data_3F6K
# 
_entry.id   3F6K 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3F6K         
RCSB  RCSB050209   
WWPDB D_1000050209 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3F6K 
_pdbx_database_status.recvd_initial_deposition_date   2008-11-06 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Quistgaard, E.M.'  1 
'Madsen, P.'        2 
'Groftehauge, M.K.' 3 
'Nissen, P.'        4 
'Petersen, C.M.'    5 
'Thirup, S.'        6 
# 
_citation.id                        primary 
_citation.title                     'Ligands bind to Sortilin in the tunnel of a ten-bladed beta-propeller domain.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            16 
_citation.page_first                96 
_citation.page_last                 98 
_citation.year                      2009 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19122660 
_citation.pdbx_database_id_DOI      10.1038/nsmb.1543 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Quistgaard, E.M.'  1 ? 
primary 'Madsen, P.'        2 ? 
primary 'Groftehauge, M.K.' 3 ? 
primary 'Nissen, P.'        4 ? 
primary 'Petersen, C.M.'    5 ? 
primary 'Thirup, S.S.'      6 ? 
# 
_cell.entry_id           3F6K 
_cell.length_a           145.760 
_cell.length_b           74.530 
_cell.length_c           108.330 
_cell.angle_alpha        90.00 
_cell.angle_beta         131.87 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3F6K 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Sortilin               76774.703 1   ? ? 'UNP residues 78-756'  ? 
2 polymer     syn Neurotensin            1675.948  1   ? ? 'UNP residues 151-163' ? 
3 non-polymer man N-ACETYL-D-GLUCOSAMINE 221.208   4   ? ? ?                      ? 
4 non-polymer man BETA-D-MANNOSE         180.156   1   ? ? ?                      ? 
5 non-polymer syn 'TRIETHYLENE GLYCOL'   150.173   1   ? ? ?                      ? 
6 non-polymer syn GLYCEROL               92.094    1   ? ? ?                      ? 
7 water       nat water                  18.015    305 ? ? ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Neurotensin receptor 3, NTR3, NTS3, Glycoprotein 95, Gp95, 100 kDa NT receptor' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;SAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDI
TDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTEN
GLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASV
MADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTT
TGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMA
PLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCW
QTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILG
YKEQFLRLRKSSMCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRK
IPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSHHHHHH
;
;SAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDI
TDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTEN
GLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASV
MADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTT
TGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMA
PLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCW
QTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILG
YKEQFLRLRKSSMCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRK
IPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSHHHHHH
;
A ? 
2 'polypeptide(L)' no yes '(PCA)LYENKPRRPYIL' QLYENKPRRPYIL N ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ALA n 
1 3   PRO n 
1 4   GLY n 
1 5   GLU n 
1 6   ASP n 
1 7   GLU n 
1 8   GLU n 
1 9   CYS n 
1 10  GLY n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  ASP n 
1 15  PHE n 
1 16  VAL n 
1 17  ALA n 
1 18  LYS n 
1 19  LEU n 
1 20  ALA n 
1 21  ASN n 
1 22  ASN n 
1 23  THR n 
1 24  HIS n 
1 25  GLN n 
1 26  HIS n 
1 27  VAL n 
1 28  PHE n 
1 29  ASP n 
1 30  ASP n 
1 31  LEU n 
1 32  ARG n 
1 33  GLY n 
1 34  SER n 
1 35  VAL n 
1 36  SER n 
1 37  LEU n 
1 38  SER n 
1 39  TRP n 
1 40  VAL n 
1 41  GLY n 
1 42  ASP n 
1 43  SER n 
1 44  THR n 
1 45  GLY n 
1 46  VAL n 
1 47  ILE n 
1 48  LEU n 
1 49  VAL n 
1 50  LEU n 
1 51  THR n 
1 52  THR n 
1 53  PHE n 
1 54  HIS n 
1 55  VAL n 
1 56  PRO n 
1 57  LEU n 
1 58  VAL n 
1 59  ILE n 
1 60  MET n 
1 61  THR n 
1 62  PHE n 
1 63  GLY n 
1 64  GLN n 
1 65  SER n 
1 66  LYS n 
1 67  LEU n 
1 68  TYR n 
1 69  ARG n 
1 70  SER n 
1 71  GLU n 
1 72  ASP n 
1 73  TYR n 
1 74  GLY n 
1 75  LYS n 
1 76  ASN n 
1 77  PHE n 
1 78  LYS n 
1 79  ASP n 
1 80  ILE n 
1 81  THR n 
1 82  ASP n 
1 83  LEU n 
1 84  ILE n 
1 85  ASN n 
1 86  ASN n 
1 87  THR n 
1 88  PHE n 
1 89  ILE n 
1 90  ARG n 
1 91  THR n 
1 92  GLU n 
1 93  PHE n 
1 94  GLY n 
1 95  MET n 
1 96  ALA n 
1 97  ILE n 
1 98  GLY n 
1 99  PRO n 
1 100 GLU n 
1 101 ASN n 
1 102 SER n 
1 103 GLY n 
1 104 LYS n 
1 105 VAL n 
1 106 VAL n 
1 107 LEU n 
1 108 THR n 
1 109 ALA n 
1 110 GLU n 
1 111 VAL n 
1 112 SER n 
1 113 GLY n 
1 114 GLY n 
1 115 SER n 
1 116 ARG n 
1 117 GLY n 
1 118 GLY n 
1 119 ARG n 
1 120 ILE n 
1 121 PHE n 
1 122 ARG n 
1 123 SER n 
1 124 SER n 
1 125 ASP n 
1 126 PHE n 
1 127 ALA n 
1 128 LYS n 
1 129 ASN n 
1 130 PHE n 
1 131 VAL n 
1 132 GLN n 
1 133 THR n 
1 134 ASP n 
1 135 LEU n 
1 136 PRO n 
1 137 PHE n 
1 138 HIS n 
1 139 PRO n 
1 140 LEU n 
1 141 THR n 
1 142 GLN n 
1 143 MET n 
1 144 MET n 
1 145 TYR n 
1 146 SER n 
1 147 PRO n 
1 148 GLN n 
1 149 ASN n 
1 150 SER n 
1 151 ASP n 
1 152 TYR n 
1 153 LEU n 
1 154 LEU n 
1 155 ALA n 
1 156 LEU n 
1 157 SER n 
1 158 THR n 
1 159 GLU n 
1 160 ASN n 
1 161 GLY n 
1 162 LEU n 
1 163 TRP n 
1 164 VAL n 
1 165 SER n 
1 166 LYS n 
1 167 ASN n 
1 168 PHE n 
1 169 GLY n 
1 170 GLY n 
1 171 LYS n 
1 172 TRP n 
1 173 GLU n 
1 174 GLU n 
1 175 ILE n 
1 176 HIS n 
1 177 LYS n 
1 178 ALA n 
1 179 VAL n 
1 180 CYS n 
1 181 LEU n 
1 182 ALA n 
1 183 LYS n 
1 184 TRP n 
1 185 GLY n 
1 186 SER n 
1 187 ASP n 
1 188 ASN n 
1 189 THR n 
1 190 ILE n 
1 191 PHE n 
1 192 PHE n 
1 193 THR n 
1 194 THR n 
1 195 TYR n 
1 196 ALA n 
1 197 ASN n 
1 198 GLY n 
1 199 SER n 
1 200 CYS n 
1 201 LYS n 
1 202 ALA n 
1 203 ASP n 
1 204 LEU n 
1 205 GLY n 
1 206 ALA n 
1 207 LEU n 
1 208 GLU n 
1 209 LEU n 
1 210 TRP n 
1 211 ARG n 
1 212 THR n 
1 213 SER n 
1 214 ASP n 
1 215 LEU n 
1 216 GLY n 
1 217 LYS n 
1 218 SER n 
1 219 PHE n 
1 220 LYS n 
1 221 THR n 
1 222 ILE n 
1 223 GLY n 
1 224 VAL n 
1 225 LYS n 
1 226 ILE n 
1 227 TYR n 
1 228 SER n 
1 229 PHE n 
1 230 GLY n 
1 231 LEU n 
1 232 GLY n 
1 233 GLY n 
1 234 ARG n 
1 235 PHE n 
1 236 LEU n 
1 237 PHE n 
1 238 ALA n 
1 239 SER n 
1 240 VAL n 
1 241 MET n 
1 242 ALA n 
1 243 ASP n 
1 244 LYS n 
1 245 ASP n 
1 246 THR n 
1 247 THR n 
1 248 ARG n 
1 249 ARG n 
1 250 ILE n 
1 251 HIS n 
1 252 VAL n 
1 253 SER n 
1 254 THR n 
1 255 ASP n 
1 256 GLN n 
1 257 GLY n 
1 258 ASP n 
1 259 THR n 
1 260 TRP n 
1 261 SER n 
1 262 MET n 
1 263 ALA n 
1 264 GLN n 
1 265 LEU n 
1 266 PRO n 
1 267 SER n 
1 268 VAL n 
1 269 GLY n 
1 270 GLN n 
1 271 GLU n 
1 272 GLN n 
1 273 PHE n 
1 274 TYR n 
1 275 SER n 
1 276 ILE n 
1 277 LEU n 
1 278 ALA n 
1 279 ALA n 
1 280 ASN n 
1 281 ASP n 
1 282 ASP n 
1 283 MET n 
1 284 VAL n 
1 285 PHE n 
1 286 MET n 
1 287 HIS n 
1 288 VAL n 
1 289 ASP n 
1 290 GLU n 
1 291 PRO n 
1 292 GLY n 
1 293 ASP n 
1 294 THR n 
1 295 GLY n 
1 296 PHE n 
1 297 GLY n 
1 298 THR n 
1 299 ILE n 
1 300 PHE n 
1 301 THR n 
1 302 SER n 
1 303 ASP n 
1 304 ASP n 
1 305 ARG n 
1 306 GLY n 
1 307 ILE n 
1 308 VAL n 
1 309 TYR n 
1 310 SER n 
1 311 LYS n 
1 312 SER n 
1 313 LEU n 
1 314 ASP n 
1 315 ARG n 
1 316 HIS n 
1 317 LEU n 
1 318 TYR n 
1 319 THR n 
1 320 THR n 
1 321 THR n 
1 322 GLY n 
1 323 GLY n 
1 324 GLU n 
1 325 THR n 
1 326 ASP n 
1 327 PHE n 
1 328 THR n 
1 329 ASN n 
1 330 VAL n 
1 331 THR n 
1 332 SER n 
1 333 LEU n 
1 334 ARG n 
1 335 GLY n 
1 336 VAL n 
1 337 TYR n 
1 338 ILE n 
1 339 THR n 
1 340 SER n 
1 341 VAL n 
1 342 LEU n 
1 343 SER n 
1 344 GLU n 
1 345 ASP n 
1 346 ASN n 
1 347 SER n 
1 348 ILE n 
1 349 GLN n 
1 350 THR n 
1 351 MET n 
1 352 ILE n 
1 353 THR n 
1 354 PHE n 
1 355 ASP n 
1 356 GLN n 
1 357 GLY n 
1 358 GLY n 
1 359 ARG n 
1 360 TRP n 
1 361 THR n 
1 362 HIS n 
1 363 LEU n 
1 364 ARG n 
1 365 LYS n 
1 366 PRO n 
1 367 GLU n 
1 368 ASN n 
1 369 SER n 
1 370 GLU n 
1 371 CYS n 
1 372 ASP n 
1 373 ALA n 
1 374 THR n 
1 375 ALA n 
1 376 LYS n 
1 377 ASN n 
1 378 LYS n 
1 379 ASN n 
1 380 GLU n 
1 381 CYS n 
1 382 SER n 
1 383 LEU n 
1 384 HIS n 
1 385 ILE n 
1 386 HIS n 
1 387 ALA n 
1 388 SER n 
1 389 TYR n 
1 390 SER n 
1 391 ILE n 
1 392 SER n 
1 393 GLN n 
1 394 LYS n 
1 395 LEU n 
1 396 ASN n 
1 397 VAL n 
1 398 PRO n 
1 399 MET n 
1 400 ALA n 
1 401 PRO n 
1 402 LEU n 
1 403 SER n 
1 404 GLU n 
1 405 PRO n 
1 406 ASN n 
1 407 ALA n 
1 408 VAL n 
1 409 GLY n 
1 410 ILE n 
1 411 VAL n 
1 412 ILE n 
1 413 ALA n 
1 414 HIS n 
1 415 GLY n 
1 416 SER n 
1 417 VAL n 
1 418 GLY n 
1 419 ASP n 
1 420 ALA n 
1 421 ILE n 
1 422 SER n 
1 423 VAL n 
1 424 MET n 
1 425 VAL n 
1 426 PRO n 
1 427 ASP n 
1 428 VAL n 
1 429 TYR n 
1 430 ILE n 
1 431 SER n 
1 432 ASP n 
1 433 ASP n 
1 434 GLY n 
1 435 GLY n 
1 436 TYR n 
1 437 SER n 
1 438 TRP n 
1 439 THR n 
1 440 LYS n 
1 441 MET n 
1 442 LEU n 
1 443 GLU n 
1 444 GLY n 
1 445 PRO n 
1 446 HIS n 
1 447 TYR n 
1 448 TYR n 
1 449 THR n 
1 450 ILE n 
1 451 LEU n 
1 452 ASP n 
1 453 SER n 
1 454 GLY n 
1 455 GLY n 
1 456 ILE n 
1 457 ILE n 
1 458 VAL n 
1 459 ALA n 
1 460 ILE n 
1 461 GLU n 
1 462 HIS n 
1 463 SER n 
1 464 SER n 
1 465 ARG n 
1 466 PRO n 
1 467 ILE n 
1 468 ASN n 
1 469 VAL n 
1 470 ILE n 
1 471 LYS n 
1 472 PHE n 
1 473 SER n 
1 474 THR n 
1 475 ASP n 
1 476 GLU n 
1 477 GLY n 
1 478 GLN n 
1 479 CYS n 
1 480 TRP n 
1 481 GLN n 
1 482 THR n 
1 483 TYR n 
1 484 THR n 
1 485 PHE n 
1 486 THR n 
1 487 ARG n 
1 488 ASP n 
1 489 PRO n 
1 490 ILE n 
1 491 TYR n 
1 492 PHE n 
1 493 THR n 
1 494 GLY n 
1 495 LEU n 
1 496 ALA n 
1 497 SER n 
1 498 GLU n 
1 499 PRO n 
1 500 GLY n 
1 501 ALA n 
1 502 ARG n 
1 503 SER n 
1 504 MET n 
1 505 ASN n 
1 506 ILE n 
1 507 SER n 
1 508 ILE n 
1 509 TRP n 
1 510 GLY n 
1 511 PHE n 
1 512 THR n 
1 513 GLU n 
1 514 SER n 
1 515 PHE n 
1 516 LEU n 
1 517 THR n 
1 518 SER n 
1 519 GLN n 
1 520 TRP n 
1 521 VAL n 
1 522 SER n 
1 523 TYR n 
1 524 THR n 
1 525 ILE n 
1 526 ASP n 
1 527 PHE n 
1 528 LYS n 
1 529 ASP n 
1 530 ILE n 
1 531 LEU n 
1 532 GLU n 
1 533 ARG n 
1 534 ASN n 
1 535 CYS n 
1 536 GLU n 
1 537 GLU n 
1 538 LYS n 
1 539 ASP n 
1 540 TYR n 
1 541 THR n 
1 542 ILE n 
1 543 TRP n 
1 544 LEU n 
1 545 ALA n 
1 546 HIS n 
1 547 SER n 
1 548 THR n 
1 549 ASP n 
1 550 PRO n 
1 551 GLU n 
1 552 ASP n 
1 553 TYR n 
1 554 GLU n 
1 555 ASP n 
1 556 GLY n 
1 557 CYS n 
1 558 ILE n 
1 559 LEU n 
1 560 GLY n 
1 561 TYR n 
1 562 LYS n 
1 563 GLU n 
1 564 GLN n 
1 565 PHE n 
1 566 LEU n 
1 567 ARG n 
1 568 LEU n 
1 569 ARG n 
1 570 LYS n 
1 571 SER n 
1 572 SER n 
1 573 MET n 
1 574 CYS n 
1 575 GLN n 
1 576 ASN n 
1 577 GLY n 
1 578 ARG n 
1 579 ASP n 
1 580 TYR n 
1 581 VAL n 
1 582 VAL n 
1 583 THR n 
1 584 LYS n 
1 585 GLN n 
1 586 PRO n 
1 587 SER n 
1 588 ILE n 
1 589 CYS n 
1 590 LEU n 
1 591 CYS n 
1 592 SER n 
1 593 LEU n 
1 594 GLU n 
1 595 ASP n 
1 596 PHE n 
1 597 LEU n 
1 598 CYS n 
1 599 ASP n 
1 600 PHE n 
1 601 GLY n 
1 602 TYR n 
1 603 TYR n 
1 604 ARG n 
1 605 PRO n 
1 606 GLU n 
1 607 ASN n 
1 608 ASP n 
1 609 SER n 
1 610 LYS n 
1 611 CYS n 
1 612 VAL n 
1 613 GLU n 
1 614 GLN n 
1 615 PRO n 
1 616 GLU n 
1 617 LEU n 
1 618 LYS n 
1 619 GLY n 
1 620 HIS n 
1 621 ASP n 
1 622 LEU n 
1 623 GLU n 
1 624 PHE n 
1 625 CYS n 
1 626 LEU n 
1 627 TYR n 
1 628 GLY n 
1 629 ARG n 
1 630 GLU n 
1 631 GLU n 
1 632 HIS n 
1 633 LEU n 
1 634 THR n 
1 635 THR n 
1 636 ASN n 
1 637 GLY n 
1 638 TYR n 
1 639 ARG n 
1 640 LYS n 
1 641 ILE n 
1 642 PRO n 
1 643 GLY n 
1 644 ASP n 
1 645 LYS n 
1 646 CYS n 
1 647 GLN n 
1 648 GLY n 
1 649 GLY n 
1 650 VAL n 
1 651 ASN n 
1 652 PRO n 
1 653 VAL n 
1 654 ARG n 
1 655 GLU n 
1 656 VAL n 
1 657 LYS n 
1 658 ASP n 
1 659 LEU n 
1 660 LYS n 
1 661 LYS n 
1 662 LYS n 
1 663 CYS n 
1 664 THR n 
1 665 SER n 
1 666 ASN n 
1 667 PHE n 
1 668 LEU n 
1 669 SER n 
1 670 PRO n 
1 671 GLU n 
1 672 LYS n 
1 673 GLN n 
1 674 ASN n 
1 675 SER n 
1 676 LYS n 
1 677 SER n 
1 678 ASN n 
1 679 SER n 
1 680 HIS n 
1 681 HIS n 
1 682 HIS n 
1 683 HIS n 
1 684 HIS n 
1 685 HIS n 
2 1   PCA n 
2 2   LEU n 
2 3   TYR n 
2 4   GLU n 
2 5   ASN n 
2 6   LYS n 
2 7   PRO n 
2 8   ARG n 
2 9   ARG n 
2 10  PRO n 
2 11  TYR n 
2 12  ILE n 
2 13  LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 SORT1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Cricetulus griseus' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     10029 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               CHO-K1 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                
;Synthetic peptide purchased from Sigma. It represents the naturally occurring form of neurotensin in human, residues 151-163 of UniProt entry P30990, NEUT_HUMAN
;
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP SORT_HUMAN Q99523 1 
;SAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDI
TDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTEN
GLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASV
MADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTT
TGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMA
PLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCW
QTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILG
YKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRK
IPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNS
;
78  ? 
2 UNP NEUT_HUMAN P30990 2 QLYENKPRRPYIL 151 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3F6K A 1 ? 679 ? Q99523 78  ? 756 ? 45 723 
2 2 3F6K N 1 ? 13  ? P30990 151 ? 163 ? 1  13  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3F6K MET A 573 ? UNP Q99523 VAL 650 variant          617 1 
1 3F6K HIS A 680 ? UNP Q99523 ?   ?   'expression tag' 724 2 
1 3F6K HIS A 681 ? UNP Q99523 ?   ?   'expression tag' 725 3 
1 3F6K HIS A 682 ? UNP Q99523 ?   ?   'expression tag' 726 4 
1 3F6K HIS A 683 ? UNP Q99523 ?   ?   'expression tag' 727 5 
1 3F6K HIS A 684 ? UNP Q99523 ?   ?   'expression tag' 728 6 
1 3F6K HIS A 685 ? UNP Q99523 ?   ?   'expression tag' 729 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE               ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE             ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'        ?                               'C4 H7 N O4'     133.103 
BMA D-saccharide        . BETA-D-MANNOSE         ?                               'C6 H12 O6'      180.156 
CYS 'L-peptide linking' y CYSTEINE               ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE              ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'        ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL               'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE              ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                  ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE             ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                 ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE             ?                               'C5 H11 N O2 S'  149.211 
NAG D-saccharide        . N-ACETYL-D-GLUCOSAMINE ?                               'C8 H15 N O6'    221.208 
PCA 'L-peptide linking' n 'PYROGLUTAMIC ACID'    ?                               'C5 H7 N O3'     129.114 
PGE non-polymer         . 'TRIETHYLENE GLYCOL'   ?                               'C6 H14 O4'      150.173 
PHE 'L-peptide linking' y PHENYLALANINE          ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                 ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE              ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN             ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE               ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                 ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3F6K 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.79 
_exptl_crystal.density_percent_sol   55.96 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.8 
_exptl_crystal_grow.pdbx_details    
'19% PEG 6000, 600 mM NaCl, 3% Glycerol, 100 mM HEPES, 93 mM Tris-HCl, pH 7.8, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2005-10-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Fixed-exit LN2 cooled double crystal' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.95008 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.95008 
# 
_reflns.entry_id                     3F6K 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.00 
_reflns.number_obs                   56985 
_reflns.number_all                   58793 
_reflns.percent_possible_obs         96.9 
_reflns.pdbx_Rmerge_I_obs            0.073 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.59 
_reflns.B_iso_Wilson_estimate        37.05 
_reflns.pdbx_redundancy              3.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.10 
_reflns_shell.percent_possible_all   98.8 
_reflns_shell.Rmerge_I_obs           0.440 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.32 
_reflns_shell.pdbx_redundancy        3.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      7942 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3F6K 
_refine.ls_number_reflns_obs                     56985 
_refine.ls_number_reflns_all                     56985 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.32 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    97.39 
_refine.ls_R_factor_obs                          0.20524 
_refine.ls_R_factor_all                          0.20524 
_refine.ls_R_factor_R_work                       0.20395 
_refine.ls_R_factor_R_free                       0.22879 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2904 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.947 
_refine.correlation_coeff_Fo_to_Fc_free          0.941 
_refine.B_iso_mean                               31.780 
_refine.aniso_B[1][1]                            -0.58 
_refine.aniso_B[2][2]                            1.22 
_refine.aniso_B[3][3]                            -1.67 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.78 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIRAS 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.176 
_refine.pdbx_overall_ESU_R_Free                  0.151 
_refine.overall_SU_ML                            0.110 
_refine.overall_SU_B                             7.610 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5212 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         83 
_refine_hist.number_atoms_solvent             305 
_refine_hist.number_atoms_total               5600 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        40.32 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.021  0.022  ? 5428 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.832  1.960  ? 7357 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   7.053  5.000  ? 658  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   35.684 24.160 ? 250  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   16.770 15.000 ? 890  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   22.079 15.000 ? 28   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.137  0.200  ? 808  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.009  0.020  ? 4092 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.238  0.200  ? 2229 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.319  0.200  ? 3763 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.268  0.200  ? 372  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.223  0.200  ? 54   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.235  0.200  ? 13   'X-RAY DIFFRACTION' ? 
r_mcbond_it              1.446  1.500  ? 3359 'X-RAY DIFFRACTION' ? 
r_mcangle_it             2.290  2.000  ? 5288 'X-RAY DIFFRACTION' ? 
r_scbond_it              3.273  3.000  ? 2370 'X-RAY DIFFRACTION' ? 
r_scangle_it             4.816  4.500  ? 2069 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.000 
_refine_ls_shell.d_res_low                        2.052 
_refine_ls_shell.number_reflns_R_work             4048 
_refine_ls_shell.R_factor_R_work                  0.224 
_refine_ls_shell.percent_reflns_obs               99.12 
_refine_ls_shell.R_factor_R_free                  0.257 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             218 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3F6K 
_struct.title                     'Crystal structure of the Vps10p domain of human sortilin/NTS3 in complex with neurotensin' 
_struct.pdbx_descriptor           'Sortilin, Neurotensin' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3F6K 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
;PROTEIN SORTING RECEPTOR, 10-bladed beta-propeller, Cys-rich domains, sSortilin, sortilin Vps10p-D, protein-peptide complex, Developmental protein, Differentiation, Endocytosis, Endoplasmic reticulum, Endosome, Glycoprotein, Golgi apparatus, Lysosome, Membrane, Phosphoprotein, Receptor, Transmembrane, Transport, Cytoplasmic vesicle, Secreted, SIGNALING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 6 ? 
J N N 7 ? 
K N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'THE BIOLOGICAL UNIT IS A HETERODIMERIC COMPLEX OF THE PROTEIN MONOMER WITH THE PEPTIDE MONOMER.' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 14  ? ASN A 21  ? ASP A 58  ASN A 65  1 ? 8  
HELX_P HELX_P2  2  THR A 81  ? ASN A 85  ? THR A 125 ASN A 129 5 ? 5  
HELX_P HELX_P3  3  ARG A 90  ? PHE A 93  ? ARG A 134 PHE A 137 5 ? 4  
HELX_P HELX_P4  4  ALA A 387 ? GLN A 393 ? ALA A 431 GLN A 437 1 ? 7  
HELX_P HELX_P5  5  ASP A 452 ? GLY A 455 ? ASP A 496 GLY A 499 5 ? 4  
HELX_P HELX_P6  6  LYS A 528 ? ILE A 530 ? LYS A 572 ILE A 574 5 ? 3  
HELX_P HELX_P7  7  GLU A 536 ? LYS A 538 ? GLU A 580 LYS A 582 5 ? 3  
HELX_P HELX_P8  8  SER A 592 ? GLU A 594 ? SER A 636 GLU A 638 5 ? 3  
HELX_P HELX_P9  9  LYS A 618 ? GLY A 628 ? LYS A 662 GLY A 672 1 ? 11 
HELX_P HELX_P10 10 ARG A 629 ? LEU A 633 ? ARG A 673 LEU A 677 1 ? 5  
HELX_P HELX_P11 11 LEU A 659 ? THR A 664 ? LEU A 703 THR A 708 1 ? 6  
HELX_P HELX_P12 12 SER A 665 ? PHE A 667 ? SER A 709 PHE A 711 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ?    ? A CYS 180 SG  ? ? ? 1_555 A CYS 200 SG ? ? A CYS 224 A CYS 244 1_555 ? ? ? ? ? ? ? 2.076 ? 
disulf2 disulf ?    ? A CYS 371 SG  ? ? ? 1_555 A CYS 381 SG ? ? A CYS 415 A CYS 425 1_555 ? ? ? ? ? ? ? 2.078 ? 
disulf3 disulf ?    ? A CYS 535 SG  ? ? ? 1_555 A CYS 574 SG ? ? A CYS 579 A CYS 618 1_555 ? ? ? ? ? ? ? 2.153 ? 
disulf4 disulf ?    ? A CYS 557 SG  ? ? ? 1_555 A CYS 589 SG ? ? A CYS 601 A CYS 633 1_555 ? ? ? ? ? ? ? 2.049 ? 
disulf5 disulf ?    ? A CYS 591 SG  ? ? ? 1_555 A CYS 646 SG ? ? A CYS 635 A CYS 690 1_555 ? ? ? ? ? ? ? 2.116 ? 
disulf6 disulf ?    ? A CYS 598 SG  ? ? ? 1_555 A CYS 611 SG ? ? A CYS 642 A CYS 655 1_555 ? ? ? ? ? ? ? 2.074 ? 
disulf7 disulf ?    ? A CYS 625 SG  ? ? ? 1_555 A CYS 663 SG ? ? A CYS 669 A CYS 707 1_555 ? ? ? ? ? ? ? 2.741 ? 
covale1 covale one  ? A ASN 329 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 373 A NAG 801 1_555 ? ? ? ? ? ? ? 1.463 ? 
covale2 covale one  ? A ASN 505 ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 549 A NAG 901 1_555 ? ? ? ? ? ? ? 1.447 ? 
covale3 covale both ? C NAG .   O4  ? ? ? 1_555 D NAG .   C1 ? ? A NAG 801 A NAG 802 1_555 ? ? ? ? ? ? ? 1.446 ? 
covale4 covale both ? E NAG .   O4  ? ? ? 1_555 F NAG .   C1 ? ? A NAG 901 A NAG 902 1_555 ? ? ? ? ? ? ? 1.443 ? 
covale5 covale both ? F NAG .   O4  ? ? ? 1_555 G BMA .   C1 ? ? A NAG 902 A BMA 903 1_555 ? ? ? ? ? ? ? 1.468 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
E ? 7 ? 
F ? 5 ? 
G ? 8 ? 
H ? 4 ? 
I ? 3 ? 
J ? 2 ? 
K ? 2 ? 
L ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
E 5 6 ? anti-parallel 
E 6 7 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? anti-parallel 
G 6 7 ? anti-parallel 
G 7 8 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 23  ? PHE A 28  ? THR A 67  PHE A 72  
A 2 SER A 518 ? ASP A 526 ? SER A 562 ASP A 570 
A 3 ASN A 505 ? GLU A 513 ? ASN A 549 GLU A 557 
A 4 TYR A 491 ? ALA A 496 ? TYR A 535 ALA A 540 
B 1 SER A 34  ? TRP A 39  ? SER A 78  TRP A 83  
B 2 ILE A 47  ? PHE A 53  ? ILE A 91  PHE A 97  
B 3 GLN A 64  ? SER A 70  ? GLN A 108 SER A 114 
B 4 LYS A 78  ? ASP A 79  ? LYS A 122 ASP A 123 
C 1 MET A 95  ? ILE A 97  ? MET A 139 ILE A 141 
C 2 VAL A 105 ? ALA A 109 ? VAL A 149 ALA A 153 
C 3 ARG A 119 ? SER A 123 ? ARG A 163 SER A 167 
C 4 VAL A 131 ? ASP A 134 ? VAL A 175 ASP A 178 
D 1 MET A 144 ? SER A 146 ? MET A 188 SER A 190 
D 2 ASN A 149 ? LEU A 156 ? ASN A 193 LEU A 200 
D 3 LEU A 162 ? SER A 165 ? LEU A 206 SER A 209 
D 4 TRP A 172 ? HIS A 176 ? TRP A 216 HIS A 220 
E 1 VAL A 179 ? TRP A 184 ? VAL A 223 TRP A 228 
E 2 ILE A 190 ? THR A 194 ? ILE A 234 THR A 238 
E 3 LEU A 207 ? THR A 212 ? LEU A 251 THR A 256 
E 4 LYS A 220 ? GLY A 232 ? LYS A 264 GLY A 276 
E 5 PHE A 235 ? MET A 241 ? PHE A 279 MET A 285 
E 6 ARG A 248 ? SER A 253 ? ARG A 292 SER A 297 
E 7 SER A 261 ? MET A 262 ? SER A 305 MET A 306 
F 1 TYR A 309 ? LEU A 317 ? TYR A 353 LEU A 361 
F 2 PHE A 296 ? SER A 302 ? PHE A 340 SER A 346 
F 3 VAL A 284 ? ASP A 289 ? VAL A 328 ASP A 333 
F 4 TYR A 274 ? ALA A 279 ? TYR A 318 ALA A 323 
F 5 TYR B 11  ? ILE B 12  ? TYR N 11  ILE N 12  
G 1 THR A 328 ? ASN A 329 ? THR A 372 ASN A 373 
G 2 TYR A 337 ? LEU A 342 ? TYR A 381 LEU A 386 
G 3 ILE A 348 ? THR A 353 ? ILE A 392 THR A 397 
G 4 THR A 361 ? ARG A 364 ? THR A 405 ARG A 408 
G 5 SER A 382 ? ILE A 385 ? SER A 426 ILE A 429 
G 6 VAL A 411 ? GLY A 418 ? VAL A 455 GLY A 462 
G 7 ASP A 427 ? SER A 431 ? ASP A 471 SER A 475 
G 8 THR A 439 ? LEU A 442 ? THR A 483 LEU A 486 
H 1 HIS A 446 ? LEU A 451 ? HIS A 490 LEU A 495 
H 2 ILE A 456 ? GLU A 461 ? ILE A 500 GLU A 505 
H 3 VAL A 469 ? SER A 473 ? VAL A 513 SER A 517 
H 4 GLN A 481 ? THR A 484 ? GLN A 525 THR A 528 
I 1 TYR A 540 ? LEU A 544 ? TYR A 584 LEU A 588 
I 2 TYR A 561 ? LEU A 568 ? TYR A 605 LEU A 612 
I 3 LYS A 584 ? ILE A 588 ? LYS A 628 ILE A 632 
J 1 PHE A 596 ? CYS A 598 ? PHE A 640 CYS A 642 
J 2 TYR A 638 ? LYS A 640 ? TYR A 682 LYS A 684 
K 1 TYR A 602 ? TYR A 603 ? TYR A 646 TYR A 647 
K 2 VAL A 612 ? GLU A 613 ? VAL A 656 GLU A 657 
L 1 THR A 634 ? THR A 635 ? THR A 678 THR A 679 
L 2 LYS A 657 ? ASP A 658 ? LYS A 701 ASP A 702 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N HIS A 24  ? N HIS A 68  O THR A 524 ? O THR A 568 
A 2 3 O TYR A 523 ? O TYR A 567 N ILE A 508 ? N ILE A 552 
A 3 4 O TRP A 509 ? O TRP A 553 N GLY A 494 ? N GLY A 538 
B 1 2 N SER A 36  ? N SER A 80  O LEU A 50  ? O LEU A 94  
B 2 3 N VAL A 49  ? N VAL A 93  O TYR A 68  ? O TYR A 112 
B 3 4 N ARG A 69  ? N ARG A 113 O LYS A 78  ? O LYS A 122 
C 1 2 N ALA A 96  ? N ALA A 140 O VAL A 106 ? O VAL A 150 
C 2 3 N ALA A 109 ? N ALA A 153 O ARG A 119 ? O ARG A 163 
C 3 4 N ILE A 120 ? N ILE A 164 O THR A 133 ? O THR A 177 
D 1 2 N SER A 146 ? N SER A 190 O TYR A 152 ? O TYR A 196 
D 2 3 N ALA A 155 ? N ALA A 199 O TRP A 163 ? O TRP A 207 
D 3 4 N LEU A 162 ? N LEU A 206 O HIS A 176 ? O HIS A 220 
E 1 2 N LYS A 183 ? N LYS A 227 O PHE A 191 ? O PHE A 235 
E 2 3 N PHE A 192 ? N PHE A 236 O TRP A 210 ? O TRP A 254 
E 3 4 N ARG A 211 ? N ARG A 255 O LYS A 220 ? O LYS A 264 
E 4 5 N GLY A 230 ? N GLY A 274 O PHE A 237 ? O PHE A 281 
E 5 6 N VAL A 240 ? N VAL A 284 O ARG A 249 ? O ARG A 293 
E 6 7 N VAL A 252 ? N VAL A 296 O SER A 261 ? O SER A 305 
F 1 2 O SER A 312 ? O SER A 356 N ILE A 299 ? N ILE A 343 
F 2 3 O PHE A 300 ? O PHE A 344 N MET A 286 ? N MET A 330 
F 3 4 O HIS A 287 ? O HIS A 331 N SER A 275 ? N SER A 319 
F 4 5 N ILE A 276 ? N ILE A 320 O TYR B 11  ? O TYR N 11  
G 1 2 N THR A 328 ? N THR A 372 O ILE A 338 ? O ILE A 382 
G 2 3 N VAL A 341 ? N VAL A 385 O GLN A 349 ? O GLN A 393 
G 3 4 N ILE A 352 ? N ILE A 396 O THR A 361 ? O THR A 405 
G 4 5 N LEU A 363 ? N LEU A 407 O LEU A 383 ? O LEU A 427 
G 5 6 N SER A 382 ? N SER A 426 O GLY A 418 ? O GLY A 462 
G 6 7 N ALA A 413 ? N ALA A 457 O TYR A 429 ? O TYR A 473 
G 7 8 N VAL A 428 ? N VAL A 472 O MET A 441 ? O MET A 485 
H 1 2 N LEU A 451 ? N LEU A 495 O ILE A 456 ? O ILE A 500 
H 2 3 N ALA A 459 ? N ALA A 503 O LYS A 471 ? O LYS A 515 
H 3 4 N ILE A 470 ? N ILE A 514 O TYR A 483 ? O TYR A 527 
I 1 2 N TRP A 543 ? N TRP A 587 O PHE A 565 ? O PHE A 609 
I 2 3 N LYS A 562 ? N LYS A 606 O SER A 587 ? O SER A 631 
J 1 2 N LEU A 597 ? N LEU A 641 O ARG A 639 ? O ARG A 683 
K 1 2 N TYR A 603 ? N TYR A 647 O VAL A 612 ? O VAL A 656 
L 1 2 N THR A 635 ? N THR A 679 O LYS A 657 ? O LYS A 701 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE NAG A 801' 
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NAG A 802' 
AC3 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE NAG A 901' 
AC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE NAG A 902' 
AC5 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE BMA A 903' 
AC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE PGE A 951' 
AC7 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE GOL A 952' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 ALA A 278 ? ALA A 322  . ? 1_555 ? 
2  AC1 10 ALA A 279 ? ALA A 323  . ? 1_555 ? 
3  AC1 10 ASN A 280 ? ASN A 324  . ? 1_555 ? 
4  AC1 10 ASN A 329 ? ASN A 373  . ? 1_555 ? 
5  AC1 10 THR A 331 ? THR A 375  . ? 1_555 ? 
6  AC1 10 TYR A 337 ? TYR A 381  . ? 1_555 ? 
7  AC1 10 NAG D .   ? NAG A 802  . ? 1_555 ? 
8  AC1 10 HOH J .   ? HOH A 1033 . ? 1_555 ? 
9  AC1 10 HOH J .   ? HOH A 1129 . ? 1_555 ? 
10 AC1 10 HOH J .   ? HOH A 1144 . ? 1_555 ? 
11 AC2 6  ASP A 281 ? ASP A 325  . ? 1_555 ? 
12 AC2 6  NAG C .   ? NAG A 801  . ? 1_555 ? 
13 AC2 6  HOH J .   ? HOH A 1059 . ? 1_555 ? 
14 AC2 6  HOH J .   ? HOH A 1129 . ? 1_555 ? 
15 AC2 6  HOH J .   ? HOH A 1199 . ? 1_555 ? 
16 AC2 6  HOH J .   ? HOH A 1236 . ? 1_555 ? 
17 AC3 9  ASP A 72  ? ASP A 116  . ? 1_555 ? 
18 AC3 9  TYR A 73  ? TYR A 117  . ? 1_555 ? 
19 AC3 9  LYS A 75  ? LYS A 119  . ? 1_555 ? 
20 AC3 9  SER A 503 ? SER A 547  . ? 1_555 ? 
21 AC3 9  MET A 504 ? MET A 548  . ? 1_555 ? 
22 AC3 9  ASN A 505 ? ASN A 549  . ? 1_555 ? 
23 AC3 9  ARG A 578 ? ARG A 622  . ? 1_555 ? 
24 AC3 9  NAG F .   ? NAG A 902  . ? 1_555 ? 
25 AC3 9  HOH J .   ? HOH A 1169 . ? 1_555 ? 
26 AC4 2  NAG E .   ? NAG A 901  . ? 1_555 ? 
27 AC4 2  BMA G .   ? BMA A 903  . ? 1_555 ? 
28 AC5 1  NAG F .   ? NAG A 902  . ? 1_555 ? 
29 AC6 2  ASN A 396 ? ASN A 440  . ? 1_555 ? 
30 AC6 2  HIS A 462 ? HIS A 506  . ? 1_555 ? 
31 AC7 8  ASP A 14  ? ASP A 58   . ? 1_555 ? 
32 AC7 8  LYS A 18  ? LYS A 62   . ? 1_555 ? 
33 AC7 8  ASN A 101 ? ASN A 145  . ? 4_545 ? 
34 AC7 8  SER A 102 ? SER A 146  . ? 4_545 ? 
35 AC7 8  SER A 124 ? SER A 168  . ? 4_545 ? 
36 AC7 8  PHE A 126 ? PHE A 170  . ? 4_545 ? 
37 AC7 8  GLU A 532 ? GLU A 576  . ? 1_555 ? 
38 AC7 8  HOH J .   ? HOH A 1248 . ? 4_545 ? 
# 
_database_PDB_matrix.entry_id          3F6K 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3F6K 
_atom_sites.fract_transf_matrix[1][1]   0.006861 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.006149 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013417 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012396 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ARG A 1 11  ? 31.888  39.600  5.827   1.00 36.91 ? 55   ARG A N   1 
ATOM   2    C CA  . ARG A 1 11  ? 31.301  39.465  4.456   1.00 36.67 ? 55   ARG A CA  1 
ATOM   3    C C   . ARG A 1 11  ? 32.067  40.363  3.497   1.00 34.92 ? 55   ARG A C   1 
ATOM   4    O O   . ARG A 1 11  ? 31.957  40.223  2.270   1.00 35.26 ? 55   ARG A O   1 
ATOM   5    C CB  . ARG A 1 11  ? 29.815  39.849  4.454   1.00 37.31 ? 55   ARG A CB  1 
ATOM   6    C CG  . ARG A 1 11  ? 28.827  38.686  4.497   1.00 39.08 ? 55   ARG A CG  1 
ATOM   7    C CD  . ARG A 1 11  ? 28.527  38.141  3.094   1.00 43.07 ? 55   ARG A CD  1 
ATOM   8    N NE  . ARG A 1 11  ? 27.971  39.160  2.186   1.00 45.46 ? 55   ARG A NE  1 
ATOM   9    C CZ  . ARG A 1 11  ? 26.913  38.979  1.391   1.00 45.87 ? 55   ARG A CZ  1 
ATOM   10   N NH1 . ARG A 1 11  ? 26.278  37.811  1.368   1.00 45.78 ? 55   ARG A NH1 1 
ATOM   11   N NH2 . ARG A 1 11  ? 26.490  39.967  0.609   1.00 45.73 ? 55   ARG A NH2 1 
ATOM   12   N N   . VAL A 1 12  ? 32.843  41.273  4.069   1.00 32.69 ? 56   VAL A N   1 
ATOM   13   C CA  . VAL A 1 12  ? 33.691  42.160  3.307   1.00 30.60 ? 56   VAL A CA  1 
ATOM   14   C C   . VAL A 1 12  ? 34.977  41.382  3.010   1.00 29.78 ? 56   VAL A C   1 
ATOM   15   O O   . VAL A 1 12  ? 35.594  40.850  3.931   1.00 29.37 ? 56   VAL A O   1 
ATOM   16   C CB  . VAL A 1 12  ? 33.980  43.425  4.113   1.00 31.16 ? 56   VAL A CB  1 
ATOM   17   C CG1 . VAL A 1 12  ? 34.729  44.482  3.283   1.00 29.57 ? 56   VAL A CG1 1 
ATOM   18   C CG2 . VAL A 1 12  ? 32.685  44.007  4.661   1.00 31.48 ? 56   VAL A CG2 1 
ATOM   19   N N   . ARG A 1 13  ? 35.359  41.285  1.734   1.00 28.17 ? 57   ARG A N   1 
ATOM   20   C CA  . ARG A 1 13  ? 36.611  40.593  1.353   1.00 27.11 ? 57   ARG A CA  1 
ATOM   21   C C   . ARG A 1 13  ? 37.802  41.548  1.334   1.00 25.45 ? 57   ARG A C   1 
ATOM   22   O O   . ARG A 1 13  ? 37.647  42.733  1.017   1.00 24.11 ? 57   ARG A O   1 
ATOM   23   C CB  . ARG A 1 13  ? 36.510  39.954  -0.035  1.00 27.65 ? 57   ARG A CB  1 
ATOM   24   C CG  . ARG A 1 13  ? 35.156  39.370  -0.424  1.00 30.66 ? 57   ARG A CG  1 
ATOM   25   C CD  . ARG A 1 13  ? 34.880  38.023  0.258   1.00 36.02 ? 57   ARG A CD  1 
ATOM   26   N NE  . ARG A 1 13  ? 35.831  36.975  -0.116  1.00 37.07 ? 57   ARG A NE  1 
ATOM   27   C CZ  . ARG A 1 13  ? 35.879  36.394  -1.313  1.00 37.92 ? 57   ARG A CZ  1 
ATOM   28   N NH1 . ARG A 1 13  ? 35.033  36.778  -2.279  1.00 37.37 ? 57   ARG A NH1 1 
ATOM   29   N NH2 . ARG A 1 13  ? 36.779  35.432  -1.539  1.00 36.73 ? 57   ARG A NH2 1 
ATOM   30   N N   . ASP A 1 14  ? 38.987  41.004  1.648   1.00 23.86 ? 58   ASP A N   1 
ATOM   31   C CA  . ASP A 1 14  ? 40.260  41.731  1.645   1.00 23.05 ? 58   ASP A CA  1 
ATOM   32   C C   . ASP A 1 14  ? 40.221  42.979  2.549   1.00 21.75 ? 58   ASP A C   1 
ATOM   33   O O   . ASP A 1 14  ? 40.978  43.935  2.324   1.00 21.12 ? 58   ASP A O   1 
ATOM   34   C CB  . ASP A 1 14  ? 40.695  42.107  0.210   1.00 23.01 ? 58   ASP A CB  1 
ATOM   35   C CG  . ASP A 1 14  ? 40.998  40.865  -0.670  1.00 27.46 ? 58   ASP A CG  1 
ATOM   36   O OD1 . ASP A 1 14  ? 41.572  39.873  -0.144  1.00 29.52 ? 58   ASP A OD1 1 
ATOM   37   O OD2 . ASP A 1 14  ? 40.650  40.867  -1.889  1.00 30.91 ? 58   ASP A OD2 1 
ATOM   38   N N   . PHE A 1 15  ? 39.338  42.980  3.544   1.00 20.40 ? 59   PHE A N   1 
ATOM   39   C CA  . PHE A 1 15  ? 39.122  44.218  4.335   1.00 20.93 ? 59   PHE A CA  1 
ATOM   40   C C   . PHE A 1 15  ? 40.358  44.754  5.058   1.00 20.55 ? 59   PHE A C   1 
ATOM   41   O O   . PHE A 1 15  ? 40.579  45.978  5.171   1.00 20.18 ? 59   PHE A O   1 
ATOM   42   C CB  . PHE A 1 15  ? 37.863  44.118  5.239   1.00 21.31 ? 59   PHE A CB  1 
ATOM   43   C CG  . PHE A 1 15  ? 38.047  43.316  6.510   1.00 21.80 ? 59   PHE A CG  1 
ATOM   44   C CD1 . PHE A 1 15  ? 38.613  43.911  7.647   1.00 23.16 ? 59   PHE A CD1 1 
ATOM   45   C CD2 . PHE A 1 15  ? 37.586  42.025  6.596   1.00 22.52 ? 59   PHE A CD2 1 
ATOM   46   C CE1 . PHE A 1 15  ? 38.762  43.218  8.803   1.00 22.32 ? 59   PHE A CE1 1 
ATOM   47   C CE2 . PHE A 1 15  ? 37.719  41.308  7.769   1.00 26.00 ? 59   PHE A CE2 1 
ATOM   48   C CZ  . PHE A 1 15  ? 38.309  41.918  8.887   1.00 24.47 ? 59   PHE A CZ  1 
ATOM   49   N N   . VAL A 1 16  ? 41.197  43.854  5.534   1.00 20.70 ? 60   VAL A N   1 
ATOM   50   C CA  . VAL A 1 16  ? 42.413  44.314  6.201   1.00 22.26 ? 60   VAL A CA  1 
ATOM   51   C C   . VAL A 1 16  ? 43.352  45.138  5.274   1.00 22.92 ? 60   VAL A C   1 
ATOM   52   O O   . VAL A 1 16  ? 43.777  46.251  5.632   1.00 22.99 ? 60   VAL A O   1 
ATOM   53   C CB  . VAL A 1 16  ? 43.150  43.146  6.878   1.00 22.76 ? 60   VAL A CB  1 
ATOM   54   C CG1 . VAL A 1 16  ? 44.501  43.588  7.383   1.00 22.22 ? 60   VAL A CG1 1 
ATOM   55   C CG2 . VAL A 1 16  ? 42.300  42.613  8.017   1.00 22.14 ? 60   VAL A CG2 1 
ATOM   56   N N   . ALA A 1 17  ? 43.633  44.611  4.086   1.00 22.87 ? 61   ALA A N   1 
ATOM   57   C CA  . ALA A 1 17  ? 44.385  45.331  3.054   1.00 23.14 ? 61   ALA A CA  1 
ATOM   58   C C   . ALA A 1 17  ? 43.731  46.650  2.609   1.00 23.29 ? 61   ALA A C   1 
ATOM   59   O O   . ALA A 1 17  ? 44.422  47.573  2.194   1.00 24.80 ? 61   ALA A O   1 
ATOM   60   C CB  . ALA A 1 17  ? 44.591  44.407  1.817   1.00 23.18 ? 61   ALA A CB  1 
ATOM   61   N N   . LYS A 1 18  ? 42.404  46.717  2.634   1.00 22.28 ? 62   LYS A N   1 
ATOM   62   C CA  . LYS A 1 18  ? 41.679  47.898  2.191   1.00 21.81 ? 62   LYS A CA  1 
ATOM   63   C C   . LYS A 1 18  ? 41.666  48.978  3.279   1.00 22.85 ? 62   LYS A C   1 
ATOM   64   O O   . LYS A 1 18  ? 41.281  50.131  3.022   1.00 24.24 ? 62   LYS A O   1 
ATOM   65   C CB  . LYS A 1 18  ? 40.245  47.524  1.845   1.00 20.96 ? 62   LYS A CB  1 
ATOM   66   C CG  . LYS A 1 18  ? 40.070  46.745  0.513   1.00 19.75 ? 62   LYS A CG  1 
ATOM   67   C CD  . LYS A 1 18  ? 38.687  46.154  0.476   1.00 19.56 ? 62   LYS A CD  1 
ATOM   68   C CE  . LYS A 1 18  ? 38.264  45.757  -0.919  1.00 23.27 ? 62   LYS A CE  1 
ATOM   69   N NZ  . LYS A 1 18  ? 36.917  45.132  -0.860  1.00 25.87 ? 62   LYS A NZ  1 
ATOM   70   N N   . LEU A 1 19  ? 42.044  48.601  4.492   1.00 22.75 ? 63   LEU A N   1 
ATOM   71   C CA  . LEU A 1 19  ? 41.987  49.519  5.644   1.00 23.15 ? 63   LEU A CA  1 
ATOM   72   C C   . LEU A 1 19  ? 43.397  49.915  6.028   1.00 23.50 ? 63   LEU A C   1 
ATOM   73   O O   . LEU A 1 19  ? 43.656  51.048  6.417   1.00 24.36 ? 63   LEU A O   1 
ATOM   74   C CB  . LEU A 1 19  ? 41.257  48.846  6.824   1.00 21.57 ? 63   LEU A CB  1 
ATOM   75   C CG  . LEU A 1 19  ? 39.726  48.872  6.780   1.00 22.33 ? 63   LEU A CG  1 
ATOM   76   C CD1 . LEU A 1 19  ? 39.056  48.252  7.977   1.00 19.21 ? 63   LEU A CD1 1 
ATOM   77   C CD2 . LEU A 1 19  ? 39.226  50.298  6.624   1.00 21.57 ? 63   LEU A CD2 1 
ATOM   78   N N   . ALA A 1 20  ? 44.320  48.978  5.893   1.00 24.13 ? 64   ALA A N   1 
ATOM   79   C CA  . ALA A 1 20  ? 45.704  49.165  6.353   1.00 25.55 ? 64   ALA A CA  1 
ATOM   80   C C   . ALA A 1 20  ? 46.435  50.363  5.757   1.00 26.42 ? 64   ALA A C   1 
ATOM   81   O O   . ALA A 1 20  ? 47.223  51.009  6.472   1.00 27.94 ? 64   ALA A O   1 
ATOM   82   C CB  . ALA A 1 20  ? 46.532  47.866  6.183   1.00 24.95 ? 64   ALA A CB  1 
ATOM   83   N N   . ASN A 1 21  ? 46.186  50.677  4.485   1.00 26.02 ? 65   ASN A N   1 
ATOM   84   C CA  . ASN A 1 21  ? 46.845  51.835  3.839   1.00 25.31 ? 65   ASN A CA  1 
ATOM   85   C C   . ASN A 1 21  ? 45.959  53.090  3.960   1.00 24.21 ? 65   ASN A C   1 
ATOM   86   O O   . ASN A 1 21  ? 46.303  54.147  3.441   1.00 24.01 ? 65   ASN A O   1 
ATOM   87   C CB  . ASN A 1 21  ? 47.192  51.519  2.377   1.00 26.37 ? 65   ASN A CB  1 
ATOM   88   C CG  . ASN A 1 21  ? 48.294  52.452  1.775   1.00 30.91 ? 65   ASN A CG  1 
ATOM   89   O OD1 . ASN A 1 21  ? 49.301  52.791  2.428   1.00 34.69 ? 65   ASN A OD1 1 
ATOM   90   N ND2 . ASN A 1 21  ? 48.119  52.814  0.503   1.00 33.80 ? 65   ASN A ND2 1 
ATOM   91   N N   . ASN A 1 22  ? 44.850  52.962  4.693   1.00 22.47 ? 66   ASN A N   1 
ATOM   92   C CA  . ASN A 1 22  ? 43.943  54.071  4.942   1.00 20.82 ? 66   ASN A CA  1 
ATOM   93   C C   . ASN A 1 22  ? 43.775  54.436  6.412   1.00 19.77 ? 66   ASN A C   1 
ATOM   94   O O   . ASN A 1 22  ? 42.809  55.118  6.803   1.00 22.29 ? 66   ASN A O   1 
ATOM   95   C CB  . ASN A 1 22  ? 42.633  53.721  4.303   1.00 20.44 ? 66   ASN A CB  1 
ATOM   96   C CG  . ASN A 1 22  ? 42.669  53.902  2.801   1.00 20.58 ? 66   ASN A CG  1 
ATOM   97   O OD1 . ASN A 1 22  ? 42.865  55.012  2.308   1.00 17.97 ? 66   ASN A OD1 1 
ATOM   98   N ND2 . ASN A 1 22  ? 42.517  52.795  2.065   1.00 21.72 ? 66   ASN A ND2 1 
ATOM   99   N N   . THR A 1 23  ? 44.736  54.010  7.214   1.00 19.57 ? 67   THR A N   1 
ATOM   100  C CA  . THR A 1 23  ? 44.780  54.218  8.643   1.00 20.28 ? 67   THR A CA  1 
ATOM   101  C C   . THR A 1 23  ? 45.958  55.125  8.935   1.00 20.98 ? 67   THR A C   1 
ATOM   102  O O   . THR A 1 23  ? 47.071  54.818  8.532   1.00 20.95 ? 67   THR A O   1 
ATOM   103  C CB  . THR A 1 23  ? 44.989  52.877  9.385   1.00 20.88 ? 67   THR A CB  1 
ATOM   104  O OG1 . THR A 1 23  ? 43.911  51.999  9.063   1.00 20.07 ? 67   THR A OG1 1 
ATOM   105  C CG2 . THR A 1 23  ? 45.049  53.084  10.913  1.00 19.98 ? 67   THR A CG2 1 
ATOM   106  N N   . HIS A 1 24  ? 45.721  56.211  9.648   1.00 20.83 ? 68   HIS A N   1 
ATOM   107  C CA  . HIS A 1 24  ? 46.673  57.305  9.734   1.00 22.53 ? 68   HIS A CA  1 
ATOM   108  C C   . HIS A 1 24  ? 46.910  57.673  11.179  1.00 22.57 ? 68   HIS A C   1 
ATOM   109  O O   . HIS A 1 24  ? 45.974  58.046  11.904  1.00 22.84 ? 68   HIS A O   1 
ATOM   110  C CB  . HIS A 1 24  ? 46.088  58.486  8.954   1.00 24.20 ? 68   HIS A CB  1 
ATOM   111  C CG  . HIS A 1 24  ? 46.021  58.236  7.477   1.00 26.88 ? 68   HIS A CG  1 
ATOM   112  N ND1 . HIS A 1 24  ? 44.874  57.804  6.843   1.00 28.72 ? 68   HIS A ND1 1 
ATOM   113  C CD2 . HIS A 1 24  ? 46.984  58.279  6.529   1.00 23.64 ? 68   HIS A CD2 1 
ATOM   114  C CE1 . HIS A 1 24  ? 45.122  57.647  5.551   1.00 29.25 ? 68   HIS A CE1 1 
ATOM   115  N NE2 . HIS A 1 24  ? 46.397  57.934  5.333   1.00 28.85 ? 68   HIS A NE2 1 
ATOM   116  N N   . GLN A 1 25  ? 48.151  57.579  11.601  1.00 21.27 ? 69   GLN A N   1 
ATOM   117  C CA  . GLN A 1 25  ? 48.512  57.777  12.996  1.00 20.94 ? 69   GLN A CA  1 
ATOM   118  C C   . GLN A 1 25  ? 49.079  59.141  13.151  1.00 21.35 ? 69   GLN A C   1 
ATOM   119  O O   . GLN A 1 25  ? 49.892  59.560  12.354  1.00 19.71 ? 69   GLN A O   1 
ATOM   120  C CB  . GLN A 1 25  ? 49.571  56.759  13.402  1.00 21.33 ? 69   GLN A CB  1 
ATOM   121  C CG  . GLN A 1 25  ? 49.822  56.674  14.924  1.00 22.20 ? 69   GLN A CG  1 
ATOM   122  C CD  . GLN A 1 25  ? 51.180  56.221  15.248  1.00 22.92 ? 69   GLN A CD  1 
ATOM   123  O OE1 . GLN A 1 25  ? 52.136  56.801  14.781  1.00 24.16 ? 69   GLN A OE1 1 
ATOM   124  N NE2 . GLN A 1 25  ? 51.297  55.184  16.066  1.00 23.87 ? 69   GLN A NE2 1 
ATOM   125  N N   . HIS A 1 26  ? 48.618  59.881  14.150  1.00 22.13 ? 70   HIS A N   1 
ATOM   126  C CA  . HIS A 1 26  ? 49.317  61.114  14.512  1.00 22.95 ? 70   HIS A CA  1 
ATOM   127  C C   . HIS A 1 26  ? 49.676  61.078  15.976  1.00 23.65 ? 70   HIS A C   1 
ATOM   128  O O   . HIS A 1 26  ? 48.854  60.700  16.798  1.00 22.94 ? 70   HIS A O   1 
ATOM   129  C CB  . HIS A 1 26  ? 48.473  62.334  14.221  1.00 23.47 ? 70   HIS A CB  1 
ATOM   130  C CG  . HIS A 1 26  ? 49.224  63.597  14.419  1.00 26.02 ? 70   HIS A CG  1 
ATOM   131  N ND1 . HIS A 1 26  ? 50.027  64.130  13.441  1.00 25.68 ? 70   HIS A ND1 1 
ATOM   132  C CD2 . HIS A 1 26  ? 49.395  64.371  15.516  1.00 28.05 ? 70   HIS A CD2 1 
ATOM   133  C CE1 . HIS A 1 26  ? 50.637  65.199  13.913  1.00 28.25 ? 70   HIS A CE1 1 
ATOM   134  N NE2 . HIS A 1 26  ? 50.262  65.376  15.167  1.00 25.58 ? 70   HIS A NE2 1 
ATOM   135  N N   . VAL A 1 27  ? 50.907  61.455  16.305  1.00 25.30 ? 71   VAL A N   1 
ATOM   136  C CA  . VAL A 1 27  ? 51.374  61.495  17.693  1.00 27.07 ? 71   VAL A CA  1 
ATOM   137  C C   . VAL A 1 27  ? 51.519  62.946  18.144  1.00 28.59 ? 71   VAL A C   1 
ATOM   138  O O   . VAL A 1 27  ? 52.241  63.738  17.528  1.00 29.51 ? 71   VAL A O   1 
ATOM   139  C CB  . VAL A 1 27  ? 52.649  60.658  17.872  1.00 27.23 ? 71   VAL A CB  1 
ATOM   140  C CG1 . VAL A 1 27  ? 53.411  61.015  19.158  1.00 27.85 ? 71   VAL A CG1 1 
ATOM   141  C CG2 . VAL A 1 27  ? 52.293  59.176  17.869  1.00 27.93 ? 71   VAL A CG2 1 
ATOM   142  N N   . PHE A 1 28  ? 50.804  63.294  19.206  1.00 30.42 ? 72   PHE A N   1 
ATOM   143  C CA  . PHE A 1 28  ? 50.840  64.634  19.760  1.00 32.82 ? 72   PHE A CA  1 
ATOM   144  C C   . PHE A 1 28  ? 51.929  64.707  20.827  1.00 36.10 ? 72   PHE A C   1 
ATOM   145  O O   . PHE A 1 28  ? 51.863  64.020  21.853  1.00 36.89 ? 72   PHE A O   1 
ATOM   146  C CB  . PHE A 1 28  ? 49.469  65.028  20.311  1.00 31.13 ? 72   PHE A CB  1 
ATOM   147  C CG  . PHE A 1 28  ? 48.379  65.045  19.268  1.00 30.53 ? 72   PHE A CG  1 
ATOM   148  C CD1 . PHE A 1 28  ? 48.020  66.230  18.647  1.00 27.18 ? 72   PHE A CD1 1 
ATOM   149  C CD2 . PHE A 1 28  ? 47.721  63.876  18.898  1.00 28.54 ? 72   PHE A CD2 1 
ATOM   150  C CE1 . PHE A 1 28  ? 47.015  66.262  17.686  1.00 26.09 ? 72   PHE A CE1 1 
ATOM   151  C CE2 . PHE A 1 28  ? 46.729  63.899  17.914  1.00 29.05 ? 72   PHE A CE2 1 
ATOM   152  C CZ  . PHE A 1 28  ? 46.368  65.089  17.317  1.00 27.57 ? 72   PHE A CZ  1 
ATOM   153  N N   . ASP A 1 29  ? 52.947  65.522  20.545  1.00 39.85 ? 73   ASP A N   1 
ATOM   154  C CA  . ASP A 1 29  ? 54.127  65.716  21.415  1.00 43.12 ? 73   ASP A CA  1 
ATOM   155  C C   . ASP A 1 29  ? 53.740  66.125  22.827  1.00 44.18 ? 73   ASP A C   1 
ATOM   156  O O   . ASP A 1 29  ? 54.450  65.823  23.784  1.00 44.51 ? 73   ASP A O   1 
ATOM   157  C CB  . ASP A 1 29  ? 55.055  66.805  20.842  1.00 43.96 ? 73   ASP A CB  1 
ATOM   158  C CG  . ASP A 1 29  ? 54.979  66.909  19.317  1.00 47.06 ? 73   ASP A CG  1 
ATOM   159  O OD1 . ASP A 1 29  ? 55.743  66.168  18.646  1.00 50.04 ? 73   ASP A OD1 1 
ATOM   160  O OD2 . ASP A 1 29  ? 54.157  67.725  18.796  1.00 50.06 ? 73   ASP A OD2 1 
ATOM   161  N N   . ASP A 1 30  ? 52.619  66.836  22.937  1.00 45.89 ? 74   ASP A N   1 
ATOM   162  C CA  . ASP A 1 30  ? 52.143  67.351  24.212  1.00 47.65 ? 74   ASP A CA  1 
ATOM   163  C C   . ASP A 1 30  ? 50.669  67.692  24.124  1.00 48.11 ? 74   ASP A C   1 
ATOM   164  O O   . ASP A 1 30  ? 50.232  68.397  23.213  1.00 48.24 ? 74   ASP A O   1 
ATOM   165  C CB  . ASP A 1 30  ? 52.966  68.577  24.661  1.00 48.43 ? 74   ASP A CB  1 
ATOM   166  C CG  . ASP A 1 30  ? 53.267  69.555  23.506  1.00 50.83 ? 74   ASP A CG  1 
ATOM   167  O OD1 . ASP A 1 30  ? 52.790  69.332  22.361  1.00 51.56 ? 74   ASP A OD1 1 
ATOM   168  O OD2 . ASP A 1 30  ? 53.995  70.549  23.754  1.00 52.98 ? 74   ASP A OD2 1 
ATOM   169  N N   . LEU A 1 31  ? 49.909  67.175  25.084  1.00 48.90 ? 75   LEU A N   1 
ATOM   170  C CA  . LEU A 1 31  ? 48.460  67.346  25.126  1.00 49.49 ? 75   LEU A CA  1 
ATOM   171  C C   . LEU A 1 31  ? 47.967  67.217  26.595  1.00 49.87 ? 75   LEU A C   1 
ATOM   172  O O   . LEU A 1 31  ? 46.899  66.647  26.873  1.00 50.10 ? 75   LEU A O   1 
ATOM   173  C CB  . LEU A 1 31  ? 47.813  66.332  24.161  1.00 49.71 ? 75   LEU A CB  1 
ATOM   174  C CG  . LEU A 1 31  ? 46.490  66.591  23.442  1.00 50.12 ? 75   LEU A CG  1 
ATOM   175  C CD1 . LEU A 1 31  ? 46.618  66.431  21.952  1.00 50.86 ? 75   LEU A CD1 1 
ATOM   176  C CD2 . LEU A 1 31  ? 45.477  65.624  23.937  1.00 50.31 ? 75   LEU A CD2 1 
ATOM   177  N N   . ARG A 1 32  ? 48.761  67.749  27.532  1.00 49.58 ? 76   ARG A N   1 
ATOM   178  C CA  . ARG A 1 32  ? 48.375  67.759  28.938  1.00 49.59 ? 76   ARG A CA  1 
ATOM   179  C C   . ARG A 1 32  ? 47.262  68.772  29.172  1.00 49.39 ? 76   ARG A C   1 
ATOM   180  O O   . ARG A 1 32  ? 47.057  69.683  28.370  1.00 49.69 ? 76   ARG A O   1 
ATOM   181  C CB  . ARG A 1 32  ? 49.568  68.042  29.870  1.00 49.67 ? 76   ARG A CB  1 
ATOM   182  C CG  . ARG A 1 32  ? 50.413  66.815  30.257  1.00 50.77 ? 76   ARG A CG  1 
ATOM   183  C CD  . ARG A 1 32  ? 49.557  65.543  30.458  1.00 51.97 ? 76   ARG A CD  1 
ATOM   184  N NE  . ARG A 1 32  ? 50.131  64.314  29.871  1.00 51.56 ? 76   ARG A NE  1 
ATOM   185  C CZ  . ARG A 1 32  ? 50.455  64.133  28.581  1.00 49.86 ? 76   ARG A CZ  1 
ATOM   186  N NH1 . ARG A 1 32  ? 50.318  65.103  27.682  1.00 49.41 ? 76   ARG A NH1 1 
ATOM   187  N NH2 . ARG A 1 32  ? 50.950  62.970  28.187  1.00 48.98 ? 76   ARG A NH2 1 
ATOM   188  N N   . GLY A 1 33  ? 46.552  68.604  30.285  1.00 49.19 ? 77   GLY A N   1 
ATOM   189  C CA  . GLY A 1 33  ? 45.446  69.487  30.665  1.00 48.06 ? 77   GLY A CA  1 
ATOM   190  C C   . GLY A 1 33  ? 44.154  69.206  29.918  1.00 47.20 ? 77   GLY A C   1 
ATOM   191  O O   . GLY A 1 33  ? 44.034  68.198  29.209  1.00 46.74 ? 77   GLY A O   1 
ATOM   192  N N   . SER A 1 34  ? 43.185  70.100  30.110  1.00 46.38 ? 78   SER A N   1 
ATOM   193  C CA  . SER A 1 34  ? 41.923  70.085  29.378  1.00 45.46 ? 78   SER A CA  1 
ATOM   194  C C   . SER A 1 34  ? 42.210  70.145  27.875  1.00 44.51 ? 78   SER A C   1 
ATOM   195  O O   . SER A 1 34  ? 42.888  71.050  27.377  1.00 44.19 ? 78   SER A O   1 
ATOM   196  C CB  . SER A 1 34  ? 41.015  71.266  29.798  1.00 45.98 ? 78   SER A CB  1 
ATOM   197  O OG  . SER A 1 34  ? 40.406  71.093  31.075  1.00 46.96 ? 78   SER A OG  1 
ATOM   198  N N   . VAL A 1 35  ? 41.700  69.139  27.180  1.00 43.43 ? 79   VAL A N   1 
ATOM   199  C CA  . VAL A 1 35  ? 41.875  68.975  25.739  1.00 42.16 ? 79   VAL A CA  1 
ATOM   200  C C   . VAL A 1 35  ? 40.511  68.984  25.081  1.00 41.07 ? 79   VAL A C   1 
ATOM   201  O O   . VAL A 1 35  ? 39.562  68.347  25.570  1.00 40.49 ? 79   VAL A O   1 
ATOM   202  C CB  . VAL A 1 35  ? 42.558  67.647  25.408  1.00 42.13 ? 79   VAL A CB  1 
ATOM   203  C CG1 . VAL A 1 35  ? 42.596  67.444  23.905  1.00 42.65 ? 79   VAL A CG1 1 
ATOM   204  C CG2 . VAL A 1 35  ? 43.953  67.603  26.032  1.00 41.46 ? 79   VAL A CG2 1 
ATOM   205  N N   . SER A 1 36  ? 40.410  69.736  23.988  1.00 38.64 ? 80   SER A N   1 
ATOM   206  C CA  . SER A 1 36  ? 39.144  69.881  23.312  1.00 36.33 ? 80   SER A CA  1 
ATOM   207  C C   . SER A 1 36  ? 39.319  69.897  21.810  1.00 33.78 ? 80   SER A C   1 
ATOM   208  O O   . SER A 1 36  ? 40.374  70.261  21.277  1.00 32.61 ? 80   SER A O   1 
ATOM   209  C CB  . SER A 1 36  ? 38.376  71.113  23.803  1.00 36.51 ? 80   SER A CB  1 
ATOM   210  O OG  . SER A 1 36  ? 39.241  72.203  24.010  1.00 39.79 ? 80   SER A OG  1 
ATOM   211  N N   . LEU A 1 37  ? 38.255  69.493  21.144  1.00 31.58 ? 81   LEU A N   1 
ATOM   212  C CA  . LEU A 1 37  ? 38.297  69.307  19.725  1.00 30.27 ? 81   LEU A CA  1 
ATOM   213  C C   . LEU A 1 37  ? 37.035  69.955  19.152  1.00 28.65 ? 81   LEU A C   1 
ATOM   214  O O   . LEU A 1 37  ? 35.934  69.805  19.698  1.00 27.73 ? 81   LEU A O   1 
ATOM   215  C CB  . LEU A 1 37  ? 38.389  67.805  19.476  1.00 30.86 ? 81   LEU A CB  1 
ATOM   216  C CG  . LEU A 1 37  ? 38.411  67.089  18.138  1.00 31.13 ? 81   LEU A CG  1 
ATOM   217  C CD1 . LEU A 1 37  ? 39.642  67.356  17.410  1.00 38.73 ? 81   LEU A CD1 1 
ATOM   218  C CD2 . LEU A 1 37  ? 38.449  65.633  18.458  1.00 35.34 ? 81   LEU A CD2 1 
ATOM   219  N N   . SER A 1 38  ? 37.218  70.710  18.075  1.00 26.62 ? 82   SER A N   1 
ATOM   220  C CA  . SER A 1 38  ? 36.136  71.389  17.393  1.00 25.34 ? 82   SER A CA  1 
ATOM   221  C C   . SER A 1 38  ? 36.263  71.194  15.916  1.00 23.69 ? 82   SER A C   1 
ATOM   222  O O   . SER A 1 38  ? 37.341  71.391  15.354  1.00 21.93 ? 82   SER A O   1 
ATOM   223  C CB  . SER A 1 38  ? 36.216  72.898  17.643  1.00 27.75 ? 82   SER A CB  1 
ATOM   224  O OG  . SER A 1 38  ? 35.771  73.216  18.949  1.00 29.17 ? 82   SER A OG  1 
ATOM   225  N N   . TRP A 1 39  ? 35.152  70.895  15.266  1.00 20.55 ? 83   TRP A N   1 
ATOM   226  C CA  . TRP A 1 39  ? 35.159  70.803  13.830  1.00 21.25 ? 83   TRP A CA  1 
ATOM   227  C C   . TRP A 1 39  ? 34.869  72.187  13.278  1.00 22.40 ? 83   TRP A C   1 
ATOM   228  O O   . TRP A 1 39  ? 34.010  72.892  13.828  1.00 22.21 ? 83   TRP A O   1 
ATOM   229  C CB  . TRP A 1 39  ? 34.086  69.827  13.399  1.00 20.97 ? 83   TRP A CB  1 
ATOM   230  C CG  . TRP A 1 39  ? 34.490  68.421  13.705  1.00 20.45 ? 83   TRP A CG  1 
ATOM   231  C CD1 . TRP A 1 39  ? 34.336  67.735  14.873  1.00 24.74 ? 83   TRP A CD1 1 
ATOM   232  C CD2 . TRP A 1 39  ? 35.138  67.548  12.800  1.00 22.43 ? 83   TRP A CD2 1 
ATOM   233  N NE1 . TRP A 1 39  ? 34.830  66.437  14.731  1.00 21.50 ? 83   TRP A NE1 1 
ATOM   234  C CE2 . TRP A 1 39  ? 35.351  66.326  13.465  1.00 23.18 ? 83   TRP A CE2 1 
ATOM   235  C CE3 . TRP A 1 39  ? 35.551  67.679  11.441  1.00 25.43 ? 83   TRP A CE3 1 
ATOM   236  C CZ2 . TRP A 1 39  ? 35.964  65.260  12.846  1.00 22.30 ? 83   TRP A CZ2 1 
ATOM   237  C CZ3 . TRP A 1 39  ? 36.151  66.625  10.833  1.00 20.37 ? 83   TRP A CZ3 1 
ATOM   238  C CH2 . TRP A 1 39  ? 36.367  65.434  11.535  1.00 22.09 ? 83   TRP A CH2 1 
ATOM   239  N N   . VAL A 1 40  ? 35.556  72.589  12.216  1.00 20.37 ? 84   VAL A N   1 
ATOM   240  C CA  . VAL A 1 40  ? 35.247  73.910  11.648  1.00 21.33 ? 84   VAL A CA  1 
ATOM   241  C C   . VAL A 1 40  ? 34.652  73.774  10.212  1.00 21.00 ? 84   VAL A C   1 
ATOM   242  O O   . VAL A 1 40  ? 35.373  73.515  9.237   1.00 21.86 ? 84   VAL A O   1 
ATOM   243  C CB  . VAL A 1 40  ? 36.521  74.767  11.677  1.00 20.71 ? 84   VAL A CB  1 
ATOM   244  C CG1 . VAL A 1 40  ? 36.298  76.206  11.214  1.00 20.23 ? 84   VAL A CG1 1 
ATOM   245  C CG2 . VAL A 1 40  ? 37.122  74.843  13.093  1.00 23.17 ? 84   VAL A CG2 1 
ATOM   246  N N   . GLY A 1 41  ? 33.361  74.018  10.050  1.00 21.35 ? 85   GLY A N   1 
ATOM   247  C CA  . GLY A 1 41  ? 32.673  73.907  8.728   1.00 22.60 ? 85   GLY A CA  1 
ATOM   248  C C   . GLY A 1 41  ? 32.310  72.455  8.361   1.00 25.43 ? 85   GLY A C   1 
ATOM   249  O O   . GLY A 1 41  ? 32.866  71.510  8.963   1.00 24.00 ? 85   GLY A O   1 
ATOM   250  N N   . ASP A 1 42  ? 31.380  72.293  7.401   1.00 26.53 ? 86   ASP A N   1 
ATOM   251  C CA  . ASP A 1 42  ? 31.019  70.990  6.761   1.00 27.75 ? 86   ASP A CA  1 
ATOM   252  C C   . ASP A 1 42  ? 31.812  70.826  5.457   1.00 28.18 ? 86   ASP A C   1 
ATOM   253  O O   . ASP A 1 42  ? 31.941  71.774  4.659   1.00 27.56 ? 86   ASP A O   1 
ATOM   254  C CB  . ASP A 1 42  ? 29.541  70.988  6.417   1.00 27.91 ? 86   ASP A CB  1 
ATOM   255  C CG  . ASP A 1 42  ? 29.002  69.607  5.941   1.00 33.26 ? 86   ASP A CG  1 
ATOM   256  O OD1 . ASP A 1 42  ? 29.346  68.546  6.544   1.00 37.70 ? 86   ASP A OD1 1 
ATOM   257  O OD2 . ASP A 1 42  ? 28.159  69.581  4.985   1.00 37.66 ? 86   ASP A OD2 1 
ATOM   258  N N   . SER A 1 43  ? 32.302  69.624  5.213   1.00 27.57 ? 87   SER A N   1 
ATOM   259  C CA  . SER A 1 43  ? 33.042  69.295  3.994   1.00 27.97 ? 87   SER A CA  1 
ATOM   260  C C   . SER A 1 43  ? 34.356  70.031  3.876   1.00 27.89 ? 87   SER A C   1 
ATOM   261  O O   . SER A 1 43  ? 34.806  70.274  2.758   1.00 29.24 ? 87   SER A O   1 
ATOM   262  C CB  . SER A 1 43  ? 32.204  69.594  2.723   1.00 28.99 ? 87   SER A CB  1 
ATOM   263  O OG  . SER A 1 43  ? 30.963  68.917  2.753   1.00 31.94 ? 87   SER A OG  1 
ATOM   264  N N   . THR A 1 44  ? 34.955  70.413  5.004   1.00 26.24 ? 88   THR A N   1 
ATOM   265  C CA  . THR A 1 44  ? 36.217  71.090  4.996   1.00 25.73 ? 88   THR A CA  1 
ATOM   266  C C   . THR A 1 44  ? 37.274  70.149  5.475   1.00 24.78 ? 88   THR A C   1 
ATOM   267  O O   . THR A 1 44  ? 38.402  70.282  5.074   1.00 23.70 ? 88   THR A O   1 
ATOM   268  C CB  . THR A 1 44  ? 36.222  72.355  5.915   1.00 26.76 ? 88   THR A CB  1 
ATOM   269  O OG1 . THR A 1 44  ? 35.819  71.965  7.229   1.00 23.93 ? 88   THR A OG1 1 
ATOM   270  C CG2 . THR A 1 44  ? 35.235  73.365  5.408   1.00 25.10 ? 88   THR A CG2 1 
ATOM   271  N N   . GLY A 1 45  ? 36.899  69.178  6.312   1.00 24.27 ? 89   GLY A N   1 
ATOM   272  C CA  . GLY A 1 45  ? 37.911  68.293  6.937   1.00 23.17 ? 89   GLY A CA  1 
ATOM   273  C C   . GLY A 1 45  ? 38.735  68.958  8.036   1.00 22.98 ? 89   GLY A C   1 
ATOM   274  O O   . GLY A 1 45  ? 39.737  68.391  8.517   1.00 25.31 ? 89   GLY A O   1 
ATOM   275  N N   . VAL A 1 46  ? 38.352  70.178  8.402   1.00 21.34 ? 90   VAL A N   1 
ATOM   276  C CA  . VAL A 1 46  ? 39.051  70.966  9.408   1.00 20.39 ? 90   VAL A CA  1 
ATOM   277  C C   . VAL A 1 46  ? 38.694  70.703  10.825  1.00 19.80 ? 90   VAL A C   1 
ATOM   278  O O   . VAL A 1 46  ? 37.527  70.866  11.278  1.00 20.00 ? 90   VAL A O   1 
ATOM   279  C CB  . VAL A 1 46  ? 38.941  72.497  9.153   1.00 21.13 ? 90   VAL A CB  1 
ATOM   280  C CG1 . VAL A 1 46  ? 39.647  73.274  10.295  1.00 21.51 ? 90   VAL A CG1 1 
ATOM   281  C CG2 . VAL A 1 46  ? 39.523  72.903  7.790   1.00 18.60 ? 90   VAL A CG2 1 
ATOM   282  N N   . ILE A 1 47  ? 39.712  70.305  11.570  1.00 21.38 ? 91   ILE A N   1 
ATOM   283  C CA  . ILE A 1 47  ? 39.590  70.010  12.997  1.00 21.81 ? 91   ILE A CA  1 
ATOM   284  C C   . ILE A 1 47  ? 40.638  70.809  13.768  1.00 21.49 ? 91   ILE A C   1 
ATOM   285  O O   . ILE A 1 47  ? 41.743  70.863  13.339  1.00 20.42 ? 91   ILE A O   1 
ATOM   286  C CB  . ILE A 1 47  ? 39.914  68.533  13.340  1.00 23.67 ? 91   ILE A CB  1 
ATOM   287  C CG1 . ILE A 1 47  ? 39.084  67.595  12.494  1.00 23.14 ? 91   ILE A CG1 1 
ATOM   288  C CG2 . ILE A 1 47  ? 39.712  68.267  14.844  1.00 21.14 ? 91   ILE A CG2 1 
ATOM   289  C CD1 . ILE A 1 47  ? 39.478  66.123  12.705  1.00 25.25 ? 91   ILE A CD1 1 
ATOM   290  N N   . LEU A 1 48  ? 40.250  71.450  14.853  1.00 21.98 ? 92   LEU A N   1 
ATOM   291  C CA  . LEU A 1 48  ? 41.182  72.162  15.737  1.00 23.30 ? 92   LEU A CA  1 
ATOM   292  C C   . LEU A 1 48  ? 41.260  71.415  17.038  1.00 23.23 ? 92   LEU A C   1 
ATOM   293  O O   . LEU A 1 48  ? 40.231  71.085  17.588  1.00 25.75 ? 92   LEU A O   1 
ATOM   294  C CB  . LEU A 1 48  ? 40.632  73.519  16.078  1.00 23.58 ? 92   LEU A CB  1 
ATOM   295  C CG  . LEU A 1 48  ? 40.872  74.743  15.211  1.00 28.14 ? 92   LEU A CG  1 
ATOM   296  C CD1 . LEU A 1 48  ? 40.194  75.979  15.835  1.00 27.86 ? 92   LEU A CD1 1 
ATOM   297  C CD2 . LEU A 1 48  ? 42.372  75.013  15.058  1.00 26.20 ? 92   LEU A CD2 1 
ATOM   298  N N   . VAL A 1 49  ? 42.453  71.127  17.546  1.00 23.95 ? 93   VAL A N   1 
ATOM   299  C CA  . VAL A 1 49  ? 42.582  70.489  18.845  1.00 24.34 ? 93   VAL A CA  1 
ATOM   300  C C   . VAL A 1 49  ? 43.321  71.501  19.739  1.00 25.10 ? 93   VAL A C   1 
ATOM   301  O O   . VAL A 1 49  ? 44.364  71.975  19.363  1.00 25.41 ? 93   VAL A O   1 
ATOM   302  C CB  . VAL A 1 49  ? 43.362  69.146  18.709  1.00 24.91 ? 93   VAL A CB  1 
ATOM   303  C CG1 . VAL A 1 49  ? 43.718  68.541  20.099  1.00 25.18 ? 93   VAL A CG1 1 
ATOM   304  C CG2 . VAL A 1 49  ? 42.559  68.139  17.869  1.00 24.08 ? 93   VAL A CG2 1 
ATOM   305  N N   . LEU A 1 50  ? 42.716  71.902  20.847  1.00 26.98 ? 94   LEU A N   1 
ATOM   306  C CA  . LEU A 1 50  ? 43.308  72.862  21.770  1.00 29.73 ? 94   LEU A CA  1 
ATOM   307  C C   . LEU A 1 50  ? 43.572  72.198  23.130  1.00 31.69 ? 94   LEU A C   1 
ATOM   308  O O   . LEU A 1 50  ? 42.821  71.323  23.549  1.00 31.91 ? 94   LEU A O   1 
ATOM   309  C CB  . LEU A 1 50  ? 42.377  74.057  21.940  1.00 29.69 ? 94   LEU A CB  1 
ATOM   310  C CG  . LEU A 1 50  ? 42.601  75.108  23.043  1.00 31.65 ? 94   LEU A CG  1 
ATOM   311  C CD1 . LEU A 1 50  ? 43.846  75.998  22.796  1.00 27.92 ? 94   LEU A CD1 1 
ATOM   312  C CD2 . LEU A 1 50  ? 41.358  75.988  23.207  1.00 29.72 ? 94   LEU A CD2 1 
ATOM   313  N N   . THR A 1 51  ? 44.646  72.618  23.805  1.00 34.03 ? 95   THR A N   1 
ATOM   314  C CA  . THR A 1 51  ? 45.028  72.107  25.124  1.00 35.93 ? 95   THR A CA  1 
ATOM   315  C C   . THR A 1 51  ? 45.282  73.277  26.087  1.00 37.75 ? 95   THR A C   1 
ATOM   316  O O   . THR A 1 51  ? 45.711  74.368  25.686  1.00 37.80 ? 95   THR A O   1 
ATOM   317  C CB  . THR A 1 51  ? 46.356  71.357  25.086  1.00 35.34 ? 95   THR A CB  1 
ATOM   318  O OG1 . THR A 1 51  ? 47.387  72.326  24.962  1.00 34.45 ? 95   THR A OG1 1 
ATOM   319  C CG2 . THR A 1 51  ? 46.439  70.389  23.918  1.00 36.58 ? 95   THR A CG2 1 
ATOM   320  N N   . THR A 1 52  ? 45.047  73.019  27.364  1.00 39.75 ? 96   THR A N   1 
ATOM   321  C CA  . THR A 1 52  ? 45.328  73.976  28.420  1.00 42.32 ? 96   THR A CA  1 
ATOM   322  C C   . THR A 1 52  ? 45.694  73.211  29.693  1.00 43.48 ? 96   THR A C   1 
ATOM   323  O O   . THR A 1 52  ? 44.961  72.316  30.119  1.00 43.54 ? 96   THR A O   1 
ATOM   324  C CB  . THR A 1 52  ? 44.100  74.835  28.685  1.00 42.43 ? 96   THR A CB  1 
ATOM   325  O OG1 . THR A 1 52  ? 44.160  75.400  30.001  1.00 43.96 ? 96   THR A OG1 1 
ATOM   326  C CG2 . THR A 1 52  ? 42.872  73.962  28.584  1.00 43.30 ? 96   THR A CG2 1 
ATOM   327  N N   . PHE A 1 53  ? 46.837  73.564  30.276  1.00 45.16 ? 97   PHE A N   1 
ATOM   328  C CA  . PHE A 1 53  ? 47.265  73.049  31.583  1.00 46.82 ? 97   PHE A CA  1 
ATOM   329  C C   . PHE A 1 53  ? 47.921  74.166  32.357  1.00 47.65 ? 97   PHE A C   1 
ATOM   330  O O   . PHE A 1 53  ? 48.438  75.125  31.768  1.00 47.31 ? 97   PHE A O   1 
ATOM   331  C CB  . PHE A 1 53  ? 48.248  71.890  31.441  1.00 47.20 ? 97   PHE A CB  1 
ATOM   332  C CG  . PHE A 1 53  ? 49.375  72.161  30.487  1.00 47.83 ? 97   PHE A CG  1 
ATOM   333  C CD1 . PHE A 1 53  ? 50.643  72.467  30.966  1.00 50.06 ? 97   PHE A CD1 1 
ATOM   334  C CD2 . PHE A 1 53  ? 49.170  72.094  29.101  1.00 50.38 ? 97   PHE A CD2 1 
ATOM   335  C CE1 . PHE A 1 53  ? 51.699  72.715  30.081  1.00 50.85 ? 97   PHE A CE1 1 
ATOM   336  C CE2 . PHE A 1 53  ? 50.212  72.333  28.197  1.00 50.56 ? 97   PHE A CE2 1 
ATOM   337  C CZ  . PHE A 1 53  ? 51.482  72.650  28.692  1.00 50.68 ? 97   PHE A CZ  1 
ATOM   338  N N   . HIS A 1 54  ? 47.892  74.041  33.679  1.00 49.49 ? 98   HIS A N   1 
ATOM   339  C CA  . HIS A 1 54  ? 48.612  74.956  34.559  1.00 50.79 ? 98   HIS A CA  1 
ATOM   340  C C   . HIS A 1 54  ? 49.775  74.195  35.150  1.00 51.97 ? 98   HIS A C   1 
ATOM   341  O O   . HIS A 1 54  ? 49.724  72.964  35.246  1.00 52.16 ? 98   HIS A O   1 
ATOM   342  C CB  . HIS A 1 54  ? 47.702  75.449  35.678  1.00 50.92 ? 98   HIS A CB  1 
ATOM   343  C CG  . HIS A 1 54  ? 46.673  76.440  35.232  1.00 51.72 ? 98   HIS A CG  1 
ATOM   344  N ND1 . HIS A 1 54  ? 45.676  76.127  34.331  1.00 52.94 ? 98   HIS A ND1 1 
ATOM   345  C CD2 . HIS A 1 54  ? 46.477  77.735  35.575  1.00 52.72 ? 98   HIS A CD2 1 
ATOM   346  C CE1 . HIS A 1 54  ? 44.918  77.190  34.129  1.00 53.44 ? 98   HIS A CE1 1 
ATOM   347  N NE2 . HIS A 1 54  ? 45.380  78.179  34.876  1.00 53.46 ? 98   HIS A NE2 1 
ATOM   348  N N   . VAL A 1 55  ? 50.825  74.918  35.537  1.00 53.38 ? 99   VAL A N   1 
ATOM   349  C CA  . VAL A 1 55  ? 51.923  74.321  36.302  1.00 54.65 ? 99   VAL A CA  1 
ATOM   350  C C   . VAL A 1 55  ? 51.890  74.849  37.751  1.00 55.51 ? 99   VAL A C   1 
ATOM   351  O O   . VAL A 1 55  ? 52.545  75.851  38.078  1.00 56.00 ? 99   VAL A O   1 
ATOM   352  C CB  . VAL A 1 55  ? 53.313  74.479  35.588  1.00 54.72 ? 99   VAL A CB  1 
ATOM   353  C CG1 . VAL A 1 55  ? 53.713  75.965  35.409  1.00 54.81 ? 99   VAL A CG1 1 
ATOM   354  C CG2 . VAL A 1 55  ? 54.397  73.673  36.316  1.00 54.64 ? 99   VAL A CG2 1 
ATOM   355  N N   . PRO A 1 56  ? 51.088  74.190  38.617  1.00 56.21 ? 100  PRO A N   1 
ATOM   356  C CA  . PRO A 1 56  ? 50.779  74.678  39.974  1.00 56.43 ? 100  PRO A CA  1 
ATOM   357  C C   . PRO A 1 56  ? 51.718  74.297  41.139  1.00 56.63 ? 100  PRO A C   1 
ATOM   358  O O   . PRO A 1 56  ? 51.708  73.153  41.606  1.00 56.85 ? 100  PRO A O   1 
ATOM   359  C CB  . PRO A 1 56  ? 49.362  74.114  40.225  1.00 56.59 ? 100  PRO A CB  1 
ATOM   360  C CG  . PRO A 1 56  ? 49.010  73.267  38.942  1.00 56.52 ? 100  PRO A CG  1 
ATOM   361  C CD  . PRO A 1 56  ? 50.336  72.957  38.328  1.00 56.22 ? 100  PRO A CD  1 
ATOM   362  N N   . LEU A 1 57  ? 52.508  75.270  41.596  1.00 56.69 ? 101  LEU A N   1 
ATOM   363  C CA  . LEU A 1 57  ? 53.155  75.243  42.919  1.00 56.64 ? 101  LEU A CA  1 
ATOM   364  C C   . LEU A 1 57  ? 53.352  76.676  43.413  1.00 56.74 ? 101  LEU A C   1 
ATOM   365  O O   . LEU A 1 57  ? 53.540  76.861  44.678  1.00 57.00 ? 101  LEU A O   1 
ATOM   366  C CB  . LEU A 1 57  ? 54.508  74.493  42.918  1.00 56.59 ? 101  LEU A CB  1 
ATOM   367  C CG  . LEU A 1 57  ? 54.612  72.996  43.331  1.00 56.37 ? 101  LEU A CG  1 
ATOM   368  C CD1 . LEU A 1 57  ? 56.139  72.514  43.262  1.00 55.71 ? 101  LEU A CD1 1 
ATOM   369  C CD2 . LEU A 1 57  ? 53.827  72.759  44.796  1.00 55.52 ? 101  LEU A CD2 1 
ATOM   370  N N   . GLY A 1 63  ? 50.606  78.970  32.897  1.00 25.94 ? 107  GLY A N   1 
ATOM   371  C CA  . GLY A 1 63  ? 49.600  78.384  31.976  1.00 27.04 ? 107  GLY A CA  1 
ATOM   372  C C   . GLY A 1 63  ? 50.091  78.367  30.533  1.00 27.01 ? 107  GLY A C   1 
ATOM   373  O O   . GLY A 1 63  ? 50.500  79.416  29.991  1.00 27.42 ? 107  GLY A O   1 
ATOM   374  N N   . GLN A 1 64  ? 50.051  77.181  29.906  1.00 27.02 ? 108  GLN A N   1 
ATOM   375  C CA  . GLN A 1 64  ? 50.483  77.050  28.504  1.00 27.27 ? 108  GLN A CA  1 
ATOM   376  C C   . GLN A 1 64  ? 49.419  76.359  27.629  1.00 26.91 ? 108  GLN A C   1 
ATOM   377  O O   . GLN A 1 64  ? 48.724  75.426  28.065  1.00 26.67 ? 108  GLN A O   1 
ATOM   378  C CB  . GLN A 1 64  ? 51.868  76.352  28.390  1.00 26.93 ? 108  GLN A CB  1 
ATOM   379  C CG  . GLN A 1 64  ? 53.089  77.276  28.964  1.00 28.68 ? 108  GLN A CG  1 
ATOM   380  C CD  . GLN A 1 64  ? 54.446  76.486  29.067  1.00 29.30 ? 108  GLN A CD  1 
ATOM   381  O OE1 . GLN A 1 64  ? 54.492  75.256  28.909  1.00 32.83 ? 108  GLN A OE1 1 
ATOM   382  N NE2 . GLN A 1 64  ? 55.548  77.210  29.333  1.00 29.05 ? 108  GLN A NE2 1 
ATOM   383  N N   . SER A 1 65  ? 49.275  76.826  26.395  1.00 26.61 ? 109  SER A N   1 
ATOM   384  C CA  . SER A 1 65  ? 48.299  76.223  25.478  1.00 25.75 ? 109  SER A CA  1 
ATOM   385  C C   . SER A 1 65  ? 48.931  75.776  24.200  1.00 25.15 ? 109  SER A C   1 
ATOM   386  O O   . SER A 1 65  ? 49.865  76.402  23.705  1.00 24.92 ? 109  SER A O   1 
ATOM   387  C CB  . SER A 1 65  ? 47.192  77.191  25.136  1.00 25.83 ? 109  SER A CB  1 
ATOM   388  O OG  . SER A 1 65  ? 46.244  77.216  26.167  1.00 27.60 ? 109  SER A OG  1 
ATOM   389  N N   . LYS A 1 66  ? 48.387  74.690  23.662  1.00 24.66 ? 110  LYS A N   1 
ATOM   390  C CA  . LYS A 1 66  ? 48.853  74.126  22.426  1.00 24.00 ? 110  LYS A CA  1 
ATOM   391  C C   . LYS A 1 66  ? 47.652  74.063  21.509  1.00 22.76 ? 110  LYS A C   1 
ATOM   392  O O   . LYS A 1 66  ? 46.540  73.851  21.959  1.00 22.45 ? 110  LYS A O   1 
ATOM   393  C CB  . LYS A 1 66  ? 49.479  72.751  22.642  1.00 24.91 ? 110  LYS A CB  1 
ATOM   394  C CG  . LYS A 1 66  ? 50.641  72.707  23.668  1.00 28.38 ? 110  LYS A CG  1 
ATOM   395  C CD  . LYS A 1 66  ? 51.914  73.213  23.078  1.00 32.29 ? 110  LYS A CD  1 
ATOM   396  C CE  . LYS A 1 66  ? 52.134  72.565  21.713  1.00 36.32 ? 110  LYS A CE  1 
ATOM   397  N NZ  . LYS A 1 66  ? 53.079  73.425  20.915  1.00 41.08 ? 110  LYS A NZ  1 
ATOM   398  N N   . LEU A 1 67  ? 47.881  74.366  20.245  1.00 21.67 ? 111  LEU A N   1 
ATOM   399  C CA  . LEU A 1 67  ? 46.840  74.355  19.236  1.00 21.18 ? 111  LEU A CA  1 
ATOM   400  C C   . LEU A 1 67  ? 47.318  73.547  18.046  1.00 20.41 ? 111  LEU A C   1 
ATOM   401  O O   . LEU A 1 67  ? 48.403  73.778  17.520  1.00 20.70 ? 111  LEU A O   1 
ATOM   402  C CB  . LEU A 1 67  ? 46.498  75.772  18.802  1.00 21.10 ? 111  LEU A CB  1 
ATOM   403  C CG  . LEU A 1 67  ? 45.247  75.977  17.931  1.00 21.42 ? 111  LEU A CG  1 
ATOM   404  C CD1 . LEU A 1 67  ? 43.940  75.516  18.633  1.00 23.00 ? 111  LEU A CD1 1 
ATOM   405  C CD2 . LEU A 1 67  ? 45.116  77.446  17.521  1.00 21.59 ? 111  LEU A CD2 1 
ATOM   406  N N   . TYR A 1 68  ? 46.488  72.617  17.608  1.00 19.33 ? 112  TYR A N   1 
ATOM   407  C CA  . TYR A 1 68  ? 46.825  71.784  16.482  1.00 19.14 ? 112  TYR A CA  1 
ATOM   408  C C   . TYR A 1 68  ? 45.700  71.889  15.444  1.00 17.00 ? 112  TYR A C   1 
ATOM   409  O O   . TYR A 1 68  ? 44.554  72.029  15.800  1.00 18.36 ? 112  TYR A O   1 
ATOM   410  C CB  . TYR A 1 68  ? 46.944  70.323  16.920  1.00 20.20 ? 112  TYR A CB  1 
ATOM   411  C CG  . TYR A 1 68  ? 48.028  70.033  17.928  1.00 20.47 ? 112  TYR A CG  1 
ATOM   412  C CD1 . TYR A 1 68  ? 49.316  69.722  17.521  1.00 22.54 ? 112  TYR A CD1 1 
ATOM   413  C CD2 . TYR A 1 68  ? 47.753  70.066  19.288  1.00 22.84 ? 112  TYR A CD2 1 
ATOM   414  C CE1 . TYR A 1 68  ? 50.317  69.492  18.471  1.00 23.69 ? 112  TYR A CE1 1 
ATOM   415  C CE2 . TYR A 1 68  ? 48.711  69.807  20.235  1.00 19.13 ? 112  TYR A CE2 1 
ATOM   416  C CZ  . TYR A 1 68  ? 49.990  69.519  19.824  1.00 23.04 ? 112  TYR A CZ  1 
ATOM   417  O OH  . TYR A 1 68  ? 50.971  69.279  20.794  1.00 25.45 ? 112  TYR A OH  1 
ATOM   418  N N   . ARG A 1 69  ? 46.020  71.761  14.181  1.00 18.06 ? 113  ARG A N   1 
ATOM   419  C CA  . ARG A 1 69  ? 45.006  71.868  13.141  1.00 19.35 ? 113  ARG A CA  1 
ATOM   420  C C   . ARG A 1 69  ? 45.152  70.802  12.110  1.00 20.65 ? 113  ARG A C   1 
ATOM   421  O O   . ARG A 1 69  ? 46.240  70.625  11.570  1.00 20.51 ? 113  ARG A O   1 
ATOM   422  C CB  . ARG A 1 69  ? 45.175  73.190  12.417  1.00 17.78 ? 113  ARG A CB  1 
ATOM   423  C CG  . ARG A 1 69  ? 44.091  73.470  11.394  1.00 20.25 ? 113  ARG A CG  1 
ATOM   424  C CD  . ARG A 1 69  ? 44.225  74.884  10.852  1.00 21.36 ? 113  ARG A CD  1 
ATOM   425  N NE  . ARG A 1 69  ? 43.271  75.207  9.774   1.00 20.16 ? 113  ARG A NE  1 
ATOM   426  C CZ  . ARG A 1 69  ? 43.383  74.877  8.505   1.00 17.33 ? 113  ARG A CZ  1 
ATOM   427  N NH1 . ARG A 1 69  ? 44.472  74.250  8.024   1.00 21.07 ? 113  ARG A NH1 1 
ATOM   428  N NH2 . ARG A 1 69  ? 42.428  75.289  7.682   1.00 20.53 ? 113  ARG A NH2 1 
ATOM   429  N N   . SER A 1 70  ? 44.035  70.172  11.748  1.00 20.89 ? 114  SER A N   1 
ATOM   430  C CA  . SER A 1 70  ? 44.012  69.241  10.606  1.00 22.48 ? 114  SER A CA  1 
ATOM   431  C C   . SER A 1 70  ? 43.183  69.880  9.495   1.00 22.63 ? 114  SER A C   1 
ATOM   432  O O   . SER A 1 70  ? 42.218  70.624  9.787   1.00 23.50 ? 114  SER A O   1 
ATOM   433  C CB  . SER A 1 70  ? 43.327  67.903  11.054  1.00 22.67 ? 114  SER A CB  1 
ATOM   434  O OG  . SER A 1 70  ? 43.259  66.969  9.968   1.00 26.07 ? 114  SER A OG  1 
ATOM   435  N N   . GLU A 1 71  ? 43.494  69.574  8.237   1.00 22.25 ? 115  GLU A N   1 
ATOM   436  C CA  . GLU A 1 71  ? 42.623  69.926  7.117   1.00 24.71 ? 115  GLU A CA  1 
ATOM   437  C C   . GLU A 1 71  ? 42.259  68.665  6.354   1.00 24.15 ? 115  GLU A C   1 
ATOM   438  O O   . GLU A 1 71  ? 41.681  68.710  5.277   1.00 23.88 ? 115  GLU A O   1 
ATOM   439  C CB  . GLU A 1 71  ? 43.226  71.017  6.197   1.00 24.13 ? 115  GLU A CB  1 
ATOM   440  C CG  . GLU A 1 71  ? 44.798  70.961  6.063   1.00 27.44 ? 115  GLU A CG  1 
ATOM   441  C CD  . GLU A 1 71  ? 45.360  72.203  5.389   1.00 31.27 ? 115  GLU A CD  1 
ATOM   442  O OE1 . GLU A 1 71  ? 44.526  72.951  4.803   1.00 35.75 ? 115  GLU A OE1 1 
ATOM   443  O OE2 . GLU A 1 71  ? 46.623  72.441  5.450   1.00 40.29 ? 115  GLU A OE2 1 
ATOM   444  N N   . ASP A 1 72  ? 42.498  67.521  6.960   1.00 23.97 ? 116  ASP A N   1 
ATOM   445  C CA  . ASP A 1 72  ? 42.138  66.283  6.274   1.00 24.78 ? 116  ASP A CA  1 
ATOM   446  C C   . ASP A 1 72  ? 41.366  65.312  7.148   1.00 23.67 ? 116  ASP A C   1 
ATOM   447  O O   . ASP A 1 72  ? 41.612  64.136  7.041   1.00 24.95 ? 116  ASP A O   1 
ATOM   448  C CB  . ASP A 1 72  ? 43.330  65.550  5.638   1.00 24.96 ? 116  ASP A CB  1 
ATOM   449  C CG  . ASP A 1 72  ? 44.460  65.284  6.615   1.00 30.12 ? 116  ASP A CG  1 
ATOM   450  O OD1 . ASP A 1 72  ? 44.249  65.364  7.842   1.00 31.14 ? 116  ASP A OD1 1 
ATOM   451  O OD2 . ASP A 1 72  ? 45.614  65.015  6.151   1.00 36.16 ? 116  ASP A OD2 1 
ATOM   452  N N   . TYR A 1 73  ? 40.422  65.785  7.956   1.00 22.35 ? 117  TYR A N   1 
ATOM   453  C CA  . TYR A 1 73  ? 39.564  64.854  8.763   1.00 21.74 ? 117  TYR A CA  1 
