data_3F5T
# 
_entry.id   3F5T 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3F5T         pdb_00003f5t 10.2210/pdb3f5t/pdb 
RCSB  RCSB050182   ?            ?                   
WWPDB D_1000050182 ?            ?                   
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.pdb_id           3F5T 
_pdbx_database_PDB_obs_spr.replace_pdb_id   3EU6 
_pdbx_database_PDB_obs_spr.date             2008-11-25 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2GX9 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.entry_id                        3F5T 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2008-11-04 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bornholdt, Z.A.' 1 
'Prasad, B.V.V.'  2 
# 
_citation.id                        primary 
_citation.title                     'X-ray structure of NS1 from a highly pathogenic H5N1 influenza virus' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            456 
_citation.page_first                985 
_citation.page_last                 988 
_citation.year                      2008 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18987632 
_citation.pdbx_database_id_DOI      10.1038/nature07444 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bornholdt, Z.A.' 1 ? 
primary 'Prasad, B.V.V.'  2 ? 
# 
_cell.entry_id           3F5T 
_cell.length_a           106.122 
_cell.length_b           106.122 
_cell.length_c           69.630 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3F5T 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                179 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 nat 
_entity.pdbx_description           'Nonstructural protein 1' 
_entity.formula_weight             24252.779 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    'Full length A/Vietnam/1203/2004(H5N1) sequence' 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        NS1 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDSNTVSSFQVDCFLWHVRKRFADQELGDAPFLDRLRADQASLRGRGNTLGLDIETATRAGKQIVERILEGESDKALKMP
ASRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIKMDQAIMDKTIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPS
LPGHTGEDVKNAIGVLIGGLEWNDNTVRVTETIQRFAWRNSDEDGRLPLPPNQKR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDSNTVSSFQVDCFLWHVRKRFADQELGDAPFLDRLRADQASLRGRGNTLGLDIETATRAGKQIVERILEGESDKALKMP
ASRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIKMDQAIMDKTIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPS
LPGHTGEDVKNAIGVLIGGLEWNDNTVRVTETIQRFAWRNSDEDGRLPLPPNQKR
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   SER n 
1 4   ASN n 
1 5   THR n 
1 6   VAL n 
1 7   SER n 
1 8   SER n 
1 9   PHE n 
1 10  GLN n 
1 11  VAL n 
1 12  ASP n 
1 13  CYS n 
1 14  PHE n 
1 15  LEU n 
1 16  TRP n 
1 17  HIS n 
1 18  VAL n 
1 19  ARG n 
1 20  LYS n 
1 21  ARG n 
1 22  PHE n 
1 23  ALA n 
1 24  ASP n 
1 25  GLN n 
1 26  GLU n 
1 27  LEU n 
1 28  GLY n 
1 29  ASP n 
1 30  ALA n 
1 31  PRO n 
1 32  PHE n 
1 33  LEU n 
1 34  ASP n 
1 35  ARG n 
1 36  LEU n 
1 37  ARG n 
1 38  ALA n 
1 39  ASP n 
1 40  GLN n 
1 41  ALA n 
1 42  SER n 
1 43  LEU n 
1 44  ARG n 
1 45  GLY n 
1 46  ARG n 
1 47  GLY n 
1 48  ASN n 
1 49  THR n 
1 50  LEU n 
1 51  GLY n 
1 52  LEU n 
1 53  ASP n 
1 54  ILE n 
1 55  GLU n 
1 56  THR n 
1 57  ALA n 
1 58  THR n 
1 59  ARG n 
1 60  ALA n 
1 61  GLY n 
1 62  LYS n 
1 63  GLN n 
1 64  ILE n 
1 65  VAL n 
1 66  GLU n 
1 67  ARG n 
1 68  ILE n 
1 69  LEU n 
1 70  GLU n 
1 71  GLY n 
1 72  GLU n 
1 73  SER n 
1 74  ASP n 
1 75  LYS n 
1 76  ALA n 
1 77  LEU n 
1 78  LYS n 
1 79  MET n 
1 80  PRO n 
1 81  ALA n 
1 82  SER n 
1 83  ARG n 
1 84  TYR n 
1 85  LEU n 
1 86  THR n 
1 87  ASP n 
1 88  MET n 
1 89  THR n 
1 90  LEU n 
1 91  GLU n 
1 92  GLU n 
1 93  MET n 
1 94  SER n 
1 95  ARG n 
1 96  ASP n 
1 97  TRP n 
1 98  PHE n 
1 99  MET n 
1 100 LEU n 
1 101 MET n 
1 102 PRO n 
1 103 LYS n 
1 104 GLN n 
1 105 LYS n 
1 106 VAL n 
1 107 ALA n 
1 108 GLY n 
1 109 SER n 
1 110 LEU n 
1 111 CYS n 
1 112 ILE n 
1 113 LYS n 
1 114 MET n 
1 115 ASP n 
1 116 GLN n 
1 117 ALA n 
1 118 ILE n 
1 119 MET n 
1 120 ASP n 
1 121 LYS n 
1 122 THR n 
1 123 ILE n 
1 124 ILE n 
1 125 LEU n 
1 126 LYS n 
1 127 ALA n 
1 128 ASN n 
1 129 PHE n 
1 130 SER n 
1 131 VAL n 
1 132 ILE n 
1 133 PHE n 
1 134 ASP n 
1 135 ARG n 
1 136 LEU n 
1 137 GLU n 
1 138 THR n 
1 139 LEU n 
1 140 ILE n 
1 141 LEU n 
1 142 LEU n 
1 143 ARG n 
1 144 ALA n 
1 145 PHE n 
1 146 THR n 
1 147 GLU n 
1 148 GLU n 
1 149 GLY n 
1 150 ALA n 
1 151 ILE n 
1 152 VAL n 
1 153 GLY n 
1 154 GLU n 
1 155 ILE n 
1 156 SER n 
1 157 PRO n 
1 158 LEU n 
1 159 PRO n 
1 160 SER n 
1 161 LEU n 
1 162 PRO n 
1 163 GLY n 
1 164 HIS n 
1 165 THR n 
1 166 GLY n 
1 167 GLU n 
1 168 ASP n 
1 169 VAL n 
1 170 LYS n 
1 171 ASN n 
1 172 ALA n 
1 173 ILE n 
1 174 GLY n 
1 175 VAL n 
1 176 LEU n 
1 177 ILE n 
1 178 GLY n 
1 179 GLY n 
1 180 LEU n 
1 181 GLU n 
1 182 TRP n 
1 183 ASN n 
1 184 ASP n 
1 185 ASN n 
1 186 THR n 
1 187 VAL n 
1 188 ARG n 
1 189 VAL n 
1 190 THR n 
1 191 GLU n 
1 192 THR n 
1 193 ILE n 
1 194 GLN n 
1 195 ARG n 
1 196 PHE n 
1 197 ALA n 
1 198 TRP n 
1 199 ARG n 
1 200 ASN n 
1 201 SER n 
1 202 ASP n 
1 203 GLU n 
1 204 ASP n 
1 205 GLY n 
1 206 ARG n 
1 207 LEU n 
1 208 PRO n 
1 209 LEU n 
1 210 PRO n 
1 211 PRO n 
1 212 ASN n 
1 213 GLN n 
1 214 LYS n 
1 215 ARG n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Influenza virus' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      11309 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     A/Vietnam/1203/2004 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.entity_id                  1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    A5A5U1_9INFA 
_struct_ref.pdbx_db_accession          A5A5U1 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MDSNTVSSFQVDCFLWHVRKRFADQELGDAPFLDRLRRDQKSLRGRGNTLGLDIETATRAGKQIVERILEGESDKALKMP
ASRYLTDMTLEEMSRDWFMLMPKQKVAGSLCIKMDQAIMDKTIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPS
LPGHTGEDVKNAIGVLIGGLEWNDNTVRVTETIQRFAWRNSDEDGRLPLPPNQKR
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3F5T 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 215 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             A5A5U1 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  215 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       215 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3F5T ALA A 38 ? UNP A5A5U1 ARG 38 'engineered mutation' 38 1 
1 3F5T ALA A 41 ? UNP A5A5U1 LYS 41 'engineered mutation' 41 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3F5T 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.33 
_exptl_crystal.density_percent_sol   47.29 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.pH              7.8 
_exptl_crystal_grow.pdbx_details    'pH 7.8, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
_exptl_crystal_grow.temp_details    ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3F5T 
_reflns.observed_criterion_sigma_I   0. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             35.0 
_reflns.d_resolution_high            2.70 
_reflns.number_obs                   6721 
_reflns.number_all                   6721 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 3F5T 
_refine.ls_d_res_high                            2.700 
_refine.ls_d_res_low                             35.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    99.880 
_refine.ls_number_reflns_obs                     6721 
_refine.ls_number_reflns_all                     6721 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.281 
_refine.ls_R_factor_all                          0.281 
_refine.ls_R_factor_R_work                       0.279 
_refine.ls_R_factor_R_free                       0.296 
_refine.ls_percent_reflns_R_free                 10. 
_refine.ls_number_reflns_R_free                  669 
_refine.ls_number_reflns_R_work                  6052 
_refine.B_iso_mean                               50.422 
_refine.aniso_B[1][1]                            0.590 
_refine.aniso_B[2][2]                            0.590 
_refine.aniso_B[3][3]                            -0.880 
_refine.aniso_B[1][2]                            0.290 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.886 
_refine.correlation_coeff_Fo_to_Fc_free          0.895 
_refine.pdbx_overall_ESU_R                       2.284 
_refine.pdbx_overall_ESU_R_Free                  0.408 
_refine.overall_SU_ML                            0.338 
_refine.overall_SU_B                             36.894 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.B_iso_max                                68.00 
_refine.B_iso_min                                37.42 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1469 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               1469 
_refine_hist.d_res_high                       2.700 
_refine_hist.d_res_low                        35.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         1492 0.016  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      2013 1.497  1.966  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   186  5.953  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   68   35.825 23.676 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   270  16.693 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   14   16.488 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           232  0.101  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     1107 0.004  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            630  0.229  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          1044 0.302  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    43   0.153  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   57   0.260  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 6    0.233  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              954  0.824  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1497 1.072  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              594  1.650  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             516  2.547  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.700 
_refine_ls_shell.d_res_low                        2.770 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               100.000 
_refine_ls_shell.number_reflns_R_work             422 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.366 
_refine_ls_shell.R_factor_R_free                  0.485 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             41 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                463 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  3F5T 
_struct.title                     'X-ray Structure of H5N1 NS1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3F5T 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN' 
_struct_keywords.text            
;NS1, H5N1, Influenza, Host-virus interaction, Interferon antiviral system evasion, Nucleus, RNA-binding, Suppressor of RNA silencing, VIRAL PROTEIN
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 5   ? LYS A 20  ? THR A 5   LYS A 20  1 ? 16 
HELX_P HELX_P2 2 LYS A 20  ? GLU A 26  ? LYS A 20  GLU A 26  1 ? 7  
HELX_P HELX_P3 3 ASP A 29  ? GLY A 51  ? ASP A 29  GLY A 51  1 ? 23 
HELX_P HELX_P4 4 ASP A 53  ? ARG A 67  ? ASP A 53  ARG A 67  1 ? 15 
HELX_P HELX_P5 5 THR A 89  ? ARG A 95  ? THR A 89  ARG A 95  1 ? 7  
HELX_P HELX_P6 6 THR A 165 ? ASN A 183 ? THR A 165 ASN A 183 1 ? 19 
HELX_P HELX_P7 7 THR A 190 ? ALA A 197 ? THR A 190 ALA A 197 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLU 
_struct_mon_prot_cis.label_seq_id           70 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLU 
_struct_mon_prot_cis.auth_seq_id            70 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   GLY 
_struct_mon_prot_cis.pdbx_label_seq_id_2    71 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    GLY 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     71 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       4.91 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 85  ? THR A 86  ? LEU A 85  THR A 86  
A 2 THR A 122 ? ILE A 132 ? THR A 122 ILE A 132 
A 3 ARG A 135 ? THR A 146 ? ARG A 135 THR A 146 
A 4 ILE A 151 ? PRO A 157 ? ILE A 151 PRO A 157 
A 5 LEU A 110 ? ASP A 115 ? LEU A 110 ASP A 115 
A 6 PRO A 102 ? ALA A 107 ? PRO A 102 ALA A 107 
B 1 LEU A 85  ? THR A 86  ? LEU A 85  THR A 86  
B 2 THR A 122 ? ILE A 132 ? THR A 122 ILE A 132 
B 3 THR A 186 ? VAL A 189 ? THR A 186 VAL A 189 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 85  ? N LEU A 85  O PHE A 129 ? O PHE A 129 
A 2 3 N ILE A 124 ? N ILE A 124 O PHE A 145 ? O PHE A 145 
A 3 4 N ALA A 144 ? N ALA A 144 O GLY A 153 ? O GLY A 153 
A 4 5 O SER A 156 ? O SER A 156 N CYS A 111 ? N CYS A 111 
A 5 6 O LEU A 110 ? O LEU A 110 N ALA A 107 ? N ALA A 107 
B 1 2 N LEU A 85  ? N LEU A 85  O PHE A 129 ? O PHE A 129 
B 2 3 N ILE A 123 ? N ILE A 123 O THR A 186 ? O THR A 186 
# 
_atom_sites.entry_id                    3F5T 
_atom_sites.fract_transf_matrix[1][1]   0.009423 
_atom_sites.fract_transf_matrix[1][2]   0.005440 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010881 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014362 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . THR A 1 5   ? -13.016 45.473 27.364  1.00 47.22 ? 5   THR A N   1 
ATOM 2    C CA  . THR A 1 5   ? -11.935 46.451 27.731  1.00 47.91 ? 5   THR A CA  1 
ATOM 3    C C   . THR A 1 5   ? -10.765 45.909 28.604  1.00 47.82 ? 5   THR A C   1 
ATOM 4    O O   . THR A 1 5   ? -9.598  46.062 28.216  1.00 48.48 ? 5   THR A O   1 
ATOM 5    C CB  . THR A 1 5   ? -12.494 47.782 28.327  1.00 47.83 ? 5   THR A CB  1 
ATOM 6    O OG1 . THR A 1 5   ? -11.467 48.415 29.125  1.00 47.90 ? 5   THR A OG1 1 
ATOM 7    C CG2 . THR A 1 5   ? -13.769 47.528 29.195  1.00 49.73 ? 5   THR A CG2 1 
ATOM 8    N N   . VAL A 1 6   ? -11.069 45.321 29.770  1.00 47.55 ? 6   VAL A N   1 
ATOM 9    C CA  . VAL A 1 6   ? -10.094 44.544 30.555  1.00 47.17 ? 6   VAL A CA  1 
ATOM 10   C C   . VAL A 1 6   ? -9.566  43.393 29.678  1.00 47.34 ? 6   VAL A C   1 
ATOM 11   O O   . VAL A 1 6   ? -8.353  43.132 29.621  1.00 46.90 ? 6   VAL A O   1 
ATOM 12   C CB  . VAL A 1 6   ? -10.681 43.985 31.930  1.00 46.95 ? 6   VAL A CB  1 
ATOM 13   C CG1 . VAL A 1 6   ? -10.960 45.117 32.937  1.00 46.31 ? 6   VAL A CG1 1 
ATOM 14   C CG2 . VAL A 1 6   ? -11.957 43.177 31.718  1.00 46.99 ? 6   VAL A CG2 1 
ATOM 15   N N   . SER A 1 7   ? -10.498 42.736 28.982  1.00 47.82 ? 7   SER A N   1 
ATOM 16   C CA  . SER A 1 7   ? -10.189 41.687 28.013  1.00 48.50 ? 7   SER A CA  1 
ATOM 17   C C   . SER A 1 7   ? -9.362  42.201 26.834  1.00 48.98 ? 7   SER A C   1 
ATOM 18   O O   . SER A 1 7   ? -8.502  41.475 26.339  1.00 49.70 ? 7   SER A O   1 
ATOM 19   C CB  . SER A 1 7   ? -11.467 40.975 27.519  1.00 48.70 ? 7   SER A CB  1 
ATOM 20   O OG  . SER A 1 7   ? -12.528 41.871 27.213  1.00 48.84 ? 7   SER A OG  1 
ATOM 21   N N   . SER A 1 8   ? -9.590  43.441 26.390  1.00 49.15 ? 8   SER A N   1 
ATOM 22   C CA  . SER A 1 8   ? -8.728  44.049 25.348  1.00 49.13 ? 8   SER A CA  1 
ATOM 23   C C   . SER A 1 8   ? -7.275  44.342 25.798  1.00 49.46 ? 8   SER A C   1 
ATOM 24   O O   . SER A 1 8   ? -6.327  44.305 24.980  1.00 49.56 ? 8   SER A O   1 
ATOM 25   C CB  . SER A 1 8   ? -9.388  45.289 24.745  1.00 48.89 ? 8   SER A CB  1 
ATOM 26   O OG  . SER A 1 8   ? -10.449 44.904 23.826  1.00 48.17 ? 8   SER A OG  1 
ATOM 27   N N   . PHE A 1 9   ? -7.119  44.630 27.095  1.00 49.77 ? 9   PHE A N   1 
ATOM 28   C CA  . PHE A 1 9   ? -5.812  44.848 27.755  1.00 49.90 ? 9   PHE A CA  1 
ATOM 29   C C   . PHE A 1 9   ? -5.018  43.535 27.876  1.00 50.15 ? 9   PHE A C   1 
ATOM 30   O O   . PHE A 1 9   ? -3.817  43.508 27.627  1.00 50.69 ? 9   PHE A O   1 
ATOM 31   C CB  . PHE A 1 9   ? -6.006  45.533 29.133  1.00 49.37 ? 9   PHE A CB  1 
ATOM 32   C CG  . PHE A 1 9   ? -4.709  45.949 29.831  1.00 48.79 ? 9   PHE A CG  1 
ATOM 33   C CD1 . PHE A 1 9   ? -3.933  47.010 29.344  1.00 47.83 ? 9   PHE A CD1 1 
ATOM 34   C CD2 . PHE A 1 9   ? -4.294  45.302 31.013  1.00 47.48 ? 9   PHE A CD2 1 
ATOM 35   C CE1 . PHE A 1 9   ? -2.745  47.391 30.012  1.00 48.11 ? 9   PHE A CE1 1 
ATOM 36   C CE2 . PHE A 1 9   ? -3.122  45.680 31.685  1.00 46.67 ? 9   PHE A CE2 1 
ATOM 37   C CZ  . PHE A 1 9   ? -2.344  46.719 31.184  1.00 47.21 ? 9   PHE A CZ  1 
ATOM 38   N N   . GLN A 1 10  ? -5.703  42.453 28.240  1.00 50.10 ? 10  GLN A N   1 
ATOM 39   C CA  . GLN A 1 10  ? -5.106  41.125 28.308  1.00 49.83 ? 10  GLN A CA  1 
ATOM 40   C C   . GLN A 1 10  ? -4.725  40.622 26.912  1.00 49.85 ? 10  GLN A C   1 
ATOM 41   O O   . GLN A 1 10  ? -3.731  39.920 26.733  1.00 49.71 ? 10  GLN A O   1 
ATOM 42   C CB  . GLN A 1 10  ? -6.107  40.164 28.955  1.00 49.72 ? 10  GLN A CB  1 
ATOM 43   C CG  . GLN A 1 10  ? -6.745  40.734 30.238  1.00 49.60 ? 10  GLN A CG  1 
ATOM 44   C CD  . GLN A 1 10  ? -7.855  39.846 30.831  1.00 48.70 ? 10  GLN A CD  1 
ATOM 45   O OE1 . GLN A 1 10  ? -8.803  39.435 30.145  1.00 47.60 ? 10  GLN A OE1 1 
ATOM 46   N NE2 . GLN A 1 10  ? -7.748  39.581 32.128  1.00 47.92 ? 10  GLN A NE2 1 
ATOM 47   N N   . VAL A 1 11  ? -5.525  40.986 25.925  1.00 49.98 ? 11  VAL A N   1 
ATOM 48   C CA  . VAL A 1 11  ? -5.327  40.477 24.593  1.00 50.72 ? 11  VAL A CA  1 
ATOM 49   C C   . VAL A 1 11  ? -4.048  41.061 23.976  1.00 51.48 ? 11  VAL A C   1 
ATOM 50   O O   . VAL A 1 11  ? -3.237  40.320 23.395  1.00 52.26 ? 11  VAL A O   1 
ATOM 51   C CB  . VAL A 1 11  ? -6.556  40.737 23.702  1.00 50.85 ? 11  VAL A CB  1 
ATOM 52   C CG1 . VAL A 1 11  ? -6.230  40.438 22.232  1.00 50.44 ? 11  VAL A CG1 1 
ATOM 53   C CG2 . VAL A 1 11  ? -7.754  39.894 24.172  1.00 50.26 ? 11  VAL A CG2 1 
ATOM 54   N N   . ASP A 1 12  ? -3.855  42.377 24.100  1.00 51.69 ? 12  ASP A N   1 
ATOM 55   C CA  . ASP A 1 12  ? -2.590  43.007 23.676  1.00 51.41 ? 12  ASP A CA  1 
ATOM 56   C C   . ASP A 1 12  ? -1.373  42.515 24.487  1.00 51.28 ? 12  ASP A C   1 
ATOM 57   O O   . ASP A 1 12  ? -0.384  42.085 23.894  1.00 51.23 ? 12  ASP A O   1 
ATOM 58   C CB  . ASP A 1 12  ? -2.682  44.525 23.768  1.00 51.62 ? 12  ASP A CB  1 
ATOM 59   C CG  . ASP A 1 12  ? -3.706  45.104 22.833  1.00 52.15 ? 12  ASP A CG  1 
ATOM 60   O OD1 . ASP A 1 12  ? -3.936  44.490 21.751  1.00 53.55 ? 12  ASP A OD1 1 
ATOM 61   O OD2 . ASP A 1 12  ? -4.260  46.192 23.173  1.00 52.61 ? 12  ASP A OD2 1 
ATOM 62   N N   . CYS A 1 13  ? -1.468  42.573 25.828  1.00 51.09 ? 13  CYS A N   1 
ATOM 63   C CA  . CYS A 1 13  ? -0.427  42.083 26.754  1.00 50.64 ? 13  CYS A CA  1 
ATOM 64   C C   . CYS A 1 13  ? 0.135   40.720 26.361  1.00 50.97 ? 13  CYS A C   1 
ATOM 65   O O   . CYS A 1 13  ? 1.319   40.449 26.564  1.00 51.30 ? 13  CYS A O   1 
