data_3F78
# 
_entry.id   3F78 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3F78         
RCSB  RCSB050233   
WWPDB D_1000050233 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3F74 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        3F78 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2008-11-07 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, H.'   1 
'Wang, J.-H.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structure of isoflurane bound to integrin LFA-1 supports a unified mechanism of volatile anesthetic action in the immune and central nervous systems.
;
_citation.journal_abbrev            'Faseb J.' 
_citation.journal_volume            23 
_citation.page_first                2735 
_citation.page_last                 2740 
_citation.year                      2009 
_citation.journal_id_ASTM           FAJOEC 
_citation.country                   US 
_citation.journal_id_ISSN           0892-6638 
_citation.journal_id_CSD            2074 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19332643 
_citation.pdbx_database_id_DOI      10.1096/fj.09-129908 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhang, H.'    1 
primary 'Astrof, N.S.' 2 
primary 'Liu, J.H.'    3 
primary 'Wang, J.H.'   4 
primary 'Shimaoka, M.' 5 
# 
_cell.length_a           62.679 
_cell.length_b           85.800 
_cell.length_c           63.917 
_cell.angle_alpha        90.000 
_cell.angle_beta         118.180 
_cell.angle_gamma        90.000 
_cell.entry_id           3F78 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              6 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.entry_id                         3F78 
_symmetry.Int_Tables_number                4 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Integrin alpha-L'                                   20739.766 3   ? ? 
'UNP residues 153-332, VWFA domain, I domain' ? 
2 non-polymer syn '1-CHLORO-2,2,2-TRIFLUOROETHYL DIFLUOROMETHYL ETHER' 184.492   2   ? ? ? ? 
3 non-polymer syn GLYCEROL                                             92.094    4   ? ? ? ? 
4 non-polymer syn 'MAGNESIUM ION'                                      24.305    1   ? ? ? ? 
5 water       nat water                                                18.015    644 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Leukocyte adhesion glycoprotein LFA-1 alpha chain, LFA-1A, Leukocyte function-associated molecule 1 alpha chain, CD11 antigen-like family member A
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGNVDLVFLFDGSMSLQPDEFQKILDFMKDVMKKLSNTSYQFAAVQFSTSYKTEFDFSDYVKWKDPDALLKHVKHMLLLT
NTFGAINYVATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLHKFASKPASEFV
KILDTFEKLKDLFTELQKKIY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGNVDLVFLFDGSMSLQPDEFQKILDFMKDVMKKLSNTSYQFAAVQFSTSYKTEFDFSDYVKWKDPDALLKHVKHMLLLT
NTFGAINYVATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLHKFASKPASEFV
KILDTFEKLKDLFTELQKKIY
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   ASN n 
1 4   VAL n 
1 5   ASP n 
1 6   LEU n 
1 7   VAL n 
1 8   PHE n 
1 9   LEU n 
1 10  PHE n 
1 11  ASP n 
1 12  GLY n 
1 13  SER n 
1 14  MET n 
1 15  SER n 
1 16  LEU n 
1 17  GLN n 
1 18  PRO n 
1 19  ASP n 
1 20  GLU n 
1 21  PHE n 
1 22  GLN n 
1 23  LYS n 
1 24  ILE n 
1 25  LEU n 
1 26  ASP n 
1 27  PHE n 
1 28  MET n 
1 29  LYS n 
1 30  ASP n 
1 31  VAL n 
1 32  MET n 
1 33  LYS n 
1 34  LYS n 
1 35  LEU n 
1 36  SER n 
1 37  ASN n 
1 38  THR n 
1 39  SER n 
1 40  TYR n 
1 41  GLN n 
1 42  PHE n 
1 43  ALA n 
1 44  ALA n 
1 45  VAL n 
1 46  GLN n 
1 47  PHE n 
1 48  SER n 
1 49  THR n 
1 50  SER n 
1 51  TYR n 
1 52  LYS n 
1 53  THR n 
1 54  GLU n 
1 55  PHE n 
1 56  ASP n 
1 57  PHE n 
1 58  SER n 
1 59  ASP n 
1 60  TYR n 
1 61  VAL n 
1 62  LYS n 
1 63  TRP n 
1 64  LYS n 
1 65  ASP n 
1 66  PRO n 
1 67  ASP n 
1 68  ALA n 
1 69  LEU n 
1 70  LEU n 
1 71  LYS n 
1 72  HIS n 
1 73  VAL n 
1 74  LYS n 
1 75  HIS n 
1 76  MET n 
1 77  LEU n 
1 78  LEU n 
1 79  LEU n 
1 80  THR n 
1 81  ASN n 
1 82  THR n 
1 83  PHE n 
1 84  GLY n 
1 85  ALA n 
1 86  ILE n 
1 87  ASN n 
1 88  TYR n 
1 89  VAL n 
1 90  ALA n 
1 91  THR n 
1 92  GLU n 
1 93  VAL n 
1 94  PHE n 
1 95  ARG n 
1 96  GLU n 
1 97  GLU n 
1 98  LEU n 
1 99  GLY n 
1 100 ALA n 
1 101 ARG n 
1 102 PRO n 
1 103 ASP n 
1 104 ALA n 
1 105 THR n 
1 106 LYS n 
1 107 VAL n 
1 108 LEU n 
1 109 ILE n 
1 110 ILE n 
1 111 ILE n 
1 112 THR n 
1 113 ASP n 
1 114 GLY n 
1 115 GLU n 
1 116 ALA n 
1 117 THR n 
1 118 ASP n 
1 119 SER n 
1 120 GLY n 
1 121 ASN n 
1 122 ILE n 
1 123 ASP n 
1 124 ALA n 
1 125 ALA n 
1 126 LYS n 
1 127 ASP n 
1 128 ILE n 
1 129 ILE n 
1 130 ARG n 
1 131 TYR n 
1 132 ILE n 
1 133 ILE n 
1 134 GLY n 
1 135 ILE n 
1 136 GLY n 
1 137 LYS n 
1 138 HIS n 
1 139 PHE n 
1 140 GLN n 
1 141 THR n 
1 142 LYS n 
1 143 GLU n 
1 144 SER n 
1 145 GLN n 
1 146 GLU n 
1 147 THR n 
1 148 LEU n 
1 149 HIS n 
1 150 LYS n 
1 151 PHE n 
1 152 ALA n 
1 153 SER n 
1 154 LYS n 
1 155 PRO n 
1 156 ALA n 
1 157 SER n 
1 158 GLU n 
1 159 PHE n 
1 160 VAL n 
1 161 LYS n 
1 162 ILE n 
1 163 LEU n 
1 164 ASP n 
1 165 THR n 
1 166 PHE n 
1 167 GLU n 
1 168 LYS n 
1 169 LEU n 
1 170 LYS n 
1 171 ASP n 
1 172 LEU n 
1 173 PHE n 
1 174 THR n 
1 175 GLU n 
1 176 LEU n 
1 177 GLN n 
1 178 LYS n 
1 179 LYS n 
1 180 ILE n 
1 181 TYR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'CD11A, integrin LFA1, ITGAL' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET22b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ITAL_HUMAN 
_struct_ref.pdbx_db_accession          P20701 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GNVDLVFLFDGSMSLQPDEFQKILDFMKDVMKKLSNTSYQFAAVQFSTSYKTEFDFSDYVKRKDPDALLKHVKHMLLLTN
TFGAINYVATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLHKFASKPASEFVK
ILDTFEKLKDLFTELQKKIY
;
_struct_ref.pdbx_align_begin           153 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3F78 A 2 ? 181 ? P20701 153 ? 332 ? 128 307 
2 1 3F78 B 2 ? 181 ? P20701 153 ? 332 ? 128 307 
3 1 3F78 C 2 ? 181 ? P20701 153 ? 332 ? 128 307 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3F78 MET A 1  ? UNP P20701 ?   ?   'EXPRESSION TAG' 127 1 
1 3F78 TRP A 63 ? UNP P20701 ARG 214 VARIANT          189 2 
2 3F78 MET B 1  ? UNP P20701 ?   ?   'EXPRESSION TAG' 127 3 
2 3F78 TRP B 63 ? UNP P20701 ARG 214 VARIANT          189 4 
3 3F78 MET C 1  ? UNP P20701 ?   ?   'EXPRESSION TAG' 127 5 
3 3F78 TRP C 63 ? UNP P20701 ARG 214 VARIANT          189 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                              ?                               'C3 H7 N O2'     
89.093  
ARG 'L-peptide linking' y ARGININE                                             ?                               'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                           ?                               'C4 H8 N2 O3'    
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                      ?                               'C4 H7 N O4'     
133.103 
GLN 'L-peptide linking' y GLUTAMINE                                            ?                               'C5 H10 N2 O3'   
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                      ?                               'C5 H9 N O4'     
147.129 
GLY 'peptide linking'   y GLYCINE                                              ?                               'C2 H5 N O2'     
75.067  
GOL non-polymer         . GLYCEROL                                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       
92.094  
HIS 'L-peptide linking' y HISTIDINE                                            ?                               'C6 H10 N3 O2 1' 
156.162 
HOH non-polymer         . WATER                                                ?                               'H2 O'           
18.015  
ICF non-polymer         . '1-CHLORO-2,2,2-TRIFLUOROETHYL DIFLUOROMETHYL ETHER' ISOFLURANE                      'C3 H2 Cl F5 O'  
184.492 
ILE 'L-peptide linking' y ISOLEUCINE                                           ?                               'C6 H13 N O2'    
131.173 
LEU 'L-peptide linking' y LEUCINE                                              ?                               'C6 H13 N O2'    
131.173 
LYS 'L-peptide linking' y LYSINE                                               ?                               'C6 H15 N2 O2 1' 
147.195 
MET 'L-peptide linking' y METHIONINE                                           ?                               'C5 H11 N O2 S'  
149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                      ?                               'Mg 2'           
24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                        ?                               'C9 H11 N O2'    
165.189 
PRO 'L-peptide linking' y PROLINE                                              ?                               'C5 H9 N O2'     
115.130 
SER 'L-peptide linking' y SERINE                                               ?                               'C3 H7 N O3'     
105.093 
THR 'L-peptide linking' y THREONINE                                            ?                               'C4 H9 N O3'     
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                           ?                               'C11 H12 N2 O2'  
204.225 
TYR 'L-peptide linking' y TYROSINE                                             ?                               'C9 H11 N O3'    
181.189 
VAL 'L-peptide linking' y VALINE                                               ?                               'C5 H11 N O2'    
117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3F78 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.43 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   49.48 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.pdbx_details    
'0.1M sodium acetate pH7.5, 0.2M ammonium acetate, 25% PEG3350, 10mM isoflurane, VAPOR DIFFUSION, HANGING DROP, temperature 295K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2008-06-30 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97931 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_wavelength_list        0.97931 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
# 
_reflns.entry_id                     3F78 
_reflns.d_resolution_high            1.600 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   76838 
_reflns.pdbx_Rmerge_I_obs            0.065 
_reflns.pdbx_netI_over_sigmaI        22.222 
_reflns.pdbx_chi_squared             1.040 
_reflns.pdbx_redundancy              4.400 
_reflns.percent_possible_obs         97.900 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
1.60 1.66  ? ? ? 0.616 ? ? 0.690 3.30 ? 7043 90.40 1  1 
1.66 1.72  ? ? ? 0.537 ? ? 0.729 4.20 ? 7647 97.40 2  1 
1.72 1.80  ? ? ? 0.382 ? ? 0.760 4.50 ? 7641 97.90 3  1 
1.80 1.90  ? ? ? 0.251 ? ? 0.895 4.60 ? 7707 98.30 4  1 
1.90 2.02  ? ? ? 0.165 ? ? 1.055 4.60 ? 7695 98.50 5  1 
2.02 2.17  ? ? ? 0.119 ? ? 1.212 4.60 ? 7763 98.80 6  1 
2.17 2.39  ? ? ? 0.086 ? ? 1.176 4.60 ? 7771 99.00 7  1 
2.39 2.74  ? ? ? 0.068 ? ? 1.132 4.60 ? 7790 99.30 8  1 
2.74 3.45  ? ? ? 0.059 ? ? 1.409 4.60 ? 7863 99.60 9  1 
3.45 50.00 ? ? ? 0.043 ? ? 1.139 4.50 ? 7918 99.30 10 1 
# 
_refine.entry_id                                 3F78 
_refine.ls_d_res_high                            1.600 
_refine.ls_d_res_low                             20.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    97.670 
_refine.ls_number_reflns_obs                     76778 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS 
 U VALUES      : RESIDUAL ONLY
;
_refine.ls_R_factor_obs                          0.154 
_refine.ls_R_factor_R_work                       0.153 
_refine.ls_R_factor_R_free                       0.181 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  3872 
_refine.B_iso_mean                               22.764 
_refine.aniso_B[1][1]                            1.780 
_refine.aniso_B[2][2]                            -0.750 
_refine.aniso_B[3][3]                            -0.640 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.420 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.975 
_refine.correlation_coeff_Fo_to_Fc_free          0.965 
_refine.pdbx_overall_ESU_R                       0.079 
_refine.pdbx_overall_ESU_R_Free                  0.079 
_refine.overall_SU_ML                            0.052 
_refine.overall_SU_B                             3.317 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.B_iso_max                                61.85 
_refine.B_iso_min                                10.53 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            0.30 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1LFA' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4362 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         45 
_refine_hist.number_atoms_solvent             644 
_refine_hist.number_atoms_total               5051 
_refine_hist.d_res_high                       1.600 
_refine_hist.d_res_low                        20.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       4604 0.008  0.022  ? 'X-RAY DIFFRACTION' ? 
r_bond_other_d         3166 0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    6220 1.187  1.975  ? 'X-RAY DIFFRACTION' ? 
r_angle_other_deg      7794 0.831  3.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 572  5.673  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 210  33.488 25.333 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 878  12.202 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 10   21.474 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr         702  0.073  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   5008 0.004  0.020  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_other     919  0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it            2742 0.714  2.000  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_other         1107 0.193  2.000  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it           4462 1.302  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it            1862 2.140  5.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it           1740 3.171  5.000  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       1.60 
_refine_ls_shell.d_res_low                        1.640 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               86.250 
_refine_ls_shell.number_reflns_R_work             4715 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.250 
_refine_ls_shell.R_factor_R_free                  0.252 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             233 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                4948 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3F78 
_struct.title                     'Crystal structure of wild type LFA1 I domain complexed with isoflurane' 
_struct.pdbx_descriptor           'Integrin alpha-L' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3F78 
_struct_keywords.text            
;integrin, LFA1, I domain, inactive conformation, wild type, volatile anesthetic, isoflurane, inhibitor of integrin, Cell adhesion, Glycoprotein, Magnesium, Membrane, Receptor, Transmembrane
;
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
I N N 4 ? 