ATOM   454  C C   . TYR A 1 73  ? 40.373  64.133  9.834   1.00 22.25 ? 117  TYR A C   1 
ATOM   455  O O   . TYR A 1 73  ? 39.973  63.068  10.339  1.00 24.31 ? 117  TYR A O   1 
ATOM   456  C CB  . TYR A 1 73  ? 38.876  63.861  7.844   1.00 20.79 ? 117  TYR A CB  1 
ATOM   457  C CG  . TYR A 1 73  ? 37.753  64.493  7.080   1.00 20.94 ? 117  TYR A CG  1 
ATOM   458  C CD1 . TYR A 1 73  ? 36.451  64.414  7.565   1.00 17.98 ? 117  TYR A CD1 1 
ATOM   459  C CD2 . TYR A 1 73  ? 37.999  65.227  5.884   1.00 20.04 ? 117  TYR A CD2 1 
ATOM   460  C CE1 . TYR A 1 73  ? 35.382  65.037  6.841   1.00 20.20 ? 117  TYR A CE1 1 
ATOM   461  C CE2 . TYR A 1 73  ? 36.967  65.800  5.154   1.00 17.77 ? 117  TYR A CE2 1 
ATOM   462  C CZ  . TYR A 1 73  ? 35.668  65.740  5.663   1.00 21.20 ? 117  TYR A CZ  1 
ATOM   463  O OH  . TYR A 1 73  ? 34.605  66.363  4.981   1.00 21.09 ? 117  TYR A OH  1 
ATOM   464  N N   . GLY A 1 74  ? 41.524  64.706  10.195  1.00 24.03 ? 118  GLY A N   1 
ATOM   465  C CA  . GLY A 1 74  ? 42.267  64.241  11.372  1.00 22.94 ? 118  GLY A CA  1 
ATOM   466  C C   . GLY A 1 74  ? 43.419  63.340  11.029  1.00 25.10 ? 118  GLY A C   1 
ATOM   467  O O   . GLY A 1 74  ? 44.171  62.937  11.918  1.00 24.68 ? 118  GLY A O   1 
ATOM   468  N N   . LYS A 1 75  ? 43.639  63.108  9.739   1.00 25.34 ? 119  LYS A N   1 
ATOM   469  C CA  . LYS A 1 75  ? 44.701  62.212  9.330   1.00 26.69 ? 119  LYS A CA  1 
ATOM   470  C C   . LYS A 1 75  ? 46.067  62.787  9.720   1.00 27.55 ? 119  LYS A C   1 
ATOM   471  O O   . LYS A 1 75  ? 46.874  62.118  10.360  1.00 28.11 ? 119  LYS A O   1 
ATOM   472  C CB  . LYS A 1 75  ? 44.613  61.915  7.844   1.00 25.60 ? 119  LYS A CB  1 
ATOM   473  C CG  . LYS A 1 75  ? 43.464  60.986  7.535   1.00 23.88 ? 119  LYS A CG  1 
ATOM   474  C CD  . LYS A 1 75  ? 43.214  60.887  6.031   1.00 23.81 ? 119  LYS A CD  1 
ATOM   475  C CE  . LYS A 1 75  ? 41.859  60.179  5.752   1.00 28.03 ? 119  LYS A CE  1 
ATOM   476  N NZ  . LYS A 1 75  ? 41.704  59.736  4.327   1.00 28.09 ? 119  LYS A NZ  1 
ATOM   477  N N   . ASN A 1 76  ? 46.285  64.048  9.372   1.00 28.60 ? 120  ASN A N   1 
ATOM   478  C CA  . ASN A 1 76  ? 47.497  64.771  9.728   1.00 28.92 ? 120  ASN A CA  1 
ATOM   479  C C   . ASN A 1 76  ? 47.178  66.028  10.513  1.00 27.75 ? 120  ASN A C   1 
ATOM   480  O O   . ASN A 1 76  ? 46.272  66.751  10.138  1.00 28.07 ? 120  ASN A O   1 
ATOM   481  C CB  . ASN A 1 76  ? 48.254  65.113  8.447   1.00 29.86 ? 120  ASN A CB  1 
ATOM   482  C CG  . ASN A 1 76  ? 48.665  63.866  7.676   1.00 31.89 ? 120  ASN A CG  1 
ATOM   483  O OD1 . ASN A 1 76  ? 49.601  63.181  8.070   1.00 32.53 ? 120  ASN A OD1 1 
ATOM   484  N ND2 . ASN A 1 76  ? 47.956  63.558  6.582   1.00 31.41 ? 120  ASN A ND2 1 
ATOM   485  N N   . PHE A 1 77  ? 47.871  66.255  11.623  1.00 26.59 ? 121  PHE A N   1 
ATOM   486  C CA  . PHE A 1 77  ? 47.859  67.569  12.267  1.00 26.23 ? 121  PHE A CA  1 
ATOM   487  C C   . PHE A 1 77  ? 49.179  68.361  12.121  1.00 27.32 ? 121  PHE A C   1 
ATOM   488  O O   . PHE A 1 77  ? 50.240  67.795  11.870  1.00 28.50 ? 121  PHE A O   1 
ATOM   489  C CB  . PHE A 1 77  ? 47.522  67.434  13.743  1.00 25.71 ? 121  PHE A CB  1 
ATOM   490  C CG  . PHE A 1 77  ? 46.120  66.990  14.000  1.00 24.22 ? 121  PHE A CG  1 
ATOM   491  C CD1 . PHE A 1 77  ? 45.173  67.896  14.415  1.00 23.13 ? 121  PHE A CD1 1 
ATOM   492  C CD2 . PHE A 1 77  ? 45.740  65.666  13.791  1.00 24.45 ? 121  PHE A CD2 1 
ATOM   493  C CE1 . PHE A 1 77  ? 43.893  67.518  14.662  1.00 26.14 ? 121  PHE A CE1 1 
ATOM   494  C CE2 . PHE A 1 77  ? 44.435  65.277  14.038  1.00 26.39 ? 121  PHE A CE2 1 
ATOM   495  C CZ  . PHE A 1 77  ? 43.499  66.219  14.462  1.00 25.03 ? 121  PHE A CZ  1 
ATOM   496  N N   . LYS A 1 78  ? 49.079  69.683  12.294  1.00 27.63 ? 122  LYS A N   1 
ATOM   497  C CA  . LYS A 1 78  ? 50.175  70.642  12.298  1.00 28.33 ? 122  LYS A CA  1 
ATOM   498  C C   . LYS A 1 78  ? 50.079  71.425  13.607  1.00 26.60 ? 122  LYS A C   1 
ATOM   499  O O   . LYS A 1 78  ? 49.005  71.859  13.995  1.00 26.78 ? 122  LYS A O   1 
ATOM   500  C CB  . LYS A 1 78  ? 49.990  71.578  11.088  1.00 28.33 ? 122  LYS A CB  1 
ATOM   501  C CG  . LYS A 1 78  ? 50.868  72.809  11.025  1.00 31.90 ? 122  LYS A CG  1 
ATOM   502  C CD  . LYS A 1 78  ? 50.517  73.658  9.793   1.00 32.24 ? 122  LYS A CD  1 
ATOM   503  C CE  . LYS A 1 78  ? 51.258  73.168  8.524   1.00 37.52 ? 122  LYS A CE  1 
ATOM   504  N NZ  . LYS A 1 78  ? 52.494  73.955  8.252   1.00 39.29 ? 122  LYS A NZ  1 
ATOM   505  N N   . ASP A 1 79  ? 51.179  71.577  14.318  1.00 25.62 ? 123  ASP A N   1 
ATOM   506  C CA  . ASP A 1 79  ? 51.192  72.395  15.518  1.00 24.43 ? 123  ASP A CA  1 
ATOM   507  C C   . ASP A 1 79  ? 51.112  73.864  15.046  1.00 24.16 ? 123  ASP A C   1 
ATOM   508  O O   . ASP A 1 79  ? 52.000  74.323  14.325  1.00 22.28 ? 123  ASP A O   1 
ATOM   509  C CB  . ASP A 1 79  ? 52.485  72.088  16.266  1.00 24.67 ? 123  ASP A CB  1 
ATOM   510  C CG  . ASP A 1 79  ? 52.534  72.666  17.677  1.00 27.50 ? 123  ASP A CG  1 
ATOM   511  O OD1 . ASP A 1 79  ? 51.676  73.509  18.025  1.00 28.95 ? 123  ASP A OD1 1 
ATOM   512  O OD2 . ASP A 1 79  ? 53.477  72.278  18.447  1.00 30.97 ? 123  ASP A OD2 1 
ATOM   513  N N   . ILE A 1 80  ? 50.048  74.591  15.401  1.00 22.50 ? 124  ILE A N   1 
ATOM   514  C CA  . ILE A 1 80  ? 49.947  75.996  14.973  1.00 22.21 ? 124  ILE A CA  1 
ATOM   515  C C   . ILE A 1 80  ? 49.966  76.919  16.187  1.00 22.44 ? 124  ILE A C   1 
ATOM   516  O O   . ILE A 1 80  ? 49.498  78.060  16.117  1.00 22.08 ? 124  ILE A O   1 
ATOM   517  C CB  . ILE A 1 80  ? 48.689  76.277  14.068  1.00 22.60 ? 124  ILE A CB  1 
ATOM   518  C CG1 . ILE A 1 80  ? 47.410  75.796  14.756  1.00 22.20 ? 124  ILE A CG1 1 
ATOM   519  C CG2 . ILE A 1 80  ? 48.799  75.535  12.745  1.00 23.53 ? 124  ILE A CG2 1 
ATOM   520  C CD1 . ILE A 1 80  ? 46.109  76.382  14.142  1.00 20.60 ? 124  ILE A CD1 1 
ATOM   521  N N   . THR A 1 81  ? 50.538  76.426  17.288  1.00 22.31 ? 125  THR A N   1 
ATOM   522  C CA  . THR A 1 81  ? 50.652  77.174  18.545  1.00 23.89 ? 125  THR A CA  1 
ATOM   523  C C   . THR A 1 81  ? 51.324  78.526  18.316  1.00 24.29 ? 125  THR A C   1 
ATOM   524  O O   . THR A 1 81  ? 50.985  79.557  18.923  1.00 24.65 ? 125  THR A O   1 
ATOM   525  C CB  . THR A 1 81  ? 51.467  76.358  19.591  1.00 23.43 ? 125  THR A CB  1 
ATOM   526  O OG1 . THR A 1 81  ? 50.848  75.070  19.767  1.00 25.77 ? 125  THR A OG1 1 
ATOM   527  C CG2 . THR A 1 81  ? 51.498  77.085  20.919  1.00 24.16 ? 125  THR A CG2 1 
ATOM   528  N N   . ASP A 1 82  ? 52.281  78.516  17.411  1.00 25.10 ? 126  ASP A N   1 
ATOM   529  C CA  . ASP A 1 82  ? 52.961  79.747  17.043  1.00 26.43 ? 126  ASP A CA  1 
ATOM   530  C C   . ASP A 1 82  ? 51.964  80.835  16.565  1.00 26.53 ? 126  ASP A C   1 
ATOM   531  O O   . ASP A 1 82  ? 52.140  82.003  16.851  1.00 27.78 ? 126  ASP A O   1 
ATOM   532  C CB  . ASP A 1 82  ? 54.125  79.464  16.073  1.00 26.23 ? 126  ASP A CB  1 
ATOM   533  C CG  . ASP A 1 82  ? 54.010  78.099  15.336  1.00 31.23 ? 126  ASP A CG  1 
ATOM   534  O OD1 . ASP A 1 82  ? 53.326  77.097  15.804  1.00 30.56 ? 126  ASP A OD1 1 
ATOM   535  O OD2 . ASP A 1 82  ? 54.648  78.022  14.256  1.00 32.67 ? 126  ASP A OD2 1 
ATOM   536  N N   . LEU A 1 83  ? 50.882  80.442  15.908  1.00 27.02 ? 127  LEU A N   1 
ATOM   537  C CA  . LEU A 1 83  ? 49.884  81.397  15.478  1.00 27.47 ? 127  LEU A CA  1 
ATOM   538  C C   . LEU A 1 83  ? 49.244  82.164  16.615  1.00 28.74 ? 127  LEU A C   1 
ATOM   539  O O   . LEU A 1 83  ? 48.879  83.321  16.446  1.00 28.79 ? 127  LEU A O   1 
ATOM   540  C CB  . LEU A 1 83  ? 48.798  80.738  14.643  1.00 27.12 ? 127  LEU A CB  1 
ATOM   541  C CG  . LEU A 1 83  ? 49.151  80.189  13.269  1.00 25.97 ? 127  LEU A CG  1 
ATOM   542  C CD1 . LEU A 1 83  ? 47.914  80.108  12.449  1.00 22.43 ? 127  LEU A CD1 1 
ATOM   543  C CD2 . LEU A 1 83  ? 50.169  81.119  12.568  1.00 26.16 ? 127  LEU A CD2 1 
ATOM   544  N N   . ILE A 1 84  ? 49.106  81.544  17.775  1.00 29.54 ? 128  ILE A N   1 
ATOM   545  C CA  . ILE A 1 84  ? 48.513  82.265  18.886  1.00 30.62 ? 128  ILE A CA  1 
ATOM   546  C C   . ILE A 1 84  ? 49.608  82.871  19.790  1.00 31.84 ? 128  ILE A C   1 
ATOM   547  O O   . ILE A 1 84  ? 49.359  83.190  20.951  1.00 32.62 ? 128  ILE A O   1 
ATOM   548  C CB  . ILE A 1 84  ? 47.502  81.409  19.676  1.00 29.72 ? 128  ILE A CB  1 
ATOM   549  C CG1 . ILE A 1 84  ? 48.173  80.175  20.256  1.00 29.41 ? 128  ILE A CG1 1 
ATOM   550  C CG2 . ILE A 1 84  ? 46.335  81.035  18.790  1.00 30.28 ? 128  ILE A CG2 1 
ATOM   551  C CD1 . ILE A 1 84  ? 47.251  79.184  20.841  1.00 24.49 ? 128  ILE A CD1 1 
ATOM   552  N N   . ASN A 1 85  ? 50.815  83.040  19.252  1.00 33.49 ? 129  ASN A N   1 
ATOM   553  C CA  . ASN A 1 85  ? 51.953  83.579  20.023  1.00 34.70 ? 129  ASN A CA  1 
ATOM   554  C C   . ASN A 1 85  ? 52.173  82.815  21.321  1.00 35.00 ? 129  ASN A C   1 
ATOM   555  O O   . ASN A 1 85  ? 52.473  83.399  22.354  1.00 33.66 ? 129  ASN A O   1 
ATOM   556  C CB  . ASN A 1 85  ? 51.746  85.065  20.335  1.00 35.91 ? 129  ASN A CB  1 
ATOM   557  C CG  . ASN A 1 85  ? 51.989  85.965  19.137  1.00 37.70 ? 129  ASN A CG  1 
ATOM   558  O OD1 . ASN A 1 85  ? 51.802  85.569  17.983  1.00 41.93 ? 129  ASN A OD1 1 
ATOM   559  N ND2 . ASN A 1 85  ? 52.382  87.191  19.410  1.00 40.78 ? 129  ASN A ND2 1 
ATOM   560  N N   . ASN A 1 86  ? 51.968  81.496  21.266  1.00 36.20 ? 130  ASN A N   1 
ATOM   561  C CA  . ASN A 1 86  ? 52.120  80.636  22.450  1.00 37.22 ? 130  ASN A CA  1 
ATOM   562  C C   . ASN A 1 86  ? 51.348  81.199  23.651  1.00 37.34 ? 130  ASN A C   1 
ATOM   563  O O   . ASN A 1 86  ? 51.770  81.030  24.807  1.00 37.68 ? 130  ASN A O   1 
ATOM   564  C CB  . ASN A 1 86  ? 53.609  80.501  22.840  1.00 37.17 ? 130  ASN A CB  1 
ATOM   565  C CG  . ASN A 1 86  ? 54.514  80.240  21.648  1.00 38.06 ? 130  ASN A CG  1 
ATOM   566  O OD1 . ASN A 1 86  ? 54.715  79.099  21.248  1.00 39.94 ? 130  ASN A OD1 1 
ATOM   567  N ND2 . ASN A 1 86  ? 55.084  81.302  21.092  1.00 39.65 ? 130  ASN A ND2 1 
ATOM   568  N N   . THR A 1 87  ? 50.245  81.895  23.387  1.00 36.48 ? 131  THR A N   1 
ATOM   569  C CA  . THR A 1 87  ? 49.534  82.545  24.468  1.00 35.93 ? 131  THR A CA  1 
ATOM   570  C C   . THR A 1 87  ? 48.691  81.495  25.135  1.00 35.42 ? 131  THR A C   1 
ATOM   571  O O   . THR A 1 87  ? 48.315  80.506  24.497  1.00 36.25 ? 131  THR A O   1 
ATOM   572  C CB  . THR A 1 87  ? 48.665  83.697  23.963  1.00 35.96 ? 131  THR A CB  1 
ATOM   573  O OG1 . THR A 1 87  ? 49.515  84.763  23.517  1.00 35.67 ? 131  THR A OG1 1 
ATOM   574  C CG2 . THR A 1 87  ? 47.772  84.220  25.072  1.00 36.06 ? 131  THR A CG2 1 
ATOM   575  N N   . PHE A 1 88  ? 48.399  81.698  26.411  1.00 34.43 ? 132  PHE A N   1 
ATOM   576  C CA  . PHE A 1 88  ? 47.509  80.814  27.139  1.00 33.60 ? 132  PHE A CA  1 
ATOM   577  C C   . PHE A 1 88  ? 46.004  81.050  26.850  1.00 33.31 ? 132  PHE A C   1 
ATOM   578  O O   . PHE A 1 88  ? 45.438  82.087  27.200  1.00 32.41 ? 132  PHE A O   1 
ATOM   579  C CB  . PHE A 1 88  ? 47.815  80.909  28.617  1.00 34.17 ? 132  PHE A CB  1 
ATOM   580  C CG  . PHE A 1 88  ? 46.802  80.274  29.484  1.00 34.68 ? 132  PHE A CG  1 
ATOM   581  C CD1 . PHE A 1 88  ? 46.553  78.908  29.397  1.00 35.76 ? 132  PHE A CD1 1 
ATOM   582  C CD2 . PHE A 1 88  ? 46.128  81.033  30.433  1.00 37.68 ? 132  PHE A CD2 1 
ATOM   583  C CE1 . PHE A 1 88  ? 45.615  78.299  30.222  1.00 37.86 ? 132  PHE A CE1 1 
ATOM   584  C CE2 . PHE A 1 88  ? 45.191  80.442  31.275  1.00 38.91 ? 132  PHE A CE2 1 
ATOM   585  C CZ  . PHE A 1 88  ? 44.932  79.064  31.168  1.00 37.28 ? 132  PHE A CZ  1 
ATOM   586  N N   . ILE A 1 89  ? 45.365  80.063  26.220  1.00 32.57 ? 133  ILE A N   1 
ATOM   587  C CA  . ILE A 1 89  ? 43.960  80.176  25.860  1.00 33.22 ? 133  ILE A CA  1 
ATOM   588  C C   . ILE A 1 89  ? 43.079  79.647  26.977  1.00 34.51 ? 133  ILE A C   1 
ATOM   589  O O   . ILE A 1 89  ? 43.254  78.514  27.419  1.00 34.83 ? 133  ILE A O   1 
ATOM   590  C CB  . ILE A 1 89  ? 43.630  79.388  24.564  1.00 32.57 ? 133  ILE A CB  1 
ATOM   591  C CG1 . ILE A 1 89  ? 44.495  79.862  23.396  1.00 30.30 ? 133  ILE A CG1 1 
ATOM   592  C CG2 . ILE A 1 89  ? 42.143  79.498  24.240  1.00 33.33 ? 133  ILE A CG2 1 
ATOM   593  C CD1 . ILE A 1 89  ? 44.377  81.337  23.079  1.00 27.39 ? 133  ILE A CD1 1 
ATOM   594  N N   . ARG A 1 90  ? 42.121  80.455  27.412  1.00 35.68 ? 134  ARG A N   1 
ATOM   595  C CA  . ARG A 1 90  ? 41.210  80.057  28.467  1.00 38.01 ? 134  ARG A CA  1 
ATOM   596  C C   . ARG A 1 90  ? 40.146  79.107  27.915  1.00 39.73 ? 134  ARG A C   1 
ATOM   597  O O   . ARG A 1 90  ? 39.429  79.451  26.981  1.00 40.01 ? 134  ARG A O   1 
ATOM   598  C CB  . ARG A 1 90  ? 40.589  81.297  29.092  1.00 37.74 ? 134  ARG A CB  1 
ATOM   599  C CG  . ARG A 1 90  ? 41.627  82.224  29.721  1.00 38.35 ? 134  ARG A CG  1 
ATOM   600  C CD  . ARG A 1 90  ? 41.011  83.525  30.193  1.00 37.59 ? 134  ARG A CD  1 
ATOM   601  N NE  . ARG A 1 90  ? 40.074  83.312  31.290  1.00 39.11 ? 134  ARG A NE  1 
ATOM   602  C CZ  . ARG A 1 90  ? 39.235  84.233  31.747  1.00 38.90 ? 134  ARG A CZ  1 
ATOM   603  N NH1 . ARG A 1 90  ? 39.211  85.448  31.209  1.00 40.49 ? 134  ARG A NH1 1 
ATOM   604  N NH2 . ARG A 1 90  ? 38.416  83.936  32.741  1.00 38.50 ? 134  ARG A NH2 1 
ATOM   605  N N   . THR A 1 91  ? 40.066  77.907  28.483  1.00 41.88 ? 135  THR A N   1 
ATOM   606  C CA  . THR A 1 91  ? 39.224  76.819  27.931  1.00 43.86 ? 135  THR A CA  1 
ATOM   607  C C   . THR A 1 91  ? 37.752  77.021  28.255  1.00 43.97 ? 135  THR A C   1 
ATOM   608  O O   . THR A 1 91  ? 36.864  76.578  27.492  1.00 43.60 ? 135  THR A O   1 
ATOM   609  C CB  . THR A 1 91  ? 39.713  75.436  28.437  1.00 44.73 ? 135  THR A CB  1 
ATOM   610  O OG1 . THR A 1 91  ? 40.986  75.181  27.840  1.00 47.97 ? 135  THR A OG1 1 
ATOM   611  C CG2 . THR A 1 91  ? 38.753  74.278  28.039  1.00 44.79 ? 135  THR A CG2 1 
ATOM   612  N N   . GLU A 1 92  ? 37.537  77.686  29.392  1.00 43.97 ? 136  GLU A N   1 
ATOM   613  C CA  . GLU A 1 92  ? 36.248  78.175  29.863  1.00 44.55 ? 136  GLU A CA  1 
ATOM   614  C C   . GLU A 1 92  ? 35.377  78.721  28.717  1.00 44.08 ? 136  GLU A C   1 
ATOM   615  O O   . GLU A 1 92  ? 34.198  78.398  28.623  1.00 44.51 ? 136  GLU A O   1 
ATOM   616  C CB  . GLU A 1 92  ? 36.506  79.252  30.939  1.00 44.75 ? 136  GLU A CB  1 
ATOM   617  C CG  . GLU A 1 92  ? 35.299  79.722  31.784  1.00 47.25 ? 136  GLU A CG  1 
ATOM   618  C CD  . GLU A 1 92  ? 34.734  78.641  32.719  1.00 49.03 ? 136  GLU A CD  1 
ATOM   619  O OE1 . GLU A 1 92  ? 34.757  78.831  33.964  1.00 48.61 ? 136  GLU A OE1 1 
ATOM   620  O OE2 . GLU A 1 92  ? 34.261  77.604  32.200  1.00 51.08 ? 136  GLU A OE2 1 
ATOM   621  N N   . PHE A 1 93  ? 35.961  79.528  27.832  1.00 43.67 ? 137  PHE A N   1 
ATOM   622  C CA  . PHE A 1 93  ? 35.210  80.139  26.735  1.00 42.96 ? 137  PHE A CA  1 
ATOM   623  C C   . PHE A 1 93  ? 35.150  79.250  25.514  1.00 42.79 ? 137  PHE A C   1 
ATOM   624  O O   . PHE A 1 93  ? 34.438  79.559  24.551  1.00 43.65 ? 137  PHE A O   1 
ATOM   625  C CB  . PHE A 1 93  ? 35.812  81.488  26.360  1.00 43.01 ? 137  PHE A CB  1 
ATOM   626  C CG  . PHE A 1 93  ? 35.804  82.475  27.480  1.00 43.17 ? 137  PHE A CG  1 
ATOM   627  C CD1 . PHE A 1 93  ? 34.629  83.124  27.840  1.00 43.47 ? 137  PHE A CD1 1 
ATOM   628  C CD2 . PHE A 1 93  ? 36.962  82.742  28.189  1.00 43.22 ? 137  PHE A CD2 1 
ATOM   629  C CE1 . PHE A 1 93  ? 34.606  84.024  28.884  1.00 44.26 ? 137  PHE A CE1 1 
ATOM   630  C CE2 . PHE A 1 93  ? 36.952  83.654  29.236  1.00 44.42 ? 137  PHE A CE2 1 
ATOM   631  C CZ  . PHE A 1 93  ? 35.769  84.295  29.586  1.00 44.37 ? 137  PHE A CZ  1 
ATOM   632  N N   . GLY A 1 94  ? 35.907  78.155  25.538  1.00 42.14 ? 138  GLY A N   1 
ATOM   633  C CA  . GLY A 1 94  ? 36.029  77.267  24.369  1.00 40.77 ? 138  GLY A CA  1 
ATOM   634  C C   . GLY A 1 94  ? 36.420  78.014  23.087  1.00 40.09 ? 138  GLY A C   1 
ATOM   635  O O   . GLY A 1 94  ? 36.853  79.189  23.109  1.00 40.44 ? 138  GLY A O   1 
ATOM   636  N N   . MET A 1 95  ? 36.277  77.333  21.959  1.00 38.52 ? 139  MET A N   1 
ATOM   637  C CA  . MET A 1 95  ? 36.541  77.928  20.676  1.00 37.06 ? 139  MET A CA  1 
ATOM   638  C C   . MET A 1 95  ? 35.147  78.260  20.176  1.00 35.33 ? 139  MET A C   1 
ATOM   639  O O   . MET A 1 95  ? 34.253  77.386  20.174  1.00 36.15 ? 139  MET A O   1 
ATOM   640  C CB  . MET A 1 95  ? 37.242  76.929  19.748  1.00 36.85 ? 139  MET A CB  1 
ATOM   641  C CG  . MET A 1 95  ? 38.529  76.338  20.298  1.00 37.82 ? 139  MET A CG  1 
ATOM   642  S SD  . MET A 1 95  ? 39.263  75.019  19.236  1.00 39.88 ? 139  MET A SD  1 
ATOM   643  C CE  . MET A 1 95  ? 38.823  73.540  20.118  1.00 34.56 ? 139  MET A CE  1 
ATOM   644  N N   . ALA A 1 96  ? 34.927  79.513  19.787  1.00 32.00 ? 140  ALA A N   1 
ATOM   645  C CA  . ALA A 1 96  ? 33.603  79.914  19.357  1.00 28.86 ? 140  ALA A CA  1 
ATOM   646  C C   . ALA A 1 96  ? 33.629  79.827  17.851  1.00 28.04 ? 140  ALA A C   1 
ATOM   647  O O   . ALA A 1 96  ? 34.222  80.665  17.165  1.00 27.30 ? 140  ALA A O   1 
ATOM   648  C CB  . ALA A 1 96  ? 33.244  81.301  19.848  1.00 28.98 ? 140  ALA A CB  1 
ATOM   649  N N   . ILE A 1 97  ? 33.024  78.759  17.354  1.00 26.92 ? 141  ILE A N   1 
ATOM   650  C CA  . ILE A 1 97  ? 33.000  78.442  15.948  1.00 26.47 ? 141  ILE A CA  1 
ATOM   651  C C   . ILE A 1 97  ? 31.795  79.124  15.308  1.00 26.14 ? 141  ILE A C   1 
ATOM   652  O O   . ILE A 1 97  ? 30.703  79.078  15.834  1.00 24.17 ? 141  ILE A O   1 
ATOM   653  C CB  . ILE A 1 97  ? 32.951  76.936  15.734  1.00 27.40 ? 141  ILE A CB  1 
ATOM   654  C CG1 . ILE A 1 97  ? 34.027  76.222  16.572  1.00 29.22 ? 141  ILE A CG1 1 
ATOM   655  C CG2 . ILE A 1 97  ? 33.047  76.600  14.254  1.00 26.97 ? 141  ILE A CG2 1 
ATOM   656  C CD1 . ILE A 1 97  ? 35.429  76.560  16.154  1.00 25.40 ? 141  ILE A CD1 1 
ATOM   657  N N   . GLY A 1 98  ? 32.011  79.827  14.199  1.00 25.80 ? 142  GLY A N   1 
ATOM   658  C CA  . GLY A 1 98  ? 30.932  80.535  13.544  1.00 25.31 ? 142  GLY A CA  1 
ATOM   659  C C   . GLY A 1 98  ? 30.003  79.600  12.816  1.00 26.75 ? 142  GLY A C   1 
ATOM   660  O O   . GLY A 1 98  ? 30.325  78.433  12.650  1.00 26.47 ? 142  GLY A O   1 
ATOM   661  N N   . PRO A 1 99  ? 28.816  80.096  12.423  1.00 28.40 ? 143  PRO A N   1 
ATOM   662  C CA  . PRO A 1 99  ? 27.807  79.267  11.763  1.00 30.12 ? 143  PRO A CA  1 
ATOM   663  C C   . PRO A 1 99  ? 28.197  78.730  10.389  1.00 31.48 ? 143  PRO A C   1 
ATOM   664  O O   . PRO A 1 99  ? 29.116  79.254  9.730   1.00 31.85 ? 143  PRO A O   1 
ATOM   665  C CB  . PRO A 1 99  ? 26.633  80.207  11.631  1.00 30.19 ? 143  PRO A CB  1 
ATOM   666  C CG  . PRO A 1 99  ? 27.226  81.545  11.617  1.00 30.15 ? 143  PRO A CG  1 
ATOM   667  C CD  . PRO A 1 99  ? 28.325  81.463  12.623  1.00 28.64 ? 143  PRO A CD  1 
ATOM   668  N N   . GLU A 1 100 ? 27.500  77.675  9.975   1.00 32.55 ? 144  GLU A N   1 
ATOM   669  C CA  . GLU A 1 100 ? 27.535  77.210  8.604   1.00 33.70 ? 144  GLU A CA  1 
ATOM   670  C C   . GLU A 1 100 ? 28.982  77.063  8.159   1.00 32.21 ? 144  GLU A C   1 
ATOM   671  O O   . GLU A 1 100 ? 29.805  76.550  8.905   1.00 32.81 ? 144  GLU A O   1 
ATOM   672  C CB  . GLU A 1 100 ? 26.771  78.198  7.708   1.00 34.33 ? 144  GLU A CB  1 
ATOM   673  C CG  . GLU A 1 100 ? 25.302  78.426  8.104   1.00 40.30 ? 144  GLU A CG  1 
ATOM   674  C CD  . GLU A 1 100 ? 24.423  77.199  7.808   1.00 49.18 ? 144  GLU A CD  1 
ATOM   675  O OE1 . GLU A 1 100 ? 24.979  76.075  7.676   1.00 52.87 ? 144  GLU A OE1 1 
ATOM   676  O OE2 . GLU A 1 100 ? 23.181  77.347  7.692   1.00 51.96 ? 144  GLU A OE2 1 
ATOM   677  N N   . ASN A 1 101 ? 29.305  77.549  6.969   1.00 31.00 ? 145  ASN A N   1 
ATOM   678  C CA  . ASN A 1 101 ? 30.671  77.540  6.511   1.00 29.97 ? 145  ASN A CA  1 
ATOM   679  C C   . ASN A 1 101 ? 31.269  78.918  6.410   1.00 29.26 ? 145  ASN A C   1 
ATOM   680  O O   . ASN A 1 101 ? 31.981  79.201  5.464   1.00 27.38 ? 145  ASN A O   1 
ATOM   681  C CB  . ASN A 1 101 ? 30.746  76.850  5.166   1.00 31.28 ? 145  ASN A CB  1 
ATOM   682  C CG  . ASN A 1 101 ? 30.608  75.356  5.292   1.00 33.92 ? 145  ASN A CG  1 
ATOM   683  O OD1 . ASN A 1 101 ? 30.645  74.819  6.382   1.00 34.34 ? 145  ASN A OD1 1 
ATOM   684  N ND2 . ASN A 1 101 ? 30.450  74.680  4.171   1.00 38.71 ? 145  ASN A ND2 1 
ATOM   685  N N   . SER A 1 102 ? 30.971  79.778  7.384   1.00 27.43 ? 146  SER A N   1 
ATOM   686  C CA  . SER A 1 102 ? 31.642  81.066  7.482   1.00 26.08 ? 146  SER A CA  1 
ATOM   687  C C   . SER A 1 102 ? 33.142  80.902  7.695   1.00 24.86 ? 146  SER A C   1 
ATOM   688  O O   . SER A 1 102 ? 33.931  81.775  7.330   1.00 25.78 ? 146  SER A O   1 
ATOM   689  C CB  . SER A 1 102 ? 31.093  81.850  8.671   1.00 25.76 ? 146  SER A CB  1 
ATOM   690  O OG  . SER A 1 102 ? 31.378  81.136  9.856   1.00 23.78 ? 146  SER A OG  1 
ATOM   691  N N   . GLY A 1 103 ? 33.526  79.844  8.369   1.00 22.84 ? 147  GLY A N   1 
ATOM   692  C CA  . GLY A 1 103 ? 34.947  79.564  8.631   1.00 22.98 ? 147  GLY A CA  1 
ATOM   693  C C   . GLY A 1 103 ? 35.517  80.426  9.764   1.00 22.52 ? 147  GLY A C   1 
ATOM   694  O O   . GLY A 1 103 ? 36.720  80.452  9.962   1.00 22.17 ? 147  GLY A O   1 
ATOM   695  N N   . LYS A 1 104 ? 34.641  81.077  10.541  1.00 21.48 ? 148  LYS A N   1 
ATOM   696  C CA  . LYS A 1 104 ? 35.068  81.901  11.677  1.00 19.81 ? 148  LYS A CA  1 
ATOM   697  C C   . LYS A 1 104 ? 35.398  81.079  12.917  1.00 20.05 ? 148  LYS A C   1 
ATOM   698  O O   . LYS A 1 104 ? 34.697  80.106  13.272  1.00 17.12 ? 148  LYS A O   1 
ATOM   699  C CB  . LYS A 1 104 ? 33.955  82.886  12.027  1.00 20.82 ? 148  LYS A CB  1 
ATOM   700  C CG  . LYS A 1 104 ? 33.652  83.774  10.862  1.00 22.27 ? 148  LYS A CG  1 
ATOM   701  C CD  . LYS A 1 104 ? 32.970  84.967  11.212  1.00 26.68 ? 148  LYS A CD  1 
ATOM   702  C CE  . LYS A 1 104 ? 33.562  86.092  10.348  1.00 26.33 ? 148  LYS A CE  1 
ATOM   703  N NZ  . LYS A 1 104 ? 33.301  85.836  8.929   1.00 28.73 ? 148  LYS A NZ  1 
ATOM   704  N N   . VAL A 1 105 ? 36.454  81.520  13.603  1.00 19.12 ? 149  VAL A N   1 
ATOM   705  C CA  . VAL A 1 105 ? 36.928  80.918  14.870  1.00 19.06 ? 149  VAL A CA  1 
ATOM   706  C C   . VAL A 1 105 ? 37.418  82.076  15.774  1.00 18.12 ? 149  VAL A C   1 
ATOM   707  O O   . VAL A 1 105 ? 38.205  82.891  15.315  1.00 18.81 ? 149  VAL A O   1 
ATOM   708  C CB  . VAL A 1 105 ? 38.089  79.950  14.610  1.00 17.76 ? 149  VAL A CB  1 
ATOM   709  C CG1 . VAL A 1 105 ? 38.498  79.258  15.936  1.00 21.20 ? 149  VAL A CG1 1 
ATOM   710  C CG2 . VAL A 1 105 ? 37.709  78.930  13.543  1.00 21.00 ? 149  VAL A CG2 1 
ATOM   711  N N   . VAL A 1 106 ? 36.931  82.163  16.994  1.00 18.42 ? 150  VAL A N   1 
ATOM   712  C CA  . VAL A 1 106 ? 37.437  83.136  17.957  1.00 19.17 ? 150  VAL A CA  1 
ATOM   713  C C   . VAL A 1 106 ? 37.948  82.361  19.157  1.00 19.84 ? 150  VAL A C   1 
ATOM   714  O O   . VAL A 1 106 ? 37.243  81.529  19.699  1.00 19.33 ? 150  VAL A O   1 
ATOM   715  C CB  . VAL A 1 106 ? 36.350  84.092  18.461  1.00 19.41 ? 150  VAL A CB  1 
ATOM   716  C CG1 . VAL A 1 106 ? 36.924  85.059  19.458  1.00 20.57 ? 150  VAL A CG1 1 
ATOM   717  C CG2 . VAL A 1 106 ? 35.758  84.915  17.326  1.00 19.13 ? 150  VAL A CG2 1 
ATOM   718  N N   . LEU A 1 107 ? 39.178  82.631  19.589  1.00 20.44 ? 151  LEU A N   1 
ATOM   719  C CA  . LEU A 1 107 ? 39.686  82.054  20.848  1.00 21.43 ? 151  LEU A CA  1 
ATOM   720  C C   . LEU A 1 107 ? 39.918  83.219  21.832  1.00 22.18 ? 151  LEU A C   1 
ATOM   721  O O   . LEU A 1 107 ? 40.372  84.282  21.436  1.00 20.53 ? 151  LEU A O   1 
ATOM   722  C CB  . LEU A 1 107 ? 41.002  81.314  20.618  1.00 21.94 ? 151  LEU A CB  1 
ATOM   723  C CG  . LEU A 1 107 ? 41.185  80.277  19.491  1.00 23.57 ? 151  LEU A CG  1 
ATOM   724  C CD1 . LEU A 1 107 ? 42.665  79.984  19.299  1.00 26.32 ? 151  LEU A CD1 1 
ATOM   725  C CD2 . LEU A 1 107 ? 40.496  79.053  19.804  1.00 26.99 ? 151  LEU A CD2 1 
ATOM   726  N N   . THR A 1 108 ? 39.612  82.998  23.103  1.00 23.00 ? 152  THR A N   1 
ATOM   727  C CA  . THR A 1 108 ? 39.692  84.037  24.128  1.00 24.21 ? 152  THR A CA  1 
ATOM   728  C C   . THR A 1 108 ? 40.899  83.760  24.992  1.00 25.27 ? 152  THR A C   1 
ATOM   729  O O   . THR A 1 108 ? 41.050  82.648  25.529  1.00 25.26 ? 152  THR A O   1 
ATOM   730  C CB  . THR A 1 108 ? 38.479  83.960  25.073  1.00 24.46 ? 152  THR A CB  1 
ATOM   731  O OG1 . THR A 1 108 ? 37.275  83.898  24.307  1.00 25.95 ? 152  THR A OG1 1 
ATOM   732  C CG2 . THR A 1 108 ? 38.432  85.169  26.017  1.00 24.95 ? 152  THR A CG2 1 
ATOM   733  N N   . ALA A 1 109 ? 41.746  84.767  25.147  1.00 25.94 ? 153  ALA A N   1 
ATOM   734  C CA  . ALA A 1 109 ? 42.984  84.614  25.896  1.00 27.77 ? 153  ALA A CA  1 
ATOM   735  C C   . ALA A 1 109 ? 42.895  85.123  27.352  1.00 28.52 ? 153  ALA A C   1 
ATOM   736  O O   . ALA A 1 109 ? 42.002  85.896  27.694  1.00 28.04 ? 153  ALA A O   1 
ATOM   737  C CB  . ALA A 1 109 ? 44.127  85.316  25.158  1.00 27.40 ? 153  ALA A CB  1 
ATOM   738  N N   . GLU A 1 110 ? 43.812  84.653  28.200  1.00 30.27 ? 154  GLU A N   1 
ATOM   739  C CA  . GLU A 1 110 ? 44.045  85.277  29.517  1.00 31.33 ? 154  GLU A CA  1 
ATOM   740  C C   . GLU A 1 110 ? 45.055  86.418  29.371  1.00 31.65 ? 154  GLU A C   1 
ATOM   741  O O   . GLU A 1 110 ? 46.159  86.233  28.804  1.00 31.01 ? 154  GLU A O   1 
ATOM   742  C CB  . GLU A 1 110 ? 44.538  84.246  30.560  1.00 31.56 ? 154  GLU A CB  1 
ATOM   743  C CG  . GLU A 1 110 ? 44.940  84.811  31.966  1.00 31.90 ? 154  GLU A CG  1 
ATOM   744  C CD  . GLU A 1 110 ? 43.799  85.538  32.746  1.00 36.79 ? 154  GLU A CD  1 
ATOM   745  O OE1 . GLU A 1 110 ? 42.626  85.511  32.293  1.00 38.07 ? 154  GLU A OE1 1 
ATOM   746  O OE2 . GLU A 1 110 ? 44.086  86.149  33.820  1.00 36.82 ? 154  GLU A OE2 1 
ATOM   747  N N   . VAL A 1 111 ? 44.655  87.598  29.857  1.00 32.75 ? 155  VAL A N   1 
ATOM   748  C CA  . VAL A 1 111 ? 45.567  88.738  29.900  1.00 34.30 ? 155  VAL A CA  1 
ATOM   749  C C   . VAL A 1 111 ? 46.197  88.872  31.294  1.00 35.42 ? 155  VAL A C   1 
ATOM   750  O O   . VAL A 1 111 ? 45.790  88.177  32.238  1.00 35.58 ? 155  VAL A O   1 
ATOM   751  C CB  . VAL A 1 111 ? 44.869  90.059  29.476  1.00 34.18 ? 155  VAL A CB  1 
ATOM   752  C CG1 . VAL A 1 111 ? 44.691  90.099  27.968  1.00 34.14 ? 155  VAL A CG1 1 
ATOM   753  C CG2 . VAL A 1 111 ? 43.531  90.218  30.173  1.00 34.25 ? 155  VAL A CG2 1 
ATOM   754  N N   . SER A 1 112 ? 47.199  89.741  31.411  1.00 36.78 ? 156  SER A N   1 
ATOM   755  C CA  . SER A 1 112 ? 47.785  90.071  32.715  1.00 38.30 ? 156  SER A CA  1 
ATOM   756  C C   . SER A 1 112 ? 46.803  90.804  33.651  1.00 39.17 ? 156  SER A C   1 
ATOM   757  O O   . SER A 1 112 ? 45.756  91.309  33.218  1.00 39.68 ? 156  SER A O   1 
ATOM   758  C CB  . SER A 1 112 ? 49.076  90.883  32.546  1.00 38.20 ? 156  SER A CB  1 
ATOM   759  O OG  . SER A 1 112 ? 48.867  92.010  31.719  1.00 38.78 ? 156  SER A OG  1 
ATOM   760  N N   . GLY A 1 113 ? 47.153  90.856  34.935  1.00 39.74 ? 157  GLY A N   1 
ATOM   761  C CA  . GLY A 1 113 ? 46.293  91.459  35.937  1.00 40.20 ? 157  GLY A CA  1 
ATOM   762  C C   . GLY A 1 113 ? 46.186  92.968  35.805  1.00 40.42 ? 157  GLY A C   1 
ATOM   763  O O   . GLY A 1 113 ? 45.251  93.566  36.333  1.00 40.77 ? 157  GLY A O   1 
ATOM   764  N N   . GLY A 1 114 ? 47.140  93.587  35.108  1.00 40.22 ? 158  GLY A N   1 
ATOM   765  C CA  . GLY A 1 114 ? 47.076  95.030  34.827  1.00 40.19 ? 158  GLY A CA  1 
ATOM   766  C C   . GLY A 1 114 ? 46.028  95.486  33.813  1.00 40.03 ? 158  GLY A C   1 
ATOM   767  O O   . GLY A 1 114 ? 45.608  96.649  33.814  1.00 40.18 ? 158  GLY A O   1 
ATOM   768  N N   . SER A 1 115 ? 45.592  94.562  32.961  1.00 40.04 ? 159  SER A N   1 
ATOM   769  C CA  . SER A 1 115 ? 44.833  94.878  31.744  1.00 39.39 ? 159  SER A CA  1 
ATOM   770  C C   . SER A 1 115 ? 43.494  95.558  31.925  1.00 38.50 ? 159  SER A C   1 
ATOM   771  O O   . SER A 1 115 ? 42.742  95.249  32.849  1.00 38.48 ? 159  SER A O   1 
ATOM   772  C CB  . SER A 1 115 ? 44.660  93.619  30.900  1.00 39.65 ? 159  SER A CB  1 
ATOM   773  O OG  . SER A 1 115 ? 45.886  93.354  30.239  1.00 40.75 ? 159  SER A OG  1 
ATOM   774  N N   . ARG A 1 116 ? 43.216  96.488  31.017  1.00 38.04 ? 160  ARG A N   1 
ATOM   775  C CA  . ARG A 1 116 ? 41.911  97.142  30.915  1.00 37.73 ? 160  ARG A CA  1 
ATOM   776  C C   . ARG A 1 116 ? 40.903  96.155  30.328  1.00 36.94 ? 160  ARG A C   1 
ATOM   777  O O   . ARG A 1 116 ? 39.832  95.905  30.913  1.00 37.27 ? 160  ARG A O   1 
ATOM   778  C CB  . ARG A 1 116 ? 41.986  98.388  30.019  1.00 38.91 ? 160  ARG A CB  1 
ATOM   779  C CG  . ARG A 1 116 ? 43.395  98.821  29.589  1.00 40.94 ? 160  ARG A CG  1 
ATOM   780  C CD  . ARG A 1 116 ? 44.167  99.595  30.670  1.00 46.55 ? 160  ARG A CD  1 
ATOM   781  N NE  . ARG A 1 116 ? 43.761  100.999 30.846  1.00 49.27 ? 160  ARG A NE  1 
ATOM   782  C CZ  . ARG A 1 116 ? 43.667  101.918 29.875  1.00 51.19 ? 160  ARG A CZ  1 
ATOM   783  N NH1 . ARG A 1 116 ? 43.906  101.615 28.596  1.00 50.51 ? 160  ARG A NH1 1 
ATOM   784  N NH2 . ARG A 1 116 ? 43.312  103.163 30.193  1.00 52.37 ? 160  ARG A NH2 1 
ATOM   785  N N   . GLY A 1 117 ? 41.254  95.567  29.183  1.00 34.71 ? 161  GLY A N   1 
ATOM   786  C CA  . GLY A 1 117 ? 40.398  94.541  28.585  1.00 32.36 ? 161  GLY A CA  1 
ATOM   787  C C   . GLY A 1 117 ? 41.152  93.296  28.174  1.00 29.90 ? 161  GLY A C   1 
ATOM   788  O O   . GLY A 1 117 ? 42.383  93.251  28.201  1.00 30.64 ? 161  GLY A O   1 
ATOM   789  N N   . GLY A 1 118 ? 40.408  92.291  27.761  1.00 28.36 ? 162  GLY A N   1 
ATOM   790  C CA  . GLY A 1 118 ? 40.982  91.013  27.419  1.00 24.69 ? 162  GLY A CA  1 
ATOM   791  C C   . GLY A 1 118 ? 41.549  91.012  26.036  1.00 23.43 ? 162  GLY A C   1 
ATOM   792  O O   . GLY A 1 118 ? 41.966  92.041  25.508  1.00 21.28 ? 162  GLY A O   1 
ATOM   793  N N   . ARG A 1 119 ? 41.562  89.832  25.438  1.00 22.35 ? 163  ARG A N   1 
ATOM   794  C CA  . ARG A 1 119 ? 42.236  89.654  24.184  1.00 23.39 ? 163  ARG A CA  1 
ATOM   795  C C   . ARG A 1 119 ? 41.724  88.401  23.515  1.00 22.56 ? 163  ARG A C   1 
ATOM   796  O O   . ARG A 1 119 ? 41.479  87.392  24.172  1.00 22.45 ? 163  ARG A O   1 
ATOM   797  C CB  . ARG A 1 119 ? 43.769  89.650  24.408  1.00 23.93 ? 163  ARG A CB  1 
ATOM   798  C CG  . ARG A 1 119 ? 44.587  89.196  23.230  1.00 25.59 ? 163  ARG A CG  1 
ATOM   799  C CD  . ARG A 1 119 ? 46.035  89.184  23.595  1.00 28.15 ? 163  ARG A CD  1 
ATOM   800  N NE  . ARG A 1 119 ? 46.562  90.532  23.770  1.00 28.99 ? 163  ARG A NE  1 
ATOM   801  C CZ  . ARG A 1 119 ? 47.823  90.767  24.113  1.00 30.96 ? 163  ARG A CZ  1 
ATOM   802  N NH1 . ARG A 1 119 ? 48.635  89.728  24.291  1.00 31.84 ? 163  ARG A NH1 1 
ATOM   803  N NH2 . ARG A 1 119 ? 48.282  92.007  24.247  1.00 24.85 ? 163  ARG A NH2 1 
ATOM   804  N N   . ILE A 1 120 ? 41.461  88.493  22.216  1.00 22.49 ? 164  ILE A N   1 
ATOM   805  C CA  . ILE A 1 120 ? 41.019  87.305  21.444  1.00 22.28 ? 164  ILE A CA  1 
ATOM   806  C C   . ILE A 1 120 ? 41.872  87.109  20.225  1.00 22.75 ? 164  ILE A C   1 
ATOM   807  O O   . ILE A 1 120 ? 42.533  88.068  19.766  1.00 22.38 ? 164  ILE A O   1 
ATOM   808  C CB  . ILE A 1 120 ? 39.627  87.461  20.928  1.00 21.58 ? 164  ILE A CB  1 
ATOM   809  C CG1 . ILE A 1 120 ? 39.511  88.782  20.153  1.00 23.73 ? 164  ILE A CG1 1 
ATOM   810  C CG2 . ILE A 1 120 ? 38.638  87.368  22.114  1.00 24.36 ? 164  ILE A CG2 1 
ATOM   811  C CD1 . ILE A 1 120 ? 38.259  88.882  19.330  1.00 23.01 ? 164  ILE A CD1 1 
ATOM   812  N N   . PHE A 1 121 ? 41.853  85.880  19.694  1.00 22.66 ? 165  PHE A N   1 
ATOM   813  C CA  . PHE A 1 121 ? 42.527  85.575  18.431  1.00 23.18 ? 165  PHE A CA  1 
ATOM   814  C C   . PHE A 1 121 ? 41.411  85.143  17.506  1.00 22.76 ? 165  PHE A C   1 
ATOM   815  O O   . PHE A 1 121 ? 40.721  84.219  17.802  1.00 22.82 ? 165  PHE A O   1 
ATOM   816  C CB  . PHE A 1 121 ? 43.527  84.434  18.598  1.00 22.40 ? 165  PHE A CB  1 
ATOM   817  C CG  . PHE A 1 121 ? 44.705  84.807  19.422  1.00 25.43 ? 165  PHE A CG  1 
ATOM   818  C CD1 . PHE A 1 121 ? 45.836  85.390  18.817  1.00 22.91 ? 165  PHE A CD1 1 
ATOM   819  C CD2 . PHE A 1 121 ? 44.694  84.618  20.805  1.00 25.92 ? 165  PHE A CD2 1 
ATOM   820  C CE1 . PHE A 1 121 ? 46.932  85.762  19.586  1.00 25.94 ? 165  PHE A CE1 1 
ATOM   821  C CE2 . PHE A 1 121 ? 45.789  85.025  21.574  1.00 25.67 ? 165  PHE A CE2 1 
ATOM   822  C CZ  . PHE A 1 121 ? 46.910  85.594  20.958  1.00 25.18 ? 165  PHE A CZ  1 
ATOM   823  N N   . ARG A 1 122 ? 41.270  85.826  16.379  1.00 22.36 ? 166  ARG A N   1 
ATOM   824  C CA  . ARG A 1 122 ? 40.165  85.631  15.502  1.00 20.97 ? 166  ARG A CA  1 
ATOM   825  C C   . ARG A 1 122 ? 40.647  85.244  14.110  1.00 20.74 ? 166  ARG A C   1 
ATOM   826  O O   . ARG A 1 122 ? 41.621  85.775  13.583  1.00 19.16 ? 166  ARG A O   1 
ATOM   827  C CB  . ARG A 1 122 ? 39.230  86.835  15.504  1.00 20.98 ? 166  ARG A CB  1 
ATOM   828  C CG  . ARG A 1 122 ? 39.864  88.117  15.398  1.00 24.16 ? 166  ARG A CG  1 
ATOM   829  C CD  . ARG A 1 122 ? 38.903  89.208  15.756  1.00 24.62 ? 166  ARG A CD  1 
ATOM   830  N NE  . ARG A 1 122 ? 39.526  90.393  15.216  1.00 24.44 ? 166  ARG A NE  1 
ATOM   831  C CZ  . ARG A 1 122 ? 39.220  90.966  14.060  1.00 23.93 ? 166  ARG A CZ  1 
ATOM   832  N NH1 . ARG A 1 122 ? 38.259  90.498  13.302  1.00 23.88 ? 166  ARG A NH1 1 
ATOM   833  N NH2 . ARG A 1 122 ? 39.890  92.009  13.667  1.00 24.34 ? 166  ARG A NH2 1 
ATOM   834  N N   . SER A 1 123 ? 39.985  84.251  13.558  1.00 19.42 ? 167  SER A N   1 
ATOM   835  C CA  . SER A 1 123 ? 40.237  83.802  12.198  1.00 20.24 ? 167  SER A CA  1 
ATOM   836  C C   . SER A 1 123 ? 38.943  83.737  11.393  1.00 20.48 ? 167  SER A C   1 
ATOM   837  O O   . SER A 1 123 ? 37.887  83.308  11.920  1.00 19.93 ? 167  SER A O   1 
ATOM   838  C CB  . SER A 1 123 ? 40.862  82.439  12.238  1.00 19.18 ? 167  SER A CB  1 
ATOM   839  O OG  . SER A 1 123 ? 40.736  81.811  10.980  1.00 20.87 ? 167  SER A OG  1 
ATOM   840  N N   . SER A 1 124 ? 39.014  84.164  10.133  1.00 20.41 ? 168  SER A N   1 
ATOM   841  C CA  . SER A 1 124 ? 37.901  83.948  9.197   1.00 22.05 ? 168  SER A CA  1 
ATOM   842  C C   . SER A 1 124 ? 38.190  82.940  8.096   1.00 22.73 ? 168  SER A C   1 
ATOM   843  O O   . SER A 1 124 ? 37.385  82.752  7.193   1.00 23.44 ? 168  SER A O   1 
ATOM   844  C CB  . SER A 1 124 ? 37.408  85.268  8.585   1.00 22.89 ? 168  SER A CB  1 
ATOM   845  O OG  . SER A 1 124 ? 38.499  85.994  7.989   1.00 21.01 ? 168  SER A OG  1 
ATOM   846  N N   . ASP A 1 125 ? 39.334  82.276  8.133   1.00 23.74 ? 169  ASP A N   1 
ATOM   847  C CA  . ASP A 1 125 ? 39.591  81.308  7.090   1.00 23.81 ? 169  ASP A CA  1 
ATOM   848  C C   . ASP A 1 125 ? 39.818  79.948  7.675   1.00 23.64 ? 169  ASP A C   1 
ATOM   849  O O   . ASP A 1 125 ? 40.812  79.318  7.353   1.00 23.44 ? 169  ASP A O   1 
ATOM   850  C CB  . ASP A 1 125 ? 40.781  81.733  6.205   1.00 25.45 ? 169  ASP A CB  1 
ATOM   851  C CG  . ASP A 1 125 ? 42.055  81.968  6.995   1.00 28.37 ? 169  ASP A CG  1 
ATOM   852  O OD1 . ASP A 1 125 ? 42.013  81.818  8.245   1.00 28.53 ? 169  ASP A OD1 1 
ATOM   853  O OD2 . ASP A 1 125 ? 43.129  82.317  6.380   1.00 35.89 ? 169  ASP A OD2 1 
ATOM   854  N N   . PHE A 1 126 ? 38.868  79.470  8.484   1.00 22.94 ? 170  PHE A N   1 
ATOM   855  C CA  . PHE A 1 126 ? 38.927  78.119  9.028   1.00 23.48 ? 170  PHE A CA  1 
ATOM   856  C C   . PHE A 1 126 ? 40.175  77.860  9.858   1.00 23.96 ? 170  PHE A C   1 
ATOM   857  O O   . PHE A 1 126 ? 40.725  76.771  9.792   1.00 24.98 ? 170  PHE A O   1 
ATOM   858  C CB  . PHE A 1 126 ? 38.761  77.040  7.924   1.00 23.20 ? 170  PHE A CB  1 
ATOM   859  C CG  . PHE A 1 126 ? 37.480  77.180  7.165   1.00 23.34 ? 170  PHE A CG  1 
ATOM   860  C CD1 . PHE A 1 126 ? 36.339  76.556  7.612   1.00 23.30 ? 170  PHE A CD1 1 
ATOM   861  C CD2 . PHE A 1 126 ? 37.387  78.057  6.082   1.00 25.42 ? 170  PHE A CD2 1 
ATOM   862  C CE1 . PHE A 1 126 ? 35.139  76.712  6.916   1.00 24.77 ? 170  PHE A CE1 1 
ATOM   863  C CE2 . PHE A 1 126 ? 36.206  78.250  5.411   1.00 23.54 ? 170  PHE A CE2 1 
ATOM   864  C CZ  . PHE A 1 126 ? 35.069  77.582  5.847   1.00 24.39 ? 170  PHE A CZ  1 
ATOM   865  N N   . ALA A 1 127 ? 40.609  78.861  10.622  1.00 24.52 ? 171  ALA A N   1 
ATOM   866  C CA  . ALA A 1 127 ? 41.793  78.748  11.499  1.00 25.90 ? 171  ALA A CA  1 
ATOM   867  C C   . ALA A 1 127 ? 43.136  78.592  10.783  1.00 25.77 ? 171  ALA A C   1 
ATOM   868  O O   . ALA A 1 127 ? 44.091  78.131  11.398  1.00 26.76 ? 171  ALA A O   1 
ATOM   869  C CB  . ALA A 1 127 ? 41.592  77.581  12.524  1.00 24.43 ? 171  ALA A CB  1 
ATOM   870  N N   . LYS A 1 128 ? 43.225  78.919  9.495   1.00 26.03 ? 172  LYS A N   1 
ATOM   871  C CA  . LYS A 1 128 ? 44.542  78.921  8.795   1.00 26.15 ? 172  LYS A CA  1 
ATOM   872  C C   . LYS A 1 128 ? 45.403  80.081  9.246   1.00 25.76 ? 172  LYS A C   1 
ATOM   873  O O   . LYS A 1 128 ? 46.657  79.997  9.331   1.00 26.42 ? 172  LYS A O   1 
ATOM   874  C CB  . LYS A 1 128 ? 44.325  78.989  7.278   1.00 26.64 ? 172  LYS A CB  1 
ATOM   875  C CG  . LYS A 1 128 ? 45.528  78.767  6.420   1.00 28.44 ? 172  LYS A CG  1 
ATOM   876  C CD  . LYS A 1 128 ? 45.940  77.348  6.244   1.00 37.12 ? 172  LYS A CD  1 
ATOM   877  C CE  . LYS A 1 128 ? 47.148  77.275  5.301   1.00 41.80 ? 172  LYS A CE  1 
ATOM   878  N NZ  . LYS A 1 128 ? 47.924  76.002  5.523   1.00 46.09 ? 172  LYS A NZ  1 
ATOM   879  N N   . ASN A 1 129 ? 44.760  81.214  9.489   1.00 24.26 ? 173  ASN A N   1 
ATOM   880  C CA  . ASN A 1 129 ? 45.468  82.388  9.959   1.00 22.79 ? 173  ASN A CA  1 
ATOM   881  C C   . ASN A 1 129 ? 44.669  83.019  11.057  1.00 22.28 ? 173  ASN A C   1 
ATOM   882  O O   . ASN A 1 129 ? 43.459  82.992  11.014  1.00 23.94 ? 173  ASN A O   1 
ATOM   883  C CB  . ASN A 1 129 ? 45.608  83.414  8.828   1.00 23.89 ? 173  ASN A CB  1 
ATOM   884  C CG  . ASN A 1 129 ? 46.542  82.946  7.730   1.00 22.37 ? 173  ASN A CG  1 
ATOM   885  O OD1 . ASN A 1 129 ? 47.742  83.138  7.833   1.00 24.47 ? 173  ASN A OD1 1 
ATOM   886  N ND2 . ASN A 1 129 ? 45.990  82.295  6.683   1.00 21.37 ? 173  ASN A ND2 1 
ATOM   887  N N   . PHE A 1 130 ? 45.345  83.568  12.047  1.00 22.00 ? 174  PHE A N   1 
ATOM   888  C CA  . PHE A 1 130 ? 44.719  84.241  13.146  1.00 21.40 ? 174  PHE A CA  1 
ATOM   889  C C   . PHE A 1 130 ? 45.299  85.635  13.246  1.00 21.90 ? 174  PHE A C   1 
ATOM   890  O O   . PHE A 1 130 ? 46.475  85.834  12.970  1.00 21.29 ? 174  PHE A O   1 
ATOM   891  C CB  . PHE A 1 130 ? 45.054  83.521  14.445  1.00 21.13 ? 174  PHE A CB  1 
ATOM   892  C CG  . PHE A 1 130 ? 44.193  82.283  14.718  1.00 20.69 ? 174  PHE A CG  1 
ATOM   893  C CD1 . PHE A 1 130 ? 43.010  82.378  15.462  1.00 19.04 ? 174  PHE A CD1 1 
ATOM   894  C CD2 . PHE A 1 130 ? 44.588  81.030  14.257  1.00 21.88 ? 174  PHE A CD2 1 
ATOM   895  C CE1 . PHE A 1 130 ? 42.228  81.265  15.703  1.00 24.09 ? 174  PHE A CE1 1 
ATOM   896  C CE2 . PHE A 1 130 ? 43.807  79.882  14.533  1.00 19.02 ? 174  PHE A CE2 1 
ATOM   897  C CZ  . PHE A 1 130 ? 42.628  80.009  15.241  1.00 21.12 ? 174  PHE A CZ  1 
ATOM   898  N N   . VAL A 1 131 ? 44.486  86.582  13.684  1.00 22.17 ? 175  VAL A N   1 
ATOM   899  C CA  . VAL A 1 131 ? 44.994  87.857  14.140  1.00 24.19 ? 175  VAL A CA  1 
ATOM   900  C C   . VAL A 1 131 ? 44.595  88.076  15.602  1.00 25.01 ? 175  VAL A C   1 
ATOM   901  O O   . VAL A 1 131 ? 43.535  87.643  16.024  1.00 26.11 ? 175  VAL A O   1 
ATOM   902  C CB  . VAL A 1 131 ? 44.470  88.986  13.237  1.00 24.62 ? 175  VAL A CB  1 
ATOM   903  C CG1 . VAL A 1 131 ? 43.171  89.575  13.751  1.00 24.59 ? 175  VAL A CG1 1 
ATOM   904  C CG2 . VAL A 1 131 ? 45.511  90.070  13.104  1.00 26.93 ? 175  VAL A CG2 1 
ATOM   905  N N   . GLN A 1 132 ? 45.460  88.713  16.366  1.00 26.08 ? 176  GLN A N   1 
ATOM   906  C CA  . GLN A 1 132 ? 45.197  89.097  17.755  1.00 27.79 ? 176  GLN A CA  1 
ATOM   907  C C   . GLN A 1 132 ? 44.524  90.455  17.831  1.00 28.09 ? 176  GLN A C   1 
ATOM   908  O O   . GLN A 1 132 ? 44.955  91.397  17.191  1.00 27.85 ? 176  GLN A O   1 
ATOM   909  C CB  . GLN A 1 132 ? 46.530  89.167  18.487  1.00 27.45 ? 176  GLN A CB  1 
ATOM   910  C CG  . GLN A 1 132 ? 46.477  89.760  19.876  1.00 29.92 ? 176  GLN A CG  1 
ATOM   911  C CD  . GLN A 1 132 ? 47.835  89.810  20.552  1.00 29.65 ? 176  GLN A CD  1 
ATOM   912  O OE1 . GLN A 1 132 ? 48.179  90.810  21.209  1.00 33.35 ? 176  GLN A OE1 1 
ATOM   913  N NE2 . GLN A 1 132 ? 48.627  88.734  20.398  1.00 31.82 ? 176  GLN A NE2 1 
ATOM   914  N N   . THR A 1 133 ? 43.480  90.564  18.635  1.00 29.01 ? 177  THR A N   1 
ATOM   915  C CA  . THR A 1 133 ? 42.748  91.815  18.819  1.00 29.36 ? 177  THR A CA  1 
ATOM   916  C C   . THR A 1 133 ? 42.643  92.032  20.331  1.00 29.20 ? 177  THR A C   1 
ATOM   917  O O   . THR A 1 133 ? 42.306  91.107  21.072  1.00 28.17 ? 177  THR A O   1 
ATOM   918  C CB  . THR A 1 133 ? 41.307  91.706  18.195  1.00 30.19 ? 177  THR A CB  1 
ATOM   919  O OG1 . THR A 1 133 ? 41.391  91.315  16.820  1.00 32.95 ? 177  THR A OG1 1 
ATOM   920  C CG2 . THR A 1 133 ? 40.540  92.999  18.256  1.00 31.30 ? 177  THR A CG2 1 
ATOM   921  N N   . ASP A 1 134 ? 42.957  93.242  20.797  1.00 29.58 ? 178  ASP A N   1 
ATOM   922  C CA  . ASP A 1 134 ? 42.770  93.567  22.197  1.00 29.96 ? 178  ASP A CA  1 
ATOM   923  C C   . ASP A 1 134 ? 41.377  94.146  22.370  1.00 29.81 ? 178  ASP A C   1 
ATOM   924  O O   . ASP A 1 134 ? 40.982  95.040  21.610  1.00 30.04 ? 178  ASP A O   1 
ATOM   925  C CB  . ASP A 1 134 ? 43.833  94.551  22.679  1.00 30.89 ? 178  ASP A CB  1 
ATOM   926  C CG  . ASP A 1 134 ? 45.176  93.889  22.909  1.00 33.68 ? 178  ASP A CG  1 
ATOM   927  O OD1 . ASP A 1 134 ? 45.273  92.921  23.705  1.00 37.54 ? 178  ASP A OD1 1 
ATOM   928  O OD2 . ASP A 1 134 ? 46.152  94.352  22.295  1.00 38.31 ? 178  ASP A OD2 1 
ATOM   929  N N   . LEU A 1 135 ? 40.642  93.638  23.365  1.00 29.07 ? 179  LEU A N   1 
ATOM   930  C CA  . LEU A 1 135 ? 39.269  94.101  23.691  1.00 28.68 ? 179  LEU A CA  1 
ATOM   931  C C   . LEU A 1 135 ? 39.180  95.288  24.668  1.00 28.97 ? 179  LEU A C   1 
ATOM   932  O O   . LEU A 1 135 ? 39.993  95.379  25.574  1.00 29.40 ? 179  LEU A O   1 
ATOM   933  C CB  . LEU A 1 135 ? 38.487  92.956  24.319  1.00 27.93 ? 179  LEU A CB  1 
ATOM   934  C CG  . LEU A 1 135 ? 38.203  91.767  23.415  1.00 26.51 ? 179  LEU A CG  1 
ATOM   935  C CD1 . LEU A 1 135 ? 37.569  90.683  24.246  1.00 26.15 ? 179  LEU A CD1 1 
ATOM   936  C CD2 . LEU A 1 135 ? 37.295  92.170  22.279  1.00 25.52 ? 179  LEU A CD2 1 
ATOM   937  N N   . PRO A 1 136 ? 38.166  96.171  24.519  1.00 28.74 ? 180  PRO A N   1 
ATOM   938  C CA  . PRO A 1 136 ? 37.987  97.198  25.566  1.00 28.72 ? 180  PRO A CA  1 
ATOM   939  C C   . PRO A 1 136 ? 37.142  96.714  26.774  1.00 28.23 ? 180  PRO A C   1 
ATOM   940  O O   . PRO A 1 136 ? 36.596  97.529  27.516  1.00 29.05 ? 180  PRO A O   1 
ATOM   941  C CB  . PRO A 1 136 ? 37.300  98.343  24.811  1.00 28.87 ? 180  PRO A CB  1 
ATOM   942  C CG  . PRO A 1 136 ? 36.436  97.591  23.789  1.00 28.68 ? 180  PRO A CG  1 
ATOM   943  C CD  . PRO A 1 136 ? 37.182  96.315  23.433  1.00 28.43 ? 180  PRO A CD  1 
ATOM   944  N N   . PHE A 1 137 ? 37.083  95.411  26.994  1.00 26.60 ? 181  PHE A N   1 
ATOM   945  C CA  . PHE A 1 137 ? 36.413  94.861  28.171  1.00 25.85 ? 181  PHE A CA  1 
ATOM   946  C C   . PHE A 1 137 ? 36.981  93.486  28.427  1.00 26.62 ? 181  PHE A C   1 
ATOM   947  O O   . PHE A 1 137 ? 37.711  92.965  27.588  1.00 27.27 ? 181  PHE A O   1 
ATOM   948  C CB  . PHE A 1 137 ? 34.883  94.789  27.947  1.00 25.46 ? 181  PHE A CB  1 
ATOM   949  C CG  . PHE A 1 137 ? 34.457  93.854  26.812  1.00 23.44 ? 181  PHE A CG  1 
ATOM   950  C CD1 . PHE A 1 137 ? 34.046  92.560  27.094  1.00 21.90 ? 181  PHE A CD1 1 
ATOM   951  C CD2 . PHE A 1 137 ? 34.441  94.287  25.484  1.00 23.69 ? 181  PHE A CD2 1 
ATOM   952  C CE1 . PHE A 1 137 ? 33.664  91.679  26.059  1.00 21.54 ? 181  PHE A CE1 1 
ATOM   953  C CE2 . PHE A 1 137 ? 34.048  93.425  24.438  1.00 20.45 ? 181  PHE A CE2 1 
ATOM   954  C CZ  . PHE A 1 137 ? 33.658  92.132  24.733  1.00 22.95 ? 181  PHE A CZ  1 
ATOM   955  N N   . HIS A 1 138 ? 36.646  92.884  29.563  1.00 27.57 ? 182  HIS A N   1 
ATOM   956  C CA  . HIS A 1 138 ? 37.004  91.494  29.827  1.00 27.95 ? 182  HIS A CA  1 
ATOM   957  C C   . HIS A 1 138 ? 35.790  90.657  29.715  1.00 29.04 ? 182  HIS A C   1 
ATOM   958  O O   . HIS A 1 138 ? 34.876  90.840  30.506  1.00 29.88 ? 182  HIS A O   1 
ATOM   959  C CB  . HIS A 1 138 ? 37.531  91.317  31.248  1.00 28.82 ? 182  HIS A CB  1 
ATOM   960  C CG  . HIS A 1 138 ? 38.810  92.040  31.494  1.00 29.22 ? 182  HIS A CG  1 
ATOM   961  N ND1 . HIS A 1 138 ? 40.035  91.497  31.180  1.00 29.18 ? 182  HIS A ND1 1 
ATOM   962  C CD2 . HIS A 1 138 ? 39.048  93.282  31.969  1.00 29.39 ? 182  HIS A CD2 1 
ATOM   963  C CE1 . HIS A 1 138 ? 40.980  92.373  31.461  1.00 30.79 ? 182  HIS A CE1 1 
ATOM   964  N NE2 . HIS A 1 138 ? 40.409  93.462  31.949  1.00 32.58 ? 182  HIS A NE2 1 
ATOM   965  N N   . PRO A 1 139 ? 35.780  89.700  28.765  1.00 29.41 ? 183  PRO A N   1 
ATOM   966  C CA  . PRO A 1 139 ? 34.606  88.884  28.510  1.00 29.23 ? 183  PRO A CA  1 
ATOM   967  C C   . PRO A 1 139 ? 34.323  87.978  29.704  1.00 30.28 ? 183  PRO A C   1 
ATOM   968  O O   . PRO A 1 139 ? 35.253  87.518  30.362  1.00 30.76 ? 183  PRO A O   1 
ATOM   969  C CB  . PRO A 1 139 ? 35.000  88.052  27.275  1.00 29.12 ? 183  PRO A CB  1 
ATOM   970  C CG  . PRO A 1 139 ? 36.231  88.731  26.717  1.00 30.56 ? 183  PRO A CG  1 
ATOM   971  C CD  . PRO A 1 139 ? 36.912  89.350  27.885  1.00 28.95 ? 183  PRO A CD  1 
ATOM   972  N N   . LEU A 1 140 ? 33.037  87.758  29.969  1.00 31.18 ? 184  LEU A N   1 
ATOM   973  C CA  . LEU A 1 140 ? 32.542  86.921  31.038  1.00 32.64 ? 184  LEU A CA  1 
ATOM   974  C C   . LEU A 1 140 ? 31.892  85.661  30.466  1.00 34.12 ? 184  LEU A C   1 
ATOM   975  O O   . LEU A 1 140 ? 31.922  84.592  31.097  1.00 34.53 ? 184  LEU A O   1 
ATOM   976  C CB  . LEU A 1 140 ? 31.537  87.727  31.831  1.00 33.00 ? 184  LEU A CB  1 
ATOM   977  C CG  . LEU A 1 140 ? 30.454  87.085  32.690  1.00 34.89 ? 184  LEU A CG  1 
ATOM   978  C CD1 . LEU A 1 140 ? 31.045  86.241  33.826  1.00 38.93 ? 184  LEU A CD1 1 
ATOM   979  C CD2 . LEU A 1 140 ? 29.606  88.207  33.242  1.00 36.71 ? 184  LEU A CD2 1 
ATOM   980  N N   . THR A 1 141 ? 31.309  85.800  29.274  1.00 34.42 ? 185  THR A N   1 
ATOM   981  C CA  . THR A 1 141 ? 30.693  84.703  28.544  1.00 35.68 ? 185  THR A CA  1 
ATOM   982  C C   . THR A 1 141 ? 31.456  84.399  27.242  1.00 35.85 ? 185  THR A C   1 
ATOM   983  O O   . THR A 1 141 ? 32.260  85.224  26.767  1.00 35.39 ? 185  THR A O   1 
ATOM   984  C CB  . THR A 1 141 ? 29.246  85.106  28.097  1.00 36.62 ? 185  THR A CB  1 
ATOM   985  O OG1 . THR A 1 141 ? 29.283  86.362  27.367  1.00 36.53 ? 185  THR A OG1 1 
ATOM   986  C CG2 . THR A 1 141 ? 28.317  85.203  29.277  1.00 35.51 ? 185  THR A CG2 1 
ATOM   987  N N   . GLN A 1 142 ? 31.183  83.225  26.647  1.00 36.55 ? 186  GLN A N   1 
ATOM   988  C CA  . GLN A 1 142 ? 31.649  82.939  25.288  1.00 37.70 ? 186  GLN A CA  1 
ATOM   989  C C   . GLN A 1 142 ? 30.991  83.911  24.328  1.00 36.55 ? 186  GLN A C   1 
ATOM   990  O O   . GLN A 1 142 ? 29.832  84.236  24.494  1.00 35.89 ? 186  GLN A O   1 
ATOM   991  C CB  . GLN A 1 142 ? 31.280  81.521  24.862  1.00 38.47 ? 186  GLN A CB  1 
ATOM   992  C CG  . GLN A 1 142 ? 31.809  81.142  23.472  1.00 41.43 ? 186  GLN A CG  1 
ATOM   993  C CD  . GLN A 1 142 ? 31.348  79.758  23.031  1.00 40.91 ? 186  GLN A CD  1 
ATOM   994  O OE1 . GLN A 1 142 ? 30.142  79.498  22.939  1.00 49.70 ? 186  GLN A OE1 1 
ATOM   995  N NE2 . GLN A 1 142 ? 32.296  78.860  22.781  1.00 41.97 ? 186  GLN A NE2 1 
ATOM   996  N N   . MET A 1 143 ? 31.728  84.389  23.339  1.00 36.50 ? 187  MET A N   1 
ATOM   997  C CA  . MET A 1 143 ? 31.131  85.228  22.299  1.00 37.42 ? 187  MET A CA  1 
ATOM   998  C C   . MET A 1 143 ? 30.123  84.466  21.428  1.00 36.20 ? 187  MET A C   1 
ATOM   999  O O   . MET A 1 143 ? 30.339  83.294  21.105  1.00 36.71 ? 187  MET A O   1 
ATOM   1000 C CB  . MET A 1 143 ? 32.214  85.816  21.431  1.00 37.37 ? 187  MET A CB  1 
ATOM   1001 C CG  . MET A 1 143 ? 32.613  87.179  21.908  1.00 40.46 ? 187  MET A CG  1 
ATOM   1002 S SD  . MET A 1 143 ? 34.263  87.507  21.373  1.00 41.62 ? 187  MET A SD  1 
ATOM   1003 C CE  . MET A 1 143 ? 35.091  86.274  22.392  1.00 46.50 ? 187  MET A CE  1 
ATOM   1004 N N   . MET A 1 144 ? 29.033  85.139  21.071  1.00 34.21 ? 188  MET A N   1 
ATOM   1005 C CA  . MET A 1 144 ? 27.886  84.558  20.366  1.00 34.55 ? 188  MET A CA  1 
ATOM   1006 C C   . MET A 1 144 ? 27.676  85.233  18.997  1.00 31.04 ? 188  MET A C   1 
ATOM   1007 O O   . MET A 1 144 ? 27.551  86.443  18.910  1.00 27.78 ? 188  MET A O   1 
ATOM   1008 C CB  . MET A 1 144 ? 26.625  84.769  21.211  1.00 33.84 ? 188  MET A CB  1 
ATOM   1009 C CG  . MET A 1 144 ? 26.694  84.161  22.615  1.00 36.83 ? 188  MET A CG  1 
ATOM   1010 S SD  . MET A 1 144 ? 25.168  84.525  23.556  1.00 44.48 ? 188  MET A SD  1 
ATOM   1011 C CE  . MET A 1 144 ? 25.807  85.569  24.886  1.00 43.76 ? 188  MET A CE  1 
ATOM   1012 N N   . TYR A 1 145 ? 27.653  84.425  17.941  1.00 29.00 ? 189  TYR A N   1 
ATOM   1013 C CA  . TYR A 1 145 ? 27.449  84.920  16.578  1.00 28.09 ? 189  TYR A CA  1 
ATOM   1014 C C   . TYR A 1 145 ? 25.970  85.066  16.289  1.00 28.28 ? 189  TYR A C   1 
ATOM   1015 O O   . TYR A 1 145 ? 25.166  84.211  16.678  1.00 26.75 ? 189  TYR A O   1 
ATOM   1016 C CB  . TYR A 1 145 ? 27.962  83.881  15.565  1.00 27.48 ? 189  TYR A CB  1 
ATOM   1017 C CG  . TYR A 1 145 ? 29.443  83.610  15.605  1.00 25.41 ? 189  TYR A CG  1 
ATOM   1018 C CD1 . TYR A 1 145 ? 30.321  84.319  14.759  1.00 23.81 ? 189  TYR A CD1 1 
ATOM   1019 C CD2 . TYR A 1 145 ? 29.967  82.630  16.470  1.00 24.26 ? 189  TYR A CD2 1 
ATOM   1020 C CE1 . TYR A 1 145 ? 31.706  84.058  14.772  1.00 23.65 ? 189  TYR A CE1 1 
ATOM   1021 C CE2 . TYR A 1 145 ? 31.352  82.361  16.507  1.00 23.73 ? 189  TYR A CE2 1 
ATOM   1022 C CZ  . TYR A 1 145 ? 32.215  83.066  15.641  1.00 25.54 ? 189  TYR A CZ  1 
ATOM   1023 O OH  . TYR A 1 145 ? 33.591  82.789  15.659  1.00 23.57 ? 189  TYR A OH  1 
ATOM   1024 N N   . SER A 1 146 ? 25.601  86.111  15.560  1.00 29.07 ? 190  SER A N   1 
ATOM   1025 C CA  . SER A 1 146 ? 24.254  86.188  15.042  1.00 32.34 ? 190  SER A CA  1 
ATOM   1026 C C   . SER A 1 146 ? 24.075  85.084  13.975  1.00 34.73 ? 190  SER A C   1 
ATOM   1027 O O   . SER A 1 146 ? 24.929  84.921  13.106  1.00 35.22 ? 190  SER A O   1 
ATOM   1028 C CB  . SER A 1 146 ? 24.010  87.568  14.445  1.00 32.01 ? 190  SER A CB  1 
ATOM   1029 O OG  . SER A 1 146 ? 22.786  87.598  13.766  1.00 31.53 ? 190  SER A OG  1 
ATOM   1030 N N   . PRO A 1 147 ? 22.971  84.327  14.026  1.00 37.22 ? 191  PRO A N   1 
ATOM   1031 C CA  . PRO A 1 147 ? 22.843  83.252  13.007  1.00 39.14 ? 191  PRO A CA  1 
ATOM   1032 C C   . PRO A 1 147 ? 22.604  83.775  11.576  1.00 40.40 ? 191  PRO A C   1 
ATOM   1033 O O   . PRO A 1 147 ? 22.992  83.098  10.616  1.00 42.00 ? 191  PRO A O   1 
ATOM   1034 C CB  . PRO A 1 147 ? 21.656  82.402  13.509  1.00 39.61 ? 191  PRO A CB  1 
ATOM   1035 C CG  . PRO A 1 147 ? 21.336  82.945  14.913  1.00 39.96 ? 191  PRO A CG  1 
ATOM   1036 C CD  . PRO A 1 147 ? 21.823  84.358  14.953  1.00 37.47 ? 191  PRO A CD  1 
ATOM   1037 N N   . GLN A 1 148 ? 22.012  84.963  11.441  1.00 40.37 ? 192  GLN A N   1 
ATOM   1038 C CA  . GLN A 1 148 ? 21.836  85.627  10.141  1.00 40.45 ? 192  GLN A CA  1 
ATOM   1039 C C   . GLN A 1 148 ? 23.164  86.145  9.560   1.00 39.18 ? 192  GLN A C   1 
ATOM   1040 O O   . GLN A 1 148 ? 23.288  86.292  8.359   1.00 39.90 ? 192  GLN A O   1 
ATOM   1041 C CB  . GLN A 1 148 ? 20.839  86.787  10.281  1.00 39.54 ? 192  GLN A CB  1 
ATOM   1042 C CG  . GLN A 1 148 ? 20.469  87.559  8.948   1.00 42.55 ? 192  GLN A CG  1 
ATOM   1043 C CD  . GLN A 1 148 ? 19.077  88.256  8.982   1.00 43.91 ? 192  GLN A CD  1 
ATOM   1044 O OE1 . GLN A 1 148 ? 18.059  87.620  9.288   1.00 50.15 ? 192  GLN A OE1 1 
ATOM   1045 N NE2 . GLN A 1 148 ? 19.040  89.555  8.659   1.00 47.34 ? 192  GLN A NE2 1 
ATOM   1046 N N   . ASN A 1 149 ? 24.152  86.430  10.417  1.00 38.14 ? 193  ASN A N   1 
ATOM   1047 C CA  . ASN A 1 149 ? 25.356  87.174  10.023  1.00 35.43 ? 193  ASN A CA  1 
ATOM   1048 C C   . ASN A 1 149 ? 26.499  86.852  10.951  1.00 34.45 ? 193  ASN A C   1 
ATOM   1049 O O   . ASN A 1 149 ? 26.548  87.309  12.080  1.00 33.99 ? 193  ASN A O   1 
ATOM   1050 C CB  . ASN A 1 149 ? 25.077  88.689  9.980   1.00 35.27 ? 193  ASN A CB  1 
ATOM   1051 C CG  . ASN A 1 149 ? 26.191  89.482  9.288   1.00 34.91 ? 193  ASN A CG  1 
ATOM   1052 O OD1 . ASN A 1 149 ? 27.327  89.033  9.198   1.00 30.94 ? 193  ASN A OD1 1 
ATOM   1053 N ND2 . ASN A 1 149 ? 25.853  90.667  8.792   1.00 34.04 ? 193  ASN A ND2 1 
ATOM   1054 N N   . SER A 1 150 ? 27.431  86.059  10.452  1.00 33.84 ? 194  SER A N   1 
ATOM   1055 C CA  . SER A 1 150 ? 28.577  85.596  11.215  1.00 33.11 ? 194  SER A CA  1 
ATOM   1056 C C   . SER A 1 150 ? 29.523  86.752  11.601  1.00 32.35 ? 194  SER A C   1 
ATOM   1057 O O   . SER A 1 150 ? 30.440  86.557  12.379  1.00 32.39 ? 194  SER A O   1 
ATOM   1058 C CB  . SER A 1 150 ? 29.316  84.518  10.392  1.00 32.79 ? 194  SER A CB  1 
ATOM   1059 O OG  . SER A 1 150 ? 30.064  85.148  9.322   1.00 35.18 ? 194  SER A OG  1 
ATOM   1060 N N   . ASP A 1 151 ? 29.327  87.950  11.040  1.00 31.80 ? 195  ASP A N   1 
ATOM   1061 C CA  . ASP A 1 151 ? 30.179  89.070  11.376  1.00 31.09 ? 195  ASP A CA  1 
ATOM   1062 C C   . ASP A 1 151 ? 29.646  89.815  12.586  1.00 29.60 ? 195  ASP A C   1 
ATOM   1063 O O   . ASP A 1 151 ? 30.311  90.692  13.119  1.00 28.63 ? 195  ASP A O   1 
ATOM   1064 C CB  . ASP A 1 151 ? 30.282  90.047  10.211  1.00 32.66 ? 195  ASP A CB  1 
ATOM   1065 C CG  . ASP A 1 151 ? 31.201  89.550  9.114   1.00 38.23 ? 195  ASP A CG  1 
ATOM   1066 O OD1 . ASP A 1 151 ? 32.362  89.173  9.418   1.00 40.17 ? 195  ASP A OD1 1 
ATOM   1067 O OD2 . ASP A 1 151 ? 30.742  89.541  7.942   1.00 45.18 ? 195  ASP A OD2 1 
ATOM   1068 N N   . TYR A 1 152 ? 28.445  89.464  13.028  1.00 27.98 ? 196  TYR A N   1 
ATOM   1069 C CA  . TYR A 1 152 ? 27.860  90.167  14.153  1.00 26.46 ? 196  TYR A CA  1 
ATOM   1070 C C   . TYR A 1 152 ? 28.083  89.308  15.393  1.00 25.99 ? 196  TYR A C   1 
ATOM   1071 O O   . TYR A 1 152 ? 27.684  88.123  15.409  1.00 24.86 ? 196  TYR A O   1 
ATOM   1072 C CB  . TYR A 1 152 ? 26.378  90.413  13.889  1.00 27.39 ? 196  TYR A CB  1 
ATOM   1073 C CG  . TYR A 1 152 ? 26.049  91.465  12.831  1.00 27.41 ? 196  TYR A CG  1 
ATOM   1074 C CD1 . TYR A 1 152 ? 27.038  92.043  12.041  1.00 28.40 ? 196  TYR A CD1 1 
ATOM   1075 C CD2 . TYR A 1 152 ? 24.729  91.849  12.596  1.00 30.07 ? 196  TYR A CD2 1 
ATOM   1076 C CE1 . TYR A 1 152 ? 26.717  93.040  11.064  1.00 28.48 ? 196  TYR A CE1 1 
ATOM   1077 C CE2 . TYR A 1 152 ? 24.407  92.823  11.613  1.00 29.55 ? 196  TYR A CE2 1 
ATOM   1078 C CZ  . TYR A 1 152 ? 25.408  93.392  10.870  1.00 27.53 ? 196  TYR A CZ  1 
ATOM   1079 O OH  . TYR A 1 152 ? 25.104  94.313  9.924   1.00 29.79 ? 196  TYR A OH  1 
ATOM   1080 N N   . LEU A 1 153 ? 28.776  89.876  16.393  1.00 24.67 ? 197  LEU A N   1 
ATOM   1081 C CA  . LEU A 1 153 ? 29.054  89.168  17.671  1.00 24.69 ? 197  LEU A CA  1 
ATOM   1082 C C   . LEU A 1 153 ? 28.481  89.933  18.862  1.00 23.60 ? 197  LEU A C   1 
ATOM   1083 O O   . LEU A 1 153 ? 28.429  91.181  18.862  1.00 21.13 ? 197  LEU A O   1 
ATOM   1084 C CB  . LEU A 1 153 ? 30.563  88.993  17.903  1.00 23.65 ? 197  LEU A CB  1 
ATOM   1085 C CG  . LEU A 1 153 ? 31.399  88.430  16.744  1.00 26.83 ? 197  LEU A CG  1 
ATOM   1086 C CD1 . LEU A 1 153 ? 32.864  88.621  16.981  1.00 23.39 ? 197  LEU A CD1 1 
ATOM   1087 C CD2 . LEU A 1 153 ? 31.153  86.955  16.577  1.00 26.88 ? 197  LEU A CD2 1 
ATOM   1088 N N   . LEU A 1 154 ? 28.027  89.195  19.869  1.00 23.13 ? 198  LEU A N   1 
ATOM   1089 C CA  . LEU A 1 154 ? 27.736  89.840  21.126  1.00 24.65 ? 198  LEU A CA  1 
ATOM   1090 C C   . LEU A 1 154 ? 28.469  89.129  22.263  1.00 25.36 ? 198  LEU A C   1 
ATOM   1091 O O   . LEU A 1 154 ? 28.869  87.963  22.119  1.00 24.70 ? 198  LEU A O   1 
ATOM   1092 C CB  . LEU A 1 154 ? 26.237  90.017  21.339  1.00 25.33 ? 198  LEU A CB  1 
ATOM   1093 C CG  . LEU A 1 154 ? 25.378  88.850  21.816  1.00 27.97 ? 198  LEU A CG  1 
ATOM   1094 C CD1 . LEU A 1 154 ? 25.627  88.573  23.281  1.00 32.65 ? 198  LEU A CD1 1 
ATOM   1095 C CD2 . LEU A 1 154 ? 23.950  89.169  21.632  1.00 30.67 ? 198  LEU A CD2 1 
ATOM   1096 N N   . ALA A 1 155 ? 28.681  89.833  23.371  1.00 25.13 ? 199  ALA A N   1 
ATOM   1097 C CA  . ALA A 1 155 ? 29.395  89.275  24.526  1.00 26.40 ? 199  ALA A CA  1 
ATOM   1098 C C   . ALA A 1 155 ? 29.100  90.141  25.745  1.00 27.39 ? 199  ALA A C   1 
ATOM   1099 O O   . ALA A 1 155 ? 28.927  91.340  25.620  1.00 26.17 ? 199  ALA A O   1 
ATOM   1100 C CB  . ALA A 1 155 ? 30.896  89.303  24.282  1.00 26.69 ? 199  ALA A CB  1 
ATOM   1101 N N   . LEU A 1 156 ? 29.055  89.516  26.910  1.00 28.27 ? 200  LEU A N   1 
ATOM   1102 C CA  . LEU A 1 156 ? 28.861  90.245  28.151  1.00 29.99 ? 200  LEU A CA  1 
ATOM   1103 C C   . LEU A 1 156 ? 30.243  90.413  28.756  1.00 30.33 ? 200  LEU A C   1 
ATOM   1104 O O   . LEU A 1 156 ? 31.088  89.536  28.609  1.00 30.68 ? 200  LEU A O   1 
ATOM   1105 C CB  . LEU A 1 156 ? 27.976  89.421  29.087  1.00 29.38 ? 200  LEU A CB  1 
ATOM   1106 C CG  . LEU A 1 156 ? 26.469  89.508  28.904  1.00 31.55 ? 200  LEU A CG  1 
ATOM   1107 C CD1 . LEU A 1 156 ? 25.728  88.731  30.032  1.00 33.51 ? 200  LEU A CD1 1 
ATOM   1108 C CD2 . LEU A 1 156 ? 26.072  90.957  28.927  1.00 36.51 ? 200  LEU A CD2 1 
ATOM   1109 N N   . SER A 1 157 ? 30.483  91.529  29.431  1.00 31.74 ? 201  SER A N   1 
ATOM   1110 C CA  . SER A 1 157 ? 31.750  91.763  30.104  1.00 31.43 ? 201  SER A CA  1 
ATOM   1111 C C   . SER A 1 157 ? 31.641  91.381  31.576  1.00 32.34 ? 201  SER A C   1 
ATOM   1112 O O   . SER A 1 157 ? 30.540  91.089  32.065  1.00 32.58 ? 201  SER A O   1 
ATOM   1113 C CB  . SER A 1 157 ? 32.112  93.227  30.004  1.00 31.70 ? 201  SER A CB  1 
ATOM   1114 O OG  . SER A 1 157 ? 31.183  93.985  30.747  1.00 31.75 ? 201  SER A OG  1 
ATOM   1115 N N   . THR A 1 158 ? 32.778  91.405  32.278  1.00 32.83 ? 202  THR A N   1 
ATOM   1116 C CA  . THR A 1 158 ? 32.843  91.044  33.691  1.00 33.43 ? 202  THR A CA  1 
ATOM   1117 C C   . THR A 1 158 ? 32.149  92.108  34.542  1.00 33.96 ? 202  THR A C   1 
ATOM   1118 O O   . THR A 1 158 ? 31.788  91.857  35.687  1.00 34.54 ? 202  THR A O   1 
ATOM   1119 C CB  . THR A 1 158 ? 34.287  90.768  34.165  1.00 33.35 ? 202  THR A CB  1 
ATOM   1120 O OG1 . THR A 1 158 ? 35.145  91.827  33.739  1.00 33.68 ? 202  THR A OG1 1 
ATOM   1121 C CG2 . THR A 1 158 ? 34.808  89.422  33.587  1.00 34.34 ? 202  THR A CG2 1 
ATOM   1122 N N   . GLU A 1 159 ? 31.920  93.277  33.953  1.00 34.04 ? 203  GLU A N   1 
ATOM   1123 C CA  . GLU A 1 159 ? 31.118  94.307  34.593  1.00 34.71 ? 203  GLU A CA  1 
ATOM   1124 C C   . GLU A 1 159 ? 29.621  94.280  34.231  1.00 34.11 ? 203  GLU A C   1 
ATOM   1125 O O   . GLU A 1 159 ? 28.865  95.189  34.597  1.00 34.06 ? 203  GLU A O   1 
ATOM   1126 C CB  . GLU A 1 159 ? 31.721  95.667  34.287  1.00 35.48 ? 203  GLU A CB  1 
ATOM   1127 C CG  . GLU A 1 159 ? 33.092  95.826  34.853  1.00 38.60 ? 203  GLU A CG  1 
ATOM   1128 C CD  . GLU A 1 159 ? 33.872  96.898  34.136  1.00 45.47 ? 203  GLU A CD  1 
ATOM   1129 O OE1 . GLU A 1 159 ? 33.711  98.100  34.488  1.00 44.44 ? 203  GLU A OE1 1 
ATOM   1130 O OE2 . GLU A 1 159 ? 34.651  96.522  33.217  1.00 48.64 ? 203  GLU A OE2 1 
ATOM   1131 N N   . ASN A 1 160 ? 29.207  93.216  33.542  1.00 33.01 ? 204  ASN A N   1 
ATOM   1132 C CA  . ASN A 1 160 ? 27.859  93.085  32.988  1.00 32.22 ? 204  ASN A CA  1 
ATOM   1133 C C   . ASN A 1 160 ? 27.482  94.185  31.991  1.00 30.38 ? 204  ASN A C   1 
ATOM   1134 O O   . ASN A 1 160 ? 26.384  94.682  31.982  1.00 31.21 ? 204  ASN A O   1 
ATOM   1135 C CB  . ASN A 1 160 ? 26.835  92.943  34.108  1.00 33.03 ? 204  ASN A CB  1 
ATOM   1136 C CG  . ASN A 1 160 ? 27.181  91.812  35.057  1.00 35.76 ? 204  ASN A CG  1 
ATOM   1137 O OD1 . ASN A 1 160 ? 27.756  92.052  36.115  1.00 43.48 ? 204  ASN A OD1 1 
ATOM   1138 N ND2 . ASN A 1 160 ? 26.846  90.577  34.683  1.00 40.53 ? 204  ASN A ND2 1 
ATOM   1139 N N   . GLY A 1 161 ? 28.406  94.578  31.143  1.00 28.27 ? 205  GLY A N   1 
ATOM   1140 C CA  . GLY A 1 161 ? 28.028  95.386  30.014  1.00 26.40 ? 205  GLY A CA  1 
ATOM   1141 C C   . GLY A 1 161 ? 27.749  94.418  28.892  1.00 25.82 ? 205  GLY A C   1 
ATOM   1142 O O   . GLY A 1 161 ? 28.389  93.383  28.792  1.00 25.01 ? 205  GLY A O   1 
ATOM   1143 N N   . LEU A 1 162 ? 26.785  94.761  28.061  1.00 25.46 ? 206  LEU A N   1 
ATOM   1144 C CA  . LEU A 1 162 ? 26.557  94.070  26.815  1.00 25.91 ? 206  LEU A CA  1 
ATOM   1145 C C   . LEU A 1 162 ? 27.276  94.817  25.703  1.00 25.40 ? 206  LEU A C   1 
ATOM   1146 O O   . LEU A 1 162 ? 27.075  96.017  25.508  1.00 26.06 ? 206  LEU A O   1 
ATOM   1147 C CB  . LEU A 1 162 ? 25.060  93.989  26.539  1.00 26.44 ? 206  LEU A CB  1 
ATOM   1148 C CG  . LEU A 1 162 ? 24.619  93.401  25.206  1.00 27.75 ? 206  LEU A CG  1 
ATOM   1149 C CD1 . LEU A 1 162 ? 25.168  91.947  25.030  1.00 22.80 ? 206  LEU A CD1 1 
ATOM   1150 C CD2 . LEU A 1 162 ? 23.117  93.464  25.213  1.00 28.17 ? 206  LEU A CD2 1 
ATOM   1151 N N   . TRP A 1 163 ? 28.159  94.103  25.018  1.00 24.43 ? 207  TRP A N   1 
ATOM   1152 C CA  . TRP A 1 163 ? 28.957  94.655  23.941  1.00 23.98 ? 207  TRP A CA  1 
ATOM   1153 C C   . TRP A 1 163 ? 28.622  93.979  22.631  1.00 23.59 ? 207  TRP A C   1 
ATOM   1154 O O   . TRP A 1 163 ? 28.447  92.762  22.582  1.00 21.43 ? 207  TRP A O   1 
ATOM   1155 C CB  . TRP A 1 163 ? 30.430  94.420  24.227  1.00 25.13 ? 207  TRP A CB  1 
ATOM   1156 C CG  . TRP A 1 163 ? 30.920  95.177  25.422  1.00 26.79 ? 207  TRP A CG  1 
ATOM   1157 C CD1 . TRP A 1 163 ? 30.731  94.846  26.735  1.00 26.79 ? 207  TRP A CD1 1 
ATOM   1158 C CD2 . TRP A 1 163 ? 31.697  96.387  25.416  1.00 27.17 ? 207  TRP A CD2 1 
ATOM   1159 N NE1 . TRP A 1 163 ? 31.335  95.785  27.551  1.00 28.88 ? 207  TRP A NE1 1 
ATOM   1160 C CE2 . TRP A 1 163 ? 31.930  96.741  26.767  1.00 27.57 ? 207  TRP A CE2 1 
ATOM   1161 C CE3 . TRP A 1 163 ? 32.213  97.203  24.405  1.00 26.57 ? 207  TRP A CE3 1 
ATOM   1162 C CZ2 . TRP A 1 163 ? 32.660  97.859  27.125  1.00 28.13 ? 207  TRP A CZ2 1 
ATOM   1163 C CZ3 . TRP A 1 163 ? 32.919  98.317  24.758  1.00 27.07 ? 207  TRP A CZ3 1 
ATOM   1164 C CH2 . TRP A 1 163 ? 33.144  98.642  26.112  1.00 28.13 ? 207  TRP A CH2 1 
ATOM   1165 N N   . VAL A 1 164 ? 28.530  94.775  21.576  1.00 22.63 ? 208  VAL A N   1 
ATOM   1166 C CA  . VAL A 1 164 ? 28.243  94.252  20.248  1.00 24.00 ? 208  VAL A CA  1 
ATOM   1167 C C   . VAL A 1 164 ? 29.346  94.608  19.248  1.00 24.18 ? 208  VAL A C   1 
ATOM   1168 O O   . VAL A 1 164 ? 29.938  95.675  19.346  1.00 23.41 ? 208  VAL A O   1 
ATOM   1169 C CB  . VAL A 1 164 ? 26.860  94.749  19.758  1.00 24.90 ? 208  VAL A CB  1 
ATOM   1170 C CG1 . VAL A 1 164 ? 26.578  94.238  18.357  1.00 26.19 ? 208  VAL A CG1 1 
ATOM   1171 C CG2 . VAL A 1 164 ? 25.747  94.225  20.710  1.00 25.10 ? 208  VAL A CG2 1 
ATOM   1172 N N   . SER A 1 165 ? 29.643  93.713  18.311  1.00 24.46 ? 209  SER A N   1 
ATOM   1173 C CA  . SER A 1 165 ? 30.597  94.034  17.243  1.00 25.71 ? 209  SER A CA  1 
ATOM   1174 C C   . SER A 1 165 ? 29.945  93.751  15.880  1.00 26.50 ? 209  SER A C   1 
ATOM   1175 O O   . SER A 1 165 ? 29.265  92.756  15.726  1.00 24.88 ? 209  SER A O   1 
ATOM   1176 C CB  . SER A 1 165 ? 31.878  93.194  17.386  1.00 24.86 ? 209  SER A CB  1 
ATOM   1177 O OG  . SER A 1 165 ? 32.752  93.385  16.265  1.00 25.72 ? 209  SER A OG  1 
ATOM   1178 N N   . LYS A 1 166 ? 30.154  94.640  14.905  1.00 26.89 ? 210  LYS A N   1 
ATOM   1179 C CA  . LYS A 1 166 ? 29.564  94.468  13.566  1.00 27.56 ? 210  LYS A CA  1 
ATOM   1180 C C   . LYS A 1 166 ? 30.565  93.970  12.536  1.00 26.67 ? 210  LYS A C   1 
ATOM   1181 O O   . LYS A 1 166 ? 30.194  93.743  11.385  1.00 25.41 ? 210  LYS A O   1 
ATOM   1182 C CB  . LYS A 1 166 ? 29.023  95.805  13.038  1.00 28.95 ? 210  LYS A CB  1 
ATOM   1183 C CG  . LYS A 1 166 ? 27.843  96.402  13.826  1.00 32.72 ? 210  LYS A CG  1 
ATOM   1184 C CD  . LYS A 1 166 ? 27.609  97.830  13.382  1.00 38.61 ? 210  LYS A CD  1 
ATOM   1185 C CE  . LYS A 1 166 ? 26.555  98.536  14.232  1.00 43.29 ? 210  LYS A CE  1 
ATOM   1186 N NZ  . LYS A 1 166 ? 27.107  99.250  15.428  1.00 46.48 ? 210  LYS A NZ  1 
ATOM   1187 N N   . ASN A 1 167 ? 31.824  93.813  12.949  1.00 26.20 ? 211  ASN A N   1 
ATOM   1188 C CA  . ASN A 1 167 ? 32.916  93.477  12.031  1.00 25.17 ? 211  ASN A CA  1 
ATOM   1189 C C   . ASN A 1 167 ? 33.780  92.377  12.587  1.00 25.04 ? 211  ASN A C   1 
ATOM   1190 O O   . ASN A 1 167 ? 35.020  92.501  12.630  1.00 23.70 ? 211  ASN A O   1 
ATOM   1191 C CB  . ASN A 1 167 ? 33.787  94.716  11.716  1.00 25.60 ? 211  ASN A CB  1 
ATOM   1192 C CG  . ASN A 1 167 ? 34.538  95.219  12.930  1.00 24.10 ? 211  ASN A CG  1 
ATOM   1193 O OD1 . ASN A 1 167 ? 34.212  94.864  14.042  1.00 22.46 ? 211  ASN A OD1 1 
ATOM   1194 N ND2 . ASN A 1 167 ? 35.566  96.030  12.714  1.00 24.88 ? 211  ASN A ND2 1 
ATOM   1195 N N   . PHE A 1 168 ? 33.112  91.308  13.019  1.00 24.81 ? 212  PHE A N   1 
ATOM   1196 C CA  . PHE A 1 168 ? 33.751  90.100  13.503  1.00 24.99 ? 212  PHE A CA  1 
ATOM   1197 C C   . PHE A 1 168 ? 34.743  90.394  14.638  1.00 26.36 ? 212  PHE A C   1 
ATOM   1198 O O   . PHE A 1 168 ? 35.877  89.907  14.628  1.00 27.08 ? 212  PHE A O   1 
ATOM   1199 C CB  . PHE A 1 168 ? 34.386  89.298  12.350  1.00 23.63 ? 212  PHE A CB  1 
ATOM   1200 C CG  . PHE A 1 168 ? 34.975  87.972  12.785  1.00 22.89 ? 212  PHE A CG  1 
ATOM   1201 C CD1 . PHE A 1 168 ? 34.297  87.150  13.675  1.00 19.65 ? 212  PHE A CD1 1 
ATOM   1202 C CD2 . PHE A 1 168 ? 36.218  87.553  12.301  1.00 21.13 ? 212  PHE A CD2 1 
ATOM   1203 C CE1 . PHE A 1 168 ? 34.860  85.962  14.084  1.00 21.13 ? 212  PHE A CE1 1 
ATOM   1204 C CE2 . PHE A 1 168 ? 36.773  86.363  12.715  1.00 22.40 ? 212  PHE A CE2 1 
ATOM   1205 C CZ  . PHE A 1 168 ? 36.097  85.563  13.602  1.00 21.38 ? 212  PHE A CZ  1 
ATOM   1206 N N   . GLY A 1 169 ? 34.320  91.228  15.593  1.00 26.64 ? 213  GLY A N   1 
ATOM   1207 C CA  . GLY A 1 169 ? 35.078  91.466  16.825  1.00 27.62 ? 213  GLY A CA  1 
ATOM   1208 C C   . GLY A 1 169 ? 36.247  92.384  16.648  1.00 28.94 ? 213  GLY A C   1 
ATOM   1209 O O   . GLY A 1 169 ? 37.107  92.457  17.518  1.00 29.27 ? 213  GLY A O   1 
ATOM   1210 N N   . GLY A 1 170 ? 36.274  93.113  15.531  1.00 29.92 ? 214  GLY A N   1 
ATOM   1211 C CA  . GLY A 1 170 ? 37.285  94.146  15.320  1.00 30.07 ? 214  GLY A CA  1 
ATOM   1212 C C   . GLY A 1 170 ? 37.104  95.355  16.230  1.00 31.27 ? 214  GLY A C   1 
ATOM   1213 O O   . GLY A 1 170 ? 38.069  95.850  16.845  1.00 32.27 ? 214  GLY A O   1 
ATOM   1214 N N   . LYS A 1 171 ? 35.886  95.883  16.275  1.00 31.28 ? 215  LYS A N   1 
ATOM   1215 C CA  . LYS A 1 171 ? 35.573  97.001  17.143  1.00 31.31 ? 215  LYS A CA  1 
ATOM   1216 C C   . LYS A 1 171 ? 34.309  96.677  17.863  1.00 30.53 ? 215  LYS A C   1 
ATOM   1217 O O   . LYS A 1 171 ? 33.388  96.101  17.294  1.00 30.61 ? 215  LYS A O   1 
ATOM   1218 C CB  . LYS A 1 171 ? 35.365  98.299  16.360  1.00 31.87 ? 215  LYS A CB  1 
ATOM   1219 C CG  . LYS A 1 171 ? 36.577  98.824  15.623  1.00 35.82 ? 215  LYS A CG  1 
ATOM   1220 C CD  . LYS A 1 171 ? 37.541  99.682  16.506  1.00 38.79 ? 215  LYS A CD  1 
ATOM   1221 C CE  . LYS A 1 171 ? 36.888  100.938 17.115  1.00 39.68 ? 215  LYS A CE  1 
ATOM   1222 N NZ  . LYS A 1 171 ? 37.880  101.739 17.926  1.00 40.06 ? 215  LYS A NZ  1 
ATOM   1223 N N   . TRP A 1 172 ? 34.249  97.073  19.116  1.00 29.95 ? 216  TRP A N   1 
ATOM   1224 C CA  . TRP A 1 172 ? 33.098  96.804  19.939  1.00 29.57 ? 216  TRP A CA  1 
ATOM   1225 C C   . TRP A 1 172 ? 32.469  98.111  20.406  1.00 30.74 ? 216  TRP A C   1 
ATOM   1226 O O   . TRP A 1 172 ? 33.123  99.156  20.410  1.00 29.25 ? 216  TRP A O   1 
ATOM   1227 C CB  . TRP A 1 172 ? 33.545  95.962  21.125  1.00 28.68 ? 216  TRP A CB  1 
ATOM   1228 C CG  . TRP A 1 172 ? 34.148  94.653  20.684  1.00 28.13 ? 216  TRP A CG  1 
ATOM   1229 C CD1 . TRP A 1 172 ? 35.401  94.454  20.173  1.00 26.42 ? 216  TRP A CD1 1 
ATOM   1230 C CD2 . TRP A 1 172 ? 33.508  93.378  20.678  1.00 26.11 ? 216  TRP A CD2 1 
ATOM   1231 N NE1 . TRP A 1 172 ? 35.579  93.134  19.883  1.00 25.62 ? 216  TRP A NE1 1 
ATOM   1232 C CE2 . TRP A 1 172 ? 34.436  92.452  20.168  1.00 25.76 ? 216  TRP A CE2 1 
ATOM   1233 C CE3 . TRP A 1 172 ? 32.239  92.923  21.075  1.00 26.10 ? 216  TRP A CE3 1 
ATOM   1234 C CZ2 . TRP A 1 172 ? 34.153  91.106  20.051  1.00 24.59 ? 216  TRP A CZ2 1 
ATOM   1235 C CZ3 . TRP A 1 172 ? 31.954  91.589  20.943  1.00 25.79 ? 216  TRP A CZ3 1 
ATOM   1236 C CH2 . TRP A 1 172 ? 32.914  90.694  20.429  1.00 26.07 ? 216  TRP A CH2 1 
ATOM   1237 N N   . GLU A 1 173 ? 31.177  98.064  20.736  1.00 31.56 ? 217  GLU A N   1 
ATOM   1238 C CA  . GLU A 1 173 ? 30.562  99.145  21.503  1.00 32.73 ? 217  GLU A CA  1 
ATOM   1239 C C   . GLU A 1 173 ? 29.626  98.578  22.539  1.00 32.27 ? 217  GLU A C   1 
ATOM   1240 O O   . GLU A 1 173 ? 28.967  97.561  22.298  1.00 30.67 ? 217  GLU A O   1 
ATOM   1241 C CB  . GLU A 1 173 ? 29.836  100.135 20.606  1.00 34.09 ? 217  GLU A CB  1 
ATOM   1242 C CG  . GLU A 1 173 ? 28.982  99.484  19.543  1.00 38.31 ? 217  GLU A CG  1 
ATOM   1243 C CD  . GLU A 1 173 ? 28.135  100.514 18.806  1.00 44.22 ? 217  GLU A CD  1 
ATOM   1244 O OE1 . GLU A 1 173 ? 27.880  101.601 19.399  1.00 46.37 ? 217  GLU A OE1 1 
ATOM   1245 O OE2 . GLU A 1 173 ? 27.734  100.235 17.642  1.00 45.27 ? 217  GLU A OE2 1 
ATOM   1246 N N   . GLU A 1 174 ? 29.608  99.191  23.717  1.00 32.05 ? 218  GLU A N   1 
ATOM   1247 C CA  . GLU A 1 174 ? 28.686  98.730  24.731  1.00 33.61 ? 218  GLU A CA  1 
ATOM   1248 C C   . GLU A 1 174 ? 27.368  99.432  24.554  1.00 33.19 ? 218  GLU A C   1 
ATOM   1249 O O   . GLU A 1 174 ? 27.302  100.649 24.549  1.00 33.85 ? 218  GLU A O   1 
ATOM   1250 C CB  . GLU A 1 174 ? 29.235  98.757  26.174  1.00 32.74 ? 218  GLU A CB  1 
ATOM   1251 C CG  . GLU A 1 174 ? 29.429  100.068 26.846  1.00 36.46 ? 218  GLU A CG  1 
ATOM   1252 C CD  . GLU A 1 174 ? 29.352  99.959  28.380  1.00 36.09 ? 218  GLU A CD  1 
ATOM   1253 O OE1 . GLU A 1 174 ? 28.947  100.960 29.011  1.00 37.73 ? 218  GLU A OE1 1 
ATOM   1254 O OE2 . GLU A 1 174 ? 29.670  98.876  28.944  1.00 40.14 ? 218  GLU A OE2 1 
ATOM   1255 N N   . ILE A 1 175 ? 26.324  98.641  24.359  1.00 32.84 ? 219  ILE A N   1 
ATOM   1256 C CA  . ILE A 1 175 ? 25.001  99.174  24.066  1.00 31.92 ? 219  ILE A CA  1 
ATOM   1257 C C   . ILE A 1 175 ? 24.157  99.172  25.342  1.00 31.04 ? 219  ILE A C   1 
ATOM   1258 O O   . ILE A 1 175 ? 23.134  99.836  25.417  1.00 30.85 ? 219  ILE A O   1 
ATOM   1259 C CB  . ILE A 1 175 ? 24.302  98.340  22.937  1.00 31.75 ? 219  ILE A CB  1 