ATOM 66   C CB  . CYS A 1 13  ? -0.955  42.007 28.185  1.00 50.40 ? 13  CYS A CB  1 
ATOM 67   S SG  . CYS A 1 13  ? -1.114  43.605 29.035  1.00 49.03 ? 13  CYS A SG  1 
ATOM 68   N N   . PHE A 1 14  ? -0.727  39.869 25.805  1.00 50.99 ? 14  PHE A N   1 
ATOM 69   C CA  . PHE A 1 14  ? -0.319  38.567 25.319  1.00 50.78 ? 14  PHE A CA  1 
ATOM 70   C C   . PHE A 1 14  ? 0.335   38.653 23.963  1.00 50.64 ? 14  PHE A C   1 
ATOM 71   O O   . PHE A 1 14  ? 1.331   37.982 23.730  1.00 50.24 ? 14  PHE A O   1 
ATOM 72   C CB  . PHE A 1 14  ? -1.510  37.607 25.230  1.00 50.81 ? 14  PHE A CB  1 
ATOM 73   C CG  . PHE A 1 14  ? -1.092  36.190 24.898  1.00 52.04 ? 14  PHE A CG  1 
ATOM 74   C CD1 . PHE A 1 14  ? -1.536  35.584 23.704  1.00 52.26 ? 14  PHE A CD1 1 
ATOM 75   C CD2 . PHE A 1 14  ? -0.234  35.456 25.779  1.00 52.85 ? 14  PHE A CD2 1 
ATOM 76   C CE1 . PHE A 1 14  ? -1.141  34.260 23.381  1.00 52.59 ? 14  PHE A CE1 1 
ATOM 77   C CE2 . PHE A 1 14  ? 0.175   34.140 25.462  1.00 52.93 ? 14  PHE A CE2 1 
ATOM 78   C CZ  . PHE A 1 14  ? -0.285  33.540 24.256  1.00 52.61 ? 14  PHE A CZ  1 
ATOM 79   N N   . LEU A 1 15  ? -0.231  39.464 23.063  1.00 51.16 ? 15  LEU A N   1 
ATOM 80   C CA  . LEU A 1 15  ? 0.248   39.524 21.665  1.00 51.31 ? 15  LEU A CA  1 
ATOM 81   C C   . LEU A 1 15  ? 1.624   40.167 21.422  1.00 51.03 ? 15  LEU A C   1 
ATOM 82   O O   . LEU A 1 15  ? 2.422   39.680 20.601  1.00 50.47 ? 15  LEU A O   1 
ATOM 83   C CB  . LEU A 1 15  ? -0.822  40.115 20.755  1.00 51.89 ? 15  LEU A CB  1 
ATOM 84   C CG  . LEU A 1 15  ? -2.166  39.353 20.797  1.00 52.29 ? 15  LEU A CG  1 
ATOM 85   C CD1 . LEU A 1 15  ? -3.182  39.939 19.795  1.00 50.92 ? 15  LEU A CD1 1 
ATOM 86   C CD2 . LEU A 1 15  ? -1.978  37.828 20.596  1.00 52.17 ? 15  LEU A CD2 1 
ATOM 87   N N   . TRP A 1 16  ? 1.869   41.266 22.140  1.00 51.37 ? 16  TRP A N   1 
ATOM 88   C CA  . TRP A 1 16  ? 3.213   41.837 22.306  1.00 51.68 ? 16  TRP A CA  1 
ATOM 89   C C   . TRP A 1 16  ? 4.199   40.756 22.720  1.00 52.07 ? 16  TRP A C   1 
ATOM 90   O O   . TRP A 1 16  ? 5.198   40.490 22.019  1.00 51.94 ? 16  TRP A O   1 
ATOM 91   C CB  . TRP A 1 16  ? 3.182   42.918 23.399  1.00 51.56 ? 16  TRP A CB  1 
ATOM 92   C CG  . TRP A 1 16  ? 4.432   43.754 23.491  1.00 51.26 ? 16  TRP A CG  1 
ATOM 93   C CD1 . TRP A 1 16  ? 4.632   44.995 22.952  1.00 50.93 ? 16  TRP A CD1 1 
ATOM 94   C CD2 . TRP A 1 16  ? 5.646   43.419 24.181  1.00 51.32 ? 16  TRP A CD2 1 
ATOM 95   N NE1 . TRP A 1 16  ? 5.895   45.454 23.258  1.00 50.40 ? 16  TRP A NE1 1 
ATOM 96   C CE2 . TRP A 1 16  ? 6.541   44.504 24.003  1.00 51.11 ? 16  TRP A CE2 1 
ATOM 97   C CE3 . TRP A 1 16  ? 6.064   42.311 24.934  1.00 50.81 ? 16  TRP A CE3 1 
ATOM 98   C CZ2 . TRP A 1 16  ? 7.834   44.507 24.539  1.00 51.53 ? 16  TRP A CZ2 1 
ATOM 99   C CZ3 . TRP A 1 16  ? 7.356   42.313 25.471  1.00 51.45 ? 16  TRP A CZ3 1 
ATOM 100  C CH2 . TRP A 1 16  ? 8.223   43.407 25.273  1.00 50.96 ? 16  TRP A CH2 1 
ATOM 101  N N   . HIS A 1 17  ? 3.906   40.146 23.874  1.00 52.32 ? 17  HIS A N   1 
ATOM 102  C CA  . HIS A 1 17  ? 4.718   39.073 24.441  1.00 52.94 ? 17  HIS A CA  1 
ATOM 103  C C   . HIS A 1 17  ? 5.235   38.079 23.375  1.00 52.98 ? 17  HIS A C   1 
ATOM 104  O O   . HIS A 1 17  ? 6.352   37.566 23.470  1.00 53.14 ? 17  HIS A O   1 
ATOM 105  C CB  . HIS A 1 17  ? 3.911   38.359 25.536  1.00 53.18 ? 17  HIS A CB  1 
ATOM 106  C CG  . HIS A 1 17  ? 4.734   37.474 26.425  1.00 53.95 ? 17  HIS A CG  1 
ATOM 107  N ND1 . HIS A 1 17  ? 4.830   36.105 26.236  1.00 54.16 ? 17  HIS A ND1 1 
ATOM 108  C CD2 . HIS A 1 17  ? 5.501   37.763 27.508  1.00 54.88 ? 17  HIS A CD2 1 
ATOM 109  C CE1 . HIS A 1 17  ? 5.624   35.591 27.162  1.00 55.21 ? 17  HIS A CE1 1 
ATOM 110  N NE2 . HIS A 1 17  ? 6.042   36.575 27.948  1.00 55.45 ? 17  HIS A NE2 1 
ATOM 111  N N   . VAL A 1 18  ? 4.423   37.840 22.356  1.00 53.35 ? 18  VAL A N   1 
ATOM 112  C CA  . VAL A 1 18  ? 4.792   36.955 21.259  1.00 53.99 ? 18  VAL A CA  1 
ATOM 113  C C   . VAL A 1 18  ? 5.545   37.686 20.125  1.00 54.56 ? 18  VAL A C   1 
ATOM 114  O O   . VAL A 1 18  ? 6.424   37.102 19.467  1.00 54.41 ? 18  VAL A O   1 
ATOM 115  C CB  . VAL A 1 18  ? 3.560   36.158 20.711  1.00 53.91 ? 18  VAL A CB  1 
ATOM 116  C CG1 . VAL A 1 18  ? 3.248   34.956 21.640  1.00 54.31 ? 18  VAL A CG1 1 
ATOM 117  C CG2 . VAL A 1 18  ? 2.344   37.052 20.549  1.00 52.08 ? 18  VAL A CG2 1 
ATOM 118  N N   . ARG A 1 19  ? 5.201   38.964 19.920  1.00 55.00 ? 19  ARG A N   1 
ATOM 119  C CA  . ARG A 1 19  ? 5.863   39.800 18.908  1.00 54.73 ? 19  ARG A CA  1 
ATOM 120  C C   . ARG A 1 19  ? 7.364   40.039 19.174  1.00 55.06 ? 19  ARG A C   1 
ATOM 121  O O   . ARG A 1 19  ? 8.150   40.168 18.224  1.00 55.02 ? 19  ARG A O   1 
ATOM 122  C CB  . ARG A 1 19  ? 5.129   41.138 18.775  1.00 54.71 ? 19  ARG A CB  1 
ATOM 123  C CG  . ARG A 1 19  ? 5.209   41.754 17.374  1.00 53.83 ? 19  ARG A CG  1 
ATOM 124  C CD  . ARG A 1 19  ? 4.602   43.164 17.302  1.00 51.09 ? 19  ARG A CD  1 
ATOM 125  N NE  . ARG A 1 19  ? 3.554   43.370 18.301  1.00 49.42 ? 19  ARG A NE  1 
ATOM 126  C CZ  . ARG A 1 19  ? 3.331   44.536 18.904  1.00 48.54 ? 19  ARG A CZ  1 
ATOM 127  N NH1 . ARG A 1 19  ? 4.075   45.594 18.616  1.00 45.96 ? 19  ARG A NH1 1 
ATOM 128  N NH2 . ARG A 1 19  ? 2.364   44.646 19.802  1.00 48.53 ? 19  ARG A NH2 1 
ATOM 129  N N   . LYS A 1 20  ? 7.753   40.084 20.455  1.00 55.18 ? 20  LYS A N   1 
ATOM 130  C CA  . LYS A 1 20  ? 9.123   40.434 20.841  1.00 55.74 ? 20  LYS A CA  1 
ATOM 131  C C   . LYS A 1 20  ? 10.239  39.684 20.077  1.00 56.80 ? 20  LYS A C   1 
ATOM 132  O O   . LYS A 1 20  ? 11.258  40.286 19.688  1.00 57.16 ? 20  LYS A O   1 
ATOM 133  C CB  . LYS A 1 20  ? 9.332   40.270 22.351  1.00 55.21 ? 20  LYS A CB  1 
ATOM 134  C CG  . LYS A 1 20  ? 10.697  40.745 22.809  1.00 53.60 ? 20  LYS A CG  1 
ATOM 135  C CD  . LYS A 1 20  ? 10.661  41.036 24.315  1.00 54.08 ? 20  LYS A CD  1 
ATOM 136  C CE  . LYS A 1 20  ? 12.159  40.913 24.854  1.00 54.33 ? 20  LYS A CE  1 
ATOM 137  N NZ  . LYS A 1 20  ? 12.170  40.683 26.337  1.00 51.68 ? 20  LYS A NZ  1 
ATOM 138  N N   . ARG A 1 21  ? 10.038  38.376 19.896  1.00 57.46 ? 21  ARG A N   1 
ATOM 139  C CA  . ARG A 1 21  ? 11.001  37.467 19.267  1.00 57.47 ? 21  ARG A CA  1 
ATOM 140  C C   . ARG A 1 21  ? 11.604  37.968 17.933  1.00 57.96 ? 21  ARG A C   1 
ATOM 141  O O   . ARG A 1 21  ? 12.842  38.074 17.826  1.00 57.52 ? 21  ARG A O   1 
ATOM 142  C CB  . ARG A 1 21  ? 10.347  36.093 19.084  1.00 57.30 ? 21  ARG A CB  1 
ATOM 143  C CG  . ARG A 1 21  ? 9.827   35.476 20.378  1.00 56.72 ? 21  ARG A CG  1 
ATOM 144  C CD  . ARG A 1 21  ? 10.849  34.506 20.954  1.00 56.15 ? 21  ARG A CD  1 
ATOM 145  N NE  . ARG A 1 21  ? 10.284  33.675 22.023  1.00 55.52 ? 21  ARG A NE  1 
ATOM 146  C CZ  . ARG A 1 21  ? 10.931  32.671 22.624  1.00 54.24 ? 21  ARG A CZ  1 
ATOM 147  N NH1 . ARG A 1 21  ? 12.163  32.351 22.256  1.00 54.26 ? 21  ARG A NH1 1 
ATOM 148  N NH2 . ARG A 1 21  ? 10.346  31.975 23.591  1.00 53.08 ? 21  ARG A NH2 1 
ATOM 149  N N   . PHE A 1 22  ? 10.747  38.286 16.939  1.00 58.49 ? 22  PHE A N   1 
ATOM 150  C CA  . PHE A 1 22  ? 11.220  38.679 15.578  1.00 59.47 ? 22  PHE A CA  1 
ATOM 151  C C   . PHE A 1 22  ? 12.347  39.737 15.502  1.00 59.80 ? 22  PHE A C   1 
ATOM 152  O O   . PHE A 1 22  ? 13.295  39.609 14.696  1.00 59.89 ? 22  PHE A O   1 
ATOM 153  C CB  . PHE A 1 22  ? 10.051  39.121 14.695  1.00 59.55 ? 22  PHE A CB  1 
ATOM 154  C CG  . PHE A 1 22  ? 10.474  39.752 13.381  1.00 61.12 ? 22  PHE A CG  1 
ATOM 155  C CD1 . PHE A 1 22  ? 11.078  38.986 12.378  1.00 62.01 ? 22  PHE A CD1 1 
ATOM 156  C CD2 . PHE A 1 22  ? 10.239  41.124 13.137  1.00 63.33 ? 22  PHE A CD2 1 
ATOM 157  C CE1 . PHE A 1 22  ? 11.451  39.577 11.160  1.00 62.31 ? 22  PHE A CE1 1 
ATOM 158  C CE2 . PHE A 1 22  ? 10.600  41.730 11.912  1.00 62.41 ? 22  PHE A CE2 1 
ATOM 159  C CZ  . PHE A 1 22  ? 11.212  40.955 10.931  1.00 63.14 ? 22  PHE A CZ  1 
ATOM 160  N N   . ALA A 1 23  ? 12.222  40.787 16.317  1.00 60.04 ? 23  ALA A N   1 
ATOM 161  C CA  . ALA A 1 23  ? 13.211  41.866 16.359  1.00 60.02 ? 23  ALA A CA  1 
ATOM 162  C C   . ALA A 1 23  ? 14.212  41.580 17.435  1.00 59.91 ? 23  ALA A C   1 
ATOM 163  O O   . ALA A 1 23  ? 15.379  41.981 17.328  1.00 59.90 ? 23  ALA A O   1 
ATOM 164  C CB  . ALA A 1 23  ? 12.537  43.175 16.647  1.00 60.27 ? 23  ALA A CB  1 
ATOM 165  N N   . ASP A 1 24  ? 13.729  40.878 18.468  1.00 60.20 ? 24  ASP A N   1 
ATOM 166  C CA  . ASP A 1 24  ? 14.502  40.520 19.657  1.00 60.34 ? 24  ASP A CA  1 
ATOM 167  C C   . ASP A 1 24  ? 15.863  39.984 19.254  1.00 61.10 ? 24  ASP A C   1 
ATOM 168  O O   . ASP A 1 24  ? 16.865  40.134 19.993  1.00 61.78 ? 24  ASP A O   1 
ATOM 169  C CB  . ASP A 1 24  ? 13.735  39.459 20.465  1.00 60.00 ? 24  ASP A CB  1 
ATOM 170  C CG  . ASP A 1 24  ? 14.289  39.247 21.863  1.00 58.02 ? 24  ASP A CG  1 
ATOM 171  O OD1 . ASP A 1 24  ? 13.936  38.208 22.487  1.00 53.79 ? 24  ASP A OD1 1 
ATOM 172  O OD2 . ASP A 1 24  ? 15.058  40.116 22.340  1.00 58.29 ? 24  ASP A OD2 1 
ATOM 173  N N   . GLN A 1 25  ? 15.902  39.347 18.084  1.00 61.52 ? 25  GLN A N   1 
ATOM 174  C CA  . GLN A 1 25  ? 17.161  38.871 17.556  1.00 61.74 ? 25  GLN A CA  1 
ATOM 175  C C   . GLN A 1 25  ? 17.386  39.394 16.151  1.00 61.87 ? 25  GLN A C   1 
ATOM 176  O O   . GLN A 1 25  ? 18.426  39.992 15.884  1.00 62.60 ? 25  GLN A O   1 
ATOM 177  C CB  . GLN A 1 25  ? 17.263  37.335 17.604  1.00 61.96 ? 25  GLN A CB  1 
ATOM 178  C CG  . GLN A 1 25  ? 16.987  36.679 18.976  1.00 61.87 ? 25  GLN A CG  1 
ATOM 179  C CD  . GLN A 1 25  ? 15.488  36.454 19.242  1.00 61.44 ? 25  GLN A CD  1 
ATOM 180  O OE1 . GLN A 1 25  ? 14.704  36.149 18.310  1.00 61.38 ? 25  GLN A OE1 1 
ATOM 181  N NE2 . GLN A 1 25  ? 15.087  36.602 20.514  1.00 59.82 ? 25  GLN A NE2 1 
ATOM 182  N N   . GLU A 1 26  ? 16.422  39.194 15.258  1.00 61.94 ? 26  GLU A N   1 
ATOM 183  C CA  . GLU A 1 26  ? 16.698  39.371 13.811  1.00 62.60 ? 26  GLU A CA  1 
ATOM 184  C C   . GLU A 1 26  ? 16.935  40.832 13.301  1.00 62.69 ? 26  GLU A C   1 
ATOM 185  O O   . GLU A 1 26  ? 17.595  41.662 14.041  1.00 62.83 ? 26  GLU A O   1 
ATOM 186  C CB  . GLU A 1 26  ? 15.678  38.580 12.940  1.00 62.69 ? 26  GLU A CB  1 
ATOM 187  C CG  . GLU A 1 26  ? 15.810  37.038 13.125  1.00 61.50 ? 26  GLU A CG  1 
ATOM 188  C CD  . GLU A 1 26  ? 15.046  36.535 14.342  1.00 58.64 ? 26  GLU A CD  1 
ATOM 189  O OE1 . GLU A 1 26  ? 13.801  36.680 14.310  1.00 60.20 ? 26  GLU A OE1 1 
ATOM 190  O OE2 . GLU A 1 26  ? 15.663  36.005 15.308  1.00 54.33 ? 26  GLU A OE2 1 
ATOM 191  N N   . LEU A 1 27  ? 16.431  41.116 12.053  1.00 62.25 ? 27  LEU A N   1 
ATOM 192  C CA  . LEU A 1 27  ? 16.712  42.404 11.374  1.00 61.95 ? 27  LEU A CA  1 
ATOM 193  C C   . LEU A 1 27  ? 16.062  43.548 12.134  1.00 61.70 ? 27  LEU A C   1 
ATOM 194  O O   . LEU A 1 27  ? 16.715  44.574 12.365  1.00 61.88 ? 27  LEU A O   1 
ATOM 195  C CB  . LEU A 1 27  ? 16.240  42.403 9.896   1.00 62.36 ? 27  LEU A CB  1 
ATOM 196  C CG  . LEU A 1 27  ? 16.576  43.511 8.863   1.00 62.19 ? 27  LEU A CG  1 
ATOM 197  C CD1 . LEU A 1 27  ? 16.533  42.957 7.396   1.00 62.29 ? 27  LEU A CD1 1 
ATOM 198  C CD2 . LEU A 1 27  ? 15.653  44.737 9.000   1.00 59.82 ? 27  LEU A CD2 1 
ATOM 199  N N   . GLY A 1 28  ? 14.791  43.360 12.524  1.00 61.02 ? 28  GLY A N   1 
ATOM 200  C CA  . GLY A 1 28  ? 14.045  44.354 13.285  1.00 59.92 ? 28  GLY A CA  1 
ATOM 201  C C   . GLY A 1 28  ? 13.544  45.427 12.344  1.00 59.65 ? 28  GLY A C   1 
ATOM 202  O O   . GLY A 1 28  ? 12.939  45.110 11.301  1.00 59.48 ? 28  GLY A O   1 
ATOM 203  N N   . ASP A 1 29  ? 13.820  46.690 12.702  1.00 58.94 ? 29  ASP A N   1 
ATOM 204  C CA  . ASP A 1 29  ? 13.346  47.882 11.973  1.00 58.38 ? 29  ASP A CA  1 
ATOM 205  C C   . ASP A 1 29  ? 13.147  48.973 13.010  1.00 57.85 ? 29  ASP A C   1 
ATOM 206  O O   . ASP A 1 29  ? 12.719  48.675 14.133  1.00 57.80 ? 29  ASP A O   1 
ATOM 207  C CB  . ASP A 1 29  ? 12.022  47.591 11.273  1.00 58.60 ? 29  ASP A CB  1 
ATOM 208  C CG  . ASP A 1 29  ? 11.332  48.844 10.756  1.00 59.21 ? 29  ASP A CG  1 
ATOM 209  O OD1 . ASP A 1 29  ? 11.922  49.473 9.839   1.00 60.53 ? 29  ASP A OD1 1 
ATOM 210  O OD2 . ASP A 1 29  ? 10.203  49.172 11.249  1.00 56.43 ? 29  ASP A OD2 1 
ATOM 211  N N   . ALA A 1 30  ? 13.461  50.225 12.659  1.00 57.20 ? 30  ALA A N   1 
ATOM 212  C CA  . ALA A 1 30  ? 13.362  51.338 13.640  1.00 56.15 ? 30  ALA A CA  1 
ATOM 213  C C   . ALA A 1 30  ? 11.908  51.569 14.069  1.00 55.27 ? 30  ALA A C   1 
ATOM 214  O O   . ALA A 1 30  ? 11.606  51.473 15.266  1.00 55.10 ? 30  ALA A O   1 
ATOM 215  C CB  . ALA A 1 30  ? 14.002  52.642 13.116  1.00 56.34 ? 30  ALA A CB  1 
ATOM 216  N N   . PRO A 1 31  ? 11.005  51.863 13.103  1.00 54.04 ? 31  PRO A N   1 
ATOM 217  C CA  . PRO A 1 31  ? 9.582   51.891 13.443  1.00 53.20 ? 31  PRO A CA  1 
ATOM 218  C C   . PRO A 1 31  ? 8.991   50.612 14.057  1.00 52.13 ? 31  PRO A C   1 
ATOM 219  O O   . PRO A 1 31  ? 8.214   50.752 14.986  1.00 52.46 ? 31  PRO A O   1 
ATOM 220  C CB  . PRO A 1 31  ? 8.910   52.246 12.115  1.00 53.42 ? 31  PRO A CB  1 
ATOM 221  C CG  . PRO A 1 31  ? 9.982   53.003 11.356  1.00 53.55 ? 31  PRO A CG  1 
ATOM 222  C CD  . PRO A 1 31  ? 11.230  52.261 11.699  1.00 53.96 ? 31  PRO A CD  1 
ATOM 223  N N   . PHE A 1 32  ? 9.343   49.403 13.591  1.00 50.93 ? 32  PHE A N   1 
ATOM 224  C CA  . PHE A 1 32  ? 8.783   48.152 14.195  1.00 49.56 ? 32  PHE A CA  1 
ATOM 225  C C   . PHE A 1 32  ? 9.167   48.047 15.684  1.00 50.00 ? 32  PHE A C   1 
ATOM 226  O O   . PHE A 1 32  ? 8.345   47.734 16.567  1.00 49.47 ? 32  PHE A O   1 
ATOM 227  C CB  . PHE A 1 32  ? 9.234   46.894 13.413  1.00 48.60 ? 32  PHE A CB  1 
ATOM 228  C CG  . PHE A 1 32  ? 8.749   45.573 13.998  1.00 44.65 ? 32  PHE A CG  1 
ATOM 229  C CD1 . PHE A 1 32  ? 7.508   45.059 13.674  1.00 43.84 ? 32  PHE A CD1 1 
ATOM 230  C CD2 . PHE A 1 32  ? 9.554   44.827 14.834  1.00 42.62 ? 32  PHE A CD2 1 
ATOM 231  C CE1 . PHE A 1 32  ? 7.073   43.830 14.211  1.00 42.12 ? 32  PHE A CE1 1 
ATOM 232  C CE2 . PHE A 1 32  ? 9.120   43.613 15.368  1.00 40.95 ? 32  PHE A CE2 1 
ATOM 233  C CZ  . PHE A 1 32  ? 7.890   43.120 15.059  1.00 40.78 ? 32  PHE A CZ  1 
ATOM 234  N N   . LEU A 1 33  ? 10.435  48.324 15.939  1.00 50.20 ? 33  LEU A N   1 
ATOM 235  C CA  . LEU A 1 33  ? 10.986  48.274 17.261  1.00 50.61 ? 33  LEU A CA  1 
ATOM 236  C C   . LEU A 1 33  ? 10.515  49.468 18.076  1.00 50.73 ? 33  LEU A C   1 
ATOM 237  O O   . LEU A 1 33  ? 10.538  49.424 19.311  1.00 50.86 ? 33  LEU A O   1 
ATOM 238  C CB  . LEU A 1 33  ? 12.501  48.298 17.150  1.00 50.82 ? 33  LEU A CB  1 
ATOM 239  C CG  . LEU A 1 33  ? 13.254  47.352 18.080  1.00 51.87 ? 33  LEU A CG  1 
ATOM 240  C CD1 . LEU A 1 33  ? 12.439  46.109 18.406  1.00 53.63 ? 33  LEU A CD1 1 
ATOM 241  C CD2 . LEU A 1 33  ? 14.581  46.965 17.444  1.00 53.50 ? 33  LEU A CD2 1 
ATOM 242  N N   . ASP A 1 34  ? 10.102  50.541 17.390  1.00 50.95 ? 34  ASP A N   1 
ATOM 243  C CA  . ASP A 1 34  ? 9.536   51.699 18.088  1.00 50.81 ? 34  ASP A CA  1 
ATOM 244  C C   . ASP A 1 34  ? 8.154   51.350 18.537  1.00 49.71 ? 34  ASP A C   1 
ATOM 245  O O   . ASP A 1 34  ? 7.745   51.742 19.625  1.00 49.16 ? 34  ASP A O   1 
ATOM 246  C CB  . ASP A 1 34  ? 9.487   52.947 17.200  1.00 51.49 ? 34  ASP A CB  1 
ATOM 247  C CG  . ASP A 1 34  ? 10.716  53.844 17.385  1.00 54.28 ? 34  ASP A CG  1 
ATOM 248  O OD1 . ASP A 1 34  ? 11.559  53.569 18.290  1.00 56.42 ? 34  ASP A OD1 1 
ATOM 249  O OD2 . ASP A 1 34  ? 10.847  54.835 16.621  1.00 58.17 ? 34  ASP A OD2 1 
ATOM 250  N N   . ARG A 1 35  ? 7.453   50.606 17.682  1.00 48.67 ? 35  ARG A N   1 
ATOM 251  C CA  . ARG A 1 35  ? 6.109   50.135 17.971  1.00 47.78 ? 35  ARG A CA  1 
ATOM 252  C C   . ARG A 1 35  ? 6.109   49.198 19.142  1.00 46.87 ? 35  ARG A C   1 
ATOM 253  O O   . ARG A 1 35  ? 5.217   49.252 19.949  1.00 47.09 ? 35  ARG A O   1 
ATOM 254  C CB  . ARG A 1 35  ? 5.481   49.463 16.759  1.00 47.55 ? 35  ARG A CB  1 
ATOM 255  C CG  . ARG A 1 35  ? 5.066   50.464 15.688  1.00 47.78 ? 35  ARG A CG  1 
ATOM 256  C CD  . ARG A 1 35  ? 4.088   49.856 14.706  1.00 48.43 ? 35  ARG A CD  1 
ATOM 257  N NE  . ARG A 1 35  ? 4.635   48.694 14.023  1.00 47.34 ? 35  ARG A NE  1 
ATOM 258  C CZ  . ARG A 1 35  ? 5.538   48.783 13.058  1.00 49.65 ? 35  ARG A CZ  1 
ATOM 259  N NH1 . ARG A 1 35  ? 6.011   49.980 12.686  1.00 49.72 ? 35  ARG A NH1 1 
ATOM 260  N NH2 . ARG A 1 35  ? 5.983   47.678 12.476  1.00 50.69 ? 35  ARG A NH2 1 
ATOM 261  N N   . LEU A 1 36  ? 7.132   48.364 19.246  1.00 46.46 ? 36  LEU A N   1 
ATOM 262  C CA  . LEU A 1 36  ? 7.277   47.460 20.371  1.00 45.96 ? 36  LEU A CA  1 
ATOM 263  C C   . LEU A 1 36  ? 7.599   48.227 21.672  1.00 46.45 ? 36  LEU A C   1 
ATOM 264  O O   . LEU A 1 36  ? 7.082   47.896 22.752  1.00 46.55 ? 36  LEU A O   1 
ATOM 265  C CB  . LEU A 1 36  ? 8.345   46.435 20.046  1.00 45.35 ? 36  LEU A CB  1 
ATOM 266  C CG  . LEU A 1 36  ? 8.185   45.029 20.615  1.00 45.57 ? 36  LEU A CG  1 
ATOM 267  C CD1 . LEU A 1 36  ? 6.854   44.409 20.235  1.00 45.04 ? 36  LEU A CD1 1 
ATOM 268  C CD2 . LEU A 1 36  ? 9.342   44.153 20.135  1.00 46.28 ? 36  LEU A CD2 1 
ATOM 269  N N   . ARG A 1 37  ? 8.435   49.263 21.561  1.00 46.69 ? 37  ARG A N   1 
ATOM 270  C CA  . ARG A 1 37  ? 8.696   50.192 22.681  1.00 46.69 ? 37  ARG A CA  1 
ATOM 271  C C   . ARG A 1 37  ? 7.431   50.909 23.116  1.00 46.55 ? 37  ARG A C   1 
ATOM 272  O O   . ARG A 1 37  ? 7.111   50.942 24.304  1.00 46.59 ? 37  ARG A O   1 
ATOM 273  C CB  . ARG A 1 37  ? 9.700   51.266 22.283  1.00 46.54 ? 37  ARG A CB  1 
ATOM 274  C CG  . ARG A 1 37  ? 11.110  50.990 22.638  1.00 46.98 ? 37  ARG A CG  1 
ATOM 275  C CD  . ARG A 1 37  ? 11.861  52.300 22.628  1.00 47.73 ? 37  ARG A CD  1 
ATOM 276  N NE  . ARG A 1 37  ? 11.371  53.190 23.671  1.00 47.54 ? 37  ARG A NE  1 
ATOM 277  C CZ  . ARG A 1 37  ? 11.808  53.174 24.932  1.00 49.68 ? 37  ARG A CZ  1 
ATOM 278  N NH1 . ARG A 1 37  ? 12.763  52.318 25.310  1.00 51.21 ? 37  ARG A NH1 1 
ATOM 279  N NH2 . ARG A 1 37  ? 11.305  54.022 25.826  1.00 49.33 ? 37  ARG A NH2 1 
ATOM 280  N N   . ALA A 1 38  ? 6.740   51.503 22.141  1.00 46.54 ? 38  ALA A N   1 
ATOM 281  C CA  . ALA A 1 38  ? 5.524   52.279 22.391  1.00 46.55 ? 38  ALA A CA  1 
ATOM 282  C C   . ALA A 1 38  ? 4.441   51.358 22.929  1.00 46.66 ? 38  ALA A C   1 
ATOM 283  O O   . ALA A 1 38  ? 3.756   51.710 23.901  1.00 47.21 ? 38  ALA A O   1 
ATOM 284  C CB  . ALA A 1 38  ? 5.048   53.015 21.129  1.00 46.16 ? 38  ALA A CB  1 
ATOM 285  N N   . ASP A 1 39  ? 4.324   50.171 22.328  1.00 46.03 ? 39  ASP A N   1 
ATOM 286  C CA  . ASP A 1 39  ? 3.344   49.195 22.766  1.00 45.59 ? 39  ASP A CA  1 
ATOM 287  C C   . ASP A 1 39  ? 3.689   48.616 24.141  1.00 46.24 ? 39  ASP A C   1 