J N N 3 ? 
K N N 5 ? 
L N N 5 ? 
M N N 5 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
1 ? 
2 ? 
3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLN A 17  ? LEU A 35  ? GLN A 143 LEU A 161 1 ? 19 
HELX_P HELX_P2  2  ASP A 56  ? LYS A 64  ? ASP A 182 LYS A 190 1 ? 9  
HELX_P HELX_P3  3  ASP A 65  ? LEU A 70  ? ASP A 191 LEU A 196 1 ? 6  
HELX_P HELX_P4  4  ASN A 81  ? VAL A 93  ? ASN A 207 VAL A 219 1 ? 13 
HELX_P HELX_P5  5  ARG A 95  ? GLY A 99  ? ARG A 221 GLY A 225 5 ? 5  
HELX_P HELX_P6  6  ILE A 122 ? LYS A 126 ? ILE A 248 LYS A 252 5 ? 5  
HELX_P HELX_P7  7  LYS A 137 ? GLN A 140 ? LYS A 263 GLN A 266 5 ? 4  
HELX_P HELX_P8  8  THR A 141 ? THR A 147 ? THR A 267 THR A 273 1 ? 7  
HELX_P HELX_P9  9  LEU A 148 ? ALA A 152 ? LEU A 274 ALA A 278 5 ? 5  
HELX_P HELX_P10 10 PRO A 155 ? PHE A 159 ? PRO A 281 PHE A 285 1 ? 5  
HELX_P HELX_P11 11 THR A 165 ? ASP A 171 ? THR A 291 ASP A 297 5 ? 7  
HELX_P HELX_P12 12 LEU A 172 ? LYS A 179 ? LEU A 298 LYS A 305 1 ? 8  
HELX_P HELX_P13 13 GLN B 17  ? LEU B 35  ? GLN B 143 LEU B 161 1 ? 19 
HELX_P HELX_P14 14 ASP B 56  ? LYS B 64  ? ASP B 182 LYS B 190 1 ? 9  
HELX_P HELX_P15 15 ASP B 65  ? LEU B 70  ? ASP B 191 LEU B 196 1 ? 6  
HELX_P HELX_P16 16 ASN B 81  ? VAL B 93  ? ASN B 207 VAL B 219 1 ? 13 
HELX_P HELX_P17 17 ARG B 95  ? GLY B 99  ? ARG B 221 GLY B 225 5 ? 5  
HELX_P HELX_P18 18 ILE B 122 ? LYS B 126 ? ILE B 248 LYS B 252 5 ? 5  
HELX_P HELX_P19 19 LYS B 137 ? GLN B 140 ? LYS B 263 GLN B 266 5 ? 4  
HELX_P HELX_P20 20 THR B 141 ? THR B 147 ? THR B 267 THR B 273 1 ? 7  
HELX_P HELX_P21 21 LEU B 148 ? ALA B 152 ? LEU B 274 ALA B 278 5 ? 5  
HELX_P HELX_P22 22 PRO B 155 ? PHE B 159 ? PRO B 281 PHE B 285 1 ? 5  
HELX_P HELX_P23 23 THR B 165 ? ASP B 171 ? THR B 291 ASP B 297 5 ? 7  
HELX_P HELX_P24 24 LEU B 172 ? LYS B 179 ? LEU B 298 LYS B 305 1 ? 8  
HELX_P HELX_P25 25 GLN C 17  ? LEU C 35  ? GLN C 143 LEU C 161 1 ? 19 
HELX_P HELX_P26 26 ASP C 56  ? LYS C 64  ? ASP C 182 LYS C 190 1 ? 9  
HELX_P HELX_P27 27 ASP C 65  ? LEU C 70  ? ASP C 191 LEU C 196 1 ? 6  
HELX_P HELX_P28 28 ASN C 81  ? VAL C 93  ? ASN C 207 VAL C 219 1 ? 13 
HELX_P HELX_P29 29 ARG C 95  ? GLY C 99  ? ARG C 221 GLY C 225 5 ? 5  
HELX_P HELX_P30 30 ILE C 122 ? LYS C 126 ? ILE C 248 LYS C 252 5 ? 5  
HELX_P HELX_P31 31 LYS C 137 ? GLN C 140 ? LYS C 263 GLN C 266 5 ? 4  
HELX_P HELX_P32 32 THR C 141 ? THR C 147 ? THR C 267 THR C 273 1 ? 7  
HELX_P HELX_P33 33 LEU C 148 ? ALA C 152 ? LEU C 274 ALA C 278 5 ? 5  
HELX_P HELX_P34 34 PRO C 155 ? PHE C 159 ? PRO C 281 PHE C 285 1 ? 5  
HELX_P HELX_P35 35 THR C 165 ? GLN C 177 ? THR C 291 GLN C 303 5 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 154 A . ? LYS 280 A PRO 155 A ? PRO 281 A 1 8.58  
2 LYS 154 B . ? LYS 280 B PRO 155 B ? PRO 281 B 1 5.36  
3 LYS 154 C . ? LYS 280 C PRO 155 C ? PRO 281 C 1 -1.31 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 6 ? 
C ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 51  ? PHE A 55  ? TYR A 177 PHE A 181 
A 2 TYR A 40  ? PHE A 47  ? TYR A 166 PHE A 173 
A 3 VAL A 4   ? ASP A 11  ? VAL A 130 ASP A 137 
A 4 THR A 105 ? THR A 112 ? THR A 231 THR A 238 
A 5 ILE A 129 ? ILE A 135 ? ILE A 255 ILE A 261 
A 6 VAL A 160 ? LEU A 163 ? VAL A 286 LEU A 289 
B 1 TYR B 51  ? PHE B 55  ? TYR B 177 PHE B 181 
B 2 TYR B 40  ? PHE B 47  ? TYR B 166 PHE B 173 
B 3 VAL B 4   ? ASP B 11  ? VAL B 130 ASP B 137 
B 4 THR B 105 ? THR B 112 ? THR B 231 THR B 238 
B 5 ILE B 129 ? ILE B 135 ? ILE B 255 ILE B 261 
B 6 VAL B 160 ? LEU B 163 ? VAL B 286 LEU B 289 
C 1 TYR C 51  ? PHE C 55  ? TYR C 177 PHE C 181 
C 2 TYR C 40  ? PHE C 47  ? TYR C 166 PHE C 173 
C 3 VAL C 4   ? ASP C 11  ? VAL C 130 ASP C 137 
C 4 THR C 105 ? THR C 112 ? THR C 231 THR C 238 
C 5 ILE C 129 ? ILE C 135 ? ILE C 255 ILE C 261 
C 6 VAL C 160 ? LEU C 163 ? VAL C 286 LEU C 289 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O PHE A 55  ? O PHE A 181 N ALA A 44  ? N ALA A 170 
A 2 3 O VAL A 45  ? O VAL A 171 N PHE A 8   ? N PHE A 134 
A 3 4 N LEU A 9   ? N LEU A 135 O ILE A 109 ? O ILE A 235 
A 4 5 N ILE A 110 ? N ILE A 236 O ILE A 133 ? O ILE A 259 
A 5 6 N ILE A 132 ? N ILE A 258 O LYS A 161 ? O LYS A 287 
B 1 2 O LYS B 52  ? O LYS B 178 N GLN B 46  ? N GLN B 172 
B 2 3 O VAL B 45  ? O VAL B 171 N PHE B 8   ? N PHE B 134 
B 3 4 N LEU B 9   ? N LEU B 135 O ILE B 109 ? O ILE B 235 
B 4 5 N LEU B 108 ? N LEU B 234 O ILE B 129 ? O ILE B 255 
B 5 6 N GLY B 134 ? N GLY B 260 O LYS B 161 ? O LYS B 287 
C 1 2 O GLU C 54  ? O GLU C 180 N ALA C 44  ? N ALA C 170 
C 2 3 O VAL C 45  ? O VAL C 171 N PHE C 8   ? N PHE C 134 
C 3 4 N LEU C 9   ? N LEU C 135 O ILE C 109 ? O ILE C 235 
C 4 5 N ILE C 110 ? N ILE C 236 O ILE C 133 ? O ILE C 259 
C 5 6 N ILE C 132 ? N ILE C 258 O LYS C 161 ? O LYS C 287 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE ICF A 1'   
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE GOL A 2'   
AC3 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE ICF B 2'   
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE GOL B 3'   
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE GOL B 4'   
AC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG C 1'    
AC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE GOL C 308' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 ILE A 109 ? ILE A 235 . ? 1_555 ? 