ATOM   1260 C CG1 . ILE A 1 175 ? 23.974  96.933  23.416  1.00 31.44 ? 219  ILE A CG1 1 
ATOM   1261 C CG2 . ILE A 1 175 ? 25.191  98.216  21.703  1.00 32.00 ? 219  ILE A CG2 1 
ATOM   1262 C CD1 . ILE A 1 175 ? 23.216  96.148  22.415  1.00 29.12 ? 219  ILE A CD1 1 
ATOM   1263 N N   . HIS A 1 176 ? 24.592  98.412  26.340  1.00 30.43 ? 220  HIS A N   1 
ATOM   1264 C CA  . HIS A 1 176 ? 23.911  98.396  27.625  1.00 30.91 ? 220  HIS A CA  1 
ATOM   1265 C C   . HIS A 1 176 ? 24.788  97.972  28.802  1.00 30.47 ? 220  HIS A C   1 
ATOM   1266 O O   . HIS A 1 176 ? 25.669  97.120  28.670  1.00 30.47 ? 220  HIS A O   1 
ATOM   1267 C CB  . HIS A 1 176 ? 22.634  97.558  27.590  1.00 31.22 ? 220  HIS A CB  1 
ATOM   1268 C CG  . HIS A 1 176 ? 21.553  98.108  28.469  1.00 34.21 ? 220  HIS A CG  1 
ATOM   1269 N ND1 . HIS A 1 176 ? 21.555  97.954  29.843  1.00 35.70 ? 220  HIS A ND1 1 
ATOM   1270 C CD2 . HIS A 1 176 ? 20.450  98.834  28.171  1.00 34.59 ? 220  HIS A CD2 1 
ATOM   1271 C CE1 . HIS A 1 176 ? 20.484  98.538  30.347  1.00 37.16 ? 220  HIS A CE1 1 
ATOM   1272 N NE2 . HIS A 1 176 ? 19.800  99.086  29.356  1.00 36.81 ? 220  HIS A NE2 1 
ATOM   1273 N N   . LYS A 1 177 ? 24.485  98.551  29.961  1.00 29.57 ? 221  LYS A N   1 
ATOM   1274 C CA  . LYS A 1 177 ? 25.357  98.527  31.114  1.00 30.04 ? 221  LYS A CA  1 
ATOM   1275 C C   . LYS A 1 177 ? 25.086  97.516  32.211  1.00 29.97 ? 221  LYS A C   1 
ATOM   1276 O O   . LYS A 1 177 ? 26.016  97.207  32.991  1.00 31.87 ? 221  LYS A O   1 
ATOM   1277 C CB  . LYS A 1 177 ? 25.348  99.898  31.776  1.00 29.91 ? 221  LYS A CB  1 
ATOM   1278 C CG  . LYS A 1 177 ? 26.513  100.731 31.396  1.00 31.97 ? 221  LYS A CG  1 
ATOM   1279 C CD  . LYS A 1 177 ? 26.833  101.684 32.527  1.00 34.64 ? 221  LYS A CD  1 
ATOM   1280 C CE  . LYS A 1 177 ? 28.058  102.489 32.205  1.00 38.42 ? 221  LYS A CE  1 
ATOM   1281 N NZ  . LYS A 1 177 ? 27.816  103.284 30.977  1.00 41.64 ? 221  LYS A NZ  1 
ATOM   1282 N N   . ALA A 1 178 ? 23.850  97.042  32.346  1.00 28.12 ? 222  ALA A N   1 
ATOM   1283 C CA  . ALA A 1 178 ? 23.547  96.206  33.509  1.00 27.01 ? 222  ALA A CA  1 
ATOM   1284 C C   . ALA A 1 178 ? 22.787  94.961  33.101  1.00 26.57 ? 222  ALA A C   1 
ATOM   1285 O O   . ALA A 1 178 ? 21.637  94.799  33.478  1.00 26.43 ? 222  ALA A O   1 
ATOM   1286 C CB  . ALA A 1 178 ? 22.774  97.009  34.563  1.00 27.67 ? 222  ALA A CB  1 
ATOM   1287 N N   . VAL A 1 179 ? 23.456  94.069  32.362  1.00 25.94 ? 223  VAL A N   1 
ATOM   1288 C CA  . VAL A 1 179 ? 22.790  92.964  31.643  1.00 25.19 ? 223  VAL A CA  1 
ATOM   1289 C C   . VAL A 1 179 ? 23.142  91.621  32.269  1.00 26.86 ? 223  VAL A C   1 
ATOM   1290 O O   . VAL A 1 179 ? 24.293  91.387  32.609  1.00 27.38 ? 223  VAL A O   1 
ATOM   1291 C CB  . VAL A 1 179 ? 23.188  93.010  30.147  1.00 24.93 ? 223  VAL A CB  1 
ATOM   1292 C CG1 . VAL A 1 179 ? 22.666  91.837  29.371  1.00 20.97 ? 223  VAL A CG1 1 
ATOM   1293 C CG2 . VAL A 1 179 ? 22.701  94.309  29.485  1.00 23.16 ? 223  VAL A CG2 1 
ATOM   1294 N N   . CYS A 1 180 ? 22.155  90.734  32.410  1.00 28.18 ? 224  CYS A N   1 
ATOM   1295 C CA  . CYS A 1 180 ? 22.377  89.448  33.025  1.00 30.66 ? 224  CYS A CA  1 
ATOM   1296 C C   . CYS A 1 180 ? 22.489  88.316  32.031  1.00 29.75 ? 224  CYS A C   1 
ATOM   1297 O O   . CYS A 1 180 ? 23.275  87.398  32.250  1.00 29.69 ? 224  CYS A O   1 
ATOM   1298 C CB  . CYS A 1 180 ? 21.222  89.101  33.939  1.00 31.96 ? 224  CYS A CB  1 
ATOM   1299 S SG  . CYS A 1 180 ? 21.210  90.199  35.239  1.00 43.61 ? 224  CYS A SG  1 
ATOM   1300 N N   . LEU A 1 181 ? 21.700  88.395  30.960  1.00 28.44 ? 225  LEU A N   1 
ATOM   1301 C CA  . LEU A 1 181 ? 21.594  87.330  29.941  1.00 27.77 ? 225  LEU A CA  1 
ATOM   1302 C C   . LEU A 1 181 ? 21.305  88.004  28.596  1.00 26.79 ? 225  LEU A C   1 
ATOM   1303 O O   . LEU A 1 181 ? 20.595  88.963  28.564  1.00 28.20 ? 225  LEU A O   1 
ATOM   1304 C CB  . LEU A 1 181 ? 20.456  86.416  30.341  1.00 27.56 ? 225  LEU A CB  1 
ATOM   1305 C CG  . LEU A 1 181 ? 20.198  85.223  29.415  1.00 28.54 ? 225  LEU A CG  1 
ATOM   1306 C CD1 . LEU A 1 181 ? 21.466  84.374  29.261  1.00 29.52 ? 225  LEU A CD1 1 
ATOM   1307 C CD2 . LEU A 1 181 ? 19.015  84.435  29.966  1.00 29.84 ? 225  LEU A CD2 1 
ATOM   1308 N N   . ALA A 1 182 ? 21.945  87.599  27.509  1.00 25.11 ? 226  ALA A N   1 
ATOM   1309 C CA  . ALA A 1 182 ? 21.591  88.127  26.208  1.00 23.74 ? 226  ALA A CA  1 
ATOM   1310 C C   . ALA A 1 182 ? 21.647  87.004  25.202  1.00 24.70 ? 226  ALA A C   1 
ATOM   1311 O O   . ALA A 1 182 ? 22.592  86.190  25.252  1.00 24.22 ? 226  ALA A O   1 
ATOM   1312 C CB  . ALA A 1 182 ? 22.537  89.200  25.793  1.00 22.33 ? 226  ALA A CB  1 
ATOM   1313 N N   . LYS A 1 183 ? 20.688  87.006  24.271  1.00 25.43 ? 227  LYS A N   1 
ATOM   1314 C CA  . LYS A 1 183 ? 20.665  86.081  23.126  1.00 27.55 ? 227  LYS A CA  1 
ATOM   1315 C C   . LYS A 1 183 ? 20.207  86.731  21.816  1.00 27.17 ? 227  LYS A C   1 
ATOM   1316 O O   . LYS A 1 183 ? 19.482  87.712  21.815  1.00 25.59 ? 227  LYS A O   1 
ATOM   1317 C CB  . LYS A 1 183 ? 19.803  84.850  23.409  1.00 28.14 ? 227  LYS A CB  1 
ATOM   1318 C CG  . LYS A 1 183 ? 19.248  84.827  24.766  1.00 33.73 ? 227  LYS A CG  1 
ATOM   1319 C CD  . LYS A 1 183 ? 18.776  83.457  25.173  1.00 41.77 ? 227  LYS A CD  1 
ATOM   1320 C CE  . LYS A 1 183 ? 19.865  82.696  25.913  1.00 48.13 ? 227  LYS A CE  1 
ATOM   1321 N NZ  . LYS A 1 183 ? 19.237  81.545  26.618  1.00 51.24 ? 227  LYS A NZ  1 
ATOM   1322 N N   . TRP A 1 184 ? 20.708  86.180  20.709  1.00 28.16 ? 228  TRP A N   1 
ATOM   1323 C CA  . TRP A 1 184 ? 20.316  86.573  19.360  1.00 29.18 ? 228  TRP A CA  1 
ATOM   1324 C C   . TRP A 1 184 ? 19.010  85.877  19.030  1.00 31.10 ? 228  TRP A C   1 
ATOM   1325 O O   . TRP A 1 184 ? 18.865  84.664  19.257  1.00 31.30 ? 228  TRP A O   1 
ATOM   1326 C CB  . TRP A 1 184 ? 21.352  86.101  18.326  1.00 28.46 ? 228  TRP A CB  1 
ATOM   1327 C CG  . TRP A 1 184 ? 22.640  86.824  18.308  1.00 27.08 ? 228  TRP A CG  1 
ATOM   1328 C CD1 . TRP A 1 184 ? 23.861  86.352  18.744  1.00 26.52 ? 228  TRP A CD1 1 
ATOM   1329 C CD2 . TRP A 1 184 ? 22.892  88.109  17.741  1.00 27.85 ? 228  TRP A CD2 1 
ATOM   1330 N NE1 . TRP A 1 184 ? 24.838  87.287  18.497  1.00 25.48 ? 228  TRP A NE1 1 
ATOM   1331 C CE2 . TRP A 1 184 ? 24.271  88.382  17.909  1.00 27.38 ? 228  TRP A CE2 1 
ATOM   1332 C CE3 . TRP A 1 184 ? 22.085  89.084  17.141  1.00 25.47 ? 228  TRP A CE3 1 
ATOM   1333 C CZ2 . TRP A 1 184 ? 24.858  89.589  17.484  1.00 26.03 ? 228  TRP A CZ2 1 
ATOM   1334 C CZ3 . TRP A 1 184 ? 22.686  90.278  16.705  1.00 24.75 ? 228  TRP A CZ3 1 
ATOM   1335 C CH2 . TRP A 1 184 ? 24.038  90.519  16.892  1.00 26.29 ? 228  TRP A CH2 1 
ATOM   1336 N N   . GLY A 1 185 ? 18.061  86.631  18.489  1.00 33.77 ? 229  GLY A N   1 
ATOM   1337 C CA  . GLY A 1 185 ? 16.853  86.042  17.907  1.00 36.93 ? 229  GLY A CA  1 
ATOM   1338 C C   . GLY A 1 185 ? 17.051  85.988  16.411  1.00 39.09 ? 229  GLY A C   1 
ATOM   1339 O O   . GLY A 1 185 ? 18.189  85.855  15.947  1.00 39.79 ? 229  GLY A O   1 
ATOM   1340 N N   . SER A 1 186 ? 15.969  86.126  15.647  1.00 40.20 ? 230  SER A N   1 
ATOM   1341 C CA  . SER A 1 186 ? 16.093  86.127  14.187  1.00 41.26 ? 230  SER A CA  1 
ATOM   1342 C C   . SER A 1 186 ? 16.318  87.524  13.630  1.00 41.32 ? 230  SER A C   1 
ATOM   1343 O O   . SER A 1 186 ? 16.016  88.524  14.292  1.00 42.18 ? 230  SER A O   1 
ATOM   1344 C CB  . SER A 1 186 ? 14.851  85.511  13.578  1.00 41.18 ? 230  SER A CB  1 
ATOM   1345 O OG  . SER A 1 186 ? 14.727  84.211  14.127  1.00 45.09 ? 230  SER A OG  1 
ATOM   1346 N N   . ASP A 1 187 ? 16.862  87.590  12.414  1.00 41.14 ? 231  ASP A N   1 
ATOM   1347 C CA  . ASP A 1 187 ? 16.983  88.845  11.695  1.00 40.86 ? 231  ASP A CA  1 
ATOM   1348 C C   . ASP A 1 187 ? 17.792  89.849  12.496  1.00 38.79 ? 231  ASP A C   1 
ATOM   1349 O O   . ASP A 1 187 ? 17.472  91.033  12.485  1.00 39.59 ? 231  ASP A O   1 
ATOM   1350 C CB  . ASP A 1 187 ? 15.596  89.423  11.369  1.00 42.59 ? 231  ASP A CB  1 
ATOM   1351 C CG  . ASP A 1 187 ? 14.687  88.420  10.625  1.00 47.90 ? 231  ASP A CG  1 
ATOM   1352 O OD1 . ASP A 1 187 ? 15.022  88.063  9.465   1.00 53.09 ? 231  ASP A OD1 1 
ATOM   1353 O OD2 . ASP A 1 187 ? 13.635  87.998  11.193  1.00 51.72 ? 231  ASP A OD2 1 
ATOM   1354 N N   . ASN A 1 188 ? 18.840  89.357  13.181  1.00 36.17 ? 232  ASN A N   1 
ATOM   1355 C CA  . ASN A 1 188 ? 19.831  90.179  13.918  1.00 33.76 ? 232  ASN A CA  1 
ATOM   1356 C C   . ASN A 1 188 ? 19.216  90.883  15.119  1.00 32.66 ? 232  ASN A C   1 
ATOM   1357 O O   . ASN A 1 188 ? 19.644  91.957  15.509  1.00 31.50 ? 232  ASN A O   1 
ATOM   1358 C CB  . ASN A 1 188 ? 20.554  91.205  13.023  1.00 33.61 ? 232  ASN A CB  1 
ATOM   1359 C CG  . ASN A 1 188 ? 21.430  90.555  11.947  1.00 34.75 ? 232  ASN A CG  1 
ATOM   1360 O OD1 . ASN A 1 188 ? 22.121  89.578  12.199  1.00 34.19 ? 232  ASN A OD1 1 
ATOM   1361 N ND2 . ASN A 1 188 ? 21.404  91.113  10.744  1.00 36.35 ? 232  ASN A ND2 1 
ATOM   1362 N N   . THR A 1 189 ? 18.206  90.265  15.711  1.00 30.69 ? 233  THR A N   1 
ATOM   1363 C CA  . THR A 1 189 ? 17.610  90.843  16.892  1.00 29.64 ? 233  THR A CA  1 
ATOM   1364 C C   . THR A 1 189 ? 18.347  90.384  18.155  1.00 27.39 ? 233  THR A C   1 
ATOM   1365 O O   . THR A 1 189 ? 18.839  89.258  18.189  1.00 27.24 ? 233  THR A O   1 
ATOM   1366 C CB  . THR A 1 189 ? 16.141  90.494  16.915  1.00 30.18 ? 233  THR A CB  1 
ATOM   1367 O OG1 . THR A 1 189 ? 15.558  91.068  15.739  1.00 33.20 ? 233  THR A OG1 1 
ATOM   1368 C CG2 . THR A 1 189 ? 15.473  91.106  18.125  1.00 29.92 ? 233  THR A CG2 1 
ATOM   1369 N N   . ILE A 1 190 ? 18.462  91.261  19.157  1.00 25.17 ? 234  ILE A N   1 
ATOM   1370 C CA  . ILE A 1 190 ? 18.989  90.895  20.466  1.00 23.40 ? 234  ILE A CA  1 
ATOM   1371 C C   . ILE A 1 190 ? 17.922  91.042  21.549  1.00 23.14 ? 234  ILE A C   1 
ATOM   1372 O O   . ILE A 1 190 ? 17.312  92.101  21.662  1.00 22.62 ? 234  ILE A O   1 
ATOM   1373 C CB  . ILE A 1 190 ? 20.247  91.726  20.824  1.00 24.47 ? 234  ILE A CB  1 
ATOM   1374 C CG1 . ILE A 1 190 ? 21.364  91.480  19.800  1.00 24.70 ? 234  ILE A CG1 1 
ATOM   1375 C CG2 . ILE A 1 190 ? 20.747  91.412  22.258  1.00 24.75 ? 234  ILE A CG2 1 
ATOM   1376 C CD1 . ILE A 1 190 ? 22.399  92.599  19.693  1.00 23.82 ? 234  ILE A CD1 1 
ATOM   1377 N N   . PHE A 1 191 ? 17.713  89.975  22.338  1.00 23.88 ? 235  PHE A N   1 
ATOM   1378 C CA  . PHE A 1 191 ? 16.896  90.008  23.568  1.00 23.77 ? 235  PHE A CA  1 
ATOM   1379 C C   . PHE A 1 191 ? 17.846  89.904  24.766  1.00 24.41 ? 235  PHE A C   1 
ATOM   1380 O O   . PHE A 1 191 ? 18.787  89.089  24.754  1.00 23.23 ? 235  PHE A O   1 
ATOM   1381 C CB  . PHE A 1 191 ? 15.937  88.800  23.633  1.00 23.48 ? 235  PHE A CB  1 
ATOM   1382 C CG  . PHE A 1 191 ? 14.991  88.698  22.462  1.00 23.88 ? 235  PHE A CG  1 
ATOM   1383 C CD1 . PHE A 1 191 ? 13.853  89.467  22.408  1.00 24.61 ? 235  PHE A CD1 1 
ATOM   1384 C CD2 . PHE A 1 191 ? 15.246  87.810  21.418  1.00 26.95 ? 235  PHE A CD2 1 
ATOM   1385 C CE1 . PHE A 1 191 ? 12.996  89.400  21.336  1.00 25.27 ? 235  PHE A CE1 1 
ATOM   1386 C CE2 . PHE A 1 191 ? 14.382  87.720  20.333  1.00 26.82 ? 235  PHE A CE2 1 
ATOM   1387 C CZ  . PHE A 1 191 ? 13.243  88.494  20.304  1.00 26.31 ? 235  PHE A CZ  1 
ATOM   1388 N N   . PHE A 1 192 ? 17.598  90.676  25.810  1.00 23.62 ? 236  PHE A N   1 
ATOM   1389 C CA  . PHE A 1 192 ? 18.494  90.653  26.982  1.00 24.80 ? 236  PHE A CA  1 
ATOM   1390 C C   . PHE A 1 192 ? 17.795  91.153  28.228  1.00 24.48 ? 236  PHE A C   1 
ATOM   1391 O O   . PHE A 1 192 ? 16.884  91.937  28.109  1.00 24.29 ? 236  PHE A O   1 
ATOM   1392 C CB  . PHE A 1 192 ? 19.781  91.457  26.745  1.00 24.10 ? 236  PHE A CB  1 
ATOM   1393 C CG  . PHE A 1 192 ? 19.554  92.909  26.462  1.00 23.88 ? 236  PHE A CG  1 
ATOM   1394 C CD1 . PHE A 1 192 ? 19.580  93.854  27.482  1.00 23.53 ? 236  PHE A CD1 1 
ATOM   1395 C CD2 . PHE A 1 192 ? 19.355  93.337  25.161  1.00 26.16 ? 236  PHE A CD2 1 
ATOM   1396 C CE1 . PHE A 1 192 ? 19.381  95.219  27.222  1.00 26.65 ? 236  PHE A CE1 1 
ATOM   1397 C CE2 . PHE A 1 192 ? 19.153  94.690  24.869  1.00 24.98 ? 236  PHE A CE2 1 
ATOM   1398 C CZ  . PHE A 1 192 ? 19.153  95.650  25.923  1.00 25.00 ? 236  PHE A CZ  1 
ATOM   1399 N N   . THR A 1 193 ? 18.190  90.655  29.408  1.00 24.13 ? 237  THR A N   1 
ATOM   1400 C CA  . THR A 1 193 ? 17.523  91.043  30.626  1.00 23.85 ? 237  THR A CA  1 
ATOM   1401 C C   . THR A 1 193 ? 18.431  91.992  31.321  1.00 24.52 ? 237  THR A C   1 
ATOM   1402 O O   . THR A 1 193 ? 19.634  91.951  31.144  1.00 24.05 ? 237  THR A O   1 
ATOM   1403 C CB  . THR A 1 193 ? 17.269  89.876  31.571  1.00 24.45 ? 237  THR A CB  1 
ATOM   1404 O OG1 . THR A 1 193 ? 18.411  89.004  31.567  1.00 24.80 ? 237  THR A OG1 1 
ATOM   1405 C CG2 . THR A 1 193 ? 16.014  89.096  31.159  1.00 23.12 ? 237  THR A CG2 1 
ATOM   1406 N N   . THR A 1 194 ? 17.856  92.872  32.106  1.00 26.33 ? 238  THR A N   1 
ATOM   1407 C CA  . THR A 1 194 ? 18.633  93.847  32.826  1.00 27.84 ? 238  THR A CA  1 
ATOM   1408 C C   . THR A 1 194 ? 18.188  93.927  34.279  1.00 29.20 ? 238  THR A C   1 
ATOM   1409 O O   . THR A 1 194 ? 17.029  93.685  34.597  1.00 28.17 ? 238  THR A O   1 
ATOM   1410 C CB  . THR A 1 194 ? 18.560  95.276  32.150  1.00 28.66 ? 238  THR A CB  1 
ATOM   1411 O OG1 . THR A 1 194 ? 17.243  95.793  32.234  1.00 27.08 ? 238  THR A OG1 1 
ATOM   1412 C CG2 . THR A 1 194 ? 18.961  95.238  30.678  1.00 27.27 ? 238  THR A CG2 1 
ATOM   1413 N N   . TYR A 1 195 ? 19.118  94.301  35.153  1.00 31.74 ? 239  TYR A N   1 
ATOM   1414 C CA  . TYR A 1 195 ? 18.811  94.503  36.554  1.00 34.38 ? 239  TYR A CA  1 
ATOM   1415 C C   . TYR A 1 195 ? 19.026  95.953  36.946  1.00 36.53 ? 239  TYR A C   1 
ATOM   1416 O O   . TYR A 1 195 ? 19.904  96.651  36.416  1.00 36.47 ? 239  TYR A O   1 
ATOM   1417 C CB  . TYR A 1 195 ? 19.633  93.571  37.448  1.00 34.32 ? 239  TYR A CB  1 
ATOM   1418 C CG  . TYR A 1 195 ? 21.129  93.803  37.410  1.00 35.37 ? 239  TYR A CG  1 
ATOM   1419 C CD1 . TYR A 1 195 ? 21.760  94.655  38.330  1.00 35.74 ? 239  TYR A CD1 1 
ATOM   1420 C CD2 . TYR A 1 195 ? 21.913  93.164  36.471  1.00 35.27 ? 239  TYR A CD2 1 
ATOM   1421 C CE1 . TYR A 1 195 ? 23.142  94.867  38.288  1.00 36.70 ? 239  TYR A CE1 1 
ATOM   1422 C CE2 . TYR A 1 195 ? 23.281  93.361  36.418  1.00 36.25 ? 239  TYR A CE2 1 
ATOM   1423 C CZ  . TYR A 1 195 ? 23.898  94.194  37.322  1.00 36.57 ? 239  TYR A CZ  1 
ATOM   1424 O OH  . TYR A 1 195 ? 25.275  94.355  37.231  1.00 37.53 ? 239  TYR A OH  1 
ATOM   1425 N N   . ALA A 1 196 ? 18.207  96.389  37.885  1.00 39.07 ? 240  ALA A N   1 
ATOM   1426 C CA  . ALA A 1 196 ? 18.205  97.754  38.332  1.00 42.74 ? 240  ALA A CA  1 
ATOM   1427 C C   . ALA A 1 196 ? 17.839  97.660  39.798  1.00 44.76 ? 240  ALA A C   1 
ATOM   1428 O O   . ALA A 1 196 ? 16.665  97.482  40.134  1.00 46.08 ? 240  ALA A O   1 
ATOM   1429 C CB  . ALA A 1 196 ? 17.170  98.565  37.549  1.00 42.79 ? 240  ALA A CB  1 
ATOM   1430 N N   . ASN A 1 197 ? 18.862  97.712  40.650  1.00 46.72 ? 241  ASN A N   1 
ATOM   1431 C CA  . ASN A 1 197 ? 18.754  97.555  42.117  1.00 48.42 ? 241  ASN A CA  1 
ATOM   1432 C C   . ASN A 1 197 ? 20.161  97.286  42.638  1.00 48.68 ? 241  ASN A C   1 
ATOM   1433 O O   . ASN A 1 197 ? 20.774  98.154  43.264  1.00 48.87 ? 241  ASN A O   1 
ATOM   1434 C CB  . ASN A 1 197 ? 17.837  96.379  42.531  1.00 48.66 ? 241  ASN A CB  1 
ATOM   1435 C CG  . ASN A 1 197 ? 16.427  96.824  42.971  1.00 50.17 ? 241  ASN A CG  1 
ATOM   1436 O OD1 . ASN A 1 197 ? 16.201  97.970  43.380  1.00 51.04 ? 241  ASN A OD1 1 
ATOM   1437 N ND2 . ASN A 1 197 ? 15.477  95.891  42.896  1.00 51.99 ? 241  ASN A ND2 1 
ATOM   1438 N N   . GLY A 1 198 ? 20.636  96.066  42.352  1.00 48.91 ? 242  GLY A N   1 
ATOM   1439 C CA  . GLY A 1 198 ? 21.987  95.565  42.655  1.00 49.11 ? 242  GLY A CA  1 
ATOM   1440 C C   . GLY A 1 198 ? 22.014  94.178  42.028  1.00 49.52 ? 242  GLY A C   1 
ATOM   1441 O O   . GLY A 1 198 ? 20.936  93.611  41.794  1.00 50.08 ? 242  GLY A O   1 
ATOM   1442 N N   . SER A 1 199 ? 23.210  93.644  41.744  1.00 48.81 ? 243  SER A N   1 
ATOM   1443 C CA  . SER A 1 199 ? 23.419  92.317  41.091  1.00 48.33 ? 243  SER A CA  1 
ATOM   1444 C C   . SER A 1 199 ? 22.273  91.525  40.367  1.00 47.97 ? 243  SER A C   1 
ATOM   1445 O O   . SER A 1 199 ? 21.095  91.542  40.740  1.00 46.99 ? 243  SER A O   1 
ATOM   1446 C CB  . SER A 1 199 ? 24.136  91.363  42.059  1.00 48.69 ? 243  SER A CB  1 
ATOM   1447 O OG  . SER A 1 199 ? 23.204  90.643  42.860  1.00 49.37 ? 243  SER A OG  1 
ATOM   1448 N N   . CYS A 1 200 ? 22.664  90.772  39.351  1.00 47.35 ? 244  CYS A N   1 
ATOM   1449 C CA  . CYS A 1 200 ? 21.744  89.868  38.704  1.00 47.61 ? 244  CYS A CA  1 
ATOM   1450 C C   . CYS A 1 200 ? 21.006  88.986  39.685  1.00 47.67 ? 244  CYS A C   1 
ATOM   1451 O O   . CYS A 1 200 ? 19.824  88.753  39.504  1.00 47.96 ? 244  CYS A O   1 
ATOM   1452 C CB  . CYS A 1 200 ? 22.488  88.986  37.713  1.00 47.46 ? 244  CYS A CB  1 
ATOM   1453 S SG  . CYS A 1 200 ? 23.000  89.879  36.241  1.00 49.31 ? 244  CYS A SG  1 
ATOM   1454 N N   . LYS A 1 201 ? 21.697  88.482  40.710  1.00 47.88 ? 245  LYS A N   1 
ATOM   1455 C CA  . LYS A 1 201 ? 21.105  87.479  41.616  1.00 48.31 ? 245  LYS A CA  1 
ATOM   1456 C C   . LYS A 1 201 ? 20.146  88.099  42.610  1.00 47.50 ? 245  LYS A C   1 
ATOM   1457 O O   . LYS A 1 201 ? 19.158  87.479  42.977  1.00 48.09 ? 245  LYS A O   1 
ATOM   1458 C CB  . LYS A 1 201 ? 22.148  86.690  42.422  1.00 48.59 ? 245  LYS A CB  1 
ATOM   1459 C CG  . LYS A 1 201 ? 23.547  86.526  41.809  1.00 50.30 ? 245  LYS A CG  1 
ATOM   1460 C CD  . LYS A 1 201 ? 24.580  86.138  42.896  1.00 49.61 ? 245  LYS A CD  1 
ATOM   1461 C CE  . LYS A 1 201 ? 24.826  87.272  43.918  1.00 50.75 ? 245  LYS A CE  1 
ATOM   1462 N NZ  . LYS A 1 201 ? 25.726  86.840  45.020  1.00 49.85 ? 245  LYS A NZ  1 
ATOM   1463 N N   . ALA A 1 202 ? 20.444  89.305  43.073  1.00 46.92 ? 246  ALA A N   1 
ATOM   1464 C CA  . ALA A 1 202 ? 19.552  89.989  44.004  1.00 46.05 ? 246  ALA A CA  1 
ATOM   1465 C C   . ALA A 1 202 ? 18.348  90.679  43.313  1.00 45.93 ? 246  ALA A C   1 
ATOM   1466 O O   . ALA A 1 202 ? 17.374  91.085  43.974  1.00 45.89 ? 246  ALA A O   1 
ATOM   1467 C CB  . ALA A 1 202 ? 20.336  90.975  44.830  1.00 46.40 ? 246  ALA A CB  1 
ATOM   1468 N N   . ASP A 1 203 ? 18.408  90.812  41.988  1.00 44.95 ? 247  ASP A N   1 
ATOM   1469 C CA  . ASP A 1 203 ? 17.315  91.435  41.228  1.00 44.11 ? 247  ASP A CA  1 
ATOM   1470 C C   . ASP A 1 203 ? 16.459  90.379  40.490  1.00 42.68 ? 247  ASP A C   1 
ATOM   1471 O O   . ASP A 1 203 ? 15.648  90.711  39.633  1.00 41.74 ? 247  ASP A O   1 
ATOM   1472 C CB  . ASP A 1 203 ? 17.896  92.437  40.235  1.00 44.63 ? 247  ASP A CB  1 
ATOM   1473 C CG  . ASP A 1 203 ? 17.096  93.728  40.155  1.00 48.12 ? 247  ASP A CG  1 
ATOM   1474 O OD1 . ASP A 1 203 ? 15.845  93.682  40.203  1.00 52.19 ? 247  ASP A OD1 1 
ATOM   1475 O OD2 . ASP A 1 203 ? 17.728  94.799  40.022  1.00 49.70 ? 247  ASP A OD2 1 
ATOM   1476 N N   . LEU A 1 204 ? 16.659  89.111  40.835  1.00 41.12 ? 248  LEU A N   1 
ATOM   1477 C CA  . LEU A 1 204 ? 15.947  88.004  40.203  1.00 40.26 ? 248  LEU A CA  1 
ATOM   1478 C C   . LEU A 1 204 ? 14.482  88.225  40.436  1.00 38.66 ? 248  LEU A C   1 
ATOM   1479 O O   . LEU A 1 204 ? 14.086  88.668  41.535  1.00 38.34 ? 248  LEU A O   1 
ATOM   1480 C CB  . LEU A 1 204 ? 16.325  86.700  40.867  1.00 40.79 ? 248  LEU A CB  1 
ATOM   1481 C CG  . LEU A 1 204 ? 16.215  85.438  40.055  1.00 42.68 ? 248  LEU A CG  1 
ATOM   1482 C CD1 . LEU A 1 204 ? 17.357  85.339  39.000  1.00 43.88 ? 248  LEU A CD1 1 
ATOM   1483 C CD2 . LEU A 1 204 ? 16.271  84.306  41.063  1.00 44.88 ? 248  LEU A CD2 1 
ATOM   1484 N N   . GLY A 1 205 ? 13.699  87.969  39.391  1.00 36.02 ? 249  GLY A N   1 
ATOM   1485 C CA  . GLY A 1 205 ? 12.259  88.165  39.410  1.00 33.15 ? 249  GLY A CA  1 
ATOM   1486 C C   . GLY A 1 205 ? 11.783  89.604  39.260  1.00 31.26 ? 249  GLY A C   1 
ATOM   1487 O O   . GLY A 1 205 ? 10.596  89.840  39.246  1.00 31.30 ? 249  GLY A O   1 
ATOM   1488 N N   . ALA A 1 206 ? 12.693  90.572  39.210  1.00 29.67 ? 250  ALA A N   1 
ATOM   1489 C CA  . ALA A 1 206 ? 12.335  91.943  38.892  1.00 27.60 ? 250  ALA A CA  1 
ATOM   1490 C C   . ALA A 1 206 ? 13.229  92.451  37.764  1.00 27.31 ? 250  ALA A C   1 
ATOM   1491 O O   . ALA A 1 206 ? 13.476  93.650  37.671  1.00 27.36 ? 250  ALA A O   1 
ATOM   1492 C CB  . ALA A 1 206 ? 12.472  92.838  40.124  1.00 28.47 ? 250  ALA A CB  1 
ATOM   1493 N N   . LEU A 1 207 ? 13.707  91.552  36.896  1.00 24.98 ? 251  LEU A N   1 
ATOM   1494 C CA  . LEU A 1 207 ? 14.500  91.973  35.768  1.00 23.81 ? 251  LEU A CA  1 
ATOM   1495 C C   . LEU A 1 207 ? 13.540  92.550  34.747  1.00 23.75 ? 251  LEU A C   1 
ATOM   1496 O O   . LEU A 1 207 ? 12.334  92.340  34.835  1.00 23.62 ? 251  LEU A O   1 
ATOM   1497 C CB  . LEU A 1 207 ? 15.329  90.806  35.144  1.00 23.67 ? 251  LEU A CB  1 
ATOM   1498 C CG  . LEU A 1 207 ? 16.184  89.922  36.071  1.00 23.03 ? 251  LEU A CG  1 
ATOM   1499 C CD1 . LEU A 1 207 ? 16.800  88.707  35.336  1.00 24.17 ? 251  LEU A CD1 1 
ATOM   1500 C CD2 . LEU A 1 207 ? 17.243  90.730  36.809  1.00 22.61 ? 251  LEU A CD2 1 
ATOM   1501 N N   . GLU A 1 208 ? 14.062  93.302  33.800  1.00 23.07 ? 252  GLU A N   1 
ATOM   1502 C CA  . GLU A 1 208 ? 13.275  93.675  32.652  1.00 24.71 ? 252  GLU A CA  1 
ATOM   1503 C C   . GLU A 1 208 ? 13.834  92.997  31.423  1.00 24.59 ? 252  GLU A C   1 
ATOM   1504 O O   . GLU A 1 208 ? 15.054  92.752  31.316  1.00 23.51 ? 252  GLU A O   1 
ATOM   1505 C CB  . GLU A 1 208 ? 13.286  95.192  32.490  1.00 26.10 ? 252  GLU A CB  1 
ATOM   1506 C CG  . GLU A 1 208 ? 14.542  95.779  33.044  1.00 31.64 ? 252  GLU A CG  1 
ATOM   1507 C CD  . GLU A 1 208 ? 14.516  97.285  33.254  1.00 37.06 ? 252  GLU A CD  1 
ATOM   1508 O OE1 . GLU A 1 208 ? 13.413  97.900  33.167  1.00 38.84 ? 252  GLU A OE1 1 
ATOM   1509 O OE2 . GLU A 1 208 ? 15.627  97.837  33.520  1.00 38.96 ? 252  GLU A OE2 1 
ATOM   1510 N N   . LEU A 1 209 ? 12.948  92.669  30.493  1.00 24.52 ? 253  LEU A N   1 
ATOM   1511 C CA  . LEU A 1 209 ? 13.392  92.045  29.260  1.00 24.39 ? 253  LEU A CA  1 
ATOM   1512 C C   . LEU A 1 209 ? 13.379  93.130  28.182  1.00 25.68 ? 253  LEU A C   1 
ATOM   1513 O O   . LEU A 1 209 ? 12.432  93.873  28.100  1.00 26.99 ? 253  LEU A O   1 
ATOM   1514 C CB  . LEU A 1 209 ? 12.507  90.843  28.932  1.00 23.70 ? 253  LEU A CB  1 
ATOM   1515 C CG  . LEU A 1 209 ? 12.748  90.181  27.605  1.00 21.85 ? 253  LEU A CG  1 
ATOM   1516 C CD1 . LEU A 1 209 ? 14.156  89.687  27.540  1.00 21.91 ? 253  LEU A CD1 1 
ATOM   1517 C CD2 . LEU A 1 209 ? 11.765  89.039  27.487  1.00 24.60 ? 253  LEU A CD2 1 
ATOM   1518 N N   . TRP A 1 210 ? 14.476  93.293  27.451  1.00 26.29 ? 254  TRP A N   1 
ATOM   1519 C CA  . TRP A 1 210 ? 14.605  94.327  26.434  1.00 27.35 ? 254  TRP A CA  1 
ATOM   1520 C C   . TRP A 1 210 ? 14.816  93.668  25.067  1.00 27.68 ? 254  TRP A C   1 
ATOM   1521 O O   . TRP A 1 210 ? 15.355  92.571  24.978  1.00 25.94 ? 254  TRP A O   1 
ATOM   1522 C CB  . TRP A 1 210 ? 15.823  95.216  26.724  1.00 28.58 ? 254  TRP A CB  1 
ATOM   1523 C CG  . TRP A 1 210 ? 15.664  96.198  27.856  1.00 30.19 ? 254  TRP A CG  1 
ATOM   1524 C CD1 . TRP A 1 210 ? 15.308  95.906  29.119  1.00 32.40 ? 254  TRP A CD1 1 
ATOM   1525 C CD2 . TRP A 1 210 ? 15.887  97.607  27.823  1.00 32.21 ? 254  TRP A CD2 1 
ATOM   1526 N NE1 . TRP A 1 210 ? 15.266  97.011  29.877  1.00 31.07 ? 254  TRP A NE1 1 
ATOM   1527 C CE2 . TRP A 1 210 ? 15.613  98.089  29.115  1.00 32.12 ? 254  TRP A CE2 1 
ATOM   1528 C CE3 . TRP A 1 210 ? 16.280  98.508  26.830  1.00 32.68 ? 254  TRP A CE3 1 
ATOM   1529 C CZ2 . TRP A 1 210 ? 15.708  99.436  29.460  1.00 32.96 ? 254  TRP A CZ2 1 
ATOM   1530 C CZ3 . TRP A 1 210 ? 16.382  99.886  27.169  1.00 33.33 ? 254  TRP A CZ3 1 
ATOM   1531 C CH2 . TRP A 1 210 ? 16.093  100.329 28.479  1.00 32.74 ? 254  TRP A CH2 1 
ATOM   1532 N N   . ARG A 1 211 ? 14.424  94.379  24.013  1.00 28.71 ? 255  ARG A N   1 
ATOM   1533 C CA  . ARG A 1 211 ? 14.713  93.990  22.643  1.00 29.25 ? 255  ARG A CA  1 
ATOM   1534 C C   . ARG A 1 211 ? 15.359  95.151  21.927  1.00 29.85 ? 255  ARG A C   1 
ATOM   1535 O O   . ARG A 1 211 ? 14.969  96.291  22.129  1.00 29.59 ? 255  ARG A O   1 
ATOM   1536 C CB  . ARG A 1 211 ? 13.409  93.678  21.908  1.00 29.71 ? 255  ARG A CB  1 
ATOM   1537 C CG  . ARG A 1 211 ? 13.597  92.899  20.606  1.00 29.47 ? 255  ARG A CG  1 
ATOM   1538 C CD  . ARG A 1 211 ? 12.291  92.761  19.831  1.00 29.46 ? 255  ARG A CD  1 
ATOM   1539 N NE  . ARG A 1 211 ? 11.752  94.026  19.324  1.00 33.05 ? 255  ARG A NE  1 
ATOM   1540 C CZ  . ARG A 1 211 ? 10.449  94.319  19.300  1.00 32.90 ? 255  ARG A CZ  1 
ATOM   1541 N NH1 . ARG A 1 211 ? 9.573   93.457  19.796  1.00 32.53 ? 255  ARG A NH1 1 
ATOM   1542 N NH2 . ARG A 1 211 ? 10.019  95.485  18.824  1.00 34.29 ? 255  ARG A NH2 1 
ATOM   1543 N N   . THR A 1 212 ? 16.325  94.850  21.075  1.00 30.69 ? 256  THR A N   1 
ATOM   1544 C CA  . THR A 1 212 ? 16.855  95.811  20.112  1.00 32.90 ? 256  THR A CA  1 
ATOM   1545 C C   . THR A 1 212 ? 16.955  95.173  18.718  1.00 34.42 ? 256  THR A C   1 
ATOM   1546 O O   . THR A 1 212 ? 17.659  94.204  18.533  1.00 34.58 ? 256  THR A O   1 
ATOM   1547 C CB  . THR A 1 212 ? 18.215  96.369  20.547  1.00 32.60 ? 256  THR A CB  1 
ATOM   1548 O OG1 . THR A 1 212 ? 18.641  97.394  19.627  1.00 33.95 ? 256  THR A OG1 1 
ATOM   1549 C CG2 . THR A 1 212 ? 19.249  95.289  20.630  1.00 31.24 ? 256  THR A CG2 1 
ATOM   1550 N N   . SER A 1 213 ? 16.246  95.729  17.745  1.00 36.34 ? 257  SER A N   1 
ATOM   1551 C CA  . SER A 1 213 ? 16.215  95.145  16.402  1.00 38.64 ? 257  SER A CA  1 
ATOM   1552 C C   . SER A 1 213 ? 17.367  95.655  15.509  1.00 39.31 ? 257  SER A C   1 
ATOM   1553 O O   . SER A 1 213 ? 17.692  95.058  14.466  1.00 39.60 ? 257  SER A O   1 
ATOM   1554 C CB  . SER A 1 213 ? 14.863  95.467  15.766  1.00 39.37 ? 257  SER A CB  1 
ATOM   1555 O OG  . SER A 1 213 ? 13.833  94.705  16.402  1.00 41.81 ? 257  SER A OG  1 
ATOM   1556 N N   . ASP A 1 214 ? 17.993  96.739  15.961  1.00 38.89 ? 258  ASP A N   1 
ATOM   1557 C CA  . ASP A 1 214 ? 18.980  97.479  15.185  1.00 39.02 ? 258  ASP A CA  1 
ATOM   1558 C C   . ASP A 1 214 ? 20.359  97.608  15.864  1.00 37.94 ? 258  ASP A C   1 
ATOM   1559 O O   . ASP A 1 214 ? 21.016  98.642  15.756  1.00 37.79 ? 258  ASP A O   1 
ATOM   1560 C CB  . ASP A 1 214 ? 18.411  98.870  14.874  1.00 39.31 ? 258  ASP A CB  1 
ATOM   1561 C CG  . ASP A 1 214 ? 17.986  99.631  16.140  1.00 40.96 ? 258  ASP A CG  1 
ATOM   1562 O OD1 . ASP A 1 214 ? 18.629  99.454  17.202  1.00 43.00 ? 258  ASP A OD1 1 
ATOM   1563 O OD2 . ASP A 1 214 ? 17.019  100.415 16.073  1.00 41.50 ? 258  ASP A OD2 1 
ATOM   1564 N N   . LEU A 1 215 ? 20.781  96.557  16.562  1.00 37.08 ? 259  LEU A N   1 
ATOM   1565 C CA  . LEU A 1 215 ? 22.121  96.475  17.148  1.00 36.55 ? 259  LEU A CA  1 
ATOM   1566 C C   . LEU A 1 215 ? 22.422  97.570  18.185  1.00 36.33 ? 259  LEU A C   1 
ATOM   1567 O O   . LEU A 1 215 ? 23.561  98.007  18.319  1.00 36.15 ? 259  LEU A O   1 
ATOM   1568 C CB  . LEU A 1 215 ? 23.202  96.452  16.050  1.00 35.33 ? 259  LEU A CB  1 
ATOM   1569 C CG  . LEU A 1 215 ? 23.243  95.244  15.106  1.00 36.34 ? 259  LEU A CG  1 
ATOM   1570 C CD1 . LEU A 1 215 ? 24.483  95.324  14.214  1.00 36.50 ? 259  LEU A CD1 1 
ATOM   1571 C CD2 . LEU A 1 215 ? 23.233  93.915  15.861  1.00 33.83 ? 259  LEU A CD2 1 
ATOM   1572 N N   . GLY A 1 216 ? 21.412  97.991  18.933  1.00 36.26 ? 260  GLY A N   1 
ATOM   1573 C CA  . GLY A 1 216 ? 21.639  98.963  19.994  1.00 37.76 ? 260  GLY A CA  1 
ATOM   1574 C C   . GLY A 1 216 ? 21.167  100.377 19.723  1.00 38.26 ? 260  GLY A C   1 
ATOM   1575 O O   . GLY A 1 216 ? 21.238  101.221 20.625  1.00 38.80 ? 260  GLY A O   1 
ATOM   1576 N N   . LYS A 1 217 ? 20.673  100.656 18.515  1.00 38.94 ? 261  LYS A N   1 
ATOM   1577 C CA  . LYS A 1 217 ? 20.159  102.019 18.222  1.00 40.00 ? 261  LYS A CA  1 
ATOM   1578 C C   . LYS A 1 217 ? 18.867  102.334 18.958  1.00 40.21 ? 261  LYS A C   1 
ATOM   1579 O O   . LYS A 1 217 ? 18.743  103.396 19.571  1.00 40.18 ? 261  LYS A O   1 
ATOM   1580 C CB  . LYS A 1 217 ? 19.937  102.269 16.724  1.00 40.57 ? 261  LYS A CB  1 
ATOM   1581 C CG  . LYS A 1 217 ? 20.909  103.246 16.082  1.00 42.34 ? 261  LYS A CG  1 
ATOM   1582 C CD  . LYS A 1 217 ? 20.479  104.729 16.212  1.00 46.71 ? 261  LYS A CD  1 
ATOM   1583 C CE  . LYS A 1 217 ? 19.459  105.115 15.143  1.00 47.97 ? 261  LYS A CE  1 
ATOM   1584 N NZ  . LYS A 1 217 ? 19.599  106.528 14.713  1.00 48.11 ? 261  LYS A NZ  1 
ATOM   1585 N N   . SER A 1 218 ? 17.888  101.445 18.857  1.00 39.79 ? 262  SER A N   1 
ATOM   1586 C CA  . SER A 1 218 ? 16.649  101.628 19.594  1.00 39.97 ? 262  SER A CA  1 
ATOM   1587 C C   . SER A 1 218 ? 16.525  100.457 20.532  1.00 39.37 ? 262  SER A C   1 
ATOM   1588 O O   . SER A 1 218 ? 17.113  99.388  20.294  1.00 38.96 ? 262  SER A O   1 
ATOM   1589 C CB  . SER A 1 218 ? 15.419  101.629 18.671  1.00 40.38 ? 262  SER A CB  1 
ATOM   1590 O OG  . SER A 1 218 ? 15.718  102.076 17.365  1.00 43.06 ? 262  SER A OG  1 
ATOM   1591 N N   . PHE A 1 219 ? 15.739  100.652 21.577  1.00 38.48 ? 263  PHE A N   1 
ATOM   1592 C CA  . PHE A 1 219 ? 15.355  99.570  22.440  1.00 38.76 ? 263  PHE A CA  1 
ATOM   1593 C C   . PHE A 1 219 ? 13.872  99.587  22.667  1.00 38.47 ? 263  PHE A C   1 
ATOM   1594 O O   . PHE A 1 219 ? 13.226  100.620 22.579  1.00 38.58 ? 263  PHE A O   1 
ATOM   1595 C CB  . PHE A 1 219 ? 16.047  99.701  23.790  1.00 39.23 ? 263  PHE A CB  1 
ATOM   1596 C CG  . PHE A 1 219 ? 17.525  99.577  23.723  1.00 38.93 ? 263  PHE A CG  1 
ATOM   1597 C CD1 . PHE A 1 219 ? 18.120  98.331  23.755  1.00 38.79 ? 263  PHE A CD1 1 
ATOM   1598 C CD2 . PHE A 1 219 ? 18.318  100.711 23.610  1.00 40.75 ? 263  PHE A CD2 1 
ATOM   1599 C CE1 . PHE A 1 219 ? 19.478  98.210  23.682  1.00 39.46 ? 263  PHE A CE1 1 
ATOM   1600 C CE2 . PHE A 1 219 ? 19.687  100.604 23.538  1.00 41.09 ? 263  PHE A CE2 1 
ATOM   1601 C CZ  . PHE A 1 219 ? 20.272  99.344  23.574  1.00 39.42 ? 263  PHE A CZ  1 
ATOM   1602 N N   . LYS A 1 220 ? 13.337  98.430  23.003  1.00 38.24 ? 264  LYS A N   1 
ATOM   1603 C CA  . LYS A 1 220 ? 11.991  98.370  23.510  1.00 37.55 ? 264  LYS A CA  1 
ATOM   1604 C C   . LYS A 1 220 ? 11.993  97.409  24.700  1.00 36.72 ? 264  LYS A C   1 
ATOM   1605 O O   . LYS A 1 220 ? 12.534  96.286  24.623  1.00 35.55 ? 264  LYS A O   1 
ATOM   1606 C CB  . LYS A 1 220 ? 11.060  97.922  22.402  1.00 38.24 ? 264  LYS A CB  1 
ATOM   1607 C CG  . LYS A 1 220 ? 9.658   97.636  22.839  1.00 40.04 ? 264  LYS A CG  1 
ATOM   1608 C CD  . LYS A 1 220 ? 9.060   96.558  21.931  1.00 43.56 ? 264  LYS A CD  1 
ATOM   1609 C CE  . LYS A 1 220 ? 7.836   97.081  21.203  1.00 46.04 ? 264  LYS A CE  1 
ATOM   1610 N NZ  . LYS A 1 220 ? 6.675   97.185  22.128  1.00 46.99 ? 264  LYS A NZ  1 
ATOM   1611 N N   . THR A 1 221 ? 11.439  97.879  25.818  1.00 35.05 ? 265  THR A N   1 
ATOM   1612 C CA  . THR A 1 221 ? 11.245  97.022  26.970  1.00 33.97 ? 265  THR A CA  1 
ATOM   1613 C C   . THR A 1 221 ? 10.023  96.179  26.687  1.00 32.49 ? 265  THR A C   1 
ATOM   1614 O O   . THR A 1 221 ? 8.936   96.708  26.527  1.00 31.90 ? 265  THR A O   1 
ATOM   1615 C CB  . THR A 1 221 ? 11.030  97.807  28.279  1.00 34.53 ? 265  THR A CB  1 
ATOM   1616 O OG1 . THR A 1 221 ? 9.678   98.297  28.321  1.00 36.17 ? 265  THR A OG1 1 
ATOM   1617 C CG2 . THR A 1 221 ? 12.040  98.978  28.412  1.00 35.50 ? 265  THR A CG2 1 
ATOM   1618 N N   . ILE A 1 222 ? 10.203  94.862  26.609  1.00 30.94 ? 266  ILE A N   1 
ATOM   1619 C CA  . ILE A 1 222 ? 9.092   93.992  26.279  1.00 29.63 ? 266  ILE A CA  1 
ATOM   1620 C C   . ILE A 1 222 ? 8.578   93.169  27.442  1.00 29.74 ? 266  ILE A C   1 
ATOM   1621 O O   . ILE A 1 222 ? 7.714   92.331  27.275  1.00 31.48 ? 266  ILE A O   1 
ATOM   1622 C CB  . ILE A 1 222 ? 9.405   93.050  25.068  1.00 29.73 ? 266  ILE A CB  1 
ATOM   1623 C CG1 . ILE A 1 222 ? 10.727  92.306  25.273  1.00 27.73 ? 266  ILE A CG1 1 
ATOM   1624 C CG2 . ILE A 1 222 ? 9.354   93.833  23.771  1.00 29.85 ? 266  ILE A CG2 1 
ATOM   1625 C CD1 . ILE A 1 222 ? 10.999  91.153  24.315  1.00 27.92 ? 266  ILE A CD1 1 
ATOM   1626 N N   . GLY A 1 223 ? 9.131   93.362  28.619  1.00 29.94 ? 267  GLY A N   1 
ATOM   1627 C CA  . GLY A 1 223 ? 8.650   92.633  29.783  1.00 28.99 ? 267  GLY A CA  1 
ATOM   1628 C C   . GLY A 1 223 ? 9.270   93.166  31.055  1.00 28.83 ? 267  GLY A C   1 
ATOM   1629 O O   . GLY A 1 223 ? 10.405  93.667  31.055  1.00 28.39 ? 267  GLY A O   1 
ATOM   1630 N N   . VAL A 1 224 ? 8.514   93.065  32.136  1.00 27.69 ? 268  VAL A N   1 
ATOM   1631 C CA  . VAL A 1 224 ? 9.010   93.429  33.437  1.00 27.37 ? 268  VAL A CA  1 
ATOM   1632 C C   . VAL A 1 224 ? 8.747   92.267  34.372  1.00 27.17 ? 268  VAL A C   1 
ATOM   1633 O O   . VAL A 1 224 ? 7.980   91.360  34.023  1.00 26.81 ? 268  VAL A O   1 
ATOM   1634 C CB  . VAL A 1 224 ? 8.325   94.703  33.971  1.00 28.28 ? 268  VAL A CB  1 
ATOM   1635 C CG1 . VAL A 1 224 ? 8.718   95.889  33.122  1.00 28.95 ? 268  VAL A CG1 1 
ATOM   1636 C CG2 . VAL A 1 224 ? 6.823   94.504  34.018  1.00 28.50 ? 268  VAL A CG2 1 
ATOM   1637 N N   . LYS A 1 225 ? 9.375   92.296  35.553  1.00 26.30 ? 269  LYS A N   1 
ATOM   1638 C CA  . LYS A 1 225 ? 9.198   91.261  36.588  1.00 26.39 ? 269  LYS A CA  1 
ATOM   1639 C C   . LYS A 1 225 ? 9.594   89.895  36.045  1.00 25.41 ? 269  LYS A C   1 
ATOM   1640 O O   . LYS A 1 225 ? 9.023   88.878  36.394  1.00 24.92 ? 269  LYS A O   1 
ATOM   1641 C CB  . LYS A 1 225 ? 7.778   91.247  37.182  1.00 27.07 ? 269  LYS A CB  1 
ATOM   1642 C CG  . LYS A 1 225 ? 7.350   92.526  37.897  1.00 29.55 ? 269  LYS A CG  1 
ATOM   1643 C CD  . LYS A 1 225 ? 8.094   92.668  39.224  1.00 36.64 ? 269  LYS A CD  1 
ATOM   1644 C CE  . LYS A 1 225 ? 8.031   94.074  39.793  1.00 41.27 ? 269  LYS A CE  1 
ATOM   1645 N NZ  . LYS A 1 225 ? 6.604   94.580  39.967  1.00 43.31 ? 269  LYS A NZ  1 
ATOM   1646 N N   . ILE A 1 226 ? 10.605  89.906  35.189  1.00 25.65 ? 270  ILE A N   1 
ATOM   1647 C CA  . ILE A 1 226 ? 11.159  88.710  34.568  1.00 24.84 ? 270  ILE A CA  1 
ATOM   1648 C C   . ILE A 1 226 ? 12.029  87.956  35.547  1.00 25.90 ? 270  ILE A C   1 
ATOM   1649 O O   . ILE A 1 226 ? 12.757  88.566  36.346  1.00 26.54 ? 270  ILE A O   1 
ATOM   1650 C CB  . ILE A 1 226 ? 12.052  89.142  33.378  1.00 25.00 ? 270  ILE A CB  1 
ATOM   1651 C CG1 . ILE A 1 226 ? 11.231  89.872  32.321  1.00 25.94 ? 270  ILE A CG1 1 
ATOM   1652 C CG2 . ILE A 1 226 ? 12.794  87.958  32.727  1.00 22.02 ? 270  ILE A CG2 1 
ATOM   1653 C CD1 . ILE A 1 226 ? 10.024  89.101  31.819  1.00 25.18 ? 270  ILE A CD1 1 
ATOM   1654 N N   . TYR A 1 227 ? 11.999  86.633  35.456  1.00 27.20 ? 271  TYR A N   1 
ATOM   1655 C CA  . TYR A 1 227 ? 12.901  85.751  36.181  1.00 28.40 ? 271  TYR A CA  1 
ATOM   1656 C C   . TYR A 1 227 ? 13.942  85.269  35.200  1.00 28.49 ? 271  TYR A C   1 
ATOM   1657 O O   . TYR A 1 227 ? 15.121  85.397  35.451  1.00 28.35 ? 271  TYR A O   1 
ATOM   1658 C CB  . TYR A 1 227 ? 12.115  84.579  36.701  1.00 30.77 ? 271  TYR A CB  1 
ATOM   1659 C CG  . TYR A 1 227 ? 12.693  83.849  37.862  1.00 35.70 ? 271  TYR A CG  1 
ATOM   1660 C CD1 . TYR A 1 227 ? 12.384  84.235  39.138  1.00 39.23 ? 271  TYR A CD1 1 
ATOM   1661 C CD2 . TYR A 1 227 ? 13.492  82.714  37.682  1.00 41.13 ? 271  TYR A CD2 1 
ATOM   1662 C CE1 . TYR A 1 227 ? 12.866  83.557  40.240  1.00 41.99 ? 271  TYR A CE1 1 
ATOM   1663 C CE2 . TYR A 1 227 ? 13.991  81.998  38.787  1.00 42.88 ? 271  TYR A CE2 1 
ATOM   1664 C CZ  . TYR A 1 227 ? 13.661  82.438  40.069  1.00 40.93 ? 271  TYR A CZ  1 
ATOM   1665 O OH  . TYR A 1 227 ? 14.117  81.792  41.224  1.00 42.29 ? 271  TYR A OH  1 
ATOM   1666 N N   . SER A 1 228 ? 13.506  84.729  34.059  1.00 27.22 ? 272  SER A N   1 
ATOM   1667 C CA  . SER A 1 228 ? 14.398  84.332  32.987  1.00 27.32 ? 272  SER A CA  1 
ATOM   1668 C C   . SER A 1 228 ? 13.644  84.284  31.650  1.00 25.68 ? 272  SER A C   1 
ATOM   1669 O O   . SER A 1 228 ? 12.445  84.477  31.619  1.00 24.16 ? 272  SER A O   1 
ATOM   1670 C CB  . SER A 1 228 ? 14.995  82.950  33.257  1.00 29.36 ? 272  SER A CB  1 
ATOM   1671 O OG  . SER A 1 228 ? 16.154  82.799  32.428  1.00 35.71 ? 272  SER A OG  1 
ATOM   1672 N N   . PHE A 1 229 ? 14.353  84.012  30.560  1.00 23.62 ? 273  PHE A N   1 
ATOM   1673 C CA  . PHE A 1 229 ? 13.710  83.937  29.258  1.00 23.56 ? 273  PHE A CA  1 
ATOM   1674 C C   . PHE A 1 229 ? 14.453  82.960  28.388  1.00 24.55 ? 273  PHE A C   1 
ATOM   1675 O O   . PHE A 1 229 ? 15.615  82.630  28.658  1.00 23.44 ? 273  PHE A O   1 
ATOM   1676 C CB  . PHE A 1 229 ? 13.592  85.337  28.584  1.00 24.21 ? 273  PHE A CB  1 
ATOM   1677 C CG  . PHE A 1 229 ? 14.841  85.801  27.927  1.00 23.61 ? 273  PHE A CG  1 
ATOM   1678 C CD1 . PHE A 1 229 ? 15.009  85.640  26.587  1.00 26.36 ? 273  PHE A CD1 1 
ATOM   1679 C CD2 . PHE A 1 229 ? 15.848  86.409  28.667  1.00 28.79 ? 273  PHE A CD2 1 
ATOM   1680 C CE1 . PHE A 1 229 ? 16.182  86.031  25.939  1.00 29.32 ? 273  PHE A CE1 1 
ATOM   1681 C CE2 . PHE A 1 229 ? 17.026  86.856  28.047  1.00 29.65 ? 273  PHE A CE2 1 
ATOM   1682 C CZ  . PHE A 1 229 ? 17.195  86.665  26.666  1.00 31.37 ? 273  PHE A CZ  1 
ATOM   1683 N N   . GLY A 1 230 ? 13.786  82.511  27.328  1.00 25.41 ? 274  GLY A N   1 
ATOM   1684 C CA  . GLY A 1 230 ? 14.389  81.614  26.381  1.00 27.46 ? 274  GLY A CA  1 
ATOM   1685 C C   . GLY A 1 230 ? 13.657  81.630  25.062  1.00 28.73 ? 274  GLY A C   1 
ATOM   1686 O O   . GLY A 1 230 ? 12.571  82.157  24.965  1.00 28.11 ? 274  GLY A O   1 
ATOM   1687 N N   . LEU A 1 231 ? 14.289  81.054  24.050  1.00 30.82 ? 275  LEU A N   1 
ATOM   1688 C CA  . LEU A 1 231 ? 13.717  80.968  22.722  1.00 32.93 ? 275  LEU A CA  1 
ATOM   1689 C C   . LEU A 1 231 ? 13.542  79.491  22.340  1.00 34.46 ? 275  LEU A C   1 
ATOM   1690 O O   . LEU A 1 231 ? 14.387  78.666  22.641  1.00 36.77 ? 275  LEU A O   1 
ATOM   1691 C CB  . LEU A 1 231 ? 14.664  81.661  21.752  1.00 33.26 ? 275  LEU A CB  1 
ATOM   1692 C CG  . LEU A 1 231 ? 14.792  83.178  21.671  1.00 35.27 ? 275  LEU A CG  1 
ATOM   1693 C CD1 . LEU A 1 231 ? 14.637  83.837  22.962  1.00 38.98 ? 275  LEU A CD1 1 
ATOM   1694 C CD2 . LEU A 1 231 ? 16.190  83.526  21.152  1.00 37.96 ? 275  LEU A CD2 1 
ATOM   1695 N N   . GLY A 1 232 ? 12.446  79.127  21.697  1.00 35.93 ? 276  GLY A N   1 
ATOM   1696 C CA  . GLY A 1 232 ? 12.345  77.762  21.150  1.00 35.58 ? 276  GLY A CA  1 
ATOM   1697 C C   . GLY A 1 232 ? 11.412  77.807  19.975  1.00 36.03 ? 276  GLY A C   1 
ATOM   1698 O O   . GLY A 1 232 ? 10.274  78.281  20.108  1.00 37.40 ? 276  GLY A O   1 
ATOM   1699 N N   . GLY A 1 233 ? 11.886  77.347  18.821  1.00 37.33 ? 277  GLY A N   1 
ATOM   1700 C CA  . GLY A 1 233 ? 11.100  77.395  17.568  1.00 36.89 ? 277  GLY A CA  1 
ATOM   1701 C C   . GLY A 1 233 ? 10.681  78.826  17.280  1.00 38.57 ? 277  GLY A C   1 
ATOM   1702 O O   . GLY A 1 233 ? 11.508  79.726  17.274  1.00 39.36 ? 277  GLY A O   1 
ATOM   1703 N N   . ARG A 1 234 ? 9.379   79.019  17.081  1.00 37.49 ? 278  ARG A N   1 
ATOM   1704 C CA  . ARG A 1 234 ? 8.759   80.281  16.786  1.00 37.29 ? 278  ARG A CA  1 
ATOM   1705 C C   . ARG A 1 234 ? 8.477   81.086  18.052  1.00 36.21 ? 278  ARG A C   1 
ATOM   1706 O O   . ARG A 1 234 ? 8.013   82.228  17.976  1.00 35.64 ? 278  ARG A O   1 
ATOM   1707 C CB  . ARG A 1 234 ? 7.420   79.943  16.159  1.00 38.13 ? 278  ARG A CB  1 
ATOM   1708 C CG  . ARG A 1 234 ? 7.161   80.542  14.845  1.00 40.30 ? 278  ARG A CG  1 
ATOM   1709 C CD  . ARG A 1 234 ? 6.433   79.582  13.927  1.00 43.37 ? 278  ARG A CD  1 
ATOM   1710 N NE  . ARG A 1 234 ? 5.710   78.451  14.540  1.00 38.64 ? 278  ARG A NE  1 
ATOM   1711 C CZ  . ARG A 1 234 ? 4.573   78.540  15.232  1.00 42.35 ? 278  ARG A CZ  1 
ATOM   1712 N NH1 . ARG A 1 234 ? 4.024   79.733  15.462  1.00 39.25 ? 278  ARG A NH1 1 
ATOM   1713 N NH2 . ARG A 1 234 ? 3.987   77.419  15.689  1.00 39.16 ? 278  ARG A NH2 1 
ATOM   1714 N N   . PHE A 1 235 ? 8.755   80.499  19.223  1.00 34.51 ? 279  PHE A N   1 
ATOM   1715 C CA  . PHE A 1 235 ? 8.260   81.085  20.470  1.00 32.24 ? 279  PHE A CA  1 
ATOM   1716 C C   . PHE A 1 235 ? 9.334   81.785  21.270  1.00 30.49 ? 279  PHE A C   1 
ATOM   1717 O O   . PHE A 1 235 ? 10.473  81.355  21.317  1.00 29.16 ? 279  PHE A O   1 
ATOM   1718 C CB  . PHE A 1 235 ? 7.538   80.052  21.362  1.00 32.86 ? 279  PHE A CB  1 
ATOM   1719 C CG  . PHE A 1 235 ? 6.600   79.133  20.607  1.00 33.85 ? 279  PHE A CG  1 
ATOM   1720 C CD1 . PHE A 1 235 ? 5.364   79.575  20.164  1.00 35.60 ? 279  PHE A CD1 1 
ATOM   1721 C CD2 . PHE A 1 235 ? 6.965   77.838  20.343  1.00 37.05 ? 279  PHE A CD2 1 
ATOM   1722 C CE1 . PHE A 1 235 ? 4.504   78.716  19.468  1.00 34.20 ? 279  PHE A CE1 1 
ATOM   1723 C CE2 . PHE A 1 235 ? 6.100   76.972  19.640  1.00 39.33 ? 279  PHE A CE2 1 
ATOM   1724 C CZ  . PHE A 1 235 ? 4.893   77.416  19.214  1.00 35.75 ? 279  PHE A CZ  1 
ATOM   1725 N N   . LEU A 1 236 ? 8.944   82.887  21.888  1.00 28.68 ? 280  LEU A N   1 
ATOM   1726 C CA  . LEU A 1 236 ? 9.783   83.536  22.911  1.00 26.78 ? 280  LEU A CA  1 
ATOM   1727 C C   . LEU A 1 236 ? 9.094   83.228  24.252  1.00 25.90 ? 280  LEU A C   1 
ATOM   1728 O O   . LEU A 1 236 ? 7.908   83.471  24.365  1.00 26.37 ? 280  LEU A O   1 
ATOM   1729 C CB  . LEU A 1 236 ? 9.911   85.032  22.613  1.00 25.64 ? 280  LEU A CB  1 
ATOM   1730 C CG  . LEU A 1 236 ? 10.570  85.905  23.707  1.00 25.01 ? 280  LEU A CG  1 
ATOM   1731 C CD1 . LEU A 1 236 ? 12.030  85.492  23.931  1.00 25.19 ? 280  LEU A CD1 1 
ATOM   1732 C CD2 . LEU A 1 236 ? 10.490  87.378  23.405  1.00 26.12 ? 280  LEU A CD2 1 
ATOM   1733 N N   . PHE A 1 237 ? 9.794   82.635  25.222  1.00 24.43 ? 281  PHE A N   1 
ATOM   1734 C CA  . PHE A 1 237 ? 9.198   82.320  26.512  1.00 24.38 ? 281  PHE A CA  1 
ATOM   1735 C C   . PHE A 1 237 ? 9.852   83.196  27.558  1.00 24.24 ? 281  PHE A C   1 
ATOM   1736 O O   . PHE A 1 237 ? 11.027  83.419  27.490  1.00 24.65 ? 281  PHE A O   1 
ATOM   1737 C CB  . PHE A 1 237 ? 9.504   80.889  26.913  1.00 24.90 ? 281  PHE A CB  1 
ATOM   1738 C CG  . PHE A 1 237 ? 8.950   79.878  26.010  1.00 26.61 ? 281  PHE A CG  1 
ATOM   1739 C CD1 . PHE A 1 237 ? 7.665   79.404  26.201  1.00 29.33 ? 281  PHE A CD1 1 
ATOM   1740 C CD2 . PHE A 1 237 ? 9.714   79.365  24.980  1.00 29.26 ? 281  PHE A CD2 1 
ATOM   1741 C CE1 . PHE A 1 237 ? 7.148   78.460  25.354  1.00 29.72 ? 281  PHE A CE1 1 
ATOM   1742 C CE2 . PHE A 1 237 ? 9.193   78.411  24.146  1.00 30.64 ? 281  PHE A CE2 1 
ATOM   1743 C CZ  . PHE A 1 237 ? 7.911   77.981  24.349  1.00 27.70 ? 281  PHE A CZ  1 
ATOM   1744 N N   . ALA A 1 238 ? 9.094   83.674  28.527  1.00 24.46 ? 282  ALA A N   1 
ATOM   1745 C CA  . ALA A 1 238 ? 9.613   84.473  29.617  1.00 23.86 ? 282  ALA A CA  1 
ATOM   1746 C C   . ALA A 1 238 ? 8.969   83.887  30.877  1.00 25.48 ? 282  ALA A C   1 
ATOM   1747 O O   . ALA A 1 238 ? 7.760   83.575  30.834  1.00 25.17 ? 282  ALA A O   1 
ATOM   1748 C CB  . ALA A 1 238 ? 9.180   85.909  29.442  1.00 24.12 ? 282  ALA A CB  1 
ATOM   1749 N N   . SER A 1 239 ? 9.707   83.710  31.980  1.00 24.12 ? 283  SER A N   1 
ATOM   1750 C CA  . SER A 1 239 ? 8.994   83.390  33.193  1.00 25.02 ? 283  SER A CA  1 
ATOM   1751 C C   . SER A 1 239 ? 8.861   84.661  34.014  1.00 25.95 ? 283  SER A C   1 
ATOM   1752 O O   . SER A 1 239 ? 9.781   85.431  34.113  1.00 24.33 ? 283  SER A O   1 
ATOM   1753 C CB  . SER A 1 239 ? 9.592   82.264  33.981  1.00 24.67 ? 283  SER A CB  1 
ATOM   1754 O OG  . SER A 1 239 ? 10.937  82.512  34.302  1.00 28.42 ? 283  SER A OG  1 
ATOM   1755 N N   . VAL A 1 240 ? 7.674   84.898  34.543  1.00 28.41 ? 284  VAL A N   1 
ATOM   1756 C CA  . VAL A 1 240 ? 7.329   86.195  35.117  1.00 30.00 ? 284  VAL A CA  1 
ATOM   1757 C C   . VAL A 1 240 ? 6.795   85.967  36.509  1.00 32.98 ? 284  VAL A C   1 
ATOM   1758 O O   . VAL A 1 240 ? 5.995   85.079  36.727  1.00 30.88 ? 284  VAL A O   1 
ATOM   1759 C CB  . VAL A 1 240 ? 6.272   86.921  34.243  1.00 29.98 ? 284  VAL A CB  1 
ATOM   1760 C CG1 . VAL A 1 240 ? 5.867   88.260  34.851  1.00 27.33 ? 284  VAL A CG1 1 
ATOM   1761 C CG2 . VAL A 1 240 ? 6.785   87.078  32.798  1.00 28.73 ? 284  VAL A CG2 1 
ATOM   1762 N N   . MET A 1 241 ? 7.230   86.796  37.450  1.00 37.72 ? 285  MET A N   1 
ATOM   1763 C CA  . MET A 1 241 ? 6.903   86.569  38.851  1.00 43.84 ? 285  MET A CA  1 
ATOM   1764 C C   . MET A 1 241 ? 5.618   87.287  39.174  1.00 45.56 ? 285  MET A C   1 
ATOM   1765 O O   . MET A 1 241 ? 5.444   88.433  38.770  1.00 46.47 ? 285  MET A O   1 
ATOM   1766 C CB  . MET A 1 241 ? 8.061   87.047  39.747  1.00 43.87 ? 285  MET A CB  1 
ATOM   1767 C CG  . MET A 1 241 ? 9.416   86.251  39.507  1.00 45.71 ? 285  MET A CG  1 
ATOM   1768 S SD  . MET A 1 241 ? 10.137  85.339  40.933  1.00 49.63 ? 285  MET A SD  1 
ATOM   1769 C CE  . MET A 1 241 ? 9.846   86.546  42.250  1.00 45.86 ? 285  MET A CE  1 
ATOM   1770 N N   . ALA A 1 242 ? 4.707   86.620  39.882  1.00 48.33 ? 286  ALA A N   1 
ATOM   1771 C CA  . ALA A 1 242 ? 3.442   87.256  40.270  1.00 50.25 ? 286  ALA A CA  1 
ATOM   1772 C C   . ALA A 1 242 ? 3.718   88.263  41.348  1.00 52.08 ? 286  ALA A C   1 
ATOM   1773 O O   . ALA A 1 242 ? 4.310   87.924  42.380  1.00 53.04 ? 286  ALA A O   1 
ATOM   1774 C CB  . ALA A 1 242 ? 2.432   86.237  40.757  1.00 50.57 ? 286  ALA A CB  1 
ATOM   1775 N N   . ASP A 1 243 ? 3.310   89.511  41.116  1.00 53.49 ? 287  ASP A N   1 
ATOM   1776 C CA  . ASP A 1 243 ? 3.556   90.550  42.110  1.00 54.40 ? 287  ASP A CA  1 
ATOM   1777 C C   . ASP A 1 243 ? 2.688   90.322  43.357  1.00 54.43 ? 287  ASP A C   1 
ATOM   1778 O O   . ASP A 1 243 ? 1.550   89.809  43.276  1.00 54.56 ? 287  ASP A O   1 
ATOM   1779 C CB  . ASP A 1 243 ? 3.485   91.984  41.525  1.00 54.80 ? 287  ASP A CB  1 
ATOM   1780 C CG  . ASP A 1 243 ? 2.079   92.396  41.073  1.00 56.39 ? 287  ASP A CG  1 
ATOM   1781 O OD1 . ASP A 1 243 ? 1.625   93.470  41.538  1.00 57.82 ? 287  ASP A OD1 1 
ATOM   1782 O OD2 . ASP A 1 243 ? 1.441   91.682  40.254  1.00 57.79 ? 287  ASP A OD2 1 
ATOM   1783 N N   . LYS A 1 244 ? 3.279   90.651  44.506  1.00 54.34 ? 288  LYS A N   1 
ATOM   1784 C CA  . LYS A 1 244 ? 2.775   90.255  45.829  1.00 53.93 ? 288  LYS A CA  1 
ATOM   1785 C C   . LYS A 1 244 ? 2.959   88.719  46.065  1.00 53.09 ? 288  LYS A C   1 
ATOM   1786 O O   . LYS A 1 244 ? 2.200   88.100  46.829  1.00 53.23 ? 288  LYS A O   1 
ATOM   1787 C CB  . LYS A 1 244 ? 1.323   90.775  46.063  1.00 53.91 ? 288  LYS A CB  1 
ATOM   1788 C CG  . LYS A 1 244 ? 0.847   90.815  47.527  1.00 54.35 ? 288  LYS A CG  1 
ATOM   1789 C CD  . LYS A 1 244 ? 1.616   91.818  48.409  1.00 54.34 ? 288  LYS A CD  1 
ATOM   1790 C CE  . LYS A 1 244 ? 1.318   91.616  49.922  1.00 54.10 ? 288  LYS A CE  1 
ATOM   1791 N NZ  . LYS A 1 244 ? 0.379   92.627  50.565  1.00 52.74 ? 288  LYS A NZ  1 
ATOM   1792 N N   . ASP A 1 245 ? 3.990   88.121  45.441  1.00 51.91 ? 289  ASP A N   1 
ATOM   1793 C CA  . ASP A 1 245 ? 4.189   86.655  45.507  1.00 50.45 ? 289  ASP A CA  1 
ATOM   1794 C C   . ASP A 1 245 ? 5.578   86.127  45.098  1.00 48.59 ? 289  ASP A C   1 
ATOM   1795 O O   . ASP A 1 245 ? 6.381   86.826  44.468  1.00 48.96 ? 289  ASP A O   1 
ATOM   1796 C CB  . ASP A 1 245 ? 3.101   85.946  44.685  1.00 51.43 ? 289  ASP A CB  1 
ATOM   1797 C CG  . ASP A 1 245 ? 2.485   84.767  45.420  1.00 53.29 ? 289  ASP A CG  1 
ATOM   1798 O OD1 . ASP A 1 245 ? 2.503   84.769  46.670  1.00 55.18 ? 289  ASP A OD1 1 
ATOM   1799 O OD2 . ASP A 1 245 ? 1.975   83.843  44.742  1.00 55.41 ? 289  ASP A OD2 1 
ATOM   1800 N N   . THR A 1 246 ? 5.847   84.874  45.452  1.00 45.49 ? 290  THR A N   1 
ATOM   1801 C CA  . THR A 1 246 ? 7.168   84.276  45.276  1.00 42.38 ? 290  THR A CA  1 
ATOM   1802 C C   . THR A 1 246 ? 7.167   83.305  44.075  1.00 40.16 ? 290  THR A C   1 
ATOM   1803 O O   . THR A 1 246 ? 8.219   82.821  43.611  1.00 39.35 ? 290  THR A O   1 
ATOM   1804 C CB  . THR A 1 246 ? 7.559   83.491  46.543  1.00 43.14 ? 290  THR A CB  1 
ATOM   1805 O OG1 . THR A 1 246 ? 6.522   82.543  46.859  1.00 43.49 ? 290  THR A OG1 1 
ATOM   1806 C CG2 . THR A 1 246 ? 7.772   84.450  47.781  1.00 43.73 ? 290  THR A CG2 1 
ATOM   1807 N N   . THR A 1 247 ? 5.973   83.013  43.584  1.00 36.75 ? 291  THR A N   1 
ATOM   1808 C CA  . THR A 1 247 ? 5.830   82.113  42.459  1.00 33.10 ? 291  THR A CA  1 
ATOM   1809 C C   . THR A 1 247 ? 6.019   82.844  41.120  1.00 30.75 ? 291  THR A C   1 
ATOM   1810 O O   . THR A 1 247 ? 6.026   84.078  41.041  1.00 29.53 ? 291  THR A O   1 
ATOM   1811 C CB  . THR A 1 247 ? 4.455   81.464  42.479  1.00 33.62 ? 291  THR A CB  1 
ATOM   1812 O OG1 . THR A 1 247 ? 3.492   82.467  42.222  1.00 33.38 ? 291  THR A OG1 1 
ATOM   1813 C CG2 . THR A 1 247 ? 4.147   80.772  43.836  1.00 33.23 ? 291  THR A CG2 1 
ATOM   1814 N N   . ARG A 1 248 ? 6.164   82.067  40.054  1.00 27.91 ? 292  ARG A N   1 
ATOM   1815 C CA  . ARG A 1 248 ? 6.287   82.622  38.716  1.00 26.03 ? 292  ARG A CA  1 
ATOM   1816 C C   . ARG A 1 248 ? 5.528   81.710  37.688  1.00 25.65 ? 292  ARG A C   1 
ATOM   1817 O O   . ARG A 1 248 ? 5.095   80.579  38.046  1.00 25.04 ? 292  ARG A O   1 
ATOM   1818 C CB  . ARG A 1 248 ? 7.778   82.782  38.382  1.00 25.92 ? 292  ARG A CB  1 
ATOM   1819 C CG  . ARG A 1 248 ? 8.471   81.480  38.079  1.00 23.34 ? 292  ARG A CG  1 
ATOM   1820 C CD  . ARG A 1 248 ? 9.927   81.657  38.089  1.00 25.85 ? 292  ARG A CD  1 
ATOM   1821 N NE  . ARG A 1 248 ? 10.627  80.462  37.634  1.00 27.29 ? 292  ARG A NE  1 
ATOM   1822 C CZ  . ARG A 1 248 ? 11.118  79.516  38.440  1.00 30.47 ? 292  ARG A CZ  1 
ATOM   1823 N NH1 . ARG A 1 248 ? 10.972  79.594  39.757  1.00 27.31 ? 292  ARG A NH1 1 
ATOM   1824 N NH2 . ARG A 1 248 ? 11.740  78.466  37.917  1.00 28.61 ? 292  ARG A NH2 1 
ATOM   1825 N N   . ARG A 1 249 ? 5.313   82.228  36.471  1.00 25.49 ? 293  ARG A N   1 
ATOM   1826 C CA  . ARG A 1 249 ? 4.517   81.594  35.368  1.00 25.76 ? 293  ARG A CA  1 
ATOM   1827 C C   . ARG A 1 249 ? 5.163   81.867  34.053  1.00 24.55 ? 293  ARG A C   1 
ATOM   1828 O O   . ARG A 1 249 ? 5.838   82.867  33.927  1.00 24.29 ? 293  ARG A O   1 
ATOM   1829 C CB  . ARG A 1 249 ? 3.277   82.383  35.112  1.00 27.06 ? 293  ARG A CB  1 
ATOM   1830 C CG  . ARG A 1 249 ? 2.260   82.264  36.065  1.00 33.21 ? 293  ARG A CG  1 
ATOM   1831 C CD  . ARG A 1 249 ? 1.011   82.703  35.429  1.00 37.20 ? 293  ARG A CD  1 
ATOM   1832 N NE  . ARG A 1 249 ? -0.054  82.512  36.379  1.00 42.05 ? 293  ARG A NE  1 
ATOM   1833 C CZ  . ARG A 1 249 ? -0.641  81.345  36.613  1.00 40.27 ? 293  ARG A CZ  1 
ATOM   1834 N NH1 . ARG A 1 249 ? -0.293  80.226  35.968  1.00 33.78 ? 293  ARG A NH1 1 
ATOM   1835 N NH2 . ARG A 1 249 ? -1.594  81.328  37.510  1.00 41.44 ? 293  ARG A NH2 1 
ATOM   1836 N N   . ILE A 1 250 ? 4.822   81.077  33.031  1.00 24.00 ? 294  ILE A N   1 
ATOM   1837 C CA  . ILE A 1 250 ? 5.434   81.202  31.715  1.00 23.13 ? 294  ILE A CA  1 
ATOM   1838 C C   . ILE A 1 250 ? 4.490   82.078  30.922  1.00 22.82 ? 294  ILE A C   1 
ATOM   1839 O O   . ILE A 1 250 ? 3.282   81.897  31.013  1.00 20.99 ? 294  ILE A O   1 
ATOM   1840 C CB  . ILE A 1 250 ? 5.533   79.828  30.993  1.00 23.41 ? 294  ILE A CB  1 
ATOM   1841 C CG1 . ILE A 1 250 ? 6.557   78.924  31.636  1.00 24.24 ? 294  ILE A CG1 1 
ATOM   1842 C CG2 . ILE A 1 250 ? 5.845   79.985  29.503  1.00 22.31 ? 294  ILE A CG2 1 
ATOM   1843 C CD1 . ILE A 1 250 ? 7.971   79.336  31.331  1.00 26.72 ? 294  ILE A CD1 1 
ATOM   1844 N N   . HIS A 1 251 ? 5.036   83.030  30.167  1.00 22.40 ? 295  HIS A N   1 
ATOM   1845 C CA  . HIS A 1 251 ? 4.269   83.809  29.197  1.00 23.88 ? 295  HIS A CA  1 
ATOM   1846 C C   . HIS A 1 251 ? 4.946   83.620  27.880  1.00 24.29 ? 295  HIS A C   1 
ATOM   1847 O O   . HIS A 1 251 ? 6.148   83.384  27.853  1.00 24.44 ? 295  HIS A O   1 
ATOM   1848 C CB  . HIS A 1 251 ? 4.268   85.279  29.542  1.00 24.53 ? 295  HIS A CB  1 
ATOM   1849 C CG  . HIS A 1 251 ? 3.501   85.608  30.781  1.00 27.29 ? 295  HIS A CG  1 
ATOM   1850 N ND1 . HIS A 1 251 ? 3.796   85.056  32.006  1.00 30.01 ? 295  HIS A ND1 1 
ATOM   1851 C CD2 . HIS A 1 251 ? 2.489   86.475  30.995  1.00 27.04 ? 295  HIS A CD2 1 
ATOM   1852 C CE1 . HIS A 1 251 ? 2.967   85.536  32.914  1.00 28.93 ? 295  HIS A CE1 1 
ATOM   1853 N NE2 . HIS A 1 251 ? 2.163   86.396  32.324  1.00 30.98 ? 295  HIS A NE2 1 
ATOM   1854 N N   . VAL A 1 252 ? 4.177   83.636  26.795  1.00 24.70 ? 296  VAL A N   1 
ATOM   1855 C CA  . VAL A 1 252 ? 4.675   83.259  25.461  1.00 26.05 ? 296  VAL A CA  1 
ATOM   1856 C C   . VAL A 1 252 ? 4.390   84.396  24.485  1.00 26.22 ? 296  VAL A C   1 
ATOM   1857 O O   . VAL A 1 252 ? 3.395   85.084  24.614  1.00 26.68 ? 296  VAL A O   1 
ATOM   1858 C CB  . VAL A 1 252 ? 4.027   81.946  24.934  1.00 26.93 ? 296  VAL A CB  1 
ATOM   1859 C CG1 . VAL A 1 252 ? 4.781   81.421  23.665  1.00 27.41 ? 296  VAL A CG1 1 
ATOM   1860 C CG2 . VAL A 1 252 ? 4.058   80.851  26.010  1.00 29.00 ? 296  VAL A CG2 1 
ATOM   1861 N N   . SER A 1 253 ? 5.310   84.652  23.580  1.00 27.66 ? 297  SER A N   1 
ATOM   1862 C CA  . SER A 1 253 ? 5.104   85.584  22.489  1.00 30.06 ? 297  SER A CA  1 
ATOM   1863 C C   . SER A 1 253 ? 5.595   84.951  21.187  1.00 32.01 ? 297  SER A C   1 
ATOM   1864 O O   . SER A 1 253 ? 6.636   84.283  21.138  1.00 31.13 ? 297  SER A O   1 
ATOM   1865 C CB  . SER A 1 253 ? 5.821   86.902  22.785  1.00 30.66 ? 297  SER A CB  1 
ATOM   1866 O OG  . SER A 1 253 ? 5.755   87.837  21.720  1.00 31.54 ? 297  SER A OG  1 
ATOM   1867 N N   . THR A 1 254 ? 4.822   85.115  20.118  1.00 34.54 ? 298  THR A N   1 
ATOM   1868 C CA  . THR A 1 254 ? 5.295   84.708  18.790  1.00 36.91 ? 298  THR A CA  1 
ATOM   1869 C C   . THR A 1 254 ? 5.564   85.934  17.912  1.00 38.29 ? 298  THR A C   1 
ATOM   1870 O O   . THR A 1 254 ? 5.730   85.790  16.719  1.00 39.92 ? 298  THR A O   1 
ATOM   1871 C CB  . THR A 1 254 ? 4.290   83.819  18.045  1.00 36.76 ? 298  THR A CB  1 
ATOM   1872 O OG1 . THR A 1 254 ? 3.037   84.509  17.988  1.00 39.71 ? 298  THR A OG1 1 
ATOM   1873 C CG2 . THR A 1 254 ? 4.076   82.516  18.746  1.00 37.50 ? 298  THR A CG2 1 
ATOM   1874 N N   . ASP A 1 255 ? 5.576   87.128  18.490  1.00 40.13 ? 299  ASP A N   1 
ATOM   1875 C CA  . ASP A 1 255 ? 5.964   88.342  17.753  1.00 41.33 ? 299  ASP A CA  1 
ATOM   1876 C C   . ASP A 1 255 ? 7.055   89.150  18.472  1.00 40.68 ? 299  ASP A C   1 
ATOM   1877 O O   . ASP A 1 255 ? 6.965   90.366  18.602  1.00 40.81 ? 299  ASP A O   1 
ATOM   1878 C CB  . ASP A 1 255 ? 4.742   89.206  17.402  1.00 42.09 ? 299  ASP A CB  1 
ATOM   1879 C CG  . ASP A 1 255 ? 4.013   89.732  18.632  1.00 45.71 ? 299  ASP A CG  1 
ATOM   1880 O OD1 . ASP A 1 255 ? 4.444   89.413  19.771  1.00 50.63 ? 299  ASP A OD1 1 
ATOM   1881 O OD2 . ASP A 1 255 ? 3.011   90.477  18.457  1.00 48.15 ? 299  ASP A OD2 1 
ATOM   1882 N N   . GLN A 1 256 ? 8.094   88.443  18.932  1.00 40.21 ? 300  GLN A N   1 
ATOM   1883 C CA  . GLN A 1 256 ? 9.258   89.051  19.560  1.00 39.25 ? 300  GLN A CA  1 
ATOM   1884 C C   . GLN A 1 256 ? 8.864   89.961  20.718  1.00 38.43 ? 300  GLN A C   1 
ATOM   1885 O O   . GLN A 1 256 ? 9.469   90.999  20.954  1.00 37.24 ? 300  GLN A O   1 
ATOM   1886 C CB  . GLN A 1 256 ? 10.109  89.794  18.515  1.00 39.27 ? 300  GLN A CB  1 
ATOM   1887 C CG  . GLN A 1 256 ? 10.613  88.921  17.361  1.00 39.59 ? 300  GLN A CG  1 
ATOM   1888 C CD  . GLN A 1 256 ? 11.575  89.671  16.421  1.00 41.54 ? 300  GLN A CD  1 
ATOM   1889 O OE1 . GLN A 1 256 ? 11.401  90.895  16.144  1.00 43.95 ? 300  GLN A OE1 1 
ATOM   1890 N NE2 . GLN A 1 256 ? 12.594  88.957  15.930  1.00 41.84 ? 300  GLN A NE2 1 
ATOM   1891 N N   . GLY A 1 257 ? 7.838   89.575  21.453  1.00 37.62 ? 301  GLY A N   1 
ATOM   1892 C CA  . GLY A 1 257 ? 7.523   90.324  22.649  1.00 37.69 ? 301  GLY A CA  1 
ATOM   1893 C C   . GLY A 1 257 ? 6.774   91.620  22.449  1.00 38.37 ? 301  GLY A C   1 
ATOM   1894 O O   . GLY A 1 257 ? 6.682   92.421  23.386  1.00 38.75 ? 301  GLY A O   1 
ATOM   1895 N N   . ASP A 1 258 ? 6.230   91.842  21.248  1.00 38.43 ? 302  ASP A N   1 
ATOM   1896 C CA  . ASP A 1 258 ? 5.272   92.950  21.037  1.00 38.41 ? 302  ASP A CA  1 
ATOM   1897 C C   . ASP A 1 258 ? 3.975   92.650  21.756  1.00 37.51 ? 302  ASP A C   1 
ATOM   1898 O O   . ASP A 1 258 ? 3.343   93.560  22.294  1.00 37.32 ? 302  ASP A O   1 
ATOM   1899 C CB  . ASP A 1 258 ? 4.997   93.172  19.551  1.00 39.15 ? 302  ASP A CB  1 
ATOM   1900 C CG  . ASP A 1 258 ? 6.104   93.934  18.875  1.00 41.88 ? 302  ASP A CG  1 
ATOM   1901 O OD1 . ASP A 1 258 ? 6.803   94.699  19.582  1.00 43.61 ? 302  ASP A OD1 1 
ATOM   1902 O OD2 . ASP A 1 258 ? 6.301   93.745  17.652  1.00 45.16 ? 302  ASP A OD2 1 
ATOM   1903 N N   . THR A 1 259 ? 3.599   91.362  21.761  1.00 36.40 ? 303  THR A N   1 
ATOM   1904 C CA  . THR A 1 259 ? 2.425   90.859  22.507  1.00 35.65 ? 303  THR A CA  1 
ATOM   1905 C C   . THR A 1 259 ? 2.693   89.521  23.218  1.00 34.40 ? 303  THR A C   1 
ATOM   1906 O O   . THR A 1 259 ? 3.454   88.705  22.734  1.00 33.57 ? 303  THR A O   1 
ATOM   1907 C CB  . THR A 1 259 ? 1.144   90.750  21.611  1.00 35.59 ? 303  THR A CB  1 
ATOM   1908 O OG1 . THR A 1 259 ? 1.229   89.612  20.755  1.00 36.99 ? 303  THR A OG1 1 
ATOM   1909 C CG2 . THR A 1 259 ? 0.966   91.982  20.747  1.00 35.99 ? 303  THR A CG2 1 
ATOM   1910 N N   . TRP A 1 260 ? 2.047   89.334  24.368  1.00 33.67 ? 304  TRP A N   1 
ATOM   1911 C CA  . TRP A 1 260 ? 2.274   88.193  25.266  1.00 33.24 ? 304  TRP A CA  1 
ATOM   1912 C C   . TRP A 1 260 ? 0.955   87.562  25.668  1.00 32.27 ? 304  TRP A C   1 
ATOM   1913 O O   . TRP A 1 260 ? -0.036  88.249  25.813  1.00 31.16 ? 304  TRP A O   1 
ATOM   1914 C CB  . TRP A 1 260 ? 2.966   88.665  26.571  1.00 33.76 ? 304  TRP A CB  1 
ATOM   1915 C CG  . TRP A 1 260 ? 4.343   89.172  26.360  1.00 33.89 ? 304  TRP A CG  1 
ATOM   1916 C CD1 . TRP A 1 260 ? 4.705   90.466  26.094  1.00 35.50 ? 304  TRP A CD1 1 
ATOM   1917 C CD2 . TRP A 1 260 ? 5.551   88.403  26.346  1.00 33.30 ? 304  TRP A CD2 1 
ATOM   1918 N NE1 . TRP A 1 260 ? 6.067   90.543  25.932  1.00 34.49 ? 304  TRP A NE1 1 
ATOM   1919 C CE2 . TRP A 1 260 ? 6.605   89.290  26.076  1.00 33.31 ? 304  TRP A CE2 1 
ATOM   1920 C CE3 . TRP A 1 260 ? 5.841   87.049  26.538  1.00 32.89 ? 304  TRP A CE3 1 
ATOM   1921 C CZ2 . TRP A 1 260 ? 7.924   88.877  26.024  1.00 33.08 ? 304  TRP A CZ2 1 
ATOM   1922 C CZ3 . TRP A 1 260 ? 7.144   86.638  26.473  1.00 33.43 ? 304  TRP A CZ3 1 
ATOM   1923 C CH2 . TRP A 1 260 ? 8.176   87.534  26.203  1.00 33.92 ? 304  TRP A CH2 1 
ATOM   1924 N N   . SER A 1 261 ? 0.964   86.253  25.890  1.00 30.95 ? 305  SER A N   1 
ATOM   1925 C CA  . SER A 1 261 ? -0.178  85.568  26.483  1.00 30.16 ? 305  SER A CA  1 
ATOM   1926 C C   . SER A 1 261 ? 0.379   84.710  27.585  1.00 29.26 ? 305  SER A C   1 
ATOM   1927 O O   . SER A 1 261 ? 1.489   84.191  27.460  1.00 26.67 ? 305  SER A O   1 
ATOM   1928 C CB  . SER A 1 261 ? -0.857  84.618  25.478  1.00 30.08 ? 305  SER A CB  1 
ATOM   1929 O OG  . SER A 1 261 ? -1.247  85.290  24.290  1.00 32.45 ? 305  SER A OG  1 
ATOM   1930 N N   . MET A 1 262 ? -0.415  84.514  28.628  1.00 28.30 ? 306  MET A N   1 
ATOM   1931 C CA  . MET A 1 262 ? -0.033  83.575  29.654  1.00 30.03 ? 306  MET A CA  1 
ATOM   1932 C C   . MET A 1 262 ? -0.234  82.173  29.101  1.00 27.98 ? 306  MET A C   1 
ATOM   1933 O O   . MET A 1 262 ? -1.149  81.921  28.340  1.00 27.50 ? 306  MET A O   1 
ATOM   1934 C CB  . MET A 1 262 ? -0.706  83.905  31.008  1.00 30.17 ? 306  MET A CB  1 
ATOM   1935 C CG  . MET A 1 262 ? -1.983  83.166  31.412  1.00 34.58 ? 306  MET A CG  1 
ATOM   1936 S SD  . MET A 1 262 ? -1.981  82.766  33.199  1.00 35.98 ? 306  MET A SD  1 
ATOM   1937 C CE  . MET A 1 262 ? -1.441  84.291  33.940  1.00 38.75 ? 306  MET A CE  1 
ATOM   1938 N N   . ALA A 1 263 ? 0.697   81.288  29.364  1.00 27.21 ? 307  ALA A N   1 
ATOM   1939 C CA  . ALA A 1 263 ? 0.548   79.951  28.880  1.00 26.52 ? 307  ALA A CA  1 
ATOM   1940 C C   . ALA A 1 263 ? -0.322  79.183  29.879  1.00 25.98 ? 307  ALA A C   1 
ATOM   1941 O O   . ALA A 1 263 ? -0.393  79.509  31.062  1.00 24.77 ? 307  ALA A O   1 
ATOM   1942 C CB  . ALA A 1 263 ? 1.897   79.303  28.692  1.00 26.75 ? 307  ALA A CB  1 
ATOM   1943 N N   . GLN A 1 264 ? -0.988  78.160  29.386  1.00 25.75 ? 308  GLN A N   1 
ATOM   1944 C CA  . GLN A 1 264 ? -1.888  77.346  30.185  1.00 27.20 ? 308  GLN A CA  1 
ATOM   1945 C C   . GLN A 1 264 ? -1.101  76.264  30.885  1.00 27.14 ? 308  GLN A C   1 
ATOM   1946 O O   . GLN A 1 264 ? -1.158  75.079  30.481  1.00 29.00 ? 308  GLN A O   1 
ATOM   1947 C CB  . GLN A 1 264 ? -2.902  76.686  29.248  1.00 27.58 ? 308  GLN A CB  1 
ATOM   1948 C CG  . GLN A 1 264 ? -4.131  76.141  29.926  1.00 32.36 ? 308  GLN A CG  1 
ATOM   1949 C CD  . GLN A 1 264 ? -4.362  74.707  29.565  1.00 37.64 ? 308  GLN A CD  1 
ATOM   1950 O OE1 . GLN A 1 264 ? -3.905  74.217  28.529  1.00 35.38 ? 308  GLN A OE1 1 
ATOM   1951 N NE2 . GLN A 1 264 ? -5.072  74.004  30.438  1.00 42.21 ? 308  GLN A NE2 1 
ATOM   1952 N N   . LEU A 1 265 ? -0.341  76.651  31.905  1.00 26.63 ? 309  LEU A N   1 
ATOM   1953 C CA  . LEU A 1 265 ? 0.621   75.753  32.578  1.00 26.28 ? 309  LEU A CA  1 
ATOM   1954 C C   . LEU A 1 265 ? 0.593   76.192  33.995  1.00 25.86 ? 309  LEU A C   1 
ATOM   1955 O O   . LEU A 1 265 ? 0.396   77.366  34.226  1.00 25.84 ? 309  LEU A O   1 
ATOM   1956 C CB  . LEU A 1 265 ? 2.063   75.979  32.072  1.00 24.91 ? 309  LEU A CB  1 
ATOM   1957 C CG  . LEU A 1 265 ? 2.467   75.336  30.769  1.00 28.44 ? 309  LEU A CG  1 
ATOM   1958 C CD1 . LEU A 1 265 ? 3.838   75.845  30.338  1.00 27.28 ? 309  LEU A CD1 1 
ATOM   1959 C CD2 . LEU A 1 265 ? 2.449   73.831  30.929  1.00 24.35 ? 309  LEU A CD2 1 
ATOM   1960 N N   . PRO A 1 266 ? 0.884   75.277  34.944  1.00 25.93 ? 310  PRO A N   1 
ATOM   1961 C CA  . PRO A 1 266 ? 0.942   75.690  36.352  1.00 26.08 ? 310  PRO A CA  1 
ATOM   1962 C C   . PRO A 1 266 ? 2.040   76.700  36.608  1.00 25.64 ? 310  PRO A C   1 
ATOM   1963 O O   . PRO A 1 266 ? 3.106   76.656  35.957  1.00 24.95 ? 310  PRO A O   1 
ATOM   1964 C CB  . PRO A 1 266 ? 1.328   74.409  37.098  1.00 26.51 ? 310  PRO A CB  1 
ATOM   1965 C CG  . PRO A 1 266 ? 1.870   73.501  36.108  1.00 26.61 ? 310  PRO A CG  1 
ATOM   1966 C CD  . PRO A 1 266 ? 1.287   73.868  34.744  1.00 26.30 ? 310  PRO A CD  1 
ATOM   1967 N N   . SER A 1 267 ? 1.798   77.573  37.568  1.00 25.30 ? 311  SER A N   1 
ATOM   1968 C CA  . SER A 1 267 ? 2.853   78.335  38.175  1.00 25.83 ? 311  SER A CA  1 
ATOM   1969 C C   . SER A 1 267 ? 3.726   77.458  39.112  1.00 26.31 ? 311  SER A C   1 
ATOM   1970 O O   . SER A 1 267 ? 3.300   76.374  39.587  1.00 27.02 ? 311  SER A O   1 
ATOM   1971 C CB  . SER A 1 267 ? 2.255   79.496  38.966  1.00 26.62 ? 311  SER A CB  1 
ATOM   1972 O OG  . SER A 1 267 ? 1.615   78.965  40.089  1.00 29.03 ? 311  SER A OG  1 
ATOM   1973 N N   . VAL A 1 268 ? 4.939   77.944  39.389  1.00 25.01 ? 312  VAL A N   1 
ATOM   1974 C CA  . VAL A 1 268 ? 5.906   77.213  40.168  1.00 25.33 ? 312  VAL A CA  1 
ATOM   1975 C C   . VAL A 1 268 ? 6.470   78.108  41.275  1.00 25.88 ? 312  VAL A C   1 
ATOM   1976 O O   . VAL A 1 268 ? 6.542   79.301  41.113  1.00 26.26 ? 312  VAL A O   1 
ATOM   1977 C CB  . VAL A 1 268 ? 7.069   76.644  39.255  1.00 24.93 ? 312  VAL A CB  1 
ATOM   1978 C CG1 . VAL A 1 268 ? 6.509   75.667  38.200  1.00 22.89 ? 312  VAL A CG1 1 
ATOM   1979 C CG2 . VAL A 1 268 ? 7.835   77.738  38.571  1.00 23.99 ? 312  VAL A CG2 1 
ATOM   1980 N N   . GLY A 1 269 ? 6.906   77.509  42.367  1.00 26.96 ? 313  GLY A N   1 
ATOM   1981 C CA  . GLY A 1 269 ? 7.679   78.215  43.393  1.00 28.38 ? 313  GLY A CA  1 
ATOM   1982 C C   . GLY A 1 269 ? 9.148   78.360  43.048  1.00 30.21 ? 313  GLY A C   1 
ATOM   1983 O O   . GLY A 1 269 ? 9.613   77.902  41.965  1.00 29.99 ? 313  GLY A O   1 
ATOM   1984 N N   . GLN A 1 270 ? 9.905   78.947  43.984  1.00 31.05 ? 314  GLN A N   1 
ATOM   1985 C CA  . GLN A 1 270 ? 11.330  79.248  43.792  1.00 32.98 ? 314  GLN A CA  1 
ATOM   1986 C C   . GLN A 1 270 ? 12.185  78.006  43.733  1.00 33.39 ? 314  GLN A C   1 
ATOM   1987 O O   . GLN A 1 270 ? 13.231  77.992  43.050  1.00 35.07 ? 314  GLN A O   1 
ATOM   1988 C CB  . GLN A 1 270 ? 11.841  80.175  44.911  1.00 34.79 ? 314  GLN A CB  1 
ATOM   1989 C CG  . GLN A 1 270 ? 11.520  81.637  44.700  1.00 37.83 ? 314  GLN A CG  1 
ATOM   1990 C CD  . GLN A 1 270 ? 12.288  82.531  45.655  1.00 43.54 ? 314  GLN A CD  1 
ATOM   1991 O OE1 . GLN A 1 270 ? 12.113  82.460  46.883  1.00 46.36 ? 314  GLN A OE1 1 
ATOM   1992 N NE2 . GLN A 1 270 ? 13.144  83.382  45.099  1.00 44.51 ? 314  GLN A NE2 1 
ATOM   1993 N N   . GLU A 1 271 ? 11.746  76.942  44.399  1.00 33.27 ? 315  GLU A N   1 
ATOM   1994 C CA  . GLU A 1 271 ? 12.495  75.674  44.317  1.00 33.86 ? 315  GLU A CA  1 
ATOM   1995 C C   . GLU A 1 271 ? 12.157  74.766  43.127  1.00 33.12 ? 315  GLU A C   1 
ATOM   1996 O O   . GLU A 1 271 ? 12.807  73.730  42.970  1.00 34.83 ? 315  GLU A O   1 
ATOM   1997 C CB  . GLU A 1 271 ? 12.433  74.894  45.644  1.00 35.17 ? 315  GLU A CB  1 
ATOM   1998 C CG  . GLU A 1 271 ? 13.243  75.565  46.824  1.00 39.33 ? 315  GLU A CG  1 
ATOM   1999 C CD  . GLU A 1 271 ? 14.767  75.268  46.773  1.00 45.61 ? 315  GLU A CD  1 
ATOM   2000 O OE1 . GLU A 1 271 ? 15.260  74.587  45.821  1.00 48.05 ? 315  GLU A OE1 1 
ATOM   2001 O OE2 . GLU A 1 271 ? 15.472  75.701  47.715  1.00 48.20 ? 315  GLU A OE2 1 
ATOM   2002 N N   . GLN A 1 272 ? 11.185  75.149  42.291  1.00 31.33 ? 316  GLN A N   1 
ATOM   2003 C CA  . GLN A 1 272 ? 10.849  74.456  41.007  1.00 28.49 ? 316  GLN A CA  1 
ATOM   2004 C C   . GLN A 1 272 ? 11.393  75.182  39.777  1.00 28.49 ? 316  GLN A C   1 
ATOM   2005 O O   . GLN A 1 272 ? 11.943  76.291  39.857  1.00 27.18 ? 316  GLN A O   1 
ATOM   2006 C CB  . GLN A 1 272 ? 9.353   74.332  40.848  1.00 28.80 ? 316  GLN A CB  1 
ATOM   2007 C CG  . GLN A 1 272 ? 8.670   73.556  41.959  1.00 30.12 ? 316  GLN A CG  1 
ATOM   2008 C CD  . GLN A 1 272 ? 7.176   73.803  41.980  1.00 33.14 ? 316  GLN A CD  1 
ATOM   2009 O OE1 . GLN A 1 272 ? 6.694   74.719  42.681  1.00 33.82 ? 316  GLN A OE1 1 
ATOM   2010 N NE2 . GLN A 1 272 ? 6.429   73.040  41.166  1.00 27.49 ? 316  GLN A NE2 1 
ATOM   2011 N N   . PHE A 1 273 ? 11.299  74.517  38.625  1.00 26.32 ? 317  PHE A N   1 
ATOM   2012 C CA  . PHE A 1 273 ? 11.805  75.068  37.398  1.00 25.26 ? 317  PHE A CA  1 
ATOM   2013 C C   . PHE A 1 273 ? 10.904  74.586  36.247  1.00 23.63 ? 317  PHE A C   1 
ATOM   2014 O O   . PHE A 1 273 ? 10.129  73.632  36.415  1.00 20.96 ? 317  PHE A O   1 
ATOM   2015 C CB  . PHE A 1 273 ? 13.279  74.649  37.172  1.00 25.50 ? 317  PHE A CB  1 
ATOM   2016 C CG  . PHE A 1 273 ? 13.504  73.137  37.033  1.00 27.17 ? 317  PHE A CG  1 
ATOM   2017 C CD1 . PHE A 1 273 ? 13.507  72.523  35.782  1.00 31.03 ? 317  PHE A CD1 1 
ATOM   2018 C CD2 . PHE A 1 273 ? 13.703  72.336  38.153  1.00 27.20 ? 317  PHE A CD2 1 
ATOM   2019 C CE1 . PHE A 1 273 ? 13.687  71.136  35.643  1.00 28.41 ? 317  PHE A CE1 1 
ATOM   2020 C CE2 . PHE A 1 273 ? 13.916  70.972  38.036  1.00 27.95 ? 317  PHE A CE2 1 
ATOM   2021 C CZ  . PHE A 1 273 ? 13.900  70.362  36.765  1.00 27.25 ? 317  PHE A CZ  1 
ATOM   2022 N N   . TYR A 1 274 ? 11.005  75.272  35.119  1.00 22.54 ? 318  TYR A N   1 
ATOM   2023 C CA  . TYR A 1 274 ? 10.498  74.785  33.836  1.00 22.61 ? 318  TYR A CA  1 
ATOM   2024 C C   . TYR A 1 274 ? 11.714  74.506  32.991  1.00 23.58 ? 318  TYR A C   1 
ATOM   2025 O O   . TYR A 1 274 ? 12.743  75.162  33.158  1.00 24.37 ? 318  TYR A O   1 
ATOM   2026 C CB  . TYR A 1 274 ? 9.732   75.864  33.082  1.00 21.74 ? 318  TYR A CB  1 
ATOM   2027 C CG  . TYR A 1 274 ? 8.595   76.472  33.830  1.00 22.21 ? 318  TYR A CG  1 
ATOM   2028 C CD1 . TYR A 1 274 ? 7.348   75.855  33.844  1.00 18.93 ? 318  TYR A CD1 1 
ATOM   2029 C CD2 . TYR A 1 274 ? 8.761   77.662  34.553  1.00 21.92 ? 318  TYR A CD2 1 
ATOM   2030 C CE1 . TYR A 1 274 ? 6.275   76.424  34.565  1.00 20.91 ? 318  TYR A CE1 1 
ATOM   2031 C CE2 . TYR A 1 274 ? 7.679   78.239  35.222  1.00 21.81 ? 318  TYR A CE2 1 
ATOM   2032 C CZ  . TYR A 1 274 ? 6.456   77.602  35.219  1.00 19.49 ? 318  TYR A CZ  1 
ATOM   2033 O OH  . TYR A 1 274 ? 5.383   78.141  35.921  1.00 25.68 ? 318  TYR A OH  1 
ATOM   2034 N N   . SER A 1 275 ? 11.579  73.595  32.031  1.00 23.04 ? 319  SER A N   1 
ATOM   2035 C CA  . SER A 1 275 ? 12.676  73.349  31.055  1.00 23.75 ? 319  SER A CA  1 
ATOM   2036 C C   . SER A 1 275 ? 12.020  73.019  29.705  1.00 22.76 ? 319  SER A C   1 
ATOM   2037 O O   . SER A 1 275 ? 11.037  72.287  29.659  1.00 22.79 ? 319  SER A O   1 
ATOM   2038 C CB  . SER A 1 275 ? 13.484  72.149  31.495  1.00 22.93 ? 319  SER A CB  1 
ATOM   2039 O OG  . SER A 1 275 ? 14.506  71.879  30.531  1.00 28.55 ? 319  SER A OG  1 
ATOM   2040 N N   . ILE A 1 276 ? 12.498  73.640  28.661  1.00 21.35 ? 320  ILE A N   1 
ATOM   2041 C CA  . ILE A 1 276 ? 12.013  73.439  27.318  1.00 23.65 ? 320  ILE A CA  1 
ATOM   2042 C C   . ILE A 1 276 ? 12.848  72.265  26.904  1.00 24.17 ? 320  ILE A C   1 
ATOM   2043 O O   . ILE A 1 276 ? 14.023  72.413  26.618  1.00 24.54 ? 320  ILE A O   1 
ATOM   2044 C CB  . ILE A 1 276 ? 12.429  74.614  26.407  1.00 23.28 ? 320  ILE A CB  1 
ATOM   2045 C CG1 . ILE A 1 276 ? 11.882  75.936  26.898  1.00 28.78 ? 320  ILE A CG1 1 
ATOM   2046 C CG2 . ILE A 1 276 ? 12.024  74.404  24.914  1.00 27.83 ? 320  ILE A CG2 1 
ATOM   2047 C CD1 . ILE A 1 276 ? 10.500  75.891  27.158  1.00 32.65 ? 320  ILE A CD1 1 
ATOM   2048 N N   . LEU A 1 277 ? 12.242  71.098  26.913  1.00 23.60 ? 321  LEU A N   1 
ATOM   2049 C CA  . LEU A 1 277 ? 12.866  69.831  26.486  1.00 22.43 ? 321  LEU A CA  1 
ATOM   2050 C C   . LEU A 1 277 ? 13.202  69.795  25.044  1.00 23.61 ? 321  LEU A C   1 
ATOM   2051 O O   . LEU A 1 277 ? 14.253  69.250  24.650  1.00 24.36 ? 321  LEU A O   1 
ATOM   2052 C CB  . LEU A 1 277 ? 11.847  68.716  26.772  1.00 22.10 ? 321  LEU A CB  1 
ATOM   2053 C CG  . LEU A 1 277 ? 11.560  68.508  28.239  1.00 23.12 ? 321  LEU A CG  1 
ATOM   2054 C CD1 . LEU A 1 277 ? 10.505  67.461  28.400  1.00 26.87 ? 321  LEU A CD1 1 
ATOM   2055 C CD2 . LEU A 1 277 ? 12.772  68.102  29.007  1.00 30.34 ? 321  LEU A CD2 1 
ATOM   2056 N N   . ALA A 1 278 ? 12.264  70.292  24.206  1.00 23.76 ? 322  ALA A N   1 
ATOM   2057 C CA  . ALA A 1 278 ? 12.423  70.264  22.754  1.00 24.84 ? 322  ALA A CA  1 
ATOM   2058 C C   . ALA A 1 278 ? 11.441  71.191  22.138  1.00 23.75 ? 322  ALA A C   1 
ATOM   2059 O O   . ALA A 1 278 ? 10.312  71.363  22.627  1.00 24.07 ? 322  ALA A O   1 
ATOM   2060 C CB  . ALA A 1 278 ? 12.211  68.877  22.220  1.00 24.77 ? 322  ALA A CB  1 
ATOM   2061 N N   . ALA A 1 279 ? 11.852  71.816  21.052  1.00 25.53 ? 323  ALA A N   1 
ATOM   2062 C CA  . ALA A 1 279 ? 10.958  72.773  20.383  1.00 24.08 ? 323  ALA A CA  1 
ATOM   2063 C C   . ALA A 1 279 ? 11.309  72.855  18.915  1.00 26.13 ? 323  ALA A C   1 
ATOM   2064 O O   . ALA A 1 279 ? 12.535  72.787  18.491  1.00 25.26 ? 323  ALA A O   1 
ATOM   2065 C CB  . ALA A 1 279 ? 11.105  74.163  21.022  1.00 24.72 ? 323  ALA A CB  1 