ATOM 288  O O   . ASP A 1 39  ? 2.790   48.182 24.849  1.00 47.09 ? 39  ASP A O   1 
ATOM 289  C CB  . ASP A 1 39  ? 3.137   48.091 21.719  1.00 44.69 ? 39  ASP A CB  1 
ATOM 290  C CG  . ASP A 1 39  ? 2.419   48.588 20.464  1.00 42.86 ? 39  ASP A CG  1 
ATOM 291  O OD1 . ASP A 1 39  ? 2.073   49.780 20.368  1.00 39.96 ? 39  ASP A OD1 1 
ATOM 292  O OD2 . ASP A 1 39  ? 2.199   47.773 19.547  1.00 41.69 ? 39  ASP A OD2 1 
ATOM 293  N N   . GLN A 1 40  ? 4.960   48.609 24.536  1.00 46.56 ? 40  GLN A N   1 
ATOM 294  C CA  . GLN A 1 40  ? 5.276   48.168 25.885  1.00 47.39 ? 40  GLN A CA  1 
ATOM 295  C C   . GLN A 1 40  ? 4.944   49.284 26.883  1.00 47.91 ? 40  GLN A C   1 
ATOM 296  O O   . GLN A 1 40  ? 4.436   49.025 27.974  1.00 47.28 ? 40  GLN A O   1 
ATOM 297  C CB  . GLN A 1 40  ? 6.728   47.685 26.032  1.00 47.50 ? 40  GLN A CB  1 
ATOM 298  C CG  . GLN A 1 40  ? 6.956   46.818 27.306  1.00 47.62 ? 40  GLN A CG  1 
ATOM 299  C CD  . GLN A 1 40  ? 8.403   46.815 27.795  1.00 48.12 ? 40  GLN A CD  1 
ATOM 300  O OE1 . GLN A 1 40  ? 9.348   46.782 27.006  1.00 47.80 ? 40  GLN A OE1 1 
ATOM 301  N NE2 . GLN A 1 40  ? 8.579   46.846 29.114  1.00 50.32 ? 40  GLN A NE2 1 
ATOM 302  N N   . ALA A 1 41  ? 5.223   50.523 26.479  1.00 48.77 ? 41  ALA A N   1 
ATOM 303  C CA  . ALA A 1 41  ? 4.875   51.704 27.259  1.00 49.55 ? 41  ALA A CA  1 
ATOM 304  C C   . ALA A 1 41  ? 3.382   51.872 27.314  1.00 50.55 ? 41  ALA A C   1 
ATOM 305  O O   . ALA A 1 41  ? 2.851   52.226 28.362  1.00 51.13 ? 41  ALA A O   1 
ATOM 306  C CB  . ALA A 1 41  ? 5.471   52.931 26.636  1.00 49.67 ? 41  ALA A CB  1 
ATOM 307  N N   . SER A 1 42  ? 2.710   51.653 26.176  1.00 51.02 ? 42  SER A N   1 
ATOM 308  C CA  . SER A 1 42  ? 1.269   51.820 26.092  1.00 51.41 ? 42  SER A CA  1 
ATOM 309  C C   . SER A 1 42  ? 0.634   50.836 27.035  1.00 51.30 ? 42  SER A C   1 
ATOM 310  O O   . SER A 1 42  ? -0.432  51.116 27.577  1.00 52.09 ? 42  SER A O   1 
ATOM 311  C CB  . SER A 1 42  ? 0.718   51.623 24.666  1.00 52.05 ? 42  SER A CB  1 
ATOM 312  O OG  . SER A 1 42  ? 0.163   50.295 24.476  1.00 53.62 ? 42  SER A OG  1 
ATOM 313  N N   . LEU A 1 43  ? 1.281   49.695 27.251  1.00 50.58 ? 43  LEU A N   1 
ATOM 314  C CA  . LEU A 1 43  ? 0.781   48.760 28.247  1.00 50.46 ? 43  LEU A CA  1 
ATOM 315  C C   . LEU A 1 43  ? 1.041   49.251 29.690  1.00 50.86 ? 43  LEU A C   1 
ATOM 316  O O   . LEU A 1 43  ? 0.181   49.079 30.573  1.00 51.18 ? 43  LEU A O   1 
ATOM 317  C CB  . LEU A 1 43  ? 1.317   47.339 27.998  1.00 50.15 ? 43  LEU A CB  1 
ATOM 318  C CG  . LEU A 1 43  ? 1.052   46.670 26.633  1.00 49.06 ? 43  LEU A CG  1 
ATOM 319  C CD1 . LEU A 1 43  ? 1.849   45.390 26.509  1.00 48.46 ? 43  LEU A CD1 1 
ATOM 320  C CD2 . LEU A 1 43  ? -0.435  46.400 26.338  1.00 48.66 ? 43  LEU A CD2 1 
ATOM 321  N N   . ARG A 1 44  ? 2.213   49.864 29.924  1.00 51.23 ? 44  ARG A N   1 
ATOM 322  C CA  . ARG A 1 44  ? 2.541   50.498 31.229  1.00 51.13 ? 44  ARG A CA  1 
ATOM 323  C C   . ARG A 1 44  ? 1.403   51.465 31.569  1.00 50.89 ? 44  ARG A C   1 
ATOM 324  O O   . ARG A 1 44  ? 0.648   51.246 32.507  1.00 50.31 ? 44  ARG A O   1 
ATOM 325  C CB  . ARG A 1 44  ? 3.872   51.298 31.195  1.00 51.00 ? 44  ARG A CB  1 
ATOM 326  C CG  . ARG A 1 44  ? 5.183   50.547 30.868  1.00 50.89 ? 44  ARG A CG  1 
ATOM 327  C CD  . ARG A 1 44  ? 5.524   49.560 31.952  1.00 52.49 ? 44  ARG A CD  1 
ATOM 328  N NE  . ARG A 1 44  ? 6.965   49.265 32.008  1.00 53.76 ? 44  ARG A NE  1 
ATOM 329  C CZ  . ARG A 1 44  ? 7.829   49.811 32.884  1.00 52.75 ? 44  ARG A CZ  1 
ATOM 330  N NH1 . ARG A 1 44  ? 7.431   50.726 33.769  1.00 51.78 ? 44  ARG A NH1 1 
ATOM 331  N NH2 . ARG A 1 44  ? 9.107   49.452 32.861  1.00 52.55 ? 44  ARG A NH2 1 
ATOM 332  N N   . GLY A 1 45  ? 1.277   52.504 30.740  1.00 51.00 ? 45  GLY A N   1 
ATOM 333  C CA  . GLY A 1 45  ? 0.291   53.567 30.894  1.00 50.77 ? 45  GLY A CA  1 
ATOM 334  C C   . GLY A 1 45  ? -1.134  53.121 31.107  1.00 50.58 ? 45  GLY A C   1 
ATOM 335  O O   . GLY A 1 45  ? -1.784  53.571 32.058  1.00 50.73 ? 45  GLY A O   1 
ATOM 336  N N   . ARG A 1 46  ? -1.630  52.253 30.218  1.00 50.74 ? 46  ARG A N   1 
ATOM 337  C CA  . ARG A 1 46  ? -3.027  51.767 30.304  1.00 50.45 ? 46  ARG A CA  1 
ATOM 338  C C   . ARG A 1 46  ? -3.214  50.866 31.521  1.00 49.90 ? 46  ARG A C   1 
ATOM 339  O O   . ARG A 1 46  ? -4.307  50.808 32.070  1.00 49.69 ? 46  ARG A O   1 
ATOM 340  C CB  . ARG A 1 46  ? -3.519  51.071 29.008  1.00 50.42 ? 46  ARG A CB  1 
ATOM 341  C CG  . ARG A 1 46  ? -3.588  51.980 27.745  1.00 52.10 ? 46  ARG A CG  1 
ATOM 342  C CD  . ARG A 1 46  ? -4.297  51.311 26.516  1.00 54.31 ? 46  ARG A CD  1 
ATOM 343  N NE  . ARG A 1 46  ? -4.068  49.853 26.450  1.00 57.04 ? 46  ARG A NE  1 
ATOM 344  C CZ  . ARG A 1 46  ? -4.887  48.980 25.847  1.00 58.45 ? 46  ARG A CZ  1 
ATOM 345  N NH1 . ARG A 1 46  ? -4.587  47.673 25.865  1.00 59.26 ? 46  ARG A NH1 1 
ATOM 346  N NH2 . ARG A 1 46  ? -6.016  49.398 25.234  1.00 60.36 ? 46  ARG A NH2 1 
ATOM 347  N N   . GLY A 1 47  ? -2.147  50.186 31.943  1.00 49.48 ? 47  GLY A N   1 
ATOM 348  C CA  . GLY A 1 47  ? -2.200  49.379 33.155  1.00 49.93 ? 47  GLY A CA  1 
ATOM 349  C C   . GLY A 1 47  ? -2.502  50.178 34.421  1.00 50.15 ? 47  GLY A C   1 
ATOM 350  O O   . GLY A 1 47  ? -3.290  49.738 35.260  1.00 50.11 ? 47  GLY A O   1 
ATOM 351  N N   . ASN A 1 48  ? -1.871  51.351 34.539  1.00 50.54 ? 48  ASN A N   1 
ATOM 352  C CA  . ASN A 1 48  ? -1.988  52.251 35.692  1.00 51.22 ? 48  ASN A CA  1 
ATOM 353  C C   . ASN A 1 48  ? -3.384  52.820 35.893  1.00 51.25 ? 48  ASN A C   1 
ATOM 354  O O   . ASN A 1 48  ? -3.895  52.856 37.022  1.00 51.49 ? 48  ASN A O   1 
ATOM 355  C CB  . ASN A 1 48  ? -0.983  53.407 35.588  1.00 51.19 ? 48  ASN A CB  1 
ATOM 356  C CG  . ASN A 1 48  ? 0.403   53.025 36.086  1.00 52.84 ? 48  ASN A CG  1 
ATOM 357  O OD1 . ASN A 1 48  ? 1.211   52.427 35.352  1.00 51.81 ? 48  ASN A OD1 1 
ATOM 358  N ND2 . ASN A 1 48  ? 0.692   53.379 37.355  1.00 56.11 ? 48  ASN A ND2 1 
ATOM 359  N N   . THR A 1 49  ? -3.993  53.286 34.802  1.00 51.40 ? 49  THR A N   1 
ATOM 360  C CA  . THR A 1 49  ? -5.364  53.802 34.860  1.00 51.45 ? 49  THR A CA  1 
ATOM 361  C C   . THR A 1 49  ? -6.348  52.659 35.130  1.00 51.36 ? 49  THR A C   1 
ATOM 362  O O   . THR A 1 49  ? -7.330  52.862 35.851  1.00 51.36 ? 49  THR A O   1 
ATOM 363  C CB  . THR A 1 49  ? -5.780  54.593 33.575  1.00 51.50 ? 49  THR A CB  1 
ATOM 364  O OG1 . THR A 1 49  ? -6.177  53.675 32.548  1.00 51.59 ? 49  THR A OG1 1 
ATOM 365  C CG2 . THR A 1 49  ? -4.641  55.512 33.071  1.00 50.65 ? 49  THR A CG2 1 
ATOM 366  N N   . LEU A 1 50  ? -6.063  51.470 34.569  1.00 51.37 ? 50  LEU A N   1 
ATOM 367  C CA  . LEU A 1 50  ? -6.888  50.252 34.781  1.00 51.55 ? 50  LEU A CA  1 
ATOM 368  C C   . LEU A 1 50  ? -6.721  49.555 36.155  1.00 51.78 ? 50  LEU A C   1 
ATOM 369  O O   . LEU A 1 50  ? -7.610  48.816 36.583  1.00 51.89 ? 50  LEU A O   1 
ATOM 370  C CB  . LEU A 1 50  ? -6.734  49.242 33.624  1.00 51.08 ? 50  LEU A CB  1 
ATOM 371  C CG  . LEU A 1 50  ? -7.336  49.685 32.266  1.00 51.36 ? 50  LEU A CG  1 
ATOM 372  C CD1 . LEU A 1 50  ? -6.866  48.857 31.032  1.00 49.48 ? 50  LEU A CD1 1 
ATOM 373  C CD2 . LEU A 1 50  ? -8.879  49.808 32.303  1.00 50.76 ? 50  LEU A CD2 1 
ATOM 374  N N   . GLY A 1 51  ? -5.611  49.819 36.847  1.00 51.91 ? 51  GLY A N   1 
ATOM 375  C CA  . GLY A 1 51  ? -5.296  49.158 38.117  1.00 51.91 ? 51  GLY A CA  1 
ATOM 376  C C   . GLY A 1 51  ? -5.086  47.670 37.873  1.00 51.94 ? 51  GLY A C   1 
ATOM 377  O O   . GLY A 1 51  ? -5.737  46.817 38.494  1.00 51.94 ? 51  GLY A O   1 
ATOM 378  N N   . LEU A 1 52  ? -4.198  47.365 36.933  1.00 51.70 ? 52  LEU A N   1 
ATOM 379  C CA  . LEU A 1 52  ? -3.934  45.993 36.527  1.00 51.68 ? 52  LEU A CA  1 
ATOM 380  C C   . LEU A 1 52  ? -2.494  46.005 36.066  1.00 51.49 ? 52  LEU A C   1 
ATOM 381  O O   . LEU A 1 52  ? -2.026  47.026 35.574  1.00 51.53 ? 52  LEU A O   1 
ATOM 382  C CB  . LEU A 1 52  ? -4.880  45.577 35.369  1.00 51.20 ? 52  LEU A CB  1 
ATOM 383  C CG  . LEU A 1 52  ? -5.168  44.061 35.224  1.00 50.91 ? 52  LEU A CG  1 
ATOM 384  C CD1 . LEU A 1 52  ? -5.605  43.383 36.551  1.00 49.57 ? 52  LEU A CD1 1 
ATOM 385  C CD2 . LEU A 1 52  ? -6.207  43.839 34.148  1.00 50.38 ? 52  LEU A CD2 1 
ATOM 386  N N   . ASP A 1 53  ? -1.766  44.906 36.232  1.00 51.60 ? 53  ASP A N   1 
ATOM 387  C CA  . ASP A 1 53  ? -0.417  44.920 35.679  1.00 52.36 ? 53  ASP A CA  1 
ATOM 388  C C   . ASP A 1 53  ? 0.070   43.727 34.852  1.00 52.50 ? 53  ASP A C   1 
ATOM 389  O O   . ASP A 1 53  ? -0.229  42.556 35.148  1.00 52.24 ? 53  ASP A O   1 
ATOM 390  C CB  . ASP A 1 53  ? 0.628   45.403 36.702  1.00 52.51 ? 53  ASP A CB  1 
ATOM 391  C CG  . ASP A 1 53  ? 1.097   46.860 36.418  1.00 52.64 ? 53  ASP A CG  1 
ATOM 392  O OD1 . ASP A 1 53  ? 2.325   47.111 36.563  1.00 53.89 ? 53  ASP A OD1 1 
ATOM 393  O OD2 . ASP A 1 53  ? 0.264   47.744 36.058  1.00 50.55 ? 53  ASP A OD2 1 
ATOM 394  N N   . ILE A 1 54  ? 0.840   44.104 33.817  1.00 52.78 ? 54  ILE A N   1 
ATOM 395  C CA  . ILE A 1 54  ? 1.302   43.266 32.694  1.00 53.33 ? 54  ILE A CA  1 
ATOM 396  C C   . ILE A 1 54  ? 1.581   41.755 32.965  1.00 53.47 ? 54  ILE A C   1 
ATOM 397  O O   . ILE A 1 54  ? 1.318   40.898 32.077  1.00 53.39 ? 54  ILE A O   1 
ATOM 398  C CB  . ILE A 1 54  ? 2.493   43.991 31.922  1.00 53.29 ? 54  ILE A CB  1 
ATOM 399  C CG1 . ILE A 1 54  ? 2.001   45.262 31.177  1.00 53.19 ? 54  ILE A CG1 1 
ATOM 400  C CG2 . ILE A 1 54  ? 3.247   43.037 30.959  1.00 53.62 ? 54  ILE A CG2 1 
ATOM 401  C CD1 . ILE A 1 54  ? 1.865   46.554 32.024  1.00 51.48 ? 54  ILE A CD1 1 
ATOM 402  N N   . GLU A 1 55  ? 2.105   41.425 34.154  1.00 53.65 ? 55  GLU A N   1 
ATOM 403  C CA  . GLU A 1 55  ? 2.287   40.012 34.498  1.00 54.31 ? 55  GLU A CA  1 
ATOM 404  C C   . GLU A 1 55  ? 0.951   39.273 34.529  1.00 54.27 ? 55  GLU A C   1 
ATOM 405  O O   . GLU A 1 55  ? 0.754   38.322 33.751  1.00 54.06 ? 55  GLU A O   1 
ATOM 406  C CB  . GLU A 1 55  ? 3.010   39.857 35.832  1.00 54.70 ? 55  GLU A CB  1 
ATOM 407  C CG  . GLU A 1 55  ? 4.531   39.879 35.706  1.00 56.60 ? 55  GLU A CG  1 
ATOM 408  C CD  . GLU A 1 55  ? 5.143   38.509 35.370  1.00 58.68 ? 55  GLU A CD  1 
ATOM 409  O OE1 . GLU A 1 55  ? 4.561   37.453 35.753  1.00 59.30 ? 55  GLU A OE1 1 
ATOM 410  O OE2 . GLU A 1 55  ? 6.232   38.496 34.742  1.00 59.83 ? 55  GLU A OE2 1 
ATOM 411  N N   . THR A 1 56  ? 0.050   39.728 35.427  1.00 54.36 ? 56  THR A N   1 
ATOM 412  C CA  . THR A 1 56  ? -1.357  39.248 35.512  1.00 54.18 ? 56  THR A CA  1 
ATOM 413  C C   . THR A 1 56  ? -2.091  39.157 34.143  1.00 54.02 ? 56  THR A C   1 
ATOM 414  O O   . THR A 1 56  ? -2.727  38.127 33.815  1.00 53.45 ? 56  THR A O   1 
ATOM 415  C CB  . THR A 1 56  ? -2.227  40.195 36.405  1.00 54.28 ? 56  THR A CB  1 
ATOM 416  O OG1 . THR A 1 56  ? -2.284  41.515 35.813  1.00 53.84 ? 56  THR A OG1 1 
ATOM 417  C CG2 . THR A 1 56  ? -1.692  40.289 37.839  1.00 54.17 ? 56  THR A CG2 1 
ATOM 418  N N   . ALA A 1 57  ? -1.997  40.261 33.381  1.00 53.68 ? 57  ALA A N   1 
ATOM 419  C CA  . ALA A 1 57  ? -2.718  40.479 32.115  1.00 53.32 ? 57  ALA A CA  1 
ATOM 420  C C   . ALA A 1 57  ? -2.288  39.550 30.962  1.00 53.08 ? 57  ALA A C   1 
ATOM 421  O O   . ALA A 1 57  ? -3.131  39.114 30.173  1.00 53.15 ? 57  ALA A O   1 
ATOM 422  C CB  . ALA A 1 57  ? -2.607  41.960 31.693  1.00 53.38 ? 57  ALA A CB  1 
ATOM 423  N N   . THR A 1 58  ? -0.989  39.257 30.867  1.00 52.69 ? 58  THR A N   1 
ATOM 424  C CA  . THR A 1 58  ? -0.452  38.347 29.842  1.00 52.25 ? 58  THR A CA  1 
ATOM 425  C C   . THR A 1 58  ? -0.901  36.887 30.022  1.00 51.69 ? 58  THR A C   1 
ATOM 426  O O   . THR A 1 58  ? -1.231  36.212 29.050  1.00 51.26 ? 58  THR A O   1 
ATOM 427  C CB  . THR A 1 58  ? 1.113   38.409 29.754  1.00 52.56 ? 58  THR A CB  1 
ATOM 428  O OG1 . THR A 1 58  ? 1.559   39.770 29.958  1.00 52.69 ? 58  THR A OG1 1 
ATOM 429  C CG2 . THR A 1 58  ? 1.603   37.890 28.365  1.00 52.75 ? 58  THR A CG2 1 
ATOM 430  N N   . ARG A 1 59  ? -0.899  36.401 31.262  1.00 51.78 ? 59  ARG A N   1 
ATOM 431  C CA  . ARG A 1 59  ? -1.346  35.032 31.538  1.00 51.69 ? 59  ARG A CA  1 
ATOM 432  C C   . ARG A 1 59  ? -2.815  34.835 31.120  1.00 51.63 ? 59  ARG A C   1 
ATOM 433  O O   . ARG A 1 59  ? -3.148  33.871 30.406  1.00 51.68 ? 59  ARG A O   1 
ATOM 434  C CB  . ARG A 1 59  ? -1.090  34.639 32.995  1.00 51.46 ? 59  ARG A CB  1 
ATOM 435  C CG  . ARG A 1 59  ? 0.385   34.814 33.477  1.00 51.97 ? 59  ARG A CG  1 
ATOM 436  C CD  . ARG A 1 59  ? 1.441   34.383 32.415  1.00 50.99 ? 59  ARG A CD  1 
ATOM 437  N NE  . ARG A 1 59  ? 2.087   35.501 31.706  1.00 48.50 ? 59  ARG A NE  1 
ATOM 438  C CZ  . ARG A 1 59  ? 3.342   35.904 31.922  1.00 47.40 ? 59  ARG A CZ  1 
ATOM 439  N NH1 . ARG A 1 59  ? 4.091   35.284 32.821  1.00 47.20 ? 59  ARG A NH1 1 
ATOM 440  N NH2 . ARG A 1 59  ? 3.855   36.926 31.248  1.00 45.99 ? 59  ARG A NH2 1 
ATOM 441  N N   . ALA A 1 60  ? -3.676  35.775 31.513  1.00 51.28 ? 60  ALA A N   1 
ATOM 442  C CA  . ALA A 1 60  ? -5.063  35.778 31.049  1.00 50.94 ? 60  ALA A CA  1 
ATOM 443  C C   . ALA A 1 60  ? -5.151  35.885 29.526  1.00 51.21 ? 60  ALA A C   1 
ATOM 444  O O   . ALA A 1 60  ? -6.126  35.432 28.927  1.00 51.13 ? 60  ALA A O   1 
ATOM 445  C CB  . ALA A 1 60  ? -5.831  36.894 31.702  1.00 50.59 ? 60  ALA A CB  1 
ATOM 446  N N   . GLY A 1 61  ? -4.131  36.491 28.913  1.00 51.64 ? 61  GLY A N   1 
ATOM 447  C CA  . GLY A 1 61  ? -4.012  36.591 27.456  1.00 51.67 ? 61  GLY A CA  1 
ATOM 448  C C   . GLY A 1 61  ? -3.762  35.256 26.768  1.00 52.09 ? 61  GLY A C   1 
ATOM 449  O O   . GLY A 1 61  ? -4.356  34.986 25.724  1.00 51.83 ? 61  GLY A O   1 
ATOM 450  N N   . LYS A 1 62  ? -2.878  34.425 27.337  1.00 52.82 ? 62  LYS A N   1 
ATOM 451  C CA  . LYS A 1 62  ? -2.689  33.031 26.870  1.00 53.45 ? 62  LYS A CA  1 
ATOM 452  C C   . LYS A 1 62  ? -4.040  32.381 26.612  1.00 54.28 ? 62  LYS A C   1 
ATOM 453  O O   . LYS A 1 62  ? -4.391  32.102 25.457  1.00 54.44 ? 62  LYS A O   1 
ATOM 454  C CB  . LYS A 1 62  ? -1.873  32.170 27.857  1.00 52.96 ? 62  LYS A CB  1 
ATOM 455  C CG  . LYS A 1 62  ? -0.446  32.634 28.047  1.00 52.22 ? 62  LYS A CG  1 
ATOM 456  C CD  . LYS A 1 62  ? 0.465   31.504 28.528  1.00 50.30 ? 62  LYS A CD  1 
ATOM 457  C CE  . LYS A 1 62  ? 1.940   32.028 28.606  1.00 50.01 ? 62  LYS A CE  1 
ATOM 458  N NZ  . LYS A 1 62  ? 2.173   33.288 29.421  1.00 46.68 ? 62  LYS A NZ  1 
ATOM 459  N N   . GLN A 1 63  ? -4.800  32.194 27.696  1.00 55.39 ? 63  GLN A N   1 
ATOM 460  C CA  . GLN A 1 63  ? -6.134  31.578 27.649  1.00 56.62 ? 63  GLN A CA  1 
ATOM 461  C C   . GLN A 1 63  ? -7.127  32.312 26.712  1.00 57.45 ? 63  GLN A C   1 
ATOM 462  O O   . GLN A 1 63  ? -7.808  31.671 25.852  1.00 57.71 ? 63  GLN A O   1 
ATOM 463  C CB  . GLN A 1 63  ? -6.713  31.438 29.080  1.00 56.44 ? 63  GLN A CB  1 
ATOM 464  N N   . ILE A 1 64  ? -7.191  33.647 26.858  1.00 58.49 ? 64  ILE A N   1 
ATOM 465  C CA  . ILE A 1 64  ? -8.113  34.445 26.036  1.00 59.65 ? 64  ILE A CA  1 
ATOM 466  C C   . ILE A 1 64  ? -7.846  34.350 24.518  1.00 59.85 ? 64  ILE A C   1 
ATOM 467  O O   . ILE A 1 64  ? -8.779  34.534 23.724  1.00 59.54 ? 64  ILE A O   1 
ATOM 468  C CB  . ILE A 1 64  ? -8.157  35.939 26.488  1.00 59.86 ? 64  ILE A CB  1 
ATOM 469  C CG1 . ILE A 1 64  ? -9.549  36.536 26.270  1.00 60.54 ? 64  ILE A CG1 1 
ATOM 470  C CG2 . ILE A 1 64  ? -7.083  36.780 25.767  1.00 60.86 ? 64  ILE A CG2 1 
ATOM 471  C CD1 . ILE A 1 64  ? -9.785  37.792 27.114  1.00 61.59 ? 64  ILE A CD1 1 
ATOM 472  N N   . VAL A 1 65  ? -6.594  34.061 24.130  1.00 60.34 ? 65  VAL A N   1 
ATOM 473  C CA  . VAL A 1 65  ? -6.232  33.932 22.701  1.00 60.96 ? 65  VAL A CA  1 
ATOM 474  C C   . VAL A 1 65  ? -6.055  32.475 22.226  1.00 61.24 ? 65  VAL A C   1 
ATOM 475  O O   . VAL A 1 65  ? -6.556  32.101 21.162  1.00 60.91 ? 65  VAL A O   1 
ATOM 476  C CB  . VAL A 1 65  ? -4.985  34.818 22.314  1.00 61.16 ? 65  VAL A CB  1 
ATOM 477  C CG1 . VAL A 1 65  ? -4.280  34.261 21.035  1.00 60.90 ? 65  VAL A CG1 1 
ATOM 478  C CG2 . VAL A 1 65  ? -5.382  36.329 22.148  1.00 60.42 ? 65  VAL A CG2 1 
ATOM 479  N N   . GLU A 1 66  ? -5.356  31.662 23.012  1.00 61.90 ? 66  GLU A N   1 
ATOM 480  C CA  . GLU A 1 66  ? -5.091  30.276 22.616  1.00 63.06 ? 66  GLU A CA  1 
ATOM 481  C C   . GLU A 1 66  ? -6.339  29.372 22.565  1.00 63.92 ? 66  GLU A C   1 
ATOM 482  O O   . GLU A 1 66  ? -6.293  28.295 21.953  1.00 64.53 ? 66  GLU A O   1 
ATOM 483  C CB  . GLU A 1 66  ? -3.973  29.663 23.469  1.00 62.86 ? 66  GLU A CB  1 
ATOM 484  C CG  . GLU A 1 66  ? -2.605  30.271 23.126  1.00 62.96 ? 66  GLU A CG  1 
ATOM 485  C CD  . GLU A 1 66  ? -1.478  29.845 24.077  1.00 62.72 ? 66  GLU A CD  1 
ATOM 486  O OE1 . GLU A 1 66  ? -1.758  29.164 25.136  1.00 60.69 ? 66  GLU A OE1 1 
ATOM 487  O OE2 . GLU A 1 66  ? -0.305  30.211 23.751  1.00 62.10 ? 66  GLU A OE2 1 
ATOM 488  N N   . ARG A 1 67  ? -7.439  29.807 23.196  1.00 64.49 ? 67  ARG A N   1 
ATOM 489  C CA  . ARG A 1 67  ? -8.749  29.170 22.988  1.00 64.70 ? 67  ARG A CA  1 
ATOM 490  C C   . ARG A 1 67  ? -9.410  29.587 21.662  1.00 65.14 ? 67  ARG A C   1 
ATOM 491  O O   . ARG A 1 67  ? -9.963  28.735 20.948  1.00 65.26 ? 67  ARG A O   1 
ATOM 492  C CB  . ARG A 1 67  ? -9.687  29.397 24.182  1.00 64.65 ? 67  ARG A CB  1 
ATOM 493  C CG  . ARG A 1 67  ? -9.400  28.447 25.385  1.00 64.48 ? 67  ARG A CG  1 
ATOM 494  C CD  . ARG A 1 67  ? -9.982  27.006 25.163  1.00 63.43 ? 67  ARG A CD  1 
ATOM 495  N NE  . ARG A 1 67  ? -9.014  25.960 25.626  1.00 61.65 ? 67  ARG A NE  1 
ATOM 496  C CZ  . ARG A 1 67  ? -7.989  25.478 24.862  1.00 61.10 ? 67  ARG A CZ  1 
ATOM 497  N NH1 . ARG A 1 67  ? -7.759  25.940 23.587  1.00 61.28 ? 67  ARG A NH1 1 
ATOM 498  N NH2 . ARG A 1 67  ? -7.182  24.528 25.374  1.00 60.29 ? 67  ARG A NH2 1 
ATOM 499  N N   . ILE A 1 68  ? -9.340  30.886 21.327  1.00 65.98 ? 68  ILE A N   1 
ATOM 500  C CA  . ILE A 1 68  ? -9.779  31.370 19.991  1.00 66.64 ? 68  ILE A CA  1 
ATOM 501  C C   . ILE A 1 68  ? -8.902  30.852 18.828  1.00 67.12 ? 68  ILE A C   1 
ATOM 502  O O   . ILE A 1 68  ? -9.353  30.836 17.670  1.00 67.05 ? 68  ILE A O   1 
ATOM 503  C CB  . ILE A 1 68  ? -9.859  32.908 19.961  1.00 66.71 ? 68  ILE A CB  1 
ATOM 504  N N   . LEU A 1 69  ? -7.654  30.451 19.142  1.00 67.85 ? 69  LEU A N   1 
ATOM 505  C CA  . LEU A 1 69  ? -6.749  29.744 18.189  1.00 67.80 ? 69  LEU A CA  1 
ATOM 506  C C   . LEU A 1 69  ? -7.295  28.343 17.854  1.00 67.74 ? 69  LEU A C   1 
ATOM 507  O O   . LEU A 1 69  ? -6.525  27.351 17.807  1.00 67.67 ? 69  LEU A O   1 
ATOM 508  C CB  . LEU A 1 69  ? -5.310  29.622 18.757  1.00 67.78 ? 69  LEU A CB  1 
ATOM 509  C CG  . LEU A 1 69  ? -4.345  30.818 18.767  1.00 66.33 ? 69  LEU A CG  1 