2  AC1 7 TYR A 131 ? TYR A 257 . ? 1_555 ? 
3  AC1 7 LYS A 161 ? LYS A 287 . ? 1_555 ? 
4  AC1 7 GLU A 175 ? GLU A 301 . ? 1_555 ? 
5  AC1 7 LEU A 176 ? LEU A 302 . ? 1_555 ? 
6  AC1 7 LYS A 179 ? LYS A 305 . ? 1_555 ? 
7  AC1 7 TYR A 181 ? TYR A 307 . ? 1_555 ? 
8  AC2 7 HIS A 149 ? HIS A 275 . ? 1_555 ? 
9  AC2 7 ALA A 156 ? ALA A 282 . ? 1_555 ? 
10 AC2 7 SER A 157 ? SER A 283 . ? 1_555 ? 
11 AC2 7 VAL A 160 ? VAL A 286 . ? 1_555 ? 
12 AC2 7 HOH K .   ? HOH A 330 . ? 1_555 ? 
13 AC2 7 HOH K .   ? HOH A 342 . ? 1_555 ? 
14 AC2 7 HOH K .   ? HOH A 364 . ? 1_555 ? 
15 AC3 9 ILE B 109 ? ILE B 235 . ? 1_555 ? 
16 AC3 9 TYR B 131 ? TYR B 257 . ? 1_555 ? 
17 AC3 9 ILE B 133 ? ILE B 259 . ? 1_555 ? 
18 AC3 9 LYS B 161 ? LYS B 287 . ? 1_555 ? 
19 AC3 9 LEU B 172 ? LEU B 298 . ? 1_555 ? 
20 AC3 9 GLU B 175 ? GLU B 301 . ? 1_555 ? 
21 AC3 9 LEU B 176 ? LEU B 302 . ? 1_555 ? 
22 AC3 9 LYS B 179 ? LYS B 305 . ? 1_555 ? 
23 AC3 9 TYR B 181 ? TYR B 307 . ? 1_555 ? 
24 AC4 4 GLY B 120 ? GLY B 246 . ? 1_555 ? 
25 AC4 4 ASN B 121 ? ASN B 247 . ? 1_555 ? 
26 AC4 4 HOH L .   ? HOH B 323 . ? 1_555 ? 
27 AC4 4 HOH L .   ? HOH B 356 . ? 1_555 ? 
28 AC5 4 HOH K .   ? HOH A 88  . ? 1_556 ? 
29 AC5 4 LEU B 79  ? LEU B 205 . ? 1_555 ? 
30 AC5 4 ASN B 81  ? ASN B 207 . ? 1_555 ? 
31 AC5 4 THR B 117 ? THR B 243 . ? 1_555 ? 
32 AC6 6 SER C 13  ? SER C 139 . ? 1_555 ? 
33 AC6 6 SER C 15  ? SER C 141 . ? 1_555 ? 
34 AC6 6 ASP C 113 ? ASP C 239 . ? 1_555 ? 
35 AC6 6 HOH M .   ? HOH C 312 . ? 1_555 ? 
36 AC6 6 HOH M .   ? HOH C 394 . ? 1_555 ? 
37 AC6 6 HOH M .   ? HOH C 589 . ? 1_555 ? 
38 AC7 5 HOH M .   ? HOH C 119 . ? 1_555 ? 
39 AC7 5 ILE C 129 ? ILE C 255 . ? 1_555 ? 
40 AC7 5 LYS C 154 ? LYS C 280 . ? 1_555 ? 
41 AC7 5 PHE C 159 ? PHE C 285 . ? 1_555 ? 
42 AC7 5 HOH M .   ? HOH C 373 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3F78 
_atom_sites.fract_transf_matrix[1][1]   0.015954 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.008547 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011655 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017749 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
F  
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N    . GLY A 1 2   ? 20.203  29.316  15.872  1.00 22.53 ? 128 GLY A N    1 
ATOM   2    C  CA   . GLY A 1 2   ? 21.535  29.991  15.950  1.00 20.98 ? 128 GLY A CA   1 
ATOM   3    C  C    . GLY A 1 2   ? 22.164  30.229  14.591  1.00 20.42 ? 128 GLY A C    1 
ATOM   4    O  O    . GLY A 1 2   ? 21.907  29.497  13.629  1.00 20.47 ? 128 GLY A O    1 
ATOM   5    N  N    . ASN A 1 3   ? 23.015  31.248  14.515  1.00 19.47 ? 129 ASN A N    1 
ATOM   6    C  CA   . ASN A 1 3   ? 23.686  31.589  13.269  1.00 18.09 ? 129 ASN A CA   1 
ATOM   7    C  C    . ASN A 1 3   ? 24.775  30.576  12.916  1.00 17.07 ? 129 ASN A C    1 
ATOM   8    O  O    . ASN A 1 3   ? 25.496  30.102  13.791  1.00 16.64 ? 129 ASN A O    1 
ATOM   9    C  CB   . ASN A 1 3   ? 24.310  32.977  13.344  1.00 18.57 ? 129 ASN A CB   1 
ATOM   10   C  CG   . ASN A 1 3   ? 23.272  34.087  13.402  1.00 19.80 ? 129 ASN A CG   1 
ATOM   11   O  OD1  . ASN A 1 3   ? 22.152  33.927  12.919  1.00 20.87 ? 129 ASN A OD1  1 
ATOM   12   N  ND2  . ASN A 1 3   ? 23.652  35.223  13.976  1.00 22.02 ? 129 ASN A ND2  1 
ATOM   13   N  N    . VAL A 1 4   ? 24.875  30.275  11.629  1.00 15.70 ? 130 VAL A N    1 
ATOM   14   C  CA   . VAL A 1 4   ? 25.930  29.401  11.105  1.00 15.73 ? 130 VAL A CA   1 
ATOM   15   C  C    . VAL A 1 4   ? 26.659  30.093  9.944   1.00 15.80 ? 130 VAL A C    1 
ATOM   16   O  O    . VAL A 1 4   ? 26.029  30.522  8.975   1.00 14.68 ? 130 VAL A O    1 
ATOM   17   C  CB   . VAL A 1 4   ? 25.364  28.058  10.623  1.00 15.60 ? 130 VAL A CB   1 
ATOM   18   C  CG1  . VAL A 1 4   ? 26.499  27.175  10.063  1.00 16.31 ? 130 VAL A CG1  1 
ATOM   19   C  CG2  . VAL A 1 4   ? 24.638  27.337  11.751  1.00 15.97 ? 130 VAL A CG2  1 
ATOM   20   N  N    . ASP A 1 5   ? 27.985  30.191  10.046  1.00 15.47 ? 131 ASP A N    1 
ATOM   21   C  CA   . ASP A 1 5   ? 28.826  30.689  8.957   1.00 15.25 ? 131 ASP A CA   1 
ATOM   22   C  C    . ASP A 1 5   ? 29.500  29.464  8.357   1.00 15.30 ? 131 ASP A C    1 
ATOM   23   O  O    . ASP A 1 5   ? 30.359  28.842  9.006   1.00 15.68 ? 131 ASP A O    1 
ATOM   24   C  CB   . ASP A 1 5   ? 29.887  31.668  9.485   1.00 15.13 ? 131 ASP A CB   1 
ATOM   25   C  CG   . ASP A 1 5   ? 29.341  33.068  9.795   1.00 17.09 ? 131 ASP A CG   1 
ATOM   26   O  OD1  . ASP A 1 5   ? 28.154  33.392  9.528   1.00 17.46 ? 131 ASP A OD1  1 
ATOM   27   O  OD2  . ASP A 1 5   ? 30.139  33.875  10.322  1.00 16.96 ? 131 ASP A OD2  1 
ATOM   28   N  N    . LEU A 1 6   ? 29.079  29.088  7.149   1.00 14.86 ? 132 LEU A N    1 
ATOM   29   C  CA   . LEU A 1 6   ? 29.532  27.848  6.522   1.00 14.79 ? 132 LEU A CA   1 
ATOM   30   C  C    . LEU A 1 6   ? 30.359  28.130  5.283   1.00 14.81 ? 132 LEU A C    1 
ATOM   31   O  O    . LEU A 1 6   ? 29.956  28.911  4.407   1.00 14.02 ? 132 LEU A O    1 
ATOM   32   C  CB   . LEU A 1 6   ? 28.329  26.962  6.176   1.00 15.56 ? 132 LEU A CB   1 
ATOM   33   C  CG   . LEU A 1 6   ? 28.645  25.538  5.710   1.00 16.55 ? 132 LEU A CG   1 
ATOM   34   C  CD1  . LEU A 1 6   ? 27.533  24.573  6.142   1.00 17.97 ? 132 LEU A CD1  1 
ATOM   35   C  CD2  . LEU A 1 6   ? 28.880  25.453  4.208   1.00 15.99 ? 132 LEU A CD2  1 
ATOM   36   N  N    . VAL A 1 7   ? 31.527  27.498  5.207   1.00 14.05 ? 133 VAL A N    1 
ATOM   37   C  CA   . VAL A 1 7   ? 32.401  27.633  4.060   1.00 14.73 ? 133 VAL A CA   1 
ATOM   38   C  C    . VAL A 1 7   ? 32.491  26.316  3.307   1.00 14.27 ? 133 VAL A C    1 
ATOM   39   O  O    . VAL A 1 7   ? 32.766  25.277  3.904   1.00 14.70 ? 133 VAL A O    1 
ATOM   40   C  CB   . VAL A 1 7   ? 33.821  28.004  4.498   1.00 13.09 ? 133 VAL A CB   1 
ATOM   41   C  CG1  . VAL A 1 7   ? 34.744  28.159  3.276   1.00 15.17 ? 133 VAL A CG1  1 
ATOM   42   C  CG2  . VAL A 1 7   ? 33.791  29.300  5.307   1.00 15.62 ? 133 VAL A CG2  1 
ATOM   43   N  N    . PHE A 1 8   ? 32.251  26.373  2.001   1.00 14.72 ? 134 PHE A N    1 
ATOM   44   C  CA   . PHE A 1 8   ? 32.564  25.276  1.106   1.00 15.28 ? 134 PHE A CA   1 
ATOM   45   C  C    . PHE A 1 8   ? 34.018  25.412  0.654   1.00 15.20 ? 134 PHE A C    1 
ATOM   46   O  O    . PHE A 1 8   ? 34.390  26.427  0.081   1.00 17.00 ? 134 PHE A O    1 
ATOM   47   C  CB   . PHE A 1 8   ? 31.685  25.300  -0.136  1.00 16.30 ? 134 PHE A CB   1 
ATOM   48   C  CG   . PHE A 1 8   ? 30.203  25.243  0.147   1.00 16.15 ? 134 PHE A CG   1 
ATOM   49   C  CD1  . PHE A 1 8   ? 29.571  24.039  0.425   1.00 15.73 ? 134 PHE A CD1  1 
ATOM   50   C  CD2  . PHE A 1 8   ? 29.442  26.394  0.079   1.00 16.76 ? 134 PHE A CD2  1 
ATOM   51   C  CE1  . PHE A 1 8   ? 28.196  24.000  0.672   1.00 17.99 ? 134 PHE A CE1  1 
ATOM   52   C  CE2  . PHE A 1 8   ? 28.077  26.366  0.318   1.00 17.99 ? 134 PHE A CE2  1 
ATOM   53   C  CZ   . PHE A 1 8   ? 27.449  25.178  0.599   1.00 18.05 ? 134 PHE A CZ   1 
ATOM   54   N  N    . LEU A 1 9   ? 34.804  24.371  0.879   1.00 15.10 ? 135 LEU A N    1 
ATOM   55   C  CA   . LEU A 1 9   ? 36.192  24.300  0.413   1.00 14.99 ? 135 LEU A CA   1 
ATOM   56   C  C    . LEU A 1 9   ? 36.276  23.159  -0.572  1.00 15.74 ? 135 LEU A C    1 
ATOM   57   O  O    . LEU A 1 9   ? 36.222  21.984  -0.185  1.00 15.64 ? 135 LEU A O    1 
ATOM   58   C  CB   . LEU A 1 9   ? 37.130  24.069  1.589   1.00 14.87 ? 135 LEU A CB   1 
ATOM   59   C  CG   . LEU A 1 9   ? 38.621  23.946  1.264   1.00 14.49 ? 135 LEU A CG   1 
ATOM   60   C  CD1  . LEU A 1 9   ? 39.129  25.241  0.582   1.00 15.04 ? 135 LEU A CD1  1 
ATOM   61   C  CD2  . LEU A 1 9   ? 39.409  23.646  2.524   1.00 16.67 ? 135 LEU A CD2  1 
ATOM   62   N  N    . PHE A 1 10  ? 36.389  23.506  -1.847  1.00 15.71 ? 136 PHE A N    1 
ATOM   63   C  CA   . PHE A 1 10  ? 36.215  22.528  -2.904  1.00 14.68 ? 136 PHE A CA   1 
ATOM   64   C  C    . PHE A 1 10  ? 37.439  22.365  -3.796  1.00 14.46 ? 136 PHE A C    1 
ATOM   65   O  O    . PHE A 1 10  ? 38.059  23.338  -4.234  1.00 14.92 ? 136 PHE A O    1 
ATOM   66   C  CB   . PHE A 1 10  ? 34.935  22.805  -3.721  1.00 15.30 ? 136 PHE A CB   1 
ATOM   67   C  CG   . PHE A 1 10  ? 34.950  24.067  -4.542  1.00 15.49 ? 136 PHE A CG   1 
ATOM   68   C  CD1  . PHE A 1 10  ? 35.191  24.020  -5.914  1.00 16.62 ? 136 PHE A CD1  1 
ATOM   69   C  CD2  . PHE A 1 10  ? 34.661  25.302  -3.974  1.00 13.71 ? 136 PHE A CD2  1 
ATOM   70   C  CE1  . PHE A 1 10  ? 35.169  25.164  -6.688  1.00 17.56 ? 136 PHE A CE1  1 
ATOM   71   C  CE2  . PHE A 1 10  ? 34.630  26.445  -4.740  1.00 14.44 ? 136 PHE A CE2  1 
ATOM   72   C  CZ   . PHE A 1 10  ? 34.886  26.380  -6.112  1.00 14.80 ? 136 PHE A CZ   1 
ATOM   73   N  N    . ASP A 1 11  ? 37.745  21.098  -4.043  1.00 15.10 ? 137 ASP A N    1 
ATOM   74   C  CA   . ASP A 1 11  ? 38.901  20.630  -4.806  1.00 15.89 ? 137 ASP A CA   1 
ATOM   75   C  C    . ASP A 1 11  ? 38.744  21.042  -6.260  1.00 17.52 ? 137 ASP A C    1 
ATOM   76   O  O    . ASP A 1 11  ? 37.704  20.807  -6.866  1.00 18.42 ? 137 ASP A O    1 
ATOM   77   C  CB   . ASP A 1 11  ? 38.908  19.103  -4.685  1.00 16.16 ? 137 ASP A CB   1 
ATOM   78   C  CG   . ASP A 1 11  ? 40.200  18.425  -5.135  1.00 19.29 ? 137 ASP A CG   1 