ATOM   2066 N N   . ASN A 1 280 ? 10.243  72.962  18.122  1.00 26.96 ? 324  ASN A N   1 
ATOM   2067 C CA  . ASN A 1 280 ? 10.389  73.150  16.695  1.00 29.79 ? 324  ASN A CA  1 
ATOM   2068 C C   . ASN A 1 280 ? 9.413   74.178  16.181  1.00 31.35 ? 324  ASN A C   1 
ATOM   2069 O O   . ASN A 1 280 ? 8.934   75.026  16.949  1.00 31.25 ? 324  ASN A O   1 
ATOM   2070 C CB  . ASN A 1 280 ? 10.325  71.806  15.935  1.00 29.09 ? 324  ASN A CB  1 
ATOM   2071 C CG  . ASN A 1 280 ? 9.004   71.123  16.081  1.00 27.89 ? 324  ASN A CG  1 
ATOM   2072 O OD1 . ASN A 1 280 ? 7.975   71.727  16.377  1.00 26.79 ? 324  ASN A OD1 1 
ATOM   2073 N ND2 . ASN A 1 280 ? 9.014   69.838  15.851  1.00 29.37 ? 324  ASN A ND2 1 
ATOM   2074 N N   . ASP A 1 281 ? 9.128   74.130  14.886  1.00 32.88 ? 325  ASP A N   1 
ATOM   2075 C CA  . ASP A 1 281 ? 8.298   75.160  14.259  1.00 33.66 ? 325  ASP A CA  1 
ATOM   2076 C C   . ASP A 1 281 ? 6.857   74.920  14.559  1.00 32.01 ? 325  ASP A C   1 
ATOM   2077 O O   . ASP A 1 281 ? 6.020   75.736  14.293  1.00 31.00 ? 325  ASP A O   1 
ATOM   2078 C CB  . ASP A 1 281 ? 8.489   75.138  12.761  1.00 35.30 ? 325  ASP A CB  1 
ATOM   2079 C CG  . ASP A 1 281 ? 9.843   75.686  12.349  1.00 44.81 ? 325  ASP A CG  1 
ATOM   2080 O OD1 . ASP A 1 281 ? 10.095  76.901  12.620  1.00 57.22 ? 325  ASP A OD1 1 
ATOM   2081 O OD2 . ASP A 1 281 ? 10.651  74.931  11.741  1.00 51.98 ? 325  ASP A OD2 1 
ATOM   2082 N N   . ASP A 1 282 ? 6.562   73.758  15.080  1.00 30.27 ? 326  ASP A N   1 
ATOM   2083 C CA  . ASP A 1 282 ? 5.172   73.372  15.348  1.00 30.14 ? 326  ASP A CA  1 
ATOM   2084 C C   . ASP A 1 282 ? 4.741   73.531  16.815  1.00 28.21 ? 326  ASP A C   1 
ATOM   2085 O O   . ASP A 1 282 ? 3.639   73.957  17.078  1.00 28.55 ? 326  ASP A O   1 
ATOM   2086 C CB  . ASP A 1 282 ? 5.047   71.875  15.023  1.00 30.46 ? 326  ASP A CB  1 
ATOM   2087 C CG  . ASP A 1 282 ? 5.063   71.587  13.525  1.00 34.55 ? 326  ASP A CG  1 
ATOM   2088 O OD1 . ASP A 1 282 ? 4.476   72.387  12.745  1.00 36.39 ? 326  ASP A OD1 1 
ATOM   2089 O OD2 . ASP A 1 282 ? 5.639   70.528  13.154  1.00 41.29 ? 326  ASP A OD2 1 
ATOM   2090 N N   . MET A 1 283 ? 5.571   73.023  17.738  1.00 26.47 ? 327  MET A N   1 
ATOM   2091 C CA  . MET A 1 283 ? 5.185   72.871  19.128  1.00 25.09 ? 327  MET A CA  1 
ATOM   2092 C C   . MET A 1 283 ? 6.401   72.811  20.016  1.00 23.58 ? 327  MET A C   1 
ATOM   2093 O O   . MET A 1 283 ? 7.568   72.840  19.539  1.00 23.72 ? 327  MET A O   1 
ATOM   2094 C CB  . MET A 1 283 ? 4.339   71.597  19.319  1.00 24.42 ? 327  MET A CB  1 
ATOM   2095 C CG  . MET A 1 283 ? 5.004   70.283  18.759  1.00 26.89 ? 327  MET A CG  1 
ATOM   2096 S SD  . MET A 1 283 ? 6.213   69.576  19.890  1.00 35.73 ? 327  MET A SD  1 
ATOM   2097 C CE  . MET A 1 283 ? 5.125   68.728  21.082  1.00 29.36 ? 327  MET A CE  1 
ATOM   2098 N N   . VAL A 1 284 ? 6.138   72.754  21.308  1.00 23.56 ? 328  VAL A N   1 
ATOM   2099 C CA  . VAL A 1 284 ? 7.186   72.569  22.328  1.00 23.73 ? 328  VAL A CA  1 
ATOM   2100 C C   . VAL A 1 284 ? 6.814   71.484  23.314  1.00 22.34 ? 328  VAL A C   1 
ATOM   2101 O O   . VAL A 1 284 ? 5.619   71.327  23.613  1.00 21.90 ? 328  VAL A O   1 
ATOM   2102 C CB  . VAL A 1 284 ? 7.481   73.869  23.156  1.00 25.21 ? 328  VAL A CB  1 
ATOM   2103 C CG1 . VAL A 1 284 ? 7.705   75.079  22.238  1.00 28.54 ? 328  VAL A CG1 1 
ATOM   2104 C CG2 . VAL A 1 284 ? 6.375   74.186  24.093  1.00 27.05 ? 328  VAL A CG2 1 
ATOM   2105 N N   . PHE A 1 285 ? 7.824   70.761  23.839  1.00 21.99 ? 329  PHE A N   1 
ATOM   2106 C CA  . PHE A 1 285 ? 7.641   69.877  24.985  1.00 21.56 ? 329  PHE A CA  1 
ATOM   2107 C C   . PHE A 1 285 ? 8.179   70.677  26.172  1.00 22.24 ? 329  PHE A C   1 
ATOM   2108 O O   . PHE A 1 285 ? 9.273   71.167  26.070  1.00 20.38 ? 329  PHE A O   1 
ATOM   2109 C CB  . PHE A 1 285 ? 8.479   68.625  24.892  1.00 23.26 ? 329  PHE A CB  1 
ATOM   2110 C CG  . PHE A 1 285 ? 8.016   67.603  23.887  1.00 25.41 ? 329  PHE A CG  1 
ATOM   2111 C CD1 . PHE A 1 285 ? 7.472   66.381  24.337  1.00 29.30 ? 329  PHE A CD1 1 
ATOM   2112 C CD2 . PHE A 1 285 ? 8.244   67.775  22.531  1.00 29.28 ? 329  PHE A CD2 1 
ATOM   2113 C CE1 . PHE A 1 285 ? 7.119   65.352  23.422  1.00 29.50 ? 329  PHE A CE1 1 
ATOM   2114 C CE2 . PHE A 1 285 ? 7.840   66.768  21.579  1.00 27.05 ? 329  PHE A CE2 1 
ATOM   2115 C CZ  . PHE A 1 285 ? 7.296   65.571  22.038  1.00 28.59 ? 329  PHE A CZ  1 
ATOM   2116 N N   . MET A 1 286 ? 7.366   70.907  27.221  1.00 21.39 ? 330  MET A N   1 
ATOM   2117 C CA  . MET A 1 286 ? 7.793   71.679  28.408  1.00 21.36 ? 330  MET A CA  1 
ATOM   2118 C C   . MET A 1 286 ? 7.867   70.677  29.585  1.00 21.85 ? 330  MET A C   1 
ATOM   2119 O O   . MET A 1 286 ? 6.940   69.942  29.814  1.00 23.01 ? 330  MET A O   1 
ATOM   2120 C CB  . MET A 1 286 ? 6.720   72.752  28.732  1.00 22.26 ? 330  MET A CB  1 
ATOM   2121 C CG  . MET A 1 286 ? 7.123   73.781  29.842  1.00 22.05 ? 330  MET A CG  1 
ATOM   2122 S SD  . MET A 1 286 ? 8.538   74.827  29.285  1.00 32.49 ? 330  MET A SD  1 
ATOM   2123 C CE  . MET A 1 286 ? 7.759   75.989  28.126  1.00 24.52 ? 330  MET A CE  1 
ATOM   2124 N N   . HIS A 1 287 ? 8.898   70.717  30.408  1.00 21.12 ? 331  HIS A N   1 
ATOM   2125 C CA  . HIS A 1 287 ? 8.860   69.998  31.688  1.00 20.41 ? 331  HIS A CA  1 
ATOM   2126 C C   . HIS A 1 287 ? 8.597   71.025  32.785  1.00 21.49 ? 331  HIS A C   1 
ATOM   2127 O O   . HIS A 1 287 ? 9.203   72.103  32.780  1.00 23.02 ? 331  HIS A O   1 
ATOM   2128 C CB  . HIS A 1 287 ? 10.207  69.342  31.908  1.00 19.99 ? 331  HIS A CB  1 
ATOM   2129 C CG  . HIS A 1 287 ? 10.380  68.691  33.261  1.00 17.23 ? 331  HIS A CG  1 
ATOM   2130 N ND1 . HIS A 1 287 ? 10.214  67.337  33.456  1.00 20.07 ? 331  HIS A ND1 1 
ATOM   2131 C CD2 . HIS A 1 287 ? 10.854  69.179  34.432  1.00 18.49 ? 331  HIS A CD2 1 
ATOM   2132 C CE1 . HIS A 1 287 ? 10.486  67.032  34.723  1.00 18.66 ? 331  HIS A CE1 1 
ATOM   2133 N NE2 . HIS A 1 287 ? 10.884  68.130  35.335  1.00 19.69 ? 331  HIS A NE2 1 
ATOM   2134 N N   . VAL A 1 288 ? 7.702   70.699  33.705  1.00 21.16 ? 332  VAL A N   1 
ATOM   2135 C CA  . VAL A 1 288 ? 7.454   71.490  34.913  1.00 20.70 ? 332  VAL A CA  1 
ATOM   2136 C C   . VAL A 1 288 ? 7.761   70.553  36.079  1.00 22.73 ? 332  VAL A C   1 
ATOM   2137 O O   . VAL A 1 288 ? 7.078   69.513  36.278  1.00 20.23 ? 332  VAL A O   1 
ATOM   2138 C CB  . VAL A 1 288 ? 5.982   71.849  35.055  1.00 21.39 ? 332  VAL A CB  1 
ATOM   2139 C CG1 . VAL A 1 288 ? 5.753   72.723  36.304  1.00 20.52 ? 332  VAL A CG1 1 
ATOM   2140 C CG2 . VAL A 1 288 ? 5.409   72.486  33.761  1.00 24.28 ? 332  VAL A CG2 1 
ATOM   2141 N N   . ASP A 1 289 ? 8.750   70.961  36.880  1.00 23.54 ? 333  ASP A N   1 
ATOM   2142 C CA  . ASP A 1 289 ? 9.169   70.239  38.081  1.00 25.02 ? 333  ASP A CA  1 
ATOM   2143 C C   . ASP A 1 289 ? 7.999   70.173  39.085  1.00 26.43 ? 333  ASP A C   1 
ATOM   2144 O O   . ASP A 1 289 ? 7.256   71.153  39.284  1.00 24.67 ? 333  ASP A O   1 
ATOM   2145 C CB  . ASP A 1 289 ? 10.389  70.960  38.656  1.00 25.72 ? 333  ASP A CB  1 
ATOM   2146 C CG  . ASP A 1 289 ? 11.028  70.252  39.892  1.00 30.62 ? 333  ASP A CG  1 
ATOM   2147 O OD1 . ASP A 1 289 ? 11.156  68.985  39.937  1.00 31.10 ? 333  ASP A OD1 1 
ATOM   2148 O OD2 . ASP A 1 289 ? 11.482  71.003  40.813  1.00 34.41 ? 333  ASP A OD2 1 
ATOM   2149 N N   . GLU A 1 290 ? 7.847   69.014  39.721  1.00 29.33 ? 334  GLU A N   1 
ATOM   2150 C CA  . GLU A 1 290 ? 6.829   68.777  40.737  1.00 34.15 ? 334  GLU A CA  1 
ATOM   2151 C C   . GLU A 1 290 ? 7.211   69.490  42.057  1.00 35.88 ? 334  GLU A C   1 
ATOM   2152 O O   . GLU A 1 290 ? 8.401   69.630  42.390  1.00 34.46 ? 334  GLU A O   1 
ATOM   2153 C CB  . GLU A 1 290 ? 6.643   67.274  40.943  1.00 35.53 ? 334  GLU A CB  1 
ATOM   2154 C CG  . GLU A 1 290 ? 5.239   66.850  41.499  1.00 42.87 ? 334  GLU A CG  1 
ATOM   2155 C CD  . GLU A 1 290 ? 4.108   66.928  40.436  1.00 52.12 ? 334  GLU A CD  1 
ATOM   2156 O OE1 . GLU A 1 290 ? 3.563   68.040  40.186  1.00 53.60 ? 334  GLU A OE1 1 
ATOM   2157 O OE2 . GLU A 1 290 ? 3.749   65.865  39.852  1.00 56.98 ? 334  GLU A OE2 1 
ATOM   2158 N N   . PRO A 1 291 ? 6.197   70.010  42.784  1.00 38.23 ? 335  PRO A N   1 
ATOM   2159 C CA  . PRO A 1 291 ? 6.559   70.731  43.991  1.00 40.34 ? 335  PRO A CA  1 
ATOM   2160 C C   . PRO A 1 291 ? 7.144   69.799  45.046  1.00 42.61 ? 335  PRO A C   1 
ATOM   2161 O O   . PRO A 1 291 ? 6.621   68.689  45.235  1.00 43.06 ? 335  PRO A O   1 
ATOM   2162 C CB  . PRO A 1 291 ? 5.232   71.349  44.472  1.00 40.21 ? 335  PRO A CB  1 
ATOM   2163 C CG  . PRO A 1 291 ? 4.169   70.670  43.760  1.00 40.31 ? 335  PRO A CG  1 
ATOM   2164 C CD  . PRO A 1 291 ? 4.750   69.999  42.533  1.00 38.09 ? 335  PRO A CD  1 
ATOM   2165 N N   . GLY A 1 292 ? 8.237   70.243  45.678  1.00 44.40 ? 336  GLY A N   1 
ATOM   2166 C CA  . GLY A 1 292 ? 8.846   69.549  46.829  1.00 46.25 ? 336  GLY A CA  1 
ATOM   2167 C C   . GLY A 1 292 ? 10.060  68.712  46.458  1.00 47.46 ? 336  GLY A C   1 
ATOM   2168 O O   . GLY A 1 292 ? 10.361  67.704  47.115  1.00 47.57 ? 336  GLY A O   1 
ATOM   2169 N N   . ASP A 1 293 ? 10.769  69.167  45.420  1.00 48.04 ? 337  ASP A N   1 
ATOM   2170 C CA  . ASP A 1 293 ? 11.927  68.479  44.813  1.00 48.48 ? 337  ASP A CA  1 
ATOM   2171 C C   . ASP A 1 293 ? 12.048  66.955  45.065  1.00 47.24 ? 337  ASP A C   1 
ATOM   2172 O O   . ASP A 1 293 ? 12.821  66.466  45.898  1.00 48.06 ? 337  ASP A O   1 
ATOM   2173 C CB  . ASP A 1 293 ? 13.228  69.268  45.019  1.00 49.68 ? 337  ASP A CB  1 
ATOM   2174 C CG  . ASP A 1 293 ? 13.281  69.975  46.354  1.00 52.59 ? 337  ASP A CG  1 
ATOM   2175 O OD1 . ASP A 1 293 ? 12.650  69.480  47.316  1.00 55.57 ? 337  ASP A OD1 1 
ATOM   2176 O OD2 . ASP A 1 293 ? 13.985  71.019  46.449  1.00 57.62 ? 337  ASP A OD2 1 
ATOM   2177 N N   . THR A 1 294 ? 11.198  66.252  44.330  1.00 44.89 ? 338  THR A N   1 
ATOM   2178 C CA  . THR A 1 294 ? 11.099  64.818  44.261  1.00 42.28 ? 338  THR A CA  1 
ATOM   2179 C C   . THR A 1 294 ? 11.975  64.240  43.114  1.00 38.83 ? 338  THR A C   1 
ATOM   2180 O O   . THR A 1 294 ? 12.006  63.038  42.907  1.00 38.39 ? 338  THR A O   1 
ATOM   2181 C CB  . THR A 1 294 ? 9.652   64.494  43.981  1.00 42.52 ? 338  THR A CB  1 
ATOM   2182 O OG1 . THR A 1 294 ? 9.214   65.370  42.941  1.00 45.19 ? 338  THR A OG1 1 
ATOM   2183 C CG2 . THR A 1 294 ? 8.778   64.755  45.205  1.00 44.01 ? 338  THR A CG2 1 
ATOM   2184 N N   . GLY A 1 295 ? 12.684  65.101  42.387  1.00 35.70 ? 339  GLY A N   1 
ATOM   2185 C CA  . GLY A 1 295 ? 13.474  64.691  41.235  1.00 32.42 ? 339  GLY A CA  1 
ATOM   2186 C C   . GLY A 1 295 ? 12.683  64.287  39.985  1.00 30.82 ? 339  GLY A C   1 
ATOM   2187 O O   . GLY A 1 295 ? 13.219  63.627  39.078  1.00 30.19 ? 339  GLY A O   1 
ATOM   2188 N N   . PHE A 1 296 ? 11.404  64.639  39.944  1.00 27.99 ? 340  PHE A N   1 
ATOM   2189 C CA  . PHE A 1 296 ? 10.585  64.390  38.751  1.00 26.47 ? 340  PHE A CA  1 
ATOM   2190 C C   . PHE A 1 296 ? 9.570   65.530  38.496  1.00 25.56 ? 340  PHE A C   1 
ATOM   2191 O O   . PHE A 1 296 ? 9.353   66.394  39.352  1.00 24.50 ? 340  PHE A O   1 
ATOM   2192 C CB  . PHE A 1 296 ? 9.849   63.034  38.806  1.00 25.96 ? 340  PHE A CB  1 
ATOM   2193 C CG  . PHE A 1 296 ? 8.883   62.901  39.932  1.00 27.08 ? 340  PHE A CG  1 
ATOM   2194 C CD1 . PHE A 1 296 ? 7.629   63.455  39.863  1.00 26.55 ? 340  PHE A CD1 1 
ATOM   2195 C CD2 . PHE A 1 296 ? 9.244   62.200  41.082  1.00 29.52 ? 340  PHE A CD2 1 
ATOM   2196 C CE1 . PHE A 1 296 ? 6.762   63.327  40.857  1.00 28.98 ? 340  PHE A CE1 1 
ATOM   2197 C CE2 . PHE A 1 296 ? 8.368   62.060  42.114  1.00 31.12 ? 340  PHE A CE2 1 
ATOM   2198 C CZ  . PHE A 1 296 ? 7.126   62.633  42.022  1.00 30.57 ? 340  PHE A CZ  1 
ATOM   2199 N N   . GLY A 1 297 ? 8.943   65.516  37.325  1.00 23.61 ? 341  GLY A N   1 
ATOM   2200 C CA  . GLY A 1 297 ? 7.915   66.526  37.021  1.00 23.51 ? 341  GLY A CA  1 
ATOM   2201 C C   . GLY A 1 297 ? 6.984   65.957  35.974  1.00 23.18 ? 341  GLY A C   1 
ATOM   2202 O O   . GLY A 1 297 ? 6.770   64.710  35.877  1.00 25.06 ? 341  GLY A O   1 
ATOM   2203 N N   . THR A 1 298 ? 6.443   66.819  35.150  1.00 21.85 ? 342  THR A N   1 
ATOM   2204 C CA  . THR A 1 298 ? 5.456   66.343  34.190  1.00 22.53 ? 342  THR A CA  1 
ATOM   2205 C C   . THR A 1 298 ? 5.792   66.960  32.892  1.00 22.23 ? 342  THR A C   1 
ATOM   2206 O O   . THR A 1 298 ? 6.162   68.110  32.863  1.00 21.42 ? 342  THR A O   1 
ATOM   2207 C CB  . THR A 1 298 ? 4.064   66.816  34.575  1.00 26.17 ? 342  THR A CB  1 
ATOM   2208 O OG1 . THR A 1 298 ? 4.066   68.248  34.725  1.00 35.17 ? 342  THR A OG1 1 
ATOM   2209 C CG2 . THR A 1 298 ? 3.734   66.355  35.952  1.00 21.42 ? 342  THR A CG2 1 
ATOM   2210 N N   . ILE A 1 299 ? 5.614   66.209  31.804  1.00 21.94 ? 343  ILE A N   1 
ATOM   2211 C CA  . ILE A 1 299 ? 5.837   66.756  30.477  1.00 23.20 ? 343  ILE A CA  1 
ATOM   2212 C C   . ILE A 1 299 ? 4.520   67.193  29.937  1.00 23.67 ? 343  ILE A C   1 
ATOM   2213 O O   . ILE A 1 299 ? 3.522   66.455  30.060  1.00 22.89 ? 343  ILE A O   1 
ATOM   2214 C CB  . ILE A 1 299 ? 6.555   65.757  29.456  1.00 21.71 ? 343  ILE A CB  1 
ATOM   2215 C CG1 . ILE A 1 299 ? 7.887   65.318  30.017  1.00 21.43 ? 343  ILE A CG1 1 
ATOM   2216 C CG2 . ILE A 1 299 ? 6.724   66.441  28.062  1.00 22.63 ? 343  ILE A CG2 1 
ATOM   2217 C CD1 . ILE A 1 299 ? 8.766   64.277  29.043  1.00 22.40 ? 343  ILE A CD1 1 
ATOM   2218 N N   . PHE A 1 300 ? 4.523   68.392  29.350  1.00 23.16 ? 344  PHE A N   1 
ATOM   2219 C CA  . PHE A 1 300 ? 3.356   68.977  28.687  1.00 24.79 ? 344  PHE A CA  1 
ATOM   2220 C C   . PHE A 1 300 ? 3.734   69.259  27.260  1.00 25.07 ? 344  PHE A C   1 
ATOM   2221 O O   . PHE A 1 300 ? 4.875   69.661  27.000  1.00 26.59 ? 344  PHE A O   1 
ATOM   2222 C CB  . PHE A 1 300 ? 2.960   70.324  29.318  1.00 24.73 ? 344  PHE A CB  1 
ATOM   2223 C CG  . PHE A 1 300 ? 2.432   70.227  30.715  1.00 25.13 ? 344  PHE A CG  1 
ATOM   2224 C CD1 . PHE A 1 300 ? 1.065   70.119  30.965  1.00 26.36 ? 344  PHE A CD1 1 
ATOM   2225 C CD2 . PHE A 1 300 ? 3.302   70.263  31.810  1.00 25.04 ? 344  PHE A CD2 1 
ATOM   2226 C CE1 . PHE A 1 300 ? 0.587   70.034  32.274  1.00 28.42 ? 344  PHE A CE1 1 
ATOM   2227 C CE2 . PHE A 1 300 ? 2.840   70.184  33.101  1.00 29.02 ? 344  PHE A CE2 1 
ATOM   2228 C CZ  . PHE A 1 300 ? 1.477   70.061  33.365  1.00 26.57 ? 344  PHE A CZ  1 
ATOM   2229 N N   . THR A 1 301 ? 2.794   69.103  26.315  1.00 24.53 ? 345  THR A N   1 
ATOM   2230 C CA  . THR A 1 301 ? 3.062   69.511  24.956  1.00 23.30 ? 345  THR A CA  1 
ATOM   2231 C C   . THR A 1 301 ? 2.148   70.662  24.574  1.00 23.41 ? 345  THR A C   1 
ATOM   2232 O O   . THR A 1 301 ? 0.980   70.655  24.988  1.00 21.62 ? 345  THR A O   1 
ATOM   2233 C CB  . THR A 1 301 ? 2.822   68.354  23.977  1.00 24.91 ? 345  THR A CB  1 
ATOM   2234 O OG1 . THR A 1 301 ? 1.553   67.758  24.254  1.00 27.27 ? 345  THR A OG1 1 
ATOM   2235 C CG2 . THR A 1 301 ? 3.848   67.254  24.191  1.00 22.61 ? 345  THR A CG2 1 
ATOM   2236 N N   . SER A 1 302 ? 2.659   71.641  23.825  1.00 22.59 ? 346  SER A N   1 
ATOM   2237 C CA  . SER A 1 302 ? 1.871   72.841  23.490  1.00 24.97 ? 346  SER A CA  1 
ATOM   2238 C C   . SER A 1 302 ? 1.168   72.554  22.201  1.00 25.80 ? 346  SER A C   1 
ATOM   2239 O O   . SER A 1 302 ? 1.642   71.740  21.427  1.00 25.57 ? 346  SER A O   1 
ATOM   2240 C CB  . SER A 1 302 ? 2.778   74.035  23.194  1.00 24.73 ? 346  SER A CB  1 
ATOM   2241 O OG  . SER A 1 302 ? 3.457   73.867  21.960  1.00 24.96 ? 346  SER A OG  1 
ATOM   2242 N N   . ASP A 1 303 ? 0.081   73.262  21.969  1.00 26.81 ? 347  ASP A N   1 
ATOM   2243 C CA  . ASP A 1 303 ? -0.484  73.466  20.651  1.00 28.14 ? 347  ASP A CA  1 
ATOM   2244 C C   . ASP A 1 303 ? 0.454   74.320  19.787  1.00 29.08 ? 347  ASP A C   1 
ATOM   2245 O O   . ASP A 1 303 ? 1.609   74.575  20.160  1.00 28.46 ? 347  ASP A O   1 
ATOM   2246 C CB  . ASP A 1 303 ? -1.884  74.087  20.788  1.00 28.83 ? 347  ASP A CB  1 
ATOM   2247 C CG  . ASP A 1 303 ? -1.852  75.534  21.237  1.00 31.90 ? 347  ASP A CG  1 
ATOM   2248 O OD1 . ASP A 1 303 ? -0.771  76.065  21.567  1.00 32.57 ? 347  ASP A OD1 1 
ATOM   2249 O OD2 . ASP A 1 303 ? -2.921  76.142  21.214  1.00 33.18 ? 347  ASP A OD2 1 
ATOM   2250 N N   . ASP A 1 304 ? -0.020  74.738  18.619  1.00 29.97 ? 348  ASP A N   1 
ATOM   2251 C CA  . ASP A 1 304 ? 0.859   75.430  17.683  1.00 31.58 ? 348  ASP A CA  1 
ATOM   2252 C C   . ASP A 1 304 ? 1.029   76.931  18.001  1.00 30.99 ? 348  ASP A C   1 
ATOM   2253 O O   . ASP A 1 304 ? 1.851   77.645  17.410  1.00 31.17 ? 348  ASP A O   1 
ATOM   2254 C CB  . ASP A 1 304 ? 0.383   75.199  16.259  1.00 33.76 ? 348  ASP A CB  1 
ATOM   2255 C CG  . ASP A 1 304 ? -0.922  75.869  15.975  1.00 39.18 ? 348  ASP A CG  1 
ATOM   2256 O OD1 . ASP A 1 304 ? -1.837  75.798  16.816  1.00 41.38 ? 348  ASP A OD1 1 
ATOM   2257 O OD2 . ASP A 1 304 ? -1.047  76.466  14.881  1.00 48.85 ? 348  ASP A OD2 1 
ATOM   2258 N N   . ARG A 1 305 ? 0.276   77.389  18.985  1.00 28.97 ? 349  ARG A N   1 
ATOM   2259 C CA  . ARG A 1 305 ? 0.388   78.756  19.474  1.00 29.29 ? 349  ARG A CA  1 
ATOM   2260 C C   . ARG A 1 305 ? 1.351   78.836  20.655  1.00 28.57 ? 349  ARG A C   1 
ATOM   2261 O O   . ARG A 1 305 ? 1.768   79.927  21.065  1.00 29.52 ? 349  ARG A O   1 
ATOM   2262 C CB  . ARG A 1 305 ? -0.994  79.249  19.874  1.00 27.93 ? 349  ARG A CB  1 
ATOM   2263 C CG  . ARG A 1 305 ? -1.921  79.507  18.678  1.00 30.30 ? 349  ARG A CG  1 
ATOM   2264 C CD  . ARG A 1 305 ? -3.403  79.759  19.113  1.00 29.81 ? 349  ARG A CD  1 
ATOM   2265 N NE  . ARG A 1 305 ? -3.866  78.655  19.956  1.00 30.80 ? 349  ARG A NE  1 
ATOM   2266 C CZ  . ARG A 1 305 ? -5.075  78.544  20.485  1.00 34.25 ? 349  ARG A CZ  1 
ATOM   2267 N NH1 . ARG A 1 305 ? -6.010  79.490  20.264  1.00 36.38 ? 349  ARG A NH1 1 
ATOM   2268 N NH2 . ARG A 1 305 ? -5.357  77.485  21.233  1.00 31.34 ? 349  ARG A NH2 1 
ATOM   2269 N N   . GLY A 1 306 ? 1.730   77.685  21.189  1.00 26.92 ? 350  GLY A N   1 
ATOM   2270 C CA  . GLY A 1 306 ? 2.573   77.650  22.362  1.00 26.79 ? 350  GLY A CA  1 
ATOM   2271 C C   . GLY A 1 306 ? 1.826   78.064  23.628  1.00 26.91 ? 350  GLY A C   1 
ATOM   2272 O O   . GLY A 1 306 ? 2.475   78.333  24.669  1.00 26.83 ? 350  GLY A O   1 
ATOM   2273 N N   . ILE A 1 307 ? 0.496   78.033  23.574  1.00 25.96 ? 351  ILE A N   1 
ATOM   2274 C CA  . ILE A 1 307 ? -0.354  78.573  24.672  1.00 26.31 ? 351  ILE A CA  1 
ATOM   2275 C C   . ILE A 1 307 ? -1.188  77.527  25.428  1.00 25.75 ? 351  ILE A C   1 
ATOM   2276 O O   . ILE A 1 307 ? -1.318  77.613  26.642  1.00 26.76 ? 351  ILE A O   1 
ATOM   2277 C CB  . ILE A 1 307 ? -1.255  79.644  24.150  1.00 26.73 ? 351  ILE A CB  1 
ATOM   2278 C CG1 . ILE A 1 307 ? -0.406  80.862  23.748  1.00 30.37 ? 351  ILE A CG1 1 
ATOM   2279 C CG2 . ILE A 1 307 ? -2.234  80.129  25.212  1.00 27.51 ? 351  ILE A CG2 1 
ATOM   2280 C CD1 . ILE A 1 307 ? -1.107  81.778  22.759  1.00 32.55 ? 351  ILE A CD1 1 
ATOM   2281 N N   . VAL A 1 308 ? -1.712  76.526  24.742  1.00 24.11 ? 352  VAL A N   1 
ATOM   2282 C CA  . VAL A 1 308 ? -2.568  75.537  25.389  1.00 23.26 ? 352  VAL A CA  1 
ATOM   2283 C C   . VAL A 1 308 ? -1.758  74.267  25.487  1.00 24.31 ? 352  VAL A C   1 
ATOM   2284 O O   . VAL A 1 308 ? -1.206  73.854  24.529  1.00 24.74 ? 352  VAL A O   1 
ATOM   2285 C CB  . VAL A 1 308 ? -3.900  75.333  24.607  1.00 23.55 ? 352  VAL A CB  1 
ATOM   2286 C CG1 . VAL A 1 308 ? -4.713  74.191  25.193  1.00 22.40 ? 352  VAL A CG1 1 
ATOM   2287 C CG2 . VAL A 1 308 ? -4.739  76.652  24.675  1.00 23.74 ? 352  VAL A CG2 1 
ATOM   2288 N N   . TYR A 1 309 ? -1.670  73.670  26.660  1.00 25.08 ? 353  TYR A N   1 
ATOM   2289 C CA  . TYR A 1 309 ? -0.754  72.573  26.918  1.00 24.78 ? 353  TYR A CA  1 
ATOM   2290 C C   . TYR A 1 309 ? -1.501  71.360  27.359  1.00 26.10 ? 353  TYR A C   1 
ATOM   2291 O O   . TYR A 1 309 ? -2.487  71.445  28.092  1.00 26.29 ? 353  TYR A O   1 
ATOM   2292 C CB  . TYR A 1 309 ? 0.236   72.985  28.000  1.00 24.99 ? 353  TYR A CB  1 
ATOM   2293 C CG  . TYR A 1 309 ? 1.294   73.914  27.438  1.00 22.66 ? 353  TYR A CG  1 
ATOM   2294 C CD1 . TYR A 1 309 ? 2.510   73.429  27.031  1.00 19.48 ? 353  TYR A CD1 1 
ATOM   2295 C CD2 . TYR A 1 309 ? 1.049   75.247  27.273  1.00 22.82 ? 353  TYR A CD2 1 
ATOM   2296 C CE1 . TYR A 1 309 ? 3.479   74.277  26.518  1.00 21.65 ? 353  TYR A CE1 1 
ATOM   2297 C CE2 . TYR A 1 309 ? 2.017   76.104  26.741  1.00 21.49 ? 353  TYR A CE2 1 
ATOM   2298 C CZ  . TYR A 1 309 ? 3.194   75.595  26.348  1.00 23.96 ? 353  TYR A CZ  1 
ATOM   2299 O OH  . TYR A 1 309 ? 4.118   76.454  25.781  1.00 28.15 ? 353  TYR A OH  1 
ATOM   2300 N N   . SER A 1 310 ? -1.043  70.219  26.894  1.00 25.55 ? 354  SER A N   1 
ATOM   2301 C CA  . SER A 1 310 ? -1.676  68.978  27.237  1.00 27.17 ? 354  SER A CA  1 
ATOM   2302 C C   . SER A 1 310 ? -0.676  68.214  28.092  1.00 25.63 ? 354  SER A C   1 
ATOM   2303 O O   . SER A 1 310 ? 0.502   68.184  27.739  1.00 24.59 ? 354  SER A O   1 
ATOM   2304 C CB  . SER A 1 310 ? -2.001  68.211  25.923  1.00 28.11 ? 354  SER A CB  1 
ATOM   2305 O OG  . SER A 1 310 ? -2.530  66.938  26.246  1.00 35.49 ? 354  SER A OG  1 
ATOM   2306 N N   . LYS A 1 311 ? -1.146  67.542  29.150  1.00 24.16 ? 355  LYS A N   1 
ATOM   2307 C CA  . LYS A 1 311 ? -0.265  66.742  29.955  1.00 23.94 ? 355  LYS A CA  1 
ATOM   2308 C C   . LYS A 1 311 ? 0.039   65.500  29.137  1.00 23.19 ? 355  LYS A C   1 
ATOM   2309 O O   . LYS A 1 311 ? -0.877  64.774  28.716  1.00 22.08 ? 355  LYS A O   1 
ATOM   2310 C CB  . LYS A 1 311 ? -0.889  66.329  31.251  1.00 25.91 ? 355  LYS A CB  1 
ATOM   2311 C CG  . LYS A 1 311 ? 0.102   65.548  32.132  1.00 28.63 ? 355  LYS A CG  1 
ATOM   2312 C CD  . LYS A 1 311 ? -0.588  64.756  33.222  1.00 41.12 ? 355  LYS A CD  1 
ATOM   2313 C CE  . LYS A 1 311 ? -1.626  65.580  33.996  1.00 42.58 ? 355  LYS A CE  1 
ATOM   2314 N NZ  . LYS A 1 311 ? -2.503  64.682  34.860  1.00 50.23 ? 355  LYS A NZ  1 
ATOM   2315 N N   . SER A 1 312 ? 1.318   65.265  28.894  1.00 19.88 ? 356  SER A N   1 
ATOM   2316 C CA  . SER A 1 312 ? 1.779   64.157  28.081  1.00 19.15 ? 356  SER A CA  1 
ATOM   2317 C C   . SER A 1 312 ? 2.318   62.986  28.945  1.00 21.63 ? 356  SER A C   1 
ATOM   2318 O O   . SER A 1 312 ? 2.123   61.801  28.604  1.00 22.32 ? 356  SER A O   1 
ATOM   2319 C CB  . SER A 1 312 ? 2.949   64.680  27.213  1.00 18.23 ? 356  SER A CB  1 
ATOM   2320 O OG  . SER A 1 312 ? 3.308   63.738  26.192  1.00 21.15 ? 356  SER A OG  1 
ATOM   2321 N N   . LEU A 1 313 ? 3.098   63.286  29.995  1.00 20.85 ? 357  LEU A N   1 
ATOM   2322 C CA  . LEU A 1 313 ? 3.804   62.217  30.716  1.00 21.02 ? 357  LEU A CA  1 
ATOM   2323 C C   . LEU A 1 313 ? 4.030   62.651  32.150  1.00 21.16 ? 357  LEU A C   1 
ATOM   2324 O O   . LEU A 1 313 ? 4.708   63.635  32.390  1.00 20.99 ? 357  LEU A O   1 
ATOM   2325 C CB  . LEU A 1 313 ? 5.198   61.911  30.033  1.00 21.05 ? 357  LEU A CB  1 
ATOM   2326 C CG  . LEU A 1 313 ? 5.951   60.677  30.573  1.00 21.57 ? 357  LEU A CG  1 
ATOM   2327 C CD1 . LEU A 1 313 ? 5.103   59.335  30.513  1.00 23.24 ? 357  LEU A CD1 1 
ATOM   2328 C CD2 . LEU A 1 313 ? 7.289   60.491  29.828  1.00 19.59 ? 357  LEU A CD2 1 
ATOM   2329 N N   . ASP A 1 314 ? 3.503   61.894  33.094  1.00 22.84 ? 358  ASP A N   1 
ATOM   2330 C CA  . ASP A 1 314 ? 3.701   62.182  34.527  1.00 25.48 ? 358  ASP A CA  1 
ATOM   2331 C C   . ASP A 1 314 ? 4.923   61.414  35.043  1.00 24.20 ? 358  ASP A C   1 
ATOM   2332 O O   . ASP A 1 314 ? 5.305   60.404  34.461  1.00 23.53 ? 358  ASP A O   1 
ATOM   2333 C CB  . ASP A 1 314 ? 2.492   61.732  35.317  1.00 28.12 ? 358  ASP A CB  1 
ATOM   2334 C CG  . ASP A 1 314 ? 1.466   62.816  35.477  1.00 36.19 ? 358  ASP A CG  1 
ATOM   2335 O OD1 . ASP A 1 314 ? 1.741   63.781  36.252  1.00 45.29 ? 358  ASP A OD1 1 
ATOM   2336 O OD2 . ASP A 1 314 ? 0.367   62.676  34.854  1.00 44.30 ? 358  ASP A OD2 1 
ATOM   2337 N N   . ARG A 1 315 ? 5.525   61.945  36.109  1.00 22.31 ? 359  ARG A N   1 
ATOM   2338 C CA  . ARG A 1 315 ? 6.639   61.374  36.877  1.00 21.68 ? 359  ARG A CA  1 
ATOM   2339 C C   . ARG A 1 315 ? 7.830   61.252  35.954  1.00 21.15 ? 359  ARG A C   1 
ATOM   2340 O O   . ARG A 1 315 ? 8.581   60.279  36.007  1.00 21.76 ? 359  ARG A O   1 
ATOM   2341 C CB  . ARG A 1 315 ? 6.275   60.072  37.601  1.00 20.54 ? 359  ARG A CB  1 
ATOM   2342 C CG  . ARG A 1 315 ? 5.164   60.199  38.605  1.00 24.06 ? 359  ARG A CG  1 
ATOM   2343 C CD  . ARG A 1 315 ? 4.810   58.842  39.263  1.00 22.93 ? 359  ARG A CD  1 
ATOM   2344 N NE  . ARG A 1 315 ? 5.904   58.186  40.000  1.00 21.80 ? 359  ARG A NE  1 
ATOM   2345 C CZ  . ARG A 1 315 ? 6.214   58.430  41.263  1.00 24.66 ? 359  ARG A CZ  1 
ATOM   2346 N NH1 . ARG A 1 315 ? 5.529   59.324  41.984  1.00 30.56 ? 359  ARG A NH1 1 
ATOM   2347 N NH2 . ARG A 1 315 ? 7.170   57.749  41.845  1.00 23.87 ? 359  ARG A NH2 1 
ATOM   2348 N N   . HIS A 1 316 ? 8.013   62.279  35.113  1.00 18.80 ? 360  HIS A N   1 
ATOM   2349 C CA  . HIS A 1 316 ? 9.128   62.322  34.217  1.00 20.44 ? 360  HIS A CA  1 
ATOM   2350 C C   . HIS A 1 316 ? 10.416  62.647  35.010  1.00 21.89 ? 360  HIS A C   1 
ATOM   2351 O O   . HIS A 1 316 ? 10.444  63.641  35.729  1.00 22.60 ? 360  HIS A O   1 
ATOM   2352 C CB  . HIS A 1 316 ? 8.889   63.426  33.179  1.00 18.73 ? 360  HIS A CB  1 
ATOM   2353 C CG  . HIS A 1 316 ? 10.049  63.607  32.248  1.00 19.19 ? 360  HIS A CG  1 
ATOM   2354 N ND1 . HIS A 1 316 ? 10.589  64.836  31.944  1.00 18.44 ? 360  HIS A ND1 1 
ATOM   2355 C CD2 . HIS A 1 316 ? 10.802  62.691  31.606  1.00 19.48 ? 360  HIS A CD2 1 
ATOM   2356 C CE1 . HIS A 1 316 ? 11.595  64.678  31.106  1.00 25.52 ? 360  HIS A CE1 1 
ATOM   2357 N NE2 . HIS A 1 316 ? 11.742  63.384  30.876  1.00 23.05 ? 360  HIS A NE2 1 
ATOM   2358 N N   . LEU A 1 317 ? 11.488  61.854  34.857  1.00 23.16 ? 361  LEU A N   1 
ATOM   2359 C CA  . LEU A 1 317 ? 12.655  61.946  35.733  1.00 24.57 ? 361  LEU A CA  1 
ATOM   2360 C C   . LEU A 1 317 ? 13.452  63.178  35.264  1.00 25.05 ? 361  LEU A C   1 
ATOM   2361 O O   . LEU A 1 317 ? 13.770  63.296  34.079  1.00 23.87 ? 361  LEU A O   1 
ATOM   2362 C CB  . LEU A 1 317 ? 13.538  60.693  35.554  1.00 25.21 ? 361  LEU A CB  1 
ATOM   2363 C CG  . LEU A 1 317 ? 14.896  60.699  36.286  1.00 30.91 ? 361  LEU A CG  1 
ATOM   2364 C CD1 . LEU A 1 317 ? 15.242  59.359  36.894  1.00 32.76 ? 361  LEU A CD1 1 
ATOM   2365 C CD2 . LEU A 1 317 ? 16.084  61.205  35.412  1.00 35.60 ? 361  LEU A CD2 1 
ATOM   2366 N N   . TYR A 1 318 ? 13.767  64.096  36.167  1.00 25.78 ? 362  TYR A N   1 
ATOM   2367 C CA  . TYR A 1 318 ? 14.613  65.251  35.795  1.00 26.30 ? 362  TYR A CA  1 
ATOM   2368 C C   . TYR A 1 318 ? 15.157  65.742  37.144  1.00 28.39 ? 362  TYR A C   1 
ATOM   2369 O O   . TYR A 1 318 ? 14.379  66.241  37.992  1.00 27.56 ? 362  TYR A O   1 
ATOM   2370 C CB  . TYR A 1 318 ? 13.773  66.367  35.175  1.00 25.72 ? 362  TYR A CB  1 
ATOM   2371 C CG  . TYR A 1 318 ? 14.541  67.402  34.317  1.00 25.01 ? 362  TYR A CG  1 
ATOM   2372 C CD1 . TYR A 1 318 ? 13.990  67.880  33.123  1.00 25.61 ? 362  TYR A CD1 1 
ATOM   2373 C CD2 . TYR A 1 318 ? 15.750  67.904  34.703  1.00 25.00 ? 362  TYR A CD2 1 
ATOM   2374 C CE1 . TYR A 1 318 ? 14.630  68.832  32.339  1.00 25.42 ? 362  TYR A CE1 1 
ATOM   2375 C CE2 . TYR A 1 318 ? 16.457  68.829  33.878  1.00 28.53 ? 362  TYR A CE2 1 
ATOM   2376 C CZ  . TYR A 1 318 ? 15.873  69.283  32.717  1.00 29.21 ? 362  TYR A CZ  1 
ATOM   2377 O OH  . TYR A 1 318 ? 16.505  70.204  31.926  1.00 32.61 ? 362  TYR A OH  1 
ATOM   2378 N N   . THR A 1 319 ? 16.459  65.596  37.352  1.00 31.32 ? 363  THR A N   1 
ATOM   2379 C CA  . THR A 1 319 ? 16.993  65.739  38.704  1.00 35.71 ? 363  THR A CA  1 
ATOM   2380 C C   . THR A 1 319 ? 17.291  67.210  39.031  1.00 39.23 ? 363  THR A C   1 
ATOM   2381 O O   . THR A 1 319 ? 17.814  67.934  38.182  1.00 39.92 ? 363  THR A O   1 
ATOM   2382 C CB  . THR A 1 319 ? 18.301  65.002  38.876  1.00 35.62 ? 363  THR A CB  1 
ATOM   2383 O OG1 . THR A 1 319 ? 19.303  65.648  38.078  1.00 35.16 ? 363  THR A OG1 1 
ATOM   2384 C CG2 . THR A 1 319 ? 18.182  63.504  38.501  1.00 36.66 ? 363  THR A CG2 1 
ATOM   2385 N N   . THR A 1 320 ? 17.022  67.611  40.273  1.00 44.12 ? 364  THR A N   1 
ATOM   2386 C CA  . THR A 1 320 ? 17.404  68.949  40.764  1.00 48.45 ? 364  THR A CA  1 
ATOM   2387 C C   . THR A 1 320 ? 18.926  69.119  40.890  1.00 50.71 ? 364  THR A C   1 
ATOM   2388 O O   . THR A 1 320 ? 19.435  70.222  40.687  1.00 51.93 ? 364  THR A O   1 
ATOM   2389 C CB  . THR A 1 320 ? 16.733  69.311  42.111  1.00 49.12 ? 364  THR A CB  1 
ATOM   2390 O OG1 . THR A 1 320 ? 17.550  70.261  42.820  1.00 52.08 ? 364  THR A OG1 1 
ATOM   2391 C CG2 . THR A 1 320 ? 16.547  68.092  43.014  1.00 49.72 ? 364  THR A CG2 1 
ATOM   2392 N N   . THR A 1 321 ? 19.639  68.033  41.231  1.00 53.08 ? 365  THR A N   1 
ATOM   2393 C CA  . THR A 1 321 ? 21.127  68.012  41.281  1.00 54.50 ? 365  THR A CA  1 
ATOM   2394 C C   . THR A 1 321 ? 21.808  67.907  39.908  1.00 54.57 ? 365  THR A C   1 
ATOM   2395 O O   . THR A 1 321 ? 21.998  66.802  39.352  1.00 55.63 ? 365  THR A O   1 
ATOM   2396 C CB  . THR A 1 321 ? 21.657  66.899  42.217  1.00 54.86 ? 365  THR A CB  1 
ATOM   2397 O OG1 . THR A 1 321 ? 21.337  67.241  43.577  1.00 56.63 ? 365  THR A OG1 1 
ATOM   2398 C CG2 . THR A 1 321 ? 23.197  66.716  42.069  1.00 55.52 ? 365  THR A CG2 1 
ATOM   2399 N N   . GLY A 1 322 ? 22.192  69.058  39.361  1.00 53.97 ? 366  GLY A N   1 
ATOM   2400 C CA  . GLY A 1 322 ? 22.805  69.063  38.034  1.00 52.52 ? 366  GLY A CA  1 
ATOM   2401 C C   . GLY A 1 322 ? 21.809  69.154  36.884  1.00 51.17 ? 366  GLY A C   1 
ATOM   2402 O O   . GLY A 1 322 ? 22.150  69.654  35.810  1.00 52.28 ? 366  GLY A O   1 
ATOM   2403 N N   . GLY A 1 323 ? 20.570  68.697  37.099  1.00 48.82 ? 367  GLY A N   1 
ATOM   2404 C CA  . GLY A 1 323 ? 19.539  68.820  36.070  1.00 45.10 ? 367  GLY A CA  1 
ATOM   2405 C C   . GLY A 1 323 ? 19.823  67.794  34.993  1.00 42.50 ? 367  GLY A C   1 
ATOM   2406 O O   . GLY A 1 323 ? 20.173  68.150  33.881  1.00 43.40 ? 367  GLY A O   1 
ATOM   2407 N N   . GLU A 1 324 ? 19.725  66.519  35.348  1.00 38.95 ? 368  GLU A N   1 
ATOM   2408 C CA  . GLU A 1 324 ? 19.944  65.445  34.386  1.00 37.02 ? 368  GLU A CA  1 
ATOM   2409 C C   . GLU A 1 324 ? 18.591  64.939  34.009  1.00 33.10 ? 368  GLU A C   1 
ATOM   2410 O O   . GLU A 1 324 ? 17.756  64.749  34.888  1.00 31.24 ? 368  GLU A O   1 
ATOM   2411 C CB  . GLU A 1 324 ? 20.747  64.291  35.020  1.00 37.13 ? 368  GLU A CB  1 
ATOM   2412 C CG  . GLU A 1 324 ? 22.247  64.605  35.212  1.00 45.61 ? 368  GLU A CG  1 
ATOM   2413 C CD  . GLU A 1 324 ? 22.968  64.968  33.882  1.00 52.68 ? 368  GLU A CD  1 
ATOM   2414 O OE1 . GLU A 1 324 ? 22.354  64.824  32.787  1.00 56.21 ? 368  GLU A OE1 1 
ATOM   2415 O OE2 . GLU A 1 324 ? 24.153  65.395  33.924  1.00 55.80 ? 368  GLU A OE2 1 
ATOM   2416 N N   . THR A 1 325 ? 18.362  64.713  32.716  1.00 31.39 ? 369  THR A N   1 
ATOM   2417 C CA  . THR A 1 325 ? 17.102  64.109  32.259  1.00 28.32 ? 369  THR A CA  1 
ATOM   2418 C C   . THR A 1 325 ? 17.406  63.115  31.125  1.00 27.93 ? 369  THR A C   1 
ATOM   2419 O O   . THR A 1 325 ? 18.435  63.257  30.424  1.00 27.34 ? 369  THR A O   1 
ATOM   2420 C CB  . THR A 1 325 ? 16.034  65.148  31.780  1.00 29.37 ? 369  THR A CB  1 
ATOM   2421 O OG1 . THR A 1 325 ? 14.899  64.452  31.301  1.00 27.32 ? 369  THR A OG1 1 
ATOM   2422 C CG2 . THR A 1 325 ? 16.511  65.966  30.565  1.00 26.74 ? 369  THR A CG2 1 
ATOM   2423 N N   . ASP A 1 326 ? 16.553  62.103  30.951  1.00 23.71 ? 370  ASP A N   1 
ATOM   2424 C CA  . ASP A 1 326 ? 16.840  61.109  29.871  1.00 25.74 ? 370  ASP A CA  1 
ATOM   2425 C C   . ASP A 1 326 ? 16.067  61.447  28.611  1.00 23.77 ? 370  ASP A C   1 
ATOM   2426 O O   . ASP A 1 326 ? 16.081  60.674  27.636  1.00 24.04 ? 370  ASP A O   1 
ATOM   2427 C CB  . ASP A 1 326 ? 16.551  59.663  30.329  1.00 25.93 ? 370  ASP A CB  1 
ATOM   2428 C CG  . ASP A 1 326 ? 17.612  59.147  31.347  1.00 32.60 ? 370  ASP A CG  1 
ATOM   2429 O OD1 . ASP A 1 326 ? 18.740  59.722  31.414  1.00 39.88 ? 370  ASP A OD1 1 
ATOM   2430 O OD2 . ASP A 1 326 ? 17.378  58.128  32.055  1.00 38.63 ? 370  ASP A OD2 1 
ATOM   2431 N N   . PHE A 1 327 ? 15.412  62.602  28.591  1.00 23.78 ? 371  PHE A N   1 
ATOM   2432 C CA  . PHE A 1 327 ? 14.644  62.982  27.394  1.00 24.64 ? 371  PHE A CA  1 
ATOM   2433 C C   . PHE A 1 327 ? 15.477  63.053  26.125  1.00 25.26 ? 371  PHE A C   1 
ATOM   2434 O O   . PHE A 1 327 ? 16.427  63.796  26.103  1.00 22.34 ? 371  PHE A O   1 
ATOM   2435 C CB  . PHE A 1 327 ? 13.877  64.271  27.612  1.00 24.30 ? 371  PHE A CB  1 
ATOM   2436 C CG  . PHE A 1 327 ? 12.864  64.569  26.516  1.00 25.19 ? 371  PHE A CG  1 
ATOM   2437 C CD1 . PHE A 1 327 ? 11.571  64.106  26.623  1.00 22.10 ? 371  PHE A CD1 1 
ATOM   2438 C CD2 . PHE A 1 327 ? 13.213  65.359  25.404  1.00 23.67 ? 371  PHE A CD2 1 
ATOM   2439 C CE1 . PHE A 1 327 ? 10.652  64.419  25.618  1.00 23.77 ? 371  PHE A CE1 1 
ATOM   2440 C CE2 . PHE A 1 327 ? 12.312  65.629  24.401  1.00 23.47 ? 371  PHE A CE2 1 
ATOM   2441 C CZ  . PHE A 1 327 ? 11.043  65.180  24.525  1.00 22.88 ? 371  PHE A CZ  1 
ATOM   2442 N N   . THR A 1 328 ? 15.097  62.318  25.049  1.00 26.13 ? 372  THR A N   1 
ATOM   2443 C CA  . THR A 1 328 ? 15.940  62.198  23.871  1.00 25.33 ? 372  THR A CA  1 
ATOM   2444 C C   . THR A 1 328 ? 14.933  62.229  22.643  1.00 25.77 ? 372  THR A C   1 
ATOM   2445 O O   . THR A 1 328 ? 14.009  61.501  22.627  1.00 22.08 ? 372  THR A O   1 
ATOM   2446 C CB  . THR A 1 328 ? 16.651  60.798  23.894  1.00 29.31 ? 372  THR A CB  1 
ATOM   2447 O OG1 . THR A 1 328 ? 17.532  60.650  25.045  1.00 30.90 ? 372  THR A OG1 1 
ATOM   2448 C CG2 . THR A 1 328 ? 17.460  60.473  22.600  1.00 29.23 ? 372  THR A CG2 1 
ATOM   2449 N N   . ASN A 1 329 ? 15.117  63.135  21.696  1.00 22.77 ? 373  ASN A N   1 
ATOM   2450 C CA  . ASN A 1 329 ? 14.475  63.009  20.388  1.00 22.36 ? 373  ASN A CA  1 
ATOM   2451 C C   . ASN A 1 329 ? 15.188  61.923  19.613  1.00 23.31 ? 373  ASN A C   1 
ATOM   2452 O O   . ASN A 1 329 ? 16.420  61.926  19.438  1.00 23.45 ? 373  ASN A O   1 
ATOM   2453 C CB  . ASN A 1 329 ? 14.671  64.367  19.709  1.00 22.67 ? 373  ASN A CB  1 
ATOM   2454 C CG  . ASN A 1 329 ? 13.970  64.507  18.379  1.00 22.55 ? 373  ASN A CG  1 
ATOM   2455 O OD1 . ASN A 1 329 ? 13.490  63.560  17.780  1.00 22.66 ? 373  ASN A OD1 1 
ATOM   2456 N ND2 . ASN A 1 329 ? 13.945  65.733  17.904  1.00 26.79 ? 373  ASN A ND2 1 
ATOM   2457 N N   . VAL A 1 330 ? 14.468  60.927  19.161  1.00 21.41 ? 374  VAL A N   1 
ATOM   2458 C CA  . VAL A 1 330 ? 15.040  59.912  18.246  1.00 18.54 ? 374  VAL A CA  1 
ATOM   2459 C C   . VAL A 1 330 ? 15.001  60.589  16.923  1.00 19.97 ? 374  VAL A C   1 
ATOM   2460 O O   . VAL A 1 330 ? 13.989  60.610  16.241  1.00 17.10 ? 374  VAL A O   1 
ATOM   2461 C CB  . VAL A 1 330 ? 14.213  58.599  18.231  1.00 21.74 ? 374  VAL A CB  1 
ATOM   2462 C CG1 . VAL A 1 330 ? 14.848  57.542  17.241  1.00 24.05 ? 374  VAL A CG1 1 
ATOM   2463 C CG2 . VAL A 1 330 ? 14.152  58.043  19.669  1.00 23.16 ? 374  VAL A CG2 1 
ATOM   2464 N N   . THR A 1 331 ? 16.156  61.172  16.498  1.00 20.00 ? 375  THR A N   1 
ATOM   2465 C CA  . THR A 1 331 ? 16.100  62.048  15.344  1.00 21.14 ? 375  THR A CA  1 
ATOM   2466 C C   . THR A 1 331 ? 15.901  61.282  14.067  1.00 22.68 ? 375  THR A C   1 
ATOM   2467 O O   . THR A 1 331 ? 15.667  61.875  13.013  1.00 22.17 ? 375  THR A O   1 
ATOM   2468 C CB  . THR A 1 331 ? 17.386  62.859  15.269  1.00 19.93 ? 375  THR A CB  1 
ATOM   2469 O OG1 . THR A 1 331 ? 18.476  61.958  15.171  1.00 25.84 ? 375  THR A OG1 1 
ATOM   2470 C CG2 . THR A 1 331 ? 17.580  63.570  16.575  1.00 22.16 ? 375  THR A CG2 1 
ATOM   2471 N N   . SER A 1 332 ? 16.034  59.950  14.126  1.00 20.12 ? 376  SER A N   1 
ATOM   2472 C CA  . SER A 1 332 ? 15.912  59.181  12.907  1.00 21.12 ? 376  SER A CA  1 
ATOM   2473 C C   . SER A 1 332 ? 14.542  58.664  12.527  1.00 22.10 ? 376  SER A C   1 
ATOM   2474 O O   . SER A 1 332 ? 14.430  57.941  11.515  1.00 21.15 ? 376  SER A O   1 
ATOM   2475 C CB  . SER A 1 332 ? 16.881  58.025  12.968  1.00 21.21 ? 376  SER A CB  1 
ATOM   2476 O OG  . SER A 1 332 ? 16.312  57.247  14.033  1.00 24.76 ? 376  SER A OG  1 
ATOM   2477 N N   . LEU A 1 333 ? 13.455  59.080  13.266  1.00 20.49 ? 377  LEU A N   1 
ATOM   2478 C CA  . LEU A 1 333 ? 12.141  58.749  12.855  1.00 20.55 ? 377  LEU A CA  1 
ATOM   2479 C C   . LEU A 1 333 ? 11.210  59.834  13.438  1.00 19.61 ? 377  LEU A C   1 
ATOM   2480 O O   . LEU A 1 333 ? 11.285  60.132  14.605  1.00 17.15 ? 377  LEU A O   1 
ATOM   2481 C CB  . LEU A 1 333 ? 11.665  57.444  13.441  1.00 19.05 ? 377  LEU A CB  1 
ATOM   2482 C CG  . LEU A 1 333 ? 10.401  57.028  12.672  1.00 23.24 ? 377  LEU A CG  1 
ATOM   2483 C CD1 . LEU A 1 333 ? 10.416  57.134  11.170  1.00 28.01 ? 377  LEU A CD1 1 
ATOM   2484 C CD2 . LEU A 1 333 ? 10.150  55.626  13.007  1.00 22.00 ? 377  LEU A CD2 1 
ATOM   2485 N N   . ARG A 1 334 ? 10.437  60.462  12.556  1.00 18.54 ? 378  ARG A N   1 
ATOM   2486 C CA  . ARG A 1 334 ? 9.526   61.538  12.931  1.00 20.80 ? 378  ARG A CA  1 
ATOM   2487 C C   . ARG A 1 334 ? 8.624   61.121  14.048  1.00 21.08 ? 378  ARG A C   1 
ATOM   2488 O O   . ARG A 1 334 ? 8.150   59.986  13.989  1.00 19.36 ? 378  ARG A O   1 
ATOM   2489 C CB  . ARG A 1 334 ? 8.721   61.833  11.662  1.00 21.05 ? 378  ARG A CB  1 
ATOM   2490 C CG  . ARG A 1 334 ? 7.532   62.787  11.843  1.00 22.96 ? 378  ARG A CG  1 
ATOM   2491 C CD  . ARG A 1 334 ? 6.916   63.087  10.432  1.00 22.73 ? 378  ARG A CD  1 
ATOM   2492 N NE  . ARG A 1 334 ? 6.264   61.887  9.916   1.00 22.54 ? 378  ARG A NE  1 
ATOM   2493 C CZ  . ARG A 1 334 ? 4.969   61.674  10.121  1.00 29.49 ? 378  ARG A CZ  1 
ATOM   2494 N NH1 . ARG A 1 334 ? 4.251   62.609  10.800  1.00 23.42 ? 378  ARG A NH1 1 
ATOM   2495 N NH2 . ARG A 1 334 ? 4.405   60.568  9.670   1.00 24.27 ? 378  ARG A NH2 1 
ATOM   2496 N N   . GLY A 1 335 ? 8.267   62.048  14.977  1.00 19.14 ? 379  GLY A N   1 
ATOM   2497 C CA  . GLY A 1 335 ? 7.374   61.725  16.062  1.00 19.81 ? 379  GLY A CA  1 
ATOM   2498 C C   . GLY A 1 335 ? 7.972   60.929  17.236  1.00 20.03 ? 379  GLY A C   1 
ATOM   2499 O O   . GLY A 1 335 ? 7.345   60.817  18.254  1.00 20.60 ? 379  GLY A O   1 
ATOM   2500 N N   . VAL A 1 336 ? 9.186   60.322  17.077  1.00 18.28 ? 380  VAL A N   1 
ATOM   2501 C CA  . VAL A 1 336 ? 9.593   59.367  18.140  1.00 16.62 ? 380  VAL A CA  1 
ATOM   2502 C C   . VAL A 1 336 ? 10.487  60.115  19.178  1.00 17.33 ? 380  VAL A C   1 
ATOM   2503 O O   . VAL A 1 336 ? 11.438  60.827  18.807  1.00 16.64 ? 380  VAL A O   1 
ATOM   2504 C CB  . VAL A 1 336 ? 10.403  58.212  17.531  1.00 16.05 ? 380  VAL A CB  1 
ATOM   2505 C CG1 . VAL A 1 336 ? 10.803  57.282  18.637  1.00 15.72 ? 380  VAL A CG1 1 
ATOM   2506 C CG2 . VAL A 1 336 ? 9.495   57.450  16.475  1.00 16.62 ? 380  VAL A CG2 1 
ATOM   2507 N N   . TYR A 1 337 ? 10.184  59.926  20.444  1.00 15.93 ? 381  TYR A N   1 
ATOM   2508 C CA  . TYR A 1 337 ? 11.012  60.441  21.570  1.00 16.70 ? 381  TYR A CA  1 
ATOM   2509 C C   . TYR A 1 337 ? 11.093  59.325  22.608  1.00 17.22 ? 381  TYR A C   1 
ATOM   2510 O O   . TYR A 1 337 ? 10.128  58.591  22.760  1.00 19.28 ? 381  TYR A O   1 
ATOM   2511 C CB  . TYR A 1 337 ? 10.318  61.726  22.209  1.00 14.27 ? 381  TYR A CB  1 
ATOM   2512 C CG  . TYR A 1 337 ? 10.178  62.835  21.191  1.00 19.48 ? 381  TYR A CG  1 
ATOM   2513 C CD1 . TYR A 1 337 ? 11.022  63.937  21.187  1.00 22.32 ? 381  TYR A CD1 1 
ATOM   2514 C CD2 . TYR A 1 337 ? 9.174   62.777  20.239  1.00 24.25 ? 381  TYR A CD2 1 
ATOM   2515 C CE1 . TYR A 1 337 ? 10.865  64.965  20.196  1.00 19.50 ? 381  TYR A CE1 1 
ATOM   2516 C CE2 . TYR A 1 337 ? 8.994   63.805  19.248  1.00 22.30 ? 381  TYR A CE2 1 
ATOM   2517 C CZ  . TYR A 1 337 ? 9.872   64.834  19.235  1.00 22.29 ? 381  TYR A CZ  1 
ATOM   2518 O OH  . TYR A 1 337 ? 9.683   65.738  18.239  1.00 21.83 ? 381  TYR A OH  1 
ATOM   2519 N N   . ILE A 1 338 ? 12.134  59.362  23.472  1.00 19.80 ? 382  ILE A N   1 
ATOM   2520 C CA  . ILE A 1 338 ? 12.265  58.339  24.524  1.00 20.57 ? 382  ILE A CA  1 
ATOM   2521 C C   . ILE A 1 338 ? 12.610  59.097  25.801  1.00 21.09 ? 382  ILE A C   1 
ATOM   2522 O O   . ILE A 1 338 ? 13.249  60.140  25.693  1.00 19.25 ? 382  ILE A O   1 
ATOM   2523 C CB  . ILE A 1 338 ? 13.445  57.409  24.162  1.00 21.29 ? 382  ILE A CB  1 
ATOM   2524 C CG1 . ILE A 1 338 ? 12.933  56.378  23.153  1.00 21.91 ? 382  ILE A CG1 1 
ATOM   2525 C CG2 . ILE A 1 338 ? 13.825  56.533  25.342  1.00 27.92 ? 382  ILE A CG2 1 
ATOM   2526 C CD1 . ILE A 1 338 ? 14.137  55.688  22.199  1.00 21.60 ? 382  ILE A CD1 1 
ATOM   2527 N N   . THR A 1 339 ? 12.158  58.629  26.987  1.00 20.07 ? 383  THR A N   1 
ATOM   2528 C CA  . THR A 1 339 ? 12.656  59.207  28.207  1.00 20.89 ? 383  THR A CA  1 
ATOM   2529 C C   . THR A 1 339 ? 12.526  58.220  29.346  1.00 21.17 ? 383  THR A C   1 
ATOM   2530 O O   . THR A 1 339 ? 12.120  57.077  29.102  1.00 21.41 ? 383  THR A O   1 
ATOM   2531 C CB  . THR A 1 339 ? 11.886  60.546  28.473  1.00 21.70 ? 383  THR A CB  1 
ATOM   2532 O OG1 . THR A 1 339 ? 12.586  61.309  29.482  1.00 24.56 ? 383  THR A OG1 1 
ATOM   2533 C CG2 . THR A 1 339 ? 10.488  60.315  28.830  1.00 22.19 ? 383  THR A CG2 1 
ATOM   2534 N N   . SER A 1 340 ? 12.832  58.649  30.575  1.00 21.22 ? 384  SER A N   1 
ATOM   2535 C CA  . SER A 1 340 ? 12.712  57.786  31.777  1.00 20.94 ? 384  SER A CA  1 
ATOM   2536 C C   . SER A 1 340 ? 11.661  58.345  32.672  1.00 20.08 ? 384  SER A C   1 
ATOM   2537 O O   . SER A 1 340 ? 11.519  59.555  32.794  1.00 20.11 ? 384  SER A O   1 
ATOM   2538 C CB  . SER A 1 340 ? 14.028  57.805  32.574  1.00 23.33 ? 384  SER A CB  1 
ATOM   2539 O OG  . SER A 1 340 ? 15.059  57.240  31.812  1.00 26.22 ? 384  SER A OG  1 
ATOM   2540 N N   . VAL A 1 341 ? 10.980  57.483  33.382  1.00 19.28 ? 385  VAL A N   1 
ATOM   2541 C CA  . VAL A 1 341 ? 9.954   57.917  34.327  1.00 20.33 ? 385  VAL A CA  1 
ATOM   2542 C C   . VAL A 1 341 ? 10.166  57.110  35.582  1.00 22.37 ? 385  VAL A C   1 
ATOM   2543 O O   . VAL A 1 341 ? 10.695  56.012  35.526  1.00 22.02 ? 385  VAL A O   1 
ATOM   2544 C CB  . VAL A 1 341 ? 8.528   57.640  33.851  1.00 20.24 ? 385  VAL A CB  1 
ATOM   2545 C CG1 . VAL A 1 341 ? 8.276   58.398  32.542  1.00 18.93 ? 385  VAL A CG1 1 
ATOM   2546 C CG2 . VAL A 1 341 ? 8.269   56.121  33.611  1.00 22.59 ? 385  VAL A CG2 1 
ATOM   2547 N N   . LEU A 1 342 ? 9.696   57.635  36.685  1.00 22.90 ? 386  LEU A N   1 
ATOM   2548 C CA  . LEU A 1 342 ? 9.798   56.937  37.950  1.00 27.23 ? 386  LEU A CA  1 
ATOM   2549 C C   . LEU A 1 342 ? 8.544   56.169  38.190  1.00 28.44 ? 386  LEU A C   1 
ATOM   2550 O O   . LEU A 1 342 ? 7.451   56.698  38.087  1.00 27.08 ? 386  LEU A O   1 
ATOM   2551 C CB  . LEU A 1 342 ? 9.923   57.931  39.077  1.00 27.45 ? 386  LEU A CB  1 
ATOM   2552 C CG  . LEU A 1 342 ? 11.354  58.275  39.438  1.00 31.86 ? 386  LEU A CG  1 
ATOM   2553 C CD1 . LEU A 1 342 ? 11.767  59.313  38.487  1.00 33.40 ? 386  LEU A CD1 1 
ATOM   2554 C CD2 . LEU A 1 342 ? 11.339  58.823  40.862  1.00 35.49 ? 386  LEU A CD2 1 
ATOM   2555 N N   . SER A 1 343 ? 8.689   54.917  38.541  1.00 30.43 ? 387  SER A N   1 
ATOM   2556 C CA  . SER A 1 343 ? 7.511   54.161  38.881  1.00 33.42 ? 387  SER A CA  1 
ATOM   2557 C C   . SER A 1 343 ? 6.973   54.570  40.264  1.00 33.20 ? 387  SER A C   1 
ATOM   2558 O O   . SER A 1 343 ? 7.613   55.311  41.003  1.00 32.59 ? 387  SER A O   1 
ATOM   2559 C CB  . SER A 1 343 ? 7.820   52.682  38.804  1.00 34.04 ? 387  SER A CB  1 
ATOM   2560 O OG  . SER A 1 343 ? 6.636   51.994  39.093  1.00 37.99 ? 387  SER A OG  1 
ATOM   2561 N N   . GLU A 1 344 ? 5.779   54.122  40.621  1.00 35.28 ? 388  GLU A N   1 
ATOM   2562 C CA  . GLU A 1 344 ? 5.314   54.421  41.977  1.00 36.85 ? 388  GLU A CA  1 
ATOM   2563 C C   . GLU A 1 344 ? 6.188   53.806  43.094  1.00 36.41 ? 388  GLU A C   1 
ATOM   2564 O O   . GLU A 1 344 ? 6.155   54.282  44.236  1.00 35.89 ? 388  GLU A O   1 
ATOM   2565 C CB  . GLU A 1 344 ? 3.839   54.093  42.147  1.00 38.55 ? 388  GLU A CB  1 
ATOM   2566 C CG  . GLU A 1 344 ? 2.954   55.143  41.487  1.00 44.61 ? 388  GLU A CG  1 
ATOM   2567 C CD  . GLU A 1 344 ? 2.934   56.489  42.253  1.00 52.89 ? 388  GLU A CD  1 
ATOM   2568 O OE1 . GLU A 1 344 ? 3.397   56.565  43.425  1.00 54.51 ? 388  GLU A OE1 1 
ATOM   2569 O OE2 . GLU A 1 344 ? 2.433   57.481  41.664  1.00 57.44 ? 388  GLU A OE2 1 
ATOM   2570 N N   . ASP A 1 345 ? 6.990   52.787  42.745  1.00 35.87 ? 389  ASP A N   1 
ATOM   2571 C CA  . ASP A 1 345 ? 7.975   52.169  43.668  1.00 36.31 ? 389  ASP A CA  1 
ATOM   2572 C C   . ASP A 1 345 ? 9.386   52.770  43.539  1.00 35.37 ? 389  ASP A C   1 
ATOM   2573 O O   . ASP A 1 345 ? 10.350  52.309  44.179  1.00 33.93 ? 389  ASP A O   1 
ATOM   2574 C CB  . ASP A 1 345 ? 8.060   50.662  43.469  1.00 37.90 ? 389  ASP A CB  1 
ATOM   2575 C CG  . ASP A 1 345 ? 8.220   50.263  42.018  1.00 42.83 ? 389  ASP A CG  1 
ATOM   2576 O OD1 . ASP A 1 345 ? 9.248   50.616  41.384  1.00 47.10 ? 389  ASP A OD1 1 
ATOM   2577 O OD2 . ASP A 1 345 ? 7.299   49.586  41.507  1.00 50.72 ? 389  ASP A OD2 1 
ATOM   2578 N N   . ASN A 1 346 ? 9.477   53.815  42.725  1.00 33.33 ? 390  ASN A N   1 
ATOM   2579 C CA  . ASN A 1 346 ? 10.684  54.612  42.591  1.00 32.88 ? 390  ASN A CA  1 
ATOM   2580 C C   . ASN A 1 346 ? 11.799  53.871  41.833  1.00 31.41 ? 390  ASN A C   1 
ATOM   2581 O O   . ASN A 1 346 ? 12.950  54.311  41.799  1.00 32.54 ? 390  ASN A O   1 
ATOM   2582 C CB  . ASN A 1 346 ? 11.111  55.219  43.929  1.00 34.13 ? 390  ASN A CB  1 
ATOM   2583 C CG  . ASN A 1 346 ? 10.194  56.360  44.370  1.00 38.74 ? 390  ASN A CG  1 
ATOM   2584 O OD1 . ASN A 1 346 ? 9.223   56.166  45.132  1.00 45.25 ? 390  ASN A OD1 1 
ATOM   2585 N ND2 . ASN A 1 346 ? 10.480  57.550  43.877  1.00 44.04 ? 390  ASN A ND2 1 
ATOM   2586 N N   . SER A 1 347 ? 11.446  52.788  41.141  1.00 28.44 ? 391  SER A N   1 
ATOM   2587 C CA  . SER A 1 347 ? 12.354  52.271  40.122  1.00 26.80 ? 391  SER A CA  1 
ATOM   2588 C C   . SER A 1 347 ? 12.161  53.101  38.826  1.00 25.26 ? 391  SER A C   1 
ATOM   2589 O O   . SER A 1 347 ? 11.163  53.799  38.707  1.00 23.04 ? 391  SER A O   1 
ATOM   2590 C CB  . SER A 1 347 ? 12.149  50.769  39.903  1.00 26.49 ? 391  SER A CB  1 
ATOM   2591 O OG  . SER A 1 347 ? 10.871  50.485  39.429  1.00 29.62 ? 391  SER A OG  1 
ATOM   2592 N N   . ILE A 1 348 ? 13.153  53.087  37.936  1.00 22.93 ? 392  ILE A N   1 
ATOM   2593 C CA  . ILE A 1 348 ? 13.144  53.934  36.748  1.00 21.02 ? 392  ILE A CA  1 
ATOM   2594 C C   . ILE A 1 348 ? 12.880  53.086  35.514  1.00 22.05 ? 392  ILE A C   1 
ATOM   2595 O O   . ILE A 1 348 ? 13.602  52.117  35.248  1.00 23.42 ? 392  ILE A O   1 
ATOM   2596 C CB  . ILE A 1 348 ? 14.475  54.664  36.560  1.00 20.87 ? 392  ILE A CB  1 
ATOM   2597 C CG1 . ILE A 1 348 ? 14.900  55.383  37.860  1.00 20.80 ? 392  ILE A CG1 1 
ATOM   2598 C CG2 . ILE A 1 348 ? 14.408  55.657  35.369  1.00 17.64 ? 392  ILE A CG2 1 
ATOM   2599 C CD1 . ILE A 1 348 ? 16.357  55.860  37.760  1.00 23.19 ? 392  ILE A CD1 1 
ATOM   2600 N N   . GLN A 1 349 ? 11.876  53.469  34.735  1.00 21.71 ? 393  GLN A N   1 
ATOM   2601 C CA  . GLN A 1 349 ? 11.571  52.777  33.493  1.00 22.44 ? 393  GLN A CA  1 
ATOM   2602 C C   . GLN A 1 349 ? 11.745  53.709  32.271  1.00 21.71 ? 393  GLN A C   1 
ATOM   2603 O O   . GLN A 1 349 ? 11.448  54.895  32.368  1.00 19.71 ? 393  GLN A O   1 
ATOM   2604 C CB  . GLN A 1 349 ? 10.138  52.366  33.506  1.00 23.24 ? 393  GLN A CB  1 
ATOM   2605 C CG  . GLN A 1 349 ? 9.887   51.076  34.272  1.00 29.28 ? 393  GLN A CG  1 
ATOM   2606 C CD  . GLN A 1 349 ? 9.465   51.337  35.678  1.00 36.06 ? 393  GLN A CD  1 
ATOM   2607 O OE1 . GLN A 1 349 ? 8.669   52.252  35.914  1.00 39.25 ? 393  GLN A OE1 1 
ATOM   2608 N NE2 . GLN A 1 349 ? 9.922   50.502  36.624  1.00 37.96 ? 393  GLN A NE2 1 
ATOM   2609 N N   . THR A 1 350 ? 12.091  53.121  31.143  1.00 19.26 ? 394  THR A N   1 
ATOM   2610 C CA  . THR A 1 350 ? 12.124  53.830  29.887  1.00 18.50 ? 394  THR A CA  1 
ATOM   2611 C C   . THR A 1 350 ? 10.780  53.738  29.154  1.00 18.29 ? 394  THR A C   1 
ATOM   2612 O O   . THR A 1 350 ? 10.111  52.690  29.175  1.00 18.01 ? 394  THR A O   1 
ATOM   2613 C CB  . THR A 1 350 ? 13.264  53.290  28.973  1.00 18.48 ? 394  THR A CB  1 
ATOM   2614 O OG1 . THR A 1 350 ? 14.496  53.404  29.681  1.00 21.67 ? 394  THR A OG1 1 
ATOM   2615 C CG2 . THR A 1 350 ? 13.420  54.144  27.714  1.00 17.91 ? 394  THR A CG2 1 
ATOM   2616 N N   . MET A 1 351 ? 10.351  54.872  28.576  1.00 18.27 ? 395  MET A N   1 
ATOM   2617 C CA  . MET A 1 351 ? 9.104   54.968  27.836  1.00 18.91 ? 395  MET A CA  1 
ATOM   2618 C C   . MET A 1 351 ? 9.411   55.554  26.478  1.00 18.71 ? 395  MET A C   1 
ATOM   2619 O O   . MET A 1 351 ? 10.357  56.329  26.314  1.00 18.00 ? 395  MET A O   1 
ATOM   2620 C CB  . MET A 1 351 ? 8.058   55.897  28.535  1.00 20.19 ? 395  MET A CB  1 
ATOM   2621 C CG  . MET A 1 351 ? 7.826   55.675  29.940  1.00 27.87 ? 395  MET A CG  1 
ATOM   2622 S SD  . MET A 1 351 ? 6.349   54.650  30.125  1.00 42.87 ? 395  MET A SD  1 
ATOM   2623 C CE  . MET A 1 351 ? 7.307   53.192  29.964  1.00 34.99 ? 395  MET A CE  1 
ATOM   2624 N N   . ILE A 1 352 ? 8.597   55.208  25.498  1.00 18.25 ? 396  ILE A N   1 
ATOM   2625 C CA  . ILE A 1 352 ? 8.818   55.765  24.173  1.00 18.91 ? 396  ILE A CA  1 
ATOM   2626 C C   . ILE A 1 352 ? 7.455   56.188  23.638  1.00 18.19 ? 396  ILE A C   1 
ATOM   2627 O O   . ILE A 1 352 ? 6.392   55.618  23.980  1.00 19.53 ? 396  ILE A O   1 
ATOM   2628 C CB  . ILE A 1 352 ? 9.492   54.702  23.221  1.00 21.20 ? 396  ILE A CB  1 
ATOM   2629 C CG1 . ILE A 1 352 ? 9.645   55.206  21.813  1.00 18.56 ? 396  ILE A CG1 1 
ATOM   2630 C CG2 . ILE A 1 352 ? 8.677   53.458  23.153  1.00 16.21 ? 396  ILE A CG2 1 
ATOM   2631 C CD1 . ILE A 1 352 ? 10.760  54.425  21.041  1.00 19.41 ? 396  ILE A CD1 1 
ATOM   2632 N N   . THR A 1 353 ? 7.482   57.234  22.835  1.00 19.15 ? 397  THR A N   1 
ATOM   2633 C CA  . THR A 1 353 ? 6.335   57.730  22.101  1.00 19.87 ? 397  THR A CA  1 
ATOM   2634 C C   . THR A 1 353 ? 6.677   57.807  20.640  1.00 20.45 ? 397  THR A C   1 
ATOM   2635 O O   . THR A 1 353 ? 7.849   58.148  20.280  1.00 21.97 ? 397  THR A O   1 
ATOM   2636 C CB  . THR A 1 353 ? 5.870   59.120  22.609  1.00 20.77 ? 397  THR A CB  1 
ATOM   2637 O OG1 . THR A 1 353 ? 4.706   59.521  21.863  1.00 20.53 ? 397  THR A OG1 1 
ATOM   2638 C CG2 . THR A 1 353 ? 6.933   60.205  22.330  1.00 19.19 ? 397  THR A CG2 1 
ATOM   2639 N N   . PHE A 1 354 ? 5.677   57.454  19.792  1.00 22.31 ? 398  PHE A N   1 
ATOM   2640 C CA  . PHE A 1 354 ? 5.844   57.416  18.373  1.00 22.38 ? 398  PHE A CA  1 
ATOM   2641 C C   . PHE A 1 354 ? 5.074   58.476  17.716  1.00 22.76 ? 398  PHE A C   1 
ATOM   2642 O O   . PHE A 1 354 ? 5.316   58.735  16.571  1.00 23.30 ? 398  PHE A O   1 
ATOM   2643 C CB  . PHE A 1 354 ? 5.374   56.046  17.815  1.00 22.85 ? 398  PHE A CB  1 
ATOM   2644 C CG  . PHE A 1 354 ? 6.173   54.881  18.398  1.00 20.95 ? 398  PHE A CG  1 
ATOM   2645 C CD1 . PHE A 1 354 ? 7.479   54.649  17.992  1.00 21.91 ? 398  PHE A CD1 1 
ATOM   2646 C CD2 . PHE A 1 354 ? 5.621   54.060  19.373  1.00 23.14 ? 398  PHE A CD2 1 
ATOM   2647 C CE1 . PHE A 1 354 ? 8.206   53.625  18.546  1.00 18.18 ? 398  PHE A CE1 1 
ATOM   2648 C CE2 . PHE A 1 354 ? 6.355   52.988  19.943  1.00 22.25 ? 398  PHE A CE2 1 
ATOM   2649 C CZ  . PHE A 1 354 ? 7.667   52.796  19.503  1.00 20.18 ? 398  PHE A CZ  1 
ATOM   2650 N N   . ASP A 1 355 ? 4.128   59.097  18.448  1.00 22.53 ? 399  ASP A N   1 
ATOM   2651 C CA  . ASP A 1 355 ? 3.331   60.195  17.907  1.00 23.57 ? 399  ASP A CA  1 
ATOM   2652 C C   . ASP A 1 355 ? 3.509   61.516  18.676  1.00 23.51 ? 399  ASP A C   1 
ATOM   2653 O O   . ASP A 1 355 ? 2.506   62.115  19.107  1.00 22.70 ? 399  ASP A O   1 
ATOM   2654 C CB  . ASP A 1 355 ? 1.821   59.787  17.940  1.00 23.28 ? 399  ASP A CB  1 
ATOM   2655 C CG  . ASP A 1 355 ? 1.288   59.518  19.372  1.00 27.39 ? 399  ASP A CG  1 
ATOM   2656 O OD1 . ASP A 1 355 ? 2.081   59.437  20.339  1.00 25.27 ? 399  ASP A OD1 1 
ATOM   2657 O OD2 . ASP A 1 355 ? 0.029   59.374  19.559  1.00 31.56 ? 399  ASP A OD2 1 
ATOM   2658 N N   . GLN A 1 356 ? 4.737   61.967  18.882  1.00 24.62 ? 400  GLN A N   1 
ATOM   2659 C CA  . GLN A 1 356 ? 4.904   63.322  19.438  1.00 25.80 ? 400  GLN A CA  1 
ATOM   2660 C C   . GLN A 1 356 ? 4.206   63.521  20.807  1.00 26.19 ? 400  GLN A C   1 
ATOM   2661 O O   . GLN A 1 356 ? 3.724   64.626  21.166  1.00 24.87 ? 400  GLN A O   1 
ATOM   2662 C CB  . GLN A 1 356 ? 4.391   64.335  18.368  1.00 26.41 ? 400  GLN A CB  1 
ATOM   2663 C CG  . GLN A 1 356 ? 4.745   65.759  18.662  1.00 27.72 ? 400  GLN A CG  1 
ATOM   2664 C CD  . GLN A 1 356 ? 4.268   66.697  17.553  1.00 28.28 ? 400  GLN A CD  1 
ATOM   2665 O OE1 . GLN A 1 356 ? 5.023   66.908  16.603  1.00 32.87 ? 400  GLN A OE1 1 
ATOM   2666 N NE2 . GLN A 1 356 ? 3.080   67.298  17.698  1.00 24.16 ? 400  GLN A NE2 1 
ATOM   2667 N N   . GLY A 1 357 ? 4.123   62.438  21.580  1.00 24.97 ? 401  GLY A N   1 
ATOM   2668 C CA  . GLY A 1 357 ? 3.726   62.567  22.954  1.00 22.15 ? 401  GLY A CA  1 
ATOM   2669 C C   . GLY A 1 357 ? 2.266   62.400  23.158  1.00 25.48 ? 401  GLY A C   1 
ATOM   2670 O O   . GLY A 1 357 ? 1.820   62.640  24.254  1.00 25.49 ? 401  GLY A O   1 
ATOM   2671 N N   . GLY A 1 358 ? 1.494   61.950  22.154  1.00 24.46 ? 402  GLY A N   1 
ATOM   2672 C CA  . GLY A 1 358 ? 0.124   61.632  22.412  1.00 26.16 ? 402  GLY A CA  1 
ATOM   2673 C C   . GLY A 1 358 ? -0.082  60.355  23.237  1.00 26.43 ? 402  GLY A C   1 
ATOM   2674 O O   . GLY A 1 358 ? -1.070  60.208  23.959  1.00 24.59 ? 402  GLY A O   1 
ATOM   2675 N N   . ARG A 1 359 ? 0.797   59.392  23.077  1.00 25.72 ? 403  ARG A N   1 
ATOM   2676 C CA  . ARG A 1 359 ? 0.738   58.151  23.859  1.00 28.22 ? 403  ARG A CA  1 
ATOM   2677 C C   . ARG A 1 359 ? 2.152   57.725  24.113  1.00 25.74 ? 403  ARG A C   1 
ATOM   2678 O O   . ARG A 1 359 ? 3.050   57.981  23.233  1.00 25.14 ? 403  ARG A O   1 
ATOM   2679 C CB  . ARG A 1 359 ? -0.012  57.061  23.054  1.00 29.95 ? 403  ARG A CB  1 
ATOM   2680 C CG  . ARG A 1 359 ? 0.205   55.603  23.575  1.00 35.36 ? 403  ARG A CG  1 
ATOM   2681 C CD  . ARG A 1 359 ? -0.551  54.514  22.723  1.00 35.76 ? 403  ARG A CD  1 
ATOM   2682 N NE  . ARG A 1 359 ? -0.314  53.107  23.165  1.00 45.93 ? 403  ARG A NE  1 
ATOM   2683 C CZ  . ARG A 1 359 ? -0.332  52.666  24.434  1.00 50.16 ? 403  ARG A CZ  1 
ATOM   2684 N NH1 . ARG A 1 359 ? -0.510  53.511  25.441  1.00 53.41 ? 403  ARG A NH1 1 
ATOM   2685 N NH2 . ARG A 1 359 ? -0.114  51.370  24.710  1.00 53.16 ? 403  ARG A NH2 1 
ATOM   2686 N N   . TRP A 1 360 ? 2.403   57.148  25.300  1.00 22.71 ? 404  TRP A N   1 
ATOM   2687 C CA  . TRP A 1 360 ? 3.762   56.684  25.649  1.00 22.81 ? 404  TRP A CA  1 
ATOM   2688 C C   . TRP A 1 360 ? 3.643   55.248  26.062  1.00 23.72 ? 404  TRP A C   1 
ATOM   2689 O O   . TRP A 1 360 ? 2.700   54.887  26.758  1.00 21.47 ? 404  TRP A O   1 
ATOM   2690 C CB  . TRP A 1 360 ? 4.364   57.464  26.890  1.00 21.30 ? 404  TRP A CB  1 
ATOM   2691 C CG  . TRP A 1 360 ? 4.692   58.907  26.636  1.00 21.07 ? 404  TRP A CG  1 
ATOM   2692 C CD1 . TRP A 1 360 ? 3.856   59.962  26.729  1.00 21.08 ? 404  TRP A CD1 1 
ATOM   2693 C CD2 . TRP A 1 360 ? 5.972   59.432  26.293  1.00 19.11 ? 404  TRP A CD2 1 
ATOM   2694 N NE1 . TRP A 1 360 ? 4.533   61.127  26.371  1.00 20.89 ? 404  TRP A NE1 1 
ATOM   2695 C CE2 . TRP A 1 360 ? 5.851   60.822  26.210  1.00 19.81 ? 404  TRP A CE2 1 
ATOM   2696 C CE3 . TRP A 1 360 ? 7.236   58.846  26.094  1.00 17.32 ? 404  TRP A CE3 1 
ATOM   2697 C CZ2 . TRP A 1 360 ? 6.911   61.641  25.871  1.00 17.19 ? 404  TRP A CZ2 1 
ATOM   2698 C CZ3 . TRP A 1 360 ? 8.297   59.672  25.796  1.00 19.77 ? 404  TRP A CZ3 1 
ATOM   2699 C CH2 . TRP A 1 360 ? 8.128   61.034  25.644  1.00 19.02 ? 404  TRP A CH2 1 
ATOM   2700 N N   . THR A 1 361 ? 4.620   54.435  25.705  1.00 24.09 ? 405  THR A N   1 
ATOM   2701 C CA  . THR A 1 361 ? 4.594   52.998  26.060  1.00 26.20 ? 405  THR A CA  1 
ATOM   2702 C C   . THR A 1 361 ? 5.993   52.474  26.449  1.00 25.38 ? 405  THR A C   1 
ATOM   2703 O O   . THR A 1 361 ? 7.031   53.139  26.248  1.00 23.06 ? 405  THR A O   1 
ATOM   2704 C CB  . THR A 1 361 ? 4.003   52.169  24.800  1.00 28.81 ? 405  THR A CB  1 
ATOM   2705 O OG1 . THR A 1 361 ? 3.673   50.811  25.156  1.00 33.33 ? 405  THR A OG1 1 
ATOM   2706 C CG2 . THR A 1 361 ? 4.926   52.184  23.664  1.00 28.07 ? 405  THR A CG2 1 
ATOM   2707 N N   . HIS A 1 362 ? 6.044   51.256  26.971  1.00 26.11 ? 406  HIS A N   1 
ATOM   2708 C CA  . HIS A 1 362 ? 7.325   50.582  27.222  1.00 26.11 ? 406  HIS A CA  1 
ATOM   2709 C C   . HIS A 1 362 ? 7.995   50.157  25.949  1.00 23.72 ? 406  HIS A C   1 
ATOM   2710 O O   . HIS A 1 362 ? 7.311   49.920  24.922  1.00 23.04 ? 406  HIS A O   1 
ATOM   2711 C CB  . HIS A 1 362 ? 6.996   49.360  28.090  1.00 28.37 ? 406  HIS A CB  1 
ATOM   2712 C CG  . HIS A 1 362 ? 6.538   49.731  29.467  1.00 34.21 ? 406  HIS A CG  1 
ATOM   2713 N ND1 . HIS A 1 362 ? 7.358   50.391  30.369  1.00 42.16 ? 406  HIS A ND1 1 
ATOM   2714 C CD2 . HIS A 1 362 ? 5.353   49.565  30.090  1.00 40.62 ? 406  HIS A CD2 1 
ATOM   2715 C CE1 . HIS A 1 362 ? 6.699   50.576  31.500  1.00 43.98 ? 406  HIS A CE1 1 
ATOM   2716 N NE2 . HIS A 1 362 ? 5.481   50.080  31.358  1.00 44.47 ? 406  HIS A NE2 1 
ATOM   2717 N N   . LEU A 1 363 ? 9.333   50.043  25.940  1.00 21.95 ? 407  LEU A N   1 
ATOM   2718 C CA  . LEU A 1 363 ? 9.995   49.576  24.734  1.00 21.60 ? 407  LEU A CA  1 
ATOM   2719 C C   . LEU A 1 363 ? 9.930   48.041  24.622  1.00 24.50 ? 407  LEU A C   1 
ATOM   2720 O O   . LEU A 1 363 ? 10.224  47.316  25.598  1.00 22.21 ? 407  LEU A O   1 
ATOM   2721 C CB  . LEU A 1 363 ? 11.488  49.986  24.669  1.00 19.25 ? 407  LEU A CB  1 
ATOM   2722 C CG  . LEU A 1 363 ? 11.829  51.411  24.242  1.00 18.65 ? 407  LEU A CG  1 
ATOM   2723 C CD1 . LEU A 1 363 ? 11.292  52.257  25.411  1.00 21.48 ? 407  LEU A CD1 1 
ATOM   2724 C CD2 . LEU A 1 363 ? 13.346  51.553  24.222  1.00 24.15 ? 407  LEU A CD2 1 
ATOM   2725 N N   . ARG A 1 364 ? 9.692   47.532  23.411  1.00 25.45 ? 408  ARG A N   1 
ATOM   2726 C CA  . ARG A 1 364 ? 9.522   46.090  23.240  1.00 28.62 ? 408  ARG A CA  1 
ATOM   2727 C C   . ARG A 1 364 ? 10.857  45.331  23.470  1.00 28.71 ? 408  ARG A C   1 
ATOM   2728 O O   . ARG A 1 364 ? 11.912  45.699  22.917  1.00 29.88 ? 408  ARG A O   1 
ATOM   2729 C CB  . ARG A 1 364 ? 8.856   45.845  21.864  1.00 28.90 ? 408  ARG A CB  1 
ATOM   2730 C CG  . ARG A 1 364 ? 9.057   44.494  21.230  1.00 33.11 ? 408  ARG A CG  1 
ATOM   2731 C CD  . ARG A 1 364 ? 8.250   44.404  19.862  1.00 35.16 ? 408  ARG A CD  1 
ATOM   2732 N NE  . ARG A 1 364 ? 7.695   43.057  19.666  1.00 50.12 ? 408  ARG A NE  1 
ATOM   2733 C CZ  . ARG A 1 364 ? 7.733   42.352  18.522  1.00 55.38 ? 408  ARG A CZ  1 
ATOM   2734 N NH1 . ARG A 1 364 ? 8.329   42.841  17.420  1.00 56.07 ? 408  ARG A NH1 1 
ATOM   2735 N NH2 . ARG A 1 364 ? 7.192   41.121  18.491  1.00 56.51 ? 408  ARG A NH2 1 
ATOM   2736 N N   . LYS A 1 365 ? 10.810  44.259  24.260  1.00 28.07 ? 409  LYS A N   1 
ATOM   2737 C CA  . LYS A 1 365 ? 11.973  43.448  24.562  1.00 29.38 ? 409  LYS A CA  1 
ATOM   2738 C C   . LYS A 1 365 ? 12.518  42.844  23.260  1.00 30.16 ? 409  LYS A C   1 
ATOM   2739 O O   . LYS A 1 365 ? 11.716  42.489  22.411  1.00 29.73 ? 409  LYS A O   1 
ATOM   2740 C CB  . LYS A 1 365 ? 11.507  42.289  25.491  1.00 30.38 ? 409  LYS A CB  1 
ATOM   2741 C CG  . LYS A 1 365 ? 12.574  41.230  25.686  1.00 31.15 ? 409  LYS A CG  1 
ATOM   2742 C CD  . LYS A 1 365 ? 12.258  40.253  26.776  1.00 38.62 ? 409  LYS A CD  1 
ATOM   2743 C CE  . LYS A 1 365 ? 11.018  39.430  26.486  1.00 39.57 ? 409  LYS A CE  1 
ATOM   2744 N NZ  . LYS A 1 365 ? 10.827  38.320  27.539  1.00 46.52 ? 409  LYS A NZ  1 
ATOM   2745 N N   . PRO A 1 366 ? 13.876  42.761  23.071  1.00 30.48 ? 410  PRO A N   1 
ATOM   2746 C CA  . PRO A 1 366 ? 14.436  41.978  21.976  1.00 31.28 ? 410  PRO A CA  1 
ATOM   2747 C C   . PRO A 1 366 ? 13.998  40.507  22.055  1.00 34.91 ? 410  PRO A C   1 
ATOM   2748 O O   . PRO A 1 366 ? 14.041  39.916  23.126  1.00 33.59 ? 410  PRO A O   1 
ATOM   2749 C CB  . PRO A 1 366 ? 15.909  42.054  22.251  1.00 30.32 ? 410  PRO A CB  1 
ATOM   2750 C CG  . PRO A 1 366 ? 16.059  43.441  22.900  1.00 31.21 ? 410  PRO A CG  1 
ATOM   2751 C CD  . PRO A 1 366 ? 14.936  43.402  23.868  1.00 30.06 ? 410  PRO A CD  1 
ATOM   2752 N N   . GLU A 1 367 ? 13.603  39.924  20.936  1.00 38.42 ? 411  GLU A N   1 
ATOM   2753 C CA  . GLU A 1 367 ? 13.082  38.558  20.913  1.00 42.89 ? 411  GLU A CA  1 
ATOM   2754 C C   . GLU A 1 367 ? 13.995  37.544  21.650  1.00 43.69 ? 411  GLU A C   1 
ATOM   2755 O O   . GLU A 1 367 ? 13.538  36.689  22.424  1.00 44.30 ? 411  GLU A O   1 
ATOM   2756 C CB  . GLU A 1 367 ? 12.860  38.102  19.449  1.00 43.97 ? 411  GLU A CB  1 
ATOM   2757 C CG  . GLU A 1 367 ? 11.856  38.942  18.642  1.00 50.28 ? 411  GLU A CG  1 
ATOM   2758 C CD  . GLU A 1 367 ? 10.395  38.823  19.140  1.00 56.92 ? 411  GLU A CD  1 
ATOM   2759 O OE1 . GLU A 1 367 ? 9.801   37.723  19.017  1.00 60.84 ? 411  GLU A OE1 1 
ATOM   2760 O OE2 . GLU A 1 367 ? 9.830   39.836  19.636  1.00 59.13 ? 411  GLU A OE2 1 
ATOM   2761 N N   . ASN A 1 368 ? 15.287  37.657  21.411  1.00 44.58 ? 412  ASN A N   1 
ATOM   2762 C CA  . ASN A 1 368 ? 16.242  36.690  21.929  1.00 45.76 ? 412  ASN A CA  1 
ATOM   2763 C C   . ASN A 1 368 ? 16.947  37.103  23.228  1.00 46.10 ? 412  ASN A C   1 
ATOM   2764 O O   . ASN A 1 368 ? 18.024  36.571  23.545  1.00 46.83 ? 412  ASN A O   1 
ATOM   2765 C CB  . ASN A 1 368 ? 17.277  36.358  20.842  1.00 46.04 ? 412  ASN A CB  1 
ATOM   2766 C CG  . ASN A 1 368 ? 16.764  35.321  19.842  1.00 49.77 ? 412  ASN A CG  1 
ATOM   2767 O OD1 . ASN A 1 368 ? 16.254  34.247  20.229  1.00 53.85 ? 412  ASN A OD1 1 
ATOM   2768 N ND2 . ASN A 1 368 ? 16.909  35.623  18.553  1.00 52.09 ? 412  ASN A ND2 1 
ATOM   2769 N N   . SER A 1 369 ? 16.342  38.037  23.973  1.00 45.03 ? 413  SER A N   1 
ATOM   2770 C CA  . SER A 1 369 ? 16.855  38.458  25.269  1.00 43.97 ? 413  SER A CA  1 
ATOM   2771 C C   . SER A 1 369 ? 16.166  37.719  26.435  1.00 43.33 ? 413  SER A C   1 
ATOM   2772 O O   . SER A 1 369 ? 15.022  37.230  26.324  1.00 43.69 ? 413  SER A O   1 
ATOM   2773 C CB  . SER A 1 369 ? 16.706  39.974  25.439  1.00 44.78 ? 413  SER A CB  1 
ATOM   2774 O OG  . SER A 1 369 ? 17.873  40.635  24.987  1.00 45.45 ? 413  SER A OG  1 
ATOM   2775 N N   . GLU A 1 370 ? 16.899  37.641  27.539  1.00 41.44 ? 414  GLU A N   1 
ATOM   2776 C CA  . GLU A 1 370 ? 16.466  37.032  28.787  1.00 40.46 ? 414  GLU A CA  1 
ATOM   2777 C C   . GLU A 1 370 ? 16.135  38.191  29.753  1.00 38.28 ? 414  GLU A C   1 
ATOM   2778 O O   . GLU A 1 370 ? 16.914  39.152  29.838  1.00 36.23 ? 414  GLU A O   1 
ATOM   2779 C CB  . GLU A 1 370 ? 17.636  36.219  29.348  1.00 41.70 ? 414  GLU A CB  1 
ATOM   2780 C CG  . GLU A 1 370 ? 18.506  35.442  28.275  1.00 46.39 ? 414  GLU A CG  1 
ATOM   2781 C CD  . GLU A 1 370 ? 19.422  36.340  27.343  1.00 54.47 ? 414  GLU A CD  1 
ATOM   2782 O OE1 . GLU A 1 370 ? 20.048  37.329  27.801  1.00 56.81 ? 414  GLU A OE1 1 
ATOM   2783 O OE2 . GLU A 1 370 ? 19.532  36.027  26.127  1.00 56.56 ? 414  GLU A OE2 1 
ATOM   2784 N N   . CYS A 1 371 ? 14.990  38.130  30.446  1.00 35.52 ? 415  CYS A N   1 
ATOM   2785 C CA  . CYS A 1 371 ? 14.647  39.163  31.458  1.00 35.28 ? 415  CYS A CA  1 
ATOM   2786 C C   . CYS A 1 371 ? 15.593  39.129  32.663  1.00 33.49 ? 415  CYS A C   1 
ATOM   2787 O O   . CYS A 1 371 ? 15.817  38.066  33.223  1.00 33.39 ? 415  CYS A O   1 
ATOM   2788 C CB  . CYS A 1 371 ? 13.187  39.037  31.945  1.00 34.96 ? 415  CYS A CB  1 
ATOM   2789 S SG  . CYS A 1 371 ? 11.932  39.234  30.616  1.00 40.33 ? 415  CYS A SG  1 
ATOM   2790 N N   . ASP A 1 372 ? 16.144  40.282  33.061  1.00 30.99 ? 416  ASP A N   1 
ATOM   2791 C CA  . ASP A 1 372 ? 17.111  40.334  34.165  1.00 30.00 ? 416  ASP A CA  1 
ATOM   2792 C C   . ASP A 1 372 ? 16.477  40.240  35.570  1.00 29.71 ? 416  ASP A C   1 
ATOM   2793 O O   . ASP A 1 372 ? 15.275  39.902  35.727  1.00 29.39 ? 416  ASP A O   1 
ATOM   2794 C CB  . ASP A 1 372 ? 18.095  41.546  34.038  1.00 29.78 ? 416  ASP A CB  1 
ATOM   2795 C CG  . ASP A 1 372 ? 17.450  42.909  34.379  1.00 31.82 ? 416  ASP A CG  1 
ATOM   2796 O OD1 . ASP A 1 372 ? 16.406  42.964  35.037  1.00 32.43 ? 416  ASP A OD1 1 
ATOM   2797 O OD2 . ASP A 1 372 ? 17.995  43.962  33.983  1.00 33.51 ? 416  ASP A OD2 1 
ATOM   2798 N N   . ALA A 1 373 ? 17.286  40.517  36.588  1.00 28.14 ? 417  ALA A N   1 
ATOM   2799 C CA  . ALA A 1 373 ? 16.831  40.399  37.951  1.00 27.60 ? 417  ALA A CA  1 
ATOM   2800 C C   . ALA A 1 373 ? 15.822  41.457  38.366  1.00 27.05 ? 417  ALA A C   1 
ATOM   2801 O O   . ALA A 1 373 ? 15.138  41.275  39.341  1.00 25.65 ? 417  ALA A O   1 
ATOM   2802 C CB  . ALA A 1 373 ? 17.989  40.370  38.896  1.00 28.76 ? 417  ALA A CB  1 
ATOM   2803 N N   . THR A 1 374 ? 15.694  42.547  37.618  1.00 26.40 ? 418  THR A N   1 
ATOM   2804 C CA  . THR A 1 374 ? 14.653  43.503  37.934  1.00 26.73 ? 418  THR A CA  1 
ATOM   2805 C C   . THR A 1 374 ? 13.235  43.046  37.518  1.00 27.42 ? 418  THR A C   1 
ATOM   2806 O O   . THR A 1 374 ? 12.260  43.709  37.858  1.00 26.18 ? 418  THR A O   1 
ATOM   2807 C CB  . THR A 1 374 ? 14.936  44.856  37.276  1.00 27.56 ? 418  THR A CB  1 
ATOM   2808 O OG1 . THR A 1 374 ? 14.758  44.733  35.862  1.00 28.40 ? 418  THR A OG1 1 
ATOM   2809 C CG2 . THR A 1 374 ? 16.365  45.304  37.593  1.00 24.41 ? 418  THR A CG2 1 
ATOM   2810 N N   . ALA A 1 375 ? 13.130  41.943  36.760  1.00 27.99 ? 419  ALA A N   1 
ATOM   2811 C CA  . ALA A 1 375 ? 11.850  41.526  36.152  1.00 27.84 ? 419  ALA A CA  1 
ATOM   2812 C C   . ALA A 1 375 ? 11.045  40.650  37.109  1.00 29.17 ? 419  ALA A C   1 
ATOM   2813 O O   . ALA A 1 375 ? 11.555  39.625  37.574  1.00 28.74 ? 419  ALA A O   1 
ATOM   2814 C CB  . ALA A 1 375 ? 12.086  40.782  34.844  1.00 26.98 ? 419  ALA A CB  1 
ATOM   2815 N N   . LYS A 1 376 ? 9.812   41.077  37.411  1.00 30.57 ? 420  LYS A N   1 
ATOM   2816 C CA  . LYS A 1 376 ? 8.839   40.333  38.209  1.00 33.63 ? 420  LYS A CA  1 
ATOM   2817 C C   . LYS A 1 376 ? 8.517   38.998  37.502  1.00 34.18 ? 420  LYS A C   1 
ATOM   2818 O O   . LYS A 1 376 ? 8.420   37.953  38.133  1.00 32.62 ? 420  LYS A O   1 
ATOM   2819 C CB  . LYS A 1 376 ? 7.590   41.232  38.378  1.00 34.03 ? 420  LYS A CB  1 
ATOM   2820 C CG  . LYS A 1 376 ? 6.313   40.594  38.891  1.00 38.73 ? 420  LYS A CG  1 
ATOM   2821 C CD  . LYS A 1 376 ? 5.085   41.578  38.868  1.00 37.11 ? 420  LYS A CD  1 
ATOM   2822 C CE  . LYS A 1 376 ? 4.900   42.390  37.564  1.00 43.49 ? 420  LYS A CE  1 
ATOM   2823 N NZ  . LYS A 1 376 ? 4.032   41.673  36.552  1.00 46.44 ? 420  LYS A NZ  1 
ATOM   2824 N N   . ASN A 1 377 ? 8.389   39.050  36.182  1.00 35.71 ? 421  ASN A N   1 
ATOM   2825 C CA  . ASN A 1 377 ? 8.039   37.897  35.360  1.00 38.87 ? 421  ASN A CA  1 
ATOM   2826 C C   . ASN A 1 377 ? 9.145   37.558  34.353  1.00 40.17 ? 421  ASN A C   1 
ATOM   2827 O O   . ASN A 1 377 ? 9.557   38.390  33.521  1.00 41.24 ? 421  ASN A O   1 
ATOM   2828 C CB  . ASN A 1 377 ? 6.728   38.207  34.642  1.00 39.75 ? 421  ASN A CB  1 
ATOM   2829 C CG  . ASN A 1 377 ? 6.108   36.993  33.961  1.00 41.09 ? 421  ASN A CG  1 
ATOM   2830 O OD1 . ASN A 1 377 ? 6.782   36.194  33.301  1.00 41.78 ? 421  ASN A OD1 1 
ATOM   2831 N ND2 . ASN A 1 377 ? 4.798   36.876  34.097  1.00 44.07 ? 421  ASN A ND2 1 
ATOM   2832 N N   . LYS A 1 378 ? 9.644   36.338  34.420  1.00 41.92 ? 422  LYS A N   1 
ATOM   2833 C CA  . LYS A 1 378 ? 10.778  35.924  33.586  1.00 43.49 ? 422  LYS A CA  1 
ATOM   2834 C C   . LYS A 1 378 ? 10.450  35.713  32.091  1.00 43.46 ? 422  LYS A C   1 
ATOM   2835 O O   . LYS A 1 378 ? 11.350  35.464  31.297  1.00 44.17 ? 422  LYS A O   1 
ATOM   2836 C CB  . LYS A 1 378 ? 11.453  34.700  34.213  1.00 44.16 ? 422  LYS A CB  1 
ATOM   2837 C CG  . LYS A 1 378 ? 12.630  34.086  33.445  1.00 48.04 ? 422  LYS A CG  1 
ATOM   2838 C CD  . LYS A 1 378 ? 13.875  35.018  33.328  1.00 52.60 ? 422  LYS A CD  1 
ATOM   2839 C CE  . LYS A 1 378 ? 15.192  34.187  33.365  1.00 55.01 ? 422  LYS A CE  1 
ATOM   2840 N NZ  . LYS A 1 378 ? 15.258  33.303  34.587  1.00 53.14 ? 422  LYS A NZ  1 
ATOM   2841 N N   . ASN A 1 379 ? 9.185   35.823  31.696  1.00 43.67 ? 423  ASN A N   1 
ATOM   2842 C CA  . ASN A 1 379 ? 8.833   35.723  30.275  1.00 44.51 ? 423  ASN A CA  1 
ATOM   2843 C C   . ASN A 1 379 ? 8.196   37.009  29.723  1.00 44.18 ? 423  ASN A C   1 
ATOM   2844 O O   . ASN A 1 379 ? 7.687   37.015  28.593  1.00 45.99 ? 423  ASN A O   1 
ATOM   2845 C CB  . ASN A 1 379 ? 7.885   34.528  29.984  1.00 44.36 ? 423  ASN A CB  1 
ATOM   2846 C CG  . ASN A 1 379 ? 8.448   33.162  30.440  1.00 46.37 ? 423  ASN A CG  1 
ATOM   2847 O OD1 . ASN A 1 379 ? 9.586   32.783  30.117  1.00 47.48 ? 423  ASN A OD1 1 
ATOM   2848 N ND2 . ASN A 1 379 ? 7.619   32.403  31.171  1.00 45.63 ? 423  ASN A ND2 1 
ATOM   2849 N N   . GLU A 1 380 ? 8.199   38.091  30.498  1.00 43.11 ? 424  GLU A N   1 
ATOM   2850 C CA  . GLU A 1 380 ? 7.472   39.301  30.114  1.00 40.90 ? 424  GLU A CA  1 
ATOM   2851 C C   . GLU A 1 380 ? 8.209   40.450  30.741  1.00 38.87 ? 424  GLU A C   1 
ATOM   2852 O O   . GLU A 1 380 ? 8.255   40.526  31.959  1.00 39.64 ? 424  GLU A O   1 
ATOM   2853 C CB  . GLU A 1 380 ? 6.023   39.255  30.623  1.00 42.18 ? 424  GLU A CB  1 
ATOM   2854 C CG  . GLU A 1 380 ? 5.227   40.624  30.647  1.00 46.16 ? 424  GLU A CG  1 
ATOM   2855 C CD  . GLU A 1 380 ? 5.408   41.486  31.956  1.00 53.53 ? 424  GLU A CD  1 
ATOM   2856 O OE1 . GLU A 1 380 ? 5.442   40.935  33.110  1.00 54.86 ? 424  GLU A OE1 1 
ATOM   2857 O OE2 . GLU A 1 380 ? 5.493   42.740  31.806  1.00 55.19 ? 424  GLU A OE2 1 
ATOM   2858 N N   . CYS A 1 381 ? 8.814   41.306  29.911  1.00 34.07 ? 425  CYS A N   1 
ATOM   2859 C CA  . CYS A 1 381 ? 9.544   42.456  30.364  1.00 31.75 ? 425  CYS A CA  1 
ATOM   2860 C C   . CYS A 1 381 ? 9.736   43.426  29.192  1.00 29.37 ? 425  CYS A C   1 
ATOM   2861 O O   . CYS A 1 381 ? 9.042   43.309  28.175  1.00 29.09 ? 425  CYS A O   1 
ATOM   2862 C CB  . CYS A 1 381 ? 10.890  42.078  30.979  1.00 32.26 ? 425  CYS A CB  1 
ATOM   2863 S SG  . CYS A 1 381 ? 12.043  41.193  29.933  1.00 34.29 ? 425  CYS A SG  1 
ATOM   2864 N N   . SER A 1 382 ? 10.624  44.398  29.346  1.00 25.78 ? 426  SER A N   1 
ATOM   2865 C CA  . SER A 1 382 ? 10.766  45.406  28.328  1.00 24.61 ? 426  SER A CA  1 
ATOM   2866 C C   . SER A 1 382 ? 12.221  45.883  28.270  1.00 22.80 ? 426  SER A C   1 
ATOM   2867 O O   . SER A 1 382 ? 13.044  45.501  29.070  1.00 22.09 ? 426  SER A O   1 
ATOM   2868 C CB  . SER A 1 382 ? 9.752   46.536  28.574  1.00 26.51 ? 426  SER A CB  1 
ATOM   2869 O OG  . SER A 1 382 ? 9.927   47.113  29.861  1.00 30.15 ? 426  SER A OG  1 
ATOM   2870 N N   . LEU A 1 383 ? 12.551  46.637  27.270  1.00 21.10 ? 427  LEU A N   1 
ATOM   2871 C CA  . LEU A 1 383 ? 13.900  47.195  27.122  1.00 21.94 ? 427  LEU A CA  1 