ATOM 510  C CD1 . LEU A 1 69  ? -3.004  30.411 19.381  1.00 64.14 ? 69  LEU A CD1 1 
ATOM 511  C CD2 . LEU A 1 69  ? -4.142  31.349 17.366  1.00 64.45 ? 69  LEU A CD2 1 
ATOM 512  N N   . GLU A 1 70  ? -8.625  28.295 17.631  1.00 67.76 ? 70  GLU A N   1 
ATOM 513  C CA  . GLU A 1 70  ? -9.404  27.062 17.410  1.00 67.85 ? 70  GLU A CA  1 
ATOM 514  C C   . GLU A 1 70  ? -10.743 27.427 16.750  1.00 67.88 ? 70  GLU A C   1 
ATOM 515  O O   . GLU A 1 70  ? -11.533 28.143 17.389  1.00 67.95 ? 70  GLU A O   1 
ATOM 516  C CB  . GLU A 1 70  ? -9.680  26.384 18.754  1.00 67.81 ? 70  GLU A CB  1 
ATOM 517  C CG  . GLU A 1 70  ? -8.790  25.188 19.069  1.00 67.72 ? 70  GLU A CG  1 
ATOM 518  C CD  . GLU A 1 70  ? -9.563  23.862 19.003  1.00 67.18 ? 70  GLU A CD  1 
ATOM 519  O OE1 . GLU A 1 70  ? -9.925  23.331 20.073  1.00 67.24 ? 70  GLU A OE1 1 
ATOM 520  O OE2 . GLU A 1 70  ? -9.827  23.348 17.894  1.00 67.23 ? 70  GLU A OE2 1 
ATOM 521  N N   . GLY A 1 71  ? -11.068 26.960 15.528  1.00 67.89 ? 71  GLY A N   1 
ATOM 522  C CA  . GLY A 1 71  ? -10.348 25.999 14.654  1.00 67.89 ? 71  GLY A CA  1 
ATOM 523  C C   . GLY A 1 71  ? -9.057  25.234 14.972  1.00 67.87 ? 71  GLY A C   1 
ATOM 524  O O   . GLY A 1 71  ? -8.934  24.525 15.993  1.00 67.85 ? 71  GLY A O   1 
ATOM 525  N N   . GLU A 1 72  ? -8.116  25.327 14.028  1.00 67.81 ? 72  GLU A N   1 
ATOM 526  C CA  . GLU A 1 72  ? -6.738  24.835 14.240  1.00 67.77 ? 72  GLU A CA  1 
ATOM 527  C C   . GLU A 1 72  ? -5.774  25.987 13.893  1.00 67.77 ? 72  GLU A C   1 
ATOM 528  O O   . GLU A 1 72  ? -4.545  25.798 13.739  1.00 67.81 ? 72  GLU A O   1 
ATOM 529  C CB  . GLU A 1 72  ? -6.438  23.594 13.377  1.00 67.71 ? 72  GLU A CB  1 
ATOM 530  C CG  . GLU A 1 72  ? -7.409  22.437 13.532  1.00 67.62 ? 72  GLU A CG  1 
ATOM 531  C CD  . GLU A 1 72  ? -7.653  21.753 12.174  1.00 67.61 ? 72  GLU A CD  1 
ATOM 532  O OE1 . GLU A 1 72  ? -6.650  21.226 11.618  1.00 67.65 ? 72  GLU A OE1 1 
ATOM 533  O OE2 . GLU A 1 72  ? -8.839  21.751 11.657  1.00 67.53 ? 72  GLU A OE2 1 
ATOM 534  N N   . SER A 1 73  ? -6.350  27.189 13.783  1.00 67.77 ? 73  SER A N   1 
ATOM 535  C CA  . SER A 1 73  ? -5.586  28.365 13.380  1.00 67.78 ? 73  SER A CA  1 
ATOM 536  C C   . SER A 1 73  ? -4.486  28.002 12.349  1.00 67.75 ? 73  SER A C   1 
ATOM 537  O O   . SER A 1 73  ? -3.285  28.255 12.567  1.00 67.73 ? 73  SER A O   1 
ATOM 538  C CB  . SER A 1 73  ? -5.044  29.112 14.621  1.00 67.77 ? 73  SER A CB  1 
ATOM 539  O OG  . SER A 1 73  ? -6.029  30.055 15.062  1.00 67.86 ? 73  SER A OG  1 
ATOM 540  N N   . ASP A 1 74  ? -4.941  27.347 11.258  1.00 67.71 ? 74  ASP A N   1 
ATOM 541  C CA  . ASP A 1 74  ? -4.174  27.250 10.018  1.00 67.71 ? 74  ASP A CA  1 
ATOM 542  C C   . ASP A 1 74  ? -4.761  28.313 9.095   1.00 67.70 ? 74  ASP A C   1 
ATOM 543  O O   . ASP A 1 74  ? -4.769  28.171 7.867   1.00 67.64 ? 74  ASP A O   1 
ATOM 544  C CB  . ASP A 1 74  ? -4.328  25.836 9.376   1.00 67.64 ? 74  ASP A CB  1 
ATOM 545  C CG  . ASP A 1 74  ? -3.811  24.723 10.364  1.00 67.42 ? 74  ASP A CG  1 
ATOM 546  O OD1 . ASP A 1 74  ? -2.959  25.028 11.231  1.00 64.87 ? 74  ASP A OD1 1 
ATOM 547  O OD2 . ASP A 1 74  ? -4.263  23.533 10.269  1.00 65.99 ? 74  ASP A OD2 1 
ATOM 548  N N   . PRO A 1 80  ? -3.515  22.498 1.937   1.00 49.98 ? 80  PRO A N   1 
ATOM 549  C CA  . PRO A 1 80  ? -4.045  23.886 1.809   1.00 49.98 ? 80  PRO A CA  1 
ATOM 550  C C   . PRO A 1 80  ? -2.924  24.940 1.654   1.00 49.98 ? 80  PRO A C   1 
ATOM 551  O O   . PRO A 1 80  ? -2.950  26.045 2.265   1.00 49.98 ? 80  PRO A O   1 
ATOM 552  C CB  . PRO A 1 80  ? -4.830  24.102 3.130   1.00 49.98 ? 80  PRO A CB  1 
ATOM 553  C CG  . PRO A 1 80  ? -4.021  23.236 4.187   1.00 49.98 ? 80  PRO A CG  1 
ATOM 554  C CD  . PRO A 1 80  ? -3.523  21.990 3.338   1.00 49.98 ? 80  PRO A CD  1 
ATOM 555  N N   . ALA A 1 81  ? -1.981  24.545 0.752   1.00 56.15 ? 81  ALA A N   1 
ATOM 556  C CA  . ALA A 1 81  ? -0.935  25.517 0.434   1.00 56.78 ? 81  ALA A CA  1 
ATOM 557  C C   . ALA A 1 81  ? -1.523  26.643 -0.444  1.00 56.98 ? 81  ALA A C   1 
ATOM 558  O O   . ALA A 1 81  ? -1.569  26.543 -1.680  1.00 57.23 ? 81  ALA A O   1 
ATOM 559  C CB  . ALA A 1 81  ? 0.260   24.815 -0.260  1.00 56.74 ? 81  ALA A CB  1 
ATOM 560  N N   . SER A 1 82  ? -2.006  27.708 0.202   1.00 57.35 ? 82  SER A N   1 
ATOM 561  C CA  . SER A 1 82  ? -2.561  28.835 -0.537  1.00 57.62 ? 82  SER A CA  1 
ATOM 562  C C   . SER A 1 82  ? -1.443  29.766 -1.000  1.00 57.39 ? 82  SER A C   1 
ATOM 563  O O   . SER A 1 82  ? -0.448  29.945 -0.283  1.00 57.54 ? 82  SER A O   1 
ATOM 564  C CB  . SER A 1 82  ? -3.570  29.617 0.322   1.00 57.63 ? 82  SER A CB  1 
ATOM 565  O OG  . SER A 1 82  ? -4.314  30.514 -0.516  1.00 58.88 ? 82  SER A OG  1 
ATOM 566  N N   . ARG A 1 83  ? -1.618  30.348 -2.196  1.00 56.93 ? 83  ARG A N   1 
ATOM 567  C CA  . ARG A 1 83  ? -0.685  31.349 -2.758  1.00 55.93 ? 83  ARG A CA  1 
ATOM 568  C C   . ARG A 1 83  ? -1.430  32.494 -3.518  1.00 55.24 ? 83  ARG A C   1 
ATOM 569  O O   . ARG A 1 83  ? -2.616  32.807 -3.193  1.00 55.17 ? 83  ARG A O   1 
ATOM 570  C CB  . ARG A 1 83  ? 0.358   30.685 -3.688  1.00 56.19 ? 83  ARG A CB  1 
ATOM 571  C CG  . ARG A 1 83  ? -0.193  29.772 -4.794  1.00 55.66 ? 83  ARG A CG  1 
ATOM 572  C CD  . ARG A 1 83  ? 0.887   29.483 -5.869  1.00 53.28 ? 83  ARG A CD  1 
ATOM 573  N NE  . ARG A 1 83  ? 0.426   28.429 -6.791  1.00 51.52 ? 83  ARG A NE  1 
ATOM 574  C CZ  . ARG A 1 83  ? 0.807   28.293 -8.060  1.00 48.86 ? 83  ARG A CZ  1 
ATOM 575  N NH1 . ARG A 1 83  ? 1.664   29.154 -8.612  1.00 48.31 ? 83  ARG A NH1 1 
ATOM 576  N NH2 . ARG A 1 83  ? 0.311   27.290 -8.784  1.00 47.12 ? 83  ARG A NH2 1 
ATOM 577  N N   . TYR A 1 84  ? -0.731  33.116 -4.507  1.00 53.67 ? 84  TYR A N   1 
ATOM 578  C CA  . TYR A 1 84  ? -1.132  34.421 -5.046  1.00 52.65 ? 84  TYR A CA  1 
ATOM 579  C C   . TYR A 1 84  ? -0.522  34.727 -6.421  1.00 51.79 ? 84  TYR A C   1 
ATOM 580  O O   . TYR A 1 84  ? 0.699   34.695 -6.576  1.00 52.03 ? 84  TYR A O   1 
ATOM 581  C CB  . TYR A 1 84  ? -0.802  35.536 -4.036  1.00 52.48 ? 84  TYR A CB  1 
ATOM 582  C CG  . TYR A 1 84  ? -1.336  36.914 -4.412  1.00 52.75 ? 84  TYR A CG  1 
ATOM 583  C CD1 . TYR A 1 84  ? -2.705  37.116 -4.685  1.00 54.50 ? 84  TYR A CD1 1 
ATOM 584  C CD2 . TYR A 1 84  ? -0.485  38.014 -4.469  1.00 50.99 ? 84  TYR A CD2 1 
ATOM 585  C CE1 . TYR A 1 84  ? -3.204  38.389 -5.036  1.00 54.35 ? 84  TYR A CE1 1 
ATOM 586  C CE2 . TYR A 1 84  ? -0.963  39.280 -4.799  1.00 52.68 ? 84  TYR A CE2 1 
ATOM 587  C CZ  . TYR A 1 84  ? -2.325  39.467 -5.089  1.00 53.35 ? 84  TYR A CZ  1 
ATOM 588  O OH  . TYR A 1 84  ? -2.789  40.725 -5.428  1.00 51.52 ? 84  TYR A OH  1 
ATOM 589  N N   . LEU A 1 85  ? -1.379  35.018 -7.410  1.00 50.73 ? 85  LEU A N   1 
ATOM 590  C CA  . LEU A 1 85  ? -0.944  35.287 -8.789  1.00 49.78 ? 85  LEU A CA  1 
ATOM 591  C C   . LEU A 1 85  ? -1.381  36.659 -9.245  1.00 49.29 ? 85  LEU A C   1 
ATOM 592  O O   . LEU A 1 85  ? -2.485  37.102 -8.914  1.00 50.14 ? 85  LEU A O   1 
ATOM 593  C CB  . LEU A 1 85  ? -1.503  34.260 -9.747  1.00 49.38 ? 85  LEU A CB  1 
ATOM 594  C CG  . LEU A 1 85  ? -1.229  32.817 -9.367  1.00 49.41 ? 85  LEU A CG  1 
ATOM 595  C CD1 . LEU A 1 85  ? -1.844  31.936 -10.422 1.00 49.55 ? 85  LEU A CD1 1 
ATOM 596  C CD2 . LEU A 1 85  ? 0.254   32.544 -9.244  1.00 48.84 ? 85  LEU A CD2 1 
ATOM 597  N N   . THR A 1 86  ? -0.529  37.327 -10.012 1.00 47.90 ? 86  THR A N   1 
ATOM 598  C CA  . THR A 1 86  ? -0.747  38.725 -10.309 1.00 47.15 ? 86  THR A CA  1 
ATOM 599  C C   . THR A 1 86  ? -0.366  39.113 -11.741 1.00 46.67 ? 86  THR A C   1 
ATOM 600  O O   . THR A 1 86  ? 0.775   38.917 -12.157 1.00 45.96 ? 86  THR A O   1 
ATOM 601  C CB  . THR A 1 86  ? 0.075   39.627 -9.359  1.00 47.14 ? 86  THR A CB  1 
ATOM 602  O OG1 . THR A 1 86  ? 1.455   39.250 -9.432  1.00 47.54 ? 86  THR A OG1 1 
ATOM 603  C CG2 . THR A 1 86  ? -0.381  39.528 -7.955  1.00 46.59 ? 86  THR A CG2 1 
ATOM 604  N N   . ASP A 1 87  ? -1.321  39.705 -12.463 1.00 46.23 ? 87  ASP A N   1 
ATOM 605  C CA  . ASP A 1 87  ? -1.061  40.272 -13.786 1.00 45.23 ? 87  ASP A CA  1 
ATOM 606  C C   . ASP A 1 87  ? -0.878  41.750 -13.667 1.00 44.97 ? 87  ASP A C   1 
ATOM 607  O O   . ASP A 1 87  ? -0.229  42.348 -14.503 1.00 45.14 ? 87  ASP A O   1 
ATOM 608  C CB  . ASP A 1 87  ? -2.234  40.042 -14.723 1.00 45.57 ? 87  ASP A CB  1 
ATOM 609  C CG  . ASP A 1 87  ? -2.316  38.628 -15.222 1.00 45.13 ? 87  ASP A CG  1 
ATOM 610  O OD1 . ASP A 1 87  ? -1.371  37.848 -15.012 1.00 45.35 ? 87  ASP A OD1 1 
ATOM 611  O OD2 . ASP A 1 87  ? -3.341  38.300 -15.828 1.00 45.47 ? 87  ASP A OD2 1 
ATOM 612  N N   . MET A 1 88  ? -1.448  42.335 -12.621 1.00 44.74 ? 88  MET A N   1 
ATOM 613  C CA  . MET A 1 88  ? -1.473  43.777 -12.473 1.00 44.99 ? 88  MET A CA  1 
ATOM 614  C C   . MET A 1 88  ? -0.534  44.294 -11.398 1.00 45.60 ? 88  MET A C   1 
ATOM 615  O O   . MET A 1 88  ? -0.354  43.665 -10.368 1.00 46.83 ? 88  MET A O   1 
ATOM 616  C CB  . MET A 1 88  ? -2.897  44.254 -12.210 1.00 44.25 ? 88  MET A CB  1 
ATOM 617  C CG  . MET A 1 88  ? -3.779  44.104 -13.422 1.00 43.96 ? 88  MET A CG  1 
ATOM 618  S SD  . MET A 1 88  ? -5.420  44.761 -13.190 1.00 43.16 ? 88  MET A SD  1 
ATOM 619  C CE  . MET A 1 88  ? -6.181  43.397 -12.327 1.00 43.75 ? 88  MET A CE  1 
ATOM 620  N N   . THR A 1 89  ? 0.078   45.444 -11.646 1.00 45.96 ? 89  THR A N   1 
ATOM 621  C CA  . THR A 1 89  ? 0.831   46.125 -10.619 1.00 46.29 ? 89  THR A CA  1 
ATOM 622  C C   . THR A 1 89  ? -0.158  46.931 -9.792  1.00 46.81 ? 89  THR A C   1 
ATOM 623  O O   . THR A 1 89  ? -1.287  47.148 -10.224 1.00 47.19 ? 89  THR A O   1 
ATOM 624  C CB  . THR A 1 89  ? 1.894   47.053 -11.223 1.00 46.17 ? 89  THR A CB  1 
ATOM 625  O OG1 . THR A 1 89  ? 1.265   48.022 -12.072 1.00 46.06 ? 89  THR A OG1 1 
ATOM 626  C CG2 . THR A 1 89  ? 2.857   46.256 -12.031 1.00 45.41 ? 89  THR A CG2 1 
ATOM 627  N N   . LEU A 1 90  ? 0.254   47.382 -8.605  1.00 47.44 ? 90  LEU A N   1 
ATOM 628  C CA  . LEU A 1 90  ? -0.615  48.227 -7.770  1.00 47.46 ? 90  LEU A CA  1 
ATOM 629  C C   . LEU A 1 90  ? -1.171  49.400 -8.563  1.00 46.89 ? 90  LEU A C   1 
ATOM 630  O O   . LEU A 1 90  ? -2.335  49.751 -8.418  1.00 47.05 ? 90  LEU A O   1 
ATOM 631  C CB  . LEU A 1 90  ? 0.096   48.731 -6.501  1.00 47.76 ? 90  LEU A CB  1 
ATOM 632  C CG  . LEU A 1 90  ? 0.636   47.673 -5.522  1.00 49.42 ? 90  LEU A CG  1 
ATOM 633  C CD1 . LEU A 1 90  ? 1.318   48.329 -4.294  1.00 52.97 ? 90  LEU A CD1 1 
ATOM 634  C CD2 . LEU A 1 90  ? -0.426  46.673 -5.080  1.00 50.68 ? 90  LEU A CD2 1 
ATOM 635  N N   . GLU A 1 91  ? -0.342  49.986 -9.413  1.00 46.81 ? 91  GLU A N   1 
ATOM 636  C CA  . GLU A 1 91  ? -0.782  51.086 -10.252 1.00 47.29 ? 91  GLU A CA  1 
ATOM 637  C C   . GLU A 1 91  ? -1.931  50.675 -11.160 1.00 46.55 ? 91  GLU A C   1 
ATOM 638  O O   . GLU A 1 91  ? -2.926  51.379 -11.218 1.00 47.15 ? 91  GLU A O   1 
ATOM 639  C CB  . GLU A 1 91  ? 0.370   51.627 -11.077 1.00 47.94 ? 91  GLU A CB  1 
ATOM 640  C CG  . GLU A 1 91  ? 0.108   52.974 -11.710 1.00 49.75 ? 91  GLU A CG  1 
ATOM 641  C CD  . GLU A 1 91  ? -0.824  52.900 -12.896 1.00 53.37 ? 91  GLU A CD  1 
ATOM 642  O OE1 . GLU A 1 91  ? -0.626  52.025 -13.791 1.00 53.34 ? 91  GLU A OE1 1 
ATOM 643  O OE2 . GLU A 1 91  ? -1.769  53.736 -12.929 1.00 56.70 ? 91  GLU A OE2 1 
ATOM 644  N N   . GLU A 1 92  ? -1.808  49.540 -11.846 1.00 45.71 ? 92  GLU A N   1 
ATOM 645  C CA  . GLU A 1 92  ? -2.897  49.049 -12.716 1.00 45.09 ? 92  GLU A CA  1 
ATOM 646  C C   . GLU A 1 92  ? -4.184  48.798 -11.931 1.00 44.62 ? 92  GLU A C   1 
ATOM 647  O O   . GLU A 1 92  ? -5.280  49.054 -12.419 1.00 44.24 ? 92  GLU A O   1 
ATOM 648  C CB  . GLU A 1 92  ? -2.478  47.801 -13.503 1.00 45.09 ? 92  GLU A CB  1 
ATOM 649  C CG  . GLU A 1 92  ? -1.380  48.059 -14.522 1.00 45.01 ? 92  GLU A CG  1 
ATOM 650  C CD  . GLU A 1 92  ? -0.961  46.817 -15.290 1.00 47.24 ? 92  GLU A CD  1 
ATOM 651  O OE1 . GLU A 1 92  ? -0.299  45.953 -14.699 1.00 46.63 ? 92  GLU A OE1 1 
ATOM 652  O OE2 . GLU A 1 92  ? -1.256  46.718 -16.505 1.00 49.10 ? 92  GLU A OE2 1 
ATOM 653  N N   . MET A 1 93  ? -4.043  48.340 -10.691 1.00 44.56 ? 93  MET A N   1 
ATOM 654  C CA  . MET A 1 93  ? -5.211  48.076 -9.843  1.00 44.81 ? 93  MET A CA  1 
ATOM 655  C C   . MET A 1 93  ? -5.903  49.290 -9.219  1.00 44.34 ? 93  MET A C   1 
ATOM 656  O O   . MET A 1 93  ? -7.086  49.257 -8.952  1.00 43.96 ? 93  MET A O   1 
ATOM 657  C CB  . MET A 1 93  ? -4.867  47.078 -8.753  1.00 44.90 ? 93  MET A CB  1 
ATOM 658  C CG  . MET A 1 93  ? -4.575  45.729 -9.296  1.00 45.71 ? 93  MET A CG  1 
ATOM 659  S SD  . MET A 1 93  ? -4.676  44.470 -8.015  1.00 50.76 ? 93  MET A SD  1 
ATOM 660  C CE  . MET A 1 93  ? -3.277  44.858 -6.927  1.00 47.10 ? 93  MET A CE  1 
ATOM 661  N N   . SER A 1 94  ? -5.160  50.356 -8.977  1.00 44.67 ? 94  SER A N   1 
ATOM 662  C CA  . SER A 1 94  ? -5.704  51.466 -8.222  1.00 44.95 ? 94  SER A CA  1 
ATOM 663  C C   . SER A 1 94  ? -5.941  52.669 -9.119  1.00 45.02 ? 94  SER A C   1 
ATOM 664  O O   . SER A 1 94  ? -6.494  53.658 -8.690  1.00 45.19 ? 94  SER A O   1 
ATOM 665  C CB  . SER A 1 94  ? -4.784  51.805 -7.037  1.00 44.95 ? 94  SER A CB  1 
ATOM 666  O OG  . SER A 1 94  ? -3.565  52.390 -7.501  1.00 45.81 ? 94  SER A OG  1 
ATOM 667  N N   . ARG A 1 95  ? -5.534  52.563 -10.371 1.00 45.77 ? 95  ARG A N   1 
ATOM 668  C CA  . ARG A 1 95  ? -5.775  53.629 -11.333 1.00 47.35 ? 95  ARG A CA  1 
ATOM 669  C C   . ARG A 1 95  ? -7.247  53.986 -11.500 1.00 48.33 ? 95  ARG A C   1 
ATOM 670  O O   . ARG A 1 95  ? -8.118  53.103 -11.515 1.00 48.68 ? 95  ARG A O   1 
ATOM 671  C CB  . ARG A 1 95  ? -5.210  53.289 -12.708 1.00 46.81 ? 95  ARG A CB  1 
ATOM 672  C CG  . ARG A 1 95  ? -5.336  54.435 -13.692 1.00 46.63 ? 95  ARG A CG  1 
ATOM 673  C CD  . ARG A 1 95  ? -5.127  53.983 -15.128 1.00 45.78 ? 95  ARG A CD  1 
ATOM 674  N NE  . ARG A 1 95  ? -3.906  53.199 -15.241 1.00 45.15 ? 95  ARG A NE  1 
ATOM 675  C CZ  . ARG A 1 95  ? -3.607  52.446 -16.284 1.00 45.59 ? 95  ARG A CZ  1 
ATOM 676  N NH1 . ARG A 1 95  ? -4.444  52.410 -17.318 1.00 44.48 ? 95  ARG A NH1 1 
ATOM 677  N NH2 . ARG A 1 95  ? -2.463  51.761 -16.296 1.00 45.81 ? 95  ARG A NH2 1 
ATOM 678  N N   . ASP A 1 96  ? -7.503  55.288 -11.635 1.00 49.54 ? 96  ASP A N   1 
ATOM 679  C CA  . ASP A 1 96  ? -8.846  55.792 -11.899 1.00 50.43 ? 96  ASP A CA  1 
ATOM 680  C C   . ASP A 1 96  ? -9.230  55.595 -13.351 1.00 49.48 ? 96  ASP A C   1 
ATOM 681  O O   . ASP A 1 96  ? -8.385  55.573 -14.247 1.00 48.94 ? 96  ASP A O   1 
ATOM 682  C CB  . ASP A 1 96  ? -8.979  57.276 -11.514 1.00 51.15 ? 96  ASP A CB  1 
ATOM 683  C CG  . ASP A 1 96  ? -9.416  57.462 -10.051 1.00 53.84 ? 96  ASP A CG  1 
ATOM 684  O OD1 . ASP A 1 96  ? -8.952  58.471 -9.431  1.00 58.24 ? 96  ASP A OD1 1 
ATOM 685  O OD2 . ASP A 1 96  ? -10.208 56.608 -9.522  1.00 54.42 ? 96  ASP A OD2 1 
ATOM 686  N N   . TRP A 1 97  ? -10.530 55.437 -13.556 1.00 49.23 ? 97  TRP A N   1 
ATOM 687  C CA  . TRP A 1 97  ? -11.114 55.225 -14.881 1.00 47.99 ? 97  TRP A CA  1 
ATOM 688  C C   . TRP A 1 97  ? -12.603 55.457 -14.771 1.00 47.24 ? 97  TRP A C   1 
ATOM 689  O O   . TRP A 1 97  ? -13.166 55.482 -13.688 1.00 47.44 ? 97  TRP A O   1 
ATOM 690  C CB  . TRP A 1 97  ? -10.879 53.791 -15.336 1.00 47.85 ? 97  TRP A CB  1 
ATOM 691  C CG  . TRP A 1 97  ? -11.690 52.812 -14.565 1.00 46.54 ? 97  TRP A CG  1 
ATOM 692  C CD1 . TRP A 1 97  ? -11.551 52.475 -13.253 1.00 44.45 ? 97  TRP A CD1 1 
ATOM 693  C CD2 . TRP A 1 97  ? -12.753 52.024 -15.074 1.00 45.09 ? 97  TRP A CD2 1 
ATOM 694  N NE1 . TRP A 1 97  ? -12.473 51.525 -12.911 1.00 45.44 ? 97  TRP A NE1 1 
ATOM 695  C CE2 . TRP A 1 97  ? -13.225 51.229 -14.016 1.00 44.19 ? 97  TRP A CE2 1 
ATOM 696  C CE3 . TRP A 1 97  ? -13.370 51.926 -16.327 1.00 45.40 ? 97  TRP A CE3 1 
ATOM 697  C CZ2 . TRP A 1 97  ? -14.277 50.348 -14.165 1.00 44.32 ? 97  TRP A CZ2 1 
ATOM 698  C CZ3 . TRP A 1 97  ? -14.414 51.037 -16.481 1.00 46.52 ? 97  TRP A CZ3 1 
ATOM 699  C CH2 . TRP A 1 97  ? -14.859 50.259 -15.403 1.00 46.56 ? 97  TRP A CH2 1 
ATOM 700  N N   . PHE A 1 98  ? -13.254 55.601 -15.904 1.00 46.33 ? 98  PHE A N   1 
ATOM 701  C CA  . PHE A 1 98  ? -14.638 55.946 -15.884 1.00 45.28 ? 98  PHE A CA  1 
ATOM 702  C C   . PHE A 1 98  ? -15.278 55.320 -17.087 1.00 43.62 ? 98  PHE A C   1 
ATOM 703  O O   . PHE A 1 98  ? -14.619 55.038 -18.080 1.00 43.53 ? 98  PHE A O   1 
ATOM 704  C CB  . PHE A 1 98  ? -14.749 57.453 -15.988 1.00 46.09 ? 98  PHE A CB  1 
ATOM 705  C CG  . PHE A 1 98  ? -14.192 57.993 -17.278 1.00 49.99 ? 98  PHE A CG  1 
ATOM 706  C CD1 . PHE A 1 98  ? -12.838 58.341 -17.373 1.00 51.97 ? 98  PHE A CD1 1 
ATOM 707  C CD2 . PHE A 1 98  ? -15.013 58.120 -18.417 1.00 53.06 ? 98  PHE A CD2 1 
ATOM 708  C CE1 . PHE A 1 98  ? -12.310 58.822 -18.561 1.00 53.19 ? 98  PHE A CE1 1 
ATOM 709  C CE2 . PHE A 1 98  ? -14.490 58.608 -19.623 1.00 55.27 ? 98  PHE A CE2 1 
ATOM 710  C CZ  . PHE A 1 98  ? -13.132 58.967 -19.694 1.00 54.34 ? 98  PHE A CZ  1 
ATOM 711  N N   . MET A 1 99  ? -16.582 55.121 -16.995 1.00 41.57 ? 99  MET A N   1 
ATOM 712  C CA  . MET A 1 99  ? -17.355 54.655 -18.106 1.00 39.38 ? 99  MET A CA  1 
ATOM 713  C C   . MET A 1 99  ? -18.165 55.835 -18.660 1.00 37.62 ? 99  MET A C   1 
ATOM 714  O O   . MET A 1 99  ? -18.830 56.569 -17.919 1.00 38.42 ? 99  MET A O   1 
ATOM 715  C CB  . MET A 1 99  ? -18.276 53.527 -17.661 1.00 39.36 ? 99  MET A CB  1 
ATOM 716  C CG  . MET A 1 99  ? -17.584 52.293 -17.138 1.00 41.03 ? 99  MET A CG  1 
ATOM 717  S SD  . MET A 1 99  ? -18.651 51.231 -16.127 1.00 45.03 ? 99  MET A SD  1 
ATOM 718  C CE  . MET A 1 99  ? -19.085 52.354 -14.805 1.00 41.97 ? 99  MET A CE  1 
ATOM 719  N N   . LEU A 1 100 ? -18.119 56.010 -19.982 1.00 33.40 ? 100 LEU A N   1 
ATOM 720  C CA  . LEU A 1 100 ? -18.887 57.118 -20.609 1.00 32.89 ? 100 LEU A CA  1 
ATOM 721  C C   . LEU A 1 100 ? -20.339 56.665 -20.664 1.00 34.35 ? 100 LEU A C   1 
ATOM 722  O O   . LEU A 1 100 ? -21.257 57.443 -20.403 1.00 35.60 ? 100 LEU A O   1 
ATOM 723  C CB  . LEU A 1 100 ? -18.336 57.434 -22.014 1.00 31.81 ? 100 LEU A CB  1 
ATOM 724  C CG  . LEU A 1 100 ? -19.075 58.536 -22.769 1.00 31.07 ? 100 LEU A CG  1 
ATOM 725  C CD1 . LEU A 1 100 ? -18.958 59.884 -22.026 1.00 30.84 ? 100 LEU A CD1 1 
ATOM 726  C CD2 . LEU A 1 100 ? -18.638 58.701 -24.259 1.00 28.87 ? 100 LEU A CD2 1 
ATOM 727  N N   . MET A 1 101 ? -20.525 55.375 -20.955 1.00 37.54 ? 101 MET A N   1 
ATOM 728  C CA  . MET A 1 101 ? -21.851 54.749 -20.934 1.00 39.89 ? 101 MET A CA  1 
ATOM 729  C C   . MET A 1 101 ? -21.817 53.525 -20.003 1.00 40.39 ? 101 MET A C   1 
ATOM 730  O O   . MET A 1 101 ? -21.565 52.402 -20.458 1.00 41.31 ? 101 MET A O   1 
ATOM 731  C CB  . MET A 1 101 ? -22.291 54.347 -22.349 1.00 39.95 ? 101 MET A CB  1 