ATOM   79   O  OD1  . ASP A 1 11  ? 41.009  19.016  -5.859  1.00 19.37 ? 137 ASP A OD1  1 
ATOM   80   O  OD2  . ASP A 1 11  ? 40.362  17.230  -4.757  1.00 19.01 ? 137 ASP A OD2  1 
ATOM   81   N  N    . GLY A 1 12  ? 39.770  21.671  -6.813  1.00 15.65 ? 138 GLY A N    1 
ATOM   82   C  CA   . GLY A 1 12  ? 39.831  21.977  -8.238  1.00 16.20 ? 138 GLY A CA   1 
ATOM   83   C  C    . GLY A 1 12  ? 41.047  21.368  -8.928  1.00 15.42 ? 138 GLY A C    1 
ATOM   84   O  O    . GLY A 1 12  ? 41.507  21.894  -9.957  1.00 15.30 ? 138 GLY A O    1 
ATOM   85   N  N    . SER A 1 13  ? 41.547  20.246  -8.404  1.00 14.64 ? 139 SER A N    1 
ATOM   86   C  CA   . SER A 1 13  ? 42.728  19.607  -8.998  1.00 15.54 ? 139 SER A CA   1 
ATOM   87   C  C    . SER A 1 13  ? 42.463  19.040  -10.387 1.00 15.13 ? 139 SER A C    1 
ATOM   88   O  O    . SER A 1 13  ? 41.306  18.865  -10.812 1.00 14.17 ? 139 SER A O    1 
ATOM   89   C  CB   . SER A 1 13  ? 43.243  18.475  -8.113  1.00 15.81 ? 139 SER A CB   1 
ATOM   90   O  OG   . SER A 1 13  ? 42.479  17.300  -8.347  1.00 16.59 ? 139 SER A OG   1 
ATOM   91   N  N    . MET A 1 14  ? 43.544  18.688  -11.070 1.00 14.84 ? 140 MET A N    1 
ATOM   92   C  CA   . MET A 1 14  ? 43.458  18.063  -12.390 1.00 15.61 ? 140 MET A CA   1 
ATOM   93   C  C    . MET A 1 14  ? 42.964  16.620  -12.355 1.00 15.66 ? 140 MET A C    1 
ATOM   94   O  O    . MET A 1 14  ? 42.726  16.046  -13.405 1.00 16.95 ? 140 MET A O    1 
ATOM   95   C  CB   . MET A 1 14  ? 44.777  18.140  -13.160 1.00 16.24 ? 140 MET A CB   1 
ATOM   96   C  CG   . MET A 1 14  ? 45.866  17.278  -12.614 1.00 19.24 ? 140 MET A CG   1 
ATOM   97   S  SD   . MET A 1 14  ? 47.317  17.325  -13.669 1.00 17.57 ? 140 MET A SD   1 
ATOM   98   C  CE   . MET A 1 14  ? 48.181  18.675  -12.875 1.00 21.18 ? 140 MET A CE   1 
ATOM   99   N  N    . SER A 1 15  ? 42.794  16.041  -11.166 1.00 15.45 ? 141 SER A N    1 
ATOM   100  C  CA   A SER A 1 15  ? 42.222  14.696  -11.086 0.50 17.09 ? 141 SER A CA   1 
ATOM   101  C  CA   B SER A 1 15  ? 42.204  14.708  -11.029 0.50 15.95 ? 141 SER A CA   1 
ATOM   102  C  C    . SER A 1 15  ? 40.726  14.711  -11.412 1.00 16.27 ? 141 SER A C    1 
ATOM   103  O  O    . SER A 1 15  ? 40.184  13.701  -11.888 1.00 18.22 ? 141 SER A O    1 
ATOM   104  C  CB   A SER A 1 15  ? 42.483  14.052  -9.716  0.50 16.87 ? 141 SER A CB   1 
ATOM   105  C  CB   B SER A 1 15  ? 42.348  14.213  -9.584  0.50 15.00 ? 141 SER A CB   1 
ATOM   106  O  OG   A SER A 1 15  ? 42.086  14.892  -8.664  0.50 23.04 ? 141 SER A OG   1 
ATOM   107  O  OG   B SER A 1 15  ? 41.833  12.902  -9.457  0.50 15.84 ? 141 SER A OG   1 
ATOM   108  N  N    . LEU A 1 16  ? 40.061  15.835  -11.162 1.00 16.42 ? 142 LEU A N    1 
ATOM   109  C  CA   . LEU A 1 16  ? 38.628  15.944  -11.436 1.00 16.94 ? 142 LEU A CA   1 
ATOM   110  C  C    . LEU A 1 16  ? 38.329  16.127  -12.912 1.00 17.31 ? 142 LEU A C    1 
ATOM   111  O  O    . LEU A 1 16  ? 38.888  17.011  -13.553 1.00 18.47 ? 142 LEU A O    1 
ATOM   112  C  CB   . LEU A 1 16  ? 38.036  17.128  -10.678 1.00 17.25 ? 142 LEU A CB   1 
ATOM   113  C  CG   . LEU A 1 16  ? 37.917  16.956  -9.180  1.00 19.78 ? 142 LEU A CG   1 
ATOM   114  C  CD1  . LEU A 1 16  ? 37.768  18.315  -8.538  1.00 24.18 ? 142 LEU A CD1  1 
ATOM   115  C  CD2  . LEU A 1 16  ? 36.745  16.070  -8.838  1.00 21.22 ? 142 LEU A CD2  1 
ATOM   116  N  N    . GLN A 1 17  ? 37.382  15.338  -13.417 1.00 16.57 ? 143 GLN A N    1 
ATOM   117  C  CA   . GLN A 1 17  ? 36.900  15.482  -14.774 1.00 17.04 ? 143 GLN A CA   1 
ATOM   118  C  C    . GLN A 1 17  ? 35.964  16.686  -14.830 1.00 17.11 ? 143 GLN A C    1 
ATOM   119  O  O    . GLN A 1 17  ? 35.412  17.098  -13.810 1.00 17.00 ? 143 GLN A O    1 
ATOM   120  C  CB   . GLN A 1 17  ? 36.179  14.209  -15.222 1.00 18.49 ? 143 GLN A CB   1 
ATOM   121  C  CG   . GLN A 1 17  ? 37.007  12.940  -14.987 1.00 20.13 ? 143 GLN A CG   1 
ATOM   122  C  CD   . GLN A 1 17  ? 38.321  12.993  -15.737 1.00 21.84 ? 143 GLN A CD   1 
ATOM   123  O  OE1  . GLN A 1 17  ? 38.334  13.206  -16.943 1.00 22.41 ? 143 GLN A OE1  1 
ATOM   124  N  NE2  . GLN A 1 17  ? 39.432  12.828  -15.025 1.00 24.56 ? 143 GLN A NE2  1 
ATOM   125  N  N    . PRO A 1 18  ? 35.773  17.257  -16.017 1.00 18.38 ? 144 PRO A N    1 
ATOM   126  C  CA   . PRO A 1 18  ? 34.934  18.441  -16.092 1.00 18.86 ? 144 PRO A CA   1 
ATOM   127  C  C    . PRO A 1 18  ? 33.528  18.249  -15.498 1.00 18.73 ? 144 PRO A C    1 
ATOM   128  O  O    . PRO A 1 18  ? 33.064  19.132  -14.780 1.00 19.83 ? 144 PRO A O    1 
ATOM   129  C  CB   . PRO A 1 18  ? 34.871  18.725  -17.589 1.00 19.82 ? 144 PRO A CB   1 
ATOM   130  C  CG   . PRO A 1 18  ? 36.116  18.143  -18.125 1.00 20.54 ? 144 PRO A CG   1 
ATOM   131  C  CD   . PRO A 1 18  ? 36.378  16.925  -17.321 1.00 19.16 ? 144 PRO A CD   1 
ATOM   132  N  N    . ASP A 1 19  ? 32.881  17.116  -15.769 1.00 18.85 ? 145 ASP A N    1 
ATOM   133  C  CA   . ASP A 1 19  ? 31.516  16.893  -15.278 1.00 18.80 ? 145 ASP A CA   1 
ATOM   134  C  C    . ASP A 1 19  ? 31.502  16.714  -13.764 1.00 17.56 ? 145 ASP A C    1 
ATOM   135  O  O    . ASP A 1 19  ? 30.524  17.059  -13.096 1.00 17.79 ? 145 ASP A O    1 
ATOM   136  C  CB   . ASP A 1 19  ? 30.838  15.704  -15.981 1.00 19.63 ? 145 ASP A CB   1 
ATOM   137  C  CG   . ASP A 1 19  ? 31.359  14.362  -15.523 1.00 23.91 ? 145 ASP A CG   1 
ATOM   138  O  OD1  . ASP A 1 19  ? 32.569  14.091  -15.680 1.00 31.35 ? 145 ASP A OD1  1 
ATOM   139  O  OD2  . ASP A 1 19  ? 30.557  13.561  -14.991 1.00 33.82 ? 145 ASP A OD2  1 
ATOM   140  N  N    . GLU A 1 20  ? 32.584  16.167  -13.223 1.00 16.43 ? 146 GLU A N    1 
ATOM   141  C  CA   . GLU A 1 20  ? 32.691  15.963  -11.775 1.00 16.00 ? 146 GLU A CA   1 
ATOM   142  C  C    . GLU A 1 20  ? 32.798  17.308  -11.061 1.00 15.29 ? 146 GLU A C    1 
ATOM   143  O  O    . GLU A 1 20  ? 32.119  17.552  -10.067 1.00 15.86 ? 146 GLU A O    1 
ATOM   144  C  CB   . GLU A 1 20  ? 33.885  15.057  -11.463 1.00 15.79 ? 146 GLU A CB   1 
ATOM   145  C  CG   . GLU A 1 20  ? 33.734  13.655  -12.071 1.00 16.23 ? 146 GLU A CG   1 
ATOM   146  C  CD   . GLU A 1 20  ? 34.966  12.769  -11.935 1.00 18.22 ? 146 GLU A CD   1 
ATOM   147  O  OE1  . GLU A 1 20  ? 36.085  13.288  -11.717 1.00 19.95 ? 146 GLU A OE1  1 
ATOM   148  O  OE2  . GLU A 1 20  ? 34.807  11.532  -12.064 1.00 21.02 ? 146 GLU A OE2  1 
ATOM   149  N  N    . PHE A 1 21  ? 33.663  18.181  -11.569 1.00 15.26 ? 147 PHE A N    1 
ATOM   150  C  CA   . PHE A 1 21  ? 33.806  19.532  -11.042 1.00 15.93 ? 147 PHE A CA   1 
ATOM   151  C  C    . PHE A 1 21  ? 32.475  20.269  -11.099 1.00 16.10 ? 147 PHE A C    1 
ATOM   152  O  O    . PHE A 1 21  ? 32.066  20.911  -10.122 1.00 16.48 ? 147 PHE A O    1 
ATOM   153  C  CB   . PHE A 1 21  ? 34.907  20.274  -11.812 1.00 16.50 ? 147 PHE A CB   1 
ATOM   154  C  CG   . PHE A 1 21  ? 35.243  21.633  -11.265 1.00 15.38 ? 147 PHE A CG   1 
ATOM   155  C  CD1  . PHE A 1 21  ? 35.992  21.767  -10.106 1.00 15.68 ? 147 PHE A CD1  1 
ATOM   156  C  CD2  . PHE A 1 21  ? 34.808  22.785  -11.916 1.00 16.92 ? 147 PHE A CD2  1 
ATOM   157  C  CE1  . PHE A 1 21  ? 36.315  23.018  -9.612  1.00 15.02 ? 147 PHE A CE1  1 
ATOM   158  C  CE2  . PHE A 1 21  ? 35.136  24.036  -11.426 1.00 18.40 ? 147 PHE A CE2  1 
ATOM   159  C  CZ   . PHE A 1 21  ? 35.894  24.147  -10.273 1.00 16.15 ? 147 PHE A CZ   1 
ATOM   160  N  N    . GLN A 1 22  ? 31.783  20.130  -12.218 1.00 16.01 ? 148 GLN A N    1 
ATOM   161  C  CA   . GLN A 1 22  ? 30.455  20.748  -12.364 1.00 15.60 ? 148 GLN A CA   1 
ATOM   162  C  C    . GLN A 1 22  ? 29.466  20.219  -11.320 1.00 15.52 ? 148 GLN A C    1 
ATOM   163  O  O    . GLN A 1 22  ? 28.673  20.994  -10.769 1.00 15.26 ? 148 GLN A O    1 
ATOM   164  C  CB   . GLN A 1 22  ? 29.893  20.563  -13.773 1.00 16.74 ? 148 GLN A CB   1 
ATOM   165  C  CG   . GLN A 1 22  ? 28.591  21.344  -14.011 1.00 18.39 ? 148 GLN A CG   1 
ATOM   166  C  CD   . GLN A 1 22  ? 28.782  22.841  -13.871 1.00 20.78 ? 148 GLN A CD   1 
ATOM   167  O  OE1  . GLN A 1 22  ? 29.635  23.428  -14.541 1.00 22.32 ? 148 GLN A OE1  1 
ATOM   168  N  NE2  . GLN A 1 22  ? 28.006  23.467  -12.994 1.00 22.74 ? 148 GLN A NE2  1 
ATOM   169  N  N    . LYS A 1 23  ? 29.537  18.922  -11.009 1.00 15.03 ? 149 LYS A N    1 
ATOM   170  C  CA   . LYS A 1 23  ? 28.639  18.343  -10.005 1.00 15.26 ? 149 LYS A CA   1 
ATOM   171  C  C    . LYS A 1 23  ? 28.939  18.905  -8.615  1.00 14.86 ? 149 LYS A C    1 
ATOM   172  O  O    . LYS A 1 23  ? 28.023  19.100  -7.819  1.00 16.25 ? 149 LYS A O    1 
ATOM   173  C  CB   . LYS A 1 23  ? 28.676  16.807  -10.031 1.00 15.79 ? 149 LYS A CB   1 
ATOM   174  C  CG   . LYS A 1 23  ? 27.923  16.221  -11.235 1.00 17.44 ? 149 LYS A CG   1 
ATOM   175  C  CD   . LYS A 1 23  ? 28.115  14.726  -11.372 1.00 20.02 ? 149 LYS A CD   1 
ATOM   176  C  CE   . LYS A 1 23  ? 27.409  14.193  -12.598 1.00 23.07 ? 149 LYS A CE   1 
ATOM   177  N  NZ   . LYS A 1 23  ? 28.113  14.585  -13.832 1.00 26.61 ? 149 LYS A NZ   1 
ATOM   178  N  N    . ILE A 1 24  ? 30.210  19.180  -8.319  1.00 15.26 ? 150 ILE A N    1 
ATOM   179  C  CA   . ILE A 1 24  ? 30.553  19.858  -7.071  1.00 15.95 ? 150 ILE A CA   1 
ATOM   180  C  C    . ILE A 1 24  ? 29.927  21.261  -7.014  1.00 16.02 ? 150 ILE A C    1 
ATOM   181  O  O    . ILE A 1 24  ? 29.330  21.639  -6.003  1.00 16.82 ? 150 ILE A O    1 