ATOM   2872 C C   . LEU A 1 383 ? 13.973  48.576  27.820  1.00 22.49 ? 427  LEU A C   1 
ATOM   2873 O O   . LEU A 1 383 ? 13.051  49.420  27.715  1.00 20.90 ? 427  LEU A O   1 
ATOM   2874 C CB  . LEU A 1 383 ? 14.252  47.290  25.647  1.00 20.16 ? 427  LEU A CB  1 
ATOM   2875 C CG  . LEU A 1 383 ? 15.601  47.952  25.314  1.00 24.28 ? 427  LEU A CG  1 
ATOM   2876 C CD1 . LEU A 1 383 ? 16.749  47.130  25.835  1.00 19.47 ? 427  LEU A CD1 1 
ATOM   2877 C CD2 . LEU A 1 383 ? 15.739  48.077  23.829  1.00 22.45 ? 427  LEU A CD2 1 
ATOM   2878 N N   . HIS A 1 384 ? 15.035  48.799  28.599  1.00 20.98 ? 428  HIS A N   1 
ATOM   2879 C CA  . HIS A 1 384 ? 15.215  50.115  29.191  1.00 20.32 ? 428  HIS A CA  1 
ATOM   2880 C C   . HIS A 1 384 ? 16.553  50.604  28.699  1.00 21.63 ? 428  HIS A C   1 
ATOM   2881 O O   . HIS A 1 384 ? 17.398  49.799  28.399  1.00 22.69 ? 428  HIS A O   1 
ATOM   2882 C CB  . HIS A 1 384 ? 15.196  49.984  30.696  1.00 20.83 ? 428  HIS A CB  1 
ATOM   2883 C CG  . HIS A 1 384 ? 13.879  49.410  31.180  1.00 18.59 ? 428  HIS A CG  1 
ATOM   2884 N ND1 . HIS A 1 384 ? 12.772  50.193  31.366  1.00 17.45 ? 428  HIS A ND1 1 
ATOM   2885 C CD2 . HIS A 1 384 ? 13.477  48.146  31.354  1.00 21.08 ? 428  HIS A CD2 1 
ATOM   2886 C CE1 . HIS A 1 384 ? 11.746  49.443  31.736  1.00 19.59 ? 428  HIS A CE1 1 
ATOM   2887 N NE2 . HIS A 1 384 ? 12.157  48.185  31.733  1.00 21.45 ? 428  HIS A NE2 1 
ATOM   2888 N N   . ILE A 1 385 ? 16.710  51.912  28.628  1.00 21.24 ? 429  ILE A N   1 
ATOM   2889 C CA  . ILE A 1 385 ? 17.837  52.559  27.902  1.00 21.99 ? 429  ILE A CA  1 
ATOM   2890 C C   . ILE A 1 385 ? 18.622  53.369  28.917  1.00 23.03 ? 429  ILE A C   1 
ATOM   2891 O O   . ILE A 1 385 ? 18.030  54.122  29.673  1.00 22.82 ? 429  ILE A O   1 
ATOM   2892 C CB  . ILE A 1 385 ? 17.285  53.489  26.838  1.00 21.56 ? 429  ILE A CB  1 
ATOM   2893 C CG1 . ILE A 1 385 ? 16.452  52.733  25.786  1.00 22.56 ? 429  ILE A CG1 1 
ATOM   2894 C CG2 . ILE A 1 385 ? 18.420  54.363  26.135  1.00 24.11 ? 429  ILE A CG2 1 
ATOM   2895 C CD1 . ILE A 1 385 ? 17.292  51.558  25.048  1.00 22.96 ? 429  ILE A CD1 1 
ATOM   2896 N N   . HIS A 1 386 ? 19.946  53.252  28.896  1.00 22.57 ? 430  HIS A N   1 
ATOM   2897 C CA  . HIS A 1 386 ? 20.817  54.071  29.730  1.00 23.13 ? 430  HIS A CA  1 
ATOM   2898 C C   . HIS A 1 386 ? 21.136  55.385  29.028  1.00 24.03 ? 430  HIS A C   1 
ATOM   2899 O O   . HIS A 1 386 ? 21.592  55.406  27.853  1.00 23.34 ? 430  HIS A O   1 
ATOM   2900 C CB  . HIS A 1 386 ? 22.145  53.350  29.975  1.00 23.61 ? 430  HIS A CB  1 
ATOM   2901 C CG  . HIS A 1 386 ? 22.020  52.144  30.845  1.00 23.23 ? 430  HIS A CG  1 
ATOM   2902 N ND1 . HIS A 1 386 ? 21.737  52.240  32.190  1.00 25.56 ? 430  HIS A ND1 1 
ATOM   2903 C CD2 . HIS A 1 386 ? 22.176  50.820  30.577  1.00 22.97 ? 430  HIS A CD2 1 
ATOM   2904 C CE1 . HIS A 1 386 ? 21.697  51.010  32.715  1.00 26.41 ? 430  HIS A CE1 1 
ATOM   2905 N NE2 . HIS A 1 386 ? 21.922  50.133  31.745  1.00 26.10 ? 430  HIS A NE2 1 
ATOM   2906 N N   . ALA A 1 387 ? 20.936  56.497  29.742  1.00 22.22 ? 431  ALA A N   1 
ATOM   2907 C CA  . ALA A 1 387 ? 21.277  57.755  29.108  1.00 23.41 ? 431  ALA A CA  1 
ATOM   2908 C C   . ALA A 1 387 ? 21.920  58.697  30.116  1.00 23.94 ? 431  ALA A C   1 
ATOM   2909 O O   . ALA A 1 387 ? 22.720  58.238  30.950  1.00 24.17 ? 431  ALA A O   1 
ATOM   2910 C CB  . ALA A 1 387 ? 20.066  58.332  28.389  1.00 19.28 ? 431  ALA A CB  1 
ATOM   2911 N N   . SER A 1 388 ? 21.649  59.996  30.025  1.00 24.98 ? 432  SER A N   1 
ATOM   2912 C CA  . SER A 1 388 ? 22.315  60.938  30.918  1.00 26.80 ? 432  SER A CA  1 
ATOM   2913 C C   . SER A 1 388 ? 22.247  60.574  32.362  1.00 25.81 ? 432  SER A C   1 
ATOM   2914 O O   . SER A 1 388 ? 23.216  60.709  33.069  1.00 27.85 ? 432  SER A O   1 
ATOM   2915 C CB  . SER A 1 388 ? 21.718  62.328  30.784  1.00 26.37 ? 432  SER A CB  1 
ATOM   2916 O OG  . SER A 1 388 ? 21.952  62.819  29.489  1.00 34.67 ? 432  SER A OG  1 
ATOM   2917 N N   . TYR A 1 389 ? 21.100  60.176  32.873  1.00 27.48 ? 433  TYR A N   1 
ATOM   2918 C CA  . TYR A 1 389 ? 21.063  59.928  34.308  1.00 26.92 ? 433  TYR A CA  1 
ATOM   2919 C C   . TYR A 1 389 ? 21.911  58.751  34.706  1.00 26.72 ? 433  TYR A C   1 
ATOM   2920 O O   . TYR A 1 389 ? 22.663  58.812  35.680  1.00 27.92 ? 433  TYR A O   1 
ATOM   2921 C CB  . TYR A 1 389 ? 19.623  59.725  34.778  1.00 28.04 ? 433  TYR A CB  1 
ATOM   2922 C CG  . TYR A 1 389 ? 19.570  59.529  36.265  1.00 29.27 ? 433  TYR A CG  1 
ATOM   2923 C CD1 . TYR A 1 389 ? 19.812  60.606  37.148  1.00 28.14 ? 433  TYR A CD1 1 
ATOM   2924 C CD2 . TYR A 1 389 ? 19.287  58.276  36.807  1.00 30.31 ? 433  TYR A CD2 1 
ATOM   2925 C CE1 . TYR A 1 389 ? 19.770  60.409  38.543  1.00 27.92 ? 433  TYR A CE1 1 
ATOM   2926 C CE2 . TYR A 1 389 ? 19.242  58.085  38.165  1.00 30.15 ? 433  TYR A CE2 1 
ATOM   2927 C CZ  . TYR A 1 389 ? 19.478  59.147  39.027  1.00 28.90 ? 433  TYR A CZ  1 
ATOM   2928 O OH  . TYR A 1 389 ? 19.441  58.896  40.371  1.00 29.51 ? 433  TYR A OH  1 
ATOM   2929 N N   . SER A 1 390 ? 21.802  57.648  33.980  1.00 25.88 ? 434  SER A N   1 
ATOM   2930 C CA  . SER A 1 390 ? 22.705  56.499  34.175  1.00 25.48 ? 434  SER A CA  1 
ATOM   2931 C C   . SER A 1 390 ? 24.171  56.876  34.203  1.00 26.97 ? 434  SER A C   1 
ATOM   2932 O O   . SER A 1 390 ? 24.934  56.411  35.053  1.00 28.85 ? 434  SER A O   1 
ATOM   2933 C CB  . SER A 1 390 ? 22.473  55.490  33.035  1.00 25.57 ? 434  SER A CB  1 
ATOM   2934 O OG  . SER A 1 390 ? 21.346  54.639  33.333  1.00 24.30 ? 434  SER A OG  1 
ATOM   2935 N N   . ILE A 1 391 ? 24.599  57.681  33.251  1.00 26.85 ? 435  ILE A N   1 
ATOM   2936 C CA  . ILE A 1 391 ? 25.992  58.138  33.160  1.00 27.81 ? 435  ILE A CA  1 
ATOM   2937 C C   . ILE A 1 391 ? 26.368  58.978  34.394  1.00 27.90 ? 435  ILE A C   1 
ATOM   2938 O O   . ILE A 1 391 ? 27.412  58.777  34.987  1.00 29.07 ? 435  ILE A O   1 
ATOM   2939 C CB  . ILE A 1 391 ? 26.154  58.970  31.843  1.00 27.84 ? 435  ILE A CB  1 
ATOM   2940 C CG1 . ILE A 1 391 ? 25.890  58.083  30.621  1.00 28.26 ? 435  ILE A CG1 1 
ATOM   2941 C CG2 . ILE A 1 391 ? 27.550  59.648  31.720  1.00 28.65 ? 435  ILE A CG2 1 
ATOM   2942 C CD1 . ILE A 1 391 ? 25.716  58.900  29.287  1.00 30.33 ? 435  ILE A CD1 1 
ATOM   2943 N N   . SER A 1 392 ? 25.516  59.918  34.791  1.00 28.58 ? 436  SER A N   1 
ATOM   2944 C CA  . SER A 1 392 ? 25.783  60.719  35.981  1.00 29.77 ? 436  SER A CA  1 
ATOM   2945 C C   . SER A 1 392 ? 25.858  59.901  37.264  1.00 30.01 ? 436  SER A C   1 
ATOM   2946 O O   . SER A 1 392 ? 26.546  60.293  38.196  1.00 30.35 ? 436  SER A O   1 
ATOM   2947 C CB  . SER A 1 392 ? 24.702  61.788  36.115  1.00 30.69 ? 436  SER A CB  1 
ATOM   2948 O OG  . SER A 1 392 ? 23.553  61.231  36.746  1.00 34.82 ? 436  SER A OG  1 
ATOM   2949 N N   . GLN A 1 393 ? 25.159  58.753  37.325  1.00 30.59 ? 437  GLN A N   1 
ATOM   2950 C CA  . GLN A 1 393 ? 25.211  57.840  38.500  1.00 31.56 ? 437  GLN A CA  1 
ATOM   2951 C C   . GLN A 1 393 ? 26.379  56.852  38.473  1.00 31.30 ? 437  GLN A C   1 
ATOM   2952 O O   . GLN A 1 393 ? 26.456  55.939  39.285  1.00 31.75 ? 437  GLN A O   1 
ATOM   2953 C CB  . GLN A 1 393 ? 23.875  57.100  38.664  1.00 31.02 ? 437  GLN A CB  1 
ATOM   2954 C CG  . GLN A 1 393 ? 22.670  58.025  38.976  1.00 32.03 ? 437  GLN A CG  1 
ATOM   2955 C CD  . GLN A 1 393 ? 22.865  58.874  40.245  1.00 36.44 ? 437  GLN A CD  1 
ATOM   2956 O OE1 . GLN A 1 393 ? 22.900  58.340  41.335  1.00 37.36 ? 437  GLN A OE1 1 
ATOM   2957 N NE2 . GLN A 1 393 ? 22.979  60.192  40.088  1.00 34.86 ? 437  GLN A NE2 1 
ATOM   2958 N N   . LYS A 1 394 ? 27.288  57.056  37.528  1.00 32.23 ? 438  LYS A N   1 
ATOM   2959 C CA  . LYS A 1 394 ? 28.525  56.264  37.406  1.00 32.88 ? 438  LYS A CA  1 
ATOM   2960 C C   . LYS A 1 394 ? 28.267  54.815  37.054  1.00 32.15 ? 438  LYS A C   1 
ATOM   2961 O O   . LYS A 1 394 ? 29.048  53.924  37.421  1.00 32.39 ? 438  LYS A O   1 
ATOM   2962 C CB  . LYS A 1 394 ? 29.445  56.390  38.663  1.00 34.18 ? 438  LYS A CB  1 
ATOM   2963 C CG  . LYS A 1 394 ? 29.722  57.854  39.090  1.00 38.43 ? 438  LYS A CG  1 
ATOM   2964 C CD  . LYS A 1 394 ? 30.883  58.481  38.303  1.00 43.43 ? 438  LYS A CD  1 
ATOM   2965 C CE  . LYS A 1 394 ? 31.053  59.984  38.624  1.00 43.48 ? 438  LYS A CE  1 
ATOM   2966 N NZ  . LYS A 1 394 ? 30.532  60.877  37.520  1.00 47.11 ? 438  LYS A NZ  1 
ATOM   2967 N N   . LEU A 1 395 ? 27.208  54.550  36.301  1.00 30.92 ? 439  LEU A N   1 
ATOM   2968 C CA  . LEU A 1 395 ? 27.090  53.222  35.737  1.00 29.28 ? 439  LEU A CA  1 
ATOM   2969 C C   . LEU A 1 395 ? 28.121  53.084  34.606  1.00 29.11 ? 439  LEU A C   1 
ATOM   2970 O O   . LEU A 1 395 ? 28.641  54.077  34.084  1.00 29.14 ? 439  LEU A O   1 
ATOM   2971 C CB  . LEU A 1 395 ? 25.693  52.962  35.240  1.00 29.11 ? 439  LEU A CB  1 
ATOM   2972 C CG  . LEU A 1 395 ? 24.604  53.005  36.333  1.00 28.55 ? 439  LEU A CG  1 
ATOM   2973 C CD1 . LEU A 1 395 ? 23.315  52.467  35.739  1.00 25.95 ? 439  LEU A CD1 1 
ATOM   2974 C CD2 . LEU A 1 395 ? 25.060  52.215  37.606  1.00 27.39 ? 439  LEU A CD2 1 
ATOM   2975 N N   . ASN A 1 396 ? 28.397  51.846  34.218  1.00 29.03 ? 440  ASN A N   1 
ATOM   2976 C CA  . ASN A 1 396 ? 29.373  51.586  33.143  1.00 29.16 ? 440  ASN A CA  1 
ATOM   2977 C C   . ASN A 1 396 ? 28.816  51.840  31.744  1.00 28.80 ? 440  ASN A C   1 
ATOM   2978 O O   . ASN A 1 396 ? 28.585  50.908  30.990  1.00 28.85 ? 440  ASN A O   1 
ATOM   2979 C CB  . ASN A 1 396 ? 29.900  50.166  33.227  1.00 30.56 ? 440  ASN A CB  1 
ATOM   2980 C CG  . ASN A 1 396 ? 31.279  50.063  32.660  1.00 33.29 ? 440  ASN A CG  1 
ATOM   2981 O OD1 . ASN A 1 396 ? 31.660  50.869  31.798  1.00 37.07 ? 440  ASN A OD1 1 
ATOM   2982 N ND2 . ASN A 1 396 ? 32.040  49.106  33.133  1.00 40.20 ? 440  ASN A ND2 1 
ATOM   2983 N N   . VAL A 1 397 ? 28.582  53.109  31.417  1.00 28.18 ? 441  VAL A N   1 
ATOM   2984 C CA  . VAL A 1 397 ? 27.848  53.490  30.191  1.00 27.99 ? 441  VAL A CA  1 
ATOM   2985 C C   . VAL A 1 397 ? 28.706  54.541  29.481  1.00 28.63 ? 441  VAL A C   1 
ATOM   2986 O O   . VAL A 1 397 ? 28.752  55.701  29.920  1.00 28.85 ? 441  VAL A O   1 
ATOM   2987 C CB  . VAL A 1 397 ? 26.457  54.013  30.525  1.00 26.93 ? 441  VAL A CB  1 
ATOM   2988 C CG1 . VAL A 1 397 ? 25.667  54.447  29.244  1.00 27.84 ? 441  VAL A CG1 1 
ATOM   2989 C CG2 . VAL A 1 397 ? 25.655  52.935  31.349  1.00 26.41 ? 441  VAL A CG2 1 
ATOM   2990 N N   . PRO A 1 398 ? 29.451  54.109  28.439  1.00 28.74 ? 442  PRO A N   1 
ATOM   2991 C CA  . PRO A 1 398 ? 30.368  54.914  27.655  1.00 29.42 ? 442  PRO A CA  1 
ATOM   2992 C C   . PRO A 1 398 ? 29.613  56.008  26.883  1.00 30.33 ? 442  PRO A C   1 
ATOM   2993 O O   . PRO A 1 398 ? 30.117  57.113  26.716  1.00 32.24 ? 442  PRO A O   1 
ATOM   2994 C CB  . PRO A 1 398 ? 30.913  53.920  26.613  1.00 28.72 ? 442  PRO A CB  1 
ATOM   2995 C CG  . PRO A 1 398 ? 30.652  52.582  27.130  1.00 29.56 ? 442  PRO A CG  1 
ATOM   2996 C CD  . PRO A 1 398 ? 29.413  52.714  27.973  1.00 29.49 ? 442  PRO A CD  1 
ATOM   2997 N N   . MET A 1 399 ? 28.443  55.698  26.365  1.00 29.10 ? 443  MET A N   1 
ATOM   2998 C CA  . MET A 1 399 ? 27.741  56.674  25.481  1.00 30.98 ? 443  MET A CA  1 
ATOM   2999 C C   . MET A 1 399 ? 26.282  56.658  25.723  1.00 29.40 ? 443  MET A C   1 
ATOM   3000 O O   . MET A 1 399 ? 25.749  55.624  26.075  1.00 26.94 ? 443  MET A O   1 
ATOM   3001 C CB  . MET A 1 399 ? 27.940  56.346  24.005  1.00 30.91 ? 443  MET A CB  1 
ATOM   3002 C CG  . MET A 1 399 ? 29.281  56.799  23.516  1.00 35.05 ? 443  MET A CG  1 
ATOM   3003 S SD  . MET A 1 399 ? 29.264  56.579  21.775  1.00 33.86 ? 443  MET A SD  1 
ATOM   3004 C CE  . MET A 1 399 ? 30.752  57.450  21.341  1.00 36.25 ? 443  MET A CE  1 
ATOM   3005 N N   . ALA A 1 400 ? 25.647  57.787  25.450  1.00 27.81 ? 444  ALA A N   1 
ATOM   3006 C CA  . ALA A 1 400 ? 24.203  57.874  25.437  1.00 29.20 ? 444  ALA A CA  1 
ATOM   3007 C C   . ALA A 1 400 ? 23.694  57.336  24.081  1.00 27.97 ? 444  ALA A C   1 
ATOM   3008 O O   . ALA A 1 400 ? 24.522  56.890  23.221  1.00 27.48 ? 444  ALA A O   1 
ATOM   3009 C CB  . ALA A 1 400 ? 23.747  59.332  25.684  1.00 30.80 ? 444  ALA A CB  1 
ATOM   3010 N N   . PRO A 1 401 ? 22.368  57.297  23.909  1.00 27.45 ? 445  PRO A N   1 
ATOM   3011 C CA  . PRO A 1 401 ? 21.727  56.790  22.665  1.00 26.38 ? 445  PRO A CA  1 
ATOM   3012 C C   . PRO A 1 401 ? 22.096  57.646  21.446  1.00 27.18 ? 445  PRO A C   1 
ATOM   3013 O O   . PRO A 1 401 ? 22.230  58.899  21.579  1.00 25.90 ? 445  PRO A O   1 
ATOM   3014 C CB  . PRO A 1 401 ? 20.272  56.975  22.956  1.00 27.79 ? 445  PRO A CB  1 
ATOM   3015 C CG  . PRO A 1 401 ? 20.165  56.835  24.491  1.00 27.14 ? 445  PRO A CG  1 
ATOM   3016 C CD  . PRO A 1 401 ? 21.335  57.732  24.874  1.00 27.15 ? 445  PRO A CD  1 
ATOM   3017 N N   . LEU A 1 402 ? 22.298  57.010  20.285  1.00 23.21 ? 446  LEU A N   1 
ATOM   3018 C CA  . LEU A 1 402 ? 22.750  57.757  19.111  1.00 23.31 ? 446  LEU A CA  1 
ATOM   3019 C C   . LEU A 1 402 ? 21.723  57.549  18.026  1.00 22.01 ? 446  LEU A C   1 
ATOM   3020 O O   . LEU A 1 402 ? 21.304  56.422  17.803  1.00 22.02 ? 446  LEU A O   1 
ATOM   3021 C CB  . LEU A 1 402 ? 24.046  57.144  18.600  1.00 22.99 ? 446  LEU A CB  1 
ATOM   3022 C CG  . LEU A 1 402 ? 24.633  57.694  17.289  1.00 25.81 ? 446  LEU A CG  1 
ATOM   3023 C CD1 . LEU A 1 402 ? 25.007  59.161  17.350  1.00 29.09 ? 446  LEU A CD1 1 
ATOM   3024 C CD2 . LEU A 1 402 ? 25.906  56.869  16.877  1.00 25.92 ? 446  LEU A CD2 1 
ATOM   3025 N N   . SER A 1 403 ? 21.294  58.597  17.335  1.00 23.94 ? 447  SER A N   1 
ATOM   3026 C CA  . SER A 1 403 ? 20.474  58.419  16.096  1.00 23.42 ? 447  SER A CA  1 
ATOM   3027 C C   . SER A 1 403 ? 20.835  59.609  15.227  1.00 24.36 ? 447  SER A C   1 
ATOM   3028 O O   . SER A 1 403 ? 21.337  60.582  15.779  1.00 25.26 ? 447  SER A O   1 
ATOM   3029 C CB  . SER A 1 403 ? 18.987  58.484  16.408  1.00 25.41 ? 447  SER A CB  1 
ATOM   3030 O OG  . SER A 1 403 ? 18.691  59.735  17.108  1.00 29.50 ? 447  SER A OG  1 
ATOM   3031 N N   . GLU A 1 404 ? 20.565  59.564  13.908  1.00 23.47 ? 448  GLU A N   1 
ATOM   3032 C CA  . GLU A 1 404 ? 20.980  60.699  13.024  1.00 24.68 ? 448  GLU A CA  1 
ATOM   3033 C C   . GLU A 1 404 ? 19.872  60.771  12.002  1.00 24.26 ? 448  GLU A C   1 
ATOM   3034 O O   . GLU A 1 404 ? 19.417  59.717  11.578  1.00 23.51 ? 448  GLU A O   1 
ATOM   3035 C CB  . GLU A 1 404 ? 22.356  60.364  12.295  1.00 24.74 ? 448  GLU A CB  1 
ATOM   3036 C CG  . GLU A 1 404 ? 23.585  60.105  13.154  1.00 31.12 ? 448  GLU A CG  1 
ATOM   3037 C CD  . GLU A 1 404 ? 24.268  61.438  13.579  1.00 40.38 ? 448  GLU A CD  1 
ATOM   3038 O OE1 . GLU A 1 404 ? 23.735  62.527  13.211  1.00 37.11 ? 448  GLU A OE1 1 
ATOM   3039 O OE2 . GLU A 1 404 ? 25.332  61.361  14.287  1.00 44.85 ? 448  GLU A OE2 1 
ATOM   3040 N N   . PRO A 1 405 ? 19.357  61.994  11.685  1.00 27.60 ? 449  PRO A N   1 
ATOM   3041 C CA  . PRO A 1 405 ? 18.215  62.246  10.770  1.00 28.84 ? 449  PRO A CA  1 
ATOM   3042 C C   . PRO A 1 405 ? 18.402  61.506  9.424   1.00 30.51 ? 449  PRO A C   1 
ATOM   3043 O O   . PRO A 1 405 ? 17.433  61.013  8.846   1.00 31.71 ? 449  PRO A O   1 
ATOM   3044 C CB  . PRO A 1 405 ? 18.328  63.739  10.505  1.00 29.62 ? 449  PRO A CB  1 
ATOM   3045 C CG  . PRO A 1 405 ? 18.880  64.300  11.642  1.00 29.65 ? 449  PRO A CG  1 
ATOM   3046 C CD  . PRO A 1 405 ? 19.782  63.258  12.335  1.00 27.51 ? 449  PRO A CD  1 
ATOM   3047 N N   . ASN A 1 406 ? 19.651  61.456  8.931   1.00 28.74 ? 450  ASN A N   1 
ATOM   3048 C CA  . ASN A 1 406 ? 19.957  60.864  7.626   1.00 29.48 ? 450  ASN A CA  1 
ATOM   3049 C C   . ASN A 1 406 ? 20.143  59.355  7.577   1.00 30.05 ? 450  ASN A C   1 
ATOM   3050 O O   . ASN A 1 406 ? 20.062  58.714  6.488   1.00 31.39 ? 450  ASN A O   1 
ATOM   3051 C CB  . ASN A 1 406 ? 21.180  61.604  7.002   1.00 29.11 ? 450  ASN A CB  1 
ATOM   3052 C CG  . ASN A 1 406 ? 22.379  61.705  7.982   1.00 28.64 ? 450  ASN A CG  1 
ATOM   3053 O OD1 . ASN A 1 406 ? 22.213  62.134  9.126   1.00 30.71 ? 450  ASN A OD1 1 
ATOM   3054 N ND2 . ASN A 1 406 ? 23.621  61.363  7.496   1.00 22.14 ? 450  ASN A ND2 1 
ATOM   3055 N N   . ALA A 1 407 ? 20.282  58.723  8.744   1.00 28.84 ? 451  ALA A N   1 
ATOM   3056 C CA  . ALA A 1 407 ? 20.298  57.261  8.807   1.00 26.13 ? 451  ALA A CA  1 
ATOM   3057 C C   . ALA A 1 407 ? 18.916  56.789  9.336   1.00 27.22 ? 451  ALA A C   1 
ATOM   3058 O O   . ALA A 1 407 ? 18.793  56.540  10.537  1.00 23.54 ? 451  ALA A O   1 
ATOM   3059 C CB  . ALA A 1 407 ? 21.362  56.867  9.792   1.00 27.25 ? 451  ALA A CB  1 
ATOM   3060 N N   . VAL A 1 408 ? 17.920  56.632  8.448   1.00 24.64 ? 452  VAL A N   1 
ATOM   3061 C CA  . VAL A 1 408 ? 16.536  56.666  8.893   1.00 25.08 ? 452  VAL A CA  1 
ATOM   3062 C C   . VAL A 1 408 ? 16.319  55.354  9.618   1.00 24.50 ? 452  VAL A C   1 
ATOM   3063 O O   . VAL A 1 408 ? 16.784  54.301  9.176   1.00 24.39 ? 452  VAL A O   1 
ATOM   3064 C CB  . VAL A 1 408 ? 15.554  56.725  7.679   1.00 26.10 ? 452  VAL A CB  1 
ATOM   3065 C CG1 . VAL A 1 408 ? 15.841  55.663  6.750   1.00 30.53 ? 452  VAL A CG1 1 
ATOM   3066 C CG2 . VAL A 1 408 ? 14.143  56.497  8.112   1.00 28.40 ? 452  VAL A CG2 1 
ATOM   3067 N N   . GLY A 1 409 ? 15.498  55.447  10.644  1.00 23.55 ? 453  GLY A N   1 
ATOM   3068 C CA  . GLY A 1 409 ? 15.139  54.349  11.500  1.00 23.45 ? 453  GLY A CA  1 
ATOM   3069 C C   . GLY A 1 409 ? 16.181  53.882  12.490  1.00 23.71 ? 453  GLY A C   1 
ATOM   3070 O O   . GLY A 1 409 ? 15.860  53.112  13.369  1.00 25.68 ? 453  GLY A O   1 
ATOM   3071 N N   . ILE A 1 410 ? 17.456  54.256  12.346  1.00 23.97 ? 454  ILE A N   1 
ATOM   3072 C CA  . ILE A 1 410 ? 18.480  53.621  13.213  1.00 22.97 ? 454  ILE A CA  1 
ATOM   3073 C C   . ILE A 1 410 ? 18.638  54.271  14.565  1.00 21.30 ? 454  ILE A C   1 
ATOM   3074 O O   . ILE A 1 410 ? 18.723  55.443  14.629  1.00 18.62 ? 454  ILE A O   1 
ATOM   3075 C CB  . ILE A 1 410 ? 19.924  53.611  12.537  1.00 23.23 ? 454  ILE A CB  1 
ATOM   3076 C CG1 . ILE A 1 410 ? 19.871  52.830  11.259  1.00 25.24 ? 454  ILE A CG1 1 
ATOM   3077 C CG2 . ILE A 1 410 ? 20.920  52.954  13.464  1.00 24.63 ? 454  ILE A CG2 1 
ATOM   3078 C CD1 . ILE A 1 410 ? 19.400  51.425  11.412  1.00 32.12 ? 454  ILE A CD1 1 
ATOM   3079 N N   . VAL A 1 411 ? 18.648  53.488  15.668  1.00 20.22 ? 455  VAL A N   1 
ATOM   3080 C CA  . VAL A 1 411 ? 18.917  54.055  16.992  1.00 20.62 ? 455  VAL A CA  1 
ATOM   3081 C C   . VAL A 1 411 ? 19.783  53.001  17.690  1.00 20.95 ? 455  VAL A C   1 
ATOM   3082 O O   . VAL A 1 411 ? 19.439  51.827  17.602  1.00 19.77 ? 455  VAL A O   1 
ATOM   3083 C CB  . VAL A 1 411 ? 17.573  54.118  17.842  1.00 20.96 ? 455  VAL A CB  1 
ATOM   3084 C CG1 . VAL A 1 411 ? 17.716  55.088  19.089  1.00 19.91 ? 455  VAL A CG1 1 
ATOM   3085 C CG2 . VAL A 1 411 ? 16.458  54.534  16.970  1.00 23.43 ? 455  VAL A CG2 1 
ATOM   3086 N N   . ILE A 1 412 ? 20.883  53.432  18.335  1.00 20.10 ? 456  ILE A N   1 
ATOM   3087 C CA  . ILE A 1 412 ? 21.782  52.555  19.078  1.00 19.13 ? 456  ILE A CA  1 
ATOM   3088 C C   . ILE A 1 412 ? 21.911  53.064  20.466  1.00 18.86 ? 456  ILE A C   1 
ATOM   3089 O O   . ILE A 1 412 ? 22.105  54.258  20.636  1.00 19.36 ? 456  ILE A O   1 
ATOM   3090 C CB  . ILE A 1 412 ? 23.239  52.535  18.392  1.00 19.02 ? 456  ILE A CB  1 
ATOM   3091 C CG1 . ILE A 1 412 ? 23.199  52.337  16.867  1.00 18.28 ? 456  ILE A CG1 1 
ATOM   3092 C CG2 . ILE A 1 412 ? 24.088  51.515  19.091  1.00 20.79 ? 456  ILE A CG2 1 
ATOM   3093 C CD1 . ILE A 1 412 ? 24.715  52.419  16.147  1.00 21.40 ? 456  ILE A CD1 1 
ATOM   3094 N N   . ALA A 1 413 ? 21.893  52.178  21.461  1.00 19.53 ? 457  ALA A N   1 
ATOM   3095 C CA  . ALA A 1 413 ? 21.959  52.590  22.862  1.00 18.58 ? 457  ALA A CA  1 
ATOM   3096 C C   . ALA A 1 413 ? 22.357  51.409  23.737  1.00 19.10 ? 457  ALA A C   1 
ATOM   3097 O O   . ALA A 1 413 ? 22.091  50.266  23.430  1.00 18.29 ? 457  ALA A O   1 
ATOM   3098 C CB  . ALA A 1 413 ? 20.532  53.131  23.336  1.00 18.06 ? 457  ALA A CB  1 
ATOM   3099 N N   . HIS A 1 414 ? 22.941  51.728  24.873  1.00 18.50 ? 458  HIS A N   1 
ATOM   3100 C CA  . HIS A 1 414 ? 23.115  50.742  25.902  1.00 18.82 ? 458  HIS A CA  1 
ATOM   3101 C C   . HIS A 1 414 ? 21.829  50.557  26.621  1.00 18.88 ? 458  HIS A C   1 
ATOM   3102 O O   . HIS A 1 414 ? 21.084  51.524  26.860  1.00 18.84 ? 458  HIS A O   1 
ATOM   3103 C CB  . HIS A 1 414 ? 24.183  51.233  26.900  1.00 20.41 ? 458  HIS A CB  1 
ATOM   3104 C CG  . HIS A 1 414 ? 25.553  51.303  26.302  1.00 19.62 ? 458  HIS A CG  1 
ATOM   3105 N ND1 . HIS A 1 414 ? 26.006  52.441  25.691  1.00 22.14 ? 458  HIS A ND1 1 
ATOM   3106 C CD2 . HIS A 1 414 ? 26.551  50.392  26.198  1.00 19.42 ? 458  HIS A CD2 1 
ATOM   3107 C CE1 . HIS A 1 414 ? 27.240  52.238  25.238  1.00 20.59 ? 458  HIS A CE1 1 
ATOM   3108 N NE2 . HIS A 1 414 ? 27.594  51.008  25.537  1.00 19.20 ? 458  HIS A NE2 1 
ATOM   3109 N N   . GLY A 1 415 ? 21.557  49.341  26.996  1.00 18.54 ? 459  GLY A N   1 
ATOM   3110 C CA  . GLY A 1 415 ? 20.274  49.087  27.592  1.00 19.87 ? 459  GLY A CA  1 
ATOM   3111 C C   . GLY A 1 415 ? 20.247  47.922  28.530  1.00 22.24 ? 459  GLY A C   1 
ATOM   3112 O O   . GLY A 1 415 ? 21.243  47.270  28.751  1.00 22.76 ? 459  GLY A O   1 
ATOM   3113 N N   . SER A 1 416 ? 19.101  47.647  29.143  1.00 23.14 ? 460  SER A N   1 
ATOM   3114 C CA  . SER A 1 416 ? 19.007  46.484  30.025  1.00 25.01 ? 460  SER A CA  1 
ATOM   3115 C C   . SER A 1 416 ? 17.605  45.930  29.831  1.00 24.79 ? 460  SER A C   1 
ATOM   3116 O O   . SER A 1 416 ? 16.714  46.687  29.550  1.00 24.21 ? 460  SER A O   1 
ATOM   3117 C CB  . SER A 1 416 ? 19.230  46.920  31.496  1.00 26.03 ? 460  SER A CB  1 
ATOM   3118 O OG  . SER A 1 416 ? 18.121  47.679  32.020  1.00 30.78 ? 460  SER A OG  1 
ATOM   3119 N N   . VAL A 1 417 ? 17.419  44.629  29.938  1.00 24.01 ? 461  VAL A N   1 
ATOM   3120 C CA  . VAL A 1 417 ? 16.141  44.009  29.640  1.00 23.63 ? 461  VAL A CA  1 
ATOM   3121 C C   . VAL A 1 417 ? 15.487  43.539  30.898  1.00 23.21 ? 461  VAL A C   1 
ATOM   3122 O O   . VAL A 1 417 ? 16.015  42.684  31.583  1.00 23.07 ? 461  VAL A O   1 
ATOM   3123 C CB  . VAL A 1 417 ? 16.303  42.907  28.550  1.00 24.27 ? 461  VAL A CB  1 
ATOM   3124 C CG1 . VAL A 1 417 ? 15.007  42.237  28.328  1.00 20.58 ? 461  VAL A CG1 1 
ATOM   3125 C CG2 . VAL A 1 417 ? 16.754  43.587  27.207  1.00 24.92 ? 461  VAL A CG2 1 
ATOM   3126 N N   . GLY A 1 418 ? 14.389  44.168  31.301  1.00 23.29 ? 462  GLY A N   1 
ATOM   3127 C CA  . GLY A 1 418 ? 13.816  43.829  32.616  1.00 22.37 ? 462  GLY A CA  1 
ATOM   3128 C C   . GLY A 1 418 ? 12.582  44.653  32.847  1.00 23.61 ? 462  GLY A C   1 
ATOM   3129 O O   . GLY A 1 418 ? 11.822  44.938  31.882  1.00 22.99 ? 462  GLY A O   1 
ATOM   3130 N N   . ASP A 1 419 ? 12.371  45.052  34.091  1.00 22.88 ? 463  ASP A N   1 
ATOM   3131 C CA  . ASP A 1 419 ? 11.239  45.888  34.487  1.00 25.22 ? 463  ASP A CA  1 
ATOM   3132 C C   . ASP A 1 419 ? 11.695  47.272  34.891  1.00 24.79 ? 463  ASP A C   1 
ATOM   3133 O O   . ASP A 1 419 ? 10.867  48.167  35.058  1.00 24.18 ? 463  ASP A O   1 
ATOM   3134 C CB  . ASP A 1 419 ? 10.432  45.264  35.631  1.00 26.45 ? 463  ASP A CB  1 
ATOM   3135 C CG  . ASP A 1 419 ? 9.518   44.118  35.162  1.00 32.68 ? 463  ASP A CG  1 
ATOM   3136 O OD1 . ASP A 1 419 ? 9.375   43.941  33.933  1.00 38.48 ? 463  ASP A OD1 1 
ATOM   3137 O OD2 . ASP A 1 419 ? 8.892   43.431  36.021  1.00 37.28 ? 463  ASP A OD2 1 
ATOM   3138 N N   . ALA A 1 420 ? 13.014  47.471  34.973  1.00 23.52 ? 464  ALA A N   1 
ATOM   3139 C CA  . ALA A 1 420 ? 13.558  48.777  35.339  1.00 22.94 ? 464  ALA A CA  1 
ATOM   3140 C C   . ALA A 1 420 ? 14.984  48.898  34.829  1.00 23.14 ? 464  ALA A C   1 
ATOM   3141 O O   . ALA A 1 420 ? 15.618  47.886  34.524  1.00 23.13 ? 464  ALA A O   1 
ATOM   3142 C CB  . ALA A 1 420 ? 13.523  48.966  36.836  1.00 23.02 ? 464  ALA A CB  1 
ATOM   3143 N N   . ILE A 1 421 ? 15.495  50.121  34.769  1.00 22.52 ? 465  ILE A N   1 
ATOM   3144 C CA  . ILE A 1 421 ? 16.911  50.317  34.523  1.00 23.10 ? 465  ILE A CA  1 
ATOM   3145 C C   . ILE A 1 421 ? 17.767  49.607  35.595  1.00 23.80 ? 465  ILE A C   1 
ATOM   3146 O O   . ILE A 1 421 ? 17.562  49.823  36.784  1.00 21.62 ? 465  ILE A O   1 
ATOM   3147 C CB  . ILE A 1 421 ? 17.325  51.790  34.513  1.00 24.63 ? 465  ILE A CB  1 
ATOM   3148 C CG1 . ILE A 1 421 ? 16.579  52.566  33.392  1.00 24.19 ? 465  ILE A CG1 1 
ATOM   3149 C CG2 . ILE A 1 421 ? 18.802  51.840  34.250  1.00 24.96 ? 465  ILE A CG2 1 
ATOM   3150 C CD1 . ILE A 1 421 ? 17.123  53.966  33.167  1.00 25.36 ? 465  ILE A CD1 1 
ATOM   3151 N N   . SER A 1 422 ? 18.737  48.807  35.135  1.00 23.41 ? 466  SER A N   1 
ATOM   3152 C CA  . SER A 1 422 ? 19.570  47.915  35.980  1.00 25.00 ? 466  SER A CA  1 
ATOM   3153 C C   . SER A 1 422 ? 20.858  48.599  36.313  1.00 25.83 ? 466  SER A C   1 
ATOM   3154 O O   . SER A 1 422 ? 21.300  49.455  35.547  1.00 25.74 ? 466  SER A O   1 
ATOM   3155 C CB  . SER A 1 422 ? 20.042  46.730  35.117  1.00 25.91 ? 466  SER A CB  1 
ATOM   3156 O OG  . SER A 1 422 ? 20.509  45.714  35.952  1.00 30.15 ? 466  SER A OG  1 
ATOM   3157 N N   . VAL A 1 423 ? 21.543  48.174  37.367  1.00 26.22 ? 467  VAL A N   1 
ATOM   3158 C CA  . VAL A 1 423 ? 22.912  48.666  37.582  1.00 26.89 ? 467  VAL A CA  1 
ATOM   3159 C C   . VAL A 1 423 ? 23.960  47.781  36.900  1.00 27.63 ? 467  VAL A C   1 
ATOM   3160 O O   . VAL A 1 423 ? 25.136  48.103  36.941  1.00 28.23 ? 467  VAL A O   1 
ATOM   3161 C CB  . VAL A 1 423 ? 23.274  48.792  39.076  1.00 27.32 ? 467  VAL A CB  1 
ATOM   3162 C CG1 . VAL A 1 423 ? 22.217  49.642  39.811  1.00 27.86 ? 467  VAL A CG1 1 
ATOM   3163 C CG2 . VAL A 1 423 ? 23.400  47.401  39.733  1.00 27.26 ? 467  VAL A CG2 1 
ATOM   3164 N N   . MET A 1 424 ? 23.559  46.689  36.257  1.00 27.55 ? 468  MET A N   1 
ATOM   3165 C CA  . MET A 1 424 ? 24.549  45.742  35.747  1.00 30.63 ? 468  MET A CA  1 
ATOM   3166 C C   . MET A 1 424 ? 25.269  46.319  34.564  1.00 28.17 ? 468  MET A C   1 
ATOM   3167 O O   . MET A 1 424 ? 24.814  47.290  33.970  1.00 28.44 ? 468  MET A O   1 
ATOM   3168 C CB  . MET A 1 424 ? 23.871  44.486  35.314  1.00 29.23 ? 468  MET A CB  1 
ATOM   3169 C CG  . MET A 1 424 ? 23.281  43.691  36.487  1.00 35.94 ? 468  MET A CG  1 
ATOM   3170 S SD  . MET A 1 424 ? 22.684  42.151  35.747  1.00 43.82 ? 468  MET A SD  1 
ATOM   3171 C CE  . MET A 1 424 ? 23.889  40.978  36.449  1.00 45.92 ? 468  MET A CE  1 
ATOM   3172 N N   . VAL A 1 425 ? 26.360  45.700  34.159  1.00 26.99 ? 469  VAL A N   1 
ATOM   3173 C CA  . VAL A 1 425 ? 27.096  46.230  32.975  1.00 26.16 ? 469  VAL A CA  1 
ATOM   3174 C C   . VAL A 1 425 ? 26.186  45.959  31.726  1.00 25.37 ? 469  VAL A C   1 
ATOM   3175 O O   . VAL A 1 425 ? 25.749  44.846  31.485  1.00 24.14 ? 469  VAL A O   1 
ATOM   3176 C CB  . VAL A 1 425 ? 28.492  45.582  32.864  1.00 26.51 ? 469  VAL A CB  1 
ATOM   3177 C CG1 . VAL A 1 425 ? 29.341  46.223  31.776  1.00 27.21 ? 469  VAL A CG1 1 
ATOM   3178 C CG2 . VAL A 1 425 ? 29.269  45.653  34.255  1.00 26.39 ? 469  VAL A CG2 1 
ATOM   3179 N N   . PRO A 1 426 ? 25.865  47.000  30.946  1.00 24.70 ? 470  PRO A N   1 
ATOM   3180 C CA  . PRO A 1 426 ? 24.909  46.809  29.879  1.00 24.23 ? 470  PRO A CA  1 
ATOM   3181 C C   . PRO A 1 426 ? 25.525  46.335  28.532  1.00 24.92 ? 470  PRO A C   1 
ATOM   3182 O O   . PRO A 1 426 ? 26.733  46.535  28.263  1.00 25.47 ? 470  PRO A O   1 
ATOM   3183 C CB  . PRO A 1 426 ? 24.449  48.249  29.649  1.00 25.20 ? 470  PRO A CB  1 
ATOM   3184 C CG  . PRO A 1 426 ? 25.790  48.993  29.708  1.00 23.98 ? 470  PRO A CG  1 
ATOM   3185 C CD  . PRO A 1 426 ? 26.365  48.399  30.993  1.00 24.72 ? 470  PRO A CD  1 
ATOM   3186 N N   . ASP A 1 427 ? 24.662  45.804  27.661  1.00 24.08 ? 471  ASP A N   1 
ATOM   3187 C CA  . ASP A 1 427 ? 25.025  45.463  26.321  1.00 23.63 ? 471  ASP A CA  1 
ATOM   3188 C C   . ASP A 1 427 ? 24.467  46.566  25.428  1.00 21.52 ? 471  ASP A C   1 
ATOM   3189 O O   . ASP A 1 427 ? 23.730  47.441  25.890  1.00 22.52 ? 471  ASP A O   1 
ATOM   3190 C CB  . ASP A 1 427 ? 24.407  44.144  25.930  1.00 24.10 ? 471  ASP A CB  1 
ATOM   3191 C CG  . ASP A 1 427 ? 24.910  42.996  26.771  1.00 27.04 ? 471  ASP A CG  1 
ATOM   3192 O OD1 . ASP A 1 427 ? 26.131  42.759  26.883  1.00 28.77 ? 471  ASP A OD1 1 
ATOM   3193 O OD2 . ASP A 1 427 ? 24.066  42.318  27.316  1.00 31.91 ? 471  ASP A OD2 1 
ATOM   3194 N N   . VAL A 1 428 ? 24.787  46.506  24.165  1.00 19.15 ? 472  VAL A N   1 
ATOM   3195 C CA  . VAL A 1 428 ? 24.375  47.572  23.209  1.00 19.88 ? 472  VAL A CA  1 
ATOM   3196 C C   . VAL A 1 428 ? 23.256  46.984  22.349  1.00 20.12 ? 472  VAL A C   1 
ATOM   3197 O O   . VAL A 1 428 ? 23.443  45.894  21.824  1.00 18.56 ? 472  VAL A O   1 
ATOM   3198 C CB  . VAL A 1 428 ? 25.586  48.070  22.283  1.00 17.78 ? 472  VAL A CB  1 
ATOM   3199 C CG1 . VAL A 1 428 ? 25.135  49.177  21.295  1.00 20.82 ? 472  VAL A CG1 1 
ATOM   3200 C CG2 . VAL A 1 428 ? 26.663  48.687  23.174  1.00 20.39 ? 472  VAL A CG2 1 
ATOM   3201 N N   . TYR A 1 429 ? 22.105  47.691  22.218  1.00 20.14 ? 473  TYR A N   1 
ATOM   3202 C CA  . TYR A 1 429 ? 20.994  47.240  21.366  1.00 20.16 ? 473  TYR A CA  1 
ATOM   3203 C C   . TYR A 1 429 ? 20.856  48.193  20.213  1.00 20.02 ? 473  TYR A C   1 
ATOM   3204 O O   . TYR A 1 429 ? 21.170  49.359  20.343  1.00 19.79 ? 473  TYR A O   1 
ATOM   3205 C CB  . TYR A 1 429 ? 19.667  47.222  22.180  1.00 20.32 ? 473  TYR A CB  1 
ATOM   3206 C CG  . TYR A 1 429 ? 19.759  46.260  23.341  1.00 21.98 ? 473  TYR A CG  1 
ATOM   3207 C CD1 . TYR A 1 429 ? 19.301  44.948  23.240  1.00 24.11 ? 473  TYR A CD1 1 
ATOM   3208 C CD2 . TYR A 1 429 ? 20.363  46.642  24.507  1.00 23.88 ? 473  TYR A CD2 1 
ATOM   3209 C CE1 . TYR A 1 429 ? 19.469  44.018  24.352  1.00 21.93 ? 473  TYR A CE1 1 
ATOM   3210 C CE2 . TYR A 1 429 ? 20.555  45.748  25.579  1.00 26.09 ? 473  TYR A CE2 1 
ATOM   3211 C CZ  . TYR A 1 429 ? 20.104  44.482  25.496  1.00 25.59 ? 473  TYR A CZ  1 
ATOM   3212 O OH  . TYR A 1 429 ? 20.333  43.741  26.633  1.00 26.28 ? 473  TYR A OH  1 
ATOM   3213 N N   . ILE A 1 430 ? 20.311  47.712  19.107  1.00 20.23 ? 474  ILE A N   1 
ATOM   3214 C CA  . ILE A 1 430 ? 20.041  48.544  17.956  1.00 19.95 ? 474  ILE A CA  1 
ATOM   3215 C C   . ILE A 1 430 ? 18.622  48.317  17.476  1.00 21.74 ? 474  ILE A C   1 
ATOM   3216 O O   . ILE A 1 430 ? 18.046  47.199  17.597  1.00 21.68 ? 474  ILE A O   1 
ATOM   3217 C CB  . ILE A 1 430 ? 21.038  48.191  16.816  1.00 22.57 ? 474  ILE A CB  1 
ATOM   3218 C CG1 . ILE A 1 430 ? 20.898  49.234  15.647  1.00 22.93 ? 474  ILE A CG1 1 
ATOM   3219 C CG2 . ILE A 1 430 ? 20.872  46.623  16.421  1.00 21.62 ? 474  ILE A CG2 1 
ATOM   3220 C CD1 . ILE A 1 430 ? 22.034  49.098  14.635  1.00 18.27 ? 474  ILE A CD1 1 
ATOM   3221 N N   . SER A 1 431 ? 18.010  49.398  16.997  1.00 19.58 ? 475  SER A N   1 
ATOM   3222 C CA  . SER A 1 431 ? 16.792  49.301  16.272  1.00 20.39 ? 475  SER A CA  1 
ATOM   3223 C C   . SER A 1 431 ? 17.016  49.881  14.902  1.00 19.62 ? 475  SER A C   1 
ATOM   3224 O O   . SER A 1 431 ? 17.774  50.814  14.745  1.00 20.01 ? 475  SER A O   1 
ATOM   3225 C CB  . SER A 1 431 ? 15.657  50.137  17.032  1.00 19.12 ? 475  SER A CB  1 
ATOM   3226 O OG  . SER A 1 431 ? 14.468  50.090  16.265  1.00 22.84 ? 475  SER A OG  1 
ATOM   3227 N N   . ASP A 1 432 ? 16.374  49.292  13.889  1.00 22.49 ? 476  ASP A N   1 
ATOM   3228 C CA  . ASP A 1 432 ? 16.424  49.851  12.545  1.00 24.42 ? 476  ASP A CA  1 
ATOM   3229 C C   . ASP A 1 432 ? 15.031  50.321  12.092  1.00 25.26 ? 476  ASP A C   1 
ATOM   3230 O O   . ASP A 1 432 ? 14.814  50.698  10.923  1.00 25.85 ? 476  ASP A O   1 
ATOM   3231 C CB  . ASP A 1 432 ? 17.071  48.741  11.601  1.00 26.70 ? 476  ASP A CB  1 
ATOM   3232 C CG  . ASP A 1 432 ? 16.133  47.601  11.330  1.00 32.04 ? 476  ASP A CG  1 
ATOM   3233 O OD1 . ASP A 1 432 ? 14.995  47.681  11.833  1.00 38.10 ? 476  ASP A OD1 1 
ATOM   3234 O OD2 . ASP A 1 432 ? 16.484  46.615  10.577  1.00 39.57 ? 476  ASP A OD2 1 
ATOM   3235 N N   . ASP A 1 433 ? 14.043  50.283  13.002  1.00 23.31 ? 477  ASP A N   1 
ATOM   3236 C CA  . ASP A 1 433 ? 12.751  50.909  12.709  1.00 23.30 ? 477  ASP A CA  1 
ATOM   3237 C C   . ASP A 1 433 ? 12.374  52.054  13.630  1.00 23.85 ? 477  ASP A C   1 
ATOM   3238 O O   . ASP A 1 433 ? 11.216  52.300  13.817  1.00 25.24 ? 477  ASP A O   1 
ATOM   3239 C CB  . ASP A 1 433 ? 11.677  49.851  12.661  1.00 23.43 ? 477  ASP A CB  1 
ATOM   3240 C CG  . ASP A 1 433 ? 11.633  49.050  13.905  1.00 26.08 ? 477  ASP A CG  1 
ATOM   3241 O OD1 . ASP A 1 433 ? 12.149  49.587  14.883  1.00 24.99 ? 477  ASP A OD1 1 
ATOM   3242 O OD2 . ASP A 1 433 ? 11.083  47.908  13.924  1.00 25.96 ? 477  ASP A OD2 1 
ATOM   3243 N N   . GLY A 1 434 ? 13.326  52.882  14.106  1.00 24.20 ? 478  GLY A N   1 
ATOM   3244 C CA  . GLY A 1 434 ? 12.836  54.037  14.923  1.00 24.10 ? 478  GLY A CA  1 
ATOM   3245 C C   . GLY A 1 434 ? 12.379  53.649  16.340  1.00 25.85 ? 478  GLY A C   1 
ATOM   3246 O O   . GLY A 1 434 ? 11.936  54.490  17.088  1.00 26.30 ? 478  GLY A O   1 
ATOM   3247 N N   . GLY A 1 435 ? 12.534  52.383  16.767  1.00 24.28 ? 479  GLY A N   1 
ATOM   3248 C CA  . GLY A 1 435 ? 12.328  52.125  18.162  1.00 22.62 ? 479  GLY A CA  1 
ATOM   3249 C C   . GLY A 1 435 ? 11.221  51.147  18.436  1.00 22.54 ? 479  GLY A C   1 
ATOM   3250 O O   . GLY A 1 435 ? 11.005  50.763  19.592  1.00 23.46 ? 479  GLY A O   1 
ATOM   3251 N N   . TYR A 1 436 ? 10.573  50.645  17.382  1.00 21.35 ? 480  TYR A N   1 
ATOM   3252 C CA  . TYR A 1 436 ? 9.575   49.619  17.558  1.00 19.91 ? 480  TYR A CA  1 
ATOM   3253 C C   . TYR A 1 436 ? 10.118  48.253  17.950  1.00 22.15 ? 480  TYR A C   1 
ATOM   3254 O O   . TYR A 1 436 ? 9.460   47.502  18.722  1.00 22.24 ? 480  TYR A O   1 
ATOM   3255 C CB  . TYR A 1 436 ? 8.685   49.442  16.281  1.00 20.33 ? 480  TYR A CB  1 
ATOM   3256 C CG  . TYR A 1 436 ? 7.772   50.635  16.019  1.00 18.24 ? 480  TYR A CG  1 
ATOM   3257 C CD1 . TYR A 1 436 ? 6.465   50.657  16.525  1.00 22.71 ? 480  TYR A CD1 1 
ATOM   3258 C CD2 . TYR A 1 436 ? 8.209   51.724  15.254  1.00 21.20 ? 480  TYR A CD2 1 
ATOM   3259 C CE1 . TYR A 1 436 ? 5.629   51.705  16.298  1.00 25.43 ? 480  TYR A CE1 1 
ATOM   3260 C CE2 . TYR A 1 436 ? 7.332   52.841  15.043  1.00 21.19 ? 480  TYR A CE2 1 
ATOM   3261 C CZ  . TYR A 1 436 ? 6.062   52.798  15.568  1.00 20.15 ? 480  TYR A CZ  1 
ATOM   3262 O OH  . TYR A 1 436 ? 5.138   53.843  15.368  1.00 20.25 ? 480  TYR A OH  1 
ATOM   3263 N N   . SER A 1 437 ? 11.160  47.832  17.274  1.00 21.16 ? 481  SER A N   1 
ATOM   3264 C CA  . SER A 1 437 ? 11.747  46.580  17.619  1.00 23.50 ? 481  SER A CA  1 
ATOM   3265 C C   . SER A 1 437 ? 13.235  46.745  17.791  1.00 21.56 ? 481  SER A C   1 
ATOM   3266 O O   . SER A 1 437 ? 13.888  47.650  17.162  1.00 21.84 ? 481  SER A O   1 
ATOM   3267 C CB  . SER A 1 437 ? 11.424  45.543  16.513  1.00 25.41 ? 481  SER A CB  1 
ATOM   3268 O OG  . SER A 1 437 ? 12.159  45.852  15.360  1.00 30.27 ? 481  SER A OG  1 
ATOM   3269 N N   . TRP A 1 438 ? 13.820  45.907  18.656  1.00 22.79 ? 482  TRP A N   1 
ATOM   3270 C CA  . TRP A 1 438 ? 15.239  46.037  18.999  1.00 22.26 ? 482  TRP A CA  1 
ATOM   3271 C C   . TRP A 1 438 ? 15.940  44.694  18.982  1.00 23.42 ? 482  TRP A C   1 
ATOM   3272 O O   . TRP A 1 438 ? 15.345  43.675  19.270  1.00 23.31 ? 482  TRP A O   1 
ATOM   3273 C CB  . TRP A 1 438 ? 15.339  46.598  20.391  1.00 21.53 ? 482  TRP A CB  1 
ATOM   3274 C CG  . TRP A 1 438 ? 14.778  47.983  20.569  1.00 22.42 ? 482  TRP A CG  1 
ATOM   3275 C CD1 . TRP A 1 438 ? 13.472  48.361  20.787  1.00 23.72 ? 482  TRP A CD1 1 
ATOM   3276 C CD2 . TRP A 1 438 ? 15.556  49.173  20.555  1.00 21.98 ? 482  TRP A CD2 1 
ATOM   3277 N NE1 . TRP A 1 438 ? 13.417  49.749  20.878  1.00 19.07 ? 482  TRP A NE1 1 
ATOM   3278 C CE2 . TRP A 1 438 ? 14.707  50.242  20.803  1.00 22.81 ? 482  TRP A CE2 1 
ATOM   3279 C CE3 . TRP A 1 438 ? 16.922  49.407  20.447  1.00 19.48 ? 482  TRP A CE3 1 
ATOM   3280 C CZ2 . TRP A 1 438 ? 15.179  51.571  20.864  1.00 23.51 ? 482  TRP A CZ2 1 
ATOM   3281 C CZ3 . TRP A 1 438 ? 17.411  50.734  20.480  1.00 24.61 ? 482  TRP A CZ3 1 
ATOM   3282 C CH2 . TRP A 1 438 ? 16.538  51.791  20.683  1.00 23.00 ? 482  TRP A CH2 1 
ATOM   3283 N N   . THR A 1 439 ? 17.221  44.703  18.721  1.00 22.26 ? 483  THR A N   1 
ATOM   3284 C CA  . THR A 1 439 ? 18.058  43.468  18.835  1.00 24.53 ? 483  THR A CA  1 
ATOM   3285 C C   . THR A 1 439 ? 19.321  43.789  19.623  1.00 24.12 ? 483  THR A C   1 
ATOM   3286 O O   . THR A 1 439 ? 19.867  44.901  19.502  1.00 21.66 ? 483  THR A O   1 
ATOM   3287 C CB  . THR A 1 439 ? 18.502  43.047  17.454  1.00 25.19 ? 483  THR A CB  1 
ATOM   3288 O OG1 . THR A 1 439 ? 17.354  42.910  16.608  1.00 31.97 ? 483  THR A OG1 1 
ATOM   3289 C CG2 . THR A 1 439 ? 19.180  41.657  17.501  1.00 30.22 ? 483  THR A CG2 1 
ATOM   3290 N N   . LYS A 1 440 ? 19.872  42.819  20.344  1.00 24.41 ? 484  LYS A N   1 
ATOM   3291 C CA  . LYS A 1 440 ? 21.177  43.011  20.949  1.00 26.89 ? 484  LYS A CA  1 
ATOM   3292 C C   . LYS A 1 440 ? 22.229  43.139  19.846  1.00 27.44 ? 484  LYS A C   1 
ATOM   3293 O O   . LYS A 1 440 ? 22.337  42.250  19.007  1.00 29.55 ? 484  LYS A O   1 
ATOM   3294 C CB  . LYS A 1 440 ? 21.493  41.863  21.965  1.00 26.53 ? 484  LYS A CB  1 
ATOM   3295 C CG  . LYS A 1 440 ? 22.800  42.121  22.755  1.00 28.14 ? 484  LYS A CG  1 
ATOM   3296 C CD  . LYS A 1 440 ? 23.190  40.965  23.721  1.00 28.95 ? 484  LYS A CD  1 
ATOM   3297 C CE  . LYS A 1 440 ? 22.009  40.556  24.644  1.00 29.64 ? 484  LYS A CE  1 
ATOM   3298 N NZ  . LYS A 1 440 ? 22.356  39.312  25.468  1.00 36.26 ? 484  LYS A NZ  1 
ATOM   3299 N N   . MET A 1 441 ? 22.952  44.265  19.786  1.00 27.60 ? 485  MET A N   1 
ATOM   3300 C CA  . MET A 1 441 ? 23.899  44.530  18.694  1.00 28.89 ? 485  MET A CA  1 
ATOM   3301 C C   . MET A 1 441 ? 25.277  44.013  19.064  1.00 29.18 ? 485  MET A C   1 
ATOM   3302 O O   . MET A 1 441 ? 25.945  43.320  18.276  1.00 28.53 ? 485  MET A O   1 
ATOM   3303 C CB  . MET A 1 441 ? 23.951  46.045  18.395  1.00 28.13 ? 485  MET A CB  1 
ATOM   3304 C CG  . MET A 1 441 ? 24.777  46.427  17.217  1.00 30.70 ? 485  MET A CG  1 
ATOM   3305 S SD  . MET A 1 441 ? 24.907  48.230  17.065  1.00 31.33 ? 485  MET A SD  1 
ATOM   3306 C CE  . MET A 1 441 ? 26.392  48.680  17.933  1.00 27.65 ? 485  MET A CE  1 
ATOM   3307 N N   . LEU A 1 442 ? 25.724  44.330  20.293  1.00 29.61 ? 486  LEU A N   1 
ATOM   3308 C CA  . LEU A 1 442 ? 27.012  43.821  20.776  1.00 27.21 ? 486  LEU A CA  1 
ATOM   3309 C C   . LEU A 1 442 ? 26.974  43.549  22.261  1.00 27.11 ? 486  LEU A C   1 
ATOM   3310 O O   . LEU A 1 442 ? 26.259  44.205  23.020  1.00 25.79 ? 486  LEU A O   1 
ATOM   3311 C CB  . LEU A 1 442 ? 28.114  44.870  20.532  1.00 27.83 ? 486  LEU A CB  1 
ATOM   3312 C CG  . LEU A 1 442 ? 28.416  45.311  19.110  1.00 28.71 ? 486  LEU A CG  1 
ATOM   3313 C CD1 . LEU A 1 442 ? 29.226  46.624  19.117  1.00 27.39 ? 486  LEU A CD1 1 
ATOM   3314 C CD2 . LEU A 1 442 ? 29.171  44.205  18.418  1.00 31.62 ? 486  LEU A CD2 1 
ATOM   3315 N N   . GLU A 1 443 ? 27.807  42.595  22.657  1.00 28.07 ? 487  GLU A N   1 
ATOM   3316 C CA  . GLU A 1 443 ? 27.951  42.164  24.043  1.00 28.64 ? 487  GLU A CA  1 
ATOM   3317 C C   . GLU A 1 443 ? 28.882  43.120  24.848  1.00 25.89 ? 487  GLU A C   1 
ATOM   3318 O O   . GLU A 1 443 ? 29.970  43.355  24.472  1.00 26.78 ? 487  GLU A O   1 
ATOM   3319 C CB  . GLU A 1 443 ? 28.480  40.734  24.001  1.00 29.89 ? 487  GLU A CB  1 
ATOM   3320 C CG  . GLU A 1 443 ? 29.840  40.528  23.128  1.00 38.36 ? 487  GLU A CG  1 
ATOM   3321 C CD  . GLU A 1 443 ? 30.018  41.308  21.714  1.00 43.38 ? 487  GLU A CD  1 
ATOM   3322 O OE1 . GLU A 1 443 ? 29.283  41.037  20.688  1.00 34.12 ? 487  GLU A OE1 1 
ATOM   3323 O OE2 . GLU A 1 443 ? 31.030  42.091  21.646  1.00 46.62 ? 487  GLU A OE2 1 
ATOM   3324 N N   . GLY A 1 444 ? 28.453  43.710  25.942  1.00 24.89 ? 488  GLY A N   1 
ATOM   3325 C CA  . GLY A 1 444 ? 29.343  44.592  26.669  1.00 22.65 ? 488  GLY A CA  1 
ATOM   3326 C C   . GLY A 1 444 ? 29.292  45.997  26.145  1.00 21.95 ? 488  GLY A C   1 
ATOM   3327 O O   . GLY A 1 444 ? 28.774  46.237  25.018  1.00 21.01 ? 488  GLY A O   1 
ATOM   3328 N N   . PRO A 1 445 ? 29.760  46.957  26.966  1.00 21.85 ? 489  PRO A N   1 
ATOM   3329 C CA  . PRO A 1 445 ? 29.653  48.378  26.627  1.00 22.73 ? 489  PRO A CA  1 
ATOM   3330 C C   . PRO A 1 445 ? 30.625  48.779  25.497  1.00 23.69 ? 489  PRO A C   1 
ATOM   3331 O O   . PRO A 1 445 ? 31.751  48.304  25.481  1.00 20.31 ? 489  PRO A O   1 
ATOM   3332 C CB  . PRO A 1 445 ? 29.944  49.095  27.961  1.00 22.11 ? 489  PRO A CB  1 
ATOM   3333 C CG  . PRO A 1 445 ? 30.651  48.041  28.828  1.00 22.44 ? 489  PRO A CG  1 
ATOM   3334 C CD  . PRO A 1 445 ? 30.310  46.709  28.318  1.00 22.62 ? 489  PRO A CD  1 
ATOM   3335 N N   . HIS A 1 446 ? 30.173  49.625  24.546  1.00 23.93 ? 490  HIS A N   1 
ATOM   3336 C CA  . HIS A 1 446 ? 31.053  50.083  23.505  1.00 22.36 ? 490  HIS A CA  1 
ATOM   3337 C C   . HIS A 1 446 ? 30.854  51.546  23.247  1.00 22.05 ? 490  HIS A C   1 
ATOM   3338 O O   . HIS A 1 446 ? 29.846  52.120  23.591  1.00 19.79 ? 490  HIS A O   1 
ATOM   3339 C CB  . HIS A 1 446 ? 30.729  49.378  22.180  1.00 23.20 ? 490  HIS A CB  1 
ATOM   3340 C CG  . HIS A 1 446 ? 31.084  47.934  22.157  1.00 20.50 ? 490  HIS A CG  1 
ATOM   3341 N ND1 . HIS A 1 446 ? 30.421  47.007  22.936  1.00 20.12 ? 490  HIS A ND1 1 
ATOM   3342 C CD2 . HIS A 1 446 ? 32.032  47.246  21.470  1.00 21.03 ? 490  HIS A CD2 1 
ATOM   3343 C CE1 . HIS A 1 446 ? 30.936  45.808  22.712  1.00 19.75 ? 490  HIS A CE1 1 
ATOM   3344 N NE2 . HIS A 1 446 ? 31.930  45.929  21.856  1.00 20.42 ? 490  HIS A NE2 1 
ATOM   3345 N N   . TYR A 1 447 ? 31.849  52.152  22.612  1.00 22.02 ? 491  TYR A N   1 
ATOM   3346 C CA  . TYR A 1 447 ? 31.611  53.468  21.982  1.00 21.82 ? 491  TYR A CA  1 
ATOM   3347 C C   . TYR A 1 447 ? 31.171  53.192  20.544  1.00 22.32 ? 491  TYR A C   1 
ATOM   3348 O O   . TYR A 1 447 ? 31.638  52.225  19.959  1.00 23.82 ? 491  TYR A O   1 
ATOM   3349 C CB  . TYR A 1 447 ? 32.926  54.240  21.965  1.00 22.14 ? 491  TYR A CB  1 
ATOM   3350 C CG  . TYR A 1 447 ? 33.430  54.615  23.342  1.00 23.85 ? 491  TYR A CG  1 
ATOM   3351 C CD1 . TYR A 1 447 ? 33.160  55.881  23.875  1.00 27.97 ? 491  TYR A CD1 1 
ATOM   3352 C CD2 . TYR A 1 447 ? 34.159  53.707  24.106  1.00 27.02 ? 491  TYR A CD2 1 
ATOM   3353 C CE1 . TYR A 1 447 ? 33.628  56.216  25.115  1.00 26.77 ? 491  TYR A CE1 1 
ATOM   3354 C CE2 . TYR A 1 447 ? 34.635  54.026  25.331  1.00 27.61 ? 491  TYR A CE2 1 
ATOM   3355 C CZ  . TYR A 1 447 ? 34.362  55.278  25.826  1.00 27.57 ? 491  TYR A CZ  1 
ATOM   3356 O OH  . TYR A 1 447 ? 34.882  55.579  27.051  1.00 32.24 ? 491  TYR A OH  1 
ATOM   3357 N N   . TYR A 1 448 ? 30.333  54.032  19.936  1.00 21.51 ? 492  TYR A N   1 
ATOM   3358 C CA  . TYR A 1 448 ? 29.785  53.687  18.618  1.00 23.12 ? 492  TYR A CA  1 
ATOM   3359 C C   . TYR A 1 448 ? 29.615  54.945  17.830  1.00 24.39 ? 492  TYR A C   1 
ATOM   3360 O O   . TYR A 1 448 ? 29.408  56.053  18.424  1.00 23.33 ? 492  TYR A O   1 
ATOM   3361 C CB  . TYR A 1 448 ? 28.422  52.904  18.686  1.00 21.41 ? 492  TYR A CB  1 
ATOM   3362 C CG  . TYR A 1 448 ? 27.436  53.269  19.820  1.00 23.61 ? 492  TYR A CG  1 
ATOM   3363 C CD1 . TYR A 1 448 ? 26.688  54.412  19.810  1.00 25.25 ? 492  TYR A CD1 1 
ATOM   3364 C CD2 . TYR A 1 448 ? 27.252  52.381  20.890  1.00 24.28 ? 492  TYR A CD2 1 
ATOM   3365 C CE1 . TYR A 1 448 ? 25.800  54.758  20.929  1.00 21.23 ? 492  TYR A CE1 1 
ATOM   3366 C CE2 . TYR A 1 448 ? 26.480  52.711  21.990  1.00 18.04 ? 492  TYR A CE2 1 
ATOM   3367 C CZ  . TYR A 1 448 ? 25.752  53.841  21.986  1.00 23.84 ? 492  TYR A CZ  1 
ATOM   3368 O OH  . TYR A 1 448 ? 25.016  54.009  23.069  1.00 24.86 ? 492  TYR A OH  1 
ATOM   3369 N N   . THR A 1 449 ? 29.677  54.807  16.510  1.00 24.32 ? 493  THR A N   1 
ATOM   3370 C CA  . THR A 1 449 ? 29.426  55.951  15.634  1.00 25.75 ? 493  THR A CA  1 
ATOM   3371 C C   . THR A 1 449 ? 28.755  55.471  14.376  1.00 24.44 ? 493  THR A C   1 
ATOM   3372 O O   . THR A 1 449 ? 29.098  54.379  13.897  1.00 25.64 ? 493  THR A O   1 
ATOM   3373 C CB  . THR A 1 449 ? 30.815  56.477  15.219  1.00 25.72 ? 493  THR A CB  1 
ATOM   3374 O OG1 . THR A 1 449 ? 31.387  57.073  16.379  1.00 34.09 ? 493  THR A OG1 1 
ATOM   3375 C CG2 . THR A 1 449 ? 30.671  57.513  14.208  1.00 29.67 ? 493  THR A CG2 1 
ATOM   3376 N N   . ILE A 1 450 ? 27.912  56.301  13.763  1.00 23.24 ? 494  ILE A N   1 
ATOM   3377 C CA  . ILE A 1 450 ? 27.394  55.997  12.427  1.00 23.14 ? 494  ILE A CA  1 
ATOM   3378 C C   . ILE A 1 450 ? 28.106  56.827  11.362  1.00 24.17 ? 494  ILE A C   1 
ATOM   3379 O O   . ILE A 1 450 ? 28.215  58.062  11.553  1.00 21.78 ? 494  ILE A O   1 
ATOM   3380 C CB  . ILE A 1 450 ? 25.931  56.358  12.411  1.00 24.35 ? 494  ILE A CB  1 
ATOM   3381 C CG1 . ILE A 1 450 ? 25.188  55.365  13.355  1.00 22.89 ? 494  ILE A CG1 1 
ATOM   3382 C CG2 . ILE A 1 450 ? 25.348  56.371  10.943  1.00 21.91 ? 494  ILE A CG2 1 
ATOM   3383 C CD1 . ILE A 1 450 ? 23.767  55.889  13.838  1.00 25.44 ? 494  ILE A CD1 1 
ATOM   3384 N N   . LEU A 1 451 ? 28.641  56.174  10.308  1.00 22.44 ? 495  LEU A N   1 
ATOM   3385 C CA  . LEU A 1 451 ? 29.336  56.925  9.155   1.00 22.55 ? 495  LEU A CA  1 
ATOM   3386 C C   . LEU A 1 451 ? 28.465  56.767  7.912   1.00 25.61 ? 495  LEU A C   1 
ATOM   3387 O O   . LEU A 1 451 ? 27.583  55.875  7.871   1.00 23.07 ? 495  LEU A O   1 
ATOM   3388 C CB  . LEU A 1 451 ? 30.721  56.350  8.791   1.00 22.87 ? 495  LEU A CB  1 
ATOM   3389 C CG  . LEU A 1 451 ? 31.713  56.193  9.958   1.00 23.18 ? 495  LEU A CG  1 
ATOM   3390 C CD1 . LEU A 1 451 ? 32.952  55.649  9.416   1.00 25.32 ? 495  LEU A CD1 1 
ATOM   3391 C CD2 . LEU A 1 451 ? 31.962  57.516  10.523  1.00 21.45 ? 495  LEU A CD2 1 
ATOM   3392 N N   . ASP A 1 452 ? 28.753  57.597  6.898   1.00 24.84 ? 496  ASP A N   1 
ATOM   3393 C CA  . ASP A 1 452 ? 28.016  57.669  5.603   1.00 26.12 ? 496  ASP A CA  1 
ATOM   3394 C C   . ASP A 1 452 ? 26.517  57.355  5.699   1.00 25.93 ? 496  ASP A C   1 
ATOM   3395 O O   . ASP A 1 452 ? 26.054  56.451  4.998   1.00 25.47 ? 496  ASP A O   1 
ATOM   3396 C CB  . ASP A 1 452 ? 28.646  56.651  4.648   1.00 26.49 ? 496  ASP A CB  1 
ATOM   3397 C CG  . ASP A 1 452 ? 28.048  56.680  3.271   1.00 31.91 ? 496  ASP A CG  1 
ATOM   3398 O OD1 . ASP A 1 452 ? 27.787  57.775  2.684   1.00 33.57 ? 496  ASP A OD1 1 
ATOM   3399 O OD2 . ASP A 1 452 ? 27.829  55.562  2.748   1.00 32.34 ? 496  ASP A OD2 1 
ATOM   3400 N N   . SER A 1 453 ? 25.782  58.143  6.483   1.00 25.19 ? 497  SER A N   1 
ATOM   3401 C CA  . SER A 1 453 ? 24.305  58.025  6.598   1.00 24.15 ? 497  SER A CA  1 
ATOM   3402 C C   . SER A 1 453 ? 23.826  56.566  6.870   1.00 24.88 ? 497  SER A C   1 
ATOM   3403 O O   . SER A 1 453 ? 22.748  56.156  6.394   1.00 25.22 ? 497  SER A O   1 
ATOM   3404 C CB  . SER A 1 453 ? 23.672  58.528  5.311   1.00 24.81 ? 497  SER A CB  1 
ATOM   3405 O OG  . SER A 1 453 ? 24.070  59.901  5.044   1.00 27.99 ? 497  SER A OG  1 
ATOM   3406 N N   . GLY A 1 454 ? 24.564  55.824  7.685   1.00 24.45 ? 498  GLY A N   1 
ATOM   3407 C CA  . GLY A 1 454 ? 24.142  54.459  8.003   1.00 26.48 ? 498  GLY A CA  1 
ATOM   3408 C C   . GLY A 1 454 ? 24.812  53.424  7.107   1.00 26.60 ? 498  GLY A C   1 
ATOM   3409 O O   . GLY A 1 454 ? 24.684  52.251  7.390   1.00 28.89 ? 498  GLY A O   1 
ATOM   3410 N N   . GLY A 1 455 ? 25.569  53.844  6.092   1.00 24.66 ? 499  GLY A N   1 
ATOM   3411 C CA  . GLY A 1 455 ? 26.354  52.934  5.285   1.00 24.20 ? 499  GLY A CA  1 
ATOM   3412 C C   . GLY A 1 455 ? 27.285  52.080  6.123   1.00 25.07 ? 499  GLY A C   1 
ATOM   3413 O O   . GLY A 1 455 ? 27.713  50.947  5.721   1.00 25.56 ? 499  GLY A O   1 
ATOM   3414 N N   . ILE A 1 456 ? 27.735  52.660  7.232   1.00 25.26 ? 500  ILE A N   1 
ATOM   3415 C CA  . ILE A 1 456 ? 28.702  51.959  8.133   1.00 26.73 ? 500  ILE A CA  1 
ATOM   3416 C C   . ILE A 1 456 ? 28.428  52.313  9.563   1.00 25.77 ? 500  ILE A C   1 
ATOM   3417 O O   . ILE A 1 456 ? 28.193  53.484  9.854   1.00 24.52 ? 500  ILE A O   1 
ATOM   3418 C CB  . ILE A 1 456 ? 30.090  52.397  7.890   1.00 27.03 ? 500  ILE A CB  1 
ATOM   3419 C CG1 . ILE A 1 456 ? 30.400  52.280  6.428   1.00 33.05 ? 500  ILE A CG1 1 
ATOM   3420 C CG2 . ILE A 1 456 ? 31.077  51.590  8.698   1.00 30.76 ? 500  ILE A CG2 1 
ATOM   3421 C CD1 . ILE A 1 456 ? 31.924  52.134  6.147   1.00 37.39 ? 500  ILE A CD1 1 
ATOM   3422 N N   . ILE A 1 457 ? 28.483  51.302  10.446  1.00 26.02 ? 501  ILE A N   1 
ATOM   3423 C CA  . ILE A 1 457 ? 28.548  51.531  11.869  1.00 25.61 ? 501  ILE A CA  1 
ATOM   3424 C C   . ILE A 1 457 ? 29.867  51.007  12.423  1.00 26.08 ? 501  ILE A C   1 
ATOM   3425 O O   . ILE A 1 457 ? 30.347  49.920  12.033  1.00 23.43 ? 501  ILE A O   1 
ATOM   3426 C CB  . ILE A 1 457 ? 27.348  50.792  12.580  1.00 26.41 ? 501  ILE A CB  1 
ATOM   3427 C CG1 . ILE A 1 457 ? 26.032  51.152  11.895  1.00 29.43 ? 501  ILE A CG1 1 
ATOM   3428 C CG2 . ILE A 1 457 ? 27.325  51.130  14.099  1.00 28.20 ? 501  ILE A CG2 1 
ATOM   3429 C CD1 . ILE A 1 457 ? 24.774  50.597  12.624  1.00 28.69 ? 501  ILE A CD1 1 
ATOM   3430 N N   . VAL A 1 458 ? 30.458  51.764  13.337  1.00 23.81 ? 502  VAL A N   1 
ATOM   3431 C CA  . VAL A 1 458 ? 31.755  51.427  13.922  1.00 24.25 ? 502  VAL A CA  1 
ATOM   3432 C C   . VAL A 1 458 ? 31.580  51.345  15.426  1.00 23.93 ? 502  VAL A C   1 
ATOM   3433 O O   . VAL A 1 458 ? 30.744  52.067  16.048  1.00 22.43 ? 502  VAL A O   1 
ATOM   3434 C CB  . VAL A 1 458 ? 32.818  52.486  13.540  1.00 25.42 ? 502  VAL A CB  1 
ATOM   3435 C CG1 . VAL A 1 458 ? 33.989  52.306  14.335  1.00 29.92 ? 502  VAL A CG1 1 
ATOM   3436 C CG2 . VAL A 1 458 ? 33.249  52.363  12.037  1.00 23.77 ? 502  VAL A CG2 1 
ATOM   3437 N N   . ALA A 1 459 ? 32.352  50.469  16.048  1.00 22.87 ? 503  ALA A N   1 
ATOM   3438 C CA  . ALA A 1 459 ? 32.311  50.391  17.493  1.00 20.97 ? 503  ALA A CA  1 
ATOM   3439 C C   . ALA A 1 459 ? 33.637  49.999  18.060  1.00 22.12 ? 503  ALA A C   1 
ATOM   3440 O O   . ALA A 1 459 ? 34.377  49.213  17.446  1.00 20.86 ? 503  ALA A O   1 
ATOM   3441 C CB  . ALA A 1 459 ? 31.223  49.447  17.994  1.00 20.09 ? 503  ALA A CB  1 
ATOM   3442 N N   . ILE A 1 460 ? 33.924  50.545  19.246  1.00 22.62 ? 504  ILE A N   1 
ATOM   3443 C CA  . ILE A 1 460 ? 35.176  50.267  19.994  1.00 23.12 ? 504  ILE A CA  1 
ATOM   3444 C C   . ILE A 1 460 ? 34.813  49.718  21.374  1.00 24.02 ? 504  ILE A C   1 
ATOM   3445 O O   . ILE A 1 460 ? 33.967  50.307  22.061  1.00 22.91 ? 504  ILE A O   1 
ATOM   3446 C CB  . ILE A 1 460 ? 35.894  51.577  20.246  1.00 24.07 ? 504  ILE A CB  1 
ATOM   3447 C CG1 . ILE A 1 460 ? 36.302  52.260  18.946  1.00 26.77 ? 504  ILE A CG1 1 
ATOM   3448 C CG2 . ILE A 1 460 ? 37.168  51.333  21.051  1.00 22.86 ? 504  ILE A CG2 1 
ATOM   3449 C CD1 . ILE A 1 460 ? 37.642  51.719  18.298  1.00 28.92 ? 504  ILE A CD1 1 
ATOM   3450 N N   . GLU A 1 461 ? 35.415  48.615  21.794  1.00 24.35 ? 505  GLU A N   1 
ATOM   3451 C CA  . GLU A 1 461 ? 35.122  48.006  23.107  1.00 28.10 ? 505  GLU A CA  1 
ATOM   3452 C C   . GLU A 1 461 ? 35.504  49.002  24.222  1.00 27.72 ? 505  GLU A C   1 
ATOM   3453 O O   . GLU A 1 461 ? 36.560  49.670  24.128  1.00 26.67 ? 505  GLU A O   1 
ATOM   3454 C CB  . GLU A 1 461 ? 35.956  46.742  23.292  1.00 27.27 ? 505  GLU A CB  1 
ATOM   3455 C CG  . GLU A 1 461 ? 35.642  45.936  24.571  1.00 32.44 ? 505  GLU A CG  1 
ATOM   3456 C CD  . GLU A 1 461 ? 36.589  44.730  24.806  1.00 36.19 ? 505  GLU A CD  1 
ATOM   3457 O OE1 . GLU A 1 461 ? 37.387  44.385  23.891  1.00 44.65 ? 505  GLU A OE1 1 
ATOM   3458 O OE2 . GLU A 1 461 ? 36.555  44.125  25.924  1.00 43.75 ? 505  GLU A OE2 1 
ATOM   3459 N N   . HIS A 1 462 ? 34.666  49.126  25.248  1.00 26.05 ? 506  HIS A N   1 
ATOM   3460 C CA  . HIS A 1 462 ? 35.008  49.963  26.398  1.00 27.37 ? 506  HIS A CA  1 
ATOM   3461 C C   . HIS A 1 462 ? 35.658  49.026  27.425  1.00 28.41 ? 506  HIS A C   1 
ATOM   3462 O O   . HIS A 1 462 ? 35.034  48.095  27.894  1.00 27.99 ? 506  HIS A O   1 
ATOM   3463 C CB  . HIS A 1 462 ? 33.731  50.640  26.912  1.00 29.23 ? 506  HIS A CB  1 
ATOM   3464 C CG  . HIS A 1 462 ? 33.855  51.231  28.264  1.00 33.10 ? 506  HIS A CG  1 
ATOM   3465 N ND1 . HIS A 1 462 ? 34.852  52.121  28.598  1.00 37.59 ? 506  HIS A ND1 1 
ATOM   3466 C CD2 . HIS A 1 462 ? 33.089  51.083  29.367  1.00 36.00 ? 506  HIS A CD2 1 
ATOM   3467 C CE1 . HIS A 1 462 ? 34.706  52.480  29.859  1.00 41.94 ? 506  HIS A CE1 1 
ATOM   3468 N NE2 . HIS A 1 462 ? 33.643  51.866  30.347  1.00 39.84 ? 506  HIS A NE2 1 
ATOM   3469 N N   . SER A 1 463 ? 36.957  49.226  27.668  1.00 28.22 ? 507  SER A N   1 
ATOM   3470 C CA  . SER A 1 463 ? 37.802  48.389  28.486  1.00 29.78 ? 507  SER A CA  1 
ATOM   3471 C C   . SER A 1 463 ? 38.578  49.204  29.541  1.00 30.46 ? 507  SER A C   1 
ATOM   3472 O O   . SER A 1 463 ? 38.877  50.376  29.332  1.00 30.45 ? 507  SER A O   1 
ATOM   3473 C CB  . SER A 1 463 ? 38.832  47.705  27.555  1.00 27.83 ? 507  SER A CB  1 
ATOM   3474 O OG  . SER A 1 463 ? 39.575  46.764  28.277  1.00 31.52 ? 507  SER A OG  1 
ATOM   3475 N N   . SER A 1 464 ? 38.994  48.561  30.628  1.00 31.83 ? 508  SER A N   1 
ATOM   3476 C CA  . SER A 1 464 ? 40.052  49.157  31.478  1.00 32.60 ? 508  SER A CA  1 
ATOM   3477 C C   . SER A 1 464 ? 41.473  48.902  30.944  1.00 33.00 ? 508  SER A C   1 
ATOM   3478 O O   . SER A 1 464 ? 42.425  49.566  31.357  1.00 33.98 ? 508  SER A O   1 
ATOM   3479 C CB  . SER A 1 464 ? 39.913  48.697  32.939  1.00 33.19 ? 508  SER A CB  1 
ATOM   3480 O OG  . SER A 1 464 ? 39.884  47.269  33.036  1.00 34.19 ? 508  SER A OG  1 
ATOM   3481 N N   . ARG A 1 465 ? 41.623  47.946  30.031  1.00 32.69 ? 509  ARG A N   1 
ATOM   3482 C CA  . ARG A 1 465 ? 42.907  47.632  29.439  1.00 32.15 ? 509  ARG A CA  1 
ATOM   3483 C C   . ARG A 1 465 ? 42.991  48.288  28.082  1.00 30.35 ? 509  ARG A C   1 
ATOM   3484 O O   . ARG A 1 465 ? 41.984  48.611  27.518  1.00 27.98 ? 509  ARG A O   1 
ATOM   3485 C CB  . ARG A 1 465 ? 43.015  46.124  29.229  1.00 33.12 ? 509  ARG A CB  1 
ATOM   3486 C CG  . ARG A 1 465 ? 42.920  45.288  30.498  1.00 37.35 ? 509  ARG A CG  1 
ATOM   3487 C CD  . ARG A 1 465 ? 42.680  43.784  30.186  1.00 38.65 ? 509  ARG A CD  1 
ATOM   3488 N NE  . ARG A 1 465 ? 43.511  43.200  29.110  1.00 48.31 ? 509  ARG A NE  1 
ATOM   3489 C CZ  . ARG A 1 465 ? 44.614  42.467  29.310  1.00 51.88 ? 509  ARG A CZ  1 
ATOM   3490 N NH1 . ARG A 1 465 ? 45.063  42.242  30.546  1.00 52.35 ? 509  ARG A NH1 1 
ATOM   3491 N NH2 . ARG A 1 465 ? 45.286  41.959  28.269  1.00 54.81 ? 509  ARG A NH2 1 
ATOM   3492 N N   . PRO A 1 466 ? 44.207  48.485  27.548  1.00 28.05 ? 510  PRO A N   1 
ATOM   3493 C CA  . PRO A 1 466 ? 44.378  49.011  26.203  1.00 27.63 ? 510  PRO A CA  1 
ATOM   3494 C C   . PRO A 1 466 ? 43.684  48.168  25.141  1.00 27.18 ? 510  PRO A C   1 
ATOM   3495 O O   . PRO A 1 466 ? 43.555  46.947  25.301  1.00 26.61 ? 510  PRO A O   1 
ATOM   3496 C CB  . PRO A 1 466 ? 45.888  48.926  25.954  1.00 27.24 ? 510  PRO A CB  1 
ATOM   3497 C CG  . PRO A 1 466 ? 46.533  48.786  27.310  1.00 27.74 ? 510  PRO A CG  1 
ATOM   3498 C CD  . PRO A 1 466 ? 45.470  48.291  28.272  1.00 28.79 ? 510  PRO A CD  1 
ATOM   3499 N N   . ILE A 1 467 ? 43.295  48.827  24.058  1.00 25.50 ? 511  ILE A N   1 
ATOM   3500 C CA  . ILE A 1 467 ? 42.678  48.179  22.886  1.00 25.78 ? 511  ILE A CA  1 
ATOM   3501 C C   . ILE A 1 467 ? 43.420  48.498  21.585  1.00 26.13 ? 511  ILE A C   1 
ATOM   3502 O O   . ILE A 1 467 ? 44.246  49.445  21.518  1.00 24.58 ? 511  ILE A O   1 
ATOM   3503 C CB  . ILE A 1 467 ? 41.178  48.556  22.767  1.00 25.27 ? 511  ILE A CB  1 
ATOM   3504 C CG1 . ILE A 1 467 ? 40.983  50.051  22.666  1.00 26.64 ? 511  ILE A CG1 1 
ATOM   3505 C CG2 . ILE A 1 467 ? 40.439  48.056  24.005  1.00 26.27 ? 511  ILE A CG2 1 
ATOM   3506 C CD1 . ILE A 1 467 ? 41.103  50.642  21.225  1.00 30.55 ? 511  ILE A CD1 1 
ATOM   3507 N N   . ASN A 1 468 ? 43.208  47.661  20.575  1.00 25.75 ? 512  ASN A N   1 
ATOM   3508 C CA  . ASN A 1 468 ? 43.828  47.942  19.272  1.00 26.87 ? 512  ASN A CA  1 
ATOM   3509 C C   . ASN A 1 468 ? 43.005  47.435  18.062  1.00 26.92 ? 512  ASN A C   1 
ATOM   3510 O O   . ASN A 1 468 ? 43.542  47.147  16.985  1.00 27.54 ? 512  ASN A O   1 
ATOM   3511 C CB  . ASN A 1 468 ? 45.197  47.378  19.228  1.00 25.22 ? 512  ASN A CB  1 
ATOM   3512 C CG  . ASN A 1 468 ? 45.219  45.880  19.257  1.00 27.05 ? 512  ASN A CG  1 
ATOM   3513 O OD1 . ASN A 1 468 ? 44.293  45.222  19.703  1.00 27.55 ? 512  ASN A OD1 1 
ATOM   3514 N ND2 . ASN A 1 468 ? 46.329  45.328  18.809  1.00 23.94 ? 512  ASN A ND2 1 
ATOM   3515 N N   . VAL A 1 469 ? 41.733  47.248  18.345  1.00 25.87 ? 513  VAL A N   1 
ATOM   3516 C CA  . VAL A 1 469 ? 40.725  46.726  17.417  1.00 26.77 ? 513  VAL A CA  1 
ATOM   3517 C C   . VAL A 1 469 ? 39.537  47.655  17.299  1.00 26.19 ? 513  VAL A C   1 
ATOM   3518 O O   . VAL A 1 469 ? 39.100  48.240  18.294  1.00 27.84 ? 513  VAL A O   1 
ATOM   3519 C CB  . VAL A 1 469 ? 40.292  45.315  17.895  1.00 27.45 ? 513  VAL A CB  1 
ATOM   3520 C CG1 . VAL A 1 469 ? 38.915  44.964  17.479  1.00 29.11 ? 513  VAL A CG1 1 
ATOM   3521 C CG2 . VAL A 1 469 ? 41.377  44.252  17.430  1.00 25.99 ? 513  VAL A CG2 1 
ATOM   3522 N N   . ILE A 1 470 ? 38.970  47.756  16.095  1.00 25.18 ? 514  ILE A N   1 
ATOM   3523 C CA  . ILE A 1 470 ? 37.773  48.520  15.900  1.00 25.62 ? 514  ILE A CA  1 
ATOM   3524 C C   . ILE A 1 470 ? 36.851  47.577  15.160  1.00 25.51 ? 514  ILE A C   1 
ATOM   3525 O O   . ILE A 1 470 ? 37.335  46.788  14.303  1.00 25.51 ? 514  ILE A O   1 
ATOM   3526 C CB  . ILE A 1 470 ? 38.006  49.858  15.139  1.00 25.87 ? 514  ILE A CB  1 
ATOM   3527 C CG1 . ILE A 1 470 ? 36.726  50.671  15.122  1.00 27.78 ? 514  ILE A CG1 1 
ATOM   3528 C CG2 . ILE A 1 470 ? 38.546  49.673  13.727  1.00 28.58 ? 514  ILE A CG2 1 
ATOM   3529 C CD1 . ILE A 1 470 ? 36.816  51.995  14.325  1.00 28.79 ? 514  ILE A CD1 1 
ATOM   3530 N N   . LYS A 1 471 ? 35.577  47.566  15.563  1.00 22.51 ? 515  LYS A N   1 
ATOM   3531 C CA  . LYS A 1 471 ? 34.561  46.717  14.874  1.00 23.64 ? 515  LYS A CA  1 
ATOM   3532 C C   . LYS A 1 471 ? 33.760  47.552  13.940  1.00 22.76 ? 515  LYS A C   1 
ATOM   3533 O O   . LYS A 1 471 ? 33.441  48.724  14.258  1.00 22.31 ? 515  LYS A O   1 
ATOM   3534 C CB  . LYS A 1 471 ? 33.647  46.000  15.852  1.00 22.79 ? 515  LYS A CB  1 
ATOM   3535 C CG  . LYS A 1 471 ? 34.368  45.693  17.170  1.00 26.38 ? 515  LYS A CG  1 
ATOM   3536 C CD  . LYS A 1 471 ? 33.393  45.097  18.242  1.00 24.10 ? 515  LYS A CD  1 
ATOM   3537 C CE  . LYS A 1 471 ? 34.215  44.714  19.544  1.00 30.80 ? 515  LYS A CE  1 
ATOM   3538 N NZ  . LYS A 1 471 ? 33.387  43.926  20.519  1.00 26.58 ? 515  LYS A NZ  1 
ATOM   3539 N N   . PHE A 1 472 ? 33.375  46.961  12.813  1.00 22.35 ? 516  PHE A N   1 
ATOM   3540 C CA  . PHE A 1 472 ? 32.502  47.734  11.884  1.00 22.91 ? 516  PHE A CA  1 
ATOM   3541 C C   . PHE A 1 472 ? 31.513  46.850  11.181  1.00 23.83 ? 516  PHE A C   1 
ATOM   3542 O O   . PHE A 1 472 ? 31.771  45.621  10.982  1.00 21.72 ? 516  PHE A O   1 
ATOM   3543 C CB  . PHE A 1 472 ? 33.353  48.520  10.839  1.00 24.95 ? 516  PHE A CB  1 
ATOM   3544 C CG  . PHE A 1 472 ? 34.117  47.623  9.856   1.00 26.67 ? 516  PHE A CG  1 
ATOM   3545 C CD1 . PHE A 1 472 ? 33.503  47.189  8.655   1.00 26.42 ? 516  PHE A CD1 1 
ATOM   3546 C CD2 . PHE A 1 472 ? 35.409  47.247  10.121  1.00 30.33 ? 516  PHE A CD2 1 
ATOM   3547 C CE1 . PHE A 1 472 ? 34.156  46.382  7.763   1.00 32.02 ? 516  PHE A CE1 1 
ATOM   3548 C CE2 . PHE A 1 472 ? 36.105  46.420  9.239   1.00 29.21 ? 516  PHE A CE2 1 
ATOM   3549 C CZ  . PHE A 1 472 ? 35.486  46.008  8.024   1.00 30.19 ? 516  PHE A CZ  1 
ATOM   3550 N N   . SER A 1 473 ? 30.370  47.451  10.802  1.00 22.40 ? 517  SER A N   1 
ATOM   3551 C CA  . SER A 1 473 ? 29.354  46.706  10.133  1.00 23.12 ? 517  SER A CA  1 
ATOM   3552 C C   . SER A 1 473 ? 28.888  47.502  8.940   1.00 22.94 ? 517  SER A C   1 
ATOM   3553 O O   . SER A 1 473 ? 28.673  48.685  9.052   1.00 24.49 ? 517  SER A O   1 
ATOM   3554 C CB  . SER A 1 473 ? 28.215  46.450  11.131  1.00 22.97 ? 517  SER A CB  1 
ATOM   3555 O OG  . SER A 1 473 ? 27.159  45.957  10.392  1.00 26.79 ? 517  SER A OG  1 
ATOM   3556 N N   . THR A 1 474 ? 28.734  46.869  7.798   1.00 25.60 ? 518  THR A N   1 
ATOM   3557 C CA  . THR A 1 474 ? 28.087  47.509  6.654   1.00 26.89 ? 518  THR A CA  1 
ATOM   3558 C C   . THR A 1 474 ? 26.622  47.136  6.517   1.00 29.91 ? 518  THR A C   1 
ATOM   3559 O O   . THR A 1 474 ? 25.965  47.562  5.558   1.00 32.56 ? 518  THR A O   1 
ATOM   3560 C CB  . THR A 1 474 ? 28.771  47.052  5.354   1.00 29.10 ? 518  THR A CB  1 
ATOM   3561 O OG1 . THR A 1 474 ? 28.650  45.608  5.199   1.00 26.31 ? 518  THR A OG1 1 
ATOM   3562 C CG2 . THR A 1 474 ? 30.216  47.449  5.402   1.00 27.83 ? 518  THR A CG2 1 
ATOM   3563 N N   . ASP A 1 475 ? 26.087  46.320  7.414   1.00 29.68 ? 519  ASP A N   1 
ATOM   3564 C CA  . ASP A 1 475 ? 24.710  45.909  7.257   1.00 32.96 ? 519  ASP A CA  1 
ATOM   3565 C C   . ASP A 1 475 ? 23.897  46.345  8.433   1.00 33.74 ? 519  ASP A C   1 
ATOM   3566 O O   . ASP A 1 475 ? 23.074  45.587  8.973   1.00 34.73 ? 519  ASP A O   1 
ATOM   3567 C CB  . ASP A 1 475 ? 24.664  44.410  7.084   1.00 34.74 ? 519  ASP A CB  1 
ATOM   3568 C CG  . ASP A 1 475 ? 25.339  43.717  8.231   1.00 41.84 ? 519  ASP A CG  1 
ATOM   3569 O OD1 . ASP A 1 475 ? 26.582  43.880  8.411   1.00 49.31 ? 519  ASP A OD1 1 
ATOM   3570 O OD2 . ASP A 1 475 ? 24.607  43.081  9.007   1.00 51.02 ? 519  ASP A OD2 1 
ATOM   3571 N N   . GLU A 1 476 ? 24.097  47.594  8.829   1.00 34.89 ? 520  GLU A N   1 
ATOM   3572 C CA  . GLU A 1 476 ? 23.413  48.156  9.978   1.00 37.77 ? 520  GLU A CA  1 
ATOM   3573 C C   . GLU A 1 476 ? 23.386  47.259  11.225  1.00 36.99 ? 520  GLU A C   1 
ATOM   3574 O O   . GLU A 1 476 ? 22.334  47.074  11.879  1.00 36.03 ? 520  GLU A O   1 
ATOM   3575 C CB  . GLU A 1 476 ? 21.989  48.602  9.601   1.00 39.92 ? 520  GLU A CB  1 
ATOM   3576 C CG  . GLU A 1 476 ? 21.984  49.687  8.549   1.00 40.97 ? 520  GLU A CG  1 
ATOM   3577 C CD  . GLU A 1 476 ? 20.600  50.067  8.095   1.00 49.89 ? 520  GLU A CD  1 
ATOM   3578 O OE1 . GLU A 1 476 ? 19.630  49.277  8.288   1.00 51.61 ? 520  GLU A OE1 1 
ATOM   3579 O OE2 . GLU A 1 476 ? 20.480  51.206  7.540   1.00 57.38 ? 520  GLU A OE2 1 
ATOM   3580 N N   . GLY A 1 477 ? 24.566  46.764  11.570  1.00 36.27 ? 521  GLY A N   1 
ATOM   3581 C CA  . GLY A 1 477 ? 24.800  46.260  12.909  1.00 35.49 ? 521  GLY A CA  1 
ATOM   3582 C C   . GLY A 1 477 ? 24.329  44.833  13.072  1.00 37.27 ? 521  GLY A C   1 
ATOM   3583 O O   . GLY A 1 477 ? 24.365  44.287  14.172  1.00 35.03 ? 521  GLY A O   1 
ATOM   3584 N N   . GLN A 1 478 ? 23.904  44.213  11.981  1.00 37.40 ? 522  GLN A N   1 
ATOM   3585 C CA  . GLN A 1 478 ? 23.629  42.786  11.996  1.00 40.31 ? 522  GLN A CA  1 
ATOM   3586 C C   . GLN A 1 478 ? 24.910  41.932  11.980  1.00 38.65 ? 522  GLN A C   1 
ATOM   3587 O O   . GLN A 1 478 ? 25.042  41.007  12.767  1.00 39.58 ? 522  GLN A O   1 
ATOM   3588 C CB  . GLN A 1 478 ? 22.758  42.414  10.794  1.00 40.68 ? 522  GLN A CB  1 
ATOM   3589 C CG  . GLN A 1 478 ? 21.253  42.698  10.962  1.00 45.48 ? 522  GLN A CG  1 
ATOM   3590 C CD  . GLN A 1 478 ? 20.514  42.736  9.618   1.00 45.85 ? 522  GLN A CD  1 
ATOM   3591 O OE1 . GLN A 1 478 ? 19.856  43.740  9.285   1.00 53.47 ? 522  GLN A OE1 1 
ATOM   3592 N NE2 . GLN A 1 478 ? 20.650  41.659  8.822   1.00 49.34 ? 522  GLN A NE2 1 
ATOM   3593 N N   . CYS A 1 479 ? 25.843  42.212  11.085  1.00 36.60 ? 523  CYS A N   1 
ATOM   3594 C CA  . CYS A 1 479 ? 27.099  41.430  11.026  1.00 36.81 ? 523  CYS A CA  1 
ATOM   3595 C C   . CYS A 1 479 ? 28.269  42.370  11.213  1.00 33.95 ? 523  CYS A C   1 
ATOM   3596 O O   . CYS A 1 479 ? 28.211  43.489  10.702  1.00 32.44 ? 523  CYS A O   1 
ATOM   3597 C CB  . CYS A 1 479 ? 27.273  40.747  9.658   1.00 37.46 ? 523  CYS A CB  1 
ATOM   3598 S SG  . CYS A 1 479 ? 25.939  39.594  9.225   1.00 46.30 ? 523  CYS A SG  1 
ATOM   3599 N N   . TRP A 1 480 ? 29.320  41.872  11.871  1.00 31.29 ? 524  TRP A N   1 
ATOM   3600 C CA  . TRP A 1 480 ? 30.487  42.658  12.278  1.00 28.68 ? 524  TRP A CA  1 
ATOM   3601 C C   . TRP A 1 480 ? 31.781  42.030  11.824  1.00 29.02 ? 524  TRP A C   1 
ATOM   3602 O O   . TRP A 1 480 ? 31.865  40.821  11.747  1.00 26.55 ? 524  TRP A O   1 
ATOM   3603 C CB  . TRP A 1 480 ? 30.506  42.824  13.797  1.00 28.26 ? 524  TRP A CB  1 
ATOM   3604 C CG  . TRP A 1 480 ? 29.298  43.683  14.269  1.00 26.81 ? 524  TRP A CG  1 
ATOM   3605 C CD1 . TRP A 1 480 ? 28.074  43.247  14.611  1.00 26.12 ? 524  TRP A CD1 1 
ATOM   3606 C CD2 . TRP A 1 480 ? 29.303  45.079  14.452  1.00 25.63 ? 524  TRP A CD2 1 
ATOM   3607 N NE1 . TRP A 1 480 ? 27.250  44.337  14.971  1.00 25.45 ? 524  TRP A NE1 1 
ATOM   3608 C CE2 . TRP A 1 480 ? 28.008  45.468  14.875  1.00 27.33 ? 524  TRP A CE2 1 
ATOM   3609 C CE3 . TRP A 1 480 ? 30.261  46.059  14.295  1.00 24.98 ? 524  TRP A CE3 1 
ATOM   3610 C CZ2 . TRP A 1 480 ? 27.693  46.785  15.140  1.00 25.99 ? 524  TRP A CZ2 1 
ATOM   3611 C CZ3 . TRP A 1 480 ? 29.928  47.341  14.530  1.00 26.21 ? 524  TRP A CZ3 1 
ATOM   3612 C CH2 . TRP A 1 480 ? 28.666  47.705  14.950  1.00 27.27 ? 524  TRP A CH2 1 
ATOM   3613 N N   . GLN A 1 481 ? 32.764  42.876  11.524  1.00 27.51 ? 525  GLN A N   1 
ATOM   3614 C CA  . GLN A 1 481 ? 34.130  42.445  11.222  1.00 29.75 ? 525  GLN A CA  1 
ATOM   3615 C C   . GLN A 1 481 ? 34.996  43.281  12.169  1.00 28.46 ? 525  GLN A C   1 
ATOM   3616 O O   . GLN A 1 481 ? 34.596  44.397  12.570  1.00 26.71 ? 525  GLN A O   1 
ATOM   3617 C CB  . GLN A 1 481 ? 34.494  42.736  9.750   1.00 30.56 ? 525  GLN A CB  1 
ATOM   3618 C CG  . GLN A 1 481 ? 33.765  41.822  8.667   1.00 37.02 ? 525  GLN A CG  1 
ATOM   3619 C CD  . GLN A 1 481 ? 32.336  42.277  8.316   1.00 45.25 ? 525  GLN A CD  1 
ATOM   3620 O OE1 . GLN A 1 481 ? 31.988  43.505  8.367   1.00 46.14 ? 525  GLN A OE1 1 
ATOM   3621 N NE2 . GLN A 1 481 ? 31.474  41.297  7.986   1.00 46.82 ? 525  GLN A NE2 1 
ATOM   3622 N N   . THR A 1 482 ? 36.143  42.733  12.539  1.00 27.75 ? 526  THR A N   1 
ATOM   3623 C CA  . THR A 1 482 ? 37.073  43.303  13.503  1.00 27.89 ? 526  THR A CA  1 
ATOM   3624 C C   . THR A 1 482 ? 38.352  43.672  12.768  1.00 27.67 ? 526  THR A C   1 
ATOM   3625 O O   . THR A 1 482 ? 38.976  42.790  12.158  1.00 27.09 ? 526  THR A O   1 
ATOM   3626 C CB  . THR A 1 482 ? 37.367  42.228  14.595  1.00 29.45 ? 526  THR A CB  1 
ATOM   3627 O OG1 . THR A 1 482 ? 36.149  41.947  15.294  1.00 31.42 ? 526  THR A OG1 1 
ATOM   3628 C CG2 . THR A 1 482 ? 38.361  42.727  15.598  1.00 31.66 ? 526  THR A CG2 1 
ATOM   3629 N N   . TYR A 1 483 ? 38.755  44.946  12.814  1.00 24.06 ? 527  TYR A N   1 
ATOM   3630 C CA  . TYR A 1 483 ? 40.052  45.356  12.275  1.00 22.77 ? 527  TYR A CA  1 
ATOM   3631 C C   . TYR A 1 483 ? 41.067  45.771  13.387  1.00 23.82 ? 527  TYR A C   1 
ATOM   3632 O O   . TYR A 1 483 ? 40.763  46.622  14.217  1.00 21.83 ? 527  TYR A O   1 
ATOM   3633 C CB  . TYR A 1 483 ? 39.827  46.507  11.323  1.00 22.27 ? 527  TYR A CB  1 
ATOM   3634 C CG  . TYR A 1 483 ? 41.082  47.185  10.799  1.00 20.81 ? 527  TYR A CG  1 
ATOM   3635 C CD1 . TYR A 1 483 ? 42.021  46.493  10.063  1.00 20.59 ? 527  TYR A CD1 1 
ATOM   3636 C CD2 . TYR A 1 483 ? 41.254  48.578  10.989  1.00 21.49 ? 527  TYR A CD2 1 
ATOM   3637 C CE1 . TYR A 1 483 ? 43.178  47.143  9.584   1.00 23.50 ? 527  TYR A CE1 1 
ATOM   3638 C CE2 . TYR A 1 483 ? 42.384  49.231  10.530  1.00 22.99 ? 527  TYR A CE2 1 
ATOM   3639 C CZ  . TYR A 1 483 ? 43.334  48.509  9.850   1.00 23.57 ? 527  TYR A CZ  1 
ATOM   3640 O OH  . TYR A 1 483 ? 44.400  49.212  9.400   1.00 24.54 ? 527  TYR A OH  1 
ATOM   3641 N N   . THR A 1 484 ? 42.263  45.183  13.377  1.00 22.65 ? 528  THR A N   1 
ATOM   3642 C CA  . THR A 1 484 ? 43.363  45.619  14.242  1.00 23.15 ? 528  THR A CA  1 
ATOM   3643 C C   . THR A 1 484 ? 44.071  46.849  13.674  1.00 24.05 ? 528  THR A C   1 
ATOM   3644 O O   . THR A 1 484 ? 44.768  46.767  12.681  1.00 23.59 ? 528  THR A O   1 
ATOM   3645 C CB  . THR A 1 484 ? 44.330  44.460  14.426  1.00 23.17 ? 528  THR A CB  1 
ATOM   3646 O OG1 . THR A 1 484 ? 43.603  43.386  15.024  1.00 22.10 ? 528  THR A OG1 1 
ATOM   3647 C CG2 . THR A 1 484 ? 45.514  44.836  15.351  1.00 23.54 ? 528  THR A CG2 1 
ATOM   3648 N N   . PHE A 1 485 ? 43.870  48.022  14.270  1.00 24.36 ? 529  PHE A N   1 
ATOM   3649 C CA  . PHE A 1 485 ? 44.331  49.217  13.590  1.00 25.39 ? 529  PHE A CA  1 
ATOM   3650 C C   . PHE A 1 485 ? 45.679  49.666  14.015  1.00 26.59 ? 529  PHE A C   1 
ATOM   3651 O O   . PHE A 1 485 ? 46.200  50.638  13.473  1.00 27.86 ? 529  PHE A O   1 
ATOM   3652 C CB  . PHE A 1 485 ? 43.373  50.377  13.799  1.00 24.33 ? 529  PHE A CB  1 
ATOM   3653 C CG  . PHE A 1 485 ? 43.180  50.757  15.231  1.00 23.41 ? 529  PHE A CG  1 
ATOM   3654 C CD1 . PHE A 1 485 ? 43.942  51.747  15.795  1.00 24.62 ? 529  PHE A CD1 1 
ATOM   3655 C CD2 . PHE A 1 485 ? 42.169  50.148  16.000  1.00 24.90 ? 529  PHE A CD2 1 
ATOM   3656 C CE1 . PHE A 1 485 ? 43.739  52.138  17.114  1.00 24.67 ? 529  PHE A CE1 1 
ATOM   3657 C CE2 . PHE A 1 485 ? 41.934  50.523  17.346  1.00 24.91 ? 529  PHE A CE2 1 
ATOM   3658 C CZ  . PHE A 1 485 ? 42.734  51.513  17.916  1.00 24.34 ? 529  PHE A CZ  1 
ATOM   3659 N N   . THR A 1 486 ? 46.241  49.006  15.012  1.00 27.46 ? 530  THR A N   1 
ATOM   3660 C CA  . THR A 1 486 ? 47.572  49.367  15.491  1.00 28.75 ? 530  THR A CA  1 
ATOM   3661 C C   . THR A 1 486 ? 48.199  48.167  16.187  1.00 29.88 ? 530  THR A C   1 
ATOM   3662 O O   . THR A 1 486 ? 47.511  47.328  16.743  1.00 30.04 ? 530  THR A O   1 
ATOM   3663 C CB  . THR A 1 486 ? 47.591  50.620  16.429  1.00 28.78 ? 530  THR A CB  1 
ATOM   3664 O OG1 . THR A 1 486 ? 48.959  51.001  16.686  1.00 30.10 ? 530  THR A OG1 1 
ATOM   3665 C CG2 . THR A 1 486 ? 46.832  50.369  17.751  1.00 28.00 ? 530  THR A CG2 1 
ATOM   3666 N N   . ARG A 1 487 ? 49.500  48.085  16.109  1.00 31.05 ? 531  ARG A N   1 
ATOM   3667 C CA  . ARG A 1 487 ? 50.212  47.151  16.946  1.00 33.35 ? 531  ARG A CA  1 
ATOM   3668 C C   . ARG A 1 487 ? 50.670  47.717  18.293  1.00 32.65 ? 531  ARG A C   1 
ATOM   3669 O O   . ARG A 1 487 ? 51.153  46.972  19.103  1.00 33.17 ? 531  ARG A O   1 
ATOM   3670 C CB  . ARG A 1 487 ? 51.384  46.547  16.185  1.00 33.97 ? 531  ARG A CB  1 
ATOM   3671 C CG  . ARG A 1 487 ? 51.318  45.003  16.112  1.00 40.31 ? 531  ARG A CG  1 
ATOM   3672 C CD  . ARG A 1 487 ? 51.655  44.278  17.465  1.00 47.44 ? 531  ARG A CD  1 
ATOM   3673 N NE  . ARG A 1 487 ? 50.529  44.365  18.414  1.00 52.27 ? 531  ARG A NE  1 
ATOM   3674 C CZ  . ARG A 1 487 ? 50.539  43.937  19.681  1.00 54.62 ? 531  ARG A CZ  1 
ATOM   3675 N NH1 . ARG A 1 487 ? 51.628  43.360  20.212  1.00 54.30 ? 531  ARG A NH1 1 
ATOM   3676 N NH2 . ARG A 1 487 ? 49.438  44.084  20.420  1.00 53.81 ? 531  ARG A NH2 1 
ATOM   3677 N N   . ASP A 1 488 ? 50.511  49.013  18.550  1.00 32.16 ? 532  ASP A N   1 