ATOM 732  C CG  . MET A 1 101 ? -22.452 55.492 -23.338 1.00 42.69 ? 101 MET A CG  1 
ATOM 733  S SD  . MET A 1 101 ? -22.664 54.950 -25.075 1.00 49.62 ? 101 MET A SD  1 
ATOM 734  C CE  . MET A 1 101 ? -24.394 54.346 -25.015 1.00 50.41 ? 101 MET A CE  1 
ATOM 735  N N   . PRO A 1 102 ? -22.064 53.752 -18.703 1.00 40.43 ? 102 PRO A N   1 
ATOM 736  C CA  . PRO A 1 102 ? -21.920 52.784 -17.625 1.00 40.65 ? 102 PRO A CA  1 
ATOM 737  C C   . PRO A 1 102 ? -22.912 51.646 -17.693 1.00 41.19 ? 102 PRO A C   1 
ATOM 738  O O   . PRO A 1 102 ? -24.043 51.818 -18.126 1.00 41.95 ? 102 PRO A O   1 
ATOM 739  C CB  . PRO A 1 102 ? -22.195 53.606 -16.367 1.00 39.92 ? 102 PRO A CB  1 
ATOM 740  C CG  . PRO A 1 102 ? -22.148 55.011 -16.781 1.00 40.26 ? 102 PRO A CG  1 
ATOM 741  C CD  . PRO A 1 102 ? -22.532 55.054 -18.203 1.00 40.83 ? 102 PRO A CD  1 
ATOM 742  N N   . LYS A 1 103 ? -22.473 50.478 -17.264 1.00 41.69 ? 103 LYS A N   1 
ATOM 743  C CA  . LYS A 1 103 ? -23.322 49.312 -17.228 1.00 42.31 ? 103 LYS A CA  1 
ATOM 744  C C   . LYS A 1 103 ? -22.802 48.485 -16.078 1.00 42.27 ? 103 LYS A C   1 
ATOM 745  O O   . LYS A 1 103 ? -21.685 47.979 -16.126 1.00 41.83 ? 103 LYS A O   1 
ATOM 746  C CB  . LYS A 1 103 ? -23.197 48.558 -18.545 1.00 42.81 ? 103 LYS A CB  1 
ATOM 747  C CG  . LYS A 1 103 ? -24.396 47.672 -18.887 1.00 44.47 ? 103 LYS A CG  1 
ATOM 748  C CD  . LYS A 1 103 ? -23.904 46.562 -19.817 1.00 47.66 ? 103 LYS A CD  1 
ATOM 749  C CE  . LYS A 1 103 ? -24.971 45.497 -20.067 1.00 50.52 ? 103 LYS A CE  1 
ATOM 750  N NZ  . LYS A 1 103 ? -24.437 44.364 -20.933 1.00 53.18 ? 103 LYS A NZ  1 
ATOM 751  N N   . GLN A 1 104 ? -23.571 48.392 -15.007 1.00 42.52 ? 104 GLN A N   1 
ATOM 752  C CA  . GLN A 1 104 ? -23.056 47.664 -13.860 1.00 43.63 ? 104 GLN A CA  1 
ATOM 753  C C   . GLN A 1 104 ? -24.092 46.827 -13.166 1.00 43.12 ? 104 GLN A C   1 
ATOM 754  O O   . GLN A 1 104 ? -25.266 47.181 -13.130 1.00 43.41 ? 104 GLN A O   1 
ATOM 755  C CB  . GLN A 1 104 ? -22.334 48.597 -12.889 1.00 44.40 ? 104 GLN A CB  1 
ATOM 756  C CG  . GLN A 1 104 ? -23.102 49.860 -12.506 1.00 48.26 ? 104 GLN A CG  1 
ATOM 757  C CD  . GLN A 1 104 ? -22.308 50.799 -11.576 1.00 52.14 ? 104 GLN A CD  1 
ATOM 758  O OE1 . GLN A 1 104 ? -21.438 50.355 -10.815 1.00 54.00 ? 104 GLN A OE1 1 
ATOM 759  N NE2 . GLN A 1 104 ? -22.620 52.105 -11.633 1.00 52.97 ? 104 GLN A NE2 1 
ATOM 760  N N   . LYS A 1 105 ? -23.652 45.692 -12.638 1.00 43.02 ? 105 LYS A N   1 
ATOM 761  C CA  . LYS A 1 105 ? -24.550 44.809 -11.894 1.00 42.85 ? 105 LYS A CA  1 
ATOM 762  C C   . LYS A 1 105 ? -23.861 44.176 -10.700 1.00 42.99 ? 105 LYS A C   1 
ATOM 763  O O   . LYS A 1 105 ? -22.648 44.233 -10.561 1.00 42.41 ? 105 LYS A O   1 
ATOM 764  C CB  . LYS A 1 105 ? -25.076 43.703 -12.808 1.00 42.90 ? 105 LYS A CB  1 
ATOM 765  C CG  . LYS A 1 105 ? -23.982 42.843 -13.410 1.00 42.53 ? 105 LYS A CG  1 
ATOM 766  C CD  . LYS A 1 105 ? -24.546 41.612 -14.049 1.00 43.76 ? 105 LYS A CD  1 
ATOM 767  C CE  . LYS A 1 105 ? -25.188 40.716 -13.036 1.00 43.07 ? 105 LYS A CE  1 
ATOM 768  N NZ  . LYS A 1 105 ? -25.334 39.371 -13.663 1.00 45.44 ? 105 LYS A NZ  1 
ATOM 769  N N   . VAL A 1 106 ? -24.652 43.558 -9.839  1.00 43.58 ? 106 VAL A N   1 
ATOM 770  C CA  . VAL A 1 106 ? -24.110 42.789 -8.738  1.00 43.89 ? 106 VAL A CA  1 
ATOM 771  C C   . VAL A 1 106 ? -24.488 41.326 -8.998  1.00 44.62 ? 106 VAL A C   1 
ATOM 772  O O   . VAL A 1 106 ? -25.657 41.011 -9.152  1.00 44.76 ? 106 VAL A O   1 
ATOM 773  C CB  . VAL A 1 106 ? -24.645 43.321 -7.408  1.00 43.66 ? 106 VAL A CB  1 
ATOM 774  C CG1 . VAL A 1 106 ? -24.240 42.411 -6.250  1.00 44.56 ? 106 VAL A CG1 1 
ATOM 775  C CG2 . VAL A 1 106 ? -24.138 44.744 -7.181  1.00 42.40 ? 106 VAL A CG2 1 
ATOM 776  N N   . ALA A 1 107 ? -23.502 40.439 -9.115  1.00 45.36 ? 107 ALA A N   1 
ATOM 777  C CA  . ALA A 1 107 ? -23.809 39.025 -9.360  1.00 45.70 ? 107 ALA A CA  1 
ATOM 778  C C   . ALA A 1 107 ? -23.285 38.194 -8.238  1.00 45.64 ? 107 ALA A C   1 
ATOM 779  O O   . ALA A 1 107 ? -22.139 37.762 -8.256  1.00 45.27 ? 107 ALA A O   1 
ATOM 780  C CB  . ALA A 1 107 ? -23.238 38.536 -10.680 1.00 46.05 ? 107 ALA A CB  1 
ATOM 781  N N   . GLY A 1 108 ? -24.167 37.950 -7.280  1.00 45.88 ? 108 GLY A N   1 
ATOM 782  C CA  . GLY A 1 108 ? -23.825 37.229 -6.080  1.00 46.28 ? 108 GLY A CA  1 
ATOM 783  C C   . GLY A 1 108 ? -23.081 38.191 -5.184  1.00 46.73 ? 108 GLY A C   1 
ATOM 784  O O   . GLY A 1 108 ? -23.695 39.092 -4.572  1.00 47.10 ? 108 GLY A O   1 
ATOM 785  N N   . SER A 1 109 ? -21.761 38.008 -5.123  1.00 46.23 ? 109 SER A N   1 
ATOM 786  C CA  . SER A 1 109 ? -20.903 38.908 -4.382  1.00 46.12 ? 109 SER A CA  1 
ATOM 787  C C   . SER A 1 109 ? -19.737 39.409 -5.245  1.00 45.26 ? 109 SER A C   1 
ATOM 788  O O   . SER A 1 109 ? -18.651 39.738 -4.747  1.00 45.25 ? 109 SER A O   1 
ATOM 789  C CB  . SER A 1 109 ? -20.408 38.219 -3.125  1.00 46.36 ? 109 SER A CB  1 
ATOM 790  O OG  . SER A 1 109 ? -19.581 37.129 -3.487  1.00 50.00 ? 109 SER A OG  1 
ATOM 791  N N   . LEU A 1 110 ? -19.990 39.482 -6.546  1.00 44.37 ? 110 LEU A N   1 
ATOM 792  C CA  . LEU A 1 110 ? -19.030 40.031 -7.485  1.00 43.16 ? 110 LEU A CA  1 
ATOM 793  C C   . LEU A 1 110 ? -19.682 41.181 -8.210  1.00 42.98 ? 110 LEU A C   1 
ATOM 794  O O   . LEU A 1 110 ? -20.807 41.086 -8.693  1.00 43.33 ? 110 LEU A O   1 
ATOM 795  C CB  . LEU A 1 110 ? -18.579 38.976 -8.481  1.00 42.92 ? 110 LEU A CB  1 
ATOM 796  C CG  . LEU A 1 110 ? -17.762 37.760 -8.067  1.00 41.30 ? 110 LEU A CG  1 
ATOM 797  C CD1 . LEU A 1 110 ? -17.605 36.843 -9.268  1.00 38.84 ? 110 LEU A CD1 1 
ATOM 798  C CD2 . LEU A 1 110 ? -16.425 38.158 -7.522  1.00 37.16 ? 110 LEU A CD2 1 
ATOM 799  N N   . CYS A 1 111 ? -18.968 42.284 -8.242  1.00 42.67 ? 111 CYS A N   1 
ATOM 800  C CA  . CYS A 1 111 ? -19.424 43.474 -8.887  1.00 42.75 ? 111 CYS A CA  1 
ATOM 801  C C   . CYS A 1 111 ? -18.813 43.537 -10.279 1.00 42.57 ? 111 CYS A C   1 
ATOM 802  O O   . CYS A 1 111 ? -17.584 43.442 -10.442 1.00 42.87 ? 111 CYS A O   1 
ATOM 803  C CB  . CYS A 1 111 ? -19.002 44.658 -8.055  1.00 42.50 ? 111 CYS A CB  1 
ATOM 804  S SG  . CYS A 1 111 ? -19.961 46.089 -8.368  1.00 47.40 ? 111 CYS A SG  1 
ATOM 805  N N   . ILE A 1 112 ? -19.669 43.657 -11.287 1.00 42.17 ? 112 ILE A N   1 
ATOM 806  C CA  . ILE A 1 112 ? -19.226 43.695 -12.673 1.00 42.12 ? 112 ILE A CA  1 
ATOM 807  C C   . ILE A 1 112 ? -19.552 45.036 -13.326 1.00 42.60 ? 112 ILE A C   1 
ATOM 808  O O   . ILE A 1 112 ? -20.692 45.518 -13.261 1.00 42.69 ? 112 ILE A O   1 
ATOM 809  C CB  . ILE A 1 112 ? -19.835 42.535 -13.489 1.00 42.06 ? 112 ILE A CB  1 
ATOM 810  C CG1 . ILE A 1 112 ? -19.481 41.197 -12.839 1.00 40.83 ? 112 ILE A CG1 1 
ATOM 811  C CG2 . ILE A 1 112 ? -19.379 42.599 -14.943 1.00 40.87 ? 112 ILE A CG2 1 
ATOM 812  C CD1 . ILE A 1 112 ? -20.372 40.067 -13.247 1.00 40.73 ? 112 ILE A CD1 1 
ATOM 813  N N   . LYS A 1 113 ? -18.543 45.628 -13.959 1.00 42.85 ? 113 LYS A N   1 
ATOM 814  C CA  . LYS A 1 113 ? -18.708 46.913 -14.657 1.00 43.42 ? 113 LYS A CA  1 
ATOM 815  C C   . LYS A 1 113 ? -18.116 46.902 -16.067 1.00 43.27 ? 113 LYS A C   1 
ATOM 816  O O   . LYS A 1 113 ? -17.091 46.275 -16.313 1.00 42.88 ? 113 LYS A O   1 
ATOM 817  C CB  . LYS A 1 113 ? -18.075 48.040 -13.832 1.00 43.49 ? 113 LYS A CB  1 
ATOM 818  C CG  . LYS A 1 113 ? -18.486 48.028 -12.378 1.00 45.70 ? 113 LYS A CG  1 
ATOM 819  C CD  . LYS A 1 113 ? -17.537 48.848 -11.528 1.00 48.67 ? 113 LYS A CD  1 
ATOM 820  C CE  . LYS A 1 113 ? -18.176 50.187 -11.188 1.00 50.29 ? 113 LYS A CE  1 
ATOM 821  N NZ  . LYS A 1 113 ? -17.517 50.800 -10.021 1.00 52.49 ? 113 LYS A NZ  1 
ATOM 822  N N   . MET A 1 114 ? -18.775 47.594 -16.991 1.00 43.96 ? 114 MET A N   1 
ATOM 823  C CA  . MET A 1 114 ? -18.240 47.820 -18.344 1.00 44.51 ? 114 MET A CA  1 
ATOM 824  C C   . MET A 1 114 ? -18.770 49.083 -19.017 1.00 44.44 ? 114 MET A C   1 
ATOM 825  O O   . MET A 1 114 ? -19.951 49.418 -18.859 1.00 44.39 ? 114 MET A O   1 
ATOM 826  C CB  . MET A 1 114 ? -18.472 46.607 -19.251 1.00 44.78 ? 114 MET A CB  1 
ATOM 827  C CG  . MET A 1 114 ? -19.919 46.337 -19.596 1.00 46.41 ? 114 MET A CG  1 
ATOM 828  S SD  . MET A 1 114 ? -20.007 45.329 -21.098 1.00 50.42 ? 114 MET A SD  1 
ATOM 829  C CE  . MET A 1 114 ? -20.154 46.576 -22.370 1.00 46.11 ? 114 MET A CE  1 
ATOM 830  N N   . ASP A 1 115 ? -17.895 49.766 -19.768 1.00 44.37 ? 115 ASP A N   1 
ATOM 831  C CA  . ASP A 1 115 ? -18.302 50.897 -20.627 1.00 44.44 ? 115 ASP A CA  1 
ATOM 832  C C   . ASP A 1 115 ? -18.963 50.417 -21.935 1.00 44.70 ? 115 ASP A C   1 
ATOM 833  O O   . ASP A 1 115 ? -18.362 49.699 -22.730 1.00 44.05 ? 115 ASP A O   1 
ATOM 834  C CB  . ASP A 1 115 ? -17.126 51.844 -20.938 1.00 44.27 ? 115 ASP A CB  1 
ATOM 835  C CG  . ASP A 1 115 ? -17.592 53.263 -21.291 1.00 44.54 ? 115 ASP A CG  1 
ATOM 836  O OD1 . ASP A 1 115 ? -18.807 53.485 -21.484 1.00 44.58 ? 115 ASP A OD1 1 
ATOM 837  O OD2 . ASP A 1 115 ? -16.753 54.185 -21.341 1.00 44.85 ? 115 ASP A OD2 1 
ATOM 838  N N   . GLN A 1 116 ? -20.216 50.814 -22.139 1.00 45.41 ? 116 GLN A N   1 
ATOM 839  C CA  . GLN A 1 116 ? -20.929 50.454 -23.354 1.00 46.76 ? 116 GLN A CA  1 
ATOM 840  C C   . GLN A 1 116 ? -20.566 51.300 -24.586 1.00 47.23 ? 116 GLN A C   1 
ATOM 841  O O   . GLN A 1 116 ? -21.009 51.005 -25.704 1.00 47.34 ? 116 GLN A O   1 
ATOM 842  C CB  . GLN A 1 116 ? -22.417 50.539 -23.114 1.00 47.38 ? 116 GLN A CB  1 
ATOM 843  C CG  . GLN A 1 116 ? -23.061 49.214 -22.776 1.00 48.75 ? 116 GLN A CG  1 
ATOM 844  C CD  . GLN A 1 116 ? -24.489 49.408 -22.391 1.00 49.43 ? 116 GLN A CD  1 
ATOM 845  O OE1 . GLN A 1 116 ? -24.809 50.193 -21.489 1.00 50.23 ? 116 GLN A OE1 1 
ATOM 846  N NE2 . GLN A 1 116 ? -25.371 48.710 -23.080 1.00 51.20 ? 116 GLN A NE2 1 
ATOM 847  N N   . ALA A 1 117 ? -19.761 52.344 -24.370 1.00 47.33 ? 117 ALA A N   1 
ATOM 848  C CA  . ALA A 1 117 ? -19.352 53.248 -25.425 1.00 47.39 ? 117 ALA A CA  1 
ATOM 849  C C   . ALA A 1 117 ? -18.148 52.691 -26.165 1.00 47.67 ? 117 ALA A C   1 
ATOM 850  O O   . ALA A 1 117 ? -17.745 53.230 -27.196 1.00 48.50 ? 117 ALA A O   1 
ATOM 851  C CB  . ALA A 1 117 ? -19.039 54.615 -24.855 1.00 46.82 ? 117 ALA A CB  1 
ATOM 852  N N   . ILE A 1 118 ? -17.560 51.619 -25.643 1.00 47.37 ? 118 ILE A N   1 
ATOM 853  C CA  . ILE A 1 118 ? -16.351 51.086 -26.247 1.00 47.19 ? 118 ILE A CA  1 
ATOM 854  C C   . ILE A 1 118 ? -16.755 50.176 -27.361 1.00 47.10 ? 118 ILE A C   1 
ATOM 855  O O   . ILE A 1 118 ? -17.562 49.262 -27.152 1.00 47.15 ? 118 ILE A O   1 
ATOM 856  C CB  . ILE A 1 118 ? -15.479 50.332 -25.230 1.00 46.90 ? 118 ILE A CB  1 
ATOM 857  C CG1 . ILE A 1 118 ? -15.035 51.291 -24.143 1.00 48.30 ? 118 ILE A CG1 1 
ATOM 858  C CG2 . ILE A 1 118 ? -14.258 49.732 -25.889 1.00 47.11 ? 118 ILE A CG2 1 
ATOM 859  C CD1 . ILE A 1 118 ? -14.369 52.558 -24.668 1.00 48.49 ? 118 ILE A CD1 1 
ATOM 860  N N   . MET A 1 119 ? -16.203 50.450 -28.545 1.00 47.25 ? 119 MET A N   1 
ATOM 861  C CA  . MET A 1 119 ? -16.441 49.623 -29.732 1.00 47.07 ? 119 MET A CA  1 
ATOM 862  C C   . MET A 1 119 ? -15.269 49.487 -30.689 1.00 46.56 ? 119 MET A C   1 
ATOM 863  O O   . MET A 1 119 ? -14.492 50.421 -30.878 1.00 46.88 ? 119 MET A O   1 
ATOM 864  C CB  . MET A 1 119 ? -17.696 50.066 -30.477 1.00 47.17 ? 119 MET A CB  1 
ATOM 865  C CG  . MET A 1 119 ? -17.911 51.577 -30.565 1.00 48.54 ? 119 MET A CG  1 
ATOM 866  S SD  . MET A 1 119 ? -19.521 51.892 -31.345 1.00 52.24 ? 119 MET A SD  1 
ATOM 867  C CE  . MET A 1 119 ? -20.630 51.257 -30.022 1.00 48.98 ? 119 MET A CE  1 
ATOM 868  N N   . ASP A 1 120 ? -15.148 48.295 -31.264 1.00 46.45 ? 120 ASP A N   1 
ATOM 869  C CA  . ASP A 1 120 ? -14.169 47.990 -32.314 1.00 46.79 ? 120 ASP A CA  1 
ATOM 870  C C   . ASP A 1 120 ? -12.751 47.986 -31.858 1.00 46.25 ? 120 ASP A C   1 
ATOM 871  O O   . ASP A 1 120 ? -11.836 48.189 -32.666 1.00 46.98 ? 120 ASP A O   1 
ATOM 872  C CB  . ASP A 1 120 ? -14.274 48.973 -33.478 1.00 46.94 ? 120 ASP A CB  1 
ATOM 873  C CG  . ASP A 1 120 ? -15.632 48.995 -34.086 1.00 46.92 ? 120 ASP A CG  1 
ATOM 874  O OD1 . ASP A 1 120 ? -16.013 50.089 -34.528 1.00 51.21 ? 120 ASP A OD1 1 
ATOM 875  O OD2 . ASP A 1 120 ? -16.314 47.945 -34.130 1.00 46.49 ? 120 ASP A OD2 1 
ATOM 876  N N   . LYS A 1 121 ? -12.571 47.763 -30.570 1.00 45.82 ? 121 LYS A N   1 
ATOM 877  C CA  . LYS A 1 121 ? -11.257 47.816 -29.952 1.00 45.08 ? 121 LYS A CA  1 
ATOM 878  C C   . LYS A 1 121 ? -10.813 46.407 -29.655 1.00 44.72 ? 121 LYS A C   1 
ATOM 879  O O   . LYS A 1 121 ? -11.639 45.507 -29.520 1.00 45.71 ? 121 LYS A O   1 
ATOM 880  C CB  . LYS A 1 121 ? -11.330 48.636 -28.651 1.00 45.35 ? 121 LYS A CB  1 
ATOM 881  C CG  . LYS A 1 121 ? -11.668 50.141 -28.819 1.00 44.46 ? 121 LYS A CG  1 
ATOM 882  C CD  . LYS A 1 121 ? -10.591 50.866 -29.579 1.00 45.55 ? 121 LYS A CD  1 
ATOM 883  C CE  . LYS A 1 121 ? -10.931 52.329 -29.770 1.00 46.36 ? 121 LYS A CE  1 
ATOM 884  N NZ  . LYS A 1 121 ? -11.861 52.568 -30.956 1.00 46.35 ? 121 LYS A NZ  1 
ATOM 885  N N   . THR A 1 122 ? -9.509  46.204 -29.583 1.00 44.24 ? 122 THR A N   1 
ATOM 886  C CA  . THR A 1 122 ? -8.968  44.998 -28.974 1.00 44.01 ? 122 THR A CA  1 
ATOM 887  C C   . THR A 1 122 ? -8.756  45.234 -27.485 1.00 43.66 ? 122 THR A C   1 
ATOM 888  O O   . THR A 1 122 ? -8.187  46.253 -27.053 1.00 42.82 ? 122 THR A O   1 
ATOM 889  C CB  . THR A 1 122 ? -7.651  44.625 -29.589 1.00 43.93 ? 122 THR A CB  1 
ATOM 890  O OG1 . THR A 1 122 ? -7.761  44.815 -31.002 1.00 47.44 ? 122 THR A OG1 1 
ATOM 891  C CG2 . THR A 1 122 ? -7.310  43.166 -29.293 1.00 43.21 ? 122 THR A CG2 1 
ATOM 892  N N   . ILE A 1 123 ? -9.213  44.262 -26.711 1.00 43.55 ? 123 ILE A N   1 
ATOM 893  C CA  . ILE A 1 123 ? -9.274  44.371 -25.269 1.00 43.05 ? 123 ILE A CA  1 
ATOM 894  C C   . ILE A 1 123 ? -8.678  43.124 -24.650 1.00 43.85 ? 123 ILE A C   1 
ATOM 895  O O   . ILE A 1 123 ? -8.940  41.994 -25.098 1.00 43.92 ? 123 ILE A O   1 
ATOM 896  C CB  . ILE A 1 123 ? -10.717 44.520 -24.798 1.00 42.43 ? 123 ILE A CB  1 
ATOM 897  C CG1 . ILE A 1 123 ? -11.321 45.827 -25.325 1.00 41.07 ? 123 ILE A CG1 1 
ATOM 898  C CG2 . ILE A 1 123 ? -10.798 44.417 -23.290 1.00 43.19 ? 123 ILE A CG2 1 
ATOM 899  C CD1 . ILE A 1 123 ? -12.805 45.907 -25.213 1.00 38.38 ? 123 ILE A CD1 1 
ATOM 900  N N   . ILE A 1 124 ? -7.866  43.331 -23.613 1.00 44.00 ? 124 ILE A N   1 
ATOM 901  C CA  . ILE A 1 124 ? -7.351  42.217 -22.837 1.00 43.96 ? 124 ILE A CA  1 
ATOM 902  C C   . ILE A 1 124 ? -7.818  42.311 -21.376 1.00 44.28 ? 124 ILE A C   1 
ATOM 903  O O   . ILE A 1 124 ? -7.846  43.415 -20.802 1.00 44.70 ? 124 ILE A O   1 
ATOM 904  C CB  . ILE A 1 124 ? -5.814  42.117 -22.977 1.00 43.75 ? 124 ILE A CB  1 
ATOM 905  C CG1 . ILE A 1 124 ? -5.299  40.830 -22.342 1.00 44.26 ? 124 ILE A CG1 1 
ATOM 906  C CG2 . ILE A 1 124 ? -5.128  43.327 -22.389 1.00 43.69 ? 124 ILE A CG2 1 
ATOM 907  C CD1 . ILE A 1 124 ? -3.787  40.831 -22.237 1.00 45.97 ? 124 ILE A CD1 1 
ATOM 908  N N   . LEU A 1 125 ? -8.204  41.167 -20.796 1.00 44.02 ? 125 LEU A N   1 
ATOM 909  C CA  . LEU A 1 125 ? -8.541  41.078 -19.364 1.00 43.65 ? 125 LEU A CA  1 
ATOM 910  C C   . LEU A 1 125 ? -7.342  40.616 -18.540 1.00 44.04 ? 125 LEU A C   1 
ATOM 911  O O   . LEU A 1 125 ? -6.640  39.664 -18.899 1.00 44.49 ? 125 LEU A O   1 
ATOM 912  C CB  . LEU A 1 125 ? -9.708  40.125 -19.111 1.00 43.52 ? 125 LEU A CB  1 
ATOM 913  C CG  . LEU A 1 125 ? -10.996 40.153 -19.939 1.00 43.06 ? 125 LEU A CG  1 
ATOM 914  C CD1 . LEU A 1 125 ? -12.017 39.269 -19.308 1.00 41.26 ? 125 LEU A CD1 1 
ATOM 915  C CD2 . LEU A 1 125 ? -11.565 41.525 -20.083 1.00 42.21 ? 125 LEU A CD2 1 
ATOM 916  N N   . LYS A 1 126 ? -7.101  41.298 -17.432 1.00 43.80 ? 126 LYS A N   1 
ATOM 917  C CA  . LYS A 1 126 ? -6.014  40.924 -16.535 1.00 43.70 ? 126 LYS A CA  1 
ATOM 918  C C   . LYS A 1 126 ? -6.566  40.676 -15.144 1.00 43.97 ? 126 LYS A C   1 
ATOM 919  O O   . LYS A 1 126 ? -7.536  41.329 -14.729 1.00 44.54 ? 126 LYS A O   1 
ATOM 920  C CB  . LYS A 1 126 ? -4.967  42.032 -16.478 1.00 43.70 ? 126 LYS A CB  1 
ATOM 921  C CG  . LYS A 1 126 ? -4.142  42.211 -17.747 1.00 42.20 ? 126 LYS A CG  1 
ATOM 922  C CD  . LYS A 1 126 ? -3.252  43.415 -17.592 1.00 41.79 ? 126 LYS A CD  1 
ATOM 923  C CE  . LYS A 1 126 ? -2.555  43.793 -18.869 1.00 44.16 ? 126 LYS A CE  1 
ATOM 924  N NZ  . LYS A 1 126 ? -1.253  44.552 -18.524 1.00 50.81 ? 126 LYS A NZ  1 
ATOM 925  N N   . ALA A 1 127 ? -5.968  39.743 -14.413 1.00 43.87 ? 127 ALA A N   1 
ATOM 926  C CA  . ALA A 1 127 ? -6.468  39.452 -13.063 1.00 43.71 ? 127 ALA A CA  1 
ATOM 927  C C   . ALA A 1 127 ? -5.382  39.218 -12.034 1.00 43.72 ? 127 ALA A C   1 
ATOM 928  O O   . ALA A 1 127 ? -4.293  38.761 -12.365 1.00 42.98 ? 127 ALA A O   1 
ATOM 929  C CB  . ALA A 1 127 ? -7.433  38.289 -13.089 1.00 43.36 ? 127 ALA A CB  1 
ATOM 930  N N   . ASN A 1 128 ? -5.698  39.601 -10.798 1.00 44.43 ? 128 ASN A N   1 
ATOM 931  C CA  . ASN A 1 128 ? -4.925  39.261 -9.606  1.00 45.23 ? 128 ASN A CA  1 
ATOM 932  C C   . ASN A 1 128 ? -5.799  38.435 -8.692  1.00 46.54 ? 128 ASN A C   1 
ATOM 933  O O   . ASN A 1 128 ? -6.866  38.884 -8.259  1.00 46.41 ? 128 ASN A O   1 
ATOM 934  C CB  . ASN A 1 128 ? -4.497  40.504 -8.857  1.00 44.71 ? 128 ASN A CB  1 
ATOM 935  C CG  . ASN A 1 128 ? -3.382  41.238 -9.546  1.00 46.37 ? 128 ASN A CG  1 
ATOM 936  O OD1 . ASN A 1 128 ? -3.153  41.070 -10.765 1.00 49.41 ? 128 ASN A OD1 1 
ATOM 937  N ND2 . ASN A 1 128 ? -2.663  42.062 -8.783  1.00 45.34 ? 128 ASN A ND2 1 
ATOM 938  N N   . PHE A 1 129 ? -5.354  37.218 -8.395  1.00 47.98 ? 129 PHE A N   1 
ATOM 939  C CA  . PHE A 1 129 ? -6.156  36.312 -7.577  1.00 49.12 ? 129 PHE A CA  1 
ATOM 940  C C   . PHE A 1 129 ? -5.318  35.241 -6.901  1.00 50.24 ? 129 PHE A C   1 
ATOM 941  O O   . PHE A 1 129 ? -4.164  35.025 -7.262  1.00 50.51 ? 129 PHE A O   1 
ATOM 942  C CB  . PHE A 1 129 ? -7.220  35.643 -8.443  1.00 48.59 ? 129 PHE A CB  1 
ATOM 943  C CG  . PHE A 1 129 ? -6.667  34.898 -9.618  1.00 47.70 ? 129 PHE A CG  1 
ATOM 944  C CD1 . PHE A 1 129 ? -6.437  35.556 -10.827 1.00 46.35 ? 129 PHE A CD1 1 
ATOM 945  C CD2 . PHE A 1 129 ? -6.398  33.530 -9.526  1.00 46.80 ? 129 PHE A CD2 1 
ATOM 946  C CE1 . PHE A 1 129 ? -5.937  34.876 -11.926 1.00 45.93 ? 129 PHE A CE1 1 
ATOM 947  C CE2 . PHE A 1 129 ? -5.917  32.822 -10.629 1.00 46.25 ? 129 PHE A CE2 1 
ATOM 948  C CZ  . PHE A 1 129 ? -5.681  33.501 -11.834 1.00 46.78 ? 129 PHE A CZ  1 
ATOM 949  N N   . SER A 1 130 ? -5.913  34.546 -5.937  1.00 51.46 ? 130 SER A N   1 
ATOM 950  C CA  . SER A 1 130 ? -5.224  33.437 -5.269  1.00 52.22 ? 130 SER A CA  1 
ATOM 951  C C   . SER A 1 130 ? -5.620  32.129 -5.932  1.00 52.48 ? 130 SER A C   1 
ATOM 952  O O   . SER A 1 130 ? -6.663  32.058 -6.579  1.00 52.41 ? 130 SER A O   1 
ATOM 953  C CB  . SER A 1 130 ? -5.520  33.429 -3.757  1.00 52.06 ? 130 SER A CB  1 