ATOM   182  C  CB   . ILE A 1 24  ? 32.073  19.914  -6.857  1.00 16.54 ? 150 ILE A CB   1 
ATOM   183  C  CG1  . ILE A 1 24  ? 32.622  18.499  -6.693  1.00 17.40 ? 150 ILE A CG1  1 
ATOM   184  C  CG2  . ILE A 1 24  ? 32.394  20.757  -5.624  1.00 16.21 ? 150 ILE A CG2  1 
ATOM   185  C  CD1  . ILE A 1 24  ? 34.156  18.467  -6.617  1.00 18.53 ? 150 ILE A CD1  1 
ATOM   186  N  N    . LEU A 1 25  ? 30.061  22.034  -8.090  1.00 16.93 ? 151 LEU A N    1 
ATOM   187  C  CA   . LEU A 1 25  ? 29.451  23.367  -8.159  1.00 16.56 ? 151 LEU A CA   1 
ATOM   188  C  C    . LEU A 1 25  ? 27.951  23.290  -7.931  1.00 17.01 ? 151 LEU A C    1 
ATOM   189  O  O    . LEU A 1 25  ? 27.389  24.032  -7.117  1.00 16.54 ? 151 LEU A O    1 
ATOM   190  C  CB   . LEU A 1 25  ? 29.770  24.046  -9.487  1.00 17.55 ? 151 LEU A CB   1 
ATOM   191  C  CG   . LEU A 1 25  ? 31.251  24.366  -9.768  1.00 17.88 ? 151 LEU A CG   1 
ATOM   192  C  CD1  . LEU A 1 25  ? 31.407  24.952  -11.173 1.00 22.16 ? 151 LEU A CD1  1 
ATOM   193  C  CD2  . LEU A 1 25  ? 31.837  25.309  -8.726  1.00 23.80 ? 151 LEU A CD2  1 
ATOM   194  N  N    . ASP A 1 26  ? 27.311  22.360  -8.616  1.00 15.86 ? 152 ASP A N    1 
ATOM   195  C  CA   . ASP A 1 26  ? 25.855  22.229  -8.527  1.00 15.50 ? 152 ASP A CA   1 
ATOM   196  C  C    . ASP A 1 26  ? 25.394  21.843  -7.118  1.00 15.43 ? 152 ASP A C    1 
ATOM   197  O  O    . ASP A 1 26  ? 24.347  22.305  -6.642  1.00 15.31 ? 152 ASP A O    1 
ATOM   198  C  CB   . ASP A 1 26  ? 25.356  21.232  -9.572  1.00 16.23 ? 152 ASP A CB   1 
ATOM   199  C  CG   . ASP A 1 26  ? 25.480  21.775  -10.999 1.00 18.61 ? 152 ASP A CG   1 
ATOM   200  O  OD1  . ASP A 1 26  ? 25.658  22.998  -11.161 1.00 24.88 ? 152 ASP A OD1  1 
ATOM   201  O  OD2  . ASP A 1 26  ? 25.410  20.977  -11.948 1.00 24.95 ? 152 ASP A OD2  1 
ATOM   202  N  N    . PHE A 1 27  ? 26.154  20.984  -6.455  1.00 15.64 ? 153 PHE A N    1 
ATOM   203  C  CA   . PHE A 1 27  ? 25.875  20.611  -5.064  1.00 15.50 ? 153 PHE A CA   1 
ATOM   204  C  C    . PHE A 1 27  ? 25.926  21.840  -4.145  1.00 15.85 ? 153 PHE A C    1 
ATOM   205  O  O    . PHE A 1 27  ? 25.028  22.053  -3.337  1.00 15.83 ? 153 PHE A O    1 
ATOM   206  C  CB   . PHE A 1 27  ? 26.898  19.564  -4.608  1.00 16.22 ? 153 PHE A CB   1 
ATOM   207  C  CG   . PHE A 1 27  ? 26.848  19.249  -3.141  1.00 16.26 ? 153 PHE A CG   1 
ATOM   208  C  CD1  . PHE A 1 27  ? 25.827  18.466  -2.624  1.00 18.01 ? 153 PHE A CD1  1 
ATOM   209  C  CD2  . PHE A 1 27  ? 27.850  19.690  -2.284  1.00 17.84 ? 153 PHE A CD2  1 
ATOM   210  C  CE1  . PHE A 1 27  ? 25.777  18.154  -1.270  1.00 18.06 ? 153 PHE A CE1  1 
ATOM   211  C  CE2  . PHE A 1 27  ? 27.798  19.385  -0.927  1.00 18.35 ? 153 PHE A CE2  1 
ATOM   212  C  CZ   . PHE A 1 27  ? 26.760  18.613  -0.426  1.00 17.95 ? 153 PHE A CZ   1 
ATOM   213  N  N    . MET A 1 28  ? 26.989  22.634  -4.260  1.00 15.75 ? 154 MET A N    1 
ATOM   214  C  CA   . MET A 1 28  ? 27.126  23.836  -3.430  1.00 16.10 ? 154 MET A CA   1 
ATOM   215  C  C    . MET A 1 28  ? 25.930  24.770  -3.650  1.00 15.69 ? 154 MET A C    1 
ATOM   216  O  O    . MET A 1 28  ? 25.361  25.299  -2.692  1.00 16.20 ? 154 MET A O    1 
ATOM   217  C  CB   . MET A 1 28  ? 28.442  24.560  -3.702  1.00 16.46 ? 154 MET A CB   1 
ATOM   218  C  CG   . MET A 1 28  ? 29.640  23.763  -3.268  1.00 16.10 ? 154 MET A CG   1 
ATOM   219  S  SD   . MET A 1 28  ? 31.205  24.631  -3.532  1.00 21.42 ? 154 MET A SD   1 
ATOM   220  C  CE   . MET A 1 28  ? 31.317  24.763  -5.303  1.00 19.13 ? 154 MET A CE   1 
ATOM   221  N  N    . LYS A 1 29  ? 25.555  24.950  -4.918  1.00 15.77 ? 155 LYS A N    1 
ATOM   222  C  CA   . LYS A 1 29  ? 24.401  25.778  -5.269  1.00 15.74 ? 155 LYS A CA   1 
ATOM   223  C  C    . LYS A 1 29  ? 23.124  25.236  -4.666  1.00 16.09 ? 155 LYS A C    1 
ATOM   224  O  O    . LYS A 1 29  ? 22.319  25.990  -4.099  1.00 14.82 ? 155 LYS A O    1 
ATOM   225  C  CB   . LYS A 1 29  ? 24.246  25.862  -6.779  1.00 16.79 ? 155 LYS A CB   1 
ATOM   226  C  CG   . LYS A 1 29  ? 25.314  26.686  -7.474  1.00 18.07 ? 155 LYS A CG   1 
ATOM   227  C  CD   . LYS A 1 29  ? 25.068  26.606  -8.970  1.00 21.90 ? 155 LYS A CD   1 
ATOM   228  C  CE   . LYS A 1 29  ? 26.012  27.424  -9.775  1.00 24.55 ? 155 LYS A CE   1 
ATOM   229  N  NZ   . LYS A 1 29  ? 25.529  27.507  -11.177 1.00 27.51 ? 155 LYS A NZ   1 
ATOM   230  N  N    . ASP A 1 30  ? 22.944  23.924  -4.777  1.00 15.88 ? 156 ASP A N    1 
ATOM   231  C  CA   . ASP A 1 30  ? 21.746  23.279  -4.252  1.00 16.93 ? 156 ASP A CA   1 
ATOM   232  C  C    . ASP A 1 30  ? 21.657  23.398  -2.730  1.00 16.97 ? 156 ASP A C    1 
ATOM   233  O  O    . ASP A 1 30  ? 20.578  23.703  -2.199  1.00 17.26 ? 156 ASP A O    1 
ATOM   234  C  CB   . ASP A 1 30  ? 21.677  21.815  -4.705  1.00 17.35 ? 156 ASP A CB   1 
ATOM   235  C  CG   . ASP A 1 30  ? 21.290  21.674  -6.178  1.00 21.87 ? 156 ASP A CG   1 
ATOM   236  O  OD1  . ASP A 1 30  ? 20.660  22.607  -6.731  1.00 26.50 ? 156 ASP A OD1  1 
ATOM   237  O  OD2  . ASP A 1 30  ? 21.613  20.628  -6.784  1.00 26.04 ? 156 ASP A OD2  1 
ATOM   238  N  N    . VAL A 1 31  ? 22.779  23.202  -2.035  1.00 16.20 ? 157 VAL A N    1 
ATOM   239  C  CA   . VAL A 1 31  ? 22.817  23.336  -0.578  1.00 17.14 ? 157 VAL A CA   1 
ATOM   240  C  C    . VAL A 1 31  ? 22.411  24.761  -0.184  1.00 17.34 ? 157 VAL A C    1 
ATOM   241  O  O    . VAL A 1 31  ? 21.561  24.939  0.677   1.00 17.51 ? 157 VAL A O    1 
ATOM   242  C  CB   . VAL A 1 31  ? 24.199  22.971  0.016   1.00 17.37 ? 157 VAL A CB   1 
ATOM   243  C  CG1  . VAL A 1 31  ? 24.292  23.344  1.492   1.00 17.38 ? 157 VAL A CG1  1 
ATOM   244  C  CG2  . VAL A 1 31  ? 24.507  21.494  -0.173  1.00 15.44 ? 157 VAL A CG2  1 
ATOM   245  N  N    . MET A 1 32  ? 22.988  25.764  -0.844  1.00 16.77 ? 158 MET A N    1 
ATOM   246  C  CA   . MET A 1 32  ? 22.641  27.165  -0.569  1.00 17.18 ? 158 MET A CA   1 
ATOM   247  C  C    . MET A 1 32  ? 21.163  27.479  -0.829  1.00 18.38 ? 158 MET A C    1 
ATOM   248  O  O    . MET A 1 32  ? 20.522  28.133  -0.005  1.00 18.32 ? 158 MET A O    1 
ATOM   249  C  CB   . MET A 1 32  ? 23.547  28.102  -1.364  1.00 17.98 ? 158 MET A CB   1 
ATOM   250  C  CG   . MET A 1 32  ? 24.946  28.083  -0.847  1.00 16.91 ? 158 MET A CG   1 
ATOM   251  S  SD   . MET A 1 32  ? 25.986  29.352  -1.585  1.00 21.48 ? 158 MET A SD   1 
ATOM   252  C  CE   . MET A 1 32  ? 26.457  28.531  -3.081  1.00 17.48 ? 158 MET A CE   1 
ATOM   253  N  N    . LYS A 1 33  ? 20.631  27.024  -1.962  1.00 18.61 ? 159 LYS A N    1 
ATOM   254  C  CA   . LYS A 1 33  ? 19.212  27.248  -2.292  1.00 20.24 ? 159 LYS A CA   1 
ATOM   255  C  C    . LYS A 1 33  ? 18.280  26.646  -1.258  1.00 21.16 ? 159 LYS A C    1 
ATOM   256  O  O    . LYS A 1 33  ? 17.251  27.249  -0.911  1.00 20.83 ? 159 LYS A O    1 
ATOM   257  C  CB   . LYS A 1 33  ? 18.890  26.677  -3.669  1.00 19.93 ? 159 LYS A CB   1 
ATOM   258  C  CG   . LYS A 1 33  ? 19.453  27.489  -4.820  1.00 22.26 ? 159 LYS A CG   1 
ATOM   259  C  CD   . LYS A 1 33  ? 19.287  26.775  -6.155  1.00 24.74 ? 159 LYS A CD   1 
ATOM   260  C  CE   . LYS A 1 33  ? 19.701  27.681  -7.312  1.00 26.72 ? 159 LYS A CE   1 
ATOM   261  N  NZ   . LYS A 1 33  ? 20.122  26.932  -8.537  1.00 30.57 ? 159 LYS A NZ   1 
ATOM   262  N  N    . LYS A 1 34  ? 18.632  25.459  -0.772  1.00 22.38 ? 160 LYS A N    1 
ATOM   263  C  CA   . LYS A 1 34  ? 17.853  24.765  0.251   1.00 23.38 ? 160 LYS A CA   1 
ATOM   264  C  C    . LYS A 1 34  ? 17.943  25.437  1.621   1.00 24.23 ? 160 LYS A C    1 
ATOM   265  O  O    . LYS A 1 34  ? 17.095  25.200  2.485   1.00 23.72 ? 160 LYS A O    1 
ATOM   266  C  CB   . LYS A 1 34  ? 18.287  23.293  0.342   1.00 23.66 ? 160 LYS A CB   1 
ATOM   267  C  CG   . LYS A 1 34  ? 17.804  22.453  -0.843  1.00 26.09 ? 160 LYS A CG   1 
ATOM   268  C  CD   . LYS A 1 34  ? 18.633  21.185  -1.056  1.00 27.49 ? 160 LYS A CD   1 
ATOM   269  C  CE   . LYS A 1 34  ? 17.934  20.167  -1.967  1.00 30.25 ? 160 LYS A CE   1 
ATOM   270  N  NZ   . LYS A 1 34  ? 16.920  20.749  -2.897  1.00 30.74 ? 160 LYS A NZ   1 
ATOM   271  N  N    . LEU A 1 35  ? 18.956  26.281  1.816   1.00 24.62 ? 161 LEU A N    1 
ATOM   272  C  CA   . LEU A 1 35  ? 19.137  27.006  3.075   1.00 25.45 ? 161 LEU A CA   1 
ATOM   273  C  C    . LEU A 1 35  ? 19.003  28.527  2.911   1.00 26.02 ? 161 LEU A C    1 
ATOM   274  O  O    . LEU A 1 35  ? 19.511  29.289  3.728   1.00 26.95 ? 161 LEU A O    1 
ATOM   275  C  CB   . LEU A 1 35  ? 20.494  26.632  3.687   1.00 25.57 ? 161 LEU A CB   1 
ATOM   276  C  CG   . LEU A 1 35  ? 20.635  25.143  4.019   1.00 25.76 ? 161 LEU A CG   1 
ATOM   277  C  CD1  . LEU A 1 35  ? 22.031  24.793  4.465   1.00 25.16 ? 161 LEU A CD1  1 
ATOM   278  C  CD2  . LEU A 1 35  ? 19.609  24.728  5.081   1.00 26.80 ? 161 LEU A CD2  1 
ATOM   279  N  N    . SER A 1 36  ? 18.312  28.971  1.867   1.00 26.81 ? 162 SER A N    1 
ATOM   280  C  CA   . SER A 1 36  ? 18.120  30.400  1.640   1.00 27.61 ? 162 SER A CA   1 
ATOM   281  C  C    . SER A 1 36  ? 17.189  30.958  2.710   1.00 28.49 ? 162 SER A C    1 
ATOM   282  O  O    . SER A 1 36  ? 16.287  30.253  3.177   1.00 28.50 ? 162 SER A O    1 
ATOM   283  C  CB   . SER A 1 36  ? 17.542  30.660  0.249   1.00 28.21 ? 162 SER A CB   1 