ATOM   3678 C CA  . ASP A 1 488 ? 50.719  49.518  19.908  1.00 32.22 ? 532  ASP A CA  1 
ATOM   3679 C C   . ASP A 1 488 ? 49.403  49.896  20.550  1.00 29.93 ? 532  ASP A C   1 
ATOM   3680 O O   . ASP A 1 488 ? 48.983  51.001  20.375  1.00 31.11 ? 532  ASP A O   1 
ATOM   3681 C CB  . ASP A 1 488 ? 51.686  50.709  19.995  1.00 34.18 ? 532  ASP A CB  1 
ATOM   3682 C CG  . ASP A 1 488 ? 51.748  51.521  18.732  1.00 39.53 ? 532  ASP A CG  1 
ATOM   3683 O OD1 . ASP A 1 488 ? 50.661  52.006  18.317  1.00 46.60 ? 532  ASP A OD1 1 
ATOM   3684 O OD2 . ASP A 1 488 ? 52.884  51.673  18.156  1.00 44.21 ? 532  ASP A OD2 1 
ATOM   3685 N N   . PRO A 1 489 ? 48.779  48.969  21.300  1.00 27.39 ? 533  PRO A N   1 
ATOM   3686 C CA  . PRO A 1 489 ? 47.469  49.200  21.881  1.00 26.36 ? 533  PRO A CA  1 
ATOM   3687 C C   . PRO A 1 489 ? 47.397  50.498  22.697  1.00 25.32 ? 533  PRO A C   1 
ATOM   3688 O O   . PRO A 1 489 ? 48.396  50.866  23.318  1.00 25.19 ? 533  PRO A O   1 
ATOM   3689 C CB  . PRO A 1 489 ? 47.241  47.959  22.760  1.00 25.29 ? 533  PRO A CB  1 
ATOM   3690 C CG  . PRO A 1 489 ? 48.209  46.922  22.226  1.00 29.12 ? 533  PRO A CG  1 
ATOM   3691 C CD  . PRO A 1 489 ? 49.341  47.648  21.658  1.00 27.14 ? 533  PRO A CD  1 
ATOM   3692 N N   . ILE A 1 490 ? 46.236  51.169  22.721  1.00 23.58 ? 534  ILE A N   1 
ATOM   3693 C CA  . ILE A 1 490 ? 46.130  52.465  23.374  1.00 22.78 ? 534  ILE A CA  1 
ATOM   3694 C C   . ILE A 1 490 ? 45.091  52.374  24.450  1.00 22.23 ? 534  ILE A C   1 
ATOM   3695 O O   . ILE A 1 490 ? 44.174  51.600  24.280  1.00 21.61 ? 534  ILE A O   1 
ATOM   3696 C CB  . ILE A 1 490 ? 45.736  53.599  22.346  1.00 22.58 ? 534  ILE A CB  1 
ATOM   3697 C CG1 . ILE A 1 490 ? 44.473  53.256  21.588  1.00 23.64 ? 534  ILE A CG1 1 
ATOM   3698 C CG2 . ILE A 1 490 ? 46.923  53.845  21.363  1.00 24.00 ? 534  ILE A CG2 1 
ATOM   3699 C CD1 . ILE A 1 490 ? 43.870  54.385  20.717  1.00 24.61 ? 534  ILE A CD1 1 
ATOM   3700 N N   . TYR A 1 491 ? 45.214  53.165  25.533  1.00 21.15 ? 535  TYR A N   1 
ATOM   3701 C CA  . TYR A 1 491 ? 44.039  53.487  26.361  1.00 22.68 ? 535  TYR A CA  1 
ATOM   3702 C C   . TYR A 1 491 ? 43.172  54.396  25.568  1.00 23.62 ? 535  TYR A C   1 
ATOM   3703 O O   . TYR A 1 491 ? 43.577  55.506  25.197  1.00 21.88 ? 535  TYR A O   1 
ATOM   3704 C CB  . TYR A 1 491 ? 44.456  54.151  27.665  1.00 23.71 ? 535  TYR A CB  1 
ATOM   3705 C CG  . TYR A 1 491 ? 45.200  53.136  28.564  1.00 25.08 ? 535  TYR A CG  1 
ATOM   3706 C CD1 . TYR A 1 491 ? 44.501  52.204  29.315  1.00 23.91 ? 535  TYR A CD1 1 
ATOM   3707 C CD2 . TYR A 1 491 ? 46.576  53.096  28.599  1.00 25.22 ? 535  TYR A CD2 1 
ATOM   3708 C CE1 . TYR A 1 491 ? 45.166  51.270  30.109  1.00 27.31 ? 535  TYR A CE1 1 
ATOM   3709 C CE2 . TYR A 1 491 ? 47.273  52.178  29.413  1.00 27.73 ? 535  TYR A CE2 1 
ATOM   3710 C CZ  . TYR A 1 491 ? 46.559  51.271  30.159  1.00 27.19 ? 535  TYR A CZ  1 
ATOM   3711 O OH  . TYR A 1 491 ? 47.245  50.360  30.957  1.00 29.28 ? 535  TYR A OH  1 
ATOM   3712 N N   . PHE A 1 492 ? 41.987  53.894  25.262  1.00 26.14 ? 536  PHE A N   1 
ATOM   3713 C CA  . PHE A 1 492 ? 41.027  54.575  24.386  1.00 26.52 ? 536  PHE A CA  1 
ATOM   3714 C C   . PHE A 1 492 ? 40.252  55.657  25.125  1.00 27.81 ? 536  PHE A C   1 
ATOM   3715 O O   . PHE A 1 492 ? 39.611  55.375  26.162  1.00 28.06 ? 536  PHE A O   1 
ATOM   3716 C CB  . PHE A 1 492 ? 40.036  53.556  23.875  1.00 26.66 ? 536  PHE A CB  1 
ATOM   3717 C CG  . PHE A 1 492 ? 39.001  54.154  23.020  1.00 28.01 ? 536  PHE A CG  1 
ATOM   3718 C CD1 . PHE A 1 492 ? 39.344  54.631  21.766  1.00 25.37 ? 536  PHE A CD1 1 
ATOM   3719 C CD2 . PHE A 1 492 ? 37.702  54.312  23.485  1.00 29.04 ? 536  PHE A CD2 1 
ATOM   3720 C CE1 . PHE A 1 492 ? 38.394  55.207  20.951  1.00 26.70 ? 536  PHE A CE1 1 
ATOM   3721 C CE2 . PHE A 1 492 ? 36.734  54.917  22.669  1.00 33.40 ? 536  PHE A CE2 1 
ATOM   3722 C CZ  . PHE A 1 492 ? 37.086  55.374  21.415  1.00 27.10 ? 536  PHE A CZ  1 
ATOM   3723 N N   . THR A 1 493 ? 40.272  56.877  24.586  1.00 28.21 ? 537  THR A N   1 
ATOM   3724 C CA  . THR A 1 493 ? 39.533  58.003  25.200  1.00 30.05 ? 537  THR A CA  1 
ATOM   3725 C C   . THR A 1 493 ? 38.239  58.459  24.444  1.00 31.54 ? 537  THR A C   1 
ATOM   3726 O O   . THR A 1 493 ? 37.245  58.963  25.070  1.00 30.98 ? 537  THR A O   1 
ATOM   3727 C CB  . THR A 1 493 ? 40.459  59.200  25.526  1.00 30.75 ? 537  THR A CB  1 
ATOM   3728 O OG1 . THR A 1 493 ? 41.248  59.582  24.379  1.00 33.00 ? 537  THR A OG1 1 
ATOM   3729 C CG2 . THR A 1 493 ? 41.484  58.797  26.605  1.00 31.18 ? 537  THR A CG2 1 
ATOM   3730 N N   . GLY A 1 494 ? 38.214  58.283  23.129  1.00 30.06 ? 538  GLY A N   1 
ATOM   3731 C CA  . GLY A 1 494 ? 37.117  58.889  22.350  1.00 29.39 ? 538  GLY A CA  1 
ATOM   3732 C C   . GLY A 1 494 ? 37.245  58.712  20.862  1.00 28.86 ? 538  GLY A C   1 
ATOM   3733 O O   . GLY A 1 494 ? 38.356  58.513  20.342  1.00 26.78 ? 538  GLY A O   1 
ATOM   3734 N N   . LEU A 1 495 ? 36.091  58.820  20.200  1.00 29.34 ? 539  LEU A N   1 
ATOM   3735 C CA  . LEU A 1 495 ? 35.900  58.720  18.745  1.00 29.80 ? 539  LEU A CA  1 
ATOM   3736 C C   . LEU A 1 495 ? 35.515  60.112  18.312  1.00 29.99 ? 539  LEU A C   1 
ATOM   3737 O O   . LEU A 1 495 ? 34.599  60.713  18.937  1.00 28.95 ? 539  LEU A O   1 
ATOM   3738 C CB  . LEU A 1 495 ? 34.668  57.862  18.480  1.00 31.23 ? 539  LEU A CB  1 
ATOM   3739 C CG  . LEU A 1 495 ? 34.857  56.360  18.569  1.00 35.96 ? 539  LEU A CG  1 
ATOM   3740 C CD1 . LEU A 1 495 ? 33.574  55.684  18.398  1.00 36.54 ? 539  LEU A CD1 1 
ATOM   3741 C CD2 . LEU A 1 495 ? 35.839  55.901  17.485  1.00 37.00 ? 539  LEU A CD2 1 
ATOM   3742 N N   . ALA A 1 496 ? 36.196  60.672  17.309  1.00 27.77 ? 540  ALA A N   1 
ATOM   3743 C CA  . ALA A 1 496 ? 35.649  61.893  16.633  1.00 25.99 ? 540  ALA A CA  1 
ATOM   3744 C C   . ALA A 1 496 ? 35.329  61.642  15.132  1.00 23.82 ? 540  ALA A C   1 
ATOM   3745 O O   . ALA A 1 496 ? 36.084  60.983  14.407  1.00 22.86 ? 540  ALA A O   1 
ATOM   3746 C CB  . ALA A 1 496 ? 36.551  63.038  16.805  1.00 25.75 ? 540  ALA A CB  1 
ATOM   3747 N N   . SER A 1 497 ? 34.164  62.091  14.681  1.00 23.33 ? 541  SER A N   1 
ATOM   3748 C CA  . SER A 1 497 ? 33.857  62.086  13.242  1.00 20.98 ? 541  SER A CA  1 
ATOM   3749 C C   . SER A 1 497 ? 33.079  63.300  12.867  1.00 21.88 ? 541  SER A C   1 
ATOM   3750 O O   . SER A 1 497 ? 32.495  63.949  13.745  1.00 23.18 ? 541  SER A O   1 
ATOM   3751 C CB  . SER A 1 497 ? 33.110  60.844  12.900  1.00 21.99 ? 541  SER A CB  1 
ATOM   3752 O OG  . SER A 1 497 ? 31.845  60.870  13.555  1.00 24.38 ? 541  SER A OG  1 
ATOM   3753 N N   . GLU A 1 498 ? 33.052  63.619  11.569  1.00 22.69 ? 542  GLU A N   1 
ATOM   3754 C CA  . GLU A 1 498 ? 32.503  64.957  11.136  1.00 23.49 ? 542  GLU A CA  1 
ATOM   3755 C C   . GLU A 1 498 ? 31.047  64.977  11.529  1.00 23.35 ? 542  GLU A C   1 
ATOM   3756 O O   . GLU A 1 498 ? 30.323  64.065  11.164  1.00 22.29 ? 542  GLU A O   1 
ATOM   3757 C CB  . GLU A 1 498 ? 32.640  65.114  9.650   1.00 23.29 ? 542  GLU A CB  1 
ATOM   3758 C CG  . GLU A 1 498 ? 32.169  66.418  9.120   1.00 23.42 ? 542  GLU A CG  1 
ATOM   3759 C CD  . GLU A 1 498 ? 32.027  66.406  7.625   1.00 30.76 ? 542  GLU A CD  1 
ATOM   3760 O OE1 . GLU A 1 498 ? 31.378  65.440  7.102   1.00 27.88 ? 542  GLU A OE1 1 
ATOM   3761 O OE2 . GLU A 1 498 ? 32.475  67.416  6.959   1.00 31.67 ? 542  GLU A OE2 1 
ATOM   3762 N N   . PRO A 1 499 ? 30.602  66.046  12.233  1.00 23.78 ? 543  PRO A N   1 
ATOM   3763 C CA  . PRO A 1 499 ? 29.223  66.185  12.512  1.00 23.63 ? 543  PRO A CA  1 
ATOM   3764 C C   . PRO A 1 499 ? 28.271  65.992  11.272  1.00 25.02 ? 543  PRO A C   1 
ATOM   3765 O O   . PRO A 1 499 ? 28.573  66.419  10.168  1.00 23.29 ? 543  PRO A O   1 
ATOM   3766 C CB  . PRO A 1 499 ? 29.105  67.633  13.010  1.00 25.79 ? 543  PRO A CB  1 
ATOM   3767 C CG  . PRO A 1 499 ? 30.377  67.792  13.822  1.00 25.22 ? 543  PRO A CG  1 
ATOM   3768 C CD  . PRO A 1 499 ? 31.403  67.185  12.772  1.00 24.36 ? 543  PRO A CD  1 
ATOM   3769 N N   . GLY A 1 500 ? 27.126  65.348  11.459  1.00 21.97 ? 544  GLY A N   1 
ATOM   3770 C CA  . GLY A 1 500 ? 26.186  65.183  10.301  1.00 24.56 ? 544  GLY A CA  1 
ATOM   3771 C C   . GLY A 1 500 ? 26.206  63.745  9.725   1.00 24.96 ? 544  GLY A C   1 
ATOM   3772 O O   . GLY A 1 500 ? 25.438  63.429  8.845   1.00 26.75 ? 544  GLY A O   1 
ATOM   3773 N N   . ALA A 1 501 ? 27.063  62.899  10.257  1.00 25.05 ? 545  ALA A N   1 
ATOM   3774 C CA  . ALA A 1 501 ? 27.183  61.443  9.865   1.00 24.70 ? 545  ALA A CA  1 
ATOM   3775 C C   . ALA A 1 501 ? 27.310  61.144  8.345   1.00 25.44 ? 545  ALA A C   1 
ATOM   3776 O O   . ALA A 1 501 ? 26.817  60.113  7.895   1.00 27.98 ? 545  ALA A O   1 
ATOM   3777 C CB  . ALA A 1 501 ? 25.999  60.625  10.527  1.00 25.69 ? 545  ALA A CB  1 
ATOM   3778 N N   . ARG A 1 502 ? 27.975  62.004  7.547   1.00 25.03 ? 546  ARG A N   1 
ATOM   3779 C CA  . ARG A 1 502 ? 28.043  61.805  6.102   1.00 26.39 ? 546  ARG A CA  1 
ATOM   3780 C C   . ARG A 1 502 ? 29.458  61.470  5.623   1.00 25.46 ? 546  ARG A C   1 
ATOM   3781 O O   . ARG A 1 502 ? 29.641  61.314  4.438   1.00 25.69 ? 546  ARG A O   1 
ATOM   3782 C CB  . ARG A 1 502 ? 27.534  63.045  5.343   1.00 27.16 ? 546  ARG A CB  1 
ATOM   3783 C CG  . ARG A 1 502 ? 25.963  63.177  5.406   1.00 28.32 ? 546  ARG A CG  1 
ATOM   3784 C CD  . ARG A 1 502 ? 25.465  64.494  4.784   1.00 30.06 ? 546  ARG A CD  1 
ATOM   3785 N NE  . ARG A 1 502 ? 23.997  64.523  4.934   1.00 36.91 ? 546  ARG A NE  1 
ATOM   3786 C CZ  . ARG A 1 502 ? 23.145  64.092  4.007   1.00 39.95 ? 546  ARG A CZ  1 
ATOM   3787 N NH1 . ARG A 1 502 ? 23.619  63.628  2.862   1.00 38.00 ? 546  ARG A NH1 1 
ATOM   3788 N NH2 . ARG A 1 502 ? 21.815  64.130  4.220   1.00 39.02 ? 546  ARG A NH2 1 
ATOM   3789 N N   . SER A 1 503 ? 30.424  61.404  6.553   1.00 23.65 ? 547  SER A N   1 
ATOM   3790 C CA  . SER A 1 503 ? 31.851  61.194  6.267   1.00 22.94 ? 547  SER A CA  1 
ATOM   3791 C C   . SER A 1 503 ? 32.067  59.679  6.289   1.00 23.93 ? 547  SER A C   1 
ATOM   3792 O O   . SER A 1 503 ? 31.248  58.939  6.862   1.00 23.74 ? 547  SER A O   1 
ATOM   3793 C CB  . SER A 1 503 ? 32.710  61.783  7.402   1.00 22.22 ? 547  SER A CB  1 
ATOM   3794 O OG  . SER A 1 503 ? 34.047  61.916  6.910   1.00 34.60 ? 547  SER A OG  1 
ATOM   3795 N N   . MET A 1 504 ? 33.151  59.215  5.671   1.00 22.29 ? 548  MET A N   1 
ATOM   3796 C CA  . MET A 1 504 ? 33.642  57.871  5.839   1.00 27.77 ? 548  MET A CA  1 
ATOM   3797 C C   . MET A 1 504 ? 34.977  57.808  6.597   1.00 24.92 ? 548  MET A C   1 
ATOM   3798 O O   . MET A 1 504 ? 35.688  56.850  6.496   1.00 27.54 ? 548  MET A O   1 
ATOM   3799 C CB  . MET A 1 504 ? 33.793  57.188  4.469   1.00 25.76 ? 548  MET A CB  1 
ATOM   3800 C CG  . MET A 1 504 ? 32.465  57.239  3.629   1.00 26.35 ? 548  MET A CG  1 
ATOM   3801 S SD  . MET A 1 504 ? 32.801  56.034  2.334   1.00 40.49 ? 548  MET A SD  1 
ATOM   3802 C CE  . MET A 1 504 ? 32.297  54.707  3.361   1.00 38.75 ? 548  MET A CE  1 
ATOM   3803 N N   . ASN A 1 505 ? 35.295  58.859  7.349   1.00 26.47 ? 549  ASN A N   1 
ATOM   3804 C CA  . ASN A 1 505 ? 36.482  58.968  8.206   1.00 23.59 ? 549  ASN A CA  1 
ATOM   3805 C C   . ASN A 1 505 ? 36.064  58.934  9.661   1.00 25.01 ? 549  ASN A C   1 
ATOM   3806 O O   . ASN A 1 505 ? 35.043  59.608  10.078  1.00 24.02 ? 549  ASN A O   1 
ATOM   3807 C CB  . ASN A 1 505 ? 37.139  60.279  7.954   1.00 24.27 ? 549  ASN A CB  1 
ATOM   3808 C CG  . ASN A 1 505 ? 37.617  60.411  6.526   1.00 27.34 ? 549  ASN A CG  1 
ATOM   3809 O OD1 . ASN A 1 505 ? 38.436  59.608  6.061   1.00 25.25 ? 549  ASN A OD1 1 
ATOM   3810 N ND2 . ASN A 1 505 ? 37.037  61.362  5.793   1.00 24.87 ? 549  ASN A ND2 1 
ATOM   3811 N N   . ILE A 1 506 ? 36.788  58.168  10.438  1.00 22.61 ? 550  ILE A N   1 
ATOM   3812 C CA  . ILE A 1 506 ? 36.576  58.121  11.848  1.00 24.48 ? 550  ILE A CA  1 
ATOM   3813 C C   . ILE A 1 506 ? 37.913  58.249  12.553  1.00 22.24 ? 550  ILE A C   1 
ATOM   3814 O O   . ILE A 1 506 ? 38.930  57.607  12.150  1.00 22.77 ? 550  ILE A O   1 
ATOM   3815 C CB  . ILE A 1 506 ? 35.798  56.770  12.277  1.00 25.40 ? 550  ILE A CB  1 
ATOM   3816 C CG1 . ILE A 1 506 ? 35.347  56.738  13.751  1.00 26.80 ? 550  ILE A CG1 1 
ATOM   3817 C CG2 . ILE A 1 506 ? 36.622  55.513  11.975  1.00 22.10 ? 550  ILE A CG2 1 
ATOM   3818 C CD1 . ILE A 1 506 ? 34.755  57.871  14.135  1.00 28.35 ? 550  ILE A CD1 1 
ATOM   3819 N N   . SER A 1 507 ? 37.959  59.108  13.581  1.00 21.48 ? 551  SER A N   1 
ATOM   3820 C CA  . SER A 1 507 ? 39.209  59.177  14.386  1.00 23.00 ? 551  SER A CA  1 
ATOM   3821 C C   . SER A 1 507 ? 39.074  58.545  15.731  1.00 22.69 ? 551  SER A C   1 
ATOM   3822 O O   . SER A 1 507 ? 38.117  58.820  16.469  1.00 22.53 ? 551  SER A O   1 
ATOM   3823 C CB  . SER A 1 507 ? 39.755  60.588  14.577  1.00 23.11 ? 551  SER A CB  1 
ATOM   3824 O OG  . SER A 1 507 ? 39.771  61.263  13.333  1.00 25.48 ? 551  SER A OG  1 
ATOM   3825 N N   . ILE A 1 508 ? 40.068  57.730  16.049  1.00 22.57 ? 552  ILE A N   1 
ATOM   3826 C CA  . ILE A 1 508 ? 40.177  57.046  17.352  1.00 22.03 ? 552  ILE A CA  1 
ATOM   3827 C C   . ILE A 1 508 ? 41.246  57.798  18.205  1.00 23.30 ? 552  ILE A C   1 
ATOM   3828 O O   . ILE A 1 508 ? 42.423  57.879  17.767  1.00 23.26 ? 552  ILE A O   1 
ATOM   3829 C CB  . ILE A 1 508 ? 40.592  55.569  17.102  1.00 23.20 ? 552  ILE A CB  1 
ATOM   3830 C CG1 . ILE A 1 508 ? 39.638  54.911  16.112  1.00 24.79 ? 552  ILE A CG1 1 
ATOM   3831 C CG2 . ILE A 1 508 ? 40.686  54.780  18.405  1.00 21.43 ? 552  ILE A CG2 1 
ATOM   3832 C CD1 . ILE A 1 508 ? 40.219  53.741  15.419  1.00 25.27 ? 552  ILE A CD1 1 
ATOM   3833 N N   . TRP A 1 509 ? 40.865  58.346  19.375  1.00 20.80 ? 553  TRP A N   1 
ATOM   3834 C CA  . TRP A 1 509 ? 41.797  59.046  20.253  1.00 22.33 ? 553  TRP A CA  1 
ATOM   3835 C C   . TRP A 1 509 ? 42.124  58.210  21.472  1.00 22.27 ? 553  TRP A C   1 
ATOM   3836 O O   . TRP A 1 509 ? 41.249  57.523  22.015  1.00 21.89 ? 553  TRP A O   1 
ATOM   3837 C CB  . TRP A 1 509 ? 41.176  60.344  20.732  1.00 23.87 ? 553  TRP A CB  1 
ATOM   3838 C CG  . TRP A 1 509 ? 41.173  61.315  19.662  1.00 24.22 ? 553  TRP A CG  1 
ATOM   3839 C CD1 . TRP A 1 509 ? 40.334  61.377  18.601  1.00 26.63 ? 553  TRP A CD1 1 
ATOM   3840 C CD2 . TRP A 1 509 ? 42.095  62.369  19.516  1.00 27.22 ? 553  TRP A CD2 1 
ATOM   3841 N NE1 . TRP A 1 509 ? 40.684  62.423  17.788  1.00 27.44 ? 553  TRP A NE1 1 
ATOM   3842 C CE2 . TRP A 1 509 ? 41.751  63.062  18.350  1.00 29.98 ? 553  TRP A CE2 1 
ATOM   3843 C CE3 . TRP A 1 509 ? 43.162  62.826  20.289  1.00 28.58 ? 553  TRP A CE3 1 
ATOM   3844 C CZ2 . TRP A 1 509 ? 42.443  64.154  17.931  1.00 30.30 ? 553  TRP A CZ2 1 
ATOM   3845 C CZ3 . TRP A 1 509 ? 43.803  63.913  19.891  1.00 27.97 ? 553  TRP A CZ3 1 
ATOM   3846 C CH2 . TRP A 1 509 ? 43.453  64.568  18.724  1.00 26.88 ? 553  TRP A CH2 1 
ATOM   3847 N N   . GLY A 1 510 ? 43.368  58.253  21.889  1.00 23.36 ? 554  GLY A N   1 
ATOM   3848 C CA  . GLY A 1 510 ? 43.763  57.674  23.178  1.00 23.75 ? 554  GLY A CA  1 
ATOM   3849 C C   . GLY A 1 510 ? 45.170  58.009  23.550  1.00 25.21 ? 554  GLY A C   1 
ATOM   3850 O O   . GLY A 1 510 ? 45.790  58.890  22.951  1.00 25.39 ? 554  GLY A O   1 
ATOM   3851 N N   . PHE A 1 511 ? 45.718  57.281  24.506  1.00 26.02 ? 555  PHE A N   1 
ATOM   3852 C CA  . PHE A 1 511 ? 47.117  57.435  24.824  1.00 26.64 ? 555  PHE A CA  1 
ATOM   3853 C C   . PHE A 1 511 ? 47.797  56.115  25.054  1.00 26.94 ? 555  PHE A C   1 
ATOM   3854 O O   . PHE A 1 511 ? 47.197  55.137  25.436  1.00 24.17 ? 555  PHE A O   1 
ATOM   3855 C CB  . PHE A 1 511 ? 47.314  58.306  26.068  1.00 28.17 ? 555  PHE A CB  1 
ATOM   3856 C CG  . PHE A 1 511 ? 46.604  57.802  27.295  1.00 28.37 ? 555  PHE A CG  1 
ATOM   3857 C CD1 . PHE A 1 511 ? 47.278  57.047  28.253  1.00 30.73 ? 555  PHE A CD1 1 
ATOM   3858 C CD2 . PHE A 1 511 ? 45.307  58.115  27.511  1.00 28.94 ? 555  PHE A CD2 1 
ATOM   3859 C CE1 . PHE A 1 511 ? 46.625  56.593  29.406  1.00 28.27 ? 555  PHE A CE1 1 
ATOM   3860 C CE2 . PHE A 1 511 ? 44.634  57.665  28.646  1.00 31.63 ? 555  PHE A CE2 1 
ATOM   3861 C CZ  . PHE A 1 511 ? 45.311  56.904  29.606  1.00 29.23 ? 555  PHE A CZ  1 
ATOM   3862 N N   . THR A 1 512 ? 49.081  56.101  24.792  1.00 28.18 ? 556  THR A N   1 
ATOM   3863 C CA  . THR A 1 512 ? 49.855  54.943  25.067  1.00 30.94 ? 556  THR A CA  1 
ATOM   3864 C C   . THR A 1 512 ? 50.541  55.247  26.401  1.00 32.32 ? 556  THR A C   1 
ATOM   3865 O O   . THR A 1 512 ? 50.897  56.400  26.671  1.00 31.06 ? 556  THR A O   1 
ATOM   3866 C CB  . THR A 1 512 ? 50.862  54.732  23.911  1.00 32.32 ? 556  THR A CB  1 
ATOM   3867 O OG1 . THR A 1 512 ? 51.659  53.586  24.179  1.00 39.01 ? 556  THR A OG1 1 
ATOM   3868 C CG2 . THR A 1 512 ? 51.809  55.903  23.782  1.00 31.91 ? 556  THR A CG2 1 
ATOM   3869 N N   . GLU A 1 513 ? 50.716  54.226  27.234  1.00 34.64 ? 557  GLU A N   1 
ATOM   3870 C CA  . GLU A 1 513 ? 51.418  54.392  28.512  1.00 38.32 ? 557  GLU A CA  1 
ATOM   3871 C C   . GLU A 1 513 ? 52.507  53.319  28.660  1.00 38.70 ? 557  GLU A C   1 
ATOM   3872 O O   . GLU A 1 513 ? 52.258  52.127  28.444  1.00 40.20 ? 557  GLU A O   1 
ATOM   3873 C CB  . GLU A 1 513 ? 50.418  54.336  29.680  1.00 37.48 ? 557  GLU A CB  1 
ATOM   3874 C CG  . GLU A 1 513 ? 50.818  55.046  30.960  1.00 40.99 ? 557  GLU A CG  1 
ATOM   3875 C CD  . GLU A 1 513 ? 49.648  55.077  31.960  1.00 42.62 ? 557  GLU A CD  1 
ATOM   3876 O OE1 . GLU A 1 513 ? 49.300  53.995  32.509  1.00 46.86 ? 557  GLU A OE1 1 
ATOM   3877 O OE2 . GLU A 1 513 ? 49.065  56.171  32.190  1.00 46.64 ? 557  GLU A OE2 1 
ATOM   3878 N N   . SER A 1 514 ? 53.717  53.757  28.975  1.00 38.62 ? 558  SER A N   1 
ATOM   3879 C CA  . SER A 1 514 ? 54.741  52.866  29.465  1.00 39.35 ? 558  SER A CA  1 
ATOM   3880 C C   . SER A 1 514 ? 55.013  53.173  30.949  1.00 38.55 ? 558  SER A C   1 
ATOM   3881 O O   . SER A 1 514 ? 54.396  54.075  31.522  1.00 37.84 ? 558  SER A O   1 
ATOM   3882 C CB  . SER A 1 514 ? 56.022  52.985  28.624  1.00 39.57 ? 558  SER A CB  1 
ATOM   3883 O OG  . SER A 1 514 ? 56.258  54.321  28.212  1.00 42.48 ? 558  SER A OG  1 
ATOM   3884 N N   . PHE A 1 515 ? 55.907  52.406  31.567  1.00 38.31 ? 559  PHE A N   1 
ATOM   3885 C CA  . PHE A 1 515 ? 56.370  52.709  32.922  1.00 38.60 ? 559  PHE A CA  1 
ATOM   3886 C C   . PHE A 1 515 ? 56.947  54.113  32.940  1.00 38.61 ? 559  PHE A C   1 
ATOM   3887 O O   . PHE A 1 515 ? 56.621  54.929  33.793  1.00 38.33 ? 559  PHE A O   1 
ATOM   3888 C CB  . PHE A 1 515 ? 57.448  51.720  33.307  1.00 38.64 ? 559  PHE A CB  1 
ATOM   3889 C CG  . PHE A 1 515 ? 57.776  51.695  34.780  1.00 39.44 ? 559  PHE A CG  1 
ATOM   3890 C CD1 . PHE A 1 515 ? 56.787  51.453  35.736  1.00 40.10 ? 559  PHE A CD1 1 
ATOM   3891 C CD2 . PHE A 1 515 ? 59.076  51.877  35.206  1.00 38.39 ? 559  PHE A CD2 1 
ATOM   3892 C CE1 . PHE A 1 515 ? 57.107  51.405  37.095  1.00 39.04 ? 559  PHE A CE1 1 
ATOM   3893 C CE2 . PHE A 1 515 ? 59.395  51.823  36.559  1.00 40.21 ? 559  PHE A CE2 1 
ATOM   3894 C CZ  . PHE A 1 515 ? 58.399  51.584  37.503  1.00 39.05 ? 559  PHE A CZ  1 
ATOM   3895 N N   . LEU A 1 516 ? 57.778  54.357  31.926  1.00 39.17 ? 560  LEU A N   1 
ATOM   3896 C CA  . LEU A 1 516 ? 58.622  55.536  31.736  1.00 39.21 ? 560  LEU A CA  1 
ATOM   3897 C C   . LEU A 1 516 ? 57.866  56.804  31.292  1.00 39.27 ? 560  LEU A C   1 
ATOM   3898 O O   . LEU A 1 516 ? 58.143  57.885  31.788  1.00 39.43 ? 560  LEU A O   1 
ATOM   3899 C CB  . LEU A 1 516 ? 59.680  55.197  30.666  1.00 39.29 ? 560  LEU A CB  1 
ATOM   3900 C CG  . LEU A 1 516 ? 60.222  53.747  30.552  1.00 39.58 ? 560  LEU A CG  1 
ATOM   3901 C CD1 . LEU A 1 516 ? 59.263  52.767  29.836  1.00 34.88 ? 560  LEU A CD1 1 
ATOM   3902 C CD2 . LEU A 1 516 ? 61.637  53.713  29.904  1.00 39.81 ? 560  LEU A CD2 1 
ATOM   3903 N N   . THR A 1 517 ? 56.918  56.674  30.359  1.00 39.38 ? 561  THR A N   1 
ATOM   3904 C CA  . THR A 1 517 ? 56.324  57.843  29.655  1.00 38.94 ? 561  THR A CA  1 
ATOM   3905 C C   . THR A 1 517 ? 54.973  57.500  29.015  1.00 38.42 ? 561  THR A C   1 
ATOM   3906 O O   . THR A 1 517 ? 54.578  56.335  28.935  1.00 38.08 ? 561  THR A O   1 
ATOM   3907 C CB  . THR A 1 517 ? 57.250  58.390  28.496  1.00 39.69 ? 561  THR A CB  1 
ATOM   3908 O OG1 . THR A 1 517 ? 57.664  57.311  27.638  1.00 40.99 ? 561  THR A OG1 1 
ATOM   3909 C CG2 . THR A 1 517 ? 58.521  59.128  29.031  1.00 41.56 ? 561  THR A CG2 1 
ATOM   3910 N N   . SER A 1 518 ? 54.247  58.515  28.576  1.00 37.33 ? 562  SER A N   1 
ATOM   3911 C CA  . SER A 1 518 ? 53.030  58.257  27.823  1.00 37.50 ? 562  SER A CA  1 
ATOM   3912 C C   . SER A 1 518 ? 52.866  59.339  26.765  1.00 37.23 ? 562  SER A C   1 
ATOM   3913 O O   . SER A 1 518 ? 53.682  60.245  26.675  1.00 36.73 ? 562  SER A O   1 
ATOM   3914 C CB  . SER A 1 518 ? 51.803  58.123  28.734  1.00 37.72 ? 562  SER A CB  1 
ATOM   3915 O OG  . SER A 1 518 ? 51.436  59.350  29.336  1.00 40.71 ? 562  SER A OG  1 
ATOM   3916 N N   . GLN A 1 519 ? 51.841  59.233  25.942  1.00 36.22 ? 563  GLN A N   1 
ATOM   3917 C CA  . GLN A 1 519 ? 51.703  60.175  24.853  1.00 36.87 ? 563  GLN A CA  1 
ATOM   3918 C C   . GLN A 1 519 ? 50.374  59.981  24.160  1.00 34.89 ? 563  GLN A C   1 
ATOM   3919 O O   . GLN A 1 519 ? 49.866  58.861  24.085  1.00 34.09 ? 563  GLN A O   1 
ATOM   3920 C CB  . GLN A 1 519 ? 52.892  60.086  23.863  1.00 37.48 ? 563  GLN A CB  1 
ATOM   3921 C CG  . GLN A 1 519 ? 52.798  59.025  22.770  1.00 38.03 ? 563  GLN A CG  1 
ATOM   3922 C CD  . GLN A 1 519 ? 54.064  58.973  21.924  1.00 39.65 ? 563  GLN A CD  1 
ATOM   3923 O OE1 . GLN A 1 519 ? 54.928  59.861  22.003  1.00 42.47 ? 563  GLN A OE1 1 
ATOM   3924 N NE2 . GLN A 1 519 ? 54.188  57.924  21.118  1.00 42.78 ? 563  GLN A NE2 1 
ATOM   3925 N N   . TRP A 1 520 ? 49.792  61.095  23.737  1.00 34.35 ? 564  TRP A N   1 
ATOM   3926 C CA  . TRP A 1 520 ? 48.469  61.078  23.114  1.00 33.52 ? 564  TRP A CA  1 
ATOM   3927 C C   . TRP A 1 520 ? 48.635  60.715  21.668  1.00 31.32 ? 564  TRP A C   1 
ATOM   3928 O O   . TRP A 1 520 ? 49.646  61.092  21.014  1.00 28.15 ? 564  TRP A O   1 
ATOM   3929 C CB  . TRP A 1 520 ? 47.817  62.412  23.228  1.00 36.38 ? 564  TRP A CB  1 
ATOM   3930 C CG  . TRP A 1 520 ? 47.484  62.737  24.606  1.00 39.48 ? 564  TRP A CG  1 
ATOM   3931 C CD1 . TRP A 1 520 ? 48.321  63.286  25.542  1.00 42.90 ? 564  TRP A CD1 1 
ATOM   3932 C CD2 . TRP A 1 520 ? 46.226  62.539  25.253  1.00 41.38 ? 564  TRP A CD2 1 
ATOM   3933 N NE1 . TRP A 1 520 ? 47.647  63.461  26.733  1.00 45.28 ? 564  TRP A NE1 1 
ATOM   3934 C CE2 . TRP A 1 520 ? 46.356  63.021  26.579  1.00 42.99 ? 564  TRP A CE2 1 
ATOM   3935 C CE3 . TRP A 1 520 ? 44.999  62.029  24.841  1.00 43.04 ? 564  TRP A CE3 1 
ATOM   3936 C CZ2 . TRP A 1 520 ? 45.304  63.005  27.492  1.00 41.98 ? 564  TRP A CZ2 1 
ATOM   3937 C CZ3 . TRP A 1 520 ? 43.944  62.010  25.760  1.00 43.25 ? 564  TRP A CZ3 1 
ATOM   3938 C CH2 . TRP A 1 520 ? 44.115  62.479  27.076  1.00 41.26 ? 564  TRP A CH2 1 
ATOM   3939 N N   . VAL A 1 521 ? 47.679  59.936  21.177  1.00 28.09 ? 565  VAL A N   1 
ATOM   3940 C CA  . VAL A 1 521 ? 47.802  59.489  19.820  1.00 27.77 ? 565  VAL A CA  1 
ATOM   3941 C C   . VAL A 1 521 ? 46.421  59.490  19.187  1.00 26.75 ? 565  VAL A C   1 
ATOM   3942 O O   . VAL A 1 521 ? 45.430  59.183  19.886  1.00 26.95 ? 565  VAL A O   1 
ATOM   3943 C CB  . VAL A 1 521 ? 48.540  58.135  19.717  1.00 27.90 ? 565  VAL A CB  1 
ATOM   3944 C CG1 . VAL A 1 521 ? 47.748  57.058  20.485  1.00 28.49 ? 565  VAL A CG1 1 
ATOM   3945 C CG2 . VAL A 1 521 ? 48.669  57.753  18.228  1.00 26.17 ? 565  VAL A CG2 1 
ATOM   3946 N N   . SER A 1 522 ? 46.306  59.909  17.921  1.00 25.18 ? 566  SER A N   1 
ATOM   3947 C CA  . SER A 1 522 ? 45.067  59.609  17.151  1.00 25.11 ? 566  SER A CA  1 
ATOM   3948 C C   . SER A 1 522 ? 45.373  58.686  15.980  1.00 23.36 ? 566  SER A C   1 
ATOM   3949 O O   . SER A 1 522 ? 46.454  58.710  15.440  1.00 24.63 ? 566  SER A O   1 
ATOM   3950 C CB  . SER A 1 522 ? 44.352  60.858  16.622  1.00 26.09 ? 566  SER A CB  1 
ATOM   3951 O OG  . SER A 1 522 ? 45.296  61.617  15.896  1.00 31.35 ? 566  SER A OG  1 
ATOM   3952 N N   . TYR A 1 523 ? 44.446  57.812  15.673  1.00 21.77 ? 567  TYR A N   1 
ATOM   3953 C CA  . TYR A 1 523 ? 44.437  57.021  14.465  1.00 22.22 ? 567  TYR A CA  1 
ATOM   3954 C C   . TYR A 1 523 ? 43.190  57.399  13.677  1.00 22.90 ? 567  TYR A C   1 
ATOM   3955 O O   . TYR A 1 523 ? 42.032  57.219  14.179  1.00 23.55 ? 567  TYR A O   1 
ATOM   3956 C CB  . TYR A 1 523 ? 44.342  55.534  14.809  1.00 23.19 ? 567  TYR A CB  1 
ATOM   3957 C CG  . TYR A 1 523 ? 45.603  55.007  15.398  1.00 24.80 ? 567  TYR A CG  1 
ATOM   3958 C CD1 . TYR A 1 523 ? 46.586  54.436  14.578  1.00 22.93 ? 567  TYR A CD1 1 
ATOM   3959 C CD2 . TYR A 1 523 ? 45.866  55.150  16.749  1.00 22.18 ? 567  TYR A CD2 1 
ATOM   3960 C CE1 . TYR A 1 523 ? 47.746  53.972  15.114  1.00 23.58 ? 567  TYR A CE1 1 
ATOM   3961 C CE2 . TYR A 1 523 ? 47.022  54.671  17.279  1.00 24.07 ? 567  TYR A CE2 1 
ATOM   3962 C CZ  . TYR A 1 523 ? 47.952  54.105  16.455  1.00 24.64 ? 567  TYR A CZ  1 
ATOM   3963 O OH  . TYR A 1 523 ? 49.111  53.625  17.000  1.00 26.78 ? 567  TYR A OH  1 
ATOM   3964 N N   . THR A 1 524 ? 43.363  57.875  12.451  1.00 22.07 ? 568  THR A N   1 
ATOM   3965 C CA  . THR A 1 524 ? 42.200  58.102  11.568  1.00 22.18 ? 568  THR A CA  1 
ATOM   3966 C C   . THR A 1 524 ? 42.104  57.025  10.451  1.00 23.17 ? 568  THR A C   1 
ATOM   3967 O O   . THR A 1 524 ? 43.106  56.683  9.799   1.00 21.77 ? 568  THR A O   1 
ATOM   3968 C CB  . THR A 1 524 ? 42.145  59.545  11.041  1.00 22.55 ? 568  THR A CB  1 
ATOM   3969 O OG1 . THR A 1 524 ? 41.988  60.442  12.153  1.00 26.83 ? 568  THR A OG1 1 
ATOM   3970 C CG2 . THR A 1 524 ? 40.938  59.801  10.026  1.00 21.59 ? 568  THR A CG2 1 
ATOM   3971 N N   . ILE A 1 525 ? 40.913  56.440  10.328  1.00 21.73 ? 569  ILE A N   1 
ATOM   3972 C CA  . ILE A 1 525 ? 40.635  55.415  9.350   1.00 22.67 ? 569  ILE A CA  1 
ATOM   3973 C C   . ILE A 1 525 ? 39.607  55.919  8.322   1.00 23.11 ? 569  ILE A C   1 
ATOM   3974 O O   . ILE A 1 525 ? 38.476  56.431  8.678   1.00 24.26 ? 569  ILE A O   1 
ATOM   3975 C CB  . ILE A 1 525 ? 40.098  54.141  10.050  1.00 22.59 ? 569  ILE A CB  1 
ATOM   3976 C CG1 . ILE A 1 525 ? 41.081  53.728  11.135  1.00 21.26 ? 569  ILE A CG1 1 
ATOM   3977 C CG2 . ILE A 1 525 ? 39.834  52.986  9.000   1.00 20.88 ? 569  ILE A CG2 1 
ATOM   3978 C CD1 . ILE A 1 525 ? 40.587  52.588  12.006  1.00 27.80 ? 569  ILE A CD1 1 
ATOM   3979 N N   . ASP A 1 526 ? 39.981  55.738  7.061   1.00 23.00 ? 570  ASP A N   1 
ATOM   3980 C CA  . ASP A 1 526 ? 39.148  56.074  5.887   1.00 24.37 ? 570  ASP A CA  1 
ATOM   3981 C C   . ASP A 1 526 ? 38.588  54.795  5.249   1.00 24.64 ? 570  ASP A C   1 
ATOM   3982 O O   . ASP A 1 526 ? 39.324  53.949  4.738   1.00 26.27 ? 570  ASP A O   1 
ATOM   3983 C CB  . ASP A 1 526 ? 39.929  56.954  4.896   1.00 22.50 ? 570  ASP A CB  1 
ATOM   3984 C CG  . ASP A 1 526 ? 39.046  57.595  3.787   1.00 28.81 ? 570  ASP A CG  1 
ATOM   3985 O OD1 . ASP A 1 526 ? 37.818  57.229  3.517   1.00 30.08 ? 570  ASP A OD1 1 
ATOM   3986 O OD2 . ASP A 1 526 ? 39.625  58.531  3.179   1.00 30.51 ? 570  ASP A OD2 1 
ATOM   3987 N N   . PHE A 1 527 ? 37.281  54.641  5.338   1.00 26.52 ? 571  PHE A N   1 
ATOM   3988 C CA  . PHE A 1 527 ? 36.576  53.482  4.729   1.00 26.76 ? 571  PHE A CA  1 
ATOM   3989 C C   . PHE A 1 527 ? 36.333  53.538  3.200   1.00 26.25 ? 571  PHE A C   1 
ATOM   3990 O O   . PHE A 1 527 ? 35.522  52.765  2.678   1.00 25.90 ? 571  PHE A O   1 
ATOM   3991 C CB  . PHE A 1 527 ? 35.263  53.299  5.480   1.00 27.20 ? 571  PHE A CB  1 
ATOM   3992 C CG  . PHE A 1 527 ? 35.469  52.729  6.839   1.00 26.56 ? 571  PHE A CG  1 
ATOM   3993 C CD1 . PHE A 1 527 ? 35.364  51.370  7.059   1.00 24.72 ? 571  PHE A CD1 1 
ATOM   3994 C CD2 . PHE A 1 527 ? 35.828  53.555  7.898   1.00 29.09 ? 571  PHE A CD2 1 
ATOM   3995 C CE1 . PHE A 1 527 ? 35.607  50.855  8.333   1.00 30.07 ? 571  PHE A CE1 1 
ATOM   3996 C CE2 . PHE A 1 527 ? 36.076  53.033  9.159   1.00 29.92 ? 571  PHE A CE2 1 
ATOM   3997 C CZ  . PHE A 1 527 ? 35.973  51.695  9.380   1.00 29.21 ? 571  PHE A CZ  1 
ATOM   3998 N N   . LYS A 1 528 ? 37.093  54.373  2.477   1.00 25.67 ? 572  LYS A N   1 
ATOM   3999 C CA  . LYS A 1 528 ? 36.759  54.674  1.068   1.00 25.96 ? 572  LYS A CA  1 
ATOM   4000 C C   . LYS A 1 528 ? 37.032  53.449  0.201   1.00 26.76 ? 572  LYS A C   1 
ATOM   4001 O O   . LYS A 1 528 ? 36.481  53.315  -0.900  1.00 24.91 ? 572  LYS A O   1 
ATOM   4002 C CB  . LYS A 1 528 ? 37.630  55.825  0.532   1.00 27.18 ? 572  LYS A CB  1 
ATOM   4003 C CG  . LYS A 1 528 ? 39.150  55.580  0.635   1.00 25.58 ? 572  LYS A CG  1 
ATOM   4004 C CD  . LYS A 1 528 ? 39.919  56.743  -0.055  1.00 28.76 ? 572  LYS A CD  1 
ATOM   4005 C CE  . LYS A 1 528 ? 41.383  56.479  -0.093  1.00 35.40 ? 572  LYS A CE  1 
ATOM   4006 N NZ  . LYS A 1 528 ? 41.765  55.364  -1.062  1.00 39.31 ? 572  LYS A NZ  1 
ATOM   4007 N N   . ASP A 1 529 ? 37.872  52.557  0.697   1.00 27.28 ? 573  ASP A N   1 
ATOM   4008 C CA  . ASP A 1 529 ? 38.228  51.343  -0.096  1.00 30.23 ? 573  ASP A CA  1 
ATOM   4009 C C   . ASP A 1 529 ? 37.345  50.134  0.239   1.00 30.56 ? 573  ASP A C   1 
ATOM   4010 O O   . ASP A 1 529 ? 37.430  49.143  -0.474  1.00 32.20 ? 573  ASP A O   1 
ATOM   4011 C CB  . ASP A 1 529 ? 39.709  50.995  0.039   1.00 30.60 ? 573  ASP A CB  1 
ATOM   4012 C CG  . ASP A 1 529 ? 40.622  51.963  -0.718  1.00 34.64 ? 573  ASP A CG  1 
ATOM   4013 O OD1 . ASP A 1 529 ? 40.107  52.753  -1.556  1.00 39.49 ? 573  ASP A OD1 1 
ATOM   4014 O OD2 . ASP A 1 529 ? 41.865  51.943  -0.488  1.00 41.52 ? 573  ASP A OD2 1 
ATOM   4015 N N   . ILE A 1 530 ? 36.532  50.239  1.309   1.00 29.45 ? 574  ILE A N   1 
ATOM   4016 C CA  . ILE A 1 530 ? 35.543  49.214  1.764   1.00 28.78 ? 574  ILE A CA  1 
ATOM   4017 C C   . ILE A 1 530 ? 34.281  49.561  0.978   1.00 30.03 ? 574  ILE A C   1 
ATOM   4018 O O   . ILE A 1 530 ? 33.750  48.742  0.200   1.00 28.84 ? 574  ILE A O   1 
ATOM   4019 C CB  . ILE A 1 530 ? 35.277  49.296  3.295   1.00 30.27 ? 574  ILE A CB  1 
ATOM   4020 C CG1 . ILE A 1 530 ? 36.520  48.981  4.129   1.00 28.46 ? 574  ILE A CG1 1 
ATOM   4021 C CG2 . ILE A 1 530 ? 34.160  48.352  3.781   1.00 29.38 ? 574  ILE A CG2 1 
ATOM   4022 C CD1 . ILE A 1 530 ? 36.915  47.597  4.018   1.00 33.44 ? 574  ILE A CD1 1 
ATOM   4023 N N   . LEU A 1 531 ? 33.843  50.816  1.082   1.00 28.44 ? 575  LEU A N   1 
ATOM   4024 C CA  . LEU A 1 531 ? 32.662  51.236  0.318   1.00 29.47 ? 575  LEU A CA  1 
ATOM   4025 C C   . LEU A 1 531 ? 33.053  51.866  -1.006  1.00 29.74 ? 575  LEU A C   1 
ATOM   4026 O O   . LEU A 1 531 ? 32.843  53.060  -1.233  1.00 27.21 ? 575  LEU A O   1 
ATOM   4027 C CB  . LEU A 1 531 ? 31.764  52.191  1.180   1.00 30.17 ? 575  LEU A CB  1 
ATOM   4028 C CG  . LEU A 1 531 ? 31.225  51.595  2.487   1.00 29.86 ? 575  LEU A CG  1 
ATOM   4029 C CD1 . LEU A 1 531 ? 30.101  52.457  2.995   1.00 34.37 ? 575  LEU A CD1 1 
ATOM   4030 C CD2 . LEU A 1 531 ? 30.643  50.240  2.295   1.00 31.67 ? 575  LEU A CD2 1 
ATOM   4031 N N   . GLU A 1 532 ? 33.682  51.051  -1.876  1.00 31.05 ? 576  GLU A N   1 
ATOM   4032 C CA  . GLU A 1 532 ? 34.397  51.573  -3.038  1.00 31.54 ? 576  GLU A CA  1 
ATOM   4033 C C   . GLU A 1 532 ? 33.414  51.935  -4.194  1.00 30.99 ? 576  GLU A C   1 
ATOM   4034 O O   . GLU A 1 532 ? 33.777  52.704  -5.090  1.00 29.20 ? 576  GLU A O   1 
ATOM   4035 C CB  . GLU A 1 532 ? 35.525  50.558  -3.421  1.00 32.11 ? 576  GLU A CB  1 
ATOM   4036 C CG  . GLU A 1 532 ? 35.361  49.766  -4.702  1.00 35.11 ? 576  GLU A CG  1 
ATOM   4037 C CD  . GLU A 1 532 ? 36.550  48.792  -4.915  1.00 35.09 ? 576  GLU A CD  1 
ATOM   4038 O OE1 . GLU A 1 532 ? 36.445  47.600  -4.564  1.00 36.89 ? 576  GLU A OE1 1 
ATOM   4039 O OE2 . GLU A 1 532 ? 37.591  49.240  -5.375  1.00 38.79 ? 576  GLU A OE2 1 
ATOM   4040 N N   . ARG A 1 533 ? 32.136  51.486  -4.109  1.00 30.28 ? 577  ARG A N   1 
ATOM   4041 C CA  . ARG A 1 533 ? 31.156  51.866  -5.136  1.00 29.55 ? 577  ARG A CA  1 
ATOM   4042 C C   . ARG A 1 533 ? 29.989  52.718  -4.605  1.00 29.42 ? 577  ARG A C   1 
ATOM   4043 O O   . ARG A 1 533 ? 29.501  52.469  -3.497  1.00 26.40 ? 577  ARG A O   1 
ATOM   4044 C CB  . ARG A 1 533 ? 30.656  50.657  -5.937  1.00 29.98 ? 577  ARG A CB  1 
ATOM   4045 C CG  . ARG A 1 533 ? 29.714  49.736  -5.220  1.00 30.76 ? 577  ARG A CG  1 
ATOM   4046 C CD  . ARG A 1 533 ? 28.913  48.834  -6.206  1.00 30.17 ? 577  ARG A CD  1 
ATOM   4047 N NE  . ARG A 1 533 ? 27.953  48.104  -5.381  1.00 29.08 ? 577  ARG A NE  1 
ATOM   4048 C CZ  . ARG A 1 533 ? 26.653  48.418  -5.279  1.00 33.33 ? 577  ARG A CZ  1 
ATOM   4049 N NH1 . ARG A 1 533 ? 26.134  49.387  -6.051  1.00 25.82 ? 577  ARG A NH1 1 
ATOM   4050 N NH2 . ARG A 1 533 ? 25.855  47.713  -4.469  1.00 31.00 ? 577  ARG A NH2 1 
ATOM   4051 N N   . ASN A 1 534 ? 29.574  53.709  -5.408  1.00 29.29 ? 578  ASN A N   1 
ATOM   4052 C CA  . ASN A 1 534 ? 28.405  54.547  -5.073  1.00 30.21 ? 578  ASN A CA  1 
ATOM   4053 C C   . ASN A 1 534 ? 27.132  53.721  -5.142  1.00 28.77 ? 578  ASN A C   1 
ATOM   4054 O O   . ASN A 1 534 ? 26.985  52.846  -6.011  1.00 27.41 ? 578  ASN A O   1 
ATOM   4055 C CB  . ASN A 1 534 ? 28.270  55.726  -6.061  1.00 31.66 ? 578  ASN A CB  1 
ATOM   4056 C CG  . ASN A 1 534 ? 29.522  56.619  -6.110  1.00 36.45 ? 578  ASN A CG  1 
ATOM   4057 O OD1 . ASN A 1 534 ? 30.291  56.709  -5.138  1.00 40.45 ? 578  ASN A OD1 1 
ATOM   4058 N ND2 . ASN A 1 534 ? 29.715  57.298  -7.249  1.00 36.42 ? 578  ASN A ND2 1 
ATOM   4059 N N   . CYS A 1 535 ? 26.188  54.001  -4.256  1.00 28.89 ? 579  CYS A N   1 
ATOM   4060 C CA  . CYS A 1 535 ? 24.920  53.289  -4.312  1.00 29.75 ? 579  CYS A CA  1 
ATOM   4061 C C   . CYS A 1 535 ? 24.221  53.797  -5.569  1.00 28.79 ? 579  CYS A C   1 
ATOM   4062 O O   . CYS A 1 535 ? 24.461  54.958  -5.970  1.00 29.61 ? 579  CYS A O   1 
ATOM   4063 C CB  . CYS A 1 535 ? 24.089  53.598  -3.044  1.00 30.35 ? 579  CYS A CB  1 
ATOM   4064 S SG  . CYS A 1 535 ? 24.951  52.922  -1.554  1.00 36.50 ? 579  CYS A SG  1 
ATOM   4065 N N   . GLU A 1 536 ? 23.386  52.965  -6.178  1.00 26.38 ? 580  GLU A N   1 
ATOM   4066 C CA  . GLU A 1 536 ? 22.543  53.357  -7.299  1.00 27.37 ? 580  GLU A CA  1 
ATOM   4067 C C   . GLU A 1 536 ? 21.079  53.081  -6.932  1.00 27.30 ? 580  GLU A C   1 
ATOM   4068 O O   . GLU A 1 536 ? 20.808  52.524  -5.862  1.00 24.36 ? 580  GLU A O   1 
ATOM   4069 C CB  . GLU A 1 536 ? 22.905  52.502  -8.494  1.00 27.27 ? 580  GLU A CB  1 
ATOM   4070 C CG  . GLU A 1 536 ? 24.392  52.528  -8.801  1.00 33.43 ? 580  GLU A CG  1 
ATOM   4071 C CD  . GLU A 1 536 ? 24.856  53.832  -9.474  1.00 44.53 ? 580  GLU A CD  1 
ATOM   4072 O OE1 . GLU A 1 536 ? 24.012  54.769  -9.638  1.00 49.91 ? 580  GLU A OE1 1 
ATOM   4073 O OE2 . GLU A 1 536 ? 26.069  53.918  -9.846  1.00 45.16 ? 580  GLU A OE2 1 
ATOM   4074 N N   . GLU A 1 537 ? 20.150  53.364  -7.845  1.00 27.74 ? 581  GLU A N   1 
ATOM   4075 C CA  . GLU A 1 537 ? 18.695  53.202  -7.528  1.00 32.37 ? 581  GLU A CA  1 
ATOM   4076 C C   . GLU A 1 537 ? 18.358  51.793  -7.038  1.00 29.86 ? 581  GLU A C   1 
ATOM   4077 O O   . GLU A 1 537 ? 17.548  51.612  -6.143  1.00 29.69 ? 581  GLU A O   1 
ATOM   4078 C CB  . GLU A 1 537 ? 17.842  53.537  -8.771  1.00 32.16 ? 581  GLU A CB  1 
ATOM   4079 C CG  . GLU A 1 537 ? 16.403  54.108  -8.487  1.00 40.07 ? 581  GLU A CG  1 
ATOM   4080 C CD  . GLU A 1 537 ? 15.603  54.352  -9.806  1.00 41.35 ? 581  GLU A CD  1 
ATOM   4081 O OE1 . GLU A 1 537 ? 16.003  55.264  -10.575 1.00 51.71 ? 581  GLU A OE1 1 
ATOM   4082 O OE2 . GLU A 1 537 ? 14.609  53.624  -10.086 1.00 50.34 ? 581  GLU A OE2 1 
ATOM   4083 N N   . LYS A 1 538 ? 18.965  50.777  -7.669  1.00 28.35 ? 582  LYS A N   1 
ATOM   4084 C CA  . LYS A 1 538 ? 18.771  49.350  -7.338  1.00 27.77 ? 582  LYS A CA  1 
ATOM   4085 C C   . LYS A 1 538 ? 19.212  48.945  -5.921  1.00 24.73 ? 582  LYS A C   1 
ATOM   4086 O O   . LYS A 1 538 ? 18.799  47.905  -5.374  1.00 25.19 ? 582  LYS A O   1 
ATOM   4087 C CB  . LYS A 1 538 ? 19.549  48.494  -8.397  1.00 29.50 ? 582  LYS A CB  1 
ATOM   4088 C CG  . LYS A 1 538 ? 21.048  48.383  -8.031  1.00 31.14 ? 582  LYS A CG  1 
ATOM   4089 C CD  . LYS A 1 538 ? 22.068  48.253  -9.221  1.00 32.44 ? 582  LYS A CD  1 
ATOM   4090 C CE  . LYS A 1 538 ? 23.515  48.685  -8.758  1.00 34.35 ? 582  LYS A CE  1 
ATOM   4091 N NZ  . LYS A 1 538 ? 24.495  48.818  -9.975  1.00 38.89 ? 582  LYS A NZ  1 
ATOM   4092 N N   . ASP A 1 539 ? 20.041  49.766  -5.290  1.00 22.77 ? 583  ASP A N   1 
ATOM   4093 C CA  . ASP A 1 539 ? 20.497  49.531  -3.926  1.00 22.44 ? 583  ASP A CA  1 
ATOM   4094 C C   . ASP A 1 539 ? 19.539  49.910  -2.781  1.00 23.82 ? 583  ASP A C   1 
ATOM   4095 O O   . ASP A 1 539 ? 19.860  49.706  -1.614  1.00 23.70 ? 583  ASP A O   1 
ATOM   4096 C CB  . ASP A 1 539 ? 21.804  50.266  -3.736  1.00 21.78 ? 583  ASP A CB  1 
ATOM   4097 C CG  . ASP A 1 539 ? 22.962  49.557  -4.535  1.00 27.04 ? 583  ASP A CG  1 
ATOM   4098 O OD1 . ASP A 1 539 ? 23.134  48.321  -4.311  1.00 28.30 ? 583  ASP A OD1 1 
ATOM   4099 O OD2 . ASP A 1 539 ? 23.655  50.213  -5.337  1.00 22.45 ? 583  ASP A OD2 1 
ATOM   4100 N N   . TYR A 1 540 ? 18.399  50.460  -3.147  1.00 22.26 ? 584  TYR A N   1 
ATOM   4101 C CA  . TYR A 1 540 ? 17.453  51.045  -2.168  1.00 21.49 ? 584  TYR A CA  1 
ATOM   4102 C C   . TYR A 1 540 ? 16.184  50.270  -2.274  1.00 21.50 ? 584  TYR A C   1 
ATOM   4103 O O   . TYR A 1 540 ? 15.790  49.776  -3.373  1.00 21.60 ? 584  TYR A O   1 
ATOM   4104 C CB  . TYR A 1 540 ? 17.205  52.532  -2.449  1.00 21.56 ? 584  TYR A CB  1 
ATOM   4105 C CG  . TYR A 1 540 ? 18.408  53.383  -2.162  1.00 22.51 ? 584  TYR A CG  1 
ATOM   4106 C CD1 . TYR A 1 540 ? 18.718  53.799  -0.857  1.00 23.84 ? 584  TYR A CD1 1 
ATOM   4107 C CD2 . TYR A 1 540 ? 19.285  53.709  -3.186  1.00 27.04 ? 584  TYR A CD2 1 
ATOM   4108 C CE1 . TYR A 1 540 ? 19.868  54.524  -0.596  1.00 21.76 ? 584  TYR A CE1 1 
ATOM   4109 C CE2 . TYR A 1 540 ? 20.480  54.410  -2.924  1.00 27.39 ? 584  TYR A CE2 1 
ATOM   4110 C CZ  . TYR A 1 540 ? 20.742  54.826  -1.638  1.00 27.44 ? 584  TYR A CZ  1 
ATOM   4111 O OH  . TYR A 1 540 ? 21.871  55.566  -1.387  1.00 26.21 ? 584  TYR A OH  1 
ATOM   4112 N N   . THR A 1 541 ? 15.458  50.222  -1.175  1.00 23.00 ? 585  THR A N   1 
ATOM   4113 C CA  . THR A 1 541 ? 14.224  49.463  -1.184  1.00 22.94 ? 585  THR A CA  1 
ATOM   4114 C C   . THR A 1 541 ? 13.193  50.282  -0.432  1.00 23.18 ? 585  THR A C   1 
ATOM   4115 O O   . THR A 1 541 ? 13.527  50.992  0.526   1.00 20.57 ? 585  THR A O   1 
ATOM   4116 C CB  . THR A 1 541 ? 14.453  48.108  -0.492  1.00 24.13 ? 585  THR A CB  1 
ATOM   4117 O OG1 . THR A 1 541 ? 13.288  47.303  -0.631  1.00 32.54 ? 585  THR A OG1 1 
ATOM   4118 C CG2 . THR A 1 541 ? 14.906  48.207  1.016   1.00 24.33 ? 585  THR A CG2 1 
ATOM   4119 N N   . ILE A 1 542 ? 11.952  50.178  -0.852  1.00 20.51 ? 586  ILE A N   1 
ATOM   4120 C CA  . ILE A 1 542 ? 10.869  50.922  -0.187  1.00 22.91 ? 586  ILE A CA  1 
ATOM   4121 C C   . ILE A 1 542 ? 10.600  50.381  1.208   1.00 23.13 ? 586  ILE A C   1 
ATOM   4122 O O   . ILE A 1 542 ? 10.586  49.137  1.421   1.00 20.61 ? 586  ILE A O   1 
ATOM   4123 C CB  . ILE A 1 542 ? 9.591   51.018  -1.079  1.00 22.13 ? 586  ILE A CB  1 
ATOM   4124 C CG1 . ILE A 1 542 ? 8.654   52.191  -0.621  1.00 23.88 ? 586  ILE A CG1 1 
ATOM   4125 C CG2 . ILE A 1 542 ? 8.883   49.690  -1.133  1.00 25.94 ? 586  ILE A CG2 1 
ATOM   4126 C CD1 . ILE A 1 542 ? 9.169   53.575  -1.042  1.00 24.12 ? 586  ILE A CD1 1 
ATOM   4127 N N   . TRP A 1 543 ? 10.369  51.324  2.147   1.00 21.02 ? 587  TRP A N   1 
ATOM   4128 C CA  . TRP A 1 543 ? 10.065  50.966  3.518   1.00 20.87 ? 587  TRP A CA  1 
ATOM   4129 C C   . TRP A 1 543 ? 9.007   51.940  4.099   1.00 19.37 ? 587  TRP A C   1 
ATOM   4130 O O   . TRP A 1 543 ? 9.246   53.144  4.195   1.00 19.16 ? 587  TRP A O   1 
ATOM   4131 C CB  . TRP A 1 543 ? 11.367  51.072  4.329   1.00 21.57 ? 587  TRP A CB  1 
ATOM   4132 C CG  . TRP A 1 543 ? 11.272  50.750  5.794   1.00 21.75 ? 587  TRP A CG  1 
ATOM   4133 C CD1 . TRP A 1 543 ? 11.097  49.462  6.355   1.00 25.05 ? 587  TRP A CD1 1 
ATOM   4134 C CD2 . TRP A 1 543 ? 11.313  51.669  6.897   1.00 23.19 ? 587  TRP A CD2 1 
ATOM   4135 N NE1 . TRP A 1 543 ? 11.035  49.568  7.719   1.00 25.22 ? 587  TRP A NE1 1 
ATOM   4136 C CE2 . TRP A 1 543 ? 11.165  50.895  8.087   1.00 24.44 ? 587  TRP A CE2 1 
ATOM   4137 C CE3 . TRP A 1 543 ? 11.477  53.069  7.004   1.00 25.32 ? 587  TRP A CE3 1 
ATOM   4138 C CZ2 . TRP A 1 543 ? 11.138  51.491  9.380   1.00 25.94 ? 587  TRP A CZ2 1 
ATOM   4139 C CZ3 . TRP A 1 543 ? 11.507  53.666  8.289   1.00 23.97 ? 587  TRP A CZ3 1 
ATOM   4140 C CH2 . TRP A 1 543 ? 11.320  52.867  9.459   1.00 24.68 ? 587  TRP A CH2 1 
ATOM   4141 N N   . LEU A 1 544 ? 7.931   51.399  4.586   1.00 18.30 ? 588  LEU A N   1 
ATOM   4142 C CA  . LEU A 1 544 ? 6.873   52.230  5.284   1.00 18.01 ? 588  LEU A CA  1 
ATOM   4143 C C   . LEU A 1 544 ? 7.336   52.393  6.714   1.00 20.38 ? 588  LEU A C   1 
ATOM   4144 O O   . LEU A 1 544 ? 7.492   51.374  7.450   1.00 20.99 ? 588  LEU A O   1 
ATOM   4145 C CB  . LEU A 1 544 ? 5.531   51.487  5.208   1.00 19.80 ? 588  LEU A CB  1 
ATOM   4146 C CG  . LEU A 1 544 ? 4.424   52.185  6.014   1.00 18.37 ? 588  LEU A CG  1 
ATOM   4147 C CD1 . LEU A 1 544 ? 4.033   53.512  5.342   1.00 13.15 ? 588  LEU A CD1 1 
ATOM   4148 C CD2 . LEU A 1 544 ? 3.273   51.188  6.032   1.00 20.81 ? 588  LEU A CD2 1 
ATOM   4149 N N   . ALA A 1 545 ? 7.555   53.613  7.153   1.00 18.19 ? 589  ALA A N   1 
ATOM   4150 C CA  . ALA A 1 545 ? 7.873   53.866  8.567   1.00 20.34 ? 589  ALA A CA  1 
ATOM   4151 C C   . ALA A 1 545 ? 6.594   53.690  9.451   1.00 21.45 ? 589  ALA A C   1 
ATOM   4152 O O   . ALA A 1 545 ? 5.501   53.754  8.931   1.00 18.74 ? 589  ALA A O   1 
ATOM   4153 C CB  . ALA A 1 545 ? 8.339   55.282  8.685   1.00 22.71 ? 589  ALA A CB  1 
ATOM   4154 N N   . HIS A 1 546 ? 6.750   53.398  10.744  1.00 18.63 ? 590  HIS A N   1 
ATOM   4155 C CA  . HIS A 1 546 ? 5.648   53.247  11.674  1.00 18.59 ? 590  HIS A CA  1 
ATOM   4156 C C   . HIS A 1 546 ? 4.668   52.159  11.338  1.00 20.13 ? 590  HIS A C   1 
ATOM   4157 O O   . HIS A 1 546 ? 3.495   52.261  11.715  1.00 18.91 ? 590  HIS A O   1 
ATOM   4158 C CB  . HIS A 1 546 ? 4.829   54.602  11.845  1.00 17.06 ? 590  HIS A CB  1 
ATOM   4159 C CG  . HIS A 1 546 ? 5.638   55.716  12.427  1.00 21.68 ? 590  HIS A CG  1 
ATOM   4160 N ND1 . HIS A 1 546 ? 5.955   55.763  13.781  1.00 19.76 ? 590  HIS A ND1 1 
ATOM   4161 C CD2 . HIS A 1 546 ? 6.110   56.865  11.885  1.00 20.46 ? 590  HIS A CD2 1 
ATOM   4162 C CE1 . HIS A 1 546 ? 6.651   56.870  14.023  1.00 21.01 ? 590  HIS A CE1 1 
ATOM   4163 N NE2 . HIS A 1 546 ? 6.773   57.546  12.892  1.00 21.02 ? 590  HIS A NE2 1 
ATOM   4164 N N   . SER A 1 547 ? 5.067   51.137  10.617  1.00 19.94 ? 591  SER A N   1 
ATOM   4165 C CA  . SER A 1 547 ? 4.113   50.129  10.247  1.00 24.33 ? 591  SER A CA  1 
ATOM   4166 C C   . SER A 1 547 ? 3.789   49.314  11.500  1.00 28.64 ? 591  SER A C   1 
ATOM   4167 O O   . SER A 1 547 ? 4.733   48.911  12.235  1.00 31.38 ? 591  SER A O   1 
ATOM   4168 C CB  . SER A 1 547 ? 4.731   49.166  9.195   1.00 25.78 ? 591  SER A CB  1 
ATOM   4169 O OG  . SER A 1 547 ? 3.738   48.195  8.876   1.00 25.05 ? 591  SER A OG  1 
ATOM   4170 N N   . THR A 1 548 ? 2.498   49.115  11.764  1.00 31.06 ? 592  THR A N   1 
ATOM   4171 C CA  . THR A 1 548 ? 1.950   48.255  12.872  1.00 37.46 ? 592  THR A CA  1 
ATOM   4172 C C   . THR A 1 548 ? 1.134   47.039  12.396  1.00 38.40 ? 592  THR A C   1 
ATOM   4173 O O   . THR A 1 548 ? 1.124   45.991  13.044  1.00 38.82 ? 592  THR A O   1 
ATOM   4174 C CB  . THR A 1 548 ? 0.921   49.090  13.737  1.00 36.11 ? 592  THR A CB  1 
ATOM   4175 O OG1 . THR A 1 548 ? 1.611   50.223  14.319  1.00 44.15 ? 592  THR A OG1 1 
ATOM   4176 C CG2 . THR A 1 548 ? 0.358   48.265  14.846  1.00 43.32 ? 592  THR A CG2 1 
ATOM   4177 N N   . ASP A 1 549 ? 0.359   47.214  11.323  1.00 39.26 ? 593  ASP A N   1 
ATOM   4178 C CA  . ASP A 1 549 ? -0.565  46.163  10.889  1.00 41.35 ? 593  ASP A CA  1 
ATOM   4179 C C   . ASP A 1 549 ? -0.823  46.329  9.404   1.00 41.44 ? 593  ASP A C   1 
ATOM   4180 O O   . ASP A 1 549 ? -1.654  47.152  9.023   1.00 40.54 ? 593  ASP A O   1 
ATOM   4181 C CB  . ASP A 1 549 ? -1.897  46.266  11.638  1.00 41.41 ? 593  ASP A CB  1 
ATOM   4182 C CG  . ASP A 1 549 ? -2.968  45.345  11.066  1.00 45.52 ? 593  ASP A CG  1 
ATOM   4183 O OD1 . ASP A 1 549 ? -2.622  44.298  10.429  1.00 47.00 ? 593  ASP A OD1 1 
ATOM   4184 O OD2 . ASP A 1 549 ? -4.166  45.682  11.254  1.00 48.38 ? 593  ASP A OD2 1 
ATOM   4185 N N   . PRO A 1 550 ? -0.092  45.577  8.568   1.00 42.15 ? 594  PRO A N   1 
ATOM   4186 C CA  . PRO A 1 550 ? -0.149  45.710  7.093   1.00 43.09 ? 594  PRO A CA  1 
ATOM   4187 C C   . PRO A 1 550 ? -1.518  45.434  6.455   1.00 43.69 ? 594  PRO A C   1 
ATOM   4188 O O   . PRO A 1 550 ? -1.706  45.656  5.245   1.00 45.49 ? 594  PRO A O   1 
ATOM   4189 C CB  . PRO A 1 550 ? 0.920   44.717  6.616   1.00 43.63 ? 594  PRO A CB  1 
ATOM   4190 C CG  . PRO A 1 550 ? 1.846   44.588  7.809   1.00 42.69 ? 594  PRO A CG  1 
ATOM   4191 C CD  . PRO A 1 550 ? 0.914   44.589  8.990   1.00 42.42 ? 594  PRO A CD  1 
ATOM   4192 N N   . GLU A 1 551 ? -2.481  44.992  7.255   1.00 42.84 ? 595  GLU A N   1 
ATOM   4193 C CA  . GLU A 1 551 ? -3.829  44.721  6.774   1.00 42.56 ? 595  GLU A CA  1 
ATOM   4194 C C   . GLU A 1 551 ? -4.712  45.986  6.823   1.00 40.37 ? 595  GLU A C   1 
ATOM   4195 O O   . GLU A 1 551 ? -5.827  45.983  6.303   1.00 39.66 ? 595  GLU A O   1 
ATOM   4196 C CB  . GLU A 1 551 ? -4.479  43.578  7.607   1.00 43.18 ? 595  GLU A CB  1 
ATOM   4197 C CG  . GLU A 1 551 ? -4.006  42.110  7.253   1.00 45.37 ? 595  GLU A CG  1 
ATOM   4198 C CD  . GLU A 1 551 ? -4.443  41.031  8.310   1.00 47.11 ? 595  GLU A CD  1 
ATOM   4199 O OE1 . GLU A 1 551 ? -3.862  40.963  9.432   1.00 53.35 ? 595  GLU A OE1 1 
ATOM   4200 O OE2 . GLU A 1 551 ? -5.371  40.229  8.025   1.00 51.66 ? 595  GLU A OE2 1 
ATOM   4201 N N   . ASP A 1 552 ? -4.223  47.077  7.428   1.00 36.46 ? 596  ASP A N   1 
ATOM   4202 C CA  . ASP A 1 552 ? -5.074  48.263  7.666   1.00 33.72 ? 596  ASP A CA  1 
ATOM   4203 C C   . ASP A 1 552 ? -4.677  49.317  6.633   1.00 31.96 ? 596  ASP A C   1 
ATOM   4204 O O   . ASP A 1 552 ? -3.497  49.640  6.530   1.00 29.30 ? 596  ASP A O   1 
ATOM   4205 C CB  . ASP A 1 552 ? -4.851  48.731  9.117   1.00 33.77 ? 596  ASP A CB  1 
ATOM   4206 C CG  . ASP A 1 552 ? -5.209  50.227  9.351   1.00 39.00 ? 596  ASP A CG  1 
ATOM   4207 O OD1 . ASP A 1 552 ? -6.105  50.788  8.699   1.00 39.57 ? 596  ASP A OD1 1 
ATOM   4208 O OD2 . ASP A 1 552 ? -4.561  50.850  10.234  1.00 49.81 ? 596  ASP A OD2 1 
ATOM   4209 N N   . TYR A 1 553 ? -5.616  49.867  5.869   1.00 28.99 ? 597  TYR A N   1 
ATOM   4210 C CA  . TYR A 1 553 ? -5.217  50.902  4.882   1.00 29.68 ? 597  TYR A CA  1 
ATOM   4211 C C   . TYR A 1 553 ? -4.638  52.155  5.530   1.00 29.72 ? 597  TYR A C   1 
ATOM   4212 O O   . TYR A 1 553 ? -4.101  53.067  4.859   1.00 31.82 ? 597  TYR A O   1 
ATOM   4213 C CB  . TYR A 1 553 ? -6.330  51.255  3.872   1.00 28.28 ? 597  TYR A CB  1 
ATOM   4214 C CG  . TYR A 1 553 ? -7.543  51.915  4.484   1.00 28.90 ? 597  TYR A CG  1 
ATOM   4215 C CD1 . TYR A 1 553 ? -7.610  53.299  4.632   1.00 27.74 ? 597  TYR A CD1 1 
ATOM   4216 C CD2 . TYR A 1 553 ? -8.607  51.156  4.942   1.00 26.63 ? 597  TYR A CD2 1 
ATOM   4217 C CE1 . TYR A 1 553 ? -8.701  53.922  5.205   1.00 30.96 ? 597  TYR A CE1 1 
ATOM   4218 C CE2 . TYR A 1 553 ? -9.730  51.786  5.519   1.00 30.56 ? 597  TYR A CE2 1 
ATOM   4219 C CZ  . TYR A 1 553 ? -9.755  53.154  5.650   1.00 29.71 ? 597  TYR A CZ  1 
ATOM   4220 O OH  . TYR A 1 553 ? -10.835 53.811  6.198   1.00 32.06 ? 597  TYR A OH  1 
ATOM   4221 N N   . GLU A 1 554 ? -4.720  52.214  6.846   1.00 27.56 ? 598  GLU A N   1 
ATOM   4222 C CA  . GLU A 1 554 ? -4.182  53.364  7.560   1.00 28.61 ? 598  GLU A CA  1 
ATOM   4223 C C   . GLU A 1 554 ? -2.909  53.014  8.303   1.00 26.47 ? 598  GLU A C   1 
ATOM   4224 O O   . GLU A 1 554 ? -2.469  53.798  9.106   1.00 27.75 ? 598  GLU A O   1 
ATOM   4225 C CB  . GLU A 1 554 ? -5.265  53.994  8.524   1.00 27.82 ? 598  GLU A CB  1 
ATOM   4226 C CG  . GLU A 1 554 ? -6.458  54.505  7.764   1.00 30.26 ? 598  GLU A CG  1 
ATOM   4227 C CD  . GLU A 1 554 ? -7.425  55.377  8.635   1.00 35.00 ? 598  GLU A CD  1 
ATOM   4228 O OE1 . GLU A 1 554 ? -7.649  55.020  9.842   1.00 40.05 ? 598  GLU A OE1 1 
ATOM   4229 O OE2 . GLU A 1 554 ? -7.942  56.405  8.105   1.00 38.06 ? 598  GLU A OE2 1 
ATOM   4230 N N   . ASP A 1 555 ? -2.271  51.892  7.968   1.00 23.08 ? 599  ASP A N   1 
ATOM   4231 C CA  . ASP A 1 555 ? -1.050  51.446  8.621   1.00 22.42 ? 599  ASP A CA  1 
ATOM   4232 C C   . ASP A 1 555 ? 0.053   52.471  8.306   1.00 21.65 ? 599  ASP A C   1 
ATOM   4233 O O   . ASP A 1 555 ? 0.153   52.880  7.120   1.00 19.95 ? 599  ASP A O   1 
ATOM   4234 C CB  . ASP A 1 555 ? -0.579  50.093  8.007   1.00 21.41 ? 599  ASP A CB  1 
ATOM   4235 C CG  . ASP A 1 555 ? 0.564   49.494  8.796   1.00 28.00 ? 599  ASP A CG  1 
ATOM   4236 O OD1 . ASP A 1 555 ? 0.491   49.643  10.055  1.00 31.12 ? 599  ASP A OD1 1 
ATOM   4237 O OD2 . ASP A 1 555 ? 1.564   48.984  8.196   1.00 25.92 ? 599  ASP A OD2 1 
ATOM   4238 N N   . GLY A 1 556 ? 0.819   52.898  9.324   1.00 19.76 ? 600  GLY A N   1 
ATOM   4239 C CA  . GLY A 1 556 ? 1.782   53.974  9.111   1.00 19.92 ? 600  GLY A CA  1 
ATOM   4240 C C   . GLY A 1 556 ? 1.387   55.406  9.411   1.00 20.86 ? 600  GLY A C   1 
ATOM   4241 O O   . GLY A 1 556 ? 2.268   56.257  9.463   1.00 19.93 ? 600  GLY A O   1 
ATOM   4242 N N   . CYS A 1 557 ? 0.112   55.693  9.635   1.00 22.40 ? 601  CYS A N   1 
ATOM   4243 C CA  . CYS A 1 557 ? -0.315  57.053  9.847   1.00 26.22 ? 601  CYS A CA  1 
ATOM   4244 C C   . CYS A 1 557 ? 0.116   57.546  11.216  1.00 25.61 ? 601  CYS A C   1 
ATOM   4245 O O   . CYS A 1 557 ? -0.275  56.981  12.204  1.00 26.35 ? 601  CYS A O   1 
ATOM   4246 C CB  . CYS A 1 557 ? -1.860  57.267  9.704   1.00 24.64 ? 601  CYS A CB  1 
ATOM   4247 S SG  . CYS A 1 557 ? -2.611  56.837  8.061   1.00 39.30 ? 601  CYS A SG  1 
ATOM   4248 N N   . ILE A 1 558 ? 0.842   58.638  11.232  1.00 23.44 ? 602  ILE A N   1 
ATOM   4249 C CA  . ILE A 1 558 ? 1.186   59.325  12.448  1.00 24.42 ? 602  ILE A CA  1 
ATOM   4250 C C   . ILE A 1 558 ? 0.962   60.823  12.177  1.00 23.53 ? 602  ILE A C   1 
ATOM   4251 O O   . ILE A 1 558 ? 1.486   61.365  11.208  1.00 23.38 ? 602  ILE A O   1 
ATOM   4252 C CB  . ILE A 1 558 ? 2.708   58.998  12.807  1.00 23.17 ? 602  ILE A CB  1 
ATOM   4253 C CG1 . ILE A 1 558 ? 2.845   57.516  13.245  1.00 26.22 ? 602  ILE A CG1 1 
ATOM   4254 C CG2 . ILE A 1 558 ? 3.332   59.975  13.842  1.00 25.73 ? 602  ILE A CG2 1 
ATOM   4255 C CD1 . ILE A 1 558 ? 2.270   57.226  14.661  1.00 28.15 ? 602  ILE A CD1 1 
ATOM   4256 N N   . LEU A 1 559 ? 0.272   61.538  13.068  1.00 22.45 ? 603  LEU A N   1 
ATOM   4257 C CA  . LEU A 1 559 ? 0.045   62.933  12.830  1.00 21.45 ? 603  LEU A CA  1 
ATOM   4258 C C   . LEU A 1 559 ? -0.496  63.112  11.416  1.00 20.92 ? 603  LEU A C   1 
ATOM   4259 O O   . LEU A 1 559 ? -0.131  64.081  10.728  1.00 21.78 ? 603  LEU A O   1 
ATOM   4260 C CB  . LEU A 1 559 ? 1.276   63.801  13.056  1.00 22.40 ? 603  LEU A CB  1 
ATOM   4261 C CG  . LEU A 1 559 ? 1.468   64.338  14.505  1.00 26.30 ? 603  LEU A CG  1 
ATOM   4262 C CD1 . LEU A 1 559 ? 1.452   63.270  15.435  1.00 26.25 ? 603  LEU A CD1 1 
ATOM   4263 C CD2 . LEU A 1 559 ? 2.839   64.869  14.559  1.00 27.65 ? 603  LEU A CD2 1 
ATOM   4264 N N   . GLY A 1 560 ? -1.400  62.197  11.053  1.00 19.16 ? 604  GLY A N   1 
ATOM   4265 C CA  . GLY A 1 560 ? -2.205  62.293  9.842   1.00 21.48 ? 604  GLY A CA  1 
ATOM   4266 C C   . GLY A 1 560 ? -1.564  62.021  8.497   1.00 19.95 ? 604  GLY A C   1 
ATOM   4267 O O   . GLY A 1 560 ? -2.216  62.268  7.471   1.00 21.23 ? 604  GLY A O   1 
ATOM   4268 N N   . TYR A 1 561 ? -0.331  61.531  8.468   1.00 20.05 ? 605  TYR A N   1 
ATOM   4269 C CA  . TYR A 1 561 ? 0.225   61.063  7.234   1.00 18.07 ? 605  TYR A CA  1 
ATOM   4270 C C   . TYR A 1 561 ? 1.235   59.936  7.396   1.00 17.15 ? 605  TYR A C   1 
ATOM   4271 O O   . TYR A 1 561 ? 1.755   59.734  8.497   1.00 15.19 ? 605  TYR A O   1 
ATOM   4272 C CB  . TYR A 1 561 ? 0.858   62.204  6.402   1.00 19.81 ? 605  TYR A CB  1 
ATOM   4273 C CG  . TYR A 1 561 ? 2.029   62.871  6.969   1.00 25.55 ? 605  TYR A CG  1 
ATOM   4274 C CD1 . TYR A 1 561 ? 3.296   62.729  6.365   1.00 21.30 ? 605  TYR A CD1 1 
ATOM   4275 C CD2 . TYR A 1 561 ? 1.886   63.756  8.052   1.00 26.40 ? 605  TYR A CD2 1 
ATOM   4276 C CE1 . TYR A 1 561 ? 4.339   63.405  6.876   1.00 27.23 ? 605  TYR A CE1 1 
ATOM   4277 C CE2 . TYR A 1 561 ? 2.956   64.470  8.541   1.00 27.45 ? 605  TYR A CE2 1 
ATOM   4278 C CZ  . TYR A 1 561 ? 4.164   64.272  7.947   1.00 28.06 ? 605  TYR A CZ  1 
ATOM   4279 O OH  . TYR A 1 561 ? 5.254   64.931  8.468   1.00 31.24 ? 605  TYR A OH  1 
ATOM   4280 N N   . LYS A 1 562 ? 1.438   59.193  6.317   1.00 15.34 ? 606  LYS A N   1 
ATOM   4281 C CA  . LYS A 1 562 ? 2.448   58.101  6.356   1.00 16.92 ? 606  LYS A CA  1 
ATOM   4282 C C   . LYS A 1 562 ? 3.581   58.537  5.553   1.00 17.92 ? 606  LYS A C   1 
ATOM   4283 O O   . LYS A 1 562 ? 3.345   59.334  4.653   1.00 15.31 ? 606  LYS A O   1 
ATOM   4284 C CB  . LYS A 1 562 ? 1.928   56.971  5.499   1.00 19.53 ? 606  LYS A CB  1 
ATOM   4285 C CG  . LYS A 1 562 ? 0.750   56.227  5.984   1.00 21.18 ? 606  LYS A CG  1 
ATOM   4286 C CD  . LYS A 1 562 ? 0.299   55.404  4.796   1.00 18.15 ? 606  LYS A CD  1 
ATOM   4287 C CE  . LYS A 1 562 ? -1.237  55.188  4.901   1.00 20.62 ? 606  LYS A CE  1 
ATOM   4288 N NZ  . LYS A 1 562 ? -1.896  54.241  3.874   1.00 25.09 ? 606  LYS A NZ  1 
ATOM   4289 N N   . GLU A 1 563 ? 4.789   57.944  5.741   1.00 18.59 ? 607  GLU A N   1 
ATOM   4290 C CA  . GLU A 1 563 ? 5.864   58.191  4.812   1.00 20.78 ? 607  GLU A CA  1 
ATOM   4291 C C   . GLU A 1 563 ? 6.462   56.844  4.470   1.00 19.77 ? 607  GLU A C   1 
ATOM   4292 O O   . GLU A 1 563 ? 6.653   56.009  5.381   1.00 20.47 ? 607  GLU A O   1 
ATOM   4293 C CB  . GLU A 1 563 ? 6.971   59.077  5.465   1.00 22.18 ? 607  GLU A CB  1 
ATOM   4294 C CG  . GLU A 1 563 ? 6.490   60.457  5.957   1.00 25.88 ? 607  GLU A CG  1 
ATOM   4295 C CD  . GLU A 1 563 ? 7.552   61.227  6.783   1.00 28.58 ? 607  GLU A CD  1 
ATOM   4296 O OE1 . GLU A 1 563 ? 7.838   60.808  7.963   1.00 32.72 ? 607  GLU A OE1 1 
ATOM   4297 O OE2 . GLU A 1 563 ? 8.045   62.270  6.219   1.00 33.16 ? 607  GLU A OE2 1 
ATOM   4298 N N   . GLN A 1 564 ? 6.806   56.630  3.206   1.00 17.55 ? 608  GLN A N   1 
ATOM   4299 C CA  . GLN A 1 564 ? 7.638   55.472  2.833   1.00 17.60 ? 608  GLN A CA  1 
ATOM   4300 C C   . GLN A 1 564 ? 8.946   56.040  2.424   1.00 18.84 ? 608  GLN A C   1 
ATOM   4301 O O   . GLN A 1 564 ? 8.980   57.043  1.631   1.00 21.48 ? 608  GLN A O   1 
ATOM   4302 C CB  . GLN A 1 564 ? 7.005   54.771  1.619   1.00 18.34 ? 608  GLN A CB  1 
ATOM   4303 C CG  . GLN A 1 564 ? 5.604   54.073  1.969   1.00 17.97 ? 608  GLN A CG  1 
ATOM   4304 C CD  . GLN A 1 564 ? 4.762   53.927  0.760   1.00 26.56 ? 608  GLN A CD  1 
ATOM   4305 O OE1 . GLN A 1 564 ? 4.271   54.911  0.221   1.00 24.05 ? 608  GLN A OE1 1 
ATOM   4306 N NE2 . GLN A 1 564 ? 4.646   52.709  0.268   1.00 26.52 ? 608  GLN A NE2 1 
ATOM   4307 N N   . PHE A 1 565 ? 10.018  55.395  2.857   1.00 18.48 ? 609  PHE A N   1 
ATOM   4308 C CA  . PHE A 1 565 ? 11.400  55.796  2.534   1.00 18.69 ? 609  PHE A CA  1 
ATOM   4309 C C   . PHE A 1 565 ? 12.020  54.851  1.553   1.00 18.62 ? 609  PHE A C   1 
ATOM   4310 O O   . PHE A 1 565 ? 11.755  53.674  1.600   1.00 21.09 ? 609  PHE A O   1 
ATOM   4311 C CB  . PHE A 1 565 ? 12.244  55.775  3.854   1.00 18.06 ? 609  PHE A CB  1 
ATOM   4312 C CG  . PHE A 1 565 ? 11.833  56.833  4.819   1.00 19.72 ? 609  PHE A CG  1 
ATOM   4313 C CD1 . PHE A 1 565 ? 12.506  58.034  4.877   1.00 19.88 ? 609  PHE A CD1 1 
ATOM   4314 C CD2 . PHE A 1 565 ? 10.731  56.647  5.624   1.00 18.81 ? 609  PHE A CD2 1 
ATOM   4315 C CE1 . PHE A 1 565 ? 12.081  59.030  5.783   1.00 25.29 ? 609  PHE A CE1 1 
ATOM   4316 C CE2 . PHE A 1 565 ? 10.335  57.648  6.554   1.00 23.18 ? 609  PHE A CE2 1 
ATOM   4317 C CZ  . PHE A 1 565 ? 11.017  58.824  6.609   1.00 20.40 ? 609  PHE A CZ  1 
ATOM   4318 N N   . LEU A 1 566 ? 12.903  55.341  0.685   1.00 19.82 ? 610  LEU A N   1 
ATOM   4319 C CA  . LEU A 1 566 ? 13.866  54.423  0.000   1.00 21.61 ? 610  LEU A CA  1 
ATOM   4320 C C   . LEU A 1 566 ? 15.103  54.275  0.880   1.00 23.63 ? 610  LEU A C   1 
ATOM   4321 O O   . LEU A 1 566 ? 15.910  55.221  1.050   1.00 26.28 ? 610  LEU A O   1 
ATOM   4322 C CB  . LEU A 1 566 ? 14.222  54.985  -1.376  1.00 22.57 ? 610  LEU A CB  1 
ATOM   4323 C CG  . LEU A 1 566 ? 13.075  54.907  -2.368  1.00 24.12 ? 610  LEU A CG  1 
ATOM   4324 C CD1 . LEU A 1 566 ? 13.483  55.692  -3.619  1.00 30.46 ? 610  LEU A CD1 1 
ATOM   4325 C CD2 . LEU A 1 566 ? 12.821  53.448  -2.747  1.00 26.64 ? 610  LEU A CD2 1 
ATOM   4326 N N   . ARG A 1 567 ? 15.237  53.108  1.512   1.00 23.36 ? 611  ARG A N   1 
ATOM   4327 C CA  . ARG A 1 567 ? 16.271  52.836  2.498   1.00 23.48 ? 611  ARG A CA  1 
ATOM   4328 C C   . ARG A 1 567 ? 17.276  51.966  1.807   1.00 22.95 ? 611  ARG A C   1 
ATOM   4329 O O   . ARG A 1 567 ? 16.880  51.153  0.999   1.00 21.25 ? 611  ARG A O   1 
ATOM   4330 C CB  . ARG A 1 567 ? 15.619  51.957  3.577   1.00 23.59 ? 611  ARG A CB  1 
ATOM   4331 C CG  . ARG A 1 567 ? 14.928  52.803  4.583   1.00 31.98 ? 611  ARG A CG  1 
ATOM   4332 C CD  . ARG A 1 567 ? 14.656  51.973  5.730   1.00 35.95 ? 611  ARG A CD  1 
ATOM   4333 N NE  . ARG A 1 567 ? 15.820  51.649  6.537   1.00 33.20 ? 611  ARG A NE  1 
ATOM   4334 C CZ  . ARG A 1 567 ? 15.720  51.294  7.803   1.00 32.20 ? 611  ARG A CZ  1 
ATOM   4335 N NH1 . ARG A 1 567 ? 14.522  51.308  8.355   1.00 32.74 ? 611  ARG A NH1 1 
ATOM   4336 N NH2 . ARG A 1 567 ? 16.790  50.959  8.524   1.00 31.85 ? 611  ARG A NH2 1 
ATOM   4337 N N   . LEU A 1 568 ? 18.537  52.026  2.217   1.00 24.41 ? 612  LEU A N   1 
ATOM   4338 C CA  . LEU A 1 568 ? 19.575  51.213  1.584   1.00 25.93 ? 612  LEU A CA  1 
ATOM   4339 C C   . LEU A 1 568 ? 19.342  49.798  2.005   1.00 26.66 ? 612  LEU A C   1 
ATOM   4340 O O   . LEU A 1 568 ? 19.031  49.546  3.164   1.00 26.02 ? 612  LEU A O   1 
ATOM   4341 C CB  . LEU A 1 568 ? 20.910  51.683  2.146   1.00 27.03 ? 612  LEU A CB  1 
ATOM   4342 C CG  . LEU A 1 568 ? 22.204  51.159  1.526   1.00 28.50 ? 612  LEU A CG  1 
ATOM   4343 C CD1 . LEU A 1 568 ? 22.245  51.340  0.084   1.00 25.35 ? 612  LEU A CD1 1 
ATOM   4344 C CD2 . LEU A 1 568 ? 23.361  51.918  2.185   1.00 32.71 ? 612  LEU A CD2 1 
ATOM   4345 N N   . ARG A 1 569 ? 19.512  48.831  1.090   1.00 26.88 ? 613  ARG A N   1 
ATOM   4346 C CA  . ARG A 1 569 ? 19.269  47.490  1.439   1.00 27.01 ? 613  ARG A CA  1 
ATOM   4347 C C   . ARG A 1 569 ? 20.418  47.031  2.352   1.00 27.65 ? 613  ARG A C   1 
ATOM   4348 O O   . ARG A 1 569 ? 21.566  47.314  2.075   1.00 26.24 ? 613  ARG A O   1 
ATOM   4349 C CB  . ARG A 1 569 ? 19.279  46.639  0.177   1.00 26.53 ? 613  ARG A CB  1 
ATOM   4350 C CG  . ARG A 1 569 ? 18.132  46.869  -0.770  1.00 25.97 ? 613  ARG A CG  1 
ATOM   4351 C CD  . ARG A 1 569 ? 18.388  46.101  -2.080  1.00 31.13 ? 613  ARG A CD  1 
ATOM   4352 N NE  . ARG A 1 569 ? 17.450  46.461  -3.144  1.00 32.14 ? 613  ARG A NE  1 
ATOM   4353 C CZ  . ARG A 1 569 ? 16.221  45.983  -3.226  1.00 38.04 ? 613  ARG A CZ  1 
ATOM   4354 N NH1 . ARG A 1 569 ? 15.799  45.108  -2.305  1.00 39.56 ? 613  ARG A NH1 1 
ATOM   4355 N NH2 . ARG A 1 569 ? 15.422  46.355  -4.231  1.00 39.12 ? 613  ARG A NH2 1 
ATOM   4356 N N   . LYS A 1 570 ? 20.107  46.191  3.344   1.00 28.98 ? 614  LYS A N   1 
ATOM   4357 C CA  . LYS A 1 570 ? 21.138  45.679  4.275   1.00 30.26 ? 614  LYS A CA  1 
ATOM   4358 C C   . LYS A 1 570 ? 22.280  44.991  3.563   1.00 30.27 ? 614  LYS A C   1 
ATOM   4359 O O   . LYS A 1 570 ? 23.402  45.065  4.019   1.00 30.20 ? 614  LYS A O   1 
ATOM   4360 C CB  . LYS A 1 570 ? 20.500  44.648  5.218   1.00 31.62 ? 614  LYS A CB  1 
ATOM   4361 C CG  . LYS A 1 570 ? 19.401  45.228  6.135   1.00 35.65 ? 614  LYS A CG  1 
ATOM   4362 C CD  . LYS A 1 570 ? 19.857  46.412  6.876   1.00 42.70 ? 614  LYS A CD  1 
ATOM   4363 C CE  . LYS A 1 570 ? 18.795  46.842  7.885   1.00 51.53 ? 614  LYS A CE  1 
ATOM   4364 N NZ  . LYS A 1 570 ? 18.013  45.657  8.409   1.00 53.78 ? 614  LYS A NZ  1 
ATOM   4365 N N   . SER A 1 571 ? 21.972  44.299  2.464   1.00 30.12 ? 615  SER A N   1 
ATOM   4366 C CA  . SER A 1 571 ? 22.959  43.507  1.716   1.00 30.33 ? 615  SER A CA  1 
ATOM   4367 C C   . SER A 1 571 ? 23.742  44.330  0.695   1.00 30.58 ? 615  SER A C   1 
ATOM   4368 O O   . SER A 1 571 ? 24.650  43.816  0.067   1.00 29.78 ? 615  SER A O   1 
ATOM   4369 C CB  . SER A 1 571 ? 22.249  42.402  0.963   1.00 30.79 ? 615  SER A CB  1 
ATOM   4370 O OG  . SER A 1 571 ? 21.406  42.929  -0.068  1.00 33.32 ? 615  SER A OG  1 
ATOM   4371 N N   . SER A 1 572 ? 23.386  45.606  0.485   1.00 28.72 ? 616  SER A N   1 
ATOM   4372 C CA  . SER A 1 572 ? 24.168  46.425  -0.440  1.00 28.27 ? 616  SER A CA  1 
ATOM   4373 C C   . SER A 1 572 ? 25.363  46.991  0.300   1.00 28.92 ? 616  SER A C   1 
ATOM   4374 O O   . SER A 1 572 ? 25.206  47.625  1.337   1.00 30.76 ? 616  SER A O   1 
ATOM   4375 C CB  . SER A 1 572 ? 23.308  47.565  -1.011  1.00 25.86 ? 616  SER A CB  1 
ATOM   4376 O OG  . SER A 1 572 ? 22.418  47.074  -1.998  1.00 26.12 ? 616  SER A OG  1 
ATOM   4377 N N   . MET A 1 573 ? 26.546  46.889  -0.264  1.00 29.24 ? 617  MET A N   1 
ATOM   4378 C CA  . MET A 1 573 ? 27.687  47.464  0.372   1.00 32.96 ? 617  MET A CA  1 
ATOM   4379 C C   . MET A 1 573 ? 28.255  48.550  -0.520  1.00 31.09 ? 617  MET A C   1 
ATOM   4380 O O   . MET A 1 573 ? 29.046  48.272  -1.429  1.00 31.09 ? 617  MET A O   1 
ATOM   4381 C CB  . MET A 1 573 ? 28.740  46.405  0.611   1.00 32.19 ? 617  MET A CB  1 
ATOM   4382 C CG  . MET A 1 573 ? 29.878  46.958  1.419   1.00 36.13 ? 617  MET A CG  1 
ATOM   4383 S SD  . MET A 1 573 ? 30.898  45.619  1.882   1.00 43.77 ? 617  MET A SD  1 
ATOM   4384 C CE  . MET A 1 573 ? 32.159  45.602  0.620   1.00 38.87 ? 617  MET A CE  1 
ATOM   4385 N N   . CYS A 1 574 ? 27.830  49.778  -0.258  1.00 29.67 ? 618  CYS A N   1 
ATOM   4386 C CA  . CYS A 1 574 ? 28.035  50.869  -1.179  1.00 28.55 ? 618  CYS A CA  1 
ATOM   4387 C C   . CYS A 1 574 ? 27.905  52.177  -0.378  1.00 28.82 ? 618  CYS A C   1 
ATOM   4388 O O   . CYS A 1 574 ? 27.355  52.190  0.727   1.00 28.69 ? 618  CYS A O   1 
ATOM   4389 C CB  . CYS A 1 574 ? 27.043  50.807  -2.351  1.00 26.77 ? 618  CYS A CB  1 
ATOM   4390 S SG  . CYS A 1 574 ? 25.270  50.827  -1.936  1.00 31.57 ? 618  CYS A SG  1 
ATOM   4391 N N   . GLN A 1 575 ? 28.403  53.271  -0.955  1.00 26.76 ? 619  GLN A N   1 
ATOM   4392 C CA  . GLN A 1 575 ? 28.459  54.514  -0.233  1.00 28.04 ? 619  GLN A CA  1 
ATOM   4393 C C   . GLN A 1 575 ? 27.227  55.310  -0.649  1.00 27.24 ? 619  GLN A C   1 
ATOM   4394 O O   . GLN A 1 575 ? 26.989  55.488  -1.877  1.00 25.84 ? 619  GLN A O   1 
ATOM   4395 C CB  . GLN A 1 575 ? 29.703  55.305  -0.671  1.00 28.11 ? 619  GLN A CB  1 
ATOM   4396 C CG  . GLN A 1 575 ? 29.873  56.591  0.158   1.00 32.77 ? 619  GLN A CG  1 
ATOM   4397 C CD  . GLN A 1 575 ? 30.875  57.514  -0.511  1.00 38.73 ? 619  GLN A CD  1 
ATOM   4398 O OE1 . GLN A 1 575 ? 31.404  57.135  -1.565  1.00 37.62 ? 619  GLN A OE1 1 
ATOM   4399 N NE2 . GLN A 1 575 ? 31.125  58.748  0.063   1.00 36.65 ? 619  GLN A NE2 1 
ATOM   4400 N N   . ASN A 1 576 ? 26.450  55.776  0.342   1.00 26.90 ? 620  ASN A N   1 
ATOM   4401 C CA  . ASN A 1 576 ? 25.323  56.674  0.056   1.00 25.22 ? 620  ASN A CA  1 
ATOM   4402 C C   . ASN A 1 576 ? 25.858  57.972  -0.552  1.00 25.21 ? 620  ASN A C   1 
ATOM   4403 O O   . ASN A 1 576 ? 25.278  58.514  -1.484  1.00 26.43 ? 620  ASN A O   1 
ATOM   4404 C CB  . ASN A 1 576 ? 24.541  56.958  1.343   1.00 24.48 ? 620  ASN A CB  1 
ATOM   4405 C CG  . ASN A 1 576 ? 23.667  55.751  1.753   1.00 25.00 ? 620  ASN A CG  1 
ATOM   4406 O OD1 . ASN A 1 576 ? 22.927  55.242  0.911   1.00 25.69 ? 620  ASN A OD1 1 
ATOM   4407 N ND2 . ASN A 1 576 ? 23.822  55.265  2.947   1.00 24.01 ? 620  ASN A ND2 1 
ATOM   4408 N N   . GLY A 1 577 ? 26.912  58.514  0.033   1.00 24.45 ? 621  GLY A N   1 
ATOM   4409 C CA  . GLY A 1 577 ? 27.595  59.694  -0.602  1.00 24.74 ? 621  GLY A CA  1 
ATOM   4410 C C   . GLY A 1 577 ? 27.457  60.933  0.283   1.00 25.35 ? 621  GLY A C   1 
ATOM   4411 O O   . GLY A 1 577 ? 26.481  61.106  1.026   1.00 23.29 ? 621  GLY A O   1 
ATOM   4412 N N   . ARG A 1 578 ? 28.403  61.849  0.171   1.00 24.93 ? 622  ARG A N   1 
ATOM   4413 C CA  . ARG A 1 578 ? 28.312  63.030  1.008   1.00 27.83 ? 622  ARG A CA  1 
ATOM   4414 C C   . ARG A 1 578 ? 27.095  63.850  0.601   1.00 28.15 ? 622  ARG A C   1 
ATOM   4415 O O   . ARG A 1 578 ? 26.601  64.628  1.370   1.00 29.66 ? 622  ARG A O   1 
ATOM   4416 C CB  . ARG A 1 578 ? 29.584  63.873  0.840   1.00 28.17 ? 622  ARG A CB  1 
ATOM   4417 C CG  . ARG A 1 578 ? 30.875  63.301  1.460   1.00 26.34 ? 622  ARG A CG  1 
ATOM   4418 C CD  . ARG A 1 578 ? 31.972  64.417  1.583   1.00 30.94 ? 622  ARG A CD  1 
ATOM   4419 N NE  . ARG A 1 578 ? 31.448  65.554  2.378   1.00 33.38 ? 622  ARG A NE  1 
ATOM   4420 C CZ  . ARG A 1 578 ? 31.344  65.602  3.706   1.00 36.16 ? 622  ARG A CZ  1 
ATOM   4421 N NH1 . ARG A 1 578 ? 31.771  64.577  4.457   1.00 33.18 ? 622  ARG A NH1 1 
ATOM   4422 N NH2 . ARG A 1 578 ? 30.813  66.702  4.286   1.00 30.58 ? 622  ARG A NH2 1 
ATOM   4423 N N   . ASP A 1 579 ? 26.617  63.707  -0.628  1.00 29.42 ? 623  ASP A N   1 
ATOM   4424 C CA  . ASP A 1 579 ? 25.450  64.504  -1.122  1.00 31.55 ? 623  ASP A CA  1 
ATOM   4425 C C   . ASP A 1 579 ? 24.137  63.699  -1.082  1.00 30.63 ? 623  ASP A C   1 
ATOM   4426 O O   . ASP A 1 579 ? 23.180  64.012  -1.797  1.00 31.72 ? 623  ASP A O   1 
ATOM   4427 C CB  . ASP A 1 579 ? 25.696  64.892  -2.576  1.00 32.24 ? 623  ASP A CB  1 
ATOM   4428 C CG  . ASP A 1 579 ? 26.354  63.725  -3.400  1.00 41.50 ? 623  ASP A CG  1 
ATOM   4429 O OD1 . ASP A 1 579 ? 26.224  62.513  -3.018  1.00 37.86 ? 623  ASP A OD1 1 
ATOM   4430 O OD2 . ASP A 1 579 ? 27.054  64.044  -4.426  1.00 48.35 ? 623  ASP A OD2 1 
ATOM   4431 N N   . TYR A 1 580 ? 24.121  62.648  -0.277  1.00 27.99 ? 624  TYR A N   1 
ATOM   4432 C CA  . TYR A 1 580 ? 22.940  61.740  -0.152  1.00 27.93 ? 624  TYR A CA  1 
ATOM   4433 C C   . TYR A 1 580 ? 21.803  62.561  0.413   1.00 28.58 ? 624  TYR A C   1 
ATOM   4434 O O   . TYR A 1 580 ? 22.020  63.329  1.343   1.00 28.07 ? 624  TYR A O   1 
ATOM   4435 C CB  . TYR A 1 580 ? 23.236  60.660  0.889   1.00 25.78 ? 624  TYR A CB  1 
ATOM   4436 C CG  . TYR A 1 580 ? 22.055  59.778  1.254   1.00 27.00 ? 624  TYR A CG  1 
ATOM   4437 C CD1 . TYR A 1 580 ? 21.424  58.979  0.297   1.00 29.06 ? 624  TYR A CD1 1 
ATOM   4438 C CD2 . TYR A 1 580 ? 21.561  59.773  2.556   1.00 28.89 ? 624  TYR A CD2 1 
ATOM   4439 C CE1 . TYR A 1 580 ? 20.342  58.154  0.661   1.00 27.71 ? 624  TYR A CE1 1 
ATOM   4440 C CE2 . TYR A 1 580 ? 20.492  58.958  2.914   1.00 32.98 ? 624  TYR A CE2 1 
ATOM   4441 C CZ  . TYR A 1 580 ? 19.915  58.153  1.952   1.00 31.04 ? 624  TYR A CZ  1 
ATOM   4442 O OH  . TYR A 1 580 ? 18.878  57.332  2.344   1.00 31.19 ? 624  TYR A OH  1 
ATOM   4443 N N   . VAL A 1 581 ? 20.621  62.364  -0.160  1.00 30.06 ? 625  VAL A N   1 
ATOM   4444 C CA  . VAL A 1 581 ? 19.368  63.032  0.207   1.00 31.40 ? 625  VAL A CA  1 
ATOM   4445 C C   . VAL A 1 581 ? 18.359  61.958  0.636   1.00 30.27 ? 625  VAL A C   1 
ATOM   4446 O O   . VAL A 1 581 ? 18.116  61.078  -0.152  1.00 29.93 ? 625  VAL A O   1 
ATOM   4447 C CB  . VAL A 1 581 ? 18.755  63.673  -1.064  1.00 31.23 ? 625  VAL A CB  1 
ATOM   4448 C CG1 . VAL A 1 581 ? 17.376  64.247  -0.750  1.00 34.50 ? 625  VAL A CG1 1 
ATOM   4449 C CG2 . VAL A 1 581 ? 19.674  64.822  -1.616  1.00 35.05 ? 625  VAL A CG2 1 
ATOM   4450 N N   . VAL A 1 582 ? 17.785  62.033  1.827   1.00 30.55 ? 626  VAL A N   1 
ATOM   4451 C CA  . VAL A 1 582 ? 16.796  60.987  2.256   1.00 30.83 ? 626  VAL A CA  1 
ATOM   4452 C C   . VAL A 1 582 ? 15.594  61.105  1.341   1.00 28.96 ? 626  VAL A C   1 
ATOM   4453 O O   . VAL A 1 582 ? 14.928  62.129  1.292   1.00 27.13 ? 626  VAL A O   1 
ATOM   4454 C CB  . VAL A 1 582 ? 16.366  61.117  3.708   1.00 32.40 ? 626  VAL A CB  1 
ATOM   4455 C CG1 . VAL A 1 582 ? 15.255  60.032  4.082   1.00 33.38 ? 626  VAL A CG1 1 
ATOM   4456 C CG2 . VAL A 1 582 ? 17.573  61.007  4.645   1.00 34.39 ? 626  VAL A CG2 1 
ATOM   4457 N N   . THR A 1 583 ? 15.374  60.074  0.535   1.00 27.93 ? 627  THR A N   1 
ATOM   4458 C CA  . THR A 1 583 ? 14.215  60.076  -0.408  1.00 28.18 ? 627  THR A CA  1 
ATOM   4459 C C   . THR A 1 583 ? 12.984  59.459  0.249   1.00 27.32 ? 627  THR A C   1 
ATOM   4460 O O   . THR A 1 583 ? 13.015  58.311  0.744   1.00 24.12 ? 627  THR A O   1 
ATOM   4461 C CB  . THR A 1 583 ? 14.643  59.299  -1.668  1.00 26.92 ? 627  THR A CB  1 
ATOM   4462 O OG1 . THR A 1 583 ? 15.750  60.024  -2.230  1.00 30.90 ? 627  THR A OG1 1 
ATOM   4463 C CG2 . THR A 1 583 ? 13.510  59.267  -2.747  1.00 29.89 ? 627  THR A CG2 1 
ATOM   4464 N N   . LYS A 1 584 ? 11.889  60.203  0.259   1.00 27.18 ? 628  LYS A N   1 
ATOM   4465 C CA  . LYS A 1 584 ? 10.649  59.708  0.898   1.00 27.33 ? 628  LYS A CA  1 
ATOM   4466 C C   . LYS A 1 584 ? 9.443   60.293  0.177   1.00 27.77 ? 628  LYS A C   1 
ATOM   4467 O O   . LYS A 1 584 ? 9.576   61.276  -0.626  1.00 25.90 ? 628  LYS A O   1 
ATOM   4468 C CB  . LYS A 1 584 ? 10.591  60.060  2.375   1.00 28.90 ? 628  LYS A CB  1 
ATOM   4469 C CG  . LYS A 1 584 ? 10.721  61.578  2.628   1.00 34.20 ? 628  LYS A CG  1 
ATOM   4470 C CD  . LYS A 1 584 ? 10.119  61.946  3.944   1.00 41.54 ? 628  LYS A CD  1 
ATOM   4471 C CE  . LYS A 1 584 ? 10.562  63.352  4.369   1.00 46.57 ? 628  LYS A CE  1 
ATOM   4472 N NZ  . LYS A 1 584 ? 12.058  63.467  4.185   1.00 48.86 ? 628  LYS A NZ  1 
ATOM   4473 N N   . GLN A 1 585 ? 8.297   59.656  0.399   1.00 25.20 ? 629  GLN A N   1 
ATOM   4474 C CA  . GLN A 1 585 ? 7.060   60.013  -0.258  1.00 25.66 ? 629  GLN A CA  1 
ATOM   4475 C C   . GLN A 1 585 ? 5.906   59.912  0.724   1.00 22.54 ? 629  GLN A C   1 
ATOM   4476 O O   . GLN A 1 585 ? 5.736   58.871  1.328   1.00 23.34 ? 629  GLN A O   1 
ATOM   4477 C CB  . GLN A 1 585 ? 6.783   59.184  -1.515  1.00 25.04 ? 629  GLN A CB  1 
ATOM   4478 C CG  . GLN A 1 585 ? 6.710   57.685  -1.325  1.00 30.41 ? 629  GLN A CG  1 
ATOM   4479 C CD  . GLN A 1 585 ? 6.375   56.954  -2.594  1.00 32.26 ? 629  GLN A CD  1 
ATOM   4480 O OE1 . GLN A 1 585 ? 7.002   57.180  -3.612  1.00 38.08 ? 629  GLN A OE1 1 
ATOM   4481 N NE2 . GLN A 1 585 ? 5.413   56.014  -2.529  1.00 36.56 ? 629  GLN A NE2 1 
ATOM   4482 N N   . PRO A 1 586 ? 5.133   61.005  0.878   1.00 19.47 ? 630  PRO A N   1 
ATOM   4483 C CA  . PRO A 1 586 ? 4.037   60.976  1.871   1.00 16.33 ? 630  PRO A CA  1 