ATOM 954  O OG  . SER A 1 130 ? -6.864  33.029 -3.498  1.00 53.63 ? 130 SER A OG  1 
ATOM 955  N N   . VAL A 1 131 ? -4.765  31.112 -5.781  1.00 53.60 ? 131 VAL A N   1 
ATOM 956  C CA  . VAL A 1 131 ? -4.935  29.812 -6.442  1.00 54.38 ? 131 VAL A CA  1 
ATOM 957  C C   . VAL A 1 131 ? -4.668  28.631 -5.483  1.00 54.99 ? 131 VAL A C   1 
ATOM 958  O O   . VAL A 1 131 ? -3.787  28.699 -4.603  1.00 55.51 ? 131 VAL A O   1 
ATOM 959  C CB  . VAL A 1 131 ? -4.032  29.699 -7.702  1.00 54.35 ? 131 VAL A CB  1 
ATOM 960  C CG1 . VAL A 1 131 ? -2.565  29.833 -7.320  1.00 54.16 ? 131 VAL A CG1 1 
ATOM 961  C CG2 . VAL A 1 131 ? -4.276  28.366 -8.461  1.00 54.57 ? 131 VAL A CG2 1 
ATOM 962  N N   . ILE A 1 132 ? -5.467  27.575 -5.642  1.00 55.42 ? 132 ILE A N   1 
ATOM 963  C CA  . ILE A 1 132 ? -5.260  26.297 -4.957  1.00 55.92 ? 132 ILE A CA  1 
ATOM 964  C C   . ILE A 1 132 ? -5.481  25.193 -6.000  1.00 56.43 ? 132 ILE A C   1 
ATOM 965  O O   . ILE A 1 132 ? -6.478  25.221 -6.732  1.00 56.81 ? 132 ILE A O   1 
ATOM 966  C CB  . ILE A 1 132 ? -6.212  26.093 -3.739  1.00 55.61 ? 132 ILE A CB  1 
ATOM 967  C CG1 . ILE A 1 132 ? -7.689  26.199 -4.176  1.00 55.89 ? 132 ILE A CG1 1 
ATOM 968  C CG2 . ILE A 1 132 ? -5.893  27.119 -2.624  1.00 55.87 ? 132 ILE A CG2 1 
ATOM 969  C CD1 . ILE A 1 132 ? -8.623  25.108 -3.576  1.00 56.18 ? 132 ILE A CD1 1 
ATOM 970  N N   . PHE A 1 133 ? -4.548  24.246 -6.086  1.00 56.67 ? 133 PHE A N   1 
ATOM 971  C CA  . PHE A 1 133 ? -4.597  23.225 -7.123  1.00 57.45 ? 133 PHE A CA  1 
ATOM 972  C C   . PHE A 1 133 ? -4.297  23.848 -8.488  1.00 57.83 ? 133 PHE A C   1 
ATOM 973  O O   . PHE A 1 133 ? -3.213  24.408 -8.721  1.00 57.68 ? 133 PHE A O   1 
ATOM 974  C CB  . PHE A 1 133 ? -5.963  22.514 -7.112  1.00 57.54 ? 133 PHE A CB  1 
ATOM 975  C CG  . PHE A 1 133 ? -6.113  21.518 -5.992  1.00 59.24 ? 133 PHE A CG  1 
ATOM 976  C CD1 . PHE A 1 133 ? -6.168  21.948 -4.651  1.00 60.92 ? 133 PHE A CD1 1 
ATOM 977  C CD2 . PHE A 1 133 ? -6.178  20.155 -6.265  1.00 59.23 ? 133 PHE A CD2 1 
ATOM 978  C CE1 . PHE A 1 133 ? -6.287  21.028 -3.606  1.00 60.98 ? 133 PHE A CE1 1 
ATOM 979  C CE2 . PHE A 1 133 ? -6.300  19.226 -5.235  1.00 60.91 ? 133 PHE A CE2 1 
ATOM 980  C CZ  . PHE A 1 133 ? -6.356  19.662 -3.900  1.00 61.49 ? 133 PHE A CZ  1 
ATOM 981  N N   . ASP A 1 134 ? -5.269  23.754 -9.385  1.00 58.29 ? 134 ASP A N   1 
ATOM 982  C CA  . ASP A 1 134 ? -5.165  24.345 -10.704 1.00 58.73 ? 134 ASP A CA  1 
ATOM 983  C C   . ASP A 1 134 ? -6.446  25.131 -10.975 1.00 58.40 ? 134 ASP A C   1 
ATOM 984  O O   . ASP A 1 134 ? -6.893  25.237 -12.131 1.00 58.56 ? 134 ASP A O   1 
ATOM 985  C CB  . ASP A 1 134 ? -4.977  23.245 -11.754 1.00 59.36 ? 134 ASP A CB  1 
ATOM 986  C CG  . ASP A 1 134 ? -6.173  22.286 -11.824 1.00 61.64 ? 134 ASP A CG  1 
ATOM 987  O OD1 . ASP A 1 134 ? -6.837  22.049 -10.770 1.00 63.86 ? 134 ASP A OD1 1 
ATOM 988  O OD2 . ASP A 1 134 ? -6.450  21.770 -12.944 1.00 64.59 ? 134 ASP A OD2 1 
ATOM 989  N N   . ARG A 1 135 ? -7.030  25.680 -9.903  1.00 57.73 ? 135 ARG A N   1 
ATOM 990  C CA  . ARG A 1 135 ? -8.280  26.432 -9.995  1.00 56.86 ? 135 ARG A CA  1 
ATOM 991  C C   . ARG A 1 135 ? -8.234  27.674 -9.137  1.00 56.05 ? 135 ARG A C   1 
ATOM 992  O O   . ARG A 1 135 ? -7.537  27.706 -8.120  1.00 56.21 ? 135 ARG A O   1 
ATOM 993  C CB  . ARG A 1 135 ? -9.475  25.561 -9.590  1.00 57.25 ? 135 ARG A CB  1 
ATOM 994  C CG  . ARG A 1 135 ? -9.247  24.692 -8.363  1.00 57.43 ? 135 ARG A CG  1 
ATOM 995  C CD  . ARG A 1 135 ? -10.558 24.209 -7.757  1.00 58.62 ? 135 ARG A CD  1 
ATOM 996  N NE  . ARG A 1 135 ? -11.335 25.346 -7.248  1.00 59.87 ? 135 ARG A NE  1 
ATOM 997  C CZ  . ARG A 1 135 ? -12.388 25.269 -6.425  1.00 59.67 ? 135 ARG A CZ  1 
ATOM 998  N NH1 . ARG A 1 135 ? -12.823 24.092 -5.971  1.00 58.91 ? 135 ARG A NH1 1 
ATOM 999  N NH2 . ARG A 1 135 ? -13.004 26.397 -6.055  1.00 59.96 ? 135 ARG A NH2 1 
ATOM 1000 N N   . LEU A 1 136 ? -8.998  28.688 -9.545  1.00 55.08 ? 136 LEU A N   1 
ATOM 1001 C CA  . LEU A 1 136 ? -9.086  29.963 -8.822  1.00 54.11 ? 136 LEU A CA  1 
ATOM 1002 C C   . LEU A 1 136 ? -9.877  29.821 -7.512  1.00 53.80 ? 136 LEU A C   1 
ATOM 1003 O O   . LEU A 1 136 ? -10.940 29.188 -7.480  1.00 54.23 ? 136 LEU A O   1 
ATOM 1004 C CB  . LEU A 1 136 ? -9.736  31.016 -9.739  1.00 53.80 ? 136 LEU A CB  1 
ATOM 1005 C CG  . LEU A 1 136 ? -9.820  32.487 -9.306  1.00 52.81 ? 136 LEU A CG  1 
ATOM 1006 C CD1 . LEU A 1 136 ? -9.697  33.437 -10.495 1.00 50.93 ? 136 LEU A CD1 1 
ATOM 1007 C CD2 . LEU A 1 136 ? -11.103 32.756 -8.534  1.00 52.72 ? 136 LEU A CD2 1 
ATOM 1008 N N   . GLU A 1 137 ? -9.381  30.419 -6.442  1.00 52.88 ? 137 GLU A N   1 
ATOM 1009 C CA  . GLU A 1 137 ? -10.124 30.393 -5.204  1.00 52.66 ? 137 GLU A CA  1 
ATOM 1010 C C   . GLU A 1 137 ? -10.673 31.770 -4.854  1.00 51.96 ? 137 GLU A C   1 
ATOM 1011 O O   . GLU A 1 137 ? -11.863 31.898 -4.558  1.00 52.24 ? 137 GLU A O   1 
ATOM 1012 C CB  . GLU A 1 137 ? -9.275  29.820 -4.059  1.00 53.11 ? 137 GLU A CB  1 
ATOM 1013 C CG  . GLU A 1 137 ? -10.003 29.723 -2.704  1.00 55.06 ? 137 GLU A CG  1 
ATOM 1014 C CD  . GLU A 1 137 ? -11.059 28.597 -2.651  1.00 58.29 ? 137 GLU A CD  1 
ATOM 1015 O OE1 . GLU A 1 137 ? -10.671 27.388 -2.678  1.00 58.79 ? 137 GLU A OE1 1 
ATOM 1016 O OE2 . GLU A 1 137 ? -12.279 28.911 -2.564  1.00 59.69 ? 137 GLU A OE2 1 
ATOM 1017 N N   . THR A 1 138 ? -9.828  32.800 -4.877  1.00 50.67 ? 138 THR A N   1 
ATOM 1018 C CA  . THR A 1 138 ? -10.275 34.139 -4.485  1.00 49.93 ? 138 THR A CA  1 
ATOM 1019 C C   . THR A 1 138 ? -9.726  35.233 -5.385  1.00 49.81 ? 138 THR A C   1 
ATOM 1020 O O   . THR A 1 138 ? -8.505  35.446 -5.460  1.00 50.28 ? 138 THR A O   1 
ATOM 1021 C CB  . THR A 1 138 ? -9.889  34.473 -3.040  1.00 49.65 ? 138 THR A CB  1 
ATOM 1022 O OG1 . THR A 1 138 ? -10.457 33.491 -2.159  1.00 51.07 ? 138 THR A OG1 1 
ATOM 1023 C CG2 . THR A 1 138 ? -10.370 35.885 -2.660  1.00 48.43 ? 138 THR A CG2 1 
ATOM 1024 N N   . LEU A 1 139 ? -10.633 35.946 -6.043  1.00 49.02 ? 139 LEU A N   1 
ATOM 1025 C CA  . LEU A 1 139 ? -10.261 37.046 -6.897  1.00 47.47 ? 139 LEU A CA  1 
ATOM 1026 C C   . LEU A 1 139 ? -10.013 38.282 -6.053  1.00 47.22 ? 139 LEU A C   1 
ATOM 1027 O O   . LEU A 1 139 ? -10.760 38.567 -5.130  1.00 47.48 ? 139 LEU A O   1 
ATOM 1028 C CB  . LEU A 1 139 ? -11.368 37.289 -7.922  1.00 47.33 ? 139 LEU A CB  1 
ATOM 1029 C CG  . LEU A 1 139 ? -11.225 38.440 -8.909  1.00 45.10 ? 139 LEU A CG  1 
ATOM 1030 C CD1 . LEU A 1 139 ? -10.353 38.023 -10.050 1.00 43.64 ? 139 LEU A CD1 1 
ATOM 1031 C CD2 . LEU A 1 139 ? -12.594 38.793 -9.397  1.00 45.33 ? 139 LEU A CD2 1 
ATOM 1032 N N   . ILE A 1 140 ? -8.957  39.020 -6.361  1.00 47.29 ? 140 ILE A N   1 
ATOM 1033 C CA  . ILE A 1 140 ? -8.767  40.343 -5.751  1.00 47.14 ? 140 ILE A CA  1 
ATOM 1034 C C   . ILE A 1 140 ? -9.312  41.424 -6.653  1.00 46.77 ? 140 ILE A C   1 
ATOM 1035 O O   . ILE A 1 140 ? -9.983  42.344 -6.161  1.00 47.44 ? 140 ILE A O   1 
ATOM 1036 C CB  . ILE A 1 140 ? -7.301  40.634 -5.397  1.00 47.43 ? 140 ILE A CB  1 
ATOM 1037 C CG1 . ILE A 1 140 ? -6.732  39.445 -4.593  1.00 47.82 ? 140 ILE A CG1 1 
ATOM 1038 C CG2 . ILE A 1 140 ? -7.165  41.980 -4.631  1.00 46.23 ? 140 ILE A CG2 1 
ATOM 1039 C CD1 . ILE A 1 140 ? -7.359  39.239 -3.226  1.00 47.62 ? 140 ILE A CD1 1 
ATOM 1040 N N   . LEU A 1 141 ? -9.030  41.306 -7.952  1.00 45.41 ? 141 LEU A N   1 
ATOM 1041 C CA  . LEU A 1 141 ? -9.468  42.277 -8.947  1.00 44.68 ? 141 LEU A CA  1 
ATOM 1042 C C   . LEU A 1 141 ? -9.165  41.774 -10.350 1.00 43.83 ? 141 LEU A C   1 
ATOM 1043 O O   . LEU A 1 141 ? -8.120  41.172 -10.560 1.00 43.90 ? 141 LEU A O   1 
ATOM 1044 C CB  . LEU A 1 141 ? -8.782  43.625 -8.724  1.00 44.48 ? 141 LEU A CB  1 
ATOM 1045 C CG  . LEU A 1 141 ? -9.437  44.821 -9.413  1.00 45.04 ? 141 LEU A CG  1 
ATOM 1046 C CD1 . LEU A 1 141 ? -10.826 45.021 -8.837  1.00 44.78 ? 141 LEU A CD1 1 
ATOM 1047 C CD2 . LEU A 1 141 ? -8.619  46.108 -9.254  1.00 43.13 ? 141 LEU A CD2 1 
ATOM 1048 N N   . LEU A 1 142 ? -10.116 41.972 -11.268 1.00 42.79 ? 142 LEU A N   1 
ATOM 1049 C CA  . LEU A 1 142 ? -9.959  41.774 -12.718 1.00 41.95 ? 142 LEU A CA  1 
ATOM 1050 C C   . LEU A 1 142 ? -10.260 43.079 -13.429 1.00 41.09 ? 142 LEU A C   1 
ATOM 1051 O O   . LEU A 1 142 ? -11.204 43.765 -13.072 1.00 39.88 ? 142 LEU A O   1 
ATOM 1052 C CB  . LEU A 1 142 ? -10.859 40.656 -13.281 1.00 41.97 ? 142 LEU A CB  1 
ATOM 1053 C CG  . LEU A 1 142 ? -10.748 40.301 -14.789 1.00 43.20 ? 142 LEU A CG  1 
ATOM 1054 C CD1 . LEU A 1 142 ? -10.994 38.841 -15.079 1.00 43.08 ? 142 LEU A CD1 1 
ATOM 1055 C CD2 . LEU A 1 142 ? -11.639 41.142 -15.691 1.00 43.91 ? 142 LEU A CD2 1 
ATOM 1056 N N   . ARG A 1 143 ? -9.442  43.410 -14.434 1.00 40.89 ? 143 ARG A N   1 
ATOM 1057 C CA  . ARG A 1 143 ? -9.671  44.607 -15.257 1.00 40.66 ? 143 ARG A CA  1 
ATOM 1058 C C   . ARG A 1 143 ? -9.476  44.401 -16.758 1.00 40.83 ? 143 ARG A C   1 
ATOM 1059 O O   . ARG A 1 143 ? -8.561  43.723 -17.190 1.00 41.02 ? 143 ARG A O   1 
ATOM 1060 C CB  . ARG A 1 143 ? -8.837  45.777 -14.748 1.00 39.84 ? 143 ARG A CB  1 
ATOM 1061 C CG  . ARG A 1 143 ? -9.504  46.525 -13.629 1.00 39.76 ? 143 ARG A CG  1 
ATOM 1062 C CD  . ARG A 1 143 ? -8.628  47.595 -13.024 1.00 40.21 ? 143 ARG A CD  1 
ATOM 1063 N NE  . ARG A 1 143 ? -9.400  48.423 -12.092 1.00 40.79 ? 143 ARG A NE  1 
ATOM 1064 C CZ  . ARG A 1 143 ? -8.987  49.572 -11.547 1.00 41.68 ? 143 ARG A CZ  1 
ATOM 1065 N NH1 . ARG A 1 143 ? -7.784  50.096 -11.781 1.00 42.27 ? 143 ARG A NH1 1 
ATOM 1066 N NH2 . ARG A 1 143 ? -9.788  50.208 -10.740 1.00 42.83 ? 143 ARG A NH2 1 
ATOM 1067 N N   . ALA A 1 144 ? -10.375 44.983 -17.541 1.00 41.01 ? 144 ALA A N   1 
ATOM 1068 C CA  . ALA A 1 144 ? -10.305 44.968 -18.997 1.00 40.37 ? 144 ALA A CA  1 
ATOM 1069 C C   . ALA A 1 144 ? -9.549  46.182 -19.487 1.00 40.83 ? 144 ALA A C   1 
ATOM 1070 O O   . ALA A 1 144 ? -9.907  47.301 -19.136 1.00 40.72 ? 144 ALA A O   1 
ATOM 1071 C CB  . ALA A 1 144 ? -11.690 44.998 -19.574 1.00 39.81 ? 144 ALA A CB  1 
ATOM 1072 N N   . PHE A 1 145 ? -8.542  45.962 -20.336 1.00 40.74 ? 145 PHE A N   1 
ATOM 1073 C CA  . PHE A 1 145 ? -7.739  47.056 -20.839 1.00 41.37 ? 145 PHE A CA  1 
ATOM 1074 C C   . PHE A 1 145 ? -7.771  47.099 -22.356 1.00 41.91 ? 145 PHE A C   1 
ATOM 1075 O O   . PHE A 1 145 ? -7.758  46.063 -23.000 1.00 42.62 ? 145 PHE A O   1 
ATOM 1076 C CB  . PHE A 1 145 ? -6.275  46.913 -20.397 1.00 41.39 ? 145 PHE A CB  1 
ATOM 1077 C CG  . PHE A 1 145 ? -6.049  46.947 -18.891 1.00 40.62 ? 145 PHE A CG  1 
ATOM 1078 C CD1 . PHE A 1 145 ? -5.665  48.131 -18.255 1.00 39.93 ? 145 PHE A CD1 1 
ATOM 1079 C CD2 . PHE A 1 145 ? -6.154  45.790 -18.125 1.00 39.45 ? 145 PHE A CD2 1 
ATOM 1080 C CE1 . PHE A 1 145 ? -5.427  48.166 -16.884 1.00 38.25 ? 145 PHE A CE1 1 
ATOM 1081 C CE2 . PHE A 1 145 ? -5.914  45.819 -16.748 1.00 38.52 ? 145 PHE A CE2 1 
ATOM 1082 C CZ  . PHE A 1 145 ? -5.553  47.006 -16.134 1.00 38.17 ? 145 PHE A CZ  1 
ATOM 1083 N N   . THR A 1 146 ? -7.805  48.301 -22.921 1.00 41.98 ? 146 THR A N   1 
ATOM 1084 C CA  . THR A 1 146 ? -7.656  48.481 -24.349 1.00 42.27 ? 146 THR A CA  1 
ATOM 1085 C C   . THR A 1 146 ? -6.179  48.401 -24.662 1.00 42.27 ? 146 THR A C   1 
ATOM 1086 O O   . THR A 1 146 ? -5.362  48.504 -23.771 1.00 42.45 ? 146 THR A O   1 
ATOM 1087 C CB  . THR A 1 146 ? -8.209  49.851 -24.851 1.00 42.43 ? 146 THR A CB  1 
ATOM 1088 O OG1 . THR A 1 146 ? -7.538  50.945 -24.201 1.00 43.56 ? 146 THR A OG1 1 
ATOM 1089 C CG2 . THR A 1 146 ? -9.663  49.983 -24.570 1.00 43.26 ? 146 THR A CG2 1 
ATOM 1090 N N   . GLU A 1 147 ? -5.838  48.221 -25.932 1.00 42.48 ? 147 GLU A N   1 
ATOM 1091 C CA  . GLU A 1 147 ? -4.444  48.261 -26.373 1.00 42.61 ? 147 GLU A CA  1 
ATOM 1092 C C   . GLU A 1 147 ? -3.808  49.593 -26.050 1.00 42.40 ? 147 GLU A C   1 
ATOM 1093 O O   . GLU A 1 147 ? -2.611  49.666 -25.798 1.00 42.72 ? 147 GLU A O   1 
ATOM 1094 C CB  . GLU A 1 147 ? -4.305  47.953 -27.877 1.00 42.24 ? 147 GLU A CB  1 
ATOM 1095 C CG  . GLU A 1 147 ? -4.577  46.499 -28.269 1.00 42.78 ? 147 GLU A CG  1 
ATOM 1096 C CD  . GLU A 1 147 ? -3.597  45.447 -27.680 1.00 45.99 ? 147 GLU A CD  1 
ATOM 1097 O OE1 . GLU A 1 147 ? -3.984  44.247 -27.676 1.00 45.86 ? 147 GLU A OE1 1 
ATOM 1098 O OE2 . GLU A 1 147 ? -2.454  45.787 -27.244 1.00 46.77 ? 147 GLU A OE2 1 
ATOM 1099 N N   . GLU A 1 148 ? -4.616  50.645 -26.054 1.00 42.41 ? 148 GLU A N   1 
ATOM 1100 C CA  . GLU A 1 148 ? -4.149  51.974 -25.662 1.00 42.82 ? 148 GLU A CA  1 
ATOM 1101 C C   . GLU A 1 148 ? -4.016  52.130 -24.150 1.00 42.03 ? 148 GLU A C   1 
ATOM 1102 O O   . GLU A 1 148 ? -3.520  53.134 -23.676 1.00 41.70 ? 148 GLU A O   1 
ATOM 1103 C CB  . GLU A 1 148 ? -5.012  53.092 -26.287 1.00 43.52 ? 148 GLU A CB  1 
ATOM 1104 C CG  . GLU A 1 148 ? -6.434  52.672 -26.783 1.00 47.80 ? 148 GLU A CG  1 
ATOM 1105 C CD  . GLU A 1 148 ? -6.417  51.917 -28.133 1.00 51.60 ? 148 GLU A CD  1 
ATOM 1106 O OE1 . GLU A 1 148 ? -7.410  51.180 -28.431 1.00 51.29 ? 148 GLU A OE1 1 
ATOM 1107 O OE2 . GLU A 1 148 ? -5.409  52.063 -28.886 1.00 52.52 ? 148 GLU A OE2 1 
ATOM 1108 N N   . GLY A 1 149 ? -4.457  51.128 -23.394 1.00 41.67 ? 149 GLY A N   1 
ATOM 1109 C CA  . GLY A 1 149 ? -4.225  51.111 -21.958 1.00 41.20 ? 149 GLY A CA  1 
ATOM 1110 C C   . GLY A 1 149 ? -5.344  51.666 -21.095 1.00 41.31 ? 149 GLY A C   1 
ATOM 1111 O O   . GLY A 1 149 ? -5.208  51.737 -19.879 1.00 41.40 ? 149 GLY A O   1 
ATOM 1112 N N   . ALA A 1 150 ? -6.461  52.053 -21.705 1.00 41.08 ? 150 ALA A N   1 
ATOM 1113 C CA  . ALA A 1 150 ? -7.608  52.539 -20.943 1.00 40.75 ? 150 ALA A CA  1 
ATOM 1114 C C   . ALA A 1 150 ? -8.350  51.376 -20.295 1.00 40.83 ? 150 ALA A C   1 
ATOM 1115 O O   . ALA A 1 150 ? -8.465  50.291 -20.887 1.00 40.68 ? 150 ALA A O   1 
ATOM 1116 C CB  . ALA A 1 150 ? -8.539  53.328 -21.840 1.00 40.99 ? 150 ALA A CB  1 
ATOM 1117 N N   . ILE A 1 151 ? -8.837  51.591 -19.075 1.00 40.65 ? 151 ILE A N   1 
ATOM 1118 C CA  . ILE A 1 151 ? -9.608  50.567 -18.373 1.00 40.63 ? 151 ILE A CA  1 
ATOM 1119 C C   . ILE A 1 151 ? -11.041 50.686 -18.859 1.00 40.73 ? 151 ILE A C   1 
ATOM 1120 O O   . ILE A 1 151 ? -11.594 51.760 -18.827 1.00 41.49 ? 151 ILE A O   1 
ATOM 1121 C CB  . ILE A 1 151 ? -9.498  50.694 -16.837 1.00 40.82 ? 151 ILE A CB  1 
ATOM 1122 C CG1 . ILE A 1 151 ? -8.024  50.579 -16.407 1.00 41.38 ? 151 ILE A CG1 1 
ATOM 1123 C CG2 . ILE A 1 151 ? -10.346 49.611 -16.116 1.00 39.95 ? 151 ILE A CG2 1 
ATOM 1124 C CD1 . ILE A 1 151 ? -7.685  51.224 -15.083 1.00 39.85 ? 151 ILE A CD1 1 
ATOM 1125 N N   . VAL A 1 152 ? -11.614 49.597 -19.354 1.00 40.47 ? 152 VAL A N   1 
ATOM 1126 C CA  . VAL A 1 152 ? -12.975 49.622 -19.864 1.00 41.61 ? 152 VAL A CA  1 
ATOM 1127 C C   . VAL A 1 152 ? -13.916 48.570 -19.245 1.00 42.49 ? 152 VAL A C   1 
ATOM 1128 O O   . VAL A 1 152 ? -15.074 48.450 -19.664 1.00 42.70 ? 152 VAL A O   1 
ATOM 1129 C CB  . VAL A 1 152 ? -13.013 49.502 -21.422 1.00 41.96 ? 152 VAL A CB  1 
ATOM 1130 C CG1 . VAL A 1 152 ? -12.282 50.689 -22.072 1.00 41.69 ? 152 VAL A CG1 1 
ATOM 1131 C CG2 . VAL A 1 152 ? -12.443 48.166 -21.895 1.00 40.18 ? 152 VAL A CG2 1 
ATOM 1132 N N   . GLY A 1 153 ? -13.410 47.817 -18.263 1.00 42.62 ? 153 GLY A N   1 
ATOM 1133 C CA  . GLY A 1 153 ? -14.169 46.767 -17.632 1.00 42.73 ? 153 GLY A CA  1 
ATOM 1134 C C   . GLY A 1 153 ? -13.527 46.399 -16.319 1.00 43.15 ? 153 GLY A C   1 
ATOM 1135 O O   . GLY A 1 153 ? -12.293 46.433 -16.190 1.00 42.68 ? 153 GLY A O   1 
ATOM 1136 N N   . GLU A 1 154 ? -14.357 46.039 -15.344 1.00 42.53 ? 154 GLU A N   1 
ATOM 1137 C CA  . GLU A 1 154 ? -13.838 45.632 -14.061 1.00 43.06 ? 154 GLU A CA  1 
ATOM 1138 C C   . GLU A 1 154 ? -14.712 44.580 -13.434 1.00 43.07 ? 154 GLU A C   1 
ATOM 1139 O O   . GLU A 1 154 ? -15.946 44.660 -13.486 1.00 44.24 ? 154 GLU A O   1 
ATOM 1140 C CB  . GLU A 1 154 ? -13.688 46.843 -13.133 1.00 43.38 ? 154 GLU A CB  1 
ATOM 1141 C CG  . GLU A 1 154 ? -13.075 46.545 -11.762 1.00 45.65 ? 154 GLU A CG  1 
ATOM 1142 C CD  . GLU A 1 154 ? -12.739 47.815 -10.985 1.00 49.50 ? 154 GLU A CD  1 
ATOM 1143 O OE1 . GLU A 1 154 ? -11.540 48.089 -10.754 1.00 52.09 ? 154 GLU A OE1 1 
ATOM 1144 O OE2 . GLU A 1 154 ? -13.661 48.560 -10.594 1.00 51.99 ? 154 GLU A OE2 1 
ATOM 1145 N N   . ILE A 1 155 ? -14.082 43.576 -12.846 1.00 42.65 ? 155 ILE A N   1 
ATOM 1146 C CA  . ILE A 1 155 ? -14.821 42.666 -11.962 1.00 42.50 ? 155 ILE A CA  1 
ATOM 1147 C C   . ILE A 1 155 ? -14.153 42.711 -10.608 1.00 42.55 ? 155 ILE A C   1 
ATOM 1148 O O   . ILE A 1 155 ? -13.027 42.291 -10.477 1.00 41.34 ? 155 ILE A O   1 
ATOM 1149 C CB  . ILE A 1 155 ? -14.875 41.202 -12.488 1.00 42.22 ? 155 ILE A CB  1 
ATOM 1150 C CG1 . ILE A 1 155 ? -15.526 41.155 -13.876 1.00 40.44 ? 155 ILE A CG1 1 
ATOM 1151 C CG2 . ILE A 1 155 ? -15.577 40.306 -11.477 1.00 41.96 ? 155 ILE A CG2 1 
ATOM 1152 C CD1 . ILE A 1 155 ? -15.368 39.882 -14.593 1.00 37.40 ? 155 ILE A CD1 1 
ATOM 1153 N N   . SER A 1 156 ? -14.854 43.223 -9.604  1.00 43.52 ? 156 SER A N   1 
ATOM 1154 C CA  . SER A 1 156 ? -14.295 43.265 -8.256  1.00 44.64 ? 156 SER A CA  1 
ATOM 1155 C C   . SER A 1 156 ? -15.159 42.537 -7.252  1.00 45.26 ? 156 SER A C   1 
ATOM 1156 O O   . SER A 1 156 ? -16.372 42.498 -7.406  1.00 44.94 ? 156 SER A O   1 
ATOM 1157 C CB  . SER A 1 156 ? -14.067 44.708 -7.800  1.00 44.57 ? 156 SER A CB  1 
ATOM 1158 O OG  . SER A 1 156 ? -15.202 45.493 -8.065  1.00 45.61 ? 156 SER A OG  1 
ATOM 1159 N N   . PRO A 1 157 ? -14.538 41.966 -6.203  1.00 46.72 ? 157 PRO A N   1 
ATOM 1160 C CA  . PRO A 1 157 ? -15.297 41.278 -5.148  1.00 48.01 ? 157 PRO A CA  1 
ATOM 1161 C C   . PRO A 1 157 ? -15.917 42.216 -4.125  1.00 49.47 ? 157 PRO A C   1 
ATOM 1162 O O   . PRO A 1 157 ? -15.296 43.207 -3.740  1.00 49.62 ? 157 PRO A O   1 
ATOM 1163 C CB  . PRO A 1 157 ? -14.258 40.364 -4.493  1.00 47.49 ? 157 PRO A CB  1 
ATOM 1164 C CG  . PRO A 1 157 ? -12.967 40.971 -4.756  1.00 47.23 ? 157 PRO A CG  1 
ATOM 1165 C CD  . PRO A 1 157 ? -13.089 41.909 -5.953  1.00 46.91 ? 157 PRO A CD  1 
ATOM 1166 N N   . LEU A 1 158 ? -17.156 41.925 -3.723  1.00 51.83 ? 158 LEU A N   1 
ATOM 1167 C CA  . LEU A 1 158 ? -17.806 42.691 -2.657  1.00 54.30 ? 158 LEU A CA  1 
ATOM 1168 C C   . LEU A 1 158 ? -17.436 42.106 -1.295  1.00 56.32 ? 158 LEU A C   1 
ATOM 1169 O O   . LEU A 1 158 ? -17.365 40.877 -1.159  1.00 57.30 ? 158 LEU A O   1 
ATOM 1170 C CB  . LEU A 1 158 ? -19.318 42.644 -2.802  1.00 53.87 ? 158 LEU A CB  1 
ATOM 1171 C CG  . LEU A 1 158 ? -19.957 43.520 -3.867  1.00 54.21 ? 158 LEU A CG  1 
ATOM 1172 C CD1 . LEU A 1 158 ? -21.474 43.294 -3.894  1.00 52.85 ? 158 LEU A CD1 1 
ATOM 1173 C CD2 . LEU A 1 158 ? -19.617 44.978 -3.550  1.00 55.84 ? 158 LEU A CD2 1 
ATOM 1174 N N   . PRO A 1 159 ? -17.185 42.965 -0.284  1.00 58.00 ? 159 PRO A N   1 
ATOM 1175 C CA  . PRO A 1 159 ? -17.061 42.431 1.085   1.00 59.29 ? 159 PRO A CA  1 