ATOM   284  O  OG   . SER A 1 36  ? 16.240  30.102  0.119   1.00 29.99 ? 162 SER A OG   1 
ATOM   285  N  N    . ASN A 1 37  ? 17.428  32.208  3.104   1.00 28.77 ? 163 ASN A N    1 
ATOM   286  C  CA   . ASN A 1 37  ? 16.598  32.905  4.098   1.00 29.49 ? 163 ASN A CA   1 
ATOM   287  C  C    . ASN A 1 37  ? 16.550  32.183  5.448   1.00 29.10 ? 163 ASN A C    1 
ATOM   288  O  O    . ASN A 1 37  ? 15.506  32.118  6.101   1.00 29.92 ? 163 ASN A O    1 
ATOM   289  C  CB   . ASN A 1 37  ? 15.181  33.154  3.555   1.00 30.27 ? 163 ASN A CB   1 
ATOM   290  C  CG   . ASN A 1 37  ? 15.160  34.150  2.411   1.00 31.50 ? 163 ASN A CG   1 
ATOM   291  O  OD1  . ASN A 1 37  ? 16.161  34.344  1.717   1.00 36.33 ? 163 ASN A OD1  1 
ATOM   292  N  ND2  . ASN A 1 37  ? 14.015  34.787  2.208   1.00 32.61 ? 163 ASN A ND2  1 
ATOM   293  N  N    . THR A 1 38  ? 17.696  31.642  5.853   1.00 28.08 ? 164 THR A N    1 
ATOM   294  C  CA   . THR A 1 38  ? 17.845  30.983  7.141   1.00 27.35 ? 164 THR A CA   1 
ATOM   295  C  C    . THR A 1 38  ? 18.937  31.718  7.937   1.00 26.53 ? 164 THR A C    1 
ATOM   296  O  O    . THR A 1 38  ? 19.397  32.786  7.522   1.00 27.87 ? 164 THR A O    1 
ATOM   297  C  CB   . THR A 1 38  ? 18.220  29.512  6.944   1.00 27.41 ? 164 THR A CB   1 
ATOM   298  O  OG1  . THR A 1 38  ? 19.507  29.436  6.323   1.00 27.21 ? 164 THR A OG1  1 
ATOM   299  C  CG2  . THR A 1 38  ? 17.192  28.809  6.058   1.00 28.45 ? 164 THR A CG2  1 
ATOM   300  N  N    . SER A 1 39  ? 19.358  31.146  9.067   1.00 24.61 ? 165 SER A N    1 
ATOM   301  C  CA   . SER A 1 39  ? 20.435  31.724  9.879   1.00 22.77 ? 165 SER A CA   1 
ATOM   302  C  C    . SER A 1 39  ? 21.814  31.466  9.262   1.00 20.41 ? 165 SER A C    1 
ATOM   303  O  O    . SER A 1 39  ? 22.842  31.819  9.850   1.00 18.59 ? 165 SER A O    1 
ATOM   304  C  CB   . SER A 1 39  ? 20.412  31.129  11.277  1.00 23.26 ? 165 SER A CB   1 
ATOM   305  O  OG   . SER A 1 39  ? 20.792  29.767  11.234  1.00 26.72 ? 165 SER A OG   1 
ATOM   306  N  N    . TYR A 1 40  ? 21.826  30.837  8.097   1.00 18.71 ? 166 TYR A N    1 
ATOM   307  C  CA   . TYR A 1 40  ? 23.069  30.542  7.404   1.00 17.44 ? 166 TYR A CA   1 
ATOM   308  C  C    . TYR A 1 40  ? 23.552  31.688  6.549   1.00 17.48 ? 166 TYR A C    1 
ATOM   309  O  O    . TYR A 1 40  ? 22.754  32.400  5.917   1.00 18.84 ? 166 TYR A O    1 
ATOM   310  C  CB   . TYR A 1 40  ? 22.903  29.350  6.461   1.00 18.14 ? 166 TYR A CB   1 
ATOM   311  C  CG   . TYR A 1 40  ? 22.916  27.984  7.093   1.00 17.84 ? 166 TYR A CG   1 
ATOM   312  C  CD1  . TYR A 1 40  ? 24.084  27.232  7.143   1.00 20.15 ? 166 TYR A CD1  1 
ATOM   313  C  CD2  . TYR A 1 40  ? 21.752  27.415  7.581   1.00 18.55 ? 166 TYR A CD2  1 
ATOM   314  C  CE1  . TYR A 1 40  ? 24.098  25.974  7.701   1.00 20.14 ? 166 TYR A CE1  1 
ATOM   315  C  CE2  . TYR A 1 40  ? 21.750  26.148  8.133   1.00 18.15 ? 166 TYR A CE2  1 
ATOM   316  C  CZ   . TYR A 1 40  ? 22.931  25.430  8.188   1.00 18.52 ? 166 TYR A CZ   1 
ATOM   317  O  OH   . TYR A 1 40  ? 22.926  24.168  8.731   1.00 19.30 ? 166 TYR A OH   1 
ATOM   318  N  N    . GLN A 1 41  ? 24.872  31.852  6.526   1.00 16.41 ? 167 GLN A N    1 
ATOM   319  C  CA   A GLN A 1 41  ? 25.553  32.612  5.483   0.60 16.03 ? 167 GLN A CA   1 
ATOM   320  C  CA   B GLN A 1 41  ? 25.524  32.569  5.435   0.40 15.85 ? 167 GLN A CA   1 
ATOM   321  C  C    . GLN A 1 41  ? 26.737  31.766  4.990   1.00 15.15 ? 167 GLN A C    1 
ATOM   322  O  O    . GLN A 1 41  ? 27.256  30.938  5.738   1.00 16.07 ? 167 GLN A O    1 
ATOM   323  C  CB   A GLN A 1 41  ? 25.944  34.002  6.009   0.60 16.24 ? 167 GLN A CB   1 
ATOM   324  C  CB   B GLN A 1 41  ? 25.900  33.992  5.819   0.40 15.79 ? 167 GLN A CB   1 
ATOM   325  C  CG   A GLN A 1 41  ? 24.678  34.789  6.409   0.60 16.43 ? 167 GLN A CG   1 
ATOM   326  C  CG   B GLN A 1 41  ? 26.960  34.105  6.865   0.40 15.50 ? 167 GLN A CG   1 
ATOM   327  C  CD   A GLN A 1 41  ? 24.865  36.255  6.787   0.60 18.05 ? 167 GLN A CD   1 
ATOM   328  C  CD   B GLN A 1 41  ? 27.413  35.537  7.057   0.40 15.14 ? 167 GLN A CD   1 
ATOM   329  O  OE1  A GLN A 1 41  ? 25.964  36.720  7.092   0.60 16.14 ? 167 GLN A OE1  1 
ATOM   330  O  OE1  B GLN A 1 41  ? 26.884  36.455  6.432   0.40 20.10 ? 167 GLN A OE1  1 
ATOM   331  N  NE2  A GLN A 1 41  ? 23.751  36.986  6.802   0.60 15.48 ? 167 GLN A NE2  1 
ATOM   332  N  NE2  B GLN A 1 41  ? 28.396  35.732  7.906   0.40 10.53 ? 167 GLN A NE2  1 
ATOM   333  N  N    . PHE A 1 42  ? 27.135  31.978  3.743   1.00 14.30 ? 168 PHE A N    1 
ATOM   334  C  CA   . PHE A 1 42  ? 28.084  31.090  3.071   1.00 14.46 ? 168 PHE A CA   1 
ATOM   335  C  C    . PHE A 1 42  ? 29.242  31.824  2.442   1.00 14.35 ? 168 PHE A C    1 
ATOM   336  O  O    . PHE A 1 42  ? 29.122  32.990  2.067   1.00 14.61 ? 168 PHE A O    1 
ATOM   337  C  CB   . PHE A 1 42  ? 27.363  30.331  1.960   1.00 14.99 ? 168 PHE A CB   1 
ATOM   338  C  CG   . PHE A 1 42  ? 26.221  29.490  2.442   1.00 15.74 ? 168 PHE A CG   1 
ATOM   339  C  CD1  . PHE A 1 42  ? 26.436  28.191  2.874   1.00 16.26 ? 168 PHE A CD1  1 
ATOM   340  C  CD2  . PHE A 1 42  ? 24.933  29.984  2.456   1.00 16.58 ? 168 PHE A CD2  1 
ATOM   341  C  CE1  . PHE A 1 42  ? 25.388  27.406  3.309   1.00 18.77 ? 168 PHE A CE1  1 
ATOM   342  C  CE2  . PHE A 1 42  ? 23.879  29.192  2.899   1.00 15.86 ? 168 PHE A CE2  1 
ATOM   343  C  CZ   . PHE A 1 42  ? 24.112  27.913  3.328   1.00 16.60 ? 168 PHE A CZ   1 
ATOM   344  N  N    . ALA A 1 43  ? 30.367  31.112  2.343   1.00 14.82 ? 169 ALA A N    1 
ATOM   345  C  CA   . ALA A 1 43  ? 31.494  31.515  1.543   1.00 14.31 ? 169 ALA A CA   1 
ATOM   346  C  C    . ALA A 1 43  ? 32.017  30.271  0.814   1.00 15.40 ? 169 ALA A C    1 
ATOM   347  O  O    . ALA A 1 43  ? 31.693  29.138  1.199   1.00 15.14 ? 169 ALA A O    1 
ATOM   348  C  CB   . ALA A 1 43  ? 32.586  32.136  2.434   1.00 14.85 ? 169 ALA A CB   1 
ATOM   349  N  N    . ALA A 1 44  ? 32.787  30.471  -0.249  1.00 14.69 ? 170 ALA A N    1 
ATOM   350  C  CA   . ALA A 1 44  ? 33.340  29.338  -0.997  1.00 14.62 ? 170 ALA A CA   1 
ATOM   351  C  C    . ALA A 1 44  ? 34.766  29.622  -1.422  1.00 15.07 ? 170 ALA A C    1 
ATOM   352  O  O    . ALA A 1 44  ? 35.065  30.718  -1.906  1.00 16.12 ? 170 ALA A O    1 
ATOM   353  C  CB   . ALA A 1 44  ? 32.499  28.982  -2.192  1.00 15.47 ? 170 ALA A CB   1 
ATOM   354  N  N    . VAL A 1 45  ? 35.609  28.602  -1.280  1.00 16.01 ? 171 VAL A N    1 
ATOM   355  C  CA   . VAL A 1 45  ? 37.020  28.673  -1.628  1.00 14.66 ? 171 VAL A CA   1 
ATOM   356  C  C    . VAL A 1 45  ? 37.358  27.474  -2.498  1.00 14.40 ? 171 VAL A C    1 
ATOM   357  O  O    . VAL A 1 45  ? 37.061  26.344  -2.121  1.00 14.43 ? 171 VAL A O    1 
ATOM   358  C  CB   . VAL A 1 45  ? 37.886  28.597  -0.366  1.00 15.20 ? 171 VAL A CB   1 
ATOM   359  C  CG1  . VAL A 1 45  ? 39.402  28.468  -0.707  1.00 15.97 ? 171 VAL A CG1  1 
ATOM   360  C  CG2  . VAL A 1 45  ? 37.647  29.783  0.535   1.00 17.23 ? 171 VAL A CG2  1 
ATOM   361  N  N    . GLN A 1 46  ? 37.951  27.723  -3.664  1.00 14.73 ? 172 GLN A N    1 
ATOM   362  C  CA   . GLN A 1 46  ? 38.495  26.652  -4.483  1.00 14.36 ? 172 GLN A CA   1 
ATOM   363  C  C    . GLN A 1 46  ? 39.954  26.435  -4.093  1.00 14.75 ? 172 GLN A C    1 
ATOM   364  O  O    . GLN A 1 46  ? 40.718  27.397  -3.907  1.00 15.94 ? 172 GLN A O    1 
ATOM   365  C  CB   . GLN A 1 46  ? 38.410  26.985  -5.976  1.00 15.13 ? 172 GLN A CB   1 
ATOM   366  C  CG   . GLN A 1 46  ? 38.800  25.797  -6.850  1.00 15.67 ? 172 GLN A CG   1 
ATOM   367  C  CD   . GLN A 1 46  ? 38.802  26.047  -8.355  1.00 14.04 ? 172 GLN A CD   1 
ATOM   368  O  OE1  . GLN A 1 46  ? 39.203  25.146  -9.121  1.00 16.36 ? 172 GLN A OE1  1 
ATOM   369  N  NE2  . GLN A 1 46  ? 38.398  27.249  -8.794  1.00 13.94 ? 172 GLN A NE2  1 
ATOM   370  N  N    . PHE A 1 47  ? 40.345  25.174  -4.000  1.00 14.16 ? 173 PHE A N    1 
ATOM   371  C  CA   . PHE A 1 47  ? 41.754  24.834  -3.729  1.00 13.82 ? 173 PHE A CA   1 
ATOM   372  C  C    . PHE A 1 47  ? 42.300  23.851  -4.749  1.00 14.96 ? 173 PHE A C    1 
ATOM   373  O  O    . PHE A 1 47  ? 41.613  22.917  -5.184  1.00 15.50 ? 173 PHE A O    1 
ATOM   374  C  CB   . PHE A 1 47  ? 41.984  24.330  -2.290  1.00 14.10 ? 173 PHE A CB   1 
ATOM   375  C  CG   . PHE A 1 47  ? 41.556  22.906  -2.031  1.00 13.93 ? 173 PHE A CG   1 
ATOM   376  C  CD1  . PHE A 1 47  ? 42.498  21.867  -2.011  1.00 16.79 ? 173 PHE A CD1  1 
ATOM   377  C  CD2  . PHE A 1 47  ? 40.234  22.609  -1.718  1.00 15.07 ? 173 PHE A CD2  1 
ATOM   378  C  CE1  . PHE A 1 47  ? 42.123  20.561  -1.731  1.00 16.67 ? 173 PHE A CE1  1 
ATOM   379  C  CE2  . PHE A 1 47  ? 39.847  21.306  -1.457  1.00 16.46 ? 173 PHE A CE2  1 
ATOM   380  C  CZ   . PHE A 1 47  ? 40.764  20.284  -1.456  1.00 15.95 ? 173 PHE A CZ   1 
ATOM   381  N  N    . SER A 1 48  ? 43.542  24.089  -5.147  1.00 16.29 ? 174 SER A N    1 
ATOM   382  C  CA   . SER A 1 48  ? 44.285  23.129  -5.958  1.00 15.82 ? 174 SER A CA   1 
ATOM   383  C  C    . SER A 1 48  ? 45.752  23.247  -5.524  1.00 16.37 ? 174 SER A C    1 
ATOM   384  O  O    . SER A 1 48  ? 46.104  22.806  -4.424  1.00 17.23 ? 174 SER A O    1 
ATOM   385  C  CB   . SER A 1 48  ? 44.023  23.388  -7.445  1.00 17.16 ? 174 SER A CB   1 