ATOM   4484 C C   . PRO A 1 586 ? 2.740   60.513  1.302   1.00 17.24 ? 630  PRO A C   1 
ATOM   4485 O O   . PRO A 1 586 ? 2.450   60.727  0.108   1.00 16.10 ? 630  PRO A O   1 
ATOM   4486 C CB  . PRO A 1 586 ? 3.902   62.461  2.325   1.00 17.87 ? 630  PRO A CB  1 
ATOM   4487 C CG  . PRO A 1 586 ? 4.241   63.276  0.938   1.00 16.68 ? 630  PRO A CG  1 
ATOM   4488 C CD  . PRO A 1 586 ? 5.272   62.306  0.179   1.00 18.79 ? 630  PRO A CD  1 
ATOM   4489 N N   . SER A 1 587 ? 1.907   59.917  2.188   1.00 17.67 ? 631  SER A N   1 
ATOM   4490 C CA  . SER A 1 587 ? 0.541   59.673  1.842   1.00 16.70 ? 631  SER A CA  1 
ATOM   4491 C C   . SER A 1 587 ? -0.290  60.327  2.946   1.00 17.39 ? 631  SER A C   1 
ATOM   4492 O O   . SER A 1 587 ? -0.005  60.132  4.141   1.00 15.70 ? 631  SER A O   1 
ATOM   4493 C CB  . SER A 1 587 ? 0.241   58.182  1.909   1.00 17.07 ? 631  SER A CB  1 
ATOM   4494 O OG  . SER A 1 587 ? 1.180   57.383  1.138   1.00 19.60 ? 631  SER A OG  1 
ATOM   4495 N N   . ILE A 1 588 ? -1.350  61.006  2.542   1.00 16.14 ? 632  ILE A N   1 
ATOM   4496 C CA  . ILE A 1 588 ? -2.125  61.868  3.456   1.00 17.03 ? 632  ILE A CA  1 
ATOM   4497 C C   . ILE A 1 588 ? -3.259  60.984  3.940   1.00 18.05 ? 632  ILE A C   1 
ATOM   4498 O O   . ILE A 1 588 ? -3.947  60.401  3.118   1.00 17.73 ? 632  ILE A O   1 
ATOM   4499 C CB  . ILE A 1 588 ? -2.766  63.071  2.719   1.00 18.29 ? 632  ILE A CB  1 
ATOM   4500 C CG1 . ILE A 1 588 ? -1.741  63.980  2.089   1.00 20.98 ? 632  ILE A CG1 1 
ATOM   4501 C CG2 . ILE A 1 588 ? -3.678  63.921  3.683   1.00 19.36 ? 632  ILE A CG2 1 
ATOM   4502 C CD1 . ILE A 1 588 ? -0.742  64.473  3.063   1.00 28.10 ? 632  ILE A CD1 1 
ATOM   4503 N N   . CYS A 1 589 ? -3.509  60.961  5.240   1.00 16.50 ? 633  CYS A N   1 
ATOM   4504 C CA  . CYS A 1 589 ? -4.587  60.123  5.801   1.00 19.40 ? 633  CYS A CA  1 
ATOM   4505 C C   . CYS A 1 589 ? -5.837  60.958  6.031   1.00 17.39 ? 633  CYS A C   1 
ATOM   4506 O O   . CYS A 1 589 ? -5.776  62.208  6.128   1.00 17.15 ? 633  CYS A O   1 
ATOM   4507 C CB  . CYS A 1 589 ? -4.116  59.484  7.137   1.00 20.61 ? 633  CYS A CB  1 
ATOM   4508 S SG  . CYS A 1 589 ? -2.534  58.520  6.894   1.00 30.11 ? 633  CYS A SG  1 
ATOM   4509 N N   . LEU A 1 590 ? -6.964  60.299  6.192   1.00 17.72 ? 634  LEU A N   1 
ATOM   4510 C CA  . LEU A 1 590 ? -8.210  61.046  6.416   1.00 17.71 ? 634  LEU A CA  1 
ATOM   4511 C C   . LEU A 1 590 ? -8.255  61.559  7.825   1.00 18.14 ? 634  LEU A C   1 
ATOM   4512 O O   . LEU A 1 590 ? -7.762  60.901  8.703   1.00 18.20 ? 634  LEU A O   1 
ATOM   4513 C CB  . LEU A 1 590 ? -9.402  60.152  6.170   1.00 18.28 ? 634  LEU A CB  1 
ATOM   4514 C CG  . LEU A 1 590 ? -9.637  59.727  4.721   1.00 19.81 ? 634  LEU A CG  1 
ATOM   4515 C CD1 . LEU A 1 590 ? -10.480 58.439  4.802   1.00 23.05 ? 634  LEU A CD1 1 
ATOM   4516 C CD2 . LEU A 1 590 ? -10.375 60.792  3.933   1.00 19.64 ? 634  LEU A CD2 1 
ATOM   4517 N N   . CYS A 1 591 ? -8.912  62.678  8.102   1.00 19.17 ? 635  CYS A N   1 
ATOM   4518 C CA  . CYS A 1 591 ? -8.888  63.150  9.486   1.00 19.72 ? 635  CYS A CA  1 
ATOM   4519 C C   . CYS A 1 591 ? -9.815  62.300  10.319  1.00 19.55 ? 635  CYS A C   1 
ATOM   4520 O O   . CYS A 1 591 ? -10.886 62.008  9.872   1.00 20.36 ? 635  CYS A O   1 
ATOM   4521 C CB  . CYS A 1 591 ? -9.332  64.616  9.601   1.00 20.65 ? 635  CYS A CB  1 
ATOM   4522 S SG  . CYS A 1 591 ? -8.152  65.793  8.895   1.00 28.79 ? 635  CYS A SG  1 
ATOM   4523 N N   . SER A 1 592 ? -9.412  61.959  11.534  1.00 19.50 ? 636  SER A N   1 
ATOM   4524 C CA  . SER A 1 592 ? -10.317 61.397  12.523  1.00 22.74 ? 636  SER A CA  1 
ATOM   4525 C C   . SER A 1 592 ? -10.251 62.241  13.820  1.00 22.45 ? 636  SER A C   1 
ATOM   4526 O O   . SER A 1 592 ? -9.508  63.230  13.895  1.00 21.20 ? 636  SER A O   1 
ATOM   4527 C CB  . SER A 1 592 ? -9.911  59.951  12.802  1.00 23.07 ? 636  SER A CB  1 
ATOM   4528 O OG  . SER A 1 592 ? -8.947  60.019  13.829  1.00 26.40 ? 636  SER A OG  1 
ATOM   4529 N N   . LEU A 1 593 ? -11.015 61.850  14.848  1.00 23.90 ? 637  LEU A N   1 
ATOM   4530 C CA  . LEU A 1 593 ? -11.045 62.640  16.084  1.00 25.22 ? 637  LEU A CA  1 
ATOM   4531 C C   . LEU A 1 593 ? -9.695  62.567  16.804  1.00 25.44 ? 637  LEU A C   1 
ATOM   4532 O O   . LEU A 1 593 ? -9.275  63.522  17.467  1.00 25.27 ? 637  LEU A O   1 
ATOM   4533 C CB  . LEU A 1 593 ? -12.273 62.274  16.979  1.00 27.45 ? 637  LEU A CB  1 
ATOM   4534 C CG  . LEU A 1 593 ? -13.642 62.919  16.651  1.00 27.23 ? 637  LEU A CG  1 
ATOM   4535 C CD1 . LEU A 1 593 ? -14.720 62.601  17.695  1.00 29.32 ? 637  LEU A CD1 1 
ATOM   4536 C CD2 . LEU A 1 593 ? -13.540 64.434  16.481  1.00 26.70 ? 637  LEU A CD2 1 
ATOM   4537 N N   . GLU A 1 594 ? -8.979  61.475  16.574  1.00 24.69 ? 638  GLU A N   1 
ATOM   4538 C CA  . GLU A 1 594 ? -7.612  61.281  17.061  1.00 25.98 ? 638  GLU A CA  1 
ATOM   4539 C C   . GLU A 1 594 ? -6.581  62.280  16.516  1.00 24.30 ? 638  GLU A C   1 
ATOM   4540 O O   . GLU A 1 594 ? -5.477  62.345  17.054  1.00 25.83 ? 638  GLU A O   1 
ATOM   4541 C CB  . GLU A 1 594 ? -7.112  59.855  16.702  1.00 27.16 ? 638  GLU A CB  1 
ATOM   4542 C CG  . GLU A 1 594 ? -8.012  58.702  17.245  1.00 33.50 ? 638  GLU A CG  1 
ATOM   4543 C CD  . GLU A 1 594 ? -7.705  58.320  18.707  1.00 43.79 ? 638  GLU A CD  1 
ATOM   4544 O OE1 . GLU A 1 594 ? -6.539  57.942  18.978  1.00 47.86 ? 638  GLU A OE1 1 
ATOM   4545 O OE2 . GLU A 1 594 ? -8.621  58.370  19.588  1.00 48.60 ? 638  GLU A OE2 1 
ATOM   4546 N N   . ASP A 1 595 ? -6.901  63.035  15.462  1.00 21.36 ? 639  ASP A N   1 
ATOM   4547 C CA  . ASP A 1 595 ? -5.963  64.002  14.914  1.00 19.83 ? 639  ASP A CA  1 
ATOM   4548 C C   . ASP A 1 595 ? -6.168  65.377  15.561  1.00 20.04 ? 639  ASP A C   1 
ATOM   4549 O O   . ASP A 1 595 ? -5.512  66.364  15.145  1.00 18.43 ? 639  ASP A O   1 
ATOM   4550 C CB  . ASP A 1 595 ? -6.217  64.196  13.429  1.00 19.75 ? 639  ASP A CB  1 
ATOM   4551 C CG  . ASP A 1 595 ? -5.716  63.007  12.621  1.00 21.68 ? 639  ASP A CG  1 
ATOM   4552 O OD1 . ASP A 1 595 ? -4.512  62.720  12.667  1.00 24.65 ? 639  ASP A OD1 1 
ATOM   4553 O OD2 . ASP A 1 595 ? -6.547  62.317  12.038  1.00 26.08 ? 639  ASP A OD2 1 
ATOM   4554 N N   . PHE A 1 596 ? -7.085  65.428  16.526  1.00 18.50 ? 640  PHE A N   1 
ATOM   4555 C CA  . PHE A 1 596 ? -7.404  66.674  17.245  1.00 20.71 ? 640  PHE A CA  1 
ATOM   4556 C C   . PHE A 1 596 ? -7.025  66.589  18.733  1.00 22.08 ? 640  PHE A C   1 
ATOM   4557 O O   . PHE A 1 596 ? -7.144  65.520  19.358  1.00 22.76 ? 640  PHE A O   1 
ATOM   4558 C CB  . PHE A 1 596 ? -8.914  66.963  17.092  1.00 21.10 ? 640  PHE A CB  1 
ATOM   4559 C CG  . PHE A 1 596 ? -9.318  67.279  15.686  1.00 20.92 ? 640  PHE A CG  1 
ATOM   4560 C CD1 . PHE A 1 596 ? -9.231  68.582  15.200  1.00 19.97 ? 640  PHE A CD1 1 
ATOM   4561 C CD2 . PHE A 1 596 ? -9.723  66.258  14.816  1.00 23.91 ? 640  PHE A CD2 1 
ATOM   4562 C CE1 . PHE A 1 596 ? -9.578  68.876  13.900  1.00 25.07 ? 640  PHE A CE1 1 
ATOM   4563 C CE2 . PHE A 1 596 ? -10.034 66.550  13.496  1.00 22.98 ? 640  PHE A CE2 1 
ATOM   4564 C CZ  . PHE A 1 596 ? -9.943  67.855  13.036  1.00 22.81 ? 640  PHE A CZ  1 
ATOM   4565 N N   . LEU A 1 597 ? -6.595  67.711  19.294  1.00 23.32 ? 641  LEU A N   1 
ATOM   4566 C CA  . LEU A 1 597 ? -6.352  67.800  20.753  1.00 25.49 ? 641  LEU A CA  1 
ATOM   4567 C C   . LEU A 1 597 ? -7.600  68.463  21.371  1.00 26.40 ? 641  LEU A C   1 
ATOM   4568 O O   . LEU A 1 597 ? -8.242  69.258  20.697  1.00 25.85 ? 641  LEU A O   1 
ATOM   4569 C CB  . LEU A 1 597 ? -5.065  68.610  21.032  1.00 25.76 ? 641  LEU A CB  1 
ATOM   4570 C CG  . LEU A 1 597 ? -4.884  70.087  20.531  1.00 29.31 ? 641  LEU A CG  1 
ATOM   4571 C CD1 . LEU A 1 597 ? -5.202  71.251  21.571  1.00 29.62 ? 641  LEU A CD1 1 
ATOM   4572 C CD2 . LEU A 1 597 ? -3.469  70.372  19.917  1.00 24.37 ? 641  LEU A CD2 1 
ATOM   4573 N N   . CYS A 1 598 ? -7.952  68.135  22.618  1.00 28.20 ? 642  CYS A N   1 
ATOM   4574 C CA  . CYS A 1 598 ? -8.999  68.905  23.338  1.00 30.68 ? 642  CYS A CA  1 
ATOM   4575 C C   . CYS A 1 598 ? -8.486  70.296  23.574  1.00 29.65 ? 642  CYS A C   1 
ATOM   4576 O O   . CYS A 1 598 ? -7.368  70.468  24.044  1.00 31.25 ? 642  CYS A O   1 
ATOM   4577 C CB  . CYS A 1 598 ? -9.350  68.272  24.667  1.00 31.03 ? 642  CYS A CB  1 
ATOM   4578 S SG  . CYS A 1 598 ? -10.043 66.632  24.456  1.00 39.34 ? 642  CYS A SG  1 
ATOM   4579 N N   . ASP A 1 599 ? -9.250  71.299  23.185  1.00 29.12 ? 643  ASP A N   1 
ATOM   4580 C CA  . ASP A 1 599 ? -8.804  72.666  23.327  1.00 28.30 ? 643  ASP A CA  1 
ATOM   4581 C C   . ASP A 1 599 ? -9.065  73.067  24.795  1.00 29.37 ? 643  ASP A C   1 
ATOM   4582 O O   . ASP A 1 599 ? -9.575  72.252  25.580  1.00 28.92 ? 643  ASP A O   1 
ATOM   4583 C CB  . ASP A 1 599 ? -9.579  73.542  22.356  1.00 28.36 ? 643  ASP A CB  1 
ATOM   4584 C CG  . ASP A 1 599 ? -8.897  74.833  22.054  1.00 29.85 ? 643  ASP A CG  1 
ATOM   4585 O OD1 . ASP A 1 599 ? -7.855  75.117  22.680  1.00 34.49 ? 643  ASP A OD1 1 
ATOM   4586 O OD2 . ASP A 1 599 ? -9.429  75.605  21.206  1.00 31.19 ? 643  ASP A OD2 1 
ATOM   4587 N N   . PHE A 1 600 ? -8.718  74.294  25.178  1.00 28.72 ? 644  PHE A N   1 
ATOM   4588 C CA  . PHE A 1 600 ? -8.861  74.651  26.583  1.00 29.63 ? 644  PHE A CA  1 
ATOM   4589 C C   . PHE A 1 600 ? -10.336 74.539  26.964  1.00 29.50 ? 644  PHE A C   1 
ATOM   4590 O O   . PHE A 1 600 ? -11.216 74.828  26.138  1.00 29.79 ? 644  PHE A O   1 
ATOM   4591 C CB  . PHE A 1 600 ? -8.362  76.055  26.864  1.00 29.58 ? 644  PHE A CB  1 
ATOM   4592 C CG  . PHE A 1 600 ? -8.563  76.462  28.293  1.00 32.24 ? 644  PHE A CG  1 
ATOM   4593 C CD1 . PHE A 1 600 ? -7.752  75.934  29.293  1.00 33.25 ? 644  PHE A CD1 1 
ATOM   4594 C CD2 . PHE A 1 600 ? -9.615  77.319  28.652  1.00 33.60 ? 644  PHE A CD2 1 
ATOM   4595 C CE1 . PHE A 1 600 ? -7.952  76.305  30.631  1.00 34.81 ? 644  PHE A CE1 1 
ATOM   4596 C CE2 . PHE A 1 600 ? -9.836  77.658  29.978  1.00 33.63 ? 644  PHE A CE2 1 
ATOM   4597 C CZ  . PHE A 1 600 ? -9.014  77.147  30.962  1.00 30.90 ? 644  PHE A CZ  1 
ATOM   4598 N N   . GLY A 1 601 ? -10.594 74.075  28.192  1.00 30.01 ? 645  GLY A N   1 
ATOM   4599 C CA  . GLY A 1 601 ? -11.960 73.958  28.730  1.00 30.04 ? 645  GLY A CA  1 
ATOM   4600 C C   . GLY A 1 601 ? -12.591 72.603  28.497  1.00 30.33 ? 645  GLY A C   1 
ATOM   4601 O O   . GLY A 1 601 ? -13.568 72.293  29.138  1.00 29.02 ? 645  GLY A O   1 
ATOM   4602 N N   . TYR A 1 602 ? -12.010 71.785  27.603  1.00 29.82 ? 646  TYR A N   1 
ATOM   4603 C CA  . TYR A 1 602 ? -12.522 70.438  27.320  1.00 30.91 ? 646  TYR A CA  1 
ATOM   4604 C C   . TYR A 1 602 ? -11.579 69.322  27.731  1.00 32.15 ? 646  TYR A C   1 
ATOM   4605 O O   . TYR A 1 602 ? -10.396 69.557  27.969  1.00 32.25 ? 646  TYR A O   1 
ATOM   4606 C CB  . TYR A 1 602 ? -12.851 70.278  25.822  1.00 30.15 ? 646  TYR A CB  1 
ATOM   4607 C CG  . TYR A 1 602 ? -13.954 71.181  25.348  1.00 29.60 ? 646  TYR A CG  1 
ATOM   4608 C CD1 . TYR A 1 602 ? -15.152 70.670  24.875  1.00 28.59 ? 646  TYR A CD1 1 
ATOM   4609 C CD2 . TYR A 1 602 ? -13.801 72.556  25.392  1.00 28.63 ? 646  TYR A CD2 1 
ATOM   4610 C CE1 . TYR A 1 602 ? -16.161 71.517  24.443  1.00 29.24 ? 646  TYR A CE1 1 
ATOM   4611 C CE2 . TYR A 1 602 ? -14.800 73.403  24.986  1.00 30.61 ? 646  TYR A CE2 1 
ATOM   4612 C CZ  . TYR A 1 602 ? -15.962 72.889  24.509  1.00 30.51 ? 646  TYR A CZ  1 
ATOM   4613 O OH  . TYR A 1 602 ? -16.909 73.785  24.108  1.00 34.07 ? 646  TYR A OH  1 
ATOM   4614 N N   . TYR A 1 603 ? -12.120 68.110  27.804  1.00 34.03 ? 647  TYR A N   1 
ATOM   4615 C CA  . TYR A 1 603 ? -11.339 66.886  27.986  1.00 37.21 ? 647  TYR A CA  1 
ATOM   4616 C C   . TYR A 1 603 ? -11.963 65.704  27.310  1.00 38.69 ? 647  TYR A C   1 
ATOM   4617 O O   . TYR A 1 603 ? -13.103 65.770  26.867  1.00 38.79 ? 647  TYR A O   1 
ATOM   4618 C CB  . TYR A 1 603 ? -11.156 66.517  29.452  1.00 38.09 ? 647  TYR A CB  1 
ATOM   4619 C CG  . TYR A 1 603 ? -12.408 66.128  30.209  1.00 39.81 ? 647  TYR A CG  1 
ATOM   4620 C CD1 . TYR A 1 603 ? -12.421 65.016  31.043  1.00 40.73 ? 647  TYR A CD1 1 
ATOM   4621 C CD2 . TYR A 1 603 ? -13.560 66.901  30.128  1.00 40.07 ? 647  TYR A CD2 1 
ATOM   4622 C CE1 . TYR A 1 603 ? -13.546 64.692  31.765  1.00 41.54 ? 647  TYR A CE1 1 
ATOM   4623 C CE2 . TYR A 1 603 ? -14.683 66.592  30.839  1.00 41.06 ? 647  TYR A CE2 1 
ATOM   4624 C CZ  . TYR A 1 603 ? -14.683 65.493  31.655  1.00 41.98 ? 647  TYR A CZ  1 
ATOM   4625 O OH  . TYR A 1 603 ? -15.846 65.216  32.372  1.00 42.87 ? 647  TYR A OH  1 
ATOM   4626 N N   . ARG A 1 604 ? -11.205 64.612  27.310  1.00 41.11 ? 648  ARG A N   1 
ATOM   4627 C CA  . ARG A 1 604 ? -11.548 63.375  26.644  1.00 44.00 ? 648  ARG A CA  1 
ATOM   4628 C C   . ARG A 1 604 ? -11.588 62.271  27.717  1.00 46.12 ? 648  ARG A C   1 
ATOM   4629 O O   . ARG A 1 604 ? -10.528 61.797  28.141  1.00 46.98 ? 648  ARG A O   1 
ATOM   4630 C CB  . ARG A 1 604 ? -10.481 63.085  25.578  1.00 43.74 ? 648  ARG A CB  1 
ATOM   4631 C CG  . ARG A 1 604 ? -10.765 61.921  24.637  1.00 44.30 ? 648  ARG A CG  1 
ATOM   4632 C CD  . ARG A 1 604 ? -10.619 62.349  23.183  1.00 45.33 ? 648  ARG A CD  1 
ATOM   4633 N NE  . ARG A 1 604 ? -9.327  62.949  22.884  1.00 46.33 ? 648  ARG A NE  1 
ATOM   4634 C CZ  . ARG A 1 604 ? -9.021  63.595  21.758  1.00 46.43 ? 648  ARG A CZ  1 
ATOM   4635 N NH1 . ARG A 1 604 ? -9.909  63.760  20.780  1.00 44.76 ? 648  ARG A NH1 1 
ATOM   4636 N NH2 . ARG A 1 604 ? -7.805  64.086  21.621  1.00 47.25 ? 648  ARG A NH2 1 
ATOM   4637 N N   . PRO A 1 605 ? -12.799 61.900  28.203  1.00 47.63 ? 649  PRO A N   1 
ATOM   4638 C CA  . PRO A 1 605 ? -12.916 60.820  29.181  1.00 49.00 ? 649  PRO A CA  1 
ATOM   4639 C C   . PRO A 1 605 ? -12.711 59.392  28.624  1.00 50.53 ? 649  PRO A C   1 
ATOM   4640 O O   . PRO A 1 605 ? -12.381 59.205  27.450  1.00 50.60 ? 649  PRO A O   1 
ATOM   4641 C CB  . PRO A 1 605 ? -14.339 61.004  29.744  1.00 48.91 ? 649  PRO A CB  1 
ATOM   4642 C CG  . PRO A 1 605 ? -14.809 62.337  29.220  1.00 48.24 ? 649  PRO A CG  1 
ATOM   4643 C CD  . PRO A 1 605 ? -14.117 62.497  27.923  1.00 47.67 ? 649  PRO A CD  1 
ATOM   4644 N N   . GLU A 1 606 ? -12.937 58.410  29.496  1.00 52.49 ? 650  GLU A N   1 
ATOM   4645 C CA  . GLU A 1 606 ? -12.525 57.014  29.325  1.00 54.18 ? 650  GLU A CA  1 
ATOM   4646 C C   . GLU A 1 606 ? -12.082 56.591  27.934  1.00 55.34 ? 650  GLU A C   1 
ATOM   4647 O O   . GLU A 1 606 ? -10.921 56.214  27.743  1.00 56.02 ? 650  GLU A O   1 
ATOM   4648 C CB  . GLU A 1 606 ? -13.610 56.058  29.844  1.00 54.54 ? 650  GLU A CB  1 
ATOM   4649 C CG  . GLU A 1 606 ? -13.948 56.219  31.344  1.00 55.43 ? 650  GLU A CG  1 
ATOM   4650 C CD  . GLU A 1 606 ? -13.006 55.454  32.280  1.00 56.63 ? 650  GLU A CD  1 
ATOM   4651 O OE1 . GLU A 1 606 ? -12.032 54.830  31.796  1.00 58.12 ? 650  GLU A OE1 1 
ATOM   4652 O OE2 . GLU A 1 606 ? -13.248 55.474  33.506  1.00 55.35 ? 650  GLU A OE2 1 
ATOM   4653 N N   . ASN A 1 607 ? -12.985 56.650  26.958  1.00 56.29 ? 651  ASN A N   1 
ATOM   4654 C CA  . ASN A 1 607 ? -12.727 55.966  25.688  1.00 56.76 ? 651  ASN A CA  1 
ATOM   4655 C C   . ASN A 1 607 ? -12.525 56.819  24.432  1.00 56.77 ? 651  ASN A C   1 
ATOM   4656 O O   . ASN A 1 607 ? -12.002 57.939  24.482  1.00 56.68 ? 651  ASN A O   1 
ATOM   4657 C CB  . ASN A 1 607 ? -13.771 54.861  25.441  1.00 57.26 ? 651  ASN A CB  1 
ATOM   4658 C CG  . ASN A 1 607 ? -15.206 55.389  25.424  1.00 58.65 ? 651  ASN A CG  1 
ATOM   4659 O OD1 . ASN A 1 607 ? -15.603 56.212  26.268  1.00 60.58 ? 651  ASN A OD1 1 
ATOM   4660 N ND2 . ASN A 1 607 ? -15.997 54.903  24.464  1.00 59.34 ? 651  ASN A ND2 1 
ATOM   4661 N N   . ASP A 1 608 ? -12.988 56.259  23.317  1.00 56.84 ? 652  ASP A N   1 
ATOM   4662 C CA  . ASP A 1 608 ? -12.482 56.564  21.980  1.00 56.56 ? 652  ASP A CA  1 
ATOM   4663 C C   . ASP A 1 608 ? -12.842 57.933  21.374  1.00 55.77 ? 652  ASP A C   1 
ATOM   4664 O O   . ASP A 1 608 ? -13.387 58.001  20.257  1.00 55.99 ? 652  ASP A O   1 
ATOM   4665 C CB  . ASP A 1 608 ? -12.825 55.422  21.010  1.00 56.82 ? 652  ASP A CB  1 
ATOM   4666 C CG  . ASP A 1 608 ? -11.951 55.417  19.777  1.00 58.22 ? 652  ASP A CG  1 
ATOM   4667 O OD1 . ASP A 1 608 ? -11.238 56.419  19.516  1.00 59.61 ? 652  ASP A OD1 1 
ATOM   4668 O OD2 . ASP A 1 608 ? -11.977 54.396  19.056  1.00 60.91 ? 652  ASP A OD2 1 
ATOM   4669 N N   . SER A 1 609 ? -12.548 58.997  22.129  1.00 54.34 ? 653  SER A N   1 
ATOM   4670 C CA  . SER A 1 609 ? -12.040 60.260  21.559  1.00 52.66 ? 653  SER A CA  1 
ATOM   4671 C C   . SER A 1 609 ? -12.969 61.439  21.329  1.00 51.32 ? 653  SER A C   1 
ATOM   4672 O O   . SER A 1 609 ? -12.696 62.236  20.436  1.00 50.86 ? 653  SER A O   1 
ATOM   4673 C CB  . SER A 1 609 ? -11.281 60.001  20.248  1.00 53.15 ? 653  SER A CB  1 
ATOM   4674 O OG  . SER A 1 609 ? -12.203 59.852  19.182  1.00 53.39 ? 653  SER A OG  1 
ATOM   4675 N N   . LYS A 1 610 ? -14.034 61.587  22.109  1.00 49.31 ? 654  LYS A N   1 
ATOM   4676 C CA  . LYS A 1 610 ? -14.830 62.791  21.940  1.00 48.15 ? 654  LYS A CA  1 
ATOM   4677 C C   . LYS A 1 610 ? -14.602 63.816  23.067  1.00 46.26 ? 654  LYS A C   1 
ATOM   4678 O O   . LYS A 1 610 ? -15.023 63.587  24.211  1.00 46.81 ? 654  LYS A O   1 
ATOM   4679 C CB  . LYS A 1 610 ? -16.315 62.466  21.748  1.00 48.61 ? 654  LYS A CB  1 
ATOM   4680 C CG  . LYS A 1 610 ? -17.007 63.421  20.767  1.00 49.38 ? 654  LYS A CG  1 
ATOM   4681 C CD  . LYS A 1 610 ? -18.525 63.214  20.692  1.00 49.72 ? 654  LYS A CD  1 
ATOM   4682 C CE  . LYS A 1 610 ? -19.157 64.097  19.602  1.00 51.33 ? 654  LYS A CE  1 
ATOM   4683 N NZ  . LYS A 1 610 ? -18.585 63.844  18.227  1.00 52.04 ? 654  LYS A NZ  1 
ATOM   4684 N N   . CYS A 1 611 ? -13.946 64.937  22.723  1.00 43.55 ? 655  CYS A N   1 
ATOM   4685 C CA  . CYS A 1 611 ? -13.658 66.058  23.648  1.00 40.97 ? 655  CYS A CA  1 
ATOM   4686 C C   . CYS A 1 611 ? -14.927 66.769  24.133  1.00 39.98 ? 655  CYS A C   1 
ATOM   4687 O O   . CYS A 1 611 ? -15.679 67.334  23.338  1.00 39.57 ? 655  CYS A O   1 
ATOM   4688 C CB  . CYS A 1 611 ? -12.727 67.089  23.003  1.00 40.20 ? 655  CYS A CB  1 
ATOM   4689 S SG  . CYS A 1 611 ? -11.008 66.540  22.623  1.00 40.15 ? 655  CYS A SG  1 
ATOM   4690 N N   . VAL A 1 612 ? -15.132 66.764  25.448  1.00 39.12 ? 656  VAL A N   1 
ATOM   4691 C CA  . VAL A 1 612 ? -16.356 67.320  26.080  1.00 38.15 ? 656  VAL A CA  1 
ATOM   4692 C C   . VAL A 1 612 ? -16.038 68.428  27.086  1.00 37.41 ? 656  VAL A C   1 
ATOM   4693 O O   . VAL A 1 612 ? -14.963 68.436  27.666  1.00 35.74 ? 656  VAL A O   1 
ATOM   4694 C CB  . VAL A 1 612 ? -17.172 66.231  26.797  1.00 38.24 ? 656  VAL A CB  1 
ATOM   4695 C CG1 . VAL A 1 612 ? -17.661 65.153  25.799  1.00 39.24 ? 656  VAL A CG1 1 
ATOM   4696 C CG2 . VAL A 1 612 ? -16.370 65.615  27.937  1.00 38.69 ? 656  VAL A CG2 1 
ATOM   4697 N N   . GLU A 1 613 ? -16.973 69.350  27.299  1.00 37.52 ? 657  GLU A N   1 
ATOM   4698 C CA  . GLU A 1 613 ? -16.756 70.415  28.266  1.00 38.58 ? 657  GLU A CA  1 
ATOM   4699 C C   . GLU A 1 613 ? -16.404 69.845  29.647  1.00 38.17 ? 657  GLU A C   1 
ATOM   4700 O O   . GLU A 1 613 ? -17.022 68.882  30.110  1.00 37.87 ? 657  GLU A O   1 
ATOM   4701 C CB  . GLU A 1 613 ? -17.972 71.340  28.356  1.00 38.29 ? 657  GLU A CB  1 
ATOM   4702 C CG  . GLU A 1 613 ? -17.904 72.604  27.486  1.00 39.21 ? 657  GLU A CG  1 
ATOM   4703 C CD  . GLU A 1 613 ? -19.111 73.548  27.715  1.00 41.25 ? 657  GLU A CD  1 
ATOM   4704 O OE1 . GLU A 1 613 ? -20.243 73.040  27.957  1.00 42.01 ? 657  GLU A OE1 1 
ATOM   4705 O OE2 . GLU A 1 613 ? -18.927 74.798  27.656  1.00 43.75 ? 657  GLU A OE2 1 
ATOM   4706 N N   . GLN A 1 614 ? -15.381 70.419  30.274  1.00 38.36 ? 658  GLN A N   1 
ATOM   4707 C CA  . GLN A 1 614 ? -15.132 70.194  31.700  1.00 39.00 ? 658  GLN A CA  1 
ATOM   4708 C C   . GLN A 1 614 ? -16.262 70.763  32.569  1.00 38.65 ? 658  GLN A C   1 
ATOM   4709 O O   . GLN A 1 614 ? -16.731 71.876  32.318  1.00 38.46 ? 658  GLN A O   1 
ATOM   4710 C CB  . GLN A 1 614 ? -13.802 70.805  32.111  1.00 39.18 ? 658  GLN A CB  1 
ATOM   4711 C CG  . GLN A 1 614 ? -12.712 69.790  32.199  1.00 41.01 ? 658  GLN A CG  1 
ATOM   4712 C CD  . GLN A 1 614 ? -11.357 70.374  31.945  1.00 44.82 ? 658  GLN A CD  1 
ATOM   4713 O OE1 . GLN A 1 614 ? -11.222 71.527  31.541  1.00 47.36 ? 658  GLN A OE1 1 
ATOM   4714 N NE2 . GLN A 1 614 ? -10.331 69.568  32.158  1.00 46.99 ? 658  GLN A NE2 1 
ATOM   4715 N N   . PRO A 1 615 ? -16.716 69.987  33.583  1.00 38.82 ? 659  PRO A N   1 
ATOM   4716 C CA  . PRO A 1 615 ? -17.783 70.418  34.503  1.00 38.58 ? 659  PRO A CA  1 
ATOM   4717 C C   . PRO A 1 615 ? -17.357 71.541  35.471  1.00 38.59 ? 659  PRO A C   1 
ATOM   4718 O O   . PRO A 1 615 ? -18.226 72.303  35.968  1.00 39.17 ? 659  PRO A O   1 
ATOM   4719 C CB  . PRO A 1 615 ? -18.082 69.147  35.299  1.00 38.78 ? 659  PRO A CB  1 
ATOM   4720 C CG  . PRO A 1 615 ? -16.791 68.383  35.274  1.00 38.85 ? 659  PRO A CG  1 
ATOM   4721 C CD  . PRO A 1 615 ? -16.228 68.630  33.912  1.00 38.74 ? 659  PRO A CD  1 
ATOM   4722 N N   . GLU A 1 616 ? -16.049 71.604  35.767  1.00 37.48 ? 660  GLU A N   1 
ATOM   4723 C CA  . GLU A 1 616 ? -15.458 72.600  36.667  1.00 36.95 ? 660  GLU A CA  1 
ATOM   4724 C C   . GLU A 1 616 ? -14.018 72.880  36.267  1.00 35.17 ? 660  GLU A C   1 
ATOM   4725 O O   . GLU A 1 616 ? -13.271 71.974  35.879  1.00 35.64 ? 660  GLU A O   1 
ATOM   4726 C CB  . GLU A 1 616 ? -15.457 72.123  38.137  1.00 37.79 ? 660  GLU A CB  1 
ATOM   4727 C CG  . GLU A 1 616 ? -16.822 71.746  38.772  1.00 42.61 ? 660  GLU A CG  1 
ATOM   4728 C CD  . GLU A 1 616 ? -17.712 72.937  39.169  1.00 47.06 ? 660  GLU A CD  1 
ATOM   4729 O OE1 . GLU A 1 616 ? -17.355 73.723  40.097  1.00 47.84 ? 660  GLU A OE1 1 
ATOM   4730 O OE2 . GLU A 1 616 ? -18.800 73.049  38.552  1.00 49.53 ? 660  GLU A OE2 1 
ATOM   4731 N N   . LEU A 1 617 ? -13.622 74.137  36.362  1.00 32.72 ? 661  LEU A N   1 
ATOM   4732 C CA  . LEU A 1 617 ? -12.242 74.507  36.130  1.00 30.57 ? 661  LEU A CA  1 
ATOM   4733 C C   . LEU A 1 617 ? -11.560 74.750  37.477  1.00 30.14 ? 661  LEU A C   1 
ATOM   4734 O O   . LEU A 1 617 ? -12.062 75.525  38.293  1.00 29.79 ? 661  LEU A O   1 
ATOM   4735 C CB  . LEU A 1 617 ? -12.211 75.754  35.267  1.00 31.17 ? 661  LEU A CB  1 
ATOM   4736 C CG  . LEU A 1 617 ? -12.265 75.689  33.739  1.00 32.14 ? 661  LEU A CG  1 
ATOM   4737 C CD1 . LEU A 1 617 ? -13.047 74.534  33.163  1.00 33.71 ? 661  LEU A CD1 1 
ATOM   4738 C CD2 . LEU A 1 617 ? -12.860 76.980  33.302  1.00 33.26 ? 661  LEU A CD2 1 
ATOM   4739 N N   . LYS A 1 618 ? -10.455 74.063  37.734  1.00 28.69 ? 662  LYS A N   1 
ATOM   4740 C CA  . LYS A 1 618 ? -9.740  74.149  39.013  1.00 28.53 ? 662  LYS A CA  1 
ATOM   4741 C C   . LYS A 1 618 ? -8.319  74.574  38.727  1.00 26.86 ? 662  LYS A C   1 
ATOM   4742 O O   . LYS A 1 618 ? -7.890  74.504  37.576  1.00 26.46 ? 662  LYS A O   1 
ATOM   4743 C CB  . LYS A 1 618 ? -9.695  72.771  39.667  1.00 28.28 ? 662  LYS A CB  1 
ATOM   4744 C CG  . LYS A 1 618 ? -10.532 72.605  40.891  1.00 29.81 ? 662  LYS A CG  1 
ATOM   4745 C CD  . LYS A 1 618 ? -10.492 71.132  41.419  1.00 31.39 ? 662  LYS A CD  1 
ATOM   4746 C CE  . LYS A 1 618 ? -9.291  70.786  42.338  1.00 33.09 ? 662  LYS A CE  1 
ATOM   4747 N NZ  . LYS A 1 618 ? -9.380  71.424  43.699  1.00 29.91 ? 662  LYS A NZ  1 
ATOM   4748 N N   . GLY A 1 619 ? -7.562  74.972  39.752  1.00 24.97 ? 663  GLY A N   1 
ATOM   4749 C CA  . GLY A 1 619 ? -6.101  75.083  39.589  1.00 23.39 ? 663  GLY A CA  1 
ATOM   4750 C C   . GLY A 1 619 ? -5.721  76.008  38.440  1.00 22.49 ? 663  GLY A C   1 
ATOM   4751 O O   . GLY A 1 619 ? -6.371  77.055  38.248  1.00 21.32 ? 663  GLY A O   1 
ATOM   4752 N N   . HIS A 1 620 ? -4.714  75.629  37.654  1.00 21.39 ? 664  HIS A N   1 
ATOM   4753 C CA  . HIS A 1 620 ? -4.218  76.517  36.598  1.00 21.64 ? 664  HIS A CA  1 
ATOM   4754 C C   . HIS A 1 620 ? -5.169  76.702  35.423  1.00 21.97 ? 664  HIS A C   1 
ATOM   4755 O O   . HIS A 1 620 ? -5.059  77.691  34.679  1.00 23.23 ? 664  HIS A O   1 
ATOM   4756 C CB  . HIS A 1 620 ? -2.822  76.127  36.110  1.00 22.36 ? 664  HIS A CB  1 
ATOM   4757 C CG  . HIS A 1 620 ? -2.763  74.886  35.255  1.00 23.74 ? 664  HIS A CG  1 
ATOM   4758 N ND1 . HIS A 1 620 ? -2.601  73.621  35.786  1.00 25.00 ? 664  HIS A ND1 1 
ATOM   4759 C CD2 . HIS A 1 620 ? -2.742  74.729  33.908  1.00 25.08 ? 664  HIS A CD2 1 
ATOM   4760 C CE1 . HIS A 1 620 ? -2.531  72.734  34.806  1.00 25.82 ? 664  HIS A CE1 1 
ATOM   4761 N NE2 . HIS A 1 620 ? -2.607  73.380  33.655  1.00 27.05 ? 664  HIS A NE2 1 
ATOM   4762 N N   . ASP A 1 621 ? -6.106  75.763  35.229  1.00 21.59 ? 665  ASP A N   1 
ATOM   4763 C CA  . ASP A 1 621 ? -7.180  75.966  34.212  1.00 21.14 ? 665  ASP A CA  1 
ATOM   4764 C C   . ASP A 1 621 ? -8.028  77.177  34.617  1.00 21.25 ? 665  ASP A C   1 
ATOM   4765 O O   . ASP A 1 621 ? -8.363  78.025  33.796  1.00 21.74 ? 665  ASP A O   1 
ATOM   4766 C CB  . ASP A 1 621 ? -8.102  74.773  34.156  1.00 20.74 ? 665  ASP A CB  1 
ATOM   4767 C CG  . ASP A 1 621 ? -7.460  73.575  33.471  1.00 25.32 ? 665  ASP A CG  1 
ATOM   4768 O OD1 . ASP A 1 621 ? -6.618  73.761  32.536  1.00 27.77 ? 665  ASP A OD1 1 
ATOM   4769 O OD2 . ASP A 1 621 ? -7.799  72.451  33.893  1.00 26.40 ? 665  ASP A OD2 1 
ATOM   4770 N N   . LEU A 1 622 ? -8.380  77.219  35.884  1.00 20.45 ? 666  LEU A N   1 
ATOM   4771 C CA  . LEU A 1 622 ? -9.136  78.370  36.424  1.00 21.07 ? 666  LEU A CA  1 
ATOM   4772 C C   . LEU A 1 622 ? -8.333  79.654  36.266  1.00 21.48 ? 666  LEU A C   1 
ATOM   4773 O O   . LEU A 1 622 ? -8.820  80.609  35.719  1.00 22.89 ? 666  LEU A O   1 
ATOM   4774 C CB  . LEU A 1 622 ? -9.564  78.146  37.868  1.00 20.26 ? 666  LEU A CB  1 
ATOM   4775 C CG  . LEU A 1 622 ? -10.601 79.151  38.445  1.00 19.81 ? 666  LEU A CG  1 
ATOM   4776 C CD1 . LEU A 1 622 ? -11.910 79.170  37.639  1.00 21.02 ? 666  LEU A CD1 1 
ATOM   4777 C CD2 . LEU A 1 622 ? -10.886 78.867  39.871  1.00 21.73 ? 666  LEU A CD2 1 
ATOM   4778 N N   . GLU A 1 623 ? -7.081  79.666  36.696  1.00 22.52 ? 667  GLU A N   1 
ATOM   4779 C CA  . GLU A 1 623 ? -6.203  80.818  36.437  1.00 22.62 ? 667  GLU A CA  1 
ATOM   4780 C C   . GLU A 1 623 ? -6.183  81.215  34.951  1.00 22.16 ? 667  GLU A C   1 
ATOM   4781 O O   . GLU A 1 623 ? -6.215  82.391  34.618  1.00 19.52 ? 667  GLU A O   1 
ATOM   4782 C CB  . GLU A 1 623 ? -4.788  80.524  36.916  1.00 22.54 ? 667  GLU A CB  1 
ATOM   4783 C CG  . GLU A 1 623 ? -4.672  80.064  38.367  1.00 23.53 ? 667  GLU A CG  1 
ATOM   4784 C CD  . GLU A 1 623 ? -3.206  79.786  38.783  1.00 26.49 ? 667  GLU A CD  1 
ATOM   4785 O OE1 . GLU A 1 623 ? -2.496  79.000  38.082  1.00 30.71 ? 667  GLU A OE1 1 
ATOM   4786 O OE2 . GLU A 1 623 ? -2.748  80.351  39.815  1.00 30.24 ? 667  GLU A OE2 1 
ATOM   4787 N N   . PHE A 1 624 ? -6.121  80.232  34.044  1.00 22.05 ? 668  PHE A N   1 
ATOM   4788 C CA  . PHE A 1 624 ? -6.033  80.578  32.630  1.00 22.82 ? 668  PHE A CA  1 
ATOM   4789 C C   . PHE A 1 624 ? -7.290  81.286  32.137  1.00 23.17 ? 668  PHE A C   1 
ATOM   4790 O O   . PHE A 1 624 ? -7.228  82.200  31.341  1.00 23.74 ? 668  PHE A O   1 
ATOM   4791 C CB  . PHE A 1 624 ? -5.743  79.322  31.768  1.00 22.88 ? 668  PHE A CB  1 
ATOM   4792 C CG  . PHE A 1 624 ? -5.470  79.626  30.345  1.00 23.67 ? 668  PHE A CG  1 
ATOM   4793 C CD1 . PHE A 1 624 ? -4.244  80.134  29.943  1.00 25.03 ? 668  PHE A CD1 1 
ATOM   4794 C CD2 . PHE A 1 624 ? -6.422  79.366  29.374  1.00 26.81 ? 668  PHE A CD2 1 
ATOM   4795 C CE1 . PHE A 1 624 ? -3.993  80.406  28.565  1.00 24.80 ? 668  PHE A CE1 1 
ATOM   4796 C CE2 . PHE A 1 624 ? -6.163  79.624  27.997  1.00 26.80 ? 668  PHE A CE2 1 
ATOM   4797 C CZ  . PHE A 1 624 ? -4.944  80.124  27.606  1.00 23.50 ? 668  PHE A CZ  1 
ATOM   4798 N N   . CYS A 1 625 ? -8.436  80.853  32.611  1.00 24.69 ? 669  CYS A N   1 
ATOM   4799 C CA  . CYS A 1 625 ? -9.682  81.478  32.237  1.00 26.92 ? 669  CYS A CA  1 
ATOM   4800 C C   . CYS A 1 625 ? -9.774  82.954  32.655  1.00 27.05 ? 669  CYS A C   1 
ATOM   4801 O O   . CYS A 1 625 ? -10.296 83.820  31.919  1.00 25.80 ? 669  CYS A O   1 
ATOM   4802 C CB  . CYS A 1 625 ? -10.809 80.702  32.887  1.00 27.96 ? 669  CYS A CB  1 
ATOM   4803 S SG  . CYS A 1 625 ? -12.218 80.704  31.810  1.00 37.11 ? 669  CYS A SG  1 
ATOM   4804 N N   . LEU A 1 626 ? -9.290  83.231  33.863  1.00 27.17 ? 670  LEU A N   1 
ATOM   4805 C CA  . LEU A 1 626 ? -9.298  84.589  34.393  1.00 28.48 ? 670  LEU A CA  1 
ATOM   4806 C C   . LEU A 1 626 ? -8.259  85.478  33.702  1.00 30.05 ? 670  LEU A C   1 
ATOM   4807 O O   . LEU A 1 626 ? -8.495  86.643  33.488  1.00 29.97 ? 670  LEU A O   1 
ATOM   4808 C CB  . LEU A 1 626 ? -9.056  84.552  35.901  1.00 28.60 ? 670  LEU A CB  1 
ATOM   4809 C CG  . LEU A 1 626 ? -10.210 84.053  36.790  1.00 30.54 ? 670  LEU A CG  1 
ATOM   4810 C CD1 . LEU A 1 626 ? -9.676  83.784  38.212  1.00 33.10 ? 670  LEU A CD1 1 
ATOM   4811 C CD2 . LEU A 1 626 ? -11.324 85.088  36.853  1.00 30.87 ? 670  LEU A CD2 1 
ATOM   4812 N N   . TYR A 1 627 ? -7.116  84.913  33.320  1.00 32.13 ? 671  TYR A N   1 
ATOM   4813 C CA  . TYR A 1 627 ? -6.045  85.702  32.718  1.00 34.83 ? 671  TYR A CA  1 
ATOM   4814 C C   . TYR A 1 627 ? -5.915  85.557  31.192  1.00 36.40 ? 671  TYR A C   1 
ATOM   4815 O O   . TYR A 1 627 ? -5.122  86.267  30.579  1.00 37.28 ? 671  TYR A O   1 
ATOM   4816 C CB  . TYR A 1 627 ? -4.718  85.315  33.366  1.00 35.38 ? 671  TYR A CB  1 
ATOM   4817 C CG  . TYR A 1 627 ? -4.503  85.877  34.746  1.00 37.49 ? 671  TYR A CG  1 
ATOM   4818 C CD1 . TYR A 1 627 ? -4.313  87.249  34.928  1.00 39.06 ? 671  TYR A CD1 1 
ATOM   4819 C CD2 . TYR A 1 627 ? -4.457  85.043  35.869  1.00 36.87 ? 671  TYR A CD2 1 
ATOM   4820 C CE1 . TYR A 1 627 ? -4.094  87.787  36.186  1.00 40.38 ? 671  TYR A CE1 1 
ATOM   4821 C CE2 . TYR A 1 627 ? -4.236  85.576  37.138  1.00 39.52 ? 671  TYR A CE2 1 
ATOM   4822 C CZ  . TYR A 1 627 ? -4.059  86.954  37.283  1.00 39.24 ? 671  TYR A CZ  1 
ATOM   4823 O OH  . TYR A 1 627 ? -3.850  87.531  38.525  1.00 41.19 ? 671  TYR A OH  1 
ATOM   4824 N N   . GLY A 1 628 ? -6.651  84.632  30.583  1.00 37.69 ? 672  GLY A N   1 
ATOM   4825 C CA  . GLY A 1 628 ? -6.484  84.360  29.156  1.00 38.99 ? 672  GLY A CA  1 
ATOM   4826 C C   . GLY A 1 628 ? -7.183  85.364  28.257  1.00 39.77 ? 672  GLY A C   1 
ATOM   4827 O O   . GLY A 1 628 ? -8.120  86.024  28.664  1.00 39.15 ? 672  GLY A O   1 
ATOM   4828 N N   . ARG A 1 629 ? -6.734  85.454  27.009  1.00 41.42 ? 673  ARG A N   1 
ATOM   4829 C CA  . ARG A 1 629 ? -7.419  86.264  25.996  1.00 42.84 ? 673  ARG A CA  1 
ATOM   4830 C C   . ARG A 1 629 ? -8.673  85.532  25.480  1.00 43.49 ? 673  ARG A C   1 
ATOM   4831 O O   . ARG A 1 629 ? -8.674  84.295  25.361  1.00 43.22 ? 673  ARG A O   1 
ATOM   4832 C CB  . ARG A 1 629 ? -6.489  86.523  24.813  1.00 42.90 ? 673  ARG A CB  1 
ATOM   4833 C CG  . ARG A 1 629 ? -5.151  87.172  25.130  1.00 43.73 ? 673  ARG A CG  1 
ATOM   4834 C CD  . ARG A 1 629 ? -4.282  87.210  23.865  1.00 43.94 ? 673  ARG A CD  1 
ATOM   4835 N NE  . ARG A 1 629 ? -3.168  88.152  23.963  1.00 47.83 ? 673  ARG A NE  1 
ATOM   4836 C CZ  . ARG A 1 629 ? -3.303  89.480  24.005  1.00 50.66 ? 673  ARG A CZ  1 
ATOM   4837 N NH1 . ARG A 1 629 ? -4.503  90.040  23.955  1.00 51.81 ? 673  ARG A NH1 1 
ATOM   4838 N NH2 . ARG A 1 629 ? -2.236  90.264  24.101  1.00 51.44 ? 673  ARG A NH2 1 
ATOM   4839 N N   . GLU A 1 630 ? -9.732  86.284  25.169  1.00 44.21 ? 674  GLU A N   1 
ATOM   4840 C CA  . GLU A 1 630 ? -10.864 85.751  24.376  1.00 44.74 ? 674  GLU A CA  1 
ATOM   4841 C C   . GLU A 1 630 ? -10.428 84.804  23.271  1.00 44.66 ? 674  GLU A C   1 
ATOM   4842 O O   . GLU A 1 630 ? -10.895 83.671  23.233  1.00 45.61 ? 674  GLU A O   1 
ATOM   4843 C CB  . GLU A 1 630 ? -11.722 86.869  23.773  1.00 45.27 ? 674  GLU A CB  1 
ATOM   4844 C CG  . GLU A 1 630 ? -10.989 87.848  22.849  1.00 47.95 ? 674  GLU A CG  1 
ATOM   4845 C CD  . GLU A 1 630 ? -9.908  88.680  23.566  1.00 51.33 ? 674  GLU A CD  1 
ATOM   4846 O OE1 . GLU A 1 630 ? -10.159 89.194  24.693  1.00 49.35 ? 674  GLU A OE1 1 
ATOM   4847 O OE2 . GLU A 1 630 ? -8.801  88.812  22.985  1.00 52.67 ? 674  GLU A OE2 1 
ATOM   4848 N N   . GLU A 1 631 ? -9.535  85.255  22.383  1.00 44.05 ? 675  GLU A N   1 
ATOM   4849 C CA  . GLU A 1 631 ? -9.028  84.436  21.270  1.00 43.74 ? 675  GLU A CA  1 
ATOM   4850 C C   . GLU A 1 631 ? -8.813  82.972  21.655  1.00 42.42 ? 675  GLU A C   1 
ATOM   4851 O O   . GLU A 1 631 ? -9.137  82.055  20.875  1.00 42.96 ? 675  GLU A O   1 
ATOM   4852 C CB  . GLU A 1 631 ? -7.682  84.960  20.736  1.00 43.83 ? 675  GLU A CB  1 
ATOM   4853 C CG  . GLU A 1 631 ? -7.330  86.426  21.091  1.00 45.61 ? 675  GLU A CG  1 
ATOM   4854 C CD  . GLU A 1 631 ? -5.940  86.835  20.581  1.00 45.83 ? 675  GLU A CD  1 
ATOM   4855 O OE1 . GLU A 1 631 ? -5.199  85.959  20.053  1.00 47.08 ? 675  GLU A OE1 1 
ATOM   4856 O OE2 . GLU A 1 631 ? -5.590  88.035  20.711  1.00 48.90 ? 675  GLU A OE2 1 
ATOM   4857 N N   . HIS A 1 632 ? -8.238  82.766  22.841  1.00 39.77 ? 676  HIS A N   1 
ATOM   4858 C CA  . HIS A 1 632 ? -7.840  81.444  23.297  1.00 37.93 ? 676  HIS A CA  1 
ATOM   4859 C C   . HIS A 1 632 ? -8.943  80.776  24.121  1.00 36.54 ? 676  HIS A C   1 
ATOM   4860 O O   . HIS A 1 632 ? -8.943  79.552  24.336  1.00 36.02 ? 676  HIS A O   1 
ATOM   4861 C CB  . HIS A 1 632 ? -6.528  81.538  24.101  1.00 38.17 ? 676  HIS A CB  1 
ATOM   4862 C CG  . HIS A 1 632 ? -5.459  82.355  23.434  1.00 39.56 ? 676  HIS A CG  1 
ATOM   4863 N ND1 . HIS A 1 632 ? -5.231  82.326  22.073  1.00 42.81 ? 676  HIS A ND1 1 
ATOM   4864 C CD2 . HIS A 1 632 ? -4.543  83.213  23.942  1.00 40.29 ? 676  HIS A CD2 1 
ATOM   4865 C CE1 . HIS A 1 632 ? -4.236  83.140  21.770  1.00 41.60 ? 676  HIS A CE1 1 
ATOM   4866 N NE2 . HIS A 1 632 ? -3.796  83.686  22.887  1.00 41.94 ? 676  HIS A NE2 1 
ATOM   4867 N N   . LEU A 1 633 ? -9.886  81.595  24.579  1.00 34.29 ? 677  LEU A N   1 
ATOM   4868 C CA  . LEU A 1 633 ? -10.959 81.124  25.417  1.00 33.38 ? 677  LEU A CA  1 
ATOM   4869 C C   . LEU A 1 633 ? -12.247 80.900  24.614  1.00 33.97 ? 677  LEU A C   1 
ATOM   4870 O O   . LEU A 1 633 ? -13.257 80.415  25.148  1.00 33.63 ? 677  LEU A O   1 
ATOM   4871 C CB  . LEU A 1 633 ? -11.161 82.130  26.564  1.00 33.06 ? 677  LEU A CB  1 
ATOM   4872 C CG  . LEU A 1 633 ? -10.075 82.047  27.636  1.00 31.87 ? 677  LEU A CG  1 
ATOM   4873 C CD1 . LEU A 1 633 ? -10.135 83.196  28.622  1.00 30.74 ? 677  LEU A CD1 1 
ATOM   4874 C CD2 . LEU A 1 633 ? -10.152 80.717  28.353  1.00 32.14 ? 677  LEU A CD2 1 
ATOM   4875 N N   . THR A 1 634 ? -12.207 81.257  23.325  1.00 33.84 ? 678  THR A N   1 
ATOM   4876 C CA  . THR A 1 634 ? -13.316 81.017  22.410  1.00 33.92 ? 678  THR A CA  1 
ATOM   4877 C C   . THR A 1 634 ? -12.998 79.743  21.598  1.00 32.35 ? 678  THR A C   1 
ATOM   4878 O O   . THR A 1 634 ? -12.026 79.702  20.855  1.00 31.18 ? 678  THR A O   1 
ATOM   4879 C CB  . THR A 1 634 ? -13.633 82.289  21.530  1.00 34.87 ? 678  THR A CB  1 
ATOM   4880 O OG1 . THR A 1 634 ? -14.947 82.192  20.963  1.00 38.08 ? 678  THR A OG1 1 
ATOM   4881 C CG2 . THR A 1 634 ? -12.617 82.507  20.382  1.00 36.95 ? 678  THR A CG2 1 
ATOM   4882 N N   . THR A 1 635 ? -13.779 78.689  21.809  1.00 31.18 ? 679  THR A N   1 
ATOM   4883 C CA  . THR A 1 635 ? -13.478 77.412  21.172  1.00 30.53 ? 679  THR A CA  1 
ATOM   4884 C C   . THR A 1 635 ? -14.645 76.448  20.978  1.00 28.95 ? 679  THR A C   1 
ATOM   4885 O O   . THR A 1 635 ? -15.667 76.550  21.666  1.00 26.32 ? 679  THR A O   1 
ATOM   4886 C CB  . THR A 1 635 ? -12.332 76.676  21.891  1.00 31.45 ? 679  THR A CB  1 
ATOM   4887 O OG1 . THR A 1 635 ? -12.236 75.332  21.386  1.00 36.21 ? 679  THR A OG1 1 
ATOM   4888 C CG2 . THR A 1 635 ? -12.467 76.658  23.417  1.00 32.15 ? 679  THR A CG2 1 
ATOM   4889 N N   . ASN A 1 636 ? -14.473 75.508  20.035  1.00 26.13 ? 680  ASN A N   1 
ATOM   4890 C CA  . ASN A 1 636 ? -15.400 74.412  19.900  1.00 26.01 ? 680  ASN A CA  1 
ATOM   4891 C C   . ASN A 1 636 ? -14.945 73.156  20.621  1.00 25.48 ? 680  ASN A C   1 
ATOM   4892 O O   . ASN A 1 636 ? -15.548 72.081  20.503  1.00 27.69 ? 680  ASN A O   1 
ATOM   4893 C CB  . ASN A 1 636 ? -15.681 74.120  18.420  1.00 26.46 ? 680  ASN A CB  1 
ATOM   4894 C CG  . ASN A 1 636 ? -14.579 73.340  17.757  1.00 27.27 ? 680  ASN A CG  1 
ATOM   4895 O OD1 . ASN A 1 636 ? -13.411 73.510  18.056  1.00 29.16 ? 680  ASN A OD1 1 
ATOM   4896 N ND2 . ASN A 1 636 ? -14.956 72.478  16.820  1.00 30.11 ? 680  ASN A ND2 1 
ATOM   4897 N N   . GLY A 1 637 ? -13.881 73.276  21.377  1.00 23.54 ? 681  GLY A N   1 
ATOM   4898 C CA  . GLY A 1 637 ? -13.386 72.152  22.100  1.00 22.87 ? 681  GLY A CA  1 
ATOM   4899 C C   . GLY A 1 637 ? -12.325 71.297  21.413  1.00 22.61 ? 681  GLY A C   1 
ATOM   4900 O O   . GLY A 1 637 ? -11.765 70.449  22.088  1.00 22.67 ? 681  GLY A O   1 
ATOM   4901 N N   . TYR A 1 638 ? -12.087 71.480  20.111  1.00 21.32 ? 682  TYR A N   1 
ATOM   4902 C CA  . TYR A 1 638 ? -11.042 70.693  19.353  1.00 22.62 ? 682  TYR A CA  1 
ATOM   4903 C C   . TYR A 1 638 ? -10.006 71.583  18.712  1.00 22.83 ? 682  TYR A C   1 
ATOM   4904 O O   . TYR A 1 638 ? -10.341 72.646  18.208  1.00 24.23 ? 682  TYR A O   1 
ATOM   4905 C CB  . TYR A 1 638 ? -11.679 69.904  18.204  1.00 22.26 ? 682  TYR A CB  1 
ATOM   4906 C CG  . TYR A 1 638 ? -12.638 68.849  18.658  1.00 23.64 ? 682  TYR A CG  1 
ATOM   4907 C CD1 . TYR A 1 638 ? -12.177 67.611  19.058  1.00 24.64 ? 682  TYR A CD1 1 
ATOM   4908 C CD2 . TYR A 1 638 ? -13.995 69.084  18.704  1.00 23.05 ? 682  TYR A CD2 1 
ATOM   4909 C CE1 . TYR A 1 638 ? -13.048 66.617  19.484  1.00 22.37 ? 682  TYR A CE1 1 
ATOM   4910 C CE2 . TYR A 1 638 ? -14.886 68.087  19.141  1.00 24.99 ? 682  TYR A CE2 1 
ATOM   4911 C CZ  . TYR A 1 638 ? -14.375 66.863  19.524  1.00 23.11 ? 682  TYR A CZ  1 
ATOM   4912 O OH  . TYR A 1 638 ? -15.171 65.874  19.947  1.00 24.80 ? 682  TYR A OH  1 
ATOM   4913 N N   . ARG A 1 639 ? -8.753  71.128  18.649  1.00 22.80 ? 683  ARG A N   1 
ATOM   4914 C CA  . ARG A 1 639 ? -7.787  71.821  17.885  1.00 22.54 ? 683  ARG A CA  1 
ATOM   4915 C C   . ARG A 1 639 ? -6.908  70.761  17.228  1.00 22.07 ? 683  ARG A C   1 
ATOM   4916 O O   . ARG A 1 639 ? -6.481  69.842  17.912  1.00 20.07 ? 683  ARG A O   1 
ATOM   4917 C CB  . ARG A 1 639 ? -6.953  72.677  18.848  1.00 23.88 ? 683  ARG A CB  1 
ATOM   4918 C CG  . ARG A 1 639 ? -5.885  73.475  18.129  1.00 27.46 ? 683  ARG A CG  1 
ATOM   4919 C CD  . ARG A 1 639 ? -5.596  74.792  18.774  1.00 32.83 ? 683  ARG A CD  1 
ATOM   4920 N NE  . ARG A 1 639 ? -4.828  75.609  17.823  1.00 35.28 ? 683  ARG A NE  1 
ATOM   4921 C CZ  . ARG A 1 639 ? -5.263  76.763  17.314  1.00 35.09 ? 683  ARG A CZ  1 
ATOM   4922 N NH1 . ARG A 1 639 ? -6.425  77.273  17.694  1.00 34.42 ? 683  ARG A NH1 1 
ATOM   4923 N NH2 . ARG A 1 639 ? -4.504  77.427  16.464  1.00 35.82 ? 683  ARG A NH2 1 
ATOM   4924 N N   . LYS A 1 640 ? -6.625  70.924  15.937  1.00 23.35 ? 684  LYS A N   1 
ATOM   4925 C CA  . LYS A 1 640 ? -5.751  69.995  15.202  1.00 25.36 ? 684  LYS A CA  1 
ATOM   4926 C C   . LYS A 1 640 ? -4.388  69.827  15.907  1.00 25.02 ? 684  LYS A C   1 
ATOM   4927 O O   . LYS A 1 640 ? -3.733  70.814  16.288  1.00 24.86 ? 684  LYS A O   1 
ATOM   4928 C CB  . LYS A 1 640 ? -5.534  70.503  13.751  1.00 26.87 ? 684  LYS A CB  1 
ATOM   4929 C CG  . LYS A 1 640 ? -5.351  69.412  12.665  1.00 29.77 ? 684  LYS A CG  1 
ATOM   4930 C CD  . LYS A 1 640 ? -6.484  69.482  11.601  1.00 35.27 ? 684  LYS A CD  1 
ATOM   4931 C CE  . LYS A 1 640 ? -6.242  68.650  10.396  1.00 37.22 ? 684  LYS A CE  1 
ATOM   4932 N NZ  . LYS A 1 640 ? -5.076  69.022  9.484   1.00 41.50 ? 684  LYS A NZ  1 
ATOM   4933 N N   . ILE A 1 641 ? -3.932  68.587  16.049  1.00 24.86 ? 685  ILE A N   1 
ATOM   4934 C CA  . ILE A 1 641 ? -2.626  68.336  16.612  1.00 22.79 ? 685  ILE A CA  1 
ATOM   4935 C C   . ILE A 1 641 ? -1.573  69.097  15.797  1.00 22.91 ? 685  ILE A C   1 
ATOM   4936 O O   . ILE A 1 641 ? -1.590  69.056  14.562  1.00 22.48 ? 685  ILE A O   1 
ATOM   4937 C CB  . ILE A 1 641 ? -2.330  66.842  16.617  1.00 24.13 ? 685  ILE A CB  1 
ATOM   4938 C CG1 . ILE A 1 641 ? -3.257  66.171  17.618  1.00 24.31 ? 685  ILE A CG1 1 
ATOM   4939 C CG2 . ILE A 1 641 ? -0.798  66.606  16.930  1.00 22.83 ? 685  ILE A CG2 1 
ATOM   4940 C CD1 . ILE A 1 641 ? -3.123  64.663  17.686  1.00 30.50 ? 685  ILE A CD1 1 
ATOM   4941 N N   . PRO A 1 642 ? -0.628  69.795  16.473  1.00 22.53 ? 686  PRO A N   1 
ATOM   4942 C CA  . PRO A 1 642 ? 0.318   70.604  15.664  1.00 22.53 ? 686  PRO A CA  1 
ATOM   4943 C C   . PRO A 1 642 ? 1.237   69.679  14.845  1.00 22.49 ? 686  PRO A C   1 
ATOM   4944 O O   . PRO A 1 642 ? 1.694   68.673  15.380  1.00 22.76 ? 686  PRO A O   1 
ATOM   4945 C CB  . PRO A 1 642 ? 1.137   71.326  16.707  1.00 22.46 ? 686  PRO A CB  1 
ATOM   4946 C CG  . PRO A 1 642 ? 0.816   70.713  18.035  1.00 22.67 ? 686  PRO A CG  1 
ATOM   4947 C CD  . PRO A 1 642 ? -0.373  69.879  17.939  1.00 22.53 ? 686  PRO A CD  1 
ATOM   4948 N N   . GLY A 1 643 ? 1.430   69.985  13.574  1.00 22.54 ? 687  GLY A N   1 
ATOM   4949 C CA  . GLY A 1 643 ? 2.250   69.161  12.638  1.00 24.96 ? 687  GLY A CA  1 
ATOM   4950 C C   . GLY A 1 643 ? 1.343   68.128  11.991  1.00 25.06 ? 687  GLY A C   1 
ATOM   4951 O O   . GLY A 1 643 ? 1.791   67.299  11.207  1.00 25.67 ? 687  GLY A O   1 
ATOM   4952 N N   . ASP A 1 644 ? 0.070   68.137  12.364  1.00 23.91 ? 688  ASP A N   1 
ATOM   4953 C CA  . ASP A 1 644 ? -0.846  67.088  11.864  1.00 23.71 ? 688  ASP A CA  1 
ATOM   4954 C C   . ASP A 1 644 ? -1.333  67.441  10.431  1.00 23.29 ? 688  ASP A C   1 
ATOM   4955 O O   . ASP A 1 644 ? -1.911  68.526  10.241  1.00 19.93 ? 688  ASP A O   1 
ATOM   4956 C CB  . ASP A 1 644 ? -2.062  66.841  12.813  1.00 23.26 ? 688  ASP A CB  1 
ATOM   4957 C CG  . ASP A 1 644 ? -2.792  65.595  12.426  1.00 26.81 ? 688  ASP A CG  1 
ATOM   4958 O OD1 . ASP A 1 644 ? -3.368  65.633  11.311  1.00 22.91 ? 688  ASP A OD1 1 
ATOM   4959 O OD2 . ASP A 1 644 ? -2.706  64.542  13.145  1.00 27.09 ? 688  ASP A OD2 1 
ATOM   4960 N N   . LYS A 1 645 ? -1.146  66.509  9.466   1.00 21.56 ? 689  LYS A N   1 
ATOM   4961 C CA  . LYS A 1 645 ? -1.388  66.813  8.070   1.00 23.26 ? 689  LYS A CA  1 
ATOM   4962 C C   . LYS A 1 645 ? -2.551  66.153  7.394   1.00 22.78 ? 689  LYS A C   1 
ATOM   4963 O O   . LYS A 1 645 ? -2.641  66.190  6.147   1.00 22.25 ? 689  LYS A O   1 
ATOM   4964 C CB  . LYS A 1 645 ? -0.057  66.649  7.237   1.00 24.13 ? 689  LYS A CB  1 
ATOM   4965 C CG  . LYS A 1 645 ? 1.010   67.667  7.646   1.00 26.05 ? 689  LYS A CG  1 
ATOM   4966 C CD  . LYS A 1 645 ? 2.304   67.581  6.750   1.00 27.50 ? 689  LYS A CD  1 
ATOM   4967 C CE  . LYS A 1 645 ? 3.305   68.708  7.100   1.00 34.56 ? 689  LYS A CE  1 
ATOM   4968 N NZ  . LYS A 1 645 ? 4.676   68.287  6.549   1.00 40.27 ? 689  LYS A NZ  1 
ATOM   4969 N N   . CYS A 1 646 ? -3.515  65.627  8.190   1.00 22.98 ? 690  CYS A N   1 
ATOM   4970 C CA  . CYS A 1 646 ? -4.672  64.933  7.668   1.00 21.58 ? 690  CYS A CA  1 
ATOM   4971 C C   . CYS A 1 646 ? -5.551  65.883  6.835   1.00 23.45 ? 690  CYS A C   1 
ATOM   4972 O O   . CYS A 1 646 ? -5.562  67.096  7.072   1.00 21.20 ? 690  CYS A O   1 
ATOM   4973 C CB  . CYS A 1 646 ? -5.460  64.267  8.819   1.00 21.16 ? 690  CYS A CB  1 
ATOM   4974 S SG  . CYS A 1 646 ? -6.336  65.493  9.938   1.00 27.13 ? 690  CYS A SG  1 
ATOM   4975 N N   . GLN A 1 647 ? -6.311  65.310  5.890   1.00 22.42 ? 691  GLN A N   1 
ATOM   4976 C CA  . GLN A 1 647 ? -7.210  66.047  5.006   1.00 24.36 ? 691  GLN A CA  1 
ATOM   4977 C C   . GLN A 1 647 ? -8.457  65.203  4.846   1.00 23.23 ? 691  GLN A C   1 
ATOM   4978 O O   . GLN A 1 647 ? -8.397  63.973  4.807   1.00 19.73 ? 691  GLN A O   1 
ATOM   4979 C CB  . GLN A 1 647 ? -6.558  66.226  3.627   1.00 24.68 ? 691  GLN A CB  1 
ATOM   4980 C CG  . GLN A 1 647 ? -5.439  67.286  3.581   1.00 28.01 ? 691  GLN A CG  1 
ATOM   4981 C CD  . GLN A 1 647 ? -4.802  67.360  2.187   1.00 29.49 ? 691  GLN A CD  1 
ATOM   4982 O OE1 . GLN A 1 647 ? -5.418  66.923  1.204   1.00 36.46 ? 691  GLN A OE1 1 
ATOM   4983 N NE2 . GLN A 1 647 ? -3.547  67.867  2.096   1.00 28.54 ? 691  GLN A NE2 1 
ATOM   4984 N N   . GLY A 1 648 ? -9.613  65.859  4.787   1.00 24.34 ? 692  GLY A N   1 
ATOM   4985 C CA  . GLY A 1 648 ? -10.868 65.161  4.500   1.00 24.92 ? 692  GLY A CA  1 
ATOM   4986 C C   . GLY A 1 648 ? -11.216 64.413  5.766   1.00 26.76 ? 692  GLY A C   1 
ATOM   4987 O O   . GLY A 1 648 ? -10.478 64.531  6.758   1.00 27.65 ? 692  GLY A O   1 
ATOM   4988 N N   . GLY A 1 649 ? -12.311 63.654  5.755   1.00 26.56 ? 693  GLY A N   1 
ATOM   4989 C CA  . GLY A 1 649 ? -12.700 62.867  6.916   1.00 27.12 ? 693  GLY A CA  1 
ATOM   4990 C C   . GLY A 1 649 ? -13.399 63.780  7.916   1.00 28.43 ? 693  GLY A C   1 
ATOM   4991 O O   . GLY A 1 649 ? -13.968 64.792  7.545   1.00 28.64 ? 693  GLY A O   1 
ATOM   4992 N N   . VAL A 1 650 ? -13.319 63.409  9.186   1.00 29.49 ? 694  VAL A N   1 
ATOM   4993 C CA  . VAL A 1 650 ? -14.035 64.057  10.290  1.00 29.86 ? 694  VAL A CA  1 
ATOM   4994 C C   . VAL A 1 650 ? -13.536 65.465  10.480  1.00 30.99 ? 694  VAL A C   1 
ATOM   4995 O O   . VAL A 1 650 ? -12.345 65.708  10.534  1.00 30.78 ? 694  VAL A O   1 
ATOM   4996 C CB  . VAL A 1 650 ? -13.754 63.321  11.596  1.00 29.28 ? 694  VAL A CB  1 
ATOM   4997 C CG1 . VAL A 1 650 ? -14.060 64.193  12.801  1.00 28.38 ? 694  VAL A CG1 1 
ATOM   4998 C CG2 . VAL A 1 650 ? -14.525 62.057  11.651  1.00 29.57 ? 694  VAL A CG2 1 
ATOM   4999 N N   . ASN A 1 651 ? -14.463 66.392  10.586  1.00 32.54 ? 695  ASN A N   1 
ATOM   5000 C CA  . ASN A 1 651 ? -14.132 67.781  10.811  1.00 34.27 ? 695  ASN A CA  1 
ATOM   5001 C C   . ASN A 1 651 ? -15.157 68.300  11.831  1.00 34.48 ? 695  ASN A C   1 
ATOM   5002 O O   . ASN A 1 651 ? -16.279 68.612  11.463  1.00 33.33 ? 695  ASN A O   1 
ATOM   5003 C CB  . ASN A 1 651 ? -14.223 68.554  9.479   1.00 35.67 ? 695  ASN A CB  1 
ATOM   5004 C CG  . ASN A 1 651 ? -13.570 69.932  9.545   1.00 38.90 ? 695  ASN A CG  1 
ATOM   5005 O OD1 . ASN A 1 651 ? -14.241 70.964  9.405   1.00 42.16 ? 695  ASN A OD1 1 
ATOM   5006 N ND2 . ASN A 1 651 ? -12.250 69.953  9.764   1.00 43.09 ? 695  ASN A ND2 1 
ATOM   5007 N N   . PRO A 1 652 ? -14.774 68.380  13.120  1.00 35.81 ? 696  PRO A N   1 
ATOM   5008 C CA  . PRO A 1 652 ? -15.755 68.678  14.176  1.00 37.08 ? 696  PRO A CA  1 
ATOM   5009 C C   . PRO A 1 652 ? -16.519 69.970  13.873  1.00 37.93 ? 696  PRO A C   1 
ATOM   5010 O O   . PRO A 1 652 ? -15.910 70.985  13.516  1.00 38.09 ? 696  PRO A O   1 
ATOM   5011 C CB  . PRO A 1 652 ? -14.887 68.833  15.423  1.00 37.22 ? 696  PRO A CB  1 
ATOM   5012 C CG  . PRO A 1 652 ? -13.510 69.031  14.913  1.00 36.86 ? 696  PRO A CG  1 
ATOM   5013 C CD  . PRO A 1 652 ? -13.421 68.245  13.672  1.00 35.67 ? 696  PRO A CD  1 
ATOM   5014 N N   . VAL A 1 653 ? -17.840 69.926  13.975  1.00 39.32 ? 697  VAL A N   1 
ATOM   5015 C CA  . VAL A 1 653 ? -18.639 71.059  13.511  1.00 40.58 ? 697  VAL A CA  1 
ATOM   5016 C C   . VAL A 1 653 ? -19.489 71.695  14.631  1.00 40.38 ? 697  VAL A C   1 
ATOM   5017 O O   . VAL A 1 653 ? -20.227 72.655  14.398  1.00 40.49 ? 697  VAL A O   1 
ATOM   5018 C CB  . VAL A 1 653 ? -19.438 70.729  12.190  1.00 41.01 ? 697  VAL A CB  1 
ATOM   5019 C CG1 . VAL A 1 653 ? -20.889 70.270  12.469  1.00 41.84 ? 697  VAL A CG1 1 
ATOM   5020 C CG2 . VAL A 1 653 ? -19.416 71.920  11.218  1.00 41.55 ? 697  VAL A CG2 1 
ATOM   5021 N N   . ARG A 1 654 ? -19.366 71.154  15.840  1.00 40.25 ? 698  ARG A N   1 
ATOM   5022 C CA  . ARG A 1 654 ? -19.880 71.820  17.022  1.00 40.41 ? 698  ARG A CA  1 
ATOM   5023 C C   . ARG A 1 654 ? -19.528 73.302  16.932  1.00 40.01 ? 698  ARG A C   1 
ATOM   5024 O O   . ARG A 1 654 ? -18.434 73.671  16.483  1.00 38.27 ? 698  ARG A O   1 
ATOM   5025 C CB  . ARG A 1 654 ? -19.254 71.226  18.279  1.00 40.77 ? 698  ARG A CB  1 
ATOM   5026 C CG  . ARG A 1 654 ? -19.830 71.776  19.601  1.00 43.15 ? 698  ARG A CG  1 
ATOM   5027 C CD  . ARG A 1 654 ? -19.214 71.017  20.751  1.00 45.34 ? 698  ARG A CD  1 
ATOM   5028 N NE  . ARG A 1 654 ? -19.122 69.575  20.416  1.00 45.15 ? 698  ARG A NE  1 
ATOM   5029 C CZ  . ARG A 1 654 ? -18.329 68.726  21.088  1.00 44.52 ? 698  ARG A CZ  1 
ATOM   5030 N NH1 . ARG A 1 654 ? -17.524 69.176  22.147  1.00 41.58 ? 698  ARG A NH1 1 
ATOM   5031 N NH2 . ARG A 1 654 ? -18.338 67.431  20.695  1.00 46.13 ? 698  ARG A NH2 1 
ATOM   5032 N N   . GLU A 1 655 ? -20.455 74.156  17.352  1.00 40.49 ? 699  GLU A N   1 
ATOM   5033 C CA  . GLU A 1 655 ? -20.167 75.575  17.303  1.00 41.65 ? 699  GLU A CA  1 
ATOM   5034 C C   . GLU A 1 655 ? -19.290 76.040  18.461  1.00 41.18 ? 699  GLU A C   1 
ATOM   5035 O O   . GLU A 1 655 ? -19.387 75.527  19.570  1.00 40.92 ? 699  GLU A O   1 
ATOM   5036 C CB  . GLU A 1 655 ? -21.431 76.431  17.125  1.00 42.24 ? 699  GLU A CB  1 
ATOM   5037 C CG  . GLU A 1 655 ? -21.154 77.884  16.623  1.00 46.22 ? 699  GLU A CG  1 
ATOM   5038 C CD  . GLU A 1 655 ? -19.966 78.045  15.607  1.00 50.81 ? 699  GLU A CD  1 
ATOM   5039 O OE1 . GLU A 1 655 ? -19.445 77.045  15.035  1.00 51.53 ? 699  GLU A OE1 1 
ATOM   5040 O OE2 . GLU A 1 655 ? -19.544 79.213  15.392  1.00 53.13 ? 699  GLU A OE2 1 
ATOM   5041 N N   . VAL A 1 656 ? -18.392 76.967  18.122  1.00 41.65 ? 700  VAL A N   1 
ATOM   5042 C CA  . VAL A 1 656 ? -17.525 77.732  19.038  1.00 42.32 ? 700  VAL A CA  1 
ATOM   5043 C C   . VAL A 1 656 ? -18.294 78.566  20.070  1.00 42.44 ? 700  VAL A C   1 
ATOM   5044 O O   . VAL A 1 656 ? -19.260 79.216  19.726  1.00 42.50 ? 700  VAL A O   1 
ATOM   5045 C CB  . VAL A 1 656 ? -16.505 78.655  18.237  1.00 42.36 ? 700  VAL A CB  1 
ATOM   5046 C CG1 . VAL A 1 656 ? -16.679 78.521  16.728  1.00 41.38 ? 700  VAL A CG1 1 
ATOM   5047 C CG2 . VAL A 1 656 ? -16.607 80.118  18.652  1.00 42.38 ? 700  VAL A CG2 1 
ATOM   5048 N N   . LYS A 1 657 ? -17.847 78.520  21.327  1.00 42.68 ? 701  LYS A N   1 
ATOM   5049 C CA  . LYS A 1 657 ? -18.407 79.331  22.416  1.00 43.52 ? 701  LYS A CA  1 
ATOM   5050 C C   . LYS A 1 657 ? -17.299 79.950  23.277  1.00 43.18 ? 701  LYS A C   1 
ATOM   5051 O O   . LYS A 1 657 ? -16.208 79.385  23.407  1.00 42.31 ? 701  LYS A O   1 
ATOM   5052 C CB  . LYS A 1 657 ? -19.336 78.483  23.296  1.00 43.26 ? 701  LYS A CB  1 
ATOM   5053 C CG  . LYS A 1 657 ? -18.618 77.538  24.285  1.00 44.25 ? 701  LYS A CG  1 
ATOM   5054 C CD  . LYS A 1 657 ? -19.588 76.622  25.036  1.00 44.73 ? 701  LYS A CD  1 
ATOM   5055 C CE  . LYS A 1 657 ? -20.595 77.409  25.891  1.00 47.62 ? 701  LYS A CE  1 
ATOM   5056 N NZ  . LYS A 1 657 ? -21.843 76.622  26.127  1.00 49.77 ? 701  LYS A NZ  1 
ATOM   5057 N N   . ASP A 1 658 ? -17.580 81.098  23.891  1.00 43.86 ? 702  ASP A N   1 
ATOM   5058 C CA  . ASP A 1 658 ? -16.613 81.670  24.834  1.00 43.98 ? 702  ASP A CA  1 
ATOM   5059 C C   . ASP A 1 658 ? -16.732 80.990  26.207  1.00 43.37 ? 702  ASP A C   1 
ATOM   5060 O O   . ASP A 1 658 ? -17.772 81.052  26.878  1.00 43.05 ? 702  ASP A O   1 
ATOM   5061 C CB  . ASP A 1 658 ? -16.747 83.191  24.931  1.00 44.99 ? 702  ASP A CB  1 
ATOM   5062 C CG  . ASP A 1 658 ? -18.081 83.620  25.500  1.00 47.80 ? 702  ASP A CG  1 
ATOM   5063 O OD1 . ASP A 1 658 ? -19.087 82.973  25.132  1.00 52.49 ? 702  ASP A OD1 1 
ATOM   5064 O OD2 . ASP A 1 658 ? -18.138 84.589  26.304  1.00 50.74 ? 702  ASP A OD2 1 
ATOM   5065 N N   . LEU A 1 659 ? -15.669 80.318  26.624  1.00 42.18 ? 703  LEU A N   1 
ATOM   5066 C CA  . LEU A 1 659 ? -15.687 79.696  27.932  1.00 41.73 ? 703  LEU A CA  1 
ATOM   5067 C C   . LEU A 1 659 ? -15.420 80.719  29.031  1.00 40.89 ? 703  LEU A C   1 
ATOM   5068 O O   . LEU A 1 659 ? -15.656 80.437  30.198  1.00 41.18 ? 703  LEU A O   1 
ATOM   5069 C CB  . LEU A 1 659 ? -14.689 78.553  28.014  1.00 42.27 ? 703  LEU A CB  1 
ATOM   5070 C CG  . LEU A 1 659 ? -14.930 77.367  27.078  1.00 43.73 ? 703  LEU A CG  1 
ATOM   5071 C CD1 . LEU A 1 659 ? -13.670 76.553  27.014  1.00 46.55 ? 703  LEU A CD1 1 
ATOM   5072 C CD2 . LEU A 1 659 ? -16.117 76.505  27.514  1.00 44.80 ? 703  LEU A CD2 1 
ATOM   5073 N N   . LYS A 1 660 ? -14.939 81.899  28.644  1.00 39.40 ? 704  LYS A N   1 
ATOM   5074 C CA  . LYS A 1 660 ? -14.672 82.977  29.575  1.00 38.87 ? 704  LYS A CA  1 
ATOM   5075 C C   . LYS A 1 660 ? -15.917 83.217  30.451  1.00 38.42 ? 704  LYS A C   1 
ATOM   5076 O O   . LYS A 1 660 ? -15.838 83.187  31.681  1.00 37.28 ? 704  LYS A O   1 
ATOM   5077 C CB  . LYS A 1 660 ? -14.274 84.244  28.814  1.00 38.88 ? 704  LYS A CB  1 
ATOM   5078 C CG  . LYS A 1 660 ? -13.964 85.458  29.700  1.00 40.55 ? 704  LYS A CG  1 
ATOM   5079 C CD  . LYS A 1 660 ? -12.474 85.680  29.985  1.00 41.75 ? 704  LYS A CD  1 
ATOM   5080 C CE  . LYS A 1 660 ? -12.280 86.676  31.145  1.00 41.50 ? 704  LYS A CE  1 
ATOM   5081 N NZ  . LYS A 1 660 ? -10.848 86.995  31.357  1.00 46.27 ? 704  LYS A NZ  1 
ATOM   5082 N N   . LYS A 1 661 ? -17.052 83.430  29.786  1.00 38.67 ? 705  LYS A N   1 
ATOM   5083 C CA  . LYS A 1 661 ? -18.374 83.550  30.403  1.00 39.08 ? 705  LYS A CA  1 
ATOM   5084 C C   . LYS A 1 661 ? -18.700 82.429  31.377  1.00 39.41 ? 705  LYS A C   1 
ATOM   5085 O O   . LYS A 1 661 ? -19.378 82.663  32.380  1.00 39.75 ? 705  LYS A O   1 
ATOM   5086 C CB  . LYS A 1 661 ? -19.455 83.619  29.319  1.00 39.29 ? 705  LYS A CB  1 
ATOM   5087 C CG  . LYS A 1 661 ? -19.827 85.033  28.951  1.00 40.11 ? 705  LYS A CG  1 
ATOM   5088 C CD  . LYS A 1 661 ? -21.049 85.542  29.731  1.00 41.72 ? 705  LYS A CD  1 
ATOM   5089 C CE  . LYS A 1 661 ? -22.321 85.563  28.840  1.00 41.28 ? 705  LYS A CE  1 
ATOM   5090 N NZ  . LYS A 1 661 ? -23.257 86.662  29.245  1.00 39.37 ? 705  LYS A NZ  1 
ATOM   5091 N N   . LYS A 1 662 ? -18.224 81.221  31.098  1.00 39.36 ? 706  LYS A N   1 
ATOM   5092 C CA  . LYS A 1 662 ? -18.526 80.074  31.958  1.00 40.14 ? 706  LYS A CA  1 
ATOM   5093 C C   . LYS A 1 662 ? -17.948 80.211  33.377  1.00 39.32 ? 706  LYS A C   1 
ATOM   5094 O O   . LYS A 1 662 ? -18.704 80.095  34.357  1.00 39.37 ? 706  LYS A O   1 
ATOM   5095 C CB  . LYS A 1 662 ? -18.116 78.733  31.307  1.00 40.25 ? 706  LYS A CB  1 
ATOM   5096 C CG  . LYS A 1 662 ? -16.855 78.085  31.897  1.00 41.36 ? 706  LYS A CG  1 
ATOM   5097 C CD  . LYS A 1 662 ? -16.434 76.799  31.186  1.00 42.35 ? 706  LYS A CD  1 
ATOM   5098 C CE  . LYS A 1 662 ? -17.112 75.534  31.741  1.00 46.85 ? 706  LYS A CE  1 
ATOM   5099 N NZ  . LYS A 1 662 ? -16.414 74.303  31.215  1.00 50.81 ? 706  LYS A NZ  1 
ATOM   5100 N N   . CYS A 1 663 ? -16.634 80.468  33.486  1.00 38.02 ? 707  CYS A N   1 
ATOM   5101 C CA  . CYS A 1 663 ? -15.962 80.580  34.793  1.00 36.96 ? 707  CYS A CA  1 
ATOM   5102 C C   . CYS A 1 663 ? -16.193 81.882  35.520  1.00 34.25 ? 707  CYS A C   1 
ATOM   5103 O O   . CYS A 1 663 ? -16.474 81.892  36.728  1.00 34.38 ? 707  CYS A O   1 
ATOM   5104 C CB  . CYS A 1 663 ? -14.473 80.403  34.639  1.00 38.11 ? 707  CYS A CB  1 
ATOM   5105 S SG  . CYS A 1 663 ? -14.123 79.334  33.227  1.00 47.08 ? 707  CYS A SG  1 
ATOM   5106 N N   . THR A 1 664 ? -16.050 82.988  34.794  1.00 30.53 ? 708  THR A N   1 
ATOM   5107 C CA  . THR A 1 664 ? -16.162 84.314  35.391  1.00 25.78 ? 708  THR A CA  1 
ATOM   5108 C C   . THR A 1 664 ? -17.598 84.587  35.789  1.00 24.82 ? 708  THR A C   1 
ATOM   5109 O O   . THR A 1 664 ? -17.903 85.605  36.434  1.00 24.31 ? 708  THR A O   1 
ATOM   5110 C CB  . THR A 1 664 ? -15.654 85.407  34.444  1.00 25.73 ? 708  THR A CB  1 
ATOM   5111 O OG1 . THR A 1 664 ? -16.541 85.536  33.338  1.00 23.43 ? 708  THR A OG1 1 
ATOM   5112 C CG2 . THR A 1 664 ? -14.261 85.098  33.930  1.00 24.75 ? 708  THR A CG2 1 
ATOM   5113 N N   . SER A 1 665 ? -18.489 83.695  35.359  1.00 21.50 ? 709  SER A N   1 
ATOM   5114 C CA  . SER A 1 665 ? -19.889 83.677  35.788  1.00 20.43 ? 709  SER A CA  1 
ATOM   5115 C C   . SER A 1 665 ? -20.073 83.586  37.334  1.00 17.78 ? 709  SER A C   1 
ATOM   5116 O O   . SER A 1 665 ? -21.076 84.017  37.875  1.00 16.68 ? 709  SER A O   1 
ATOM   5117 C CB  . SER A 1 665 ? -20.530 82.454  35.125  1.00 19.88 ? 709  SER A CB  1 
ATOM   5118 O OG  . SER A 1 665 ? -21.835 82.282  35.589  1.00 24.20 ? 709  SER A OG  1 
ATOM   5119 N N   . ASN A 1 666 ? -19.125 82.945  38.015  1.00 16.37 ? 710  ASN A N   1 
ATOM   5120 C CA  . ASN A 1 666 ? -19.231 82.732  39.477  1.00 16.45 ? 710  ASN A CA  1 
ATOM   5121 C C   . ASN A 1 666 ? -18.736 83.953  40.279  1.00 14.71 ? 710  ASN A C   1 
ATOM   5122 O O   . ASN A 1 666 ? -18.981 84.064  41.457  1.00 12.69 ? 710  ASN A O   1 
ATOM   5123 C CB  . ASN A 1 666 ? -18.392 81.518  39.884  1.00 16.46 ? 710  ASN A CB  1 
ATOM   5124 C CG  . ASN A 1 666 ? -18.698 80.272  39.049  1.00 19.99 ? 710  ASN A CG  1 
ATOM   5125 O OD1 . ASN A 1 666 ? -19.740 79.633  39.230  1.00 24.26 ? 710  ASN A OD1 1 
ATOM   5126 N ND2 . ASN A 1 666 ? -17.795 79.923  38.163  1.00 17.32 ? 710  ASN A ND2 1 
ATOM   5127 N N   . PHE A 1 667 ? -17.983 84.827  39.611  1.00 14.20 ? 711  PHE A N   1 
ATOM   5128 C CA  . PHE A 1 667 ? -17.267 85.932  40.258  1.00 14.17 ? 711  PHE A CA  1 
ATOM   5129 C C   . PHE A 1 667 ? -18.107 87.215  40.209  1.00 13.23 ? 711  PHE A C   1 
ATOM   5130 O O   . PHE A 1 667 ? -18.723 87.539  39.194  1.00 13.64 ? 711  PHE A O   1 
ATOM   5131 C CB  . PHE A 1 667 ? -15.920 86.129  39.542  1.00 14.04 ? 711  PHE A CB  1 
ATOM   5132 C CG  . PHE A 1 667 ? -14.960 84.957  39.680  1.00 13.88 ? 711  PHE A CG  1 
ATOM   5133 C CD1 . PHE A 1 667 ? -13.855 85.025  40.570  1.00 17.44 ? 711  PHE A CD1 1 
ATOM   5134 C CD2 . PHE A 1 667 ? -15.140 83.788  38.957  1.00 14.86 ? 711  PHE A CD2 1 
ATOM   5135 C CE1 . PHE A 1 667 ? -12.918 83.934  40.699  1.00 16.91 ? 711  PHE A CE1 1 
ATOM   5136 C CE2 . PHE A 1 667 ? -14.244 82.677  39.093  1.00 12.58 ? 711  PHE A CE2 1 
ATOM   5137 C CZ  . PHE A 1 667 ? -13.127 82.755  39.955  1.00 15.69 ? 711  PHE A CZ  1 
ATOM   5138 N N   . LEU A 1 668 ? -18.136 87.962  41.280  1.00 12.22 ? 712  LEU A N   1 
ATOM   5139 C CA  . LEU A 1 668 ? -18.703 89.310  41.221  1.00 11.88 ? 712  LEU A CA  1 
ATOM   5140 C C   . LEU A 1 668 ? -17.751 90.183  40.379  1.00 14.19 ? 712  LEU A C   1 
ATOM   5141 O O   . LEU A 1 668 ? -16.539 90.178  40.593  1.00 13.48 ? 712  LEU A O   1 
ATOM   5142 C CB  . LEU A 1 668 ? -18.935 89.877  42.614  1.00 11.16 ? 712  LEU A CB  1 
ATOM   5143 C CG  . LEU A 1 668 ? -19.274 91.363  42.678  1.00 9.33  ? 712  LEU A CG  1 
ATOM   5144 C CD1 . LEU A 1 668 ? -20.572 91.704  41.913  1.00 13.51 ? 712  LEU A CD1 1 
ATOM   5145 C CD2 . LEU A 1 668 ? -19.250 91.958  44.134  1.00 10.07 ? 712  LEU A CD2 1 
ATOM   5146 N N   . SER A 1 669 ? -18.261 90.861  39.342  1.00 16.28 ? 713  SER A N   1 
ATOM   5147 C CA  . SER A 1 669 ? -17.315 91.633  38.515  1.00 17.87 ? 713  SER A CA  1 
ATOM   5148 C C   . SER A 1 669 ? -17.285 93.076  39.026  1.00 17.67 ? 713  SER A C   1 
ATOM   5149 O O   . SER A 1 669 ? -18.267 93.571  39.565  1.00 16.32 ? 713  SER A O   1 
ATOM   5150 C CB  . SER A 1 669 ? -17.603 91.509  36.997  1.00 18.17 ? 713  SER A CB  1 
ATOM   5151 O OG  . SER A 1 669 ? -18.720 92.303  36.664  1.00 23.94 ? 713  SER A OG  1 
ATOM   5152 N N   . PRO A 1 670 ? -16.133 93.748  38.917  1.00 19.04 ? 714  PRO A N   1 
ATOM   5153 C CA  . PRO A 1 670 ? -16.081 95.144  39.319  1.00 20.40 ? 714  PRO A CA  1 
ATOM   5154 C C   . PRO A 1 670 ? -16.644 95.966  38.173  1.00 22.39 ? 714  PRO A C   1 
ATOM   5155 O O   . PRO A 1 670 ? -16.941 95.409  37.133  1.00 21.51 ? 714  PRO A O   1 
ATOM   5156 C CB  . PRO A 1 670 ? -14.598 95.403  39.475  1.00 20.79 ? 714  PRO A CB  1 
ATOM   5157 C CG  . PRO A 1 670 ? -13.966 94.476  38.406  1.00 20.75 ? 714  PRO A CG  1 
ATOM   5158 C CD  . PRO A 1 670 ? -14.844 93.259  38.380  1.00 20.19 ? 714  PRO A CD  1 
ATOM   5159 N N   . GLU A 1 671 ? -16.810 97.264  38.363  1.00 25.14 ? 715  GLU A N   1 
ATOM   5160 C CA  . GLU A 1 671 ? -17.401 98.066  37.314  1.00 28.89 ? 715  GLU A CA  1 
ATOM   5161 C C   . GLU A 1 671 ? -16.501 98.175  36.079  1.00 30.20 ? 715  GLU A C   1 
ATOM   5162 O O   . GLU A 1 671 ? -15.272 98.128  36.172  1.00 29.83 ? 715  GLU A O   1 
ATOM   5163 C CB  . GLU A 1 671 ? -17.892 99.402  37.851  1.00 28.79 ? 715  GLU A CB  1 
ATOM   5164 C CG  . GLU A 1 671 ? -19.287 99.270  38.548  1.00 30.86 ? 715  GLU A CG  1 
ATOM   5165 C CD  . GLU A 1 671 ? -19.875 100.612 39.014  1.00 32.29 ? 715  GLU A CD  1 
ATOM   5166 O OE1 . GLU A 1 671 ? -19.412 101.680 38.524  1.00 40.11 ? 715  GLU A OE1 1 
ATOM   5167 O OE2 . GLU A 1 671 ? -20.805 100.620 39.864  1.00 35.90 ? 715  GLU A OE2 1 
ATOM   5168 N N   . LYS A 1 672 ? -17.125 98.237  34.906  1.00 32.41 ? 716  LYS A N   1 
ATOM   5169 C CA  . LYS A 1 672 ? -16.373 98.322  33.661  1.00 34.06 ? 716  LYS A CA  1 
ATOM   5170 C C   . LYS A 1 672 ? -16.084 99.779  33.340  1.00 35.03 ? 716  LYS A C   1 
ATOM   5171 O O   . LYS A 1 672 ? -15.163 100.054 32.551  1.00 36.42 ? 716  LYS A O   1 
ATOM   5172 C CB  . LYS A 1 672 ? -17.116 97.649  32.496  1.00 34.42 ? 716  LYS A CB  1 
ATOM   5173 C CG  . LYS A 1 672 ? -18.652 97.637  32.607  1.00 35.55 ? 716  LYS A CG  1 
ATOM   5174 C CD  . LYS A 1 672 ? -19.166 96.497  33.513  1.00 35.91 ? 716  LYS A CD  1 
ATOM   5175 C CE  . LYS A 1 672 ? -18.362 95.201  33.348  1.00 34.36 ? 716  LYS A CE  1 
ATOM   5176 N NZ  . LYS A 1 672 ? -19.003 94.171  32.517  1.00 33.40 ? 716  LYS A NZ  1 
ATOM   5177 N N   . PRO B 2 10  ? 18.293  71.115  26.734  1.00 62.25 ? 10   PRO N N   1 
ATOM   5178 C CA  . PRO B 2 10  ? 17.249  71.749  27.556  1.00 61.60 ? 10   PRO N CA  1 
ATOM   5179 C C   . PRO B 2 10  ? 17.667  73.110  28.120  1.00 61.18 ? 10   PRO N C   1 
ATOM   5180 O O   . PRO B 2 10  ? 18.854  73.385  28.254  1.00 61.93 ? 10   PRO N O   1 
ATOM   5181 C CB  . PRO B 2 10  ? 17.008  70.722  28.666  1.00 62.04 ? 10   PRO N CB  1 
ATOM   5182 C CG  . PRO B 2 10  ? 17.302  69.386  28.000  1.00 62.43 ? 10   PRO N CG  1 
ATOM   5183 C CD  . PRO B 2 10  ? 18.342  69.649  26.913  1.00 61.79 ? 10   PRO N CD  1 
ATOM   5184 N N   . TYR B 2 11  ? 16.669  73.917  28.476  1.00 60.03 ? 11   TYR N N   1 
ATOM   5185 C CA  . TYR B 2 11  ? 16.723  75.374  28.622  1.00 58.62 ? 11   TYR N CA  1 
ATOM   5186 C C   . TYR B 2 11  ? 15.856  75.705  29.825  1.00 56.96 ? 11   TYR N C   1 
ATOM   5187 O O   . TYR B 2 11  ? 14.639  75.593  29.731  1.00 54.60 ? 11   TYR N O   1 
ATOM   5188 C CB  . TYR B 2 11  ? 15.923  75.933  27.472  1.00 60.02 ? 11   TYR N CB  1 
ATOM   5189 C CG  . TYR B 2 11  ? 16.403  77.136  26.770  1.00 61.42 ? 11   TYR N CG  1 
ATOM   5190 C CD1 . TYR B 2 11  ? 16.990  78.202  27.445  1.00 63.28 ? 11   TYR N CD1 1 
ATOM   5191 C CD2 . TYR B 2 11  ? 16.213  77.230  25.397  1.00 63.03 ? 11   TYR N CD2 1 
ATOM   5192 C CE1 . TYR B 2 11  ? 17.422  79.333  26.740  1.00 63.08 ? 11   TYR N CE1 1 
ATOM   5193 C CE2 . TYR B 2 11  ? 16.625  78.335  24.693  1.00 63.91 ? 11   TYR N CE2 1 
ATOM   5194 C CZ  . TYR B 2 11  ? 17.228  79.393  25.353  1.00 62.76 ? 11   TYR N CZ  1 
ATOM   5195 O OH  . TYR B 2 11  ? 17.625  80.484  24.584  1.00 61.08 ? 11   TYR N OH  1 
ATOM   5196 N N   . ILE B 2 12  ? 16.461  76.137  30.926  1.00 55.40 ? 12   ILE N N   1 
ATOM   5197 C CA  . ILE B 2 12  ? 15.749  76.290  32.195  1.00 53.88 ? 12   ILE N CA  1 
ATOM   5198 C C   . ILE B 2 12  ? 15.098  77.659  32.342  1.00 53.48 ? 12   ILE N C   1 
ATOM   5199 O O   . ILE B 2 12  ? 15.656  78.676  31.944  1.00 54.19 ? 12   ILE N O   1 
ATOM   5200 C CB  . ILE B 2 12  ? 16.712  76.054  33.366  1.00 53.93 ? 12   ILE N CB  1 
ATOM   5201 C CG1 . ILE B 2 12  ? 17.504  74.758  33.139  1.00 51.92 ? 12   ILE N CG1 1 
ATOM   5202 C CG2 . ILE B 2 12  ? 15.984  76.074  34.700  1.00 53.11 ? 12   ILE N CG2 1 
ATOM   5203 C CD1 . ILE B 2 12  ? 16.696  73.500  33.124  1.00 50.97 ? 12   ILE N CD1 1 
ATOM   5204 N N   . LEU B 2 13  ? 13.918  77.668  32.930  1.00 52.60 ? 13   LEU N N   1 
ATOM   5205 C CA  . LEU B 2 13  ? 13.175  78.894  33.208  1.00 51.71 ? 13   LEU N CA  1 
ATOM   5206 C C   . LEU B 2 13  ? 12.558  78.861  34.635  1.00 51.36 ? 13   LEU N C   1 
ATOM   5207 O O   . LEU B 2 13  ? 12.028  79.887  35.130  1.00 50.70 ? 13   LEU N O   1 
ATOM   5208 C CB  . LEU B 2 13  ? 12.050  79.064  32.172  1.00 52.27 ? 13   LEU N CB  1 
ATOM   5209 C CG  . LEU B 2 13  ? 12.291  79.057  30.650  1.00 53.15 ? 13   LEU N CG  1 
ATOM   5210 C CD1 . LEU B 2 13  ? 11.045  78.548  29.898  1.00 53.09 ? 13   LEU N CD1 1 
ATOM   5211 C CD2 . LEU B 2 13  ? 12.699  80.437  30.162  1.00 52.44 ? 13   LEU N CD2 1 
ATOM   5212 O OXT . LEU B 2 13  ? 12.557  77.806  35.316  1.00 50.18 ? 13   LEU N OXT 1 
HETATM 5213 C C1  . NAG C 3 .   ? 13.260  65.868  16.618  1.00 27.76 ? 801  NAG A C1  1 
HETATM 5214 C C2  . NAG C 3 .   ? 12.700  67.326  16.605  1.00 24.61 ? 801  NAG A C2  1 
HETATM 5215 C C3  . NAG C 3 .   ? 12.400  67.672  15.103  1.00 30.19 ? 801  NAG A C3  1 
HETATM 5216 C C4  . NAG C 3 .   ? 13.537  67.376  14.110  1.00 28.50 ? 801  NAG A C4  1 
HETATM 5217 C C5  . NAG C 3 .   ? 13.913  65.881  14.297  1.00 26.41 ? 801  NAG A C5  1 
HETATM 5218 C C6  . NAG C 3 .   ? 15.099  65.458  13.444  1.00 30.88 ? 801  NAG A C6  1 
HETATM 5219 C C7  . NAG C 3 .   ? 11.437  68.673  18.159  1.00 29.76 ? 801  NAG A C7  1 
HETATM 5220 C C8  . NAG C 3 .   ? 10.298  68.918  19.083  1.00 28.60 ? 801  NAG A C8  1 
HETATM 5221 N N2  . NAG C 3 .   ? 11.489  67.551  17.461  1.00 26.11 ? 801  NAG A N2  1 
HETATM 5222 O O3  . NAG C 3 .   ? 11.905  68.978  14.966  1.00 24.86 ? 801  NAG A O3  1 
HETATM 5223 O O4  . NAG C 3 .   ? 13.035  67.602  12.807  1.00 32.29 ? 801  NAG A O4  1 
HETATM 5224 O O5  . NAG C 3 .   ? 14.340  65.829  15.648  1.00 26.64 ? 801  NAG A O5  1 
HETATM 5225 O O6  . NAG C 3 .   ? 16.114  66.441  13.680  1.00 29.64 ? 801  NAG A O6  1 
HETATM 5226 O O7  . NAG C 3 .   ? 12.333  69.529  18.059  1.00 29.20 ? 801  NAG A O7  1 
HETATM 5227 C C1  . NAG D 3 .   ? 13.797  68.603  12.095  1.00 41.36 ? 802  NAG A C1  1 
HETATM 5228 C C2  . NAG D 3 .   ? 13.534  68.402  10.600  1.00 44.91 ? 802  NAG A C2  1 
HETATM 5229 C C3  . NAG D 3 .   ? 14.001  69.579  9.719   1.00 48.62 ? 802  NAG A C3  1 
HETATM 5230 C C4  . NAG D 3 .   ? 13.530  70.908  10.306  1.00 51.84 ? 802  NAG A C4  1 
HETATM 5231 C C5  . NAG D 3 .   ? 13.869  71.001  11.805  1.00 53.22 ? 802  NAG A C5  1 
HETATM 5232 C C6  . NAG D 3 .   ? 13.376  72.326  12.424  1.00 56.17 ? 802  NAG A C6  1 
HETATM 5233 C C7  . NAG D 3 .   ? 13.579  66.157  9.774   1.00 47.32 ? 802  NAG A C7  1 
HETATM 5234 C C8  . NAG D 3 .   ? 14.394  64.996  9.279   1.00 44.28 ? 802  NAG A C8  1 
HETATM 5235 N N2  . NAG D 3 .   ? 14.243  67.242  10.151  1.00 45.83 ? 802  NAG A N2  1 
HETATM 5236 O O3  . NAG D 3 .   ? 13.464  69.424  8.425   1.00 46.74 ? 802  NAG A O3  1 
HETATM 5237 O O4  . NAG D 3 .   ? 14.151  71.976  9.592   1.00 60.82 ? 802  NAG A O4  1 
HETATM 5238 O O5  . NAG D 3 .   ? 13.392  69.877  12.568  1.00 48.13 ? 802  NAG A O5  1 
HETATM 5239 O O6  . NAG D 3 .   ? 11.963  72.508  12.521  1.00 59.53 ? 802  NAG A O6  1 
HETATM 5240 O O7  . NAG D 3 .   ? 12.353  66.107  9.823   1.00 46.86 ? 802  NAG A O7  1 
HETATM 5241 C C1  . NAG E 3 .   ? 37.617  61.513  4.476   1.00 30.99 ? 901  NAG A C1  1 
HETATM 5242 C C2  . NAG E 3 .   ? 36.528  62.246  3.644   1.00 30.32 ? 901  NAG A C2  1 
HETATM 5243 C C3  . NAG E 3 .   ? 37.089  62.695  2.271   1.00 33.62 ? 901  NAG A C3  1 
HETATM 5244 C C4  . NAG E 3 .   ? 38.345  63.498  2.419   1.00 38.60 ? 901  NAG A C4  1 
HETATM 5245 C C5  . NAG E 3 .   ? 39.341  62.686  3.251   1.00 36.73 ? 901  NAG A C5  1 
HETATM 5246 C C6  . NAG E 3 .   ? 40.591  63.545  3.436   1.00 35.50 ? 901  NAG A C6  1 
HETATM 5247 C C7  . NAG E 3 .   ? 34.234  61.629  3.387   1.00 28.55 ? 901  NAG A C7  1 
HETATM 5248 C C8  . NAG E 3 .   ? 33.320  60.715  2.655   1.00 25.02 ? 901  NAG A C8  1 
HETATM 5249 N N2  . NAG E 3 .   ? 35.522  61.326  3.275   1.00 26.31 ? 901  NAG A N2  1 
HETATM 5250 O O3  . NAG E 3 .   ? 36.117  63.465  1.615   1.00 32.53 ? 901  NAG A O3  1 
HETATM 5251 O O4  . NAG E 3 .   ? 38.979  63.777  1.173   1.00 46.48 ? 901  NAG A O4  1 
HETATM 5252 O O5  . NAG E 3 .   ? 38.775  62.356  4.501   1.00 30.61 ? 901  NAG A O5  1 
HETATM 5253 O O6  . NAG E 3 .   ? 41.567  62.729  4.016   1.00 36.96 ? 901  NAG A O6  1 
HETATM 5254 O O7  . NAG E 3 .   ? 33.861  62.634  3.977   1.00 28.94 ? 901  NAG A O7  1 
HETATM 5255 C C1  . NAG F 3 .   ? 38.548  64.999  0.537   1.00 52.79 ? 902  NAG A C1  1 
HETATM 5256 C C2  . NAG F 3 .   ? 39.770  65.726  -0.081  1.00 57.87 ? 902  NAG A C2  1 
HETATM 5257 C C3  . NAG F 3 .   ? 39.370  66.869  -1.036  1.00 62.10 ? 902  NAG A C3  1 
HETATM 5258 C C4  . NAG F 3 .   ? 38.076  66.679  -1.829  1.00 64.02 ? 902  NAG A C4  1 
HETATM 5259 C C5  . NAG F 3 .   ? 37.035  65.820  -1.070  1.00 61.05 ? 902  NAG A C5  1 
HETATM 5260 C C6  . NAG F 3 .   ? 35.879  65.429  -1.991  1.00 59.86 ? 902  NAG A C6  1 
HETATM 5261 C C7  . NAG F 3 .   ? 42.014  65.827  0.943   1.00 56.95 ? 902  NAG A C7  1 
HETATM 5262 C C8  . NAG F 3 .   ? 42.914  66.467  1.957   1.00 58.31 ? 902  NAG A C8  1 
HETATM 5263 N N2  . NAG F 3 .   ? 40.753  66.254  0.904   1.00 56.21 ? 902  NAG A N2  1 
HETATM 5264 O O3  . NAG F 3 .   ? 40.433  67.080  -1.941  1.00 62.70 ? 902  NAG A O3  1 
HETATM 5265 O O4  . NAG F 3 .   ? 37.541  67.983  -2.064  1.00 72.98 ? 902  NAG A O4  1 
HETATM 5266 O O5  . NAG F 3 .   ? 37.600  64.654  -0.448  1.00 53.18 ? 902  NAG A O5  1 
HETATM 5267 O O6  . NAG F 3 .   ? 36.199  64.176  -2.553  1.00 61.77 ? 902  NAG A O6  1 
HETATM 5268 O O7  . NAG F 3 .   ? 42.462  64.937  0.201   1.00 56.42 ? 902  NAG A O7  1 
HETATM 5269 C C1  . BMA G 4 .   ? 37.698  68.489  -3.433  1.00 79.19 ? 903  BMA A C1  1 
HETATM 5270 C C2  . BMA G 4 .   ? 36.503  69.351  -3.854  1.00 80.57 ? 903  BMA A C2  1 
HETATM 5271 C C3  . BMA G 4 .   ? 36.654  69.824  -5.315  1.00 83.13 ? 903  BMA A C3  1 
HETATM 5272 C C4  . BMA G 4 .   ? 38.014  70.490  -5.546  1.00 83.77 ? 903  BMA A C4  1 
HETATM 5273 C C5  . BMA G 4 .   ? 39.147  69.610  -4.996  1.00 83.53 ? 903  BMA A C5  1 
HETATM 5274 C C6  . BMA G 4 .   ? 40.498  70.328  -5.099  1.00 84.83 ? 903  BMA A C6  1 
HETATM 5275 O O2  . BMA G 4 .   ? 36.411  70.459  -2.984  1.00 79.93 ? 903  BMA A O2  1 
HETATM 5276 O O3  . BMA G 4 .   ? 35.604  70.699  -5.713  1.00 83.62 ? 903  BMA A O3  1 
HETATM 5277 O O4  . BMA G 4 .   ? 38.175  70.742  -6.927  1.00 84.71 ? 903  BMA A O4  1 
HETATM 5278 O O5  . BMA G 4 .   ? 38.879  69.257  -3.641  1.00 81.05 ? 903  BMA A O5  1 
HETATM 5279 O O6  . BMA G 4 .   ? 41.181  70.372  -3.857  1.00 86.30 ? 903  BMA A O6  1 
HETATM 5280 C C1  . PGE H 5 .   ? 33.244  55.114  31.175  1.00 70.73 ? 951  PGE A C1  1 
HETATM 5281 O O1  . PGE H 5 .   ? 34.012  56.306  30.953  1.00 70.50 ? 951  PGE A O1  1 
HETATM 5282 C C2  . PGE H 5 .   ? 33.082  54.853  32.681  1.00 69.49 ? 951  PGE A C2  1 
HETATM 5283 O O2  . PGE H 5 .   ? 33.273  53.440  32.994  1.00 70.37 ? 951  PGE A O2  1 
HETATM 5284 C C3  . PGE H 5 .   ? 34.234  53.204  34.069  1.00 69.67 ? 951  PGE A C3  1 
HETATM 5285 C C4  . PGE H 5 .   ? 35.360  52.266  33.594  1.00 69.18 ? 951  PGE A C4  1 
HETATM 5286 O O4  . PGE H 5 .   ? 34.732  47.879  31.663  1.00 66.01 ? 951  PGE A O4  1 
HETATM 5287 C C6  . PGE H 5 .   ? 35.536  48.606  32.617  1.00 68.54 ? 951  PGE A C6  1 
HETATM 5288 C C5  . PGE H 5 .   ? 35.465  50.129  32.394  1.00 68.48 ? 951  PGE A C5  1 
HETATM 5289 O O3  . PGE H 5 .   ? 34.942  50.855  33.579  1.00 69.34 ? 951  PGE A O3  1 