ATOM 1176 C C   . PRO A 1 159 ? -18.386 41.864 1.602   1.00 60.32 ? 159 PRO A C   1 
ATOM 1177 O O   . PRO A 1 159 ? -19.315 42.641 1.926   1.00 60.99 ? 159 PRO A O   1 
ATOM 1178 C CB  . PRO A 1 159 ? -16.647 43.650 1.914   1.00 59.13 ? 159 PRO A CB  1 
ATOM 1179 C CG  . PRO A 1 159 ? -16.217 44.692 0.915   1.00 58.89 ? 159 PRO A CG  1 
ATOM 1180 C CD  . PRO A 1 159 ? -16.974 44.423 -0.333  1.00 58.04 ? 159 PRO A CD  1 
ATOM 1181 N N   . SER A 1 160 ? -18.477 40.529 1.679   1.00 61.41 ? 160 SER A N   1 
ATOM 1182 C CA  . SER A 1 160 ? -19.714 39.883 2.149   1.00 63.03 ? 160 SER A CA  1 
ATOM 1183 C C   . SER A 1 160 ? -19.445 38.642 3.031   1.00 63.73 ? 160 SER A C   1 
ATOM 1184 O O   . SER A 1 160 ? -18.351 38.051 2.962   1.00 64.73 ? 160 SER A O   1 
ATOM 1185 C CB  . SER A 1 160 ? -20.514 39.454 0.926   1.00 62.97 ? 160 SER A CB  1 
ATOM 1186 O OG  . SER A 1 160 ? -19.723 38.546 0.157   1.00 62.90 ? 160 SER A OG  1 
ATOM 1187 N N   . LEU A 1 161 ? -20.444 38.236 3.825   1.00 64.10 ? 161 LEU A N   1 
ATOM 1188 C CA  . LEU A 1 161 ? -20.409 36.969 4.615   1.00 64.61 ? 161 LEU A CA  1 
ATOM 1189 C C   . LEU A 1 161 ? -20.222 35.678 3.769   1.00 64.52 ? 161 LEU A C   1 
ATOM 1190 O O   . LEU A 1 161 ? -19.441 34.788 4.176   1.00 64.76 ? 161 LEU A O   1 
ATOM 1191 C CB  . LEU A 1 161 ? -21.676 36.810 5.489   1.00 64.58 ? 161 LEU A CB  1 
ATOM 1192 C CG  . LEU A 1 161 ? -21.970 37.784 6.640   1.00 66.02 ? 161 LEU A CG  1 
ATOM 1193 C CD1 . LEU A 1 161 ? -23.383 37.578 7.221   1.00 66.87 ? 161 LEU A CD1 1 
ATOM 1194 C CD2 . LEU A 1 161 ? -20.895 37.696 7.751   1.00 68.25 ? 161 LEU A CD2 1 
ATOM 1195 N N   . PRO A 1 162 ? -20.958 35.549 2.619   1.00 64.06 ? 162 PRO A N   1 
ATOM 1196 C CA  . PRO A 1 162 ? -20.737 34.388 1.709   1.00 62.98 ? 162 PRO A CA  1 
ATOM 1197 C C   . PRO A 1 162 ? -19.308 34.279 1.143   1.00 61.34 ? 162 PRO A C   1 
ATOM 1198 O O   . PRO A 1 162 ? -18.690 33.206 1.231   1.00 60.52 ? 162 PRO A O   1 
ATOM 1199 C CB  . PRO A 1 162 ? -21.733 34.642 0.541   1.00 63.38 ? 162 PRO A CB  1 
ATOM 1200 C CG  . PRO A 1 162 ? -22.076 36.137 0.617   1.00 64.12 ? 162 PRO A CG  1 
ATOM 1201 C CD  . PRO A 1 162 ? -22.037 36.438 2.113   1.00 64.32 ? 162 PRO A CD  1 
ATOM 1202 N N   . GLY A 1 163 ? -18.808 35.398 0.585   1.00 59.92 ? 163 GLY A N   1 
ATOM 1203 C CA  . GLY A 1 163 ? -17.628 35.399 -0.275  1.00 57.58 ? 163 GLY A CA  1 
ATOM 1204 C C   . GLY A 1 163 ? -18.092 34.831 -1.616  1.00 56.40 ? 163 GLY A C   1 
ATOM 1205 O O   . GLY A 1 163 ? -19.308 34.620 -1.817  1.00 56.25 ? 163 GLY A O   1 
ATOM 1206 N N   . HIS A 1 164 ? -17.136 34.554 -2.514  1.00 54.64 ? 164 HIS A N   1 
ATOM 1207 C CA  . HIS A 1 164 ? -17.421 34.041 -3.855  1.00 52.59 ? 164 HIS A CA  1 
ATOM 1208 C C   . HIS A 1 164 ? -16.645 32.769 -4.174  1.00 51.91 ? 164 HIS A C   1 
ATOM 1209 O O   . HIS A 1 164 ? -15.687 32.452 -3.500  1.00 52.09 ? 164 HIS A O   1 
ATOM 1210 C CB  . HIS A 1 164 ? -17.093 35.119 -4.893  1.00 52.36 ? 164 HIS A CB  1 
ATOM 1211 C CG  . HIS A 1 164 ? -15.633 35.426 -5.015  1.00 49.61 ? 164 HIS A CG  1 
ATOM 1212 N ND1 . HIS A 1 164 ? -15.058 36.541 -4.441  1.00 47.39 ? 164 HIS A ND1 1 
ATOM 1213 C CD2 . HIS A 1 164 ? -14.634 34.770 -5.657  1.00 48.00 ? 164 HIS A CD2 1 
ATOM 1214 C CE1 . HIS A 1 164 ? -13.765 36.558 -4.724  1.00 47.33 ? 164 HIS A CE1 1 
ATOM 1215 N NE2 . HIS A 1 164 ? -13.484 35.498 -5.465  1.00 48.55 ? 164 HIS A NE2 1 
ATOM 1216 N N   . THR A 1 165 ? -17.040 32.061 -5.225  1.00 51.11 ? 165 THR A N   1 
ATOM 1217 C CA  . THR A 1 165 ? -16.318 30.872 -5.653  1.00 50.89 ? 165 THR A CA  1 
ATOM 1218 C C   . THR A 1 165 ? -15.619 31.068 -7.022  1.00 50.54 ? 165 THR A C   1 
ATOM 1219 O O   . THR A 1 165 ? -15.812 32.084 -7.707  1.00 49.94 ? 165 THR A O   1 
ATOM 1220 C CB  . THR A 1 165 ? -17.275 29.642 -5.718  1.00 51.63 ? 165 THR A CB  1 
ATOM 1221 O OG1 . THR A 1 165 ? -18.220 29.803 -6.813  1.00 52.55 ? 165 THR A OG1 1 
ATOM 1222 C CG2 . THR A 1 165 ? -18.036 29.432 -4.368  1.00 51.13 ? 165 THR A CG2 1 
ATOM 1223 N N   . GLY A 1 166 ? -14.805 30.084 -7.410  1.00 50.10 ? 166 GLY A N   1 
ATOM 1224 C CA  . GLY A 1 166 ? -14.133 30.082 -8.710  1.00 48.87 ? 166 GLY A CA  1 
ATOM 1225 C C   . GLY A 1 166 ? -15.167 30.085 -9.802  1.00 48.15 ? 166 GLY A C   1 
ATOM 1226 O O   . GLY A 1 166 ? -15.033 30.800 -10.803 1.00 47.91 ? 166 GLY A O   1 
ATOM 1227 N N   . GLU A 1 167 ? -16.206 29.286 -9.585  1.00 47.63 ? 167 GLU A N   1 
ATOM 1228 C CA  . GLU A 1 167 ? -17.371 29.212 -10.467 1.00 47.68 ? 167 GLU A CA  1 
ATOM 1229 C C   . GLU A 1 167 ? -18.030 30.603 -10.664 1.00 47.71 ? 167 GLU A C   1 
ATOM 1230 O O   . GLU A 1 167 ? -18.219 31.057 -11.795 1.00 47.78 ? 167 GLU A O   1 
ATOM 1231 C CB  . GLU A 1 167 ? -18.370 28.195 -9.905  1.00 47.29 ? 167 GLU A CB  1 
ATOM 1232 C CG  . GLU A 1 167 ? -19.495 27.832 -10.831 1.00 48.37 ? 167 GLU A CG  1 
ATOM 1233 C CD  . GLU A 1 167 ? -19.145 26.678 -11.794 1.00 50.51 ? 167 GLU A CD  1 
ATOM 1234 O OE1 . GLU A 1 167 ? -18.204 26.792 -12.669 1.00 49.80 ? 167 GLU A OE1 1 
ATOM 1235 O OE2 . GLU A 1 167 ? -19.850 25.642 -11.679 1.00 50.99 ? 167 GLU A OE2 1 
ATOM 1236 N N   . ASP A 1 168 ? -18.336 31.294 -9.566  1.00 47.33 ? 168 ASP A N   1 
ATOM 1237 C CA  . ASP A 1 168 ? -18.965 32.601 -9.672  1.00 47.06 ? 168 ASP A CA  1 
ATOM 1238 C C   . ASP A 1 168 ? -18.116 33.476 -10.544 1.00 46.65 ? 168 ASP A C   1 
ATOM 1239 O O   . ASP A 1 168 ? -18.631 34.192 -11.379 1.00 47.30 ? 168 ASP A O   1 
ATOM 1240 C CB  . ASP A 1 168 ? -19.118 33.263 -8.299  1.00 47.42 ? 168 ASP A CB  1 
ATOM 1241 C CG  . ASP A 1 168 ? -20.166 32.591 -7.433  1.00 48.73 ? 168 ASP A CG  1 
ATOM 1242 O OD1 . ASP A 1 168 ? -21.158 32.076 -8.004  1.00 47.74 ? 168 ASP A OD1 1 
ATOM 1243 O OD2 . ASP A 1 168 ? -20.002 32.586 -6.177  1.00 50.83 ? 168 ASP A OD2 1 
ATOM 1244 N N   . VAL A 1 169 ? -16.807 33.416 -10.332 1.00 46.27 ? 169 VAL A N   1 
ATOM 1245 C CA  . VAL A 1 169 ? -15.840 34.227 -11.064 1.00 45.46 ? 169 VAL A CA  1 
ATOM 1246 C C   . VAL A 1 169 ? -15.838 33.858 -12.545 1.00 45.22 ? 169 VAL A C   1 
ATOM 1247 O O   . VAL A 1 169 ? -15.821 34.727 -13.406 1.00 44.13 ? 169 VAL A O   1 
ATOM 1248 C CB  . VAL A 1 169 ? -14.431 34.059 -10.446 1.00 45.44 ? 169 VAL A CB  1 
ATOM 1249 C CG1 . VAL A 1 169 ? -13.332 34.472 -11.423 1.00 46.11 ? 169 VAL A CG1 1 
ATOM 1250 C CG2 . VAL A 1 169 ? -14.331 34.861 -9.140  1.00 45.33 ? 169 VAL A CG2 1 
ATOM 1251 N N   . LYS A 1 170 ? -15.877 32.556 -12.827 1.00 45.68 ? 170 LYS A N   1 
ATOM 1252 C CA  . LYS A 1 170 ? -15.878 32.079 -14.206 1.00 46.02 ? 170 LYS A CA  1 
ATOM 1253 C C   . LYS A 1 170 ? -17.088 32.617 -14.965 1.00 45.85 ? 170 LYS A C   1 
ATOM 1254 O O   . LYS A 1 170 ? -16.954 33.041 -16.135 1.00 45.97 ? 170 LYS A O   1 
ATOM 1255 C CB  . LYS A 1 170 ? -15.855 30.559 -14.261 1.00 46.08 ? 170 LYS A CB  1 
ATOM 1256 C CG  . LYS A 1 170 ? -15.751 30.042 -15.671 1.00 48.13 ? 170 LYS A CG  1 
ATOM 1257 C CD  . LYS A 1 170 ? -15.842 28.537 -15.757 1.00 51.65 ? 170 LYS A CD  1 
ATOM 1258 C CE  . LYS A 1 170 ? -17.289 28.091 -15.962 1.00 54.21 ? 170 LYS A CE  1 
ATOM 1259 N NZ  . LYS A 1 170 ? -18.081 28.215 -14.670 1.00 56.39 ? 170 LYS A NZ  1 
ATOM 1260 N N   . ASN A 1 171 ? -18.251 32.598 -14.296 1.00 45.44 ? 171 ASN A N   1 
ATOM 1261 C CA  . ASN A 1 171 ? -19.498 33.161 -14.828 1.00 45.08 ? 171 ASN A CA  1 
ATOM 1262 C C   . ASN A 1 171 ? -19.398 34.663 -15.102 1.00 44.58 ? 171 ASN A C   1 
ATOM 1263 O O   . ASN A 1 171 ? -19.747 35.129 -16.186 1.00 44.99 ? 171 ASN A O   1 
ATOM 1264 C CB  . ASN A 1 171 ? -20.670 32.873 -13.886 1.00 45.56 ? 171 ASN A CB  1 
ATOM 1265 C CG  . ASN A 1 171 ? -21.111 31.414 -13.922 1.00 47.21 ? 171 ASN A CG  1 
ATOM 1266 O OD1 . ASN A 1 171 ? -20.295 30.497 -13.781 1.00 48.74 ? 171 ASN A OD1 1 
ATOM 1267 N ND2 . ASN A 1 171 ? -22.416 31.194 -14.097 1.00 48.34 ? 171 ASN A ND2 1 
ATOM 1268 N N   . ALA A 1 172 ? -18.898 35.413 -14.129 1.00 43.81 ? 172 ALA A N   1 
ATOM 1269 C CA  . ALA A 1 172 ? -18.668 36.837 -14.304 1.00 43.55 ? 172 ALA A CA  1 
ATOM 1270 C C   . ALA A 1 172 ? -17.848 37.158 -15.585 1.00 43.95 ? 172 ALA A C   1 
ATOM 1271 O O   . ALA A 1 172 ? -18.249 38.004 -16.384 1.00 44.56 ? 172 ALA A O   1 
ATOM 1272 C CB  . ALA A 1 172 ? -17.997 37.398 -13.067 1.00 42.93 ? 172 ALA A CB  1 
ATOM 1273 N N   . ILE A 1 173 ? -16.716 36.480 -15.784 1.00 43.58 ? 173 ILE A N   1 
ATOM 1274 C CA  . ILE A 1 173 ? -15.849 36.735 -16.924 1.00 43.48 ? 173 ILE A CA  1 
ATOM 1275 C C   . ILE A 1 173 ? -16.584 36.528 -18.238 1.00 44.16 ? 173 ILE A C   1 
ATOM 1276 O O   . ILE A 1 173 ? -16.507 37.384 -19.129 1.00 44.34 ? 173 ILE A O   1 
ATOM 1277 C CB  . ILE A 1 173 ? -14.579 35.853 -16.898 1.00 43.68 ? 173 ILE A CB  1 
ATOM 1278 C CG1 . ILE A 1 173 ? -13.677 36.281 -15.733 1.00 42.77 ? 173 ILE A CG1 1 
ATOM 1279 C CG2 . ILE A 1 173 ? -13.856 35.873 -18.260 1.00 41.51 ? 173 ILE A CG2 1 
ATOM 1280 C CD1 . ILE A 1 173 ? -12.610 35.272 -15.382 1.00 41.69 ? 173 ILE A CD1 1 
ATOM 1281 N N   . GLY A 1 174 ? -17.302 35.404 -18.339 1.00 43.93 ? 174 GLY A N   1 
ATOM 1282 C CA  . GLY A 1 174 ? -18.061 35.068 -19.537 1.00 43.03 ? 174 GLY A CA  1 
ATOM 1283 C C   . GLY A 1 174 ? -19.120 36.105 -19.837 1.00 43.01 ? 174 GLY A C   1 
ATOM 1284 O O   . GLY A 1 174 ? -19.369 36.424 -21.013 1.00 42.95 ? 174 GLY A O   1 
ATOM 1285 N N   . VAL A 1 175 ? -19.726 36.642 -18.772 1.00 42.11 ? 175 VAL A N   1 
ATOM 1286 C CA  . VAL A 1 175 ? -20.693 37.734 -18.895 1.00 41.56 ? 175 VAL A CA  1 
ATOM 1287 C C   . VAL A 1 175 ? -20.054 39.067 -19.334 1.00 41.58 ? 175 VAL A C   1 
ATOM 1288 O O   . VAL A 1 175 ? -20.657 39.861 -20.059 1.00 41.26 ? 175 VAL A O   1 
ATOM 1289 C CB  . VAL A 1 175 ? -21.463 37.921 -17.579 1.00 41.51 ? 175 VAL A CB  1 
ATOM 1290 C CG1 . VAL A 1 175 ? -22.231 39.177 -17.597 1.00 41.32 ? 175 VAL A CG1 1 
ATOM 1291 C CG2 . VAL A 1 175 ? -22.409 36.746 -17.335 1.00 42.00 ? 175 VAL A CG2 1 
ATOM 1292 N N   . LEU A 1 176 ? -18.830 39.310 -18.880 1.00 41.47 ? 176 LEU A N   1 
ATOM 1293 C CA  . LEU A 1 176 ? -18.127 40.532 -19.223 1.00 41.12 ? 176 LEU A CA  1 
ATOM 1294 C C   . LEU A 1 176 ? -17.565 40.464 -20.656 1.00 41.63 ? 176 LEU A C   1 
ATOM 1295 O O   . LEU A 1 176 ? -17.671 41.428 -21.408 1.00 41.55 ? 176 LEU A O   1 
ATOM 1296 C CB  . LEU A 1 176 ? -17.042 40.836 -18.181 1.00 40.22 ? 176 LEU A CB  1 
ATOM 1297 C CG  . LEU A 1 176 ? -16.066 41.895 -18.622 1.00 39.08 ? 176 LEU A CG  1 
ATOM 1298 C CD1 . LEU A 1 176 ? -16.758 43.215 -18.653 1.00 40.97 ? 176 LEU A CD1 1 
ATOM 1299 C CD2 . LEU A 1 176 ? -14.915 41.933 -17.725 1.00 39.98 ? 176 LEU A CD2 1 
ATOM 1300 N N   . ILE A 1 177 ? -16.961 39.327 -21.013 1.00 42.22 ? 177 ILE A N   1 
ATOM 1301 C CA  . ILE A 1 177 ? -16.561 39.052 -22.386 1.00 42.70 ? 177 ILE A CA  1 
ATOM 1302 C C   . ILE A 1 177 ? -17.779 39.185 -23.292 1.00 42.90 ? 177 ILE A C   1 
ATOM 1303 O O   . ILE A 1 177 ? -17.759 39.898 -24.280 1.00 42.82 ? 177 ILE A O   1 
ATOM 1304 C CB  . ILE A 1 177 ? -15.895 37.659 -22.532 1.00 42.71 ? 177 ILE A CB  1 
ATOM 1305 C CG1 . ILE A 1 177 ? -14.542 37.651 -21.793 1.00 43.57 ? 177 ILE A CG1 1 
ATOM 1306 C CG2 . ILE A 1 177 ? -15.670 37.329 -24.000 1.00 42.08 ? 177 ILE A CG2 1 
ATOM 1307 C CD1 . ILE A 1 177 ? -13.793 36.305 -21.841 1.00 42.41 ? 177 ILE A CD1 1 
ATOM 1308 N N   . GLY A 1 178 ? -18.860 38.536 -22.903 1.00 43.46 ? 178 GLY A N   1 
ATOM 1309 C CA  . GLY A 1 178 ? -20.121 38.677 -23.609 1.00 44.62 ? 178 GLY A CA  1 
ATOM 1310 C C   . GLY A 1 178 ? -20.545 40.103 -23.899 1.00 45.44 ? 178 GLY A C   1 
ATOM 1311 O O   . GLY A 1 178 ? -20.790 40.456 -25.068 1.00 46.79 ? 178 GLY A O   1 
ATOM 1312 N N   . GLY A 1 179 ? -20.637 40.925 -22.856 1.00 45.07 ? 179 GLY A N   1 
ATOM 1313 C CA  . GLY A 1 179 ? -21.122 42.291 -23.010 1.00 45.13 ? 179 GLY A CA  1 
ATOM 1314 C C   . GLY A 1 179 ? -20.240 43.117 -23.929 1.00 45.74 ? 179 GLY A C   1 
ATOM 1315 O O   . GLY A 1 179 ? -20.720 43.900 -24.732 1.00 46.02 ? 179 GLY A O   1 
ATOM 1316 N N   . LEU A 1 180 ? -18.935 42.929 -23.799 1.00 46.23 ? 180 LEU A N   1 
ATOM 1317 C CA  . LEU A 1 180 ? -17.970 43.710 -24.553 1.00 46.54 ? 180 LEU A CA  1 
ATOM 1318 C C   . LEU A 1 180 ? -18.001 43.335 -26.029 1.00 47.38 ? 180 LEU A C   1 
ATOM 1319 O O   . LEU A 1 180 ? -17.729 44.190 -26.912 1.00 47.73 ? 180 LEU A O   1 
ATOM 1320 C CB  . LEU A 1 180 ? -16.544 43.525 -24.008 1.00 45.72 ? 180 LEU A CB  1 
ATOM 1321 C CG  . LEU A 1 180 ? -16.054 44.224 -22.724 1.00 44.55 ? 180 LEU A CG  1 
ATOM 1322 C CD1 . LEU A 1 180 ? -14.727 43.634 -22.292 1.00 44.67 ? 180 LEU A CD1 1 
ATOM 1323 C CD2 . LEU A 1 180 ? -15.922 45.707 -22.858 1.00 41.71 ? 180 LEU A CD2 1 
ATOM 1324 N N   . GLU A 1 181 ? -18.321 42.065 -26.299 1.00 47.25 ? 181 GLU A N   1 
ATOM 1325 C CA  . GLU A 1 181 ? -18.231 41.570 -27.658 1.00 47.07 ? 181 GLU A CA  1 
ATOM 1326 C C   . GLU A 1 181 ? -19.435 42.022 -28.460 1.00 47.80 ? 181 GLU A C   1 
ATOM 1327 O O   . GLU A 1 181 ? -19.346 42.117 -29.686 1.00 47.95 ? 181 GLU A O   1 
ATOM 1328 C CB  . GLU A 1 181 ? -18.093 40.068 -27.688 1.00 46.74 ? 181 GLU A CB  1 
ATOM 1329 C CG  . GLU A 1 181 ? -16.682 39.607 -27.524 1.00 46.67 ? 181 GLU A CG  1 
ATOM 1330 C CD  . GLU A 1 181 ? -16.560 38.096 -27.470 1.00 49.08 ? 181 GLU A CD  1 
ATOM 1331 O OE1 . GLU A 1 181 ? -15.414 37.600 -27.619 1.00 53.11 ? 181 GLU A OE1 1 
ATOM 1332 O OE2 . GLU A 1 181 ? -17.591 37.395 -27.296 1.00 49.43 ? 181 GLU A OE2 1 
ATOM 1333 N N   . TRP A 1 182 ? -20.548 42.325 -27.773 1.00 48.07 ? 182 TRP A N   1 
ATOM 1334 C CA  . TRP A 1 182 ? -21.669 42.940 -28.459 1.00 48.40 ? 182 TRP A CA  1 
ATOM 1335 C C   . TRP A 1 182 ? -21.283 44.122 -29.364 1.00 49.32 ? 182 TRP A C   1 
ATOM 1336 O O   . TRP A 1 182 ? -21.793 44.218 -30.498 1.00 50.06 ? 182 TRP A O   1 
ATOM 1337 C CB  . TRP A 1 182 ? -22.759 43.391 -27.516 1.00 48.06 ? 182 TRP A CB  1 
ATOM 1338 C CG  . TRP A 1 182 ? -24.001 43.584 -28.328 1.00 48.80 ? 182 TRP A CG  1 
ATOM 1339 C CD1 . TRP A 1 182 ? -24.364 44.712 -29.048 1.00 48.35 ? 182 TRP A CD1 1 
ATOM 1340 C CD2 . TRP A 1 182 ? -25.012 42.595 -28.587 1.00 46.08 ? 182 TRP A CD2 1 
ATOM 1341 N NE1 . TRP A 1 182 ? -25.565 44.488 -29.697 1.00 49.00 ? 182 TRP A NE1 1 
ATOM 1342 C CE2 . TRP A 1 182 ? -25.977 43.197 -29.441 1.00 47.14 ? 182 TRP A CE2 1 
ATOM 1343 C CE3 . TRP A 1 182 ? -25.204 41.273 -28.169 1.00 42.70 ? 182 TRP A CE3 1 
ATOM 1344 C CZ2 . TRP A 1 182 ? -27.114 42.511 -29.882 1.00 45.32 ? 182 TRP A CZ2 1 
ATOM 1345 C CZ3 . TRP A 1 182 ? -26.343 40.592 -28.607 1.00 45.27 ? 182 TRP A CZ3 1 
ATOM 1346 C CH2 . TRP A 1 182 ? -27.278 41.212 -29.459 1.00 44.97 ? 182 TRP A CH2 1 
ATOM 1347 N N   . ASN A 1 183 ? -20.412 45.012 -28.871 1.00 49.00 ? 183 ASN A N   1 
ATOM 1348 C CA  . ASN A 1 183 ? -19.987 46.174 -29.632 1.00 48.76 ? 183 ASN A CA  1 
ATOM 1349 C C   . ASN A 1 183 ? -18.817 45.861 -30.529 1.00 49.15 ? 183 ASN A C   1 
ATOM 1350 O O   . ASN A 1 183 ? -17.982 46.719 -30.812 1.00 49.53 ? 183 ASN A O   1 
ATOM 1351 C CB  . ASN A 1 183 ? -19.671 47.349 -28.722 1.00 48.36 ? 183 ASN A CB  1 
ATOM 1352 C CG  . ASN A 1 183 ? -20.916 47.921 -28.081 1.00 49.86 ? 183 ASN A CG  1 
ATOM 1353 O OD1 . ASN A 1 183 ? -21.971 47.990 -28.719 1.00 50.91 ? 183 ASN A OD1 1 
ATOM 1354 N ND2 . ASN A 1 183 ? -20.816 48.312 -26.803 1.00 51.02 ? 183 ASN A ND2 1 
ATOM 1355 N N   . ASP A 1 184 ? -18.755 44.620 -30.993 1.00 49.50 ? 184 ASP A N   1 
ATOM 1356 C CA  . ASP A 1 184 ? -17.742 44.227 -31.990 1.00 49.72 ? 184 ASP A CA  1 
ATOM 1357 C C   . ASP A 1 184 ? -16.333 44.476 -31.480 1.00 49.47 ? 184 ASP A C   1 
ATOM 1358 O O   . ASP A 1 184 ? -15.478 44.922 -32.250 1.00 50.07 ? 184 ASP A O   1 
ATOM 1359 C CB  . ASP A 1 184 ? -17.942 44.993 -33.303 1.00 49.65 ? 184 ASP A CB  1 
ATOM 1360 C CG  . ASP A 1 184 ? -19.394 45.002 -33.763 1.00 51.49 ? 184 ASP A CG  1 
ATOM 1361 O OD1 . ASP A 1 184 ? -20.087 43.922 -33.696 1.00 52.00 ? 184 ASP A OD1 1 
ATOM 1362 O OD2 . ASP A 1 184 ? -19.856 46.101 -34.184 1.00 53.36 ? 184 ASP A OD2 1 
ATOM 1363 N N   . ASN A 1 185 ? -16.101 44.209 -30.192 1.00 48.67 ? 185 ASN A N   1 
ATOM 1364 C CA  . ASN A 1 185 ? -14.763 44.256 -29.632 1.00 48.25 ? 185 ASN A CA  1 
ATOM 1365 C C   . ASN A 1 185 ? -14.138 42.872 -29.644 1.00 48.16 ? 185 ASN A C   1 
ATOM 1366 O O   . ASN A 1 185 ? -14.793 41.879 -29.388 1.00 47.71 ? 185 ASN A O   1 
ATOM 1367 C CB  . ASN A 1 185 ? -14.785 44.773 -28.192 1.00 48.35 ? 185 ASN A CB  1 
ATOM 1368 C CG  . ASN A 1 185 ? -15.057 46.254 -28.093 1.00 48.07 ? 185 ASN A CG  1 
ATOM 1369 O OD1 . ASN A 1 185 ? -14.244 47.073 -28.529 1.00 47.90 ? 185 ASN A OD1 1 
ATOM 1370 N ND2 . ASN A 1 185 ? -16.186 46.609 -27.464 1.00 46.54 ? 185 ASN A ND2 1 
ATOM 1371 N N   . THR A 1 186 ? -12.850 42.800 -29.925 1.00 48.88 ? 186 THR A N   1 
ATOM 1372 C CA  . THR A 1 186 ? -12.155 41.525 -29.797 1.00 49.33 ? 186 THR A CA  1 
ATOM 1373 C C   . THR A 1 186 ? -11.486 41.449 -28.433 1.00 49.24 ? 186 THR A C   1 
ATOM 1374 O O   . THR A 1 186 ? -10.619 42.266 -28.103 1.00 49.17 ? 186 THR A O   1 
ATOM 1375 C CB  . THR A 1 186 ? -11.108 41.345 -30.897 1.00 49.36 ? 186 THR A CB  1 
ATOM 1376 O OG1 . THR A 1 186 ? -11.772 41.488 -32.161 1.00 49.47 ? 186 THR A OG1 1 
ATOM 1377 C CG2 . THR A 1 186 ? -10.453 39.945 -30.783 1.00 49.01 ? 186 THR A CG2 1 
ATOM 1378 N N   . VAL A 1 187 ? -11.901 40.453 -27.664 1.00 49.35 ? 187 VAL A N   1 
ATOM 1379 C CA  . VAL A 1 187 ? -11.526 40.311 -26.272 1.00 49.28 ? 187 VAL A CA  1 
ATOM 1380 C C   . VAL A 1 187 ? -10.699 39.038 -26.089 1.00 49.45 ? 187 VAL A C   1 
ATOM 1381 O O   . VAL A 1 187 ? -11.031 37.991 -26.635 1.00 49.52 ? 187 VAL A O   1 
ATOM 1382 C CB  . VAL A 1 187 ? -12.796 40.276 -25.365 1.00 49.21 ? 187 VAL A CB  1 
ATOM 1383 C CG1 . VAL A 1 187 ? -12.429 40.365 -23.855 1.00 49.15 ? 187 VAL A CG1 1 
ATOM 1384 C CG2 . VAL A 1 187 ? -13.743 41.410 -25.749 1.00 48.32 ? 187 VAL A CG2 1 
ATOM 1385 N N   . ARG A 1 188 ? -9.607  39.145 -25.332 1.00 49.58 ? 188 ARG A N   1 
ATOM 1386 C CA  . ARG A 1 188 ? -8.894  37.967 -24.868 1.00 49.11 ? 188 ARG A CA  1 
ATOM 1387 C C   . ARG A 1 188 ? -8.551  38.087 -23.388 1.00 49.35 ? 188 ARG A C   1 
ATOM 1388 O O   . ARG A 1 188 ? -8.879  39.098 -22.733 1.00 49.70 ? 188 ARG A O   1 
ATOM 1389 C CB  . ARG A 1 188 ? -7.639  37.736 -25.702 1.00 48.88 ? 188 ARG A CB  1 
ATOM 1390 C CG  . ARG A 1 188 ? -6.653  38.883 -25.648 1.00 49.04 ? 188 ARG A CG  1 
ATOM 1391 C CD  . ARG A 1 188 ? -5.489  38.604 -26.591 1.00 47.80 ? 188 ARG A CD  1 
ATOM 1392 N NE  . ARG A 1 188 ? -4.319  39.397 -26.247 1.00 48.67 ? 188 ARG A NE  1 
ATOM 1393 C CZ  . ARG A 1 188 ? -4.139  40.681 -26.578 1.00 50.44 ? 188 ARG A CZ  1 
ATOM 1394 N NH1 . ARG A 1 188 ? -5.058  41.347 -27.268 1.00 52.51 ? 188 ARG A NH1 1 
ATOM 1395 N NH2 . ARG A 1 188 ? -3.030  41.308 -26.227 1.00 48.94 ? 188 ARG A NH2 1 
ATOM 1396 N N   . VAL A 1 189 ? -7.911  37.036 -22.872 1.00 48.74 ? 189 VAL A N   1 
ATOM 1397 C CA  . VAL A 1 189 ? -7.485  36.950 -21.485 1.00 47.63 ? 189 VAL A CA  1 