ATOM   386  O  OG   . SER A 1 48  ? 44.595  22.387  -8.271  1.00 17.62 ? 174 SER A OG   1 
ATOM   387  N  N    . THR A 1 49  ? 46.614  23.829  -6.348  1.00 17.29 ? 175 THR A N    1 
ATOM   388  C  CA   . THR A 1 49  ? 47.932  24.210  -5.836  1.00 17.25 ? 175 THR A CA   1 
ATOM   389  C  C    . THR A 1 49  ? 47.789  25.403  -4.919  1.00 18.22 ? 175 THR A C    1 
ATOM   390  O  O    . THR A 1 49  ? 48.380  25.431  -3.836  1.00 17.66 ? 175 THR A O    1 
ATOM   391  C  CB   . THR A 1 49  ? 48.935  24.529  -6.950  1.00 17.88 ? 175 THR A CB   1 
ATOM   392  O  OG1  . THR A 1 49  ? 49.171  23.337  -7.698  1.00 18.06 ? 175 THR A OG1  1 
ATOM   393  C  CG2  . THR A 1 49  ? 50.259  25.025  -6.348  1.00 18.75 ? 175 THR A CG2  1 
ATOM   394  N  N    . SER A 1 50  ? 47.021  26.394  -5.385  1.00 17.23 ? 176 SER A N    1 
ATOM   395  C  CA   . SER A 1 50  ? 46.787  27.633  -4.683  1.00 16.75 ? 176 SER A CA   1 
ATOM   396  C  C    . SER A 1 50  ? 45.332  27.741  -4.256  1.00 16.67 ? 176 SER A C    1 
ATOM   397  O  O    . SER A 1 50  ? 44.502  26.876  -4.592  1.00 17.28 ? 176 SER A O    1 
ATOM   398  C  CB   . SER A 1 50  ? 47.165  28.834  -5.561  1.00 17.27 ? 176 SER A CB   1 
ATOM   399  O  OG   . SER A 1 50  ? 46.218  29.038  -6.610  1.00 18.01 ? 176 SER A OG   1 
ATOM   400  N  N    . TYR A 1 51  ? 45.031  28.801  -3.519  1.00 16.75 ? 177 TYR A N    1 
ATOM   401  C  CA   . TYR A 1 51  ? 43.719  28.994  -2.891  1.00 16.45 ? 177 TYR A CA   1 
ATOM   402  C  C    . TYR A 1 51  ? 43.082  30.269  -3.400  1.00 16.75 ? 177 TYR A C    1 
ATOM   403  O  O    . TYR A 1 51  ? 43.747  31.298  -3.521  1.00 18.19 ? 177 TYR A O    1 
ATOM   404  C  CB   . TYR A 1 51  ? 43.864  29.032  -1.365  1.00 15.80 ? 177 TYR A CB   1 
ATOM   405  C  CG   . TYR A 1 51  ? 44.784  27.940  -0.895  1.00 16.82 ? 177 TYR A CG   1 
ATOM   406  C  CD1  . TYR A 1 51  ? 44.585  26.634  -1.326  1.00 16.49 ? 177 TYR A CD1  1 
ATOM   407  C  CD2  . TYR A 1 51  ? 45.888  28.208  -0.087  1.00 15.86 ? 177 TYR A CD2  1 
ATOM   408  C  CE1  . TYR A 1 51  ? 45.437  25.615  -0.964  1.00 15.70 ? 177 TYR A CE1  1 
ATOM   409  C  CE2  . TYR A 1 51  ? 46.741  27.174  0.305   1.00 16.98 ? 177 TYR A CE2  1 
ATOM   410  C  CZ   . TYR A 1 51  ? 46.500  25.885  -0.142  1.00 17.64 ? 177 TYR A CZ   1 
ATOM   411  O  OH   . TYR A 1 51  ? 47.325  24.824  0.190   1.00 18.76 ? 177 TYR A OH   1 
ATOM   412  N  N    . LYS A 1 52  ? 41.786  30.192  -3.711  1.00 16.81 ? 178 LYS A N    1 
ATOM   413  C  CA   A LYS A 1 52  ? 41.046  31.353  -4.188  0.50 17.49 ? 178 LYS A CA   1 
ATOM   414  C  CA   B LYS A 1 52  ? 41.037  31.338  -4.210  0.50 17.55 ? 178 LYS A CA   1 
ATOM   415  C  C    . LYS A 1 52  ? 39.688  31.430  -3.513  1.00 17.43 ? 178 LYS A C    1 
ATOM   416  O  O    . LYS A 1 52  ? 38.896  30.492  -3.571  1.00 16.95 ? 178 LYS A O    1 
ATOM   417  C  CB   A LYS A 1 52  ? 40.865  31.301  -5.705  0.50 17.75 ? 178 LYS A CB   1 
ATOM   418  C  CB   B LYS A 1 52  ? 40.815  31.213  -5.718  0.50 17.90 ? 178 LYS A CB   1 
ATOM   419  C  CG   A LYS A 1 52  ? 40.111  32.498  -6.293  0.50 19.96 ? 178 LYS A CG   1 
ATOM   420  C  CG   B LYS A 1 52  ? 40.122  32.416  -6.356  0.50 20.16 ? 178 LYS A CG   1 
ATOM   421  C  CD   A LYS A 1 52  ? 39.965  32.362  -7.801  0.50 21.65 ? 178 LYS A CD   1 
ATOM   422  C  CD   B LYS A 1 52  ? 41.019  33.628  -6.285  0.50 21.89 ? 178 LYS A CD   1 
ATOM   423  C  CE   A LYS A 1 52  ? 39.503  33.658  -8.447  0.50 24.11 ? 178 LYS A CE   1 
ATOM   424  C  CE   B LYS A 1 52  ? 40.343  34.893  -6.764  0.50 24.25 ? 178 LYS A CE   1 
ATOM   425  N  NZ   A LYS A 1 52  ? 38.040  33.889  -8.303  0.50 22.15 ? 178 LYS A NZ   1 
ATOM   426  N  NZ   B LYS A 1 52  ? 41.202  36.054  -6.442  0.50 26.15 ? 178 LYS A NZ   1 
ATOM   427  N  N    . THR A 1 53  ? 39.435  32.552  -2.861  1.00 17.30 ? 179 THR A N    1 
ATOM   428  C  CA   . THR A 1 53  ? 38.104  32.806  -2.321  1.00 16.25 ? 179 THR A CA   1 
ATOM   429  C  C    . THR A 1 53  ? 37.213  33.174  -3.505  1.00 16.57 ? 179 THR A C    1 
ATOM   430  O  O    . THR A 1 53  ? 37.389  34.241  -4.108  1.00 18.14 ? 179 THR A O    1 
ATOM   431  C  CB   . THR A 1 53  ? 38.122  33.929  -1.299  1.00 16.78 ? 179 THR A CB   1 
ATOM   432  O  OG1  . THR A 1 53  ? 38.956  33.546  -0.191  1.00 16.60 ? 179 THR A OG1  1 
ATOM   433  C  CG2  . THR A 1 53  ? 36.708  34.226  -0.790  1.00 17.28 ? 179 THR A CG2  1 
ATOM   434  N  N    . GLU A 1 54  ? 36.263  32.301  -3.829  1.00 16.20 ? 180 GLU A N    1 
ATOM   435  C  CA   . GLU A 1 54  ? 35.366  32.538  -4.948  1.00 15.77 ? 180 GLU A CA   1 
ATOM   436  C  C    . GLU A 1 54  ? 34.251  33.513  -4.572  1.00 16.00 ? 180 GLU A C    1 
ATOM   437  O  O    . GLU A 1 54  ? 33.853  34.342  -5.380  1.00 17.05 ? 180 GLU A O    1 
ATOM   438  C  CB   . GLU A 1 54  ? 34.795  31.223  -5.454  1.00 15.96 ? 180 GLU A CB   1 
ATOM   439  C  CG   . GLU A 1 54  ? 35.845  30.251  -5.944  1.00 17.40 ? 180 GLU A CG   1 
ATOM   440  C  CD   . GLU A 1 54  ? 36.548  30.663  -7.244  1.00 18.34 ? 180 GLU A CD   1 
ATOM   441  O  OE1  . GLU A 1 54  ? 36.309  31.764  -7.804  1.00 17.91 ? 180 GLU A OE1  1 
ATOM   442  O  OE2  . GLU A 1 54  ? 37.346  29.837  -7.738  1.00 19.19 ? 180 GLU A OE2  1 
ATOM   443  N  N    . PHE A 1 55  ? 33.786  33.426  -3.333  1.00 16.49 ? 181 PHE A N    1 
ATOM   444  C  CA   . PHE A 1 55  ? 32.945  34.474  -2.742  1.00 16.11 ? 181 PHE A CA   1 
ATOM   445  C  C    . PHE A 1 55  ? 33.066  34.435  -1.223  1.00 16.84 ? 181 PHE A C    1 
ATOM   446  O  O    . PHE A 1 55  ? 33.244  33.364  -0.641  1.00 16.61 ? 181 PHE A O    1 
ATOM   447  C  CB   . PHE A 1 55  ? 31.471  34.426  -3.223  1.00 16.86 ? 181 PHE A CB   1 
ATOM   448  C  CG   . PHE A 1 55  ? 30.690  33.222  -2.771  1.00 15.54 ? 181 PHE A CG   1 
ATOM   449  C  CD1  . PHE A 1 55  ? 29.981  33.238  -1.571  1.00 15.31 ? 181 PHE A CD1  1 
ATOM   450  C  CD2  . PHE A 1 55  ? 30.648  32.077  -3.551  1.00 16.32 ? 181 PHE A CD2  1 
ATOM   451  C  CE1  . PHE A 1 55  ? 29.253  32.148  -1.160  1.00 15.48 ? 181 PHE A CE1  1 
ATOM   452  C  CE2  . PHE A 1 55  ? 29.900  30.972  -3.148  1.00 17.79 ? 181 PHE A CE2  1 
ATOM   453  C  CZ   . PHE A 1 55  ? 29.218  31.003  -1.940  1.00 16.21 ? 181 PHE A CZ   1 
ATOM   454  N  N    . ASP A 1 56  ? 33.015  35.619  -0.607  1.00 17.58 ? 182 ASP A N    1 
ATOM   455  C  CA   A ASP A 1 56  ? 33.113  35.836  0.839   0.50 17.55 ? 182 ASP A CA   1 
ATOM   456  C  CA   B ASP A 1 56  ? 33.085  35.672  0.848   0.50 17.85 ? 182 ASP A CA   1 
ATOM   457  C  C    . ASP A 1 56  ? 31.706  35.924  1.434   1.00 17.57 ? 182 ASP A C    1 
ATOM   458  O  O    . ASP A 1 56  ? 30.718  36.081  0.701   1.00 17.70 ? 182 ASP A O    1 
ATOM   459  C  CB   A ASP A 1 56  ? 33.854  37.163  1.133   0.50 17.43 ? 182 ASP A CB   1 
ATOM   460  C  CB   B ASP A 1 56  ? 34.128  36.679  1.332   0.50 18.33 ? 182 ASP A CB   1 
ATOM   461  C  CG   A ASP A 1 56  ? 35.373  37.045  1.016   0.50 18.44 ? 182 ASP A CG   1 
ATOM   462  C  CG   B ASP A 1 56  ? 33.819  38.092  0.939   0.50 19.61 ? 182 ASP A CG   1 
ATOM   463  O  OD1  A ASP A 1 56  ? 35.959  36.229  1.751   0.50 17.71 ? 182 ASP A OD1  1 
ATOM   464  O  OD1  B ASP A 1 56  ? 32.629  38.436  0.758   0.50 19.77 ? 182 ASP A OD1  1 
ATOM   465  O  OD2  A ASP A 1 56  ? 35.983  37.785  0.208   0.50 19.34 ? 182 ASP A OD2  1 
ATOM   466  O  OD2  B ASP A 1 56  ? 34.784  38.876  0.834   0.50 22.61 ? 182 ASP A OD2  1 
ATOM   467  N  N    . PHE A 1 57  ? 31.619  35.884  2.756   1.00 17.31 ? 183 PHE A N    1 
ATOM   468  C  CA   . PHE A 1 57  ? 30.315  36.023  3.408   1.00 17.18 ? 183 PHE A CA   1 
ATOM   469  C  C    . PHE A 1 57  ? 29.607  37.317  3.026   1.00 17.22 ? 183 PHE A C    1 
ATOM   470  O  O    . PHE A 1 57  ? 28.384  37.334  2.837   1.00 17.27 ? 183 PHE A O    1 
ATOM   471  C  CB   . PHE A 1 57  ? 30.449  35.947  4.929   1.00 16.88 ? 183 PHE A CB   1 
ATOM   472  C  CG   . PHE A 1 57  ? 30.922  34.625  5.441   1.00 18.48 ? 183 PHE A CG   1 
ATOM   473  C  CD1  . PHE A 1 57  ? 30.163  33.476  5.285   1.00 17.11 ? 183 PHE A CD1  1 
ATOM   474  C  CD2  . PHE A 1 57  ? 32.145  34.525  6.084   1.00 19.72 ? 183 PHE A CD2  1 
ATOM   475  C  CE1  . PHE A 1 57  ? 30.624  32.252  5.767   1.00 17.77 ? 183 PHE A CE1  1 
ATOM   476  C  CE2  . PHE A 1 57  ? 32.595  33.316  6.570   1.00 19.98 ? 183 PHE A CE2  1 
ATOM   477  C  CZ   . PHE A 1 57  ? 31.837  32.184  6.415   1.00 18.78 ? 183 PHE A CZ   1 
ATOM   478  N  N    . SER A 1 58  ? 30.348  38.412  2.918   1.00 17.46 ? 184 SER A N    1 
ATOM   479  C  CA   . SER A 1 58  ? 29.733  39.683  2.556   1.00 18.30 ? 184 SER A CA   1 
ATOM   480  C  C    . SER A 1 58  ? 29.176  39.645  1.127   1.00 17.27 ? 184 SER A C    1 
ATOM   481  O  O    . SER A 1 58  ? 28.144  40.273  0.839   1.00 17.55 ? 184 SER A O    1 
ATOM   482  C  CB   . SER A 1 58  ? 30.723  40.830  2.760   1.00 18.88 ? 184 SER A CB   1 
ATOM   483  O  OG   . SER A 1 58  ? 31.802  40.722  1.875   1.00 23.04 ? 184 SER A OG   1 
ATOM   484  N  N    . ASP A 1 59  ? 29.836  38.895  0.241   1.00 17.32 ? 185 ASP A N    1 
ATOM   485  C  CA   . ASP A 1 59  ? 29.319  38.691  -1.124  1.00 16.50 ? 185 ASP A CA   1 
ATOM   486  C  C    . ASP A 1 59  ? 27.998  37.939  -1.083  1.00 16.73 ? 185 ASP A C    1 
ATOM   487  O  O    . ASP A 1 59  ? 27.069  38.253  -1.838  1.00 17.41 ? 185 ASP A O    1 
ATOM   488  C  CB   . ASP A 1 59  ? 30.295  37.907  -2.003  1.00 16.07 ? 185 ASP A CB   1 