HETATM 5290 C C1  . GOL I 6 .   ? 36.960  45.103  -4.340  1.00 64.06 ? 952  GOL A C1  1 
HETATM 5291 O O1  . GOL I 6 .   ? 37.505  45.462  -5.612  1.00 60.16 ? 952  GOL A O1  1 
HETATM 5292 C C2  . GOL I 6 .   ? 36.895  43.608  -4.033  1.00 64.45 ? 952  GOL A C2  1 
HETATM 5293 O O2  . GOL I 6 .   ? 35.715  43.286  -3.300  1.00 64.37 ? 952  GOL A O2  1 
HETATM 5294 C C3  . GOL I 6 .   ? 38.120  43.131  -3.250  1.00 65.01 ? 952  GOL A C3  1 
HETATM 5295 O O3  . GOL I 6 .   ? 39.339  43.585  -3.824  1.00 66.63 ? 952  GOL A O3  1 
HETATM 5296 O O   . HOH J 7 .   ? 35.046  62.300  10.037  1.00 21.57 ? 1001 HOH A O   1 
HETATM 5297 O O   . HOH J 7 .   ? 10.461  50.138  28.374  1.00 19.18 ? 1002 HOH A O   1 
HETATM 5298 O O   . HOH J 7 .   ? 20.104  56.969  12.955  1.00 24.80 ? 1003 HOH A O   1 
HETATM 5299 O O   . HOH J 7 .   ? 29.012  64.727  7.964   1.00 27.38 ? 1004 HOH A O   1 
HETATM 5300 O O   . HOH J 7 .   ? 2.979   56.577  20.603  1.00 27.79 ? 1005 HOH A O   1 
HETATM 5301 O O   . HOH J 7 .   ? 11.974  44.173  19.967  1.00 28.19 ? 1006 HOH A O   1 
HETATM 5302 O O   . HOH J 7 .   ? 4.556   56.312  8.156   1.00 19.29 ? 1007 HOH A O   1 
HETATM 5303 O O   . HOH J 7 .   ? 15.740  55.795  29.790  1.00 27.52 ? 1008 HOH A O   1 
HETATM 5304 O O   . HOH J 7 .   ? 23.140  54.494  25.695  1.00 25.94 ? 1009 HOH A O   1 
HETATM 5305 O O   . HOH J 7 .   ? 15.244  67.733  19.773  1.00 26.65 ? 1010 HOH A O   1 
HETATM 5306 O O   . HOH J 7 .   ? 8.756   52.018  11.925  1.00 23.35 ? 1011 HOH A O   1 
HETATM 5307 O O   . HOH J 7 .   ? 9.250   49.469  21.199  1.00 26.36 ? 1012 HOH A O   1 
HETATM 5308 O O   . HOH J 7 .   ? 13.291  85.989  17.152  1.00 30.91 ? 1013 HOH A O   1 
HETATM 5309 O O   . HOH J 7 .   ? 3.714   57.135  1.754   1.00 23.87 ? 1014 HOH A O   1 
HETATM 5310 O O   . HOH J 7 .   ? 14.889  46.593  14.474  1.00 31.63 ? 1015 HOH A O   1 
HETATM 5311 O O   . HOH J 7 .   ? 34.323  69.069  7.485   1.00 30.36 ? 1016 HOH A O   1 
HETATM 5312 O O   . HOH J 7 .   ? 26.014  59.753  3.523   1.00 26.85 ? 1017 HOH A O   1 
HETATM 5313 O O   . HOH J 7 .   ? 22.006  54.029  4.753   1.00 27.64 ? 1018 HOH A O   1 
HETATM 5314 O O   . HOH J 7 .   ? 19.499  56.718  32.120  1.00 31.48 ? 1019 HOH A O   1 
HETATM 5315 O O   . HOH J 7 .   ? 2.558   53.764  16.560  1.00 26.49 ? 1020 HOH A O   1 
HETATM 5316 O O   . HOH J 7 .   ? 20.292  51.184  -10.565 1.00 33.17 ? 1021 HOH A O   1 
HETATM 5317 O O   . HOH J 7 .   ? 12.136  61.867  16.529  1.00 24.19 ? 1022 HOH A O   1 
HETATM 5318 O O   . HOH J 7 .   ? -0.255  51.847  4.699   1.00 27.32 ? 1023 HOH A O   1 
HETATM 5319 O O   . HOH J 7 .   ? 7.297   48.504  3.702   1.00 37.59 ? 1024 HOH A O   1 
HETATM 5320 O O   . HOH J 7 .   ? -2.057  55.410  1.370   1.00 26.08 ? 1025 HOH A O   1 
HETATM 5321 O O   . HOH J 7 .   ? 16.797  57.622  0.599   1.00 30.67 ? 1026 HOH A O   1 
HETATM 5322 O O   . HOH J 7 .   ? -3.242  58.299  1.596   1.00 32.45 ? 1027 HOH A O   1 
HETATM 5323 O O   . HOH J 7 .   ? 11.523  48.520  -3.516  1.00 32.05 ? 1028 HOH A O   1 
HETATM 5324 O O   . HOH J 7 .   ? 27.334  58.842  14.417  1.00 33.00 ? 1029 HOH A O   1 
HETATM 5325 O O   . HOH J 7 .   ? 29.141  44.213  7.937   1.00 36.90 ? 1030 HOH A O   1 
HETATM 5326 O O   . HOH J 7 .   ? 38.224  51.251  25.988  1.00 27.97 ? 1031 HOH A O   1 
HETATM 5327 O O   . HOH J 7 .   ? 33.676  64.734  16.726  1.00 33.80 ? 1032 HOH A O   1 
HETATM 5328 O O   . HOH J 7 .   ? 14.155  71.122  17.861  1.00 30.14 ? 1033 HOH A O   1 
HETATM 5329 O O   . HOH J 7 .   ? 22.274  47.494  32.752  1.00 31.21 ? 1034 HOH A O   1 
HETATM 5330 O O   . HOH J 7 .   ? 25.586  49.457  8.340   1.00 39.93 ? 1035 HOH A O   1 
HETATM 5331 O O   . HOH J 7 .   ? 12.039  62.826  -0.977  1.00 34.16 ? 1036 HOH A O   1 
HETATM 5332 O O   . HOH J 7 .   ? 23.727  65.192  7.730   1.00 33.18 ? 1037 HOH A O   1 
HETATM 5333 O O   . HOH J 7 .   ? -2.867  60.187  12.313  1.00 37.13 ? 1038 HOH A O   1 
HETATM 5334 O O   . HOH J 7 .   ? 19.076  56.916  5.309   1.00 40.34 ? 1039 HOH A O   1 
HETATM 5335 O O   . HOH J 7 .   ? 21.963  44.509  -2.295  1.00 38.21 ? 1040 HOH A O   1 
HETATM 5336 O O   . HOH J 7 .   ? -15.066 88.784  42.229  1.00 34.51 ? 1041 HOH A O   1 
HETATM 5337 O O   . HOH J 7 .   ? 14.346  61.564  32.013  1.00 27.32 ? 1042 HOH A O   1 
HETATM 5338 O O   . HOH J 7 .   ? 32.800  70.404  16.889  1.00 34.86 ? 1043 HOH A O   1 
HETATM 5339 O O   . HOH J 7 .   ? 37.735  61.868  11.279  1.00 33.78 ? 1044 HOH A O   1 
HETATM 5340 O O   . HOH J 7 .   ? 28.345  62.354  13.108  1.00 32.05 ? 1045 HOH A O   1 
HETATM 5341 O O   . HOH J 7 .   ? 30.622  61.768  9.751   1.00 21.45 ? 1046 HOH A O   1 
HETATM 5342 O O   . HOH J 7 .   ? -8.030  73.144  14.639  1.00 41.10 ? 1047 HOH A O   1 
HETATM 5343 O O   . HOH J 7 .   ? -1.054  60.192  15.226  1.00 35.17 ? 1048 HOH A O   1 
HETATM 5344 O O   . HOH J 7 .   ? 17.056  45.218  3.309   1.00 32.55 ? 1049 HOH A O   1 
HETATM 5345 O O   . HOH J 7 .   ? 7.611   50.330  9.918   1.00 37.89 ? 1050 HOH A O   1 
HETATM 5346 O O   . HOH J 7 .   ? 18.442  53.235  7.188   1.00 41.08 ? 1051 HOH A O   1 
HETATM 5347 O O   . HOH J 7 .   ? 41.638  84.454  8.872   1.00 36.70 ? 1052 HOH A O   1 
HETATM 5348 O O   . HOH J 7 .   ? 18.463  64.244  3.274   1.00 33.98 ? 1053 HOH A O   1 
HETATM 5349 O O   . HOH J 7 .   ? 21.840  60.758  23.183  1.00 31.17 ? 1054 HOH A O   1 
HETATM 5350 O O   . HOH J 7 .   ? 14.721  71.226  20.209  1.00 34.34 ? 1055 HOH A O   1 
HETATM 5351 O O   . HOH J 7 .   ? 10.405  63.933  15.522  1.00 31.88 ? 1056 HOH A O   1 
HETATM 5352 O O   . HOH J 7 .   ? 23.927  48.019  3.648   1.00 50.99 ? 1057 HOH A O   1 
HETATM 5353 O O   . HOH J 7 .   ? 41.027  51.160  26.493  1.00 34.65 ? 1058 HOH A O   1 
HETATM 5354 O O   . HOH J 7 .   ? 17.192  67.362  10.857  1.00 43.94 ? 1059 HOH A O   1 
HETATM 5355 O O   . HOH J 7 .   ? 20.739  65.768  31.032  1.00 39.66 ? 1060 HOH A O   1 
HETATM 5356 O O   . HOH J 7 .   ? 16.656  46.086  33.234  1.00 40.98 ? 1061 HOH A O   1 
HETATM 5357 O O   . HOH J 7 .   ? 17.328  65.011  22.227  1.00 31.35 ? 1062 HOH A O   1 
HETATM 5358 O O   . HOH J 7 .   ? -2.241  67.815  4.403   1.00 32.25 ? 1063 HOH A O   1 
HETATM 5359 O O   . HOH J 7 .   ? 27.086  60.190  24.619  1.00 35.39 ? 1064 HOH A O   1 
HETATM 5360 O O   . HOH J 7 .   ? 29.674  60.191  11.991  1.00 30.94 ? 1065 HOH A O   1 
HETATM 5361 O O   . HOH J 7 .   ? -0.860  77.484  38.936  1.00 42.61 ? 1066 HOH A O   1 
HETATM 5362 O O   . HOH J 7 .   ? -5.304  60.449  10.393  1.00 38.19 ? 1067 HOH A O   1 
HETATM 5363 O O   . HOH J 7 .   ? 39.114  52.009  3.149   1.00 30.73 ? 1068 HOH A O   1 
HETATM 5364 O O   . HOH J 7 .   ? 6.318   58.841  9.038   1.00 33.94 ? 1069 HOH A O   1 
HETATM 5365 O O   . HOH J 7 .   ? 29.239  68.808  9.149   1.00 33.89 ? 1070 HOH A O   1 
HETATM 5366 O O   . HOH J 7 .   ? -2.852  52.068  1.938   1.00 42.56 ? 1071 HOH A O   1 
HETATM 5367 O O   . HOH J 7 .   ? 29.980  59.426  2.510   1.00 34.25 ? 1072 HOH A O   1 
HETATM 5368 O O   . HOH J 7 .   ? 22.806  83.671  21.195  1.00 33.28 ? 1073 HOH A O   1 
HETATM 5369 O O   . HOH J 7 .   ? 49.842  83.545  6.159   1.00 48.89 ? 1074 HOH A O   1 
HETATM 5370 O O   . HOH J 7 .   ? 19.735  43.202  30.889  1.00 44.12 ? 1075 HOH A O   1 
HETATM 5371 O O   . HOH J 7 .   ? 32.747  45.962  26.325  1.00 41.14 ? 1076 HOH A O   1 
HETATM 5372 O O   . HOH J 7 .   ? 22.173  61.369  18.691  1.00 37.97 ? 1077 HOH A O   1 
HETATM 5373 O O   . HOH J 7 .   ? 8.318   41.264  34.411  1.00 40.78 ? 1078 HOH A O   1 
HETATM 5374 O O   . HOH J 7 .   ? 8.160   43.585  25.435  1.00 41.48 ? 1079 HOH A O   1 
HETATM 5375 O O   . HOH J 7 .   ? 4.987   68.549  37.872  1.00 35.62 ? 1080 HOH A O   1 
HETATM 5376 O O   . HOH J 7 .   ? 30.465  61.525  -1.815  1.00 38.57 ? 1081 HOH A O   1 
HETATM 5377 O O   . HOH J 7 .   ? 41.493  45.417  21.484  1.00 36.03 ? 1082 HOH A O   1 
HETATM 5378 O O   . HOH J 7 .   ? -6.956  57.305  6.069   1.00 32.84 ? 1083 HOH A O   1 
HETATM 5379 O O   . HOH J 7 .   ? 5.757   50.005  1.420   1.00 30.97 ? 1084 HOH A O   1 
HETATM 5380 O O   . HOH J 7 .   ? 23.149  63.904  11.010  1.00 36.39 ? 1085 HOH A O   1 
HETATM 5381 O O   . HOH J 7 .   ? 8.638   85.333  19.240  1.00 43.25 ? 1086 HOH A O   1 
HETATM 5382 O O   . HOH J 7 .   ? -13.868 63.395  3.025   1.00 39.71 ? 1087 HOH A O   1 
HETATM 5383 O O   . HOH J 7 .   ? 40.931  53.588  28.252  1.00 45.76 ? 1088 HOH A O   1 
HETATM 5384 O O   . HOH J 7 .   ? 14.451  38.523  40.510  1.00 43.91 ? 1089 HOH A O   1 
HETATM 5385 O O   . HOH J 7 .   ? 50.317  56.815  9.626   1.00 41.29 ? 1090 HOH A O   1 
HETATM 5386 O O   . HOH J 7 .   ? 39.453  67.572  3.764   1.00 38.79 ? 1091 HOH A O   1 
HETATM 5387 O O   . HOH J 7 .   ? 22.559  90.823  7.827   1.00 48.02 ? 1092 HOH A O   1 
HETATM 5388 O O   . HOH J 7 .   ? 26.819  45.156  -2.770  1.00 36.78 ? 1093 HOH A O   1 
HETATM 5389 O O   . HOH J 7 .   ? 24.568  46.480  -11.093 1.00 48.39 ? 1094 HOH A O   1 
HETATM 5390 O O   . HOH J 7 .   ? 11.068  60.746  9.761   1.00 36.67 ? 1095 HOH A O   1 
HETATM 5391 O O   . HOH J 7 .   ? -7.304  65.074  0.642   1.00 43.80 ? 1096 HOH A O   1 
HETATM 5392 O O   . HOH J 7 .   ? 27.373  81.550  18.635  1.00 30.17 ? 1097 HOH A O   1 
HETATM 5393 O O   . HOH J 7 .   ? 27.275  43.090  29.646  1.00 38.17 ? 1098 HOH A O   1 
HETATM 5394 O O   . HOH J 7 .   ? 15.868  53.298  -5.420  1.00 39.01 ? 1099 HOH A O   1 
HETATM 5395 O O   . HOH J 7 .   ? 26.987  50.046  3.336   1.00 37.36 ? 1100 HOH A O   1 
HETATM 5396 O O   . HOH J 7 .   ? 20.040  60.828  25.511  1.00 39.18 ? 1101 HOH A O   1 
HETATM 5397 O O   . HOH J 7 .   ? 31.566  69.918  10.687  1.00 39.04 ? 1102 HOH A O   1 
HETATM 5398 O O   . HOH J 7 .   ? 0.311   60.968  26.771  1.00 33.09 ? 1103 HOH A O   1 
HETATM 5399 O O   . HOH J 7 .   ? 1.834   66.658  19.882  1.00 49.24 ? 1104 HOH A O   1 
HETATM 5400 O O   . HOH J 7 .   ? 32.075  59.648  16.272  1.00 43.28 ? 1105 HOH A O   1 
HETATM 5401 O O   . HOH J 7 .   ? 10.405  62.517  8.234   1.00 36.76 ? 1106 HOH A O   1 
HETATM 5402 O O   . HOH J 7 .   ? 6.078   68.477  14.785  1.00 37.20 ? 1107 HOH A O   1 
HETATM 5403 O O   . HOH J 7 .   ? 45.187  60.412  12.992  1.00 37.16 ? 1108 HOH A O   1 
HETATM 5404 O O   . HOH J 7 .   ? 15.081  98.378  18.079  1.00 51.58 ? 1109 HOH A O   1 
HETATM 5405 O O   . HOH J 7 .   ? 38.533  48.456  -2.863  1.00 52.31 ? 1110 HOH A O   1 
HETATM 5406 O O   . HOH J 7 .   ? 1.458   59.832  32.348  1.00 38.25 ? 1111 HOH A O   1 
HETATM 5407 O O   . HOH J 7 .   ? 42.875  43.132  11.309  1.00 37.89 ? 1112 HOH A O   1 
HETATM 5408 O O   . HOH J 7 .   ? 0.313   57.523  27.427  1.00 33.85 ? 1113 HOH A O   1 
HETATM 5409 O O   . HOH J 7 .   ? 47.886  81.485  4.399   1.00 50.95 ? 1114 HOH A O   1 
HETATM 5410 O O   . HOH J 7 .   ? 39.795  71.735  3.674   1.00 43.70 ? 1115 HOH A O   1 
HETATM 5411 O O   . HOH J 7 .   ? 21.034  55.138  -9.837  1.00 46.64 ? 1116 HOH A O   1 
HETATM 5412 O O   . HOH J 7 .   ? -13.477 59.971  14.177  1.00 45.83 ? 1117 HOH A O   1 
HETATM 5413 O O   . HOH J 7 .   ? 1.573   80.156  32.841  1.00 33.01 ? 1118 HOH A O   1 
HETATM 5414 O O   . HOH J 7 .   ? 35.178  94.218  31.656  1.00 48.89 ? 1119 HOH A O   1 
HETATM 5415 O O   . HOH J 7 .   ? 34.885  46.476  -0.931  1.00 42.56 ? 1120 HOH A O   1 
HETATM 5416 O O   . HOH J 7 .   ? 18.924  59.739  19.715  1.00 46.18 ? 1121 HOH A O   1 
HETATM 5417 O O   . HOH J 7 .   ? 18.452  40.056  20.555  1.00 41.54 ? 1122 HOH A O   1 
HETATM 5418 O O   . HOH J 7 .   ? 30.938  53.110  -8.238  1.00 49.69 ? 1123 HOH A O   1 
HETATM 5419 O O   . HOH J 7 .   ? 24.092  82.716  18.593  1.00 49.44 ? 1124 HOH A O   1 
HETATM 5420 O O   . HOH J 7 .   ? 45.534  44.937  10.786  1.00 45.84 ? 1125 HOH A O   1 
HETATM 5421 O O   . HOH J 7 .   ? 18.402  50.310  5.527   1.00 48.22 ? 1126 HOH A O   1 
HETATM 5422 O O   . HOH J 7 .   ? 7.773   64.623  7.080   1.00 51.55 ? 1127 HOH A O   1 
HETATM 5423 O O   . HOH J 7 .   ? 27.406  49.855  -8.945  1.00 40.15 ? 1128 HOH A O   1 
HETATM 5424 O O   . HOH J 7 .   ? 10.728  69.766  12.792  1.00 53.72 ? 1129 HOH A O   1 
HETATM 5425 O O   . HOH J 7 .   ? 10.591  46.918  0.334   1.00 48.33 ? 1130 HOH A O   1 
HETATM 5426 O O   . HOH J 7 .   ? 44.748  75.181  3.467   1.00 55.47 ? 1131 HOH A O   1 
HETATM 5427 O O   . HOH J 7 .   ? -2.243  59.261  20.714  1.00 49.50 ? 1132 HOH A O   1 
HETATM 5428 O O   . HOH J 7 .   ? 13.546  41.499  18.423  1.00 46.41 ? 1133 HOH A O   1 
HETATM 5429 O O   . HOH J 7 .   ? 36.475  81.798  22.561  1.00 45.34 ? 1134 HOH A O   1 
HETATM 5430 O O   . HOH J 7 .   ? 43.165  57.240  3.377   1.00 45.03 ? 1135 HOH A O   1 
HETATM 5431 O O   . HOH J 7 .   ? 27.955  52.525  -8.646  1.00 42.83 ? 1136 HOH A O   1 
HETATM 5432 O O   . HOH J 7 .   ? 29.077  39.251  13.337  1.00 40.41 ? 1137 HOH A O   1 
HETATM 5433 O O   . HOH J 7 .   ? -2.229  70.999  23.603  1.00 34.31 ? 1138 HOH A O   1 
HETATM 5434 O O   . HOH J 7 .   ? 27.134  49.230  34.985  1.00 50.76 ? 1139 HOH A O   1 
HETATM 5435 O O   . HOH J 7 .   ? 7.274   49.907  12.979  1.00 39.15 ? 1140 HOH A O   1 
HETATM 5436 O O   . HOH J 7 .   ? 22.159  51.634  5.783   1.00 41.71 ? 1141 HOH A O   1 
HETATM 5437 O O   . HOH J 7 .   ? 0.175   68.998  21.852  1.00 60.61 ? 1142 HOH A O   1 
HETATM 5438 O O   . HOH J 7 .   ? -2.248  72.371  30.997  1.00 55.96 ? 1143 HOH A O   1 
HETATM 5439 O O   . HOH J 7 .   ? 13.678  71.014  15.463  1.00 33.27 ? 1144 HOH A O   1 
HETATM 5440 O O   . HOH J 7 .   ? 33.671  59.247  22.262  1.00 49.11 ? 1145 HOH A O   1 
HETATM 5441 O O   . HOH J 7 .   ? 3.437   78.758  33.626  1.00 37.17 ? 1146 HOH A O   1 
HETATM 5442 O O   . HOH J 7 .   ? 11.601  67.414  37.845  1.00 35.99 ? 1147 HOH A O   1 
HETATM 5443 O O   . HOH J 7 .   ? 35.940  58.074  27.448  1.00 53.90 ? 1148 HOH A O   1 
HETATM 5444 O O   . HOH J 7 .   ? -0.073  63.374  19.331  1.00 41.01 ? 1149 HOH A O   1 
HETATM 5445 O O   . HOH J 7 .   ? 43.101  83.273  3.870   1.00 47.68 ? 1150 HOH A O   1 
HETATM 5446 O O   . HOH J 7 .   ? 19.255  63.581  27.438  1.00 42.96 ? 1151 HOH A O   1 
HETATM 5447 O O   . HOH J 7 .   ? -1.581  49.661  4.565   1.00 33.64 ? 1152 HOH A O   1 
HETATM 5448 O O   . HOH J 7 .   ? 31.688  97.019  15.348  1.00 43.69 ? 1153 HOH A O   1 
HETATM 5449 O O   . HOH J 7 .   ? 30.099  67.986  0.432   1.00 50.47 ? 1154 HOH A O   1 
HETATM 5450 O O   . HOH J 7 .   ? 38.043  45.599  30.833  1.00 55.08 ? 1155 HOH A O   1 
HETATM 5451 O O   . HOH J 7 .   ? 10.141  47.541  9.622   1.00 47.77 ? 1156 HOH A O   1 
HETATM 5452 O O   . HOH J 7 .   ? -2.616  73.534  17.601  1.00 37.88 ? 1157 HOH A O   1 
HETATM 5453 O O   . HOH J 7 .   ? 7.493   48.645  6.800   1.00 40.63 ? 1158 HOH A O   1 
HETATM 5454 O O   . HOH J 7 .   ? 52.967  61.472  14.278  1.00 45.61 ? 1159 HOH A O   1 
HETATM 5455 O O   . HOH J 7 .   ? 34.779  45.489  28.198  1.00 52.78 ? 1160 HOH A O   1 
HETATM 5456 O O   . HOH J 7 .   ? 31.346  49.022  -2.127  1.00 37.24 ? 1161 HOH A O   1 
HETATM 5457 O O   . HOH J 7 .   ? 37.256  53.178  27.430  1.00 41.04 ? 1162 HOH A O   1 
HETATM 5458 O O   . HOH J 7 .   ? 20.177  39.964  36.330  1.00 47.98 ? 1163 HOH A O   1 
HETATM 5459 O O   . HOH J 7 .   ? 7.565   65.146  16.538  1.00 51.72 ? 1164 HOH A O   1 
HETATM 5460 O O   . HOH J 7 .   ? 40.089  88.972  30.207  1.00 48.72 ? 1165 HOH A O   1 
HETATM 5461 O O   . HOH J 7 .   ? 2.959   49.998  2.237   1.00 35.02 ? 1166 HOH A O   1 
HETATM 5462 O O   . HOH J 7 .   ? 1.567   55.654  18.432  1.00 39.11 ? 1167 HOH A O   1 
HETATM 5463 O O   . HOH J 7 .   ? 1.449   51.959  2.715   1.00 34.30 ? 1168 HOH A O   1 
HETATM 5464 O O   . HOH J 7 .   ? 36.300  59.012  2.155   1.00 43.17 ? 1169 HOH A O   1 
HETATM 5465 O O   . HOH J 7 .   ? 33.267  61.032  -1.160  1.00 44.03 ? 1170 HOH A O   1 
HETATM 5466 O O   . HOH J 7 .   ? 19.050  43.179  1.885   1.00 47.26 ? 1171 HOH A O   1 
HETATM 5467 O O   . HOH J 7 .   ? -19.440 87.985  36.633  1.00 46.07 ? 1172 HOH A O   1 
HETATM 5468 O O   . HOH J 7 .   ? 13.017  62.706  6.573   1.00 49.33 ? 1173 HOH A O   1 
HETATM 5469 O O   . HOH J 7 .   ? 12.946  96.906  18.888  1.00 60.33 ? 1174 HOH A O   1 
HETATM 5470 O O   . HOH J 7 .   ? 4.611   49.312  -1.413  1.00 52.99 ? 1175 HOH A O   1 
HETATM 5471 O O   . HOH J 7 .   ? 36.406  99.149  20.052  1.00 55.89 ? 1176 HOH A O   1 
HETATM 5472 O O   . HOH J 7 .   ? 32.646  67.354  17.391  1.00 53.82 ? 1177 HOH A O   1 
HETATM 5473 O O   . HOH J 7 .   ? -3.054  62.395  20.639  1.00 58.24 ? 1178 HOH A O   1 
HETATM 5474 O O   . HOH J 7 .   ? 21.678  66.266  1.171   1.00 39.65 ? 1179 HOH A O   1 
HETATM 5475 O O   . HOH J 7 .   ? -1.497  61.440  17.912  1.00 54.72 ? 1180 HOH A O   1 
HETATM 5476 O O   . HOH J 7 .   ? 9.455   81.135  41.420  1.00 50.62 ? 1181 HOH A O   1 
HETATM 5477 O O   . HOH J 7 .   ? -2.752  86.001  28.691  1.00 58.24 ? 1182 HOH A O   1 
HETATM 5478 O O   . HOH J 7 .   ? 28.076  66.992  2.917   1.00 51.79 ? 1183 HOH A O   1 
HETATM 5479 O O   . HOH J 7 .   ? -4.870  70.528  24.944  1.00 45.75 ? 1184 HOH A O   1 
HETATM 5480 O O   . HOH J 7 .   ? 3.564   73.798  40.493  1.00 46.49 ? 1185 HOH A O   1 
HETATM 5481 O O   . HOH J 7 .   ? 29.207  56.911  34.114  1.00 44.26 ? 1186 HOH A O   1 
HETATM 5482 O O   . HOH J 7 .   ? 49.677  53.895  19.591  1.00 45.75 ? 1187 HOH A O   1 
HETATM 5483 O O   . HOH J 7 .   ? 24.877  67.209  7.254   1.00 42.40 ? 1188 HOH A O   1 
HETATM 5484 O O   . HOH J 7 .   ? 53.803  70.833  12.966  1.00 57.50 ? 1189 HOH A O   1 
HETATM 5485 O O   . HOH J 7 .   ? 15.519  73.097  17.557  1.00 45.54 ? 1190 HOH A O   1 
HETATM 5486 O O   . HOH J 7 .   ? 27.402  66.757  6.299   1.00 43.36 ? 1191 HOH A O   1 
HETATM 5487 O O   . HOH J 7 .   ? 49.478  81.274  8.718   1.00 62.53 ? 1192 HOH A O   1 
HETATM 5488 O O   . HOH J 7 .   ? 13.026  45.054  -4.679  1.00 65.08 ? 1193 HOH A O   1 
HETATM 5489 O O   . HOH J 7 .   ? 19.401  54.912  3.205   1.00 44.35 ? 1194 HOH A O   1 
HETATM 5490 O O   . HOH J 7 .   ? -24.364 83.210  38.272  1.00 64.54 ? 1195 HOH A O   1 
HETATM 5491 O O   . HOH J 7 .   ? 0.854   54.135  1.588   1.00 47.39 ? 1196 HOH A O   1 
HETATM 5492 O O   . HOH J 7 .   ? -7.468  62.959  2.252   1.00 53.83 ? 1197 HOH A O   1 
HETATM 5493 O O   . HOH J 7 .   ? 40.364  88.063  27.343  1.00 53.93 ? 1198 HOH A O   1 
HETATM 5494 O O   . HOH J 7 .   ? 13.021  74.377  14.617  1.00 57.92 ? 1199 HOH A O   1 
HETATM 5495 O O   . HOH J 7 .   ? 2.180   51.802  18.183  1.00 38.30 ? 1200 HOH A O   1 
HETATM 5496 O O   . HOH J 7 .   ? 22.676  57.713  -2.757  1.00 48.11 ? 1201 HOH A O   1 
HETATM 5497 O O   . HOH J 7 .   ? 9.388   48.581  38.924  1.00 66.08 ? 1202 HOH A O   1 
HETATM 5498 O O   . HOH J 7 .   ? 47.658  90.899  28.362  1.00 70.04 ? 1203 HOH A O   1 
HETATM 5499 O O   . HOH J 7 .   ? 24.526  86.092  27.871  1.00 48.10 ? 1204 HOH A O   1 
HETATM 5500 O O   . HOH J 7 .   ? 24.110  60.258  -3.245  1.00 55.35 ? 1205 HOH A O   1 
HETATM 5501 O O   . HOH J 7 .   ? -18.333 74.281  12.724  1.00 66.46 ? 1206 HOH A O   1 
HETATM 5502 O O   . HOH J 7 .   ? 32.270  77.669  9.705   1.00 52.35 ? 1207 HOH A O   1 
HETATM 5503 O O   . HOH J 7 .   ? -5.855  52.136  12.056  1.00 60.08 ? 1208 HOH A O   1 
HETATM 5504 O O   . HOH J 7 .   ? -10.275 88.567  34.055  1.00 52.34 ? 1209 HOH A O   1 
HETATM 5505 O O   . HOH J 7 .   ? 5.765   74.348  10.640  1.00 52.59 ? 1210 HOH A O   1 
HETATM 5506 O O   . HOH J 7 .   ? -1.139  57.461  17.586  1.00 53.54 ? 1211 HOH A O   1 
HETATM 5507 O O   . HOH J 7 .   ? -4.192  60.184  14.266  1.00 54.54 ? 1212 HOH A O   1 
HETATM 5508 O O   . HOH J 7 .   ? 50.166  51.253  26.496  1.00 56.67 ? 1213 HOH A O   1 
HETATM 5509 O O   . HOH J 7 .   ? 40.260  85.630  6.599   1.00 50.49 ? 1214 HOH A O   1 
HETATM 5510 O O   . HOH J 7 .   ? 20.507  61.789  27.459  1.00 46.29 ? 1215 HOH A O   1 
HETATM 5511 O O   . HOH J 7 .   ? 16.863  65.432  42.216  1.00 47.91 ? 1216 HOH A O   1 
HETATM 5512 O O   . HOH J 7 .   ? 29.668  63.786  14.828  1.00 42.22 ? 1217 HOH A O   1 
HETATM 5513 O O   . HOH J 7 .   ? 0.716   91.874  25.779  1.00 47.27 ? 1218 HOH A O   1 
HETATM 5514 O O   . HOH J 7 .   ? 46.920  92.240  15.411  1.00 58.13 ? 1219 HOH A O   1 
HETATM 5515 O O   . HOH J 7 .   ? 4.592   65.498  11.741  1.00 56.42 ? 1220 HOH A O   1 
HETATM 5516 O O   . HOH J 7 .   ? 4.526   58.006  34.124  1.00 40.64 ? 1221 HOH A O   1 
HETATM 5517 O O   . HOH J 7 .   ? 36.876  44.015  33.131  1.00 60.88 ? 1222 HOH A O   1 
HETATM 5518 O O   . HOH J 7 .   ? 3.545   54.915  22.249  1.00 47.09 ? 1223 HOH A O   1 
HETATM 5519 O O   . HOH J 7 .   ? -4.149  84.433  26.811  1.00 65.03 ? 1224 HOH A O   1 
HETATM 5520 O O   . HOH J 7 .   ? 27.745  57.689  -3.476  1.00 50.56 ? 1225 HOH A O   1 
HETATM 5521 O O   . HOH J 7 .   ? 32.258  56.954  -9.014  1.00 58.44 ? 1226 HOH A O   1 
HETATM 5522 O O   . HOH J 7 .   ? 22.458  62.769  16.768  1.00 54.03 ? 1227 HOH A O   1 
HETATM 5523 O O   . HOH J 7 .   ? 34.814  64.948  19.118  1.00 58.33 ? 1228 HOH A O   1 
HETATM 5524 O O   . HOH J 7 .   ? 34.794  74.641  21.568  1.00 60.12 ? 1229 HOH A O   1 
HETATM 5525 O O   . HOH J 7 .   ? 19.062  40.504  30.120  1.00 51.48 ? 1230 HOH A O   1 
HETATM 5526 O O   . HOH J 7 .   ? 36.416  39.815  11.609  1.00 38.57 ? 1231 HOH A O   1 
HETATM 5527 O O   . HOH J 7 .   ? -13.352 52.129  6.256   1.00 90.93 ? 1232 HOH A O   1 
HETATM 5528 O O   . HOH J 7 .   ? 32.841  43.085  24.678  1.00 63.30 ? 1233 HOH A O   1 
HETATM 5529 O O   . HOH J 7 .   ? 16.550  39.267  19.097  1.00 49.75 ? 1234 HOH A O   1 
HETATM 5530 O O   . HOH J 7 .   ? -4.467  43.074  12.800  1.00 63.34 ? 1235 HOH A O   1 
HETATM 5531 O O   . HOH J 7 .   ? 9.721   64.963  9.159   1.00 51.04 ? 1236 HOH A O   1 
HETATM 5532 O O   . HOH J 7 .   ? 10.767  70.121  42.927  1.00 57.55 ? 1237 HOH A O   1 
HETATM 5533 O O   . HOH J 7 .   ? 40.062  63.813  15.087  1.00 45.77 ? 1238 HOH A O   1 
HETATM 5534 O O   . HOH J 7 .   ? 53.124  59.340  13.229  1.00 49.23 ? 1239 HOH A O   1 
HETATM 5535 O O   . HOH J 7 .   ? 28.719  82.335  27.646  1.00 64.69 ? 1240 HOH A O   1 
HETATM 5536 O O   . HOH J 7 .   ? 33.139  58.702  -3.440  1.00 55.40 ? 1241 HOH A O   1 
HETATM 5537 O O   . HOH J 7 .   ? 16.191  57.467  27.523  1.00 54.65 ? 1242 HOH A O   1 
HETATM 5538 O O   . HOH J 7 .   ? 38.484  97.558  13.421  1.00 56.08 ? 1243 HOH A O   1 
HETATM 5539 O O   . HOH J 7 .   ? 29.210  77.227  21.870  1.00 70.56 ? 1244 HOH A O   1 
HETATM 5540 O O   . HOH J 7 .   ? 17.788  57.436  -2.283  1.00 44.67 ? 1245 HOH A O   1 
HETATM 5541 O O   . HOH J 7 .   ? 2.071   77.224  42.159  1.00 61.04 ? 1246 HOH A O   1 
HETATM 5542 O O   . HOH J 7 .   ? 26.478  44.809  3.668   1.00 51.94 ? 1247 HOH A O   1 
HETATM 5543 O O   . HOH J 7 .   ? 33.852  84.725  6.629   1.00 56.94 ? 1248 HOH A O   1 
HETATM 5544 O O   . HOH J 7 .   ? 44.386  55.341  -0.270  1.00 59.59 ? 1249 HOH A O   1 
HETATM 5545 O O   . HOH J 7 .   ? 25.630  57.212  -4.643  1.00 51.86 ? 1250 HOH A O   1 
HETATM 5546 O O   . HOH J 7 .   ? 43.431  41.577  3.442   1.00 51.81 ? 1251 HOH A O   1 
HETATM 5547 O O   . HOH J 7 .   ? 14.519  64.209  2.725   1.00 55.53 ? 1252 HOH A O   1 
HETATM 5548 O O   . HOH J 7 .   ? 14.242  59.336  9.643   1.00 54.31 ? 1253 HOH A O   1 
HETATM 5549 O O   . HOH J 7 .   ? 6.594   50.020  22.174  1.00 49.41 ? 1254 HOH A O   1 
HETATM 5550 O O   . HOH J 7 .   ? 2.969   48.031  4.204   1.00 42.84 ? 1255 HOH A O   1 
HETATM 5551 O O   . HOH J 7 .   ? 17.163  45.497  15.444  1.00 38.65 ? 1256 HOH A O   1 
HETATM 5552 O O   . HOH J 7 .   ? 28.694  88.589  6.924   1.00 58.13 ? 1257 HOH A O   1 
HETATM 5553 O O   . HOH J 7 .   ? 13.147  42.052  -2.068  1.00 70.19 ? 1258 HOH A O   1 
HETATM 5554 O O   . HOH J 7 .   ? 44.590  73.852  33.454  1.00 80.58 ? 1259 HOH A O   1 
HETATM 5555 O O   . HOH J 7 .   ? 15.959  41.807  -3.532  1.00 70.88 ? 1260 HOH A O   1 
HETATM 5556 O O   . HOH J 7 .   ? 6.336   94.391  25.315  1.00 51.71 ? 1261 HOH A O   1 
HETATM 5557 O O   . HOH J 7 .   ? 22.395  66.384  11.436  1.00 51.04 ? 1262 HOH A O   1 
HETATM 5558 O O   . HOH J 7 .   ? 1.159   84.954  22.286  1.00 47.61 ? 1263 HOH A O   1 
HETATM 5559 O O   . HOH J 7 .   ? -7.941  77.846  22.663  1.00 66.56 ? 1264 HOH A O   1 
HETATM 5560 O O   . HOH J 7 .   ? 20.321  82.468  20.480  1.00 54.68 ? 1265 HOH A O   1 
HETATM 5561 O O   . HOH J 7 .   ? 51.426  89.031  17.270  1.00 61.94 ? 1266 HOH A O   1 
HETATM 5562 O O   . HOH J 7 .   ? 7.028   41.177  27.078  1.00 48.71 ? 1267 HOH A O   1 
HETATM 5563 O O   . HOH J 7 .   ? 31.436  76.977  18.992  1.00 53.79 ? 1268 HOH A O   1 
HETATM 5564 O O   . HOH J 7 .   ? 11.735  67.769  41.910  1.00 65.70 ? 1269 HOH A O   1 
HETATM 5565 O O   . HOH J 7 .   ? 8.436   58.907  8.855   1.00 48.05 ? 1270 HOH A O   1 
HETATM 5566 O O   . HOH J 7 .   ? 21.129  65.860  8.861   1.00 56.60 ? 1271 HOH A O   1 
HETATM 5567 O O   . HOH J 7 .   ? 30.727  71.285  12.169  1.00 45.32 ? 1272 HOH A O   1 
HETATM 5568 O O   . HOH J 7 .   ? 4.451   79.486  11.356  1.00 63.80 ? 1273 HOH A O   1 
HETATM 5569 O O   . HOH J 7 .   ? 32.118  51.263  -9.611  1.00 58.29 ? 1274 HOH A O   1 
HETATM 5570 O O   . HOH J 7 .   ? 4.480   64.171  37.478  1.00 65.88 ? 1275 HOH A O   1 
HETATM 5571 O O   . HOH J 7 .   ? -19.978 95.066  36.317  1.00 52.31 ? 1276 HOH A O   1 
HETATM 5572 O O   . HOH J 7 .   ? 34.364  57.241  0.662   1.00 47.59 ? 1277 HOH A O   1 
HETATM 5573 O O   . HOH J 7 .   ? 8.407   45.778  31.871  1.00 53.42 ? 1278 HOH A O   1 
HETATM 5574 O O   . HOH J 7 .   ? 34.075  46.460  -3.316  1.00 51.39 ? 1279 HOH A O   1 
HETATM 5575 O O   . HOH J 7 .   ? 0.017   55.531  0.002   0.50 17.61 ? 1280 HOH A O   1 
HETATM 5576 O O   . HOH J 7 .   ? 37.373  47.436  20.262  1.00 29.90 ? 1281 HOH A O   1 
HETATM 5577 O O   . HOH J 7 .   ? 26.589  42.570  2.549   1.00 55.89 ? 1282 HOH A O   1 
HETATM 5578 O O   . HOH J 7 .   ? 27.820  42.013  5.780   1.00 62.16 ? 1283 HOH A O   1 
HETATM 5579 O O   . HOH J 7 .   ? 28.760  43.699  2.044   1.00 69.85 ? 1284 HOH A O   1 
HETATM 5580 O O   . HOH J 7 .   ? 47.873  49.599  9.976   1.00 54.79 ? 1285 HOH A O   1 
HETATM 5581 O O   . HOH J 7 .   ? 48.243  51.414  12.368  1.00 54.94 ? 1286 HOH A O   1 
HETATM 5582 O O   . HOH J 7 .   ? 34.408  43.836  -0.133  1.00 55.00 ? 1287 HOH A O   1 
HETATM 5583 O O   . HOH J 7 .   ? 28.124  79.424  16.134  1.00 69.33 ? 1288 HOH A O   1 
HETATM 5584 O O   . HOH J 7 .   ? 33.495  74.713  19.676  1.00 60.33 ? 1289 HOH A O   1 
HETATM 5585 O O   . HOH J 7 .   ? 38.940  67.493  28.774  1.00 67.48 ? 1290 HOH A O   1 
HETATM 5586 O O   . HOH J 7 .   ? 43.866  95.126  18.624  1.00 55.24 ? 1291 HOH A O   1 
HETATM 5587 O O   . HOH J 7 .   ? 17.273  47.909  4.602   1.00 54.11 ? 1292 HOH A O   1 
HETATM 5588 O O   . HOH J 7 .   ? 23.069  80.384  17.869  1.00 68.99 ? 1293 HOH A O   1 
HETATM 5589 O O   . HOH J 7 .   ? 13.581  43.984  13.385  1.00 57.81 ? 1294 HOH A O   1 
HETATM 5590 O O   . HOH J 7 .   ? 17.514  82.636  17.177  1.00 55.56 ? 1295 HOH A O   1 
HETATM 5591 O O   . HOH J 7 .   ? 23.212  68.617  31.896  1.00 60.48 ? 1296 HOH A O   1 
HETATM 5592 O O   . HOH J 7 .   ? 20.872  63.409  22.237  1.00 70.70 ? 1297 HOH A O   1 
HETATM 5593 O O   . HOH J 7 .   ? 25.091  62.648  32.585  1.00 45.01 ? 1298 HOH A O   1 
HETATM 5594 O O   . HOH J 7 .   ? 18.319  66.293  19.419  1.00 50.70 ? 1299 HOH A O   1 
HETATM 5595 O O   . HOH J 7 .   ? 25.733  64.742  13.791  1.00 44.36 ? 1300 HOH A O   1 
HETATM 5596 O O   . HOH J 7 .   ? 28.230  65.561  16.140  1.00 46.10 ? 1301 HOH A O   1 
HETATM 5597 O O   . HOH J 7 .   ? 6.429   44.778  30.360  1.00 63.70 ? 1302 HOH A O   1 
HETATM 5598 O O   . HOH J 7 .   ? 18.735  44.938  13.510  1.00 53.64 ? 1303 HOH A O   1 
HETATM 5599 O O   . HOH J 7 .   ? 16.899  43.122  12.882  1.00 70.22 ? 1304 HOH A O   1 
HETATM 5600 O O   . HOH K 7 .   ? 19.120  77.458  30.695  1.00 56.01 ? 1305 HOH N O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   45  ?   ?   ?   A . n 
A 1 2   ALA 2   46  ?   ?   ?   A . n 
A 1 3   PRO 3   47  ?   ?   ?   A . n 
A 1 4   GLY 4   48  ?   ?   ?   A . n 
A 1 5   GLU 5   49  ?   ?   ?   A . n 
A 1 6   ASP 6   50  ?   ?   ?   A . n 
A 1 7   GLU 7   51  ?   ?   ?   A . n 
A 1 8   GLU 8   52  ?   ?   ?   A . n 
A 1 9   CYS 9   53  ?   ?   ?   A . n 
A 1 10  GLY 10  54  ?   ?   ?   A . n 
A 1 11  ARG 11  55  55  ARG ARG A . n 
A 1 12  VAL 12  56  56  VAL VAL A . n 
A 1 13  ARG 13  57  57  ARG ARG A . n 
A 1 14  ASP 14  58  58  ASP ASP A . n 
A 1 15  PHE 15  59  59  PHE PHE A . n 
A 1 16  VAL 16  60  60  VAL VAL A . n 
A 1 17  ALA 17  61  61  ALA ALA A . n 
A 1 18  LYS 18  62  62  LYS LYS A . n 
A 1 19  LEU 19  63  63  LEU LEU A . n 
A 1 20  ALA 20  64  64  ALA ALA A . n 
A 1 21  ASN 21  65  65  ASN ASN A . n 
A 1 22  ASN 22  66  66  ASN ASN A . n 
A 1 23  THR 23  67  67  THR THR A . n 
A 1 24  HIS 24  68  68  HIS HIS A . n 
A 1 25  GLN 25  69  69  GLN GLN A . n 
A 1 26  HIS 26  70  70  HIS HIS A . n 
A 1 27  VAL 27  71  71  VAL VAL A . n 
A 1 28  PHE 28  72  72  PHE PHE A . n 
A 1 29  ASP 29  73  73  ASP ASP A . n 
A 1 30  ASP 30  74  74  ASP ASP A . n 
A 1 31  LEU 31  75  75  LEU LEU A . n 
A 1 32  ARG 32  76  76  ARG ARG A . n 
A 1 33  GLY 33  77  77  GLY GLY A . n 
A 1 34  SER 34  78  78  SER SER A . n 
A 1 35  VAL 35  79  79  VAL VAL A . n 
A 1 36  SER 36  80  80  SER SER A . n 
A 1 37  LEU 37  81  81  LEU LEU A . n 
A 1 38  SER 38  82  82  SER SER A . n 
A 1 39  TRP 39  83  83  TRP TRP A . n 
A 1 40  VAL 40  84  84  VAL VAL A . n 
A 1 41  GLY 41  85  85  GLY GLY A . n 
A 1 42  ASP 42  86  86  ASP ASP A . n 
A 1 43  SER 43  87  87  SER SER A . n 
A 1 44  THR 44  88  88  THR THR A . n 
A 1 45  GLY 45  89  89  GLY GLY A . n 
A 1 46  VAL 46  90  90  VAL VAL A . n 
A 1 47  ILE 47  91  91  ILE ILE A . n 
A 1 48  LEU 48  92  92  LEU LEU A . n 
A 1 49  VAL 49  93  93  VAL VAL A . n 
A 1 50  LEU 50  94  94  LEU LEU A . n 
A 1 51  THR 51  95  95  THR THR A . n 
A 1 52  THR 52  96  96  THR THR A . n 
A 1 53  PHE 53  97  97  PHE PHE A . n 
A 1 54  HIS 54  98  98  HIS HIS A . n 
A 1 55  VAL 55  99  99  VAL VAL A . n 
A 1 56  PRO 56  100 100 PRO PRO A . n 
A 1 57  LEU 57  101 101 LEU LEU A . n 
A 1 58  VAL 58  102 ?   ?   ?   A . n 
A 1 59  ILE 59  103 ?   ?   ?   A . n 
A 1 60  MET 60  104 ?   ?   ?   A . n 
A 1 61  THR 61  105 ?   ?   ?   A . n 
A 1 62  PHE 62  106 ?   ?   ?   A . n 
A 1 63  GLY 63  107 107 GLY GLY A . n 
A 1 64  GLN 64  108 108 GLN GLN A . n 
A 1 65  SER 65  109 109 SER SER A . n 
A 1 66  LYS 66  110 110 LYS LYS A . n 
A 1 67  LEU 67  111 111 LEU LEU A . n 
A 1 68  TYR 68  112 112 TYR TYR A . n 
A 1 69  ARG 69  113 113 ARG ARG A . n 
A 1 70  SER 70  114 114 SER SER A . n 
A 1 71  GLU 71  115 115 GLU GLU A . n 
A 1 72  ASP 72  116 116 ASP ASP A . n 
A 1 73  TYR 73  117 117 TYR TYR A . n 
A 1 74  GLY 74  118 118 GLY GLY A . n 
A 1 75  LYS 75  119 119 LYS LYS A . n 
A 1 76  ASN 76  120 120 ASN ASN A . n 
A 1 77  PHE 77  121 121 PHE PHE A . n 
A 1 78  LYS 78  122 122 LYS LYS A . n 
A 1 79  ASP 79  123 123 ASP ASP A . n 
A 1 80  ILE 80  124 124 ILE ILE A . n 
A 1 81  THR 81  125 125 THR THR A . n 
A 1 82  ASP 82  126 126 ASP ASP A . n 
A 1 83  LEU 83  127 127 LEU LEU A . n 
A 1 84  ILE 84  128 128 ILE ILE A . n 
A 1 85  ASN 85  129 129 ASN ASN A . n 
A 1 86  ASN 86  130 130 ASN ASN A . n 
A 1 87  THR 87  131 131 THR THR A . n 
A 1 88  PHE 88  132 132 PHE PHE A . n 
A 1 89  ILE 89  133 133 ILE ILE A . n 
A 1 90  ARG 90  134 134 ARG ARG A . n 
A 1 91  THR 91  135 135 THR THR A . n 
A 1 92  GLU 92  136 136 GLU GLU A . n 
A 1 93  PHE 93  137 137 PHE PHE A . n 
A 1 94  GLY 94  138 138 GLY GLY A . n 
A 1 95  MET 95  139 139 MET MET A . n 
A 1 96  ALA 96  140 140 ALA ALA A . n 
A 1 97  ILE 97  141 141 ILE ILE A . n 
A 1 98  GLY 98  142 142 GLY GLY A . n 
A 1 99  PRO 99  143 143 PRO PRO A . n 
A 1 100 GLU 100 144 144 GLU GLU A . n 
A 1 101 ASN 101 145 145 ASN ASN A . n 
A 1 102 SER 102 146 146 SER SER A . n 
A 1 103 GLY 103 147 147 GLY GLY A . n 
A 1 104 LYS 104 148 148 LYS LYS A . n 
A 1 105 VAL 105 149 149 VAL VAL A . n 
A 1 106 VAL 106 150 150 VAL VAL A . n 
A 1 107 LEU 107 151 151 LEU LEU A . n 
A 1 108 THR 108 152 152 THR THR A . n 
A 1 109 ALA 109 153 153 ALA ALA A . n 
A 1 110 GLU 110 154 154 GLU GLU A . n 
A 1 111 VAL 111 155 155 VAL VAL A . n 
A 1 112 SER 112 156 156 SER SER A . n 
A 1 113 GLY 113 157 157 GLY GLY A . n 
A 1 114 GLY 114 158 158 GLY GLY A . n 
A 1 115 SER 115 159 159 SER SER A . n 
A 1 116 ARG 116 160 160 ARG ARG A . n 
A 1 117 GLY 117 161 161 GLY GLY A . n 
A 1 118 GLY 118 162 162 GLY GLY A . n 
A 1 119 ARG 119 163 163 ARG ARG A . n 
A 1 120 ILE 120 164 164 ILE ILE A . n 
A 1 121 PHE 121 165 165 PHE PHE A . n 
A 1 122 ARG 122 166 166 ARG ARG A . n 
A 1 123 SER 123 167 167 SER SER A . n 
A 1 124 SER 124 168 168 SER SER A . n 
A 1 125 ASP 125 169 169 ASP ASP A . n 
A 1 126 PHE 126 170 170 PHE PHE A . n 
A 1 127 ALA 127 171 171 ALA ALA A . n 
A 1 128 LYS 128 172 172 LYS LYS A . n 
A 1 129 ASN 129 173 173 ASN ASN A . n 
A 1 130 PHE 130 174 174 PHE PHE A . n 
A 1 131 VAL 131 175 175 VAL VAL A . n 
A 1 132 GLN 132 176 176 GLN GLN A . n 
A 1 133 THR 133 177 177 THR THR A . n 
A 1 134 ASP 134 178 178 ASP ASP A . n 
A 1 135 LEU 135 179 179 LEU LEU A . n 
A 1 136 PRO 136 180 180 PRO PRO A . n 
A 1 137 PHE 137 181 181 PHE PHE A . n 
A 1 138 HIS 138 182 182 HIS HIS A . n 
A 1 139 PRO 139 183 183 PRO PRO A . n 
A 1 140 LEU 140 184 184 LEU LEU A . n 
A 1 141 THR 141 185 185 THR THR A . n 
A 1 142 GLN 142 186 186 GLN GLN A . n 
A 1 143 MET 143 187 187 MET MET A . n 
A 1 144 MET 144 188 188 MET MET A . n 
A 1 145 TYR 145 189 189 TYR TYR A . n 
A 1 146 SER 146 190 190 SER SER A . n 
A 1 147 PRO 147 191 191 PRO PRO A . n 
A 1 148 GLN 148 192 192 GLN GLN A . n 
A 1 149 ASN 149 193 193 ASN ASN A . n 
A 1 150 SER 150 194 194 SER SER A . n 
A 1 151 ASP 151 195 195 ASP ASP A . n 
A 1 152 TYR 152 196 196 TYR TYR A . n 
A 1 153 LEU 153 197 197 LEU LEU A . n 
A 1 154 LEU 154 198 198 LEU LEU A . n 
A 1 155 ALA 155 199 199 ALA ALA A . n 
A 1 156 LEU 156 200 200 LEU LEU A . n 
A 1 157 SER 157 201 201 SER SER A . n 
A 1 158 THR 158 202 202 THR THR A . n 
A 1 159 GLU 159 203 203 GLU GLU A . n 
A 1 160 ASN 160 204 204 ASN ASN A . n 
A 1 161 GLY 161 205 205 GLY GLY A . n 
A 1 162 LEU 162 206 206 LEU LEU A . n 
A 1 163 TRP 163 207 207 TRP TRP A . n 
A 1 164 VAL 164 208 208 VAL VAL A . n 
A 1 165 SER 165 209 209 SER SER A . n 
A 1 166 LYS 166 210 210 LYS LYS A . n 
A 1 167 ASN 167 211 211 ASN ASN A . n 
A 1 168 PHE 168 212 212 PHE PHE A . n 
A 1 169 GLY 169 213 213 GLY GLY A . n 
A 1 170 GLY 170 214 214 GLY GLY A . n 
A 1 171 LYS 171 215 215 LYS LYS A . n 
A 1 172 TRP 172 216 216 TRP TRP A . n 
A 1 173 GLU 173 217 217 GLU GLU A . n 
A 1 174 GLU 174 218 218 GLU GLU A . n 
A 1 175 ILE 175 219 219 ILE ILE A . n 
A 1 176 HIS 176 220 220 HIS HIS A . n 
A 1 177 LYS 177 221 221 LYS LYS A . n 
A 1 178 ALA 178 222 222 ALA ALA A . n 
A 1 179 VAL 179 223 223 VAL VAL A . n 
A 1 180 CYS 180 224 224 CYS CYS A . n 
A 1 181 LEU 181 225 225 LEU LEU A . n 
A 1 182 ALA 182 226 226 ALA ALA A . n 
A 1 183 LYS 183 227 227 LYS LYS A . n 
A 1 184 TRP 184 228 228 TRP TRP A . n 
A 1 185 GLY 185 229 229 GLY GLY A . n 
A 1 186 SER 186 230 230 SER SER A . n 
A 1 187 ASP 187 231 231 ASP ASP A . n 
A 1 188 ASN 188 232 232 ASN ASN A . n 
A 1 189 THR 189 233 233 THR THR A . n 
A 1 190 ILE 190 234 234 ILE ILE A . n 
A 1 191 PHE 191 235 235 PHE PHE A . n 
A 1 192 PHE 192 236 236 PHE PHE A . n 
A 1 193 THR 193 237 237 THR THR A . n 
A 1 194 THR 194 238 238 THR THR A . n 
A 1 195 TYR 195 239 239 TYR TYR A . n 
A 1 196 ALA 196 240 240 ALA ALA A . n 
A 1 197 ASN 197 241 241 ASN ASN A . n 
A 1 198 GLY 198 242 242 GLY GLY A . n 
A 1 199 SER 199 243 243 SER SER A . n 
A 1 200 CYS 200 244 244 CYS CYS A . n 
A 1 201 LYS 201 245 245 LYS LYS A . n 
A 1 202 ALA 202 246 246 ALA ALA A . n 
A 1 203 ASP 203 247 247 ASP ASP A . n 
A 1 204 LEU 204 248 248 LEU LEU A . n 
A 1 205 GLY 205 249 249 GLY GLY A . n 
A 1 206 ALA 206 250 250 ALA ALA A . n 
A 1 207 LEU 207 251 251 LEU LEU A . n 
A 1 208 GLU 208 252 252 GLU GLU A . n 
A 1 209 LEU 209 253 253 LEU LEU A . n 
A 1 210 TRP 210 254 254 TRP TRP A . n 
A 1 211 ARG 211 255 255 ARG ARG A . n 
A 1 212 THR 212 256 256 THR THR A . n 
A 1 213 SER 213 257 257 SER SER A . n 
A 1 214 ASP 214 258 258 ASP ASP A . n 
A 1 215 LEU 215 259 259 LEU LEU A . n 
A 1 216 GLY 216 260 260 GLY GLY A . n 
A 1 217 LYS 217 261 261 LYS LYS A . n 
A 1 218 SER 218 262 262 SER SER A . n 
A 1 219 PHE 219 263 263 PHE PHE A . n 
A 1 220 LYS 220 264 264 LYS LYS A . n 
A 1 221 THR 221 265 265 THR THR A . n 
A 1 222 ILE 222 266 266 ILE ILE A . n 
A 1 223 GLY 223 267 267 GLY GLY A . n 
A 1 224 VAL 224 268 268 VAL VAL A . n 
A 1 225 LYS 225 269 269 LYS LYS A . n 
A 1 226 ILE 226 270 270 ILE ILE A . n 
A 1 227 TYR 227 271 271 TYR TYR A . n 
A 1 228 SER 228 272 272 SER SER A . n 
A 1 229 PHE 229 273 273 PHE PHE A . n 
A 1 230 GLY 230 274 274 GLY GLY A . n 
A 1 231 LEU 231 275 275 LEU LEU A . n 
A 1 232 GLY 232 276 276 GLY GLY A . n 
A 1 233 GLY 233 277 277 GLY GLY A . n 
A 1 234 ARG 234 278 278 ARG ARG A . n 
A 1 235 PHE 235 279 279 PHE PHE A . n 
A 1 236 LEU 236 280 280 LEU LEU A . n 
A 1 237 PHE 237 281 281 PHE PHE A . n 
A 1 238 ALA 238 282 282 ALA ALA A . n 
A 1 239 SER 239 283 283 SER SER A . n 
A 1 240 VAL 240 284 284 VAL VAL A . n 
A 1 241 MET 241 285 285 MET MET A . n 
A 1 242 ALA 242 286 286 ALA ALA A . n 
A 1 243 ASP 243 287 287 ASP ASP A . n 
A 1 244 LYS 244 288 288 LYS LYS A . n 
A 1 245 ASP 245 289 289 ASP ASP A . n 
A 1 246 THR 246 290 290 THR THR A . n 
A 1 247 THR 247 291 291 THR THR A . n 
A 1 248 ARG 248 292 292 ARG ARG A . n 
A 1 249 ARG 249 293 293 ARG ARG A . n 
A 1 250 ILE 250 294 294 ILE ILE A . n 
A 1 251 HIS 251 295 295 HIS HIS A . n 
A 1 252 VAL 252 296 296 VAL VAL A . n 
A 1 253 SER 253 297 297 SER SER A . n 
A 1 254 THR 254 298 298 THR THR A . n 
A 1 255 ASP 255 299 299 ASP ASP A . n 
A 1 256 GLN 256 300 300 GLN GLN A . n 
A 1 257 GLY 257 301 301 GLY GLY A . n 
A 1 258 ASP 258 302 302 ASP ASP A . n 
A 1 259 THR 259 303 303 THR THR A . n 
A 1 260 TRP 260 304 304 TRP TRP A . n 
A 1 261 SER 261 305 305 SER SER A . n 
A 1 262 MET 262 306 306 MET MET A . n 
A 1 263 ALA 263 307 307 ALA ALA A . n 
A 1 264 GLN 264 308 308 GLN GLN A . n 
A 1 265 LEU 265 309 309 LEU LEU A . n 
A 1 266 PRO 266 310 310 PRO PRO A . n 
A 1 267 SER 267 311 311 SER SER A . n 
A 1 268 VAL 268 312 312 VAL VAL A . n 
A 1 269 GLY 269 313 313 GLY GLY A . n 
A 1 270 GLN 270 314 314 GLN GLN A . n 
A 1 271 GLU 271 315 315 GLU GLU A . n 
A 1 272 GLN 272 316 316 GLN GLN A . n 
A 1 273 PHE 273 317 317 PHE PHE A . n 
A 1 274 TYR 274 318 318 TYR TYR A . n 
A 1 275 SER 275 319 319 SER SER A . n 
A 1 276 ILE 276 320 320 ILE ILE A . n 
A 1 277 LEU 277 321 321 LEU LEU A . n 
A 1 278 ALA 278 322 322 ALA ALA A . n 
A 1 279 ALA 279 323 323 ALA ALA A . n 
A 1 280 ASN 280 324 324 ASN ASN A . n 
A 1 281 ASP 281 325 325 ASP ASP A . n 
A 1 282 ASP 282 326 326 ASP ASP A . n 
A 1 283 MET 283 327 327 MET MET A . n 
A 1 284 VAL 284 328 328 VAL VAL A . n 
A 1 285 PHE 285 329 329 PHE PHE A . n 
A 1 286 MET 286 330 330 MET MET A . n 
A 1 287 HIS 287 331 331 HIS HIS A . n 
A 1 288 VAL 288 332 332 VAL VAL A . n 
A 1 289 ASP 289 333 333 ASP ASP A . n 
A 1 290 GLU 290 334 334 GLU GLU A . n 
A 1 291 PRO 291 335 335 PRO PRO A . n 
A 1 292 GLY 292 336 336 GLY GLY A . n 
A 1 293 ASP 293 337 337 ASP ASP A . n 
A 1 294 THR 294 338 338 THR THR A . n 
A 1 295 GLY 295 339 339 GLY GLY A . n 
A 1 296 PHE 296 340 340 PHE PHE A . n 
A 1 297 GLY 297 341 341 GLY GLY A . n 
A 1 298 THR 298 342 342 THR THR A . n 
A 1 299 ILE 299 343 343 ILE ILE A . n 
A 1 300 PHE 300 344 344 PHE PHE A . n 
A 1 301 THR 301 345 345 THR THR A . n 
A 1 302 SER 302 346 346 SER SER A . n 
A 1 303 ASP 303 347 347 ASP ASP A . n 
A 1 304 ASP 304 348 348 ASP ASP A . n 
A 1 305 ARG 305 349 349 ARG ARG A . n 
A 1 306 GLY 306 350 350 GLY GLY A . n 
A 1 307 ILE 307 351 351 ILE ILE A . n 
A 1 308 VAL 308 352 352 VAL VAL A . n 
A 1 309 TYR 309 353 353 TYR TYR A . n 
A 1 310 SER 310 354 354 SER SER A . n 
A 1 311 LYS 311 355 355 LYS LYS A . n 
A 1 312 SER 312 356 356 SER SER A . n 
A 1 313 LEU 313 357 357 LEU LEU A . n 
A 1 314 ASP 314 358 358 ASP ASP A . n 
A 1 315 ARG 315 359 359 ARG ARG A . n 
A 1 316 HIS 316 360 360 HIS HIS A . n 
A 1 317 LEU 317 361 361 LEU LEU A . n 
A 1 318 TYR 318 362 362 TYR TYR A . n 
A 1 319 THR 319 363 363 THR THR A . n 
A 1 320 THR 320 364 364 THR THR A . n 
A 1 321 THR 321 365 365 THR THR A . n 
A 1 322 GLY 322 366 366 GLY GLY A . n 
A 1 323 GLY 323 367 367 GLY GLY A . n 
A 1 324 GLU 324 368 368 GLU GLU A . n 
A 1 325 THR 325 369 369 THR THR A . n 
A 1 326 ASP 326 370 370 ASP ASP A . n 
A 1 327 PHE 327 371 371 PHE PHE A . n 
A 1 328 THR 328 372 372 THR THR A . n 
A 1 329 ASN 329 373 373 ASN ASN A . n 
A 1 330 VAL 330 374 374 VAL VAL A . n 
A 1 331 THR 331 375 375 THR THR A . n 
A 1 332 SER 332 376 376 SER SER A . n 
A 1 333 LEU 333 377 377 LEU LEU A . n 
A 1 334 ARG 334 378 378 ARG ARG A . n 
A 1 335 GLY 335 379 379 GLY GLY A . n 
A 1 336 VAL 336 380 380 VAL VAL A . n 
A 1 337 TYR 337 381 381 TYR TYR A . n 
A 1 338 ILE 338 382 382 ILE ILE A . n 
A 1 339 THR 339 383 383 THR THR A . n 
A 1 340 SER 340 384 384 SER SER A . n 
A 1 341 VAL 341 385 385 VAL VAL A . n 
A 1 342 LEU 342 386 386 LEU LEU A . n 
A 1 343 SER 343 387 387 SER SER A . n 
A 1 344 GLU 344 388 388 GLU GLU A . n 
A 1 345 ASP 345 389 389 ASP ASP A . n 
A 1 346 ASN 346 390 390 ASN ASN A . n 
A 1 347 SER 347 391 391 SER SER A . n 
A 1 348 ILE 348 392 392 ILE ILE A . n 
A 1 349 GLN 349 393 393 GLN GLN A . n 
A 1 350 THR 350 394 394 THR THR A . n 
A 1 351 MET 351 395 395 MET MET A . n 
A 1 352 ILE 352 396 396 ILE ILE A . n 
A 1 353 THR 353 397 397 THR THR A . n 
A 1 354 PHE 354 398 398 PHE PHE A . n 
A 1 355 ASP 355 399 399 ASP ASP A . n 
A 1 356 GLN 356 400 400 GLN GLN A . n 
A 1 357 GLY 357 401 401 GLY GLY A . n 
A 1 358 GLY 358 402 402 GLY GLY A . n 
A 1 359 ARG 359 403 403 ARG ARG A . n 
A 1 360 TRP 360 404 404 TRP TRP A . n 
A 1 361 THR 361 405 405 THR THR A . n 
A 1 362 HIS 362 406 406 HIS HIS A . n 
A 1 363 LEU 363 407 407 LEU LEU A . n 
A 1 364 ARG 364 408 408 ARG ARG A . n 
A 1 365 LYS 365 409 409 LYS LYS A . n 
A 1 366 PRO 366 410 410 PRO PRO A . n 
A 1 367 GLU 367 411 411 GLU GLU A . n 
A 1 368 ASN 368 412 412 ASN ASN A . n 
A 1 369 SER 369 413 413 SER SER A . n 
A 1 370 GLU 370 414 414 GLU GLU A . n 
A 1 371 CYS 371 415 415 CYS CYS A . n 
A 1 372 ASP 372 416 416 ASP ASP A . n 
A 1 373 ALA 373 417 417 ALA ALA A . n 
A 1 374 THR 374 418 418 THR THR A . n 
A 1 375 ALA 375 419 419 ALA ALA A . n 
A 1 376 LYS 376 420 420 LYS LYS A . n 
A 1 377 ASN 377 421 421 ASN ASN A . n 
A 1 378 LYS 378 422 422 LYS LYS A . n 
A 1 379 ASN 379 423 423 ASN ASN A . n 
A 1 380 GLU 380 424 424 GLU GLU A . n 
A 1 381 CYS 381 425 425 CYS CYS A . n 
A 1 382 SER 382 426 426 SER SER A . n 
A 1 383 LEU 383 427 427 LEU LEU A . n 
A 1 384 HIS 384 428 428 HIS HIS A . n 
A 1 385 ILE 385 429 429 ILE ILE A . n 
A 1 386 HIS 386 430 430 HIS HIS A . n 
A 1 387 ALA 387 431 431 ALA ALA A . n 
A 1 388 SER 388 432 432 SER SER A . n 
A 1 389 TYR 389 433 433 TYR TYR A . n 
A 1 390 SER 390 434 434 SER SER A . n 
A 1 391 ILE 391 435 435 ILE ILE A . n 
A 1 392 SER 392 436 436 SER SER A . n 
A 1 393 GLN 393 437 437 GLN GLN A . n 
A 1 394 LYS 394 438 438 LYS LYS A . n 
A 1 395 LEU 395 439 439 LEU LEU A . n 
A 1 396 ASN 396 440 440 ASN ASN A . n 
A 1 397 VAL 397 441 441 VAL VAL A . n 
A 1 398 PRO 398 442 442 PRO PRO A . n 
A 1 399 MET 399 443 443 MET MET A . n 
A 1 400 ALA 400 444 444 ALA ALA A . n 
A 1 401 PRO 401 445 445 PRO PRO A . n 
A 1 402 LEU 402 446 446 LEU LEU A . n 
A 1 403 SER 403 447 447 SER SER A . n 
A 1 404 GLU 404 448 448 GLU GLU A . n 
A 1 405 PRO 405 449 449 PRO PRO A . n 
A 1 406 ASN 406 450 450 ASN ASN A . n 
A 1 407 ALA 407 451 451 ALA ALA A . n 
A 1 408 VAL 408 452 452 VAL VAL A . n 
A 1 409 GLY 409 453 453 GLY GLY A . n 
A 1 410 ILE 410 454 454 ILE ILE A . n 
A 1 411 VAL 411 455 455 VAL VAL A . n 
A 1 412 ILE 412 456 456 ILE ILE A . n 
A 1 413 ALA 413 457 457 ALA ALA A . n 
A 1 414 HIS 414 458 458 HIS HIS A . n 
A 1 415 GLY 415 459 459 GLY GLY A . n 
A 1 416 SER 416 460 460 SER SER A . n 
A 1 417 VAL 417 461 461 VAL VAL A . n 
A 1 418 GLY 418 462 462 GLY GLY A . n 
A 1 419 ASP 419 463 463 ASP ASP A . n 
A 1 420 ALA 420 464 464 ALA ALA A . n 
A 1 421 ILE 421 465 465 ILE ILE A . n 
A 1 422 SER 422 466 466 SER SER A . n 
A 1 423 VAL 423 467 467 VAL VAL A . n 
A 1 424 MET 424 468 468 MET MET A . n 
A 1 425 VAL 425 469 469 VAL VAL A . n 
A 1 426 PRO 426 470 470 PRO PRO A . n 
A 1 427 ASP 427 471 471 ASP ASP A . n 
A 1 428 VAL 428 472 472 VAL VAL A . n 
A 1 429 TYR 429 473 473 TYR TYR A . n 
A 1 430 ILE 430 474 474 ILE ILE A . n 
A 1 431 SER 431 475 475 SER SER A . n 
A 1 432 ASP 432 476 476 ASP ASP A . n 
A 1 433 ASP 433 477 477 ASP ASP A . n 
A 1 434 GLY 434 478 478 GLY GLY A . n 
A 1 435 GLY 435 479 479 GLY GLY A . n 
A 1 436 TYR 436 480 480 TYR TYR A . n 
A 1 437 SER 437 481 481 SER SER A . n 
A 1 438 TRP 438 482 482 TRP TRP A . n 
A 1 439 THR 439 483 483 THR THR A . n 
A 1 440 LYS 440 484 484 LYS LYS A . n 
A 1 441 MET 441 485 485 MET MET A . n 
A 1 442 LEU 442 486 486 LEU LEU A . n 
A 1 443 GLU 443 487 487 GLU GLU A . n 
A 1 444 GLY 444 488 488 GLY GLY A . n 
A 1 445 PRO 445 489 489 PRO PRO A . n 
A 1 446 HIS 446 490 490 HIS HIS A . n 
A 1 447 TYR 447 491 491 TYR TYR A . n 
A 1 448 TYR 448 492 492 TYR TYR A . n 
A 1 449 THR 449 493 493 THR THR A . n 
A 1 450 ILE 450 494 494 ILE ILE A . n 
A 1 451 LEU 451 495 495 LEU LEU A . n 
A 1 452 ASP 452 496 496 ASP ASP A . n 
A 1 453 SER 453 497 497 SER SER A . n 
A 1 454 GLY 454 498 498 GLY GLY A . n 
A 1 455 GLY 455 499 499 GLY GLY A . n 
A 1 456 ILE 456 500 500 ILE ILE A . n 
A 1 457 ILE 457 501 501 ILE ILE A . n 
A 1 458 VAL 458 502 502 VAL VAL A . n 
A 1 459 ALA 459 503 503 ALA ALA A . n 
A 1 460 ILE 460 504 504 ILE ILE A . n 
A 1 461 GLU 461 505 505 GLU GLU A . n 
A 1 462 HIS 462 506 506 HIS HIS A . n 
A 1 463 SER 463 507 507 SER SER A . n 
A 1 464 SER 464 508 508 SER SER A . n 
A 1 465 ARG 465 509 509 ARG ARG A . n 
A 1 466 PRO 466 510 510 PRO PRO A . n 
A 1 467 ILE 467 511 511 ILE ILE A . n 
A 1 468 ASN 468 512 512 ASN ASN A . n 
A 1 469 VAL 469 513 513 VAL VAL A . n 
A 1 470 ILE 470 514 514 ILE ILE A . n 
A 1 471 LYS 471 515 515 LYS LYS A . n 
A 1 472 PHE 472 516 516 PHE PHE A . n 
A 1 473 SER 473 517 517 SER SER A . n 
A 1 474 THR 474 518 518 THR THR A . n 
A 1 475 ASP 475 519 519 ASP ASP A . n 
A 1 476 GLU 476 520 520 GLU GLU A . n 
A 1 477 GLY 477 521 521 GLY GLY A . n 
A 1 478 GLN 478 522 522 GLN GLN A . n 
A 1 479 CYS 479 523 523 CYS CYS A . n 
A 1 480 TRP 480 524 524 TRP TRP A . n 
A 1 481 GLN 481 525 525 GLN GLN A . n 
A 1 482 THR 482 526 526 THR THR A . n 
A 1 483 TYR 483 527 527 TYR TYR A . n 
A 1 484 THR 484 528 528 THR THR A . n 
A 1 485 PHE 485 529 529 PHE PHE A . n 
A 1 486 THR 486 530 530 THR THR A . n 
A 1 487 ARG 487 531 531 ARG ARG A . n 
A 1 488 ASP 488 532 532 ASP ASP A . n 
A 1 489 PRO 489 533 533 PRO PRO A . n 
A 1 490 ILE 490 534 534 ILE ILE A . n 
A 1 491 TYR 491 535 535 TYR TYR A . n 
A 1 492 PHE 492 536 536 PHE PHE A . n 
A 1 493 THR 493 537 537 THR THR A . n 
A 1 494 GLY 494 538 538 GLY GLY A . n 
A 1 495 LEU 495 539 539 LEU LEU A . n 
A 1 496 ALA 496 540 540 ALA ALA A . n 
A 1 497 SER 497 541 541 SER SER A . n 
A 1 498 GLU 498 542 542 GLU GLU A . n 
A 1 499 PRO 499 543 543 PRO PRO A . n 
A 1 500 GLY 500 544 544 GLY GLY A . n 
A 1 501 ALA 501 545 545 ALA ALA A . n 
A 1 502 ARG 502 546 546 ARG ARG A . n 
A 1 503 SER 503 547 547 SER SER A . n 
A 1 504 MET 504 548 548 MET MET A . n 
A 1 505 ASN 505 549 549 ASN ASN A . n 
A 1 506 ILE 506 550 550 ILE ILE A . n 
A 1 507 SER 507 551 551 SER SER A . n 
A 1 508 ILE 508 552 552 ILE ILE A . n 
A 1 509 TRP 509 553 553 TRP TRP A . n 
A 1 510 GLY 510 554 554 GLY GLY A . n 
A 1 511 PHE 511 555 555 PHE PHE A . n 
A 1 512 THR 512 556 556 THR THR A . n 
A 1 513 GLU 513 557 557 GLU GLU A . n 
A 1 514 SER 514 558 558 SER SER A . n 
A 1 515 PHE 515 559 559 PHE PHE A . n 
A 1 516 LEU 516 560 560 LEU LEU A . n 
A 1 517 THR 517 561 561 THR THR A . n 
A 1 518 SER 518 562 562 SER SER A . n 
A 1 519 GLN 519 563 563 GLN GLN A . n 
A 1 520 TRP 520 564 564 TRP TRP A . n 
A 1 521 VAL 521 565 565 VAL VAL A . n 
A 1 522 SER 522 566 566 SER SER A . n 
A 1 523 TYR 523 567 567 TYR TYR A . n 
A 1 524 THR 524 568 568 THR THR A . n 
A 1 525 ILE 525 569 569 ILE ILE A . n 
A 1 526 ASP 526 570 570 ASP ASP A . n 
A 1 527 PHE 527 571 571 PHE PHE A . n 
A 1 528 LYS 528 572 572 LYS LYS A . n 
A 1 529 ASP 529 573 573 ASP ASP A . n 
A 1 530 ILE 530 574 574 ILE ILE A . n 
A 1 531 LEU 531 575 575 LEU LEU A . n 
A 1 532 GLU 532 576 576 GLU GLU A . n 
A 1 533 ARG 533 577 577 ARG ARG A . n 
A 1 534 ASN 534 578 578 ASN ASN A . n 
A 1 535 CYS 535 579 579 CYS CYS A . n 
A 1 536 GLU 536 580 580 GLU GLU A . n 
A 1 537 GLU 537 581 581 GLU GLU A . n 
A 1 538 LYS 538 582 582 LYS LYS A . n 
A 1 539 ASP 539 583 583 ASP ASP A . n 
A 1 540 TYR 540 584 584 TYR TYR A . n 
A 1 541 THR 541 585 585 THR THR A . n 
A 1 542 ILE 542 586 586 ILE ILE A . n 
A 1 543 TRP 543 587 587 TRP TRP A . n 
A 1 544 LEU 544 588 588 LEU LEU A . n 
A 1 545 ALA 545 589 589 ALA ALA A . n 
A 1 546 HIS 546 590 590 HIS HIS A . n 
A 1 547 SER 547 591 591 SER SER A . n 
A 1 548 THR 548 592 592 THR THR A . n 
A 1 549 ASP 549 593 593 ASP ASP A . n 
A 1 550 PRO 550 594 594 PRO PRO A . n 
A 1 551 GLU 551 595 595 GLU GLU A . n 
A 1 552 ASP 552 596 596 ASP ASP A . n 
A 1 553 TYR 553 597 597 TYR TYR A . n 
A 1 554 GLU 554 598 598 GLU GLU A . n 
A 1 555 ASP 555 599 599 ASP ASP A . n 
A 1 556 GLY 556 600 600 GLY GLY A . n 
A 1 557 CYS 557 601 601 CYS CYS A . n 
A 1 558 ILE 558 602 602 ILE ILE A . n 
A 1 559 LEU 559 603 603 LEU LEU A . n 
A 1 560 GLY 560 604 604 GLY GLY A . n 
A 1 561 TYR 561 605 605 TYR TYR A . n 
A 1 562 LYS 562 606 606 LYS LYS A . n 
A 1 563 GLU 563 607 607 GLU GLU A . n 
A 1 564 GLN 564 608 608 GLN GLN A . n 
A 1 565 PHE 565 609 609 PHE PHE A . n 
A 1 566 LEU 566 610 610 LEU LEU A . n 
A 1 567 ARG 567 611 611 ARG ARG A . n 
A 1 568 LEU 568 612 612 LEU LEU A . n 
A 1 569 ARG 569 613 613 ARG ARG A . n 
A 1 570 LYS 570 614 614 LYS LYS A . n 
A 1 571 SER 571 615 615 SER SER A . n 
A 1 572 SER 572 616 616 SER SER A . n 
A 1 573 MET 573 617 617 MET MET A . n 
A 1 574 CYS 574 618 618 CYS CYS A . n 
A 1 575 GLN 575 619 619 GLN GLN A . n 
A 1 576 ASN 576 620 620 ASN ASN A . n 
A 1 577 GLY 577 621 621 GLY GLY A . n 
A 1 578 ARG 578 622 622 ARG ARG A . n 
A 1 579 ASP 579 623 623 ASP ASP A . n 
A 1 580 TYR 580 624 624 TYR TYR A . n 
A 1 581 VAL 581 625 625 VAL VAL A . n 
A 1 582 VAL 582 626 626 VAL VAL A . n 
A 1 583 THR 583 627 627 THR THR A . n 
A 1 584 LYS 584 628 628 LYS LYS A . n 
A 1 585 GLN 585 629 629 GLN GLN A . n 
A 1 586 PRO 586 630 630 PRO PRO A . n 
A 1 587 SER 587 631 631 SER SER A . n 
A 1 588 ILE 588 632 632 ILE ILE A . n 
A 1 589 CYS 589 633 633 CYS CYS A . n 
A 1 590 LEU 590 634 634 LEU LEU A . n 
A 1 591 CYS 591 635 635 CYS CYS A . n 
A 1 592 SER 592 636 636 SER SER A . n 
A 1 593 LEU 593 637 637 LEU LEU A . n 
A 1 594 GLU 594 638 638 GLU GLU A . n 
A 1 595 ASP 595 639 639 ASP ASP A . n 
A 1 596 PHE 596 640 640 PHE PHE A . n 
A 1 597 LEU 597 641 641 LEU LEU A . n 
A 1 598 CYS 598 642 642 CYS CYS A . n 
A 1 599 ASP 599 643 643 ASP ASP A . n 
A 1 600 PHE 600 644 644 PHE PHE A . n 
A 1 601 GLY 601 645 645 GLY GLY A . n 
A 1 602 TYR 602 646 646 TYR TYR A . n 
A 1 603 TYR 603 647 647 TYR TYR A . n 
A 1 604 ARG 604 648 648 ARG ARG A . n 
A 1 605 PRO 605 649 649 PRO PRO A . n 
A 1 606 GLU 606 650 650 GLU GLU A . n 
A 1 607 ASN 607 651 651 ASN ASN A . n 
A 1 608 ASP 608 652 652 ASP ASP A . n 
A 1 609 SER 609 653 653 SER SER A . n 
A 1 610 LYS 610 654 654 LYS LYS A . n 
A 1 611 CYS 611 655 655 CYS CYS A . n 
A 1 612 VAL 612 656 656 VAL VAL A . n 
A 1 613 GLU 613 657 657 GLU GLU A . n 
A 1 614 GLN 614 658 658 GLN GLN A . n 
A 1 615 PRO 615 659 659 PRO PRO A . n 
A 1 616 GLU 616 660 660 GLU GLU A . n 
A 1 617 LEU 617 661 661 LEU LEU A . n 
A 1 618 LYS 618 662 662 LYS LYS A . n 
A 1 619 GLY 619 663 663 GLY GLY A . n 
A 1 620 HIS 620 664 664 HIS HIS A . n 
A 1 621 ASP 621 665 665 ASP ASP A . n 
A 1 622 LEU 622 666 666 LEU LEU A . n 
A 1 623 GLU 623 667 667 GLU GLU A . n 
A 1 624 PHE 624 668 668 PHE PHE A . n 
A 1 625 CYS 625 669 669 CYS CYS A . n 
A 1 626 LEU 626 670 670 LEU LEU A . n 
A 1 627 TYR 627 671 671 TYR TYR A . n 
A 1 628 GLY 628 672 672 GLY GLY A . n 
A 1 629 ARG 629 673 673 ARG ARG A . n 
A 1 630 GLU 630 674 674 GLU GLU A . n 
A 1 631 GLU 631 675 675 GLU GLU A . n 
A 1 632 HIS 632 676 676 HIS HIS A . n 
A 1 633 LEU 633 677 677 LEU LEU A . n 
A 1 634 THR 634 678 678 THR THR A . n 
A 1 635 THR 635 679 679 THR THR A . n 
A 1 636 ASN 636 680 680 ASN ASN A . n 
A 1 637 GLY 637 681 681 GLY GLY A . n 
A 1 638 TYR 638 682 682 TYR TYR A . n 
A 1 639 ARG 639 683 683 ARG ARG A . n 
A 1 640 LYS 640 684 684 LYS LYS A . n 
A 1 641 ILE 641 685 685 ILE ILE A . n 
A 1 642 PRO 642 686 686 PRO PRO A . n 
A 1 643 GLY 643 687 687 GLY GLY A . n 
A 1 644 ASP 644 688 688 ASP ASP A . n 
A 1 645 LYS 645 689 689 LYS LYS A . n 
A 1 646 CYS 646 690 690 CYS CYS A . n 
A 1 647 GLN 647 691 691 GLN GLN A . n 
A 1 648 GLY 648 692 692 GLY GLY A . n 
A 1 649 GLY 649 693 693 GLY GLY A . n 
A 1 650 VAL 650 694 694 VAL VAL A . n 
A 1 651 ASN 651 695 695 ASN ASN A . n 
A 1 652 PRO 652 696 696 PRO PRO A . n 
A 1 653 VAL 653 697 697 VAL VAL A . n 
A 1 654 ARG 654 698 698 ARG ARG A . n 
A 1 655 GLU 655 699 699 GLU GLU A . n 
A 1 656 VAL 656 700 700 VAL VAL A . n 
A 1 657 LYS 657 701 701 LYS LYS A . n 
A 1 658 ASP 658 702 702 ASP ASP A . n 
A 1 659 LEU 659 703 703 LEU LEU A . n 
A 1 660 LYS 660 704 704 LYS LYS A . n 
A 1 661 LYS 661 705 705 LYS LYS A . n 
A 1 662 LYS 662 706 706 LYS LYS A . n 
A 1 663 CYS 663 707 707 CYS CYS A . n 
A 1 664 THR 664 708 708 THR THR A . n 
A 1 665 SER 665 709 709 SER SER A . n 
A 1 666 ASN 666 710 710 ASN ASN A . n 
A 1 667 PHE 667 711 711 PHE PHE A . n 
A 1 668 LEU 668 712 712 LEU LEU A . n 
A 1 669 SER 669 713 713 SER SER A . n 
A 1 670 PRO 670 714 714 PRO PRO A . n 
A 1 671 GLU 671 715 715 GLU GLU A . n 
A 1 672 LYS 672 716 716 LYS LYS A . n 
A 1 673 GLN 673 717 ?   ?   ?   A . n 
A 1 674 ASN 674 718 ?   ?   ?   A . n 
A 1 675 SER 675 719 ?   ?   ?   A . n 
A 1 676 LYS 676 720 ?   ?   ?   A . n 
A 1 677 SER 677 721 ?   ?   ?   A . n 
A 1 678 ASN 678 722 ?   ?   ?   A . n 
A 1 679 SER 679 723 ?   ?   ?   A . n 
A 1 680 HIS 680 724 ?   ?   ?   A . n 
A 1 681 HIS 681 725 ?   ?   ?   A . n 
A 1 682 HIS 682 726 ?   ?   ?   A . n 
A 1 683 HIS 683 727 ?   ?   ?   A . n 
A 1 684 HIS 684 728 ?   ?   ?   A . n 
A 1 685 HIS 685 729 ?   ?   ?   A . n 
B 2 1   PCA 1   1   ?   ?   ?   N . n 
B 2 2   LEU 2   2   ?   ?   ?   N . n 
B 2 3   TYR 3   3   ?   ?   ?   N . n 
B 2 4   GLU 4   4   ?   ?   ?   N . n 
B 2 5   ASN 5   5   ?   ?   ?   N . n 
B 2 6   LYS 6   6   ?   ?   ?   N . n 
B 2 7   PRO 7   7   ?   ?   ?   N . n 
B 2 8   ARG 8   8   ?   ?   ?   N . n 
B 2 9   ARG 9   9   ?   ?   ?   N . n 
B 2 10  PRO 10  10  10  PRO PRO N . n 
B 2 11  TYR 11  11  11  TYR TYR N . n 
B 2 12  ILE 12  12  12  ILE ILE N . n 
B 2 13  LEU 13  13  13  LEU LEU N . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 NAG 1   801  801  NAG NAG A . 
D 3 NAG 2   802  802  NAG NAG A . 
E 3 NAG 1   901  901  NAG NAG A . 
F 3 NAG 2   902  902  NAG NAG A . 
G 4 BMA 3   903  903  BMA BMA A . 
H 5 PGE 1   951  951  PGE PGE A . 
I 6 GOL 1   952  952  GOL GOL A . 
J 7 HOH 1   1001 1001 HOH HOH A . 
J 7 HOH 2   1002 1002 HOH HOH A . 
J 7 HOH 3   1003 1003 HOH HOH A . 
J 7 HOH 4   1004 1004 HOH HOH A . 
J 7 HOH 5   1005 1005 HOH HOH A . 
J 7 HOH 6   1006 1006 HOH HOH A . 
J 7 HOH 7   1007 1007 HOH HOH A . 
J 7 HOH 8   1008 1008 HOH HOH A . 
J 7 HOH 9   1009 1009 HOH HOH A . 
J 7 HOH 10  1010 1010 HOH HOH A . 
J 7 HOH 11  1011 1011 HOH HOH A . 
J 7 HOH 12  1012 1012 HOH HOH A . 
J 7 HOH 13  1013 1013 HOH HOH A . 
J 7 HOH 14  1014 1014 HOH HOH A . 
J 7 HOH 15  1015 1015 HOH HOH A . 
J 7 HOH 16  1016 1016 HOH HOH A . 
J 7 HOH 17  1017 1017 HOH HOH A . 
J 7 HOH 18  1018 1018 HOH HOH A . 
J 7 HOH 19  1019 1019 HOH HOH A . 
J 7 HOH 20  1020 1020 HOH HOH A . 
J 7 HOH 21  1021 1021 HOH HOH A . 
J 7 HOH 22  1022 1022 HOH HOH A . 
J 7 HOH 23  1023 1023 HOH HOH A . 
J 7 HOH 24  1024 1024 HOH HOH A . 
J 7 HOH 25  1025 1025 HOH HOH A . 
J 7 HOH 26  1026 1026 HOH HOH A . 
J 7 HOH 27  1027 1027 HOH HOH A . 
J 7 HOH 28  1028 1028 HOH HOH A . 
J 7 HOH 29  1029 1029 HOH HOH A . 
J 7 HOH 30  1030 1030 HOH HOH A . 
J 7 HOH 31  1031 1031 HOH HOH A . 
J 7 HOH 32  1032 1032 HOH HOH A . 
J 7 HOH 33  1033 1033 HOH HOH A . 
J 7 HOH 34  1034 1034 HOH HOH A . 
J 7 HOH 35  1035 1035 HOH HOH A . 
J 7 HOH 36  1036 1036 HOH HOH A . 
J 7 HOH 37  1037 1037 HOH HOH A . 
J 7 HOH 38  1038 1038 HOH HOH A . 
J 7 HOH 39  1039 1039 HOH HOH A . 
J 7 HOH 40  1040 1040 HOH HOH A . 
J 7 HOH 41  1041 1041 HOH HOH A . 
J 7 HOH 42  1042 1042 HOH HOH A . 
J 7 HOH 43  1043 1043 HOH HOH A . 
J 7 HOH 44  1044 1044 HOH HOH A . 
J 7 HOH 45  1045 1045 HOH HOH A . 
J 7 HOH 46  1046 1046 HOH HOH A . 
J 7 HOH 47  1047 1047 HOH HOH A . 
J 7 HOH 48  1048 1048 HOH HOH A . 
J 7 HOH 49  1049 1049 HOH HOH A . 
J 7 HOH 50  1050 1050 HOH HOH A . 
J 7 HOH 51  1051 1051 HOH HOH A . 
J 7 HOH 52  1052 1052 HOH HOH A . 
J 7 HOH 53  1053 1053 HOH HOH A . 
J 7 HOH 54  1054 1054 HOH HOH A . 
J 7 HOH 55  1055 1055 HOH HOH A . 
J 7 HOH 56  1056 1056 HOH HOH A . 
J 7 HOH 57  1057 1057 HOH HOH A . 
J 7 HOH 58  1058 1058 HOH HOH A . 
J 7 HOH 59  1059 1059 HOH HOH A . 
J 7 HOH 60  1060 1060 HOH HOH A . 
J 7 HOH 61  1061 1061 HOH HOH A . 
J 7 HOH 62  1062 1062 HOH HOH A . 
J 7 HOH 63  1063 1063 HOH HOH A . 
J 7 HOH 64  1064 1064 HOH HOH A . 
J 7 HOH 65  1065 1065 HOH HOH A . 
J 7 HOH 66  1066 1066 HOH HOH A . 
J 7 HOH 67  1067 1067 HOH HOH A . 
J 7 HOH 68  1068 1068 HOH HOH A . 
J 7 HOH 69  1069 1069 HOH HOH A . 
J 7 HOH 70  1070 1070 HOH HOH A . 
J 7 HOH 71  1071 1071 HOH HOH A . 
J 7 HOH 72  1072 1072 HOH HOH A . 
J 7 HOH 73  1073 1073 HOH HOH A . 
J 7 HOH 74  1074 1074 HOH HOH A . 
J 7 HOH 75  1075 1075 HOH HOH A . 
J 7 HOH 76  1076 1076 HOH HOH A . 
J 7 HOH 77  1077 1077 HOH HOH A . 
J 7 HOH 78  1078 1078 HOH HOH A . 
J 7 HOH 79  1079 1079 HOH HOH A . 
J 7 HOH 80  1080 1080 HOH HOH A . 
J 7 HOH 81  1081 1081 HOH HOH A . 
J 7 HOH 82  1082 1082 HOH HOH A . 
J 7 HOH 83  1083 1083 HOH HOH A . 
J 7 HOH 84  1084 1084 HOH HOH A . 
J 7 HOH 85  1085 1085 HOH HOH A . 
J 7 HOH 86  1086 1086 HOH HOH A . 
J 7 HOH 87  1087 1087 HOH HOH A . 
J 7 HOH 88  1088 1088 HOH HOH A . 
J 7 HOH 89  1089 1089 HOH HOH A . 
J 7 HOH 90  1090 1090 HOH HOH A . 
J 7 HOH 91  1091 1091 HOH HOH A . 
J 7 HOH 92  1092 1092 HOH HOH A . 
J 7 HOH 93  1093 1093 HOH HOH A . 
J 7 HOH 94  1094 1094 HOH HOH A . 
J 7 HOH 95  1095 1095 HOH HOH A . 
J 7 HOH 96  1096 1096 HOH HOH A . 
J 7 HOH 97  1097 1097 HOH HOH A . 
J 7 HOH 98  1098 1098 HOH HOH A . 
J 7 HOH 99  1099 1099 HOH HOH A . 
J 7 HOH 100 1100 1100 HOH HOH A . 
J 7 HOH 101 1101 1101 HOH HOH A . 
J 7 HOH 102 1102 1102 HOH HOH A . 
J 7 HOH 103 1103 1103 HOH HOH A . 
J 7 HOH 104 1104 1104 HOH HOH A . 
J 7 HOH 105 1105 1105 HOH HOH A . 
J 7 HOH 106 1106 1106 HOH HOH A . 
J 7 HOH 107 1107 1107 HOH HOH A . 
J 7 HOH 108 1108 1108 HOH HOH A . 
J 7 HOH 109 1109 1109 HOH HOH A . 
J 7 HOH 110 1110 1110 HOH HOH A . 
J 7 HOH 111 1111 1111 HOH HOH A . 
J 7 HOH 112 1112 1112 HOH HOH A . 
J 7 HOH 113 1113 1113 HOH HOH A . 
J 7 HOH 114 1114 1114 HOH HOH A . 
J 7 HOH 115 1115 1115 HOH HOH A . 
J 7 HOH 116 1116 1116 HOH HOH A . 
J 7 HOH 117 1117 1117 HOH HOH A . 
J 7 HOH 118 1118 1118 HOH HOH A . 
J 7 HOH 119 1119 1119 HOH HOH A . 
J 7 HOH 120 1120 1120 HOH HOH A . 
J 7 HOH 121 1121 1121 HOH HOH A . 
J 7 HOH 122 1122 1122 HOH HOH A . 
J 7 HOH 123 1123 1123 HOH HOH A . 
J 7 HOH 124 1124 1124 HOH HOH A . 
J 7 HOH 125 1125 1125 HOH HOH A . 
J 7 HOH 126 1126 1126 HOH HOH A . 
J 7 HOH 127 1127 1127 HOH HOH A . 
J 7 HOH 128 1128 1128 HOH HOH A . 
J 7 HOH 129 1129 1129 HOH HOH A . 
J 7 HOH 130 1130 1130 HOH HOH A . 
J 7 HOH 131 1131 1131 HOH HOH A . 
J 7 HOH 132 1132 1132 HOH HOH A . 
J 7 HOH 133 1133 1133 HOH HOH A . 
J 7 HOH 134 1134 1134 HOH HOH A . 
J 7 HOH 135 1135 1135 HOH HOH A . 
J 7 HOH 136 1136 1136 HOH HOH A . 
J 7 HOH 137 1137 1137 HOH HOH A . 
J 7 HOH 138 1138 1138 HOH HOH A . 
J 7 HOH 139 1139 1139 HOH HOH A . 
J 7 HOH 140 1140 1140 HOH HOH A . 
J 7 HOH 141 1141 1141 HOH HOH A . 
J 7 HOH 142 1142 1142 HOH HOH A . 
J 7 HOH 143 1143 1143 HOH HOH A . 
J 7 HOH 144 1144 1144 HOH HOH A . 
J 7 HOH 145 1145 1145 HOH HOH A . 
J 7 HOH 146 1146 1146 HOH HOH A . 
J 7 HOH 147 1147 1147 HOH HOH A . 
J 7 HOH 148 1148 1148 HOH HOH A . 
J 7 HOH 149 1149 1149 HOH HOH A . 
J 7 HOH 150 1150 1150 HOH HOH A . 
J 7 HOH 151 1151 1151 HOH HOH A . 
J 7 HOH 152 1152 1152 HOH HOH A . 
J 7 HOH 153 1153 1153 HOH HOH A . 
J 7 HOH 154 1154 1154 HOH HOH A . 
J 7 HOH 155 1155 1155 HOH HOH A . 
J 7 HOH 156 1156 1156 HOH HOH A . 
J 7 HOH 157 1157 1157 HOH HOH A . 
J 7 HOH 158 1158 1158 HOH HOH A . 
J 7 HOH 159 1159 1159 HOH HOH A . 
J 7 HOH 160 1160 1160 HOH HOH A . 
J 7 HOH 161 1161 1161 HOH HOH A . 
J 7 HOH 162 1162 1162 HOH HOH A . 
J 7 HOH 163 1163 1163 HOH HOH A . 
J 7 HOH 164 1164 1164 HOH HOH A . 
J 7 HOH 165 1165 1165 HOH HOH A . 
J 7 HOH 166 1166 1166 HOH HOH A . 
J 7 HOH 167 1167 1167 HOH HOH A . 
J 7 HOH 168 1168 1168 HOH HOH A . 
J 7 HOH 169 1169 1169 HOH HOH A . 
J 7 HOH 170 1170 1170 HOH HOH A . 
J 7 HOH 171 1171 1171 HOH HOH A . 
J 7 HOH 172 1172 1172 HOH HOH A . 
J 7 HOH 173 1173 1173 HOH HOH A . 
J 7 HOH 174 1174 1174 HOH HOH A . 
J 7 HOH 175 1175 1175 HOH HOH A . 
J 7 HOH 176 1176 1176 HOH HOH A . 
J 7 HOH 177 1177 1177 HOH HOH A . 
J 7 HOH 178 1178 1178 HOH HOH A . 
J 7 HOH 179 1179 1179 HOH HOH A . 
J 7 HOH 180 1180 1180 HOH HOH A . 
J 7 HOH 181 1181 1181 HOH HOH A . 
J 7 HOH 182 1182 1182 HOH HOH A . 
J 7 HOH 183 1183 1183 HOH HOH A . 
J 7 HOH 184 1184 1184 HOH HOH A . 
J 7 HOH 185 1185 1185 HOH HOH A . 
J 7 HOH 186 1186 1186 HOH HOH A . 
J 7 HOH 187 1187 1187 HOH HOH A . 
J 7 HOH 188 1188 1188 HOH HOH A . 
J 7 HOH 189 1189 1189 HOH HOH A . 
J 7 HOH 190 1190 1190 HOH HOH A . 
J 7 HOH 191 1191 1191 HOH HOH A . 
J 7 HOH 192 1192 1192 HOH HOH A . 
J 7 HOH 193 1193 1193 HOH HOH A . 
J 7 HOH 194 1194 1194 HOH HOH A . 
J 7 HOH 195 1195 1195 HOH HOH A . 
J 7 HOH 196 1196 1196 HOH HOH A . 
J 7 HOH 197 1197 1197 HOH HOH A . 
J 7 HOH 198 1198 1198 HOH HOH A . 
J 7 HOH 199 1199 1199 HOH HOH A . 
J 7 HOH 200 1200 1200 HOH HOH A . 
J 7 HOH 201 1201 1201 HOH HOH A . 
J 7 HOH 202 1202 1202 HOH HOH A . 
J 7 HOH 203 1203 1203 HOH HOH A . 
J 7 HOH 204 1204 1204 HOH HOH A . 
J 7 HOH 205 1205 1205 HOH HOH A . 
J 7 HOH 206 1206 1206 HOH HOH A . 
J 7 HOH 207 1207 1207 HOH HOH A . 
J 7 HOH 208 1208 1208 HOH HOH A . 
J 7 HOH 209 1209 1209 HOH HOH A . 
J 7 HOH 210 1210 1210 HOH HOH A . 
J 7 HOH 211 1211 1211 HOH HOH A . 
J 7 HOH 212 1212 1212 HOH HOH A . 
J 7 HOH 213 1213 1213 HOH HOH A . 
J 7 HOH 214 1214 1214 HOH HOH A . 
J 7 HOH 215 1215 1215 HOH HOH A . 
J 7 HOH 216 1216 1216 HOH HOH A . 
J 7 HOH 217 1217 1217 HOH HOH A . 
J 7 HOH 218 1218 1218 HOH HOH A . 
J 7 HOH 219 1219 1219 HOH HOH A . 
J 7 HOH 220 1220 1220 HOH HOH A . 
J 7 HOH 221 1221 1221 HOH HOH A . 
J 7 HOH 222 1222 1222 HOH HOH A . 
J 7 HOH 223 1223 1223 HOH HOH A . 
J 7 HOH 224 1224 1224 HOH HOH A . 
J 7 HOH 225 1225 1225 HOH HOH A . 
J 7 HOH 226 1226 1226 HOH HOH A . 
J 7 HOH 227 1227 1227 HOH HOH A . 
J 7 HOH 228 1228 1228 HOH HOH A . 
J 7 HOH 229 1229 1229 HOH HOH A . 
J 7 HOH 230 1230 1230 HOH HOH A . 
J 7 HOH 231 1231 1231 HOH HOH A . 
J 7 HOH 232 1232 1232 HOH HOH A . 
J 7 HOH 233 1233 1233 HOH HOH A . 
J 7 HOH 234 1234 1234 HOH HOH A . 
J 7 HOH 235 1235 1235 HOH HOH A . 
J 7 HOH 236 1236 1236 HOH HOH A . 
J 7 HOH 237 1237 1237 HOH HOH A . 
J 7 HOH 238 1238 1238 HOH HOH A . 
J 7 HOH 239 1239 1239 HOH HOH A . 
J 7 HOH 240 1240 1240 HOH HOH A . 
J 7 HOH 241 1241 1241 HOH HOH A . 
J 7 HOH 242 1242 1242 HOH HOH A . 
J 7 HOH 243 1243 1243 HOH HOH A . 
J 7 HOH 244 1244 1244 HOH HOH A . 
J 7 HOH 245 1245 1245 HOH HOH A . 
J 7 HOH 246 1246 1246 HOH HOH A . 
J 7 HOH 247 1247 1247 HOH HOH A . 
J 7 HOH 248 1248 1248 HOH HOH A . 
J 7 HOH 249 1249 1249 HOH HOH A . 
J 7 HOH 250 1250 1250 HOH HOH A . 
J 7 HOH 251 1251 1251 HOH HOH A . 
J 7 HOH 252 1252 1252 HOH HOH A . 
J 7 HOH 253 1253 1253 HOH HOH A . 
J 7 HOH 254 1254 1254 HOH HOH A . 
J 7 HOH 255 1255 1255 HOH HOH A . 
J 7 HOH 256 1256 1256 HOH HOH A . 
J 7 HOH 257 1257 1257 HOH HOH A . 
J 7 HOH 258 1258 1258 HOH HOH A . 
J 7 HOH 259 1259 1259 HOH HOH A . 
J 7 HOH 260 1260 1260 HOH HOH A . 
J 7 HOH 261 1261 1261 HOH HOH A . 
J 7 HOH 262 1262 1262 HOH HOH A . 
J 7 HOH 263 1263 1263 HOH HOH A . 
J 7 HOH 264 1264 1264 HOH HOH A . 
J 7 HOH 265 1265 1265 HOH HOH A . 
J 7 HOH 266 1266 1266 HOH HOH A . 
J 7 HOH 267 1267 1267 HOH HOH A . 
J 7 HOH 268 1268 1268 HOH HOH A . 
J 7 HOH 269 1269 1269 HOH HOH A . 
J 7 HOH 270 1270 1270 HOH HOH A . 
J 7 HOH 271 1271 1271 HOH HOH A . 
J 7 HOH 272 1272 1272 HOH HOH A . 
J 7 HOH 273 1273 1273 HOH HOH A . 
J 7 HOH 274 1274 1274 HOH HOH A . 
J 7 HOH 275 1275 1275 HOH HOH A . 
J 7 HOH 276 1276 1276 HOH HOH A . 
J 7 HOH 277 1277 1277 HOH HOH A . 
J 7 HOH 278 1278 1278 HOH HOH A . 
J 7 HOH 279 1279 1279 HOH HOH A . 
J 7 HOH 280 1280 1280 HOH HOH A . 
J 7 HOH 281 1281 1281 HOH HOH A . 
J 7 HOH 282 1282 1282 HOH HOH A . 
J 7 HOH 283 1283 1283 HOH HOH A . 
J 7 HOH 284 1284 1284 HOH HOH A . 
J 7 HOH 285 1285 1285 HOH HOH A . 
J 7 HOH 286 1286 1286 HOH HOH A . 
J 7 HOH 287 1287 1287 HOH HOH A . 
J 7 HOH 288 1288 1288 HOH HOH A . 
J 7 HOH 289 1289 1289 HOH HOH A . 
J 7 HOH 290 1290 1290 HOH HOH A . 
J 7 HOH 291 1291 1291 HOH HOH A . 
J 7 HOH 292 1292 1292 HOH HOH A . 
J 7 HOH 293 1293 1293 HOH HOH A . 
J 7 HOH 294 1294 1294 HOH HOH A . 
J 7 HOH 295 1295 1295 HOH HOH A . 
J 7 HOH 296 1296 1296 HOH HOH A . 
J 7 HOH 297 1297 1297 HOH HOH A . 
J 7 HOH 298 1298 1298 HOH HOH A . 
J 7 HOH 299 1299 1299 HOH HOH A . 
J 7 HOH 300 1300 1300 HOH HOH A . 
J 7 HOH 301 1301 1301 HOH HOH A . 
J 7 HOH 302 1302 1302 HOH HOH A . 
J 7 HOH 303 1303 1303 HOH HOH A . 
J 7 HOH 304 1304 1304 HOH HOH A . 
K 7 HOH 1   1305 1305 HOH HOH N . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 329 A ASN 373 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 505 A ASN 549 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 830   ? 
1 MORE         -4.6  ? 
1 'SSA (A^2)'  30600 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     1280 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   J 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-12-30 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 2 0 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Database references'       
4 3 'Structure model' 'Derived calculations'      
5 3 'Structure model' 'Polymer sequence'          
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' entity_poly        
2 3 'Structure model' struct_conn        
3 3 'Structure model' struct_ref_seq_dif 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' 
2 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'       
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 42.8376  69.7777 16.9772 0.1094 0.1567 0.0902  -0.0988 -0.0413 0.0524  2.1236 6.5272 1.8762 -1.2281 -0.3690 0.6749 
0.0369  -0.1308 0.2061  0.6073 -0.0793 -0.4944 -0.0819 0.3481  0.0424 'X-RAY DIFFRACTION' 
2 ? refined 20.6468  66.7618 21.8714 0.0200 0.0179 -0.0272 -0.0026 0.0013  0.0147  1.0707 0.6614 0.9161 -0.0319 -0.0732 0.1245 
0.0047  -0.1525 0.1061  0.0768 -0.0297 -0.0546 -0.1289 0.0460  0.0250 'X-RAY DIFFRACTION' 
3 ? refined -11.1651 73.6956 23.9775 0.1541 0.2974 0.1577  0.0515  0.0235  -0.1171 0.7834 3.4911 6.5078 -1.4728 -2.2280 4.5405 
-0.1039 0.0673  -0.0532 0.2652 -0.4227 0.4413  0.1682  -0.6475 0.5266 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.pdbx_refine_id 
1 1 A 55  ? ? A 155 ? ? ? ? 'X-RAY DIFFRACTION' 
2 2 A 156 ? ? A 629 ? ? ? ? 'X-RAY DIFFRACTION' 
3 3 A 630 ? ? A 716 ? ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
XDS    'data scaling'   .        ? 1 
SHARP  phasing          .        ? 2 
REFMAC refinement       5.2.0019 ? 3 
XDS    'data reduction' .        ? 4 
XSCALE 'data scaling'   .        ? 5 
# 
_pdbx_entry_details.entry_id             3F6K 
_pdbx_entry_details.compound_details     
;AUTHORS STATE THAT THE GLYCOSYLATIONS ARE COVALENTLY
ATTACHED TO THE ASPARAGINES, THEREFORE THEY SHOULD NOT BE
DESCRIBED AS SITE RECORDS. INSTEAD, WHAT SHOULD BE SHOWN
IN SITE RECORDS, IS THE NEUROTENSIN BINDING SITE.
;
_pdbx_entry_details.sequence_details     
;IN VIVO, NEUROTENSIN (ENTITY 2) IS PRODUCED BY PROTEOLYTIC
CLEAVAGE OF THE GENE PRODUCT, AND THE RESULTING N-TERMINAL
GLUTAMATE IS NATURALLY CONVERTED TO PYROGLUTAMATE.
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 1069 ? ? O A HOH 1270 ? ? 2.13 
2 1 OE1 A GLU 607  ? ? O A HOH 1270 ? ? 2.18 
3 1 O   A HOH 1102 ? ? O A HOH 1272 ? ? 2.18 
4 1 O   A HOH 1151 ? ? O A HOH 1215 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CB A CYS 224 ? ? SG  A CYS 224 ? ? 1.702 1.812 -0.110 0.016 N 
2 1 CG A GLU 487 ? ? CD  A GLU 487 ? ? 1.625 1.515 0.110  0.015 N 
3 1 CZ A ARG 698 ? ? NH1 A ARG 698 ? ? 1.404 1.326 0.078  0.013 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ARG 293 ? ? CA A ARG 293 ? ? C   A ARG 293 ? ? 96.43  110.40 -13.97 2.00 N 
2 1 NE A ARG 293 ? ? CZ A ARG 293 ? ? NH2 A ARG 293 ? ? 117.02 120.30 -3.28  0.50 N 
3 1 CB A ASP 570 ? ? CG A ASP 570 ? ? OD1 A ASP 570 ? ? 124.34 118.30 6.04   0.90 N 
4 1 NE A ARG 698 ? ? CZ A ARG 698 ? ? NH2 A ARG 698 ? ? 117.13 120.30 -3.17  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 75  ? ? -154.61 37.87   
2  1 GLU A 144 ? ? 50.33   -134.37 
3  1 ASN A 241 ? ? 164.14  -72.53  
4  1 SER A 243 ? ? 14.19   149.04  
5  1 ASN A 324 ? ? -137.54 -158.31 
6  1 ASP A 337 ? ? 21.03   75.93   
7  1 ASP A 347 ? ? -67.09  -171.04 
8  1 ASP A 399 ? ? -118.85 51.95   
9  1 ASP A 416 ? ? -77.57  -168.67 
10 1 CYS A 425 ? ? -163.03 -165.91 
11 1 ALA A 431 ? ? -140.84 -143.65 
12 1 ASP A 496 ? ? 32.19   60.38   
13 1 ASN A 512 ? ? -149.42 21.13   
14 1 GLN A 563 ? ? -172.44 143.43  
15 1 GLU A 650 ? ? -14.04  -63.19  
16 1 ASN A 651 ? ? -113.23 -146.20 
17 1 SER A 653 ? ? 99.69   28.70   
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   ASP 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    652 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   SER 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    653 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            142.06 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 45  ? A SER 1   
2  1 Y 1 A ALA 46  ? A ALA 2   
3  1 Y 1 A PRO 47  ? A PRO 3   
4  1 Y 1 A GLY 48  ? A GLY 4   
5  1 Y 1 A GLU 49  ? A GLU 5   
6  1 Y 1 A ASP 50  ? A ASP 6   
7  1 Y 1 A GLU 51  ? A GLU 7   
8  1 Y 1 A GLU 52  ? A GLU 8   
9  1 Y 1 A CYS 53  ? A CYS 9   
10 1 Y 1 A GLY 54  ? A GLY 10  
11 1 Y 1 A VAL 102 ? A VAL 58  
12 1 Y 1 A ILE 103 ? A ILE 59  
13 1 Y 1 A MET 104 ? A MET 60  
14 1 Y 1 A THR 105 ? A THR 61  
15 1 Y 1 A PHE 106 ? A PHE 62  
16 1 Y 1 A GLN 717 ? A GLN 673 
17 1 Y 1 A ASN 718 ? A ASN 674 
18 1 Y 1 A SER 719 ? A SER 675 
19 1 Y 1 A LYS 720 ? A LYS 676 
20 1 Y 1 A SER 721 ? A SER 677 
21 1 Y 1 A ASN 722 ? A ASN 678 
22 1 Y 1 A SER 723 ? A SER 679 
23 1 Y 1 A HIS 724 ? A HIS 680 
24 1 Y 1 A HIS 725 ? A HIS 681 
25 1 Y 1 A HIS 726 ? A HIS 682 
26 1 Y 1 A HIS 727 ? A HIS 683 
27 1 Y 1 A HIS 728 ? A HIS 684 
28 1 Y 1 A HIS 729 ? A HIS 685 
29 1 Y 1 N PCA 1   ? B PCA 1   
30 1 Y 1 N LEU 2   ? B LEU 2   
31 1 Y 1 N TYR 3   ? B TYR 3   
32 1 Y 1 N GLU 4   ? B GLU 4   
33 1 Y 1 N ASN 5   ? B ASN 5   
34 1 Y 1 N LYS 6   ? B LYS 6   
35 1 Y 1 N PRO 7   ? B PRO 7   
36 1 Y 1 N ARG 8   ? B ARG 8   
37 1 Y 1 N ARG 9   ? B ARG 9   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 N-ACETYL-D-GLUCOSAMINE NAG 
4 BETA-D-MANNOSE         BMA 
5 'TRIETHYLENE GLYCOL'   PGE 
6 GLYCEROL               GOL 
7 water                  HOH 
#