ATOM 1398 C C   . VAL A 1 189 ? -5.987  36.675 -21.431 1.00 47.90 ? 189 VAL A C   1 
ATOM 1399 O O   . VAL A 1 189 ? -5.414  36.133 -22.372 1.00 48.36 ? 189 VAL A O   1 
ATOM 1400 C CB  . VAL A 1 189 ? -8.249  35.851 -20.745 1.00 47.33 ? 189 VAL A CB  1 
ATOM 1401 C CG1 . VAL A 1 189 ? -9.682  36.230 -20.637 1.00 46.55 ? 189 VAL A CG1 1 
ATOM 1402 C CG2 . VAL A 1 189 ? -8.133  34.520 -21.454 1.00 47.11 ? 189 VAL A CG2 1 
ATOM 1403 N N   . THR A 1 190 ? -5.336  37.052 -20.341 1.00 47.58 ? 190 THR A N   1 
ATOM 1404 C CA  . THR A 1 190 ? -3.939  36.704 -20.182 1.00 47.10 ? 190 THR A CA  1 
ATOM 1405 C C   . THR A 1 190 ? -3.858  35.205 -19.997 1.00 47.42 ? 190 THR A C   1 
ATOM 1406 O O   . THR A 1 190 ? -4.885  34.567 -19.752 1.00 48.06 ? 190 THR A O   1 
ATOM 1407 C CB  . THR A 1 190 ? -3.373  37.341 -18.946 1.00 47.11 ? 190 THR A CB  1 
ATOM 1408 O OG1 . THR A 1 190 ? -4.264  37.113 -17.857 1.00 45.14 ? 190 THR A OG1 1 
ATOM 1409 C CG2 . THR A 1 190 ? -3.207  38.817 -19.168 1.00 47.56 ? 190 THR A CG2 1 
ATOM 1410 N N   . GLU A 1 191 ? -2.655  34.641 -20.107 1.00 47.21 ? 191 GLU A N   1 
ATOM 1411 C CA  . GLU A 1 191 ? -2.462  33.225 -19.853 1.00 46.89 ? 191 GLU A CA  1 
ATOM 1412 C C   . GLU A 1 191 ? -2.881  32.812 -18.451 1.00 46.94 ? 191 GLU A C   1 
ATOM 1413 O O   . GLU A 1 191 ? -3.423  31.728 -18.266 1.00 46.78 ? 191 GLU A O   1 
ATOM 1414 C CB  . GLU A 1 191 ? -1.008  32.840 -20.070 1.00 47.15 ? 191 GLU A CB  1 
ATOM 1415 C CG  . GLU A 1 191 ? -0.759  31.344 -20.010 1.00 46.98 ? 191 GLU A CG  1 
ATOM 1416 C CD  . GLU A 1 191 ? -1.410  30.611 -21.158 1.00 48.10 ? 191 GLU A CD  1 
ATOM 1417 O OE1 . GLU A 1 191 ? -1.213  29.389 -21.237 1.00 50.71 ? 191 GLU A OE1 1 
ATOM 1418 O OE2 . GLU A 1 191 ? -2.106  31.238 -21.995 1.00 47.19 ? 191 GLU A OE2 1 
ATOM 1419 N N   . THR A 1 192 ? -2.616  33.676 -17.470 1.00 47.44 ? 192 THR A N   1 
ATOM 1420 C CA  . THR A 1 192 ? -3.031  33.469 -16.068 1.00 47.91 ? 192 THR A CA  1 
ATOM 1421 C C   . THR A 1 192 ? -4.509  33.111 -15.956 1.00 48.19 ? 192 THR A C   1 
ATOM 1422 O O   . THR A 1 192 ? -4.883  32.105 -15.354 1.00 48.09 ? 192 THR A O   1 
ATOM 1423 C CB  . THR A 1 192 ? -2.820  34.732 -15.219 1.00 47.57 ? 192 THR A CB  1 
ATOM 1424 O OG1 . THR A 1 192 ? -1.636  35.418 -15.631 1.00 48.01 ? 192 THR A OG1 1 
ATOM 1425 C CG2 . THR A 1 192 ? -2.705  34.383 -13.760 1.00 48.00 ? 192 THR A CG2 1 
ATOM 1426 N N   . ILE A 1 193 ? -5.343  33.953 -16.551 1.00 48.87 ? 193 ILE A N   1 
ATOM 1427 C CA  . ILE A 1 193 ? -6.785  33.750 -16.520 1.00 49.86 ? 193 ILE A CA  1 
ATOM 1428 C C   . ILE A 1 193 ? -7.139  32.510 -17.294 1.00 50.34 ? 193 ILE A C   1 
ATOM 1429 O O   . ILE A 1 193 ? -7.908  31.702 -16.822 1.00 50.54 ? 193 ILE A O   1 
ATOM 1430 C CB  . ILE A 1 193 ? -7.567  34.967 -17.088 1.00 49.86 ? 193 ILE A CB  1 
ATOM 1431 C CG1 . ILE A 1 193 ? -7.452  36.173 -16.135 1.00 49.37 ? 193 ILE A CG1 1 
ATOM 1432 C CG2 . ILE A 1 193 ? -9.022  34.587 -17.331 1.00 48.73 ? 193 ILE A CG2 1 
ATOM 1433 C CD1 . ILE A 1 193 ? -7.809  37.508 -16.768 1.00 50.84 ? 193 ILE A CD1 1 
ATOM 1434 N N   . GLN A 1 194 ? -6.562  32.380 -18.483 1.00 51.62 ? 194 GLN A N   1 
ATOM 1435 C CA  . GLN A 1 194 ? -6.772  31.235 -19.384 1.00 52.61 ? 194 GLN A CA  1 
ATOM 1436 C C   . GLN A 1 194 ? -6.508  29.893 -18.711 1.00 53.33 ? 194 GLN A C   1 
ATOM 1437 O O   . GLN A 1 194 ? -7.209  28.919 -18.959 1.00 53.64 ? 194 GLN A O   1 
ATOM 1438 C CB  . GLN A 1 194 ? -5.821  31.351 -20.579 1.00 52.64 ? 194 GLN A CB  1 
ATOM 1439 C CG  . GLN A 1 194 ? -6.103  30.396 -21.691 1.00 52.41 ? 194 GLN A CG  1 
ATOM 1440 C CD  . GLN A 1 194 ? -7.221  30.902 -22.553 1.00 53.86 ? 194 GLN A CD  1 
ATOM 1441 O OE1 . GLN A 1 194 ? -8.399  30.645 -22.275 1.00 55.16 ? 194 GLN A OE1 1 
ATOM 1442 N NE2 . GLN A 1 194 ? -6.872  31.655 -23.601 1.00 53.08 ? 194 GLN A NE2 1 
ATOM 1443 N N   . ARG A 1 195 ? -5.465  29.846 -17.889 1.00 54.16 ? 195 ARG A N   1 
ATOM 1444 C CA  . ARG A 1 195 ? -5.016  28.601 -17.286 1.00 55.05 ? 195 ARG A CA  1 
ATOM 1445 C C   . ARG A 1 195 ? -5.833  28.279 -16.039 1.00 55.32 ? 195 ARG A C   1 
ATOM 1446 O O   . ARG A 1 195 ? -5.974  27.109 -15.683 1.00 55.67 ? 195 ARG A O   1 
ATOM 1447 C CB  . ARG A 1 195 ? -3.525  28.684 -16.931 1.00 54.94 ? 195 ARG A CB  1 
ATOM 1448 C CG  . ARG A 1 195 ? -2.925  27.388 -16.403 1.00 56.60 ? 195 ARG A CG  1 
ATOM 1449 C CD  . ARG A 1 195 ? -1.451  27.547 -15.981 1.00 58.99 ? 195 ARG A CD  1 
ATOM 1450 N NE  . ARG A 1 195 ? -0.839  26.284 -15.535 1.00 59.33 ? 195 ARG A NE  1 
ATOM 1451 C CZ  . ARG A 1 195 ? 0.413   26.162 -15.080 1.00 60.77 ? 195 ARG A CZ  1 
ATOM 1452 N NH1 . ARG A 1 195 ? 1.220   27.222 -14.999 1.00 60.83 ? 195 ARG A NH1 1 
ATOM 1453 N NH2 . ARG A 1 195 ? 0.879   24.965 -14.716 1.00 62.22 ? 195 ARG A NH2 1 
ATOM 1454 N N   . PHE A 1 196 ? -6.372  29.299 -15.377 1.00 55.63 ? 196 PHE A N   1 
ATOM 1455 C CA  . PHE A 1 196 ? -7.008  29.078 -14.086 1.00 55.95 ? 196 PHE A CA  1 
ATOM 1456 C C   . PHE A 1 196 ? -8.485  29.453 -13.984 1.00 56.30 ? 196 PHE A C   1 
ATOM 1457 O O   . PHE A 1 196 ? -9.050  29.385 -12.879 1.00 56.68 ? 196 PHE A O   1 
ATOM 1458 C CB  . PHE A 1 196 ? -6.225  29.805 -13.006 1.00 56.19 ? 196 PHE A CB  1 
ATOM 1459 C CG  . PHE A 1 196 ? -4.847  29.249 -12.785 1.00 57.02 ? 196 PHE A CG  1 
ATOM 1460 C CD1 . PHE A 1 196 ? -4.669  28.013 -12.137 1.00 57.34 ? 196 PHE A CD1 1 
ATOM 1461 C CD2 . PHE A 1 196 ? -3.718  29.959 -13.206 1.00 56.48 ? 196 PHE A CD2 1 
ATOM 1462 C CE1 . PHE A 1 196 ? -3.390  27.492 -11.919 1.00 56.42 ? 196 PHE A CE1 1 
ATOM 1463 C CE2 . PHE A 1 196 ? -2.419  29.439 -12.994 1.00 56.14 ? 196 PHE A CE2 1 
ATOM 1464 C CZ  . PHE A 1 196 ? -2.260  28.209 -12.347 1.00 56.09 ? 196 PHE A CZ  1 
ATOM 1465 N N   . ALA A 1 197 ? -9.100  29.851 -15.110 1.00 56.30 ? 197 ALA A N   1 
ATOM 1466 C CA  . ALA A 1 197 ? -10.526 30.228 -15.168 1.00 56.17 ? 197 ALA A CA  1 
ATOM 1467 C C   . ALA A 1 197 ? -11.112 30.192 -16.602 1.00 56.48 ? 197 ALA A C   1 
ATOM 1468 O O   . ALA A 1 197 ? -11.439 29.092 -17.097 1.00 56.87 ? 197 ALA A O   1 
ATOM 1469 C CB  . ALA A 1 197 ? -10.751 31.592 -14.518 1.00 56.18 ? 197 ALA A CB  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   SER 3   3   ?   ?   ?   A . n 
A 1 4   ASN 4   4   ?   ?   ?   A . n 
A 1 5   THR 5   5   5   THR THR A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   SER 7   7   7   SER SER A . n 
A 1 8   SER 8   8   8   SER SER A . n 
A 1 9   PHE 9   9   9   PHE PHE A . n 
A 1 10  GLN 10  10  10  GLN GLN A . n 
A 1 11  VAL 11  11  11  VAL VAL A . n 
A 1 12  ASP 12  12  12  ASP ASP A . n 
A 1 13  CYS 13  13  13  CYS CYS A . n 
A 1 14  PHE 14  14  14  PHE PHE A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  TRP 16  16  16  TRP TRP A . n 
A 1 17  HIS 17  17  17  HIS HIS A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  PHE 22  22  22  PHE PHE A . n 
A 1 23  ALA 23  23  23  ALA ALA A . n 
A 1 24  ASP 24  24  24  ASP ASP A . n 
A 1 25  GLN 25  25  25  GLN GLN A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  GLY 28  28  28  GLY GLY A . n 
A 1 29  ASP 29  29  29  ASP ASP A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  PRO 31  31  31  PRO PRO A . n 
A 1 32  PHE 32  32  32  PHE PHE A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  ASP 34  34  34  ASP ASP A . n 
A 1 35  ARG 35  35  35  ARG ARG A . n 
A 1 36  LEU 36  36  36  LEU LEU A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  ASP 39  39  39  ASP ASP A . n 
A 1 40  GLN 40  40  40  GLN GLN A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  SER 42  42  42  SER SER A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  GLY 45  45  45  GLY GLY A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  ASN 48  48  48  ASN ASN A . n 
A 1 49  THR 49  49  49  THR THR A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  ILE 54  54  54  ILE ILE A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  THR 56  56  56  THR THR A . n 
A 1 57  ALA 57  57  57  ALA ALA A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  ARG 59  59  59  ARG ARG A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  LYS 62  62  62  LYS LYS A . n 
A 1 63  GLN 63  63  63  GLN GLN A . n 
A 1 64  ILE 64  64  64  ILE ILE A . n 
A 1 65  VAL 65  65  65  VAL VAL A . n 
A 1 66  GLU 66  66  66  GLU GLU A . n 
A 1 67  ARG 67  67  67  ARG ARG A . n 
A 1 68  ILE 68  68  68  ILE ILE A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  GLU 70  70  70  GLU GLU A . n 
A 1 71  GLY 71  71  71  GLY GLY A . n 
A 1 72  GLU 72  72  72  GLU GLU A . n 
A 1 73  SER 73  73  73  SER SER A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  LYS 75  75  ?   ?   ?   A . n 
A 1 76  ALA 76  76  ?   ?   ?   A . n 
A 1 77  LEU 77  77  ?   ?   ?   A . n 
A 1 78  LYS 78  78  ?   ?   ?   A . n 
A 1 79  MET 79  79  ?   ?   ?   A . n 
A 1 80  PRO 80  80  80  PRO PRO A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  ARG 83  83  83  ARG ARG A . n 
A 1 84  TYR 84  84  84  TYR TYR A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  THR 86  86  86  THR THR A . n 
A 1 87  ASP 87  87  87  ASP ASP A . n 
A 1 88  MET 88  88  88  MET MET A . n 
A 1 89  THR 89  89  89  THR THR A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  MET 93  93  93  MET MET A . n 
A 1 94  SER 94  94  94  SER SER A . n 
A 1 95  ARG 95  95  95  ARG ARG A . n 
A 1 96  ASP 96  96  96  ASP ASP A . n 
A 1 97  TRP 97  97  97  TRP TRP A . n 
A 1 98  PHE 98  98  98  PHE PHE A . n 
A 1 99  MET 99  99  99  MET MET A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 MET 101 101 101 MET MET A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 GLN 104 104 104 GLN GLN A . n 
A 1 105 LYS 105 105 105 LYS LYS A . n 
A 1 106 VAL 106 106 106 VAL VAL A . n 
A 1 107 ALA 107 107 107 ALA ALA A . n 
A 1 108 GLY 108 108 108 GLY GLY A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 CYS 111 111 111 CYS CYS A . n 
A 1 112 ILE 112 112 112 ILE ILE A . n 
A 1 113 LYS 113 113 113 LYS LYS A . n 
A 1 114 MET 114 114 114 MET MET A . n 
A 1 115 ASP 115 115 115 ASP ASP A . n 
A 1 116 GLN 116 116 116 GLN GLN A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 MET 119 119 119 MET MET A . n 
A 1 120 ASP 120 120 120 ASP ASP A . n 
A 1 121 LYS 121 121 121 LYS LYS A . n 
A 1 122 THR 122 122 122 THR THR A . n 
A 1 123 ILE 123 123 123 ILE ILE A . n 
A 1 124 ILE 124 124 124 ILE ILE A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 LYS 126 126 126 LYS LYS A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 ASN 128 128 128 ASN ASN A . n 
A 1 129 PHE 129 129 129 PHE PHE A . n 
A 1 130 SER 130 130 130 SER SER A . n 
A 1 131 VAL 131 131 131 VAL VAL A . n 
A 1 132 ILE 132 132 132 ILE ILE A . n 
A 1 133 PHE 133 133 133 PHE PHE A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 ARG 135 135 135 ARG ARG A . n 
A 1 136 LEU 136 136 136 LEU LEU A . n 
A 1 137 GLU 137 137 137 GLU GLU A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 LEU 139 139 139 LEU LEU A . n 
A 1 140 ILE 140 140 140 ILE ILE A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 LEU 142 142 142 LEU LEU A . n 
A 1 143 ARG 143 143 143 ARG ARG A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 PHE 145 145 145 PHE PHE A . n 
A 1 146 THR 146 146 146 THR THR A . n 
A 1 147 GLU 147 147 147 GLU GLU A . n 
A 1 148 GLU 148 148 148 GLU GLU A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 ALA 150 150 150 ALA ALA A . n 
A 1 151 ILE 151 151 151 ILE ILE A . n 
A 1 152 VAL 152 152 152 VAL VAL A . n 
A 1 153 GLY 153 153 153 GLY GLY A . n 
A 1 154 GLU 154 154 154 GLU GLU A . n 
A 1 155 ILE 155 155 155 ILE ILE A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 PRO 157 157 157 PRO PRO A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 PRO 159 159 159 PRO PRO A . n 
A 1 160 SER 160 160 160 SER SER A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 GLY 163 163 163 GLY GLY A . n 
A 1 164 HIS 164 164 164 HIS HIS A . n 
A 1 165 THR 165 165 165 THR THR A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 GLU 167 167 167 GLU GLU A . n 
A 1 168 ASP 168 168 168 ASP ASP A . n 
A 1 169 VAL 169 169 169 VAL VAL A . n 
A 1 170 LYS 170 170 170 LYS LYS A . n 
A 1 171 ASN 171 171 171 ASN ASN A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 ILE 173 173 173 ILE ILE A . n 
A 1 174 GLY 174 174 174 GLY GLY A . n 
A 1 175 VAL 175 175 175 VAL VAL A . n 
A 1 176 LEU 176 176 176 LEU LEU A . n 
A 1 177 ILE 177 177 177 ILE ILE A . n 
A 1 178 GLY 178 178 178 GLY GLY A . n 
A 1 179 GLY 179 179 179 GLY GLY A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 GLU 181 181 181 GLU GLU A . n 
A 1 182 TRP 182 182 182 TRP TRP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ASP 184 184 184 ASP ASP A . n 
A 1 185 ASN 185 185 185 ASN ASN A . n 
A 1 186 THR 186 186 186 THR THR A . n 
A 1 187 VAL 187 187 187 VAL VAL A . n 
A 1 188 ARG 188 188 188 ARG ARG A . n 
A 1 189 VAL 189 189 189 VAL VAL A . n 
A 1 190 THR 190 190 190 THR THR A . n 
A 1 191 GLU 191 191 191 GLU GLU A . n 
A 1 192 THR 192 192 192 THR THR A . n 
A 1 193 ILE 193 193 193 ILE ILE A . n 
A 1 194 GLN 194 194 194 GLN GLN A . n 
A 1 195 ARG 195 195 195 ARG ARG A . n 
A 1 196 PHE 196 196 196 PHE PHE A . n 
A 1 197 ALA 197 197 197 ALA ALA A . n 
A 1 198 TRP 198 198 ?   ?   ?   A . n 
A 1 199 ARG 199 199 ?   ?   ?   A . n 
A 1 200 ASN 200 200 ?   ?   ?   A . n 
A 1 201 SER 201 201 ?   ?   ?   A . n 
A 1 202 ASP 202 202 ?   ?   ?   A . n 
A 1 203 GLU 203 203 ?   ?   ?   A . n 
A 1 204 ASP 204 204 ?   ?   ?   A . n 
A 1 205 GLY 205 205 ?   ?   ?   A . n 
A 1 206 ARG 206 206 ?   ?   ?   A . n 
A 1 207 LEU 207 207 ?   ?   ?   A . n 
A 1 208 PRO 208 208 ?   ?   ?   A . n 
A 1 209 LEU 209 209 ?   ?   ?   A . n 
A 1 210 PRO 210 210 ?   ?   ?   A . n 
A 1 211 PRO 211 211 ?   ?   ?   A . n 
A 1 212 ASN 212 212 ?   ?   ?   A . n 
A 1 213 GLN 213 213 ?   ?   ?   A . n 
A 1 214 LYS 214 214 ?   ?   ?   A . n 
A 1 215 ARG 215 215 ?   ?   ?   A . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?    monomeric 1 
2 software_defined_assembly PISA dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A 
2 1,2 A 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 2350  ? 
2 MORE         -18   ? 
2 'SSA (A^2)'  21640 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z         1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 11_555 -x+y,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 34.8150000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-11-25 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2021-10-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Refinement description'    
3 2 'Structure model' 'Version format compliance' 
4 3 'Structure model' 'Database references'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' database_2         
2 3 'Structure model' struct_ref_seq_dif 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_database_2.pdbx_DOI'                
2 3 'Structure model' '_database_2.pdbx_database_accession' 
3 3 'Structure model' '_struct_ref_seq_dif.details'         
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         -6.8464 
_pdbx_refine_tls.origin_y         41.2618 
_pdbx_refine_tls.origin_z         -0.4336 
_pdbx_refine_tls.T[1][1]          -0.1575 
_pdbx_refine_tls.T[2][2]          -0.0493 
_pdbx_refine_tls.T[3][3]          -0.0743 
_pdbx_refine_tls.T[1][2]          0.0266 
_pdbx_refine_tls.T[1][3]          0.0636 
_pdbx_refine_tls.T[2][3]          0.0462 
_pdbx_refine_tls.L[1][1]          1.3788 
_pdbx_refine_tls.L[2][2]          0.7470 
_pdbx_refine_tls.L[3][3]          4.1167 
_pdbx_refine_tls.L[1][2]          0.6242 
_pdbx_refine_tls.L[1][3]          1.0676 
_pdbx_refine_tls.L[2][3]          0.6579 
_pdbx_refine_tls.S[1][1]          0.0227 
_pdbx_refine_tls.S[2][2]          0.0764 
_pdbx_refine_tls.S[3][3]          -0.0990 
_pdbx_refine_tls.S[1][2]          -0.1590 
_pdbx_refine_tls.S[1][3]          -0.2578 
_pdbx_refine_tls.S[2][3]          -0.1146 
_pdbx_refine_tls.S[2][1]          0.2347 
_pdbx_refine_tls.S[3][1]          0.5112 
_pdbx_refine_tls.S[3][2]          0.0715 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1  1 A 159 A 163 ? . . . . ? 
'X-RAY DIFFRACTION' 2  1 A 164 A 166 ? . . . . ? 
'X-RAY DIFFRACTION' 3  1 A 5   A 22  ? . . . . ? 
'X-RAY DIFFRACTION' 4  1 A 23  A 29  ? . . . . ? 
'X-RAY DIFFRACTION' 5  1 A 30  A 47  ? . . . . ? 
'X-RAY DIFFRACTION' 6  1 A 48  A 53  ? . . . . ? 
'X-RAY DIFFRACTION' 7  1 A 54  A 68  ? . . . . ? 
'X-RAY DIFFRACTION' 8  1 A 69  A 74  ? . . . . ? 
'X-RAY DIFFRACTION' 9  1 A 80  A 83  ? . . . . ? 
'X-RAY DIFFRACTION' 10 1 A 84  A 130 ? . . . . ? 
'X-RAY DIFFRACTION' 11 1 A 131 A 135 ? . . . . ? 
'X-RAY DIFFRACTION' 12 1 A 136 A 158 ? . . . . ? 
'X-RAY DIFFRACTION' 13 1 A 167 A 183 ? . . . . ? 
'X-RAY DIFFRACTION' 14 1 A 184 A 197 ? . . . . ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
d*TREK      .        ?               package 'Jim W. Pflugrath'   Jim.Pflugrath@Rigaku.com    'data scaling'    
http://www.rigaku.com/software/dtrek.html    ?          ? 1 
PHASER      .        ?               program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/  ?          ? 2 
REFMAC      5.2.0019 ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk       refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 3 
PDB_EXTRACT 3.006    'June 11, 2008' package PDB                  help@deposit.rcsb.org       'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN A 25  ? ? -125.99 -52.84  
2  1 GLU A 26  ? ? -70.16  -143.37 
3  1 ASP A 29  ? ? 147.92  142.98  
4  1 ILE A 54  ? ? -32.56  -35.97  
5  1 LEU A 69  ? ? -66.96  42.78   
6  1 GLU A 70  ? ? -161.58 118.35  
7  1 SER A 73  ? ? 34.75   54.32   
8  1 ARG A 83  ? ? -141.48 -153.27 
9  1 PHE A 133 ? ? 70.07   -118.79 
10 1 LEU A 141 ? ? -172.07 138.23  
11 1 ASN A 183 ? ? -86.40  30.95   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A GLN 63 ? CG  ? A GLN 63 CG  
2 1 Y 1 A GLN 63 ? CD  ? A GLN 63 CD  
3 1 Y 1 A GLN 63 ? OE1 ? A GLN 63 OE1 
4 1 Y 1 A GLN 63 ? NE2 ? A GLN 63 NE2 
5 1 Y 1 A ILE 68 ? CG1 ? A ILE 68 CG1 
6 1 Y 1 A ILE 68 ? CG2 ? A ILE 68 CG2 
7 1 Y 1 A ILE 68 ? CD1 ? A ILE 68 CD1 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A ASP 2   ? A ASP 2   
3  1 Y 1 A SER 3   ? A SER 3   
4  1 Y 1 A ASN 4   ? A ASN 4   
5  1 Y 1 A LYS 75  ? A LYS 75  
6  1 Y 1 A ALA 76  ? A ALA 76  
7  1 Y 1 A LEU 77  ? A LEU 77  
8  1 Y 1 A LYS 78  ? A LYS 78  
9  1 Y 1 A MET 79  ? A MET 79  
10 1 Y 1 A TRP 198 ? A TRP 198 
11 1 Y 1 A ARG 199 ? A ARG 199 
12 1 Y 1 A ASN 200 ? A ASN 200 
13 1 Y 1 A SER 201 ? A SER 201 
14 1 Y 1 A ASP 202 ? A ASP 202 
15 1 Y 1 A GLU 203 ? A GLU 203 
16 1 Y 1 A ASP 204 ? A ASP 204 
17 1 Y 1 A GLY 205 ? A GLY 205 
18 1 Y 1 A ARG 206 ? A ARG 206 
19 1 Y 1 A LEU 207 ? A LEU 207 
20 1 Y 1 A PRO 208 ? A PRO 208 
21 1 Y 1 A LEU 209 ? A LEU 209 
22 1 Y 1 A PRO 210 ? A PRO 210 
23 1 Y 1 A PRO 211 ? A PRO 211 
24 1 Y 1 A ASN 212 ? A ASN 212 
25 1 Y 1 A GLN 213 ? A GLN 213 
26 1 Y 1 A LYS 214 ? A LYS 214 
27 1 Y 1 A ARG 215 ? A ARG 215 
#