ATOM   489  C  CG   . ASP A 1 59  ? 31.612  38.636  -2.241  1.00 18.83 ? 185 ASP A CG   1 
ATOM   490  O  OD1  . ASP A 1 59  ? 31.615  39.875  -2.416  1.00 20.09 ? 185 ASP A OD1  1 
ATOM   491  O  OD2  . ASP A 1 59  ? 32.657  37.940  -2.265  1.00 19.74 ? 185 ASP A OD2  1 
ATOM   492  N  N    . TYR A 1 60  ? 27.915  36.930  -0.217  1.00 16.80 ? 186 TYR A N    1 
ATOM   493  C  CA   . TYR A 1 60  ? 26.673  36.177  -0.052  1.00 16.80 ? 186 TYR A CA   1 
ATOM   494  C  C    . TYR A 1 60  ? 25.528  37.087  0.410   1.00 16.22 ? 186 TYR A C    1 
ATOM   495  O  O    . TYR A 1 60  ? 24.439  37.066  -0.165  1.00 17.04 ? 186 TYR A O    1 
ATOM   496  C  CB   . TYR A 1 60  ? 26.844  34.993  0.903   1.00 17.36 ? 186 TYR A CB   1 
ATOM   497  C  CG   . TYR A 1 60  ? 25.536  34.274  1.118   1.00 17.27 ? 186 TYR A CG   1 
ATOM   498  C  CD1  . TYR A 1 60  ? 25.071  33.368  0.182   1.00 18.65 ? 186 TYR A CD1  1 
ATOM   499  C  CD2  . TYR A 1 60  ? 24.754  34.532  2.237   1.00 18.47 ? 186 TYR A CD2  1 
ATOM   500  C  CE1  . TYR A 1 60  ? 23.844  32.721  0.347   1.00 18.74 ? 186 TYR A CE1  1 
ATOM   501  C  CE2  . TYR A 1 60  ? 23.530  33.890  2.423   1.00 19.54 ? 186 TYR A CE2  1 
ATOM   502  C  CZ   . TYR A 1 60  ? 23.080  32.989  1.472   1.00 19.67 ? 186 TYR A CZ   1 
ATOM   503  O  OH   . TYR A 1 60  ? 21.864  32.354  1.655   1.00 23.35 ? 186 TYR A OH   1 
ATOM   504  N  N    . VAL A 1 61  ? 25.791  37.897  1.426   1.00 15.93 ? 187 VAL A N    1 
ATOM   505  C  CA   . VAL A 1 61  ? 24.801  38.849  1.935   1.00 16.17 ? 187 VAL A CA   1 
ATOM   506  C  C    . VAL A 1 61  ? 24.367  39.826  0.834   1.00 16.69 ? 187 VAL A C    1 
ATOM   507  O  O    . VAL A 1 61  ? 23.181  40.157  0.716   1.00 17.05 ? 187 VAL A O    1 
ATOM   508  C  CB   . VAL A 1 61  ? 25.345  39.646  3.145   1.00 16.11 ? 187 VAL A CB   1 
ATOM   509  C  CG1  . VAL A 1 61  ? 24.377  40.754  3.526   1.00 18.28 ? 187 VAL A CG1  1 
ATOM   510  C  CG2  . VAL A 1 61  ? 25.596  38.716  4.344   1.00 16.58 ? 187 VAL A CG2  1 
ATOM   511  N  N    . LYS A 1 62  ? 25.311  40.260  0.004   1.00 16.30 ? 188 LYS A N    1 
ATOM   512  C  CA   . LYS A 1 62  ? 24.988  41.189  -1.087  1.00 16.05 ? 188 LYS A CA   1 
ATOM   513  C  C    . LYS A 1 62  ? 24.082  40.575  -2.160  1.00 16.46 ? 188 LYS A C    1 
ATOM   514  O  O    . LYS A 1 62  ? 23.095  41.184  -2.549  1.00 16.21 ? 188 LYS A O    1 
ATOM   515  C  CB   . LYS A 1 62  ? 26.262  41.727  -1.739  1.00 16.31 ? 188 LYS A CB   1 
ATOM   516  C  CG   . LYS A 1 62  ? 26.004  42.560  -2.983  1.00 16.37 ? 188 LYS A CG   1 
ATOM   517  C  CD   . LYS A 1 62  ? 27.294  43.121  -3.566  1.00 20.51 ? 188 LYS A CD   1 
ATOM   518  C  CE   . LYS A 1 62  ? 27.028  43.885  -4.852  1.00 21.58 ? 188 LYS A CE   1 
ATOM   519  N  NZ   . LYS A 1 62  ? 28.248  44.612  -5.339  1.00 24.25 ? 188 LYS A NZ   1 
ATOM   520  N  N    . TRP A 1 63  ? 24.408  39.361  -2.603  1.00 16.54 ? 189 TRP A N    1 
ATOM   521  C  CA   . TRP A 1 63  ? 23.782  38.748  -3.784  1.00 18.35 ? 189 TRP A CA   1 
ATOM   522  C  C    . TRP A 1 63  ? 22.680  37.746  -3.470  1.00 19.27 ? 189 TRP A C    1 
ATOM   523  O  O    . TRP A 1 63  ? 21.654  37.750  -4.150  1.00 19.40 ? 189 TRP A O    1 
ATOM   524  C  CB   . TRP A 1 63  ? 24.847  38.049  -4.636  1.00 19.01 ? 189 TRP A CB   1 
ATOM   525  C  CG   . TRP A 1 63  ? 25.711  38.994  -5.350  1.00 22.55 ? 189 TRP A CG   1 
ATOM   526  C  CD1  . TRP A 1 63  ? 26.885  39.530  -4.910  1.00 24.41 ? 189 TRP A CD1  1 
ATOM   527  C  CD2  . TRP A 1 63  ? 25.475  39.548  -6.647  1.00 27.70 ? 189 TRP A CD2  1 
ATOM   528  N  NE1  . TRP A 1 63  ? 27.389  40.393  -5.851  1.00 27.61 ? 189 TRP A NE1  1 
ATOM   529  C  CE2  . TRP A 1 63  ? 26.546  40.417  -6.930  1.00 26.92 ? 189 TRP A CE2  1 
ATOM   530  C  CE3  . TRP A 1 63  ? 24.459  39.392  -7.597  1.00 30.21 ? 189 TRP A CE3  1 
ATOM   531  C  CZ2  . TRP A 1 63  ? 26.637  41.132  -8.129  1.00 30.99 ? 189 TRP A CZ2  1 
ATOM   532  C  CZ3  . TRP A 1 63  ? 24.553  40.091  -8.793  1.00 31.94 ? 189 TRP A CZ3  1 
ATOM   533  C  CH2  . TRP A 1 63  ? 25.633  40.958  -9.045  1.00 31.67 ? 189 TRP A CH2  1 
ATOM   534  N  N    . LYS A 1 64  ? 22.904  36.887  -2.472  1.00 19.91 ? 190 LYS A N    1 
ATOM   535  C  CA   A LYS A 1 64  ? 21.969  35.810  -2.106  0.60 20.54 ? 190 LYS A CA   1 
ATOM   536  C  CA   B LYS A 1 64  ? 21.929  35.846  -2.114  0.40 20.63 ? 190 LYS A CA   1 
ATOM   537  C  C    . LYS A 1 64  ? 21.464  35.046  -3.341  1.00 21.16 ? 190 LYS A C    1 
ATOM   538  O  O    . LYS A 1 64  ? 20.282  34.662  -3.436  1.00 21.98 ? 190 LYS A O    1 
ATOM   539  C  CB   A LYS A 1 64  ? 20.806  36.376  -1.288  0.60 20.75 ? 190 LYS A CB   1 
ATOM   540  C  CB   B LYS A 1 64  ? 20.713  36.482  -1.428  0.40 20.93 ? 190 LYS A CB   1 
ATOM   541  C  CG   A LYS A 1 64  ? 21.247  37.104  -0.021  0.60 22.22 ? 190 LYS A CG   1 
ATOM   542  C  CG   B LYS A 1 64  ? 20.982  37.015  -0.041  0.40 22.17 ? 190 LYS A CG   1 
ATOM   543  C  CD   A LYS A 1 64  ? 20.074  37.403  0.905   0.60 21.49 ? 190 LYS A CD   1 
ATOM   544  C  CD   B LYS A 1 64  ? 20.928  35.889  0.962   0.40 22.74 ? 190 LYS A CD   1 
ATOM   545  C  CE   A LYS A 1 64  ? 20.502  38.193  2.149   0.60 21.89 ? 190 LYS A CE   1 
ATOM   546  C  CE   B LYS A 1 64  ? 19.614  35.142  0.838   0.40 23.00 ? 190 LYS A CE   1 
ATOM   547  N  NZ   A LYS A 1 64  ? 20.775  39.645  1.908   0.60 17.48 ? 190 LYS A NZ   1 
ATOM   548  N  NZ   B LYS A 1 64  ? 19.627  33.834  1.539   0.40 21.75 ? 190 LYS A NZ   1 
ATOM   549  N  N    . ASP A 1 65  ? 22.371  34.814  -4.280  1.00 19.91 ? 191 ASP A N    1 
ATOM   550  C  CA   . ASP A 1 65  ? 22.058  34.187  -5.569  1.00 20.66 ? 191 ASP A CA   1 
ATOM   551  C  C    . ASP A 1 65  ? 23.204  33.237  -5.875  1.00 20.24 ? 191 ASP A C    1 
ATOM   552  O  O    . ASP A 1 65  ? 24.227  33.664  -6.393  1.00 20.50 ? 191 ASP A O    1 
ATOM   553  C  CB   . ASP A 1 65  ? 21.975  35.288  -6.636  1.00 20.99 ? 191 ASP A CB   1 
ATOM   554  C  CG   . ASP A 1 65  ? 21.617  34.779  -8.032  1.00 22.89 ? 191 ASP A CG   1 
ATOM   555  O  OD1  . ASP A 1 65  ? 21.840  33.597  -8.373  1.00 22.58 ? 191 ASP A OD1  1 
ATOM   556  O  OD2  . ASP A 1 65  ? 21.097  35.609  -8.814  1.00 26.31 ? 191 ASP A OD2  1 
ATOM   557  N  N    . PRO A 1 66  ? 23.057  31.949  -5.518  1.00 20.15 ? 192 PRO A N    1 
ATOM   558  C  CA   . PRO A 1 66  ? 24.161  31.003  -5.741  1.00 20.25 ? 192 PRO A CA   1 
ATOM   559  C  C    . PRO A 1 66  ? 24.668  30.918  -7.182  1.00 19.38 ? 192 PRO A C    1 
ATOM   560  O  O    . PRO A 1 66  ? 25.865  30.719  -7.388  1.00 19.37 ? 192 PRO A O    1 
ATOM   561  C  CB   . PRO A 1 66  ? 23.567  29.662  -5.307  1.00 20.26 ? 192 PRO A CB   1 
ATOM   562  C  CG   . PRO A 1 66  ? 22.544  30.015  -4.312  1.00 21.48 ? 192 PRO A CG   1 
ATOM   563  C  CD   . PRO A 1 66  ? 21.964  31.338  -4.743  1.00 20.84 ? 192 PRO A CD   1 
ATOM   564  N  N    . ASP A 1 67  ? 23.780  31.030  -8.172  1.00 19.74 ? 193 ASP A N    1 
ATOM   565  C  CA   . ASP A 1 67  ? 24.221  31.012  -9.577  1.00 20.21 ? 193 ASP A CA   1 
ATOM   566  C  C    . ASP A 1 67  ? 25.154  32.179  -9.871  1.00 20.12 ? 193 ASP A C    1 
ATOM   567  O  O    . ASP A 1 67  ? 26.207  31.997  -10.489 1.00 20.56 ? 193 ASP A O    1 
ATOM   568  C  CB   . ASP A 1 67  ? 23.039  31.078  -10.546 1.00 20.62 ? 193 ASP A CB   1 
ATOM   569  C  CG   . ASP A 1 67  ? 22.233  29.812  -10.570 1.00 23.22 ? 193 ASP A CG   1 
ATOM   570  O  OD1  . ASP A 1 67  ? 22.810  28.725  -10.401 1.00 25.69 ? 193 ASP A OD1  1 
ATOM   571  O  OD2  . ASP A 1 67  ? 21.006  29.900  -10.792 1.00 29.34 ? 193 ASP A OD2  1 
ATOM   572  N  N    . ALA A 1 68  ? 24.768  33.371  -9.422  1.00 18.39 ? 194 ALA A N    1 
ATOM   573  C  CA   . ALA A 1 68  ? 25.588  34.562  -9.611  1.00 17.89 ? 194 ALA A CA   1 
ATOM   574  C  C    . ALA A 1 68  ? 26.916  34.452  -8.876  1.00 17.78 ? 194 ALA A C    1 
ATOM   575  O  O    . ALA A 1 68  ? 27.954  34.829  -9.404  1.00 19.54 ? 194 ALA A O    1 
ATOM   576  C  CB   . ALA A 1 68  ? 24.836  35.808  -9.147  1.00 17.92 ? 194 ALA A CB   1 
ATOM   577  N  N    . LEU A 1 69  ? 26.868  33.935  -7.658  1.00 16.96 ? 195 LEU A N    1 
ATOM   578  C  CA   . LEU A 1 69  ? 28.049  33.888  -6.791  1.00 17.19 ? 195 LEU A CA   1 
ATOM   579  C  C    . LEU A 1 69  ? 29.154  32.973  -7.306  1.00 18.68 ? 195 LEU A C    1 
ATOM   580  O  O    . LEU A 1 69  ? 30.330  33.225  -7.043  1.00 19.39 ? 195 LEU A O    1 
ATOM   581  C  CB   . LEU A 1 69  ? 27.655  33.475  -5.382  1.00 17.72 ? 195 LEU A CB   1 
ATOM   582  C  CG   . LEU A 1 69  ? 26.910  34.551  -4.583  1.00 17.23 ? 195 LEU A CG   1 
ATOM   583  C  CD1  . LEU A 1 69  ? 26.197  33.909  -3.392  1.00 19.56 ? 195 LEU A CD1  1 
ATOM   584  C  CD2  . LEU A 1 69  ? 27.876  35.655  -4.123  1.00 18.80 ? 195 LEU A CD2  1 
ATOM   585  N  N    . LEU A 1 70  ? 28.780  31.927  -8.034  1.00 18.72 ? 196 LEU A N    1 
ATOM   586  C  CA   . LEU A 1 70  ? 29.743  30.951  -8.539  1.00 18.87 ? 196 LEU A CA   1 
ATOM   587  C  C    . LEU A 1 70  ? 29.936  31.042  -10.057 1.00 19.78 ? 196 LEU A C    1 
ATOM   588  O  O    . LEU A 1 70  ? 30.589  30.178  -10.659 1.00 18.73 ? 196 LEU A O    1 
ATOM   589  C  CB   . LEU A 1 70  ? 29.282  29.552  -8.127  1.00 18.86 ? 196 LEU A CB   1 
ATOM   590  C  CG   . LEU A 1 70  ? 29.418  29.270  -6.626  1.00 18.25 ? 196 LEU A CG   1 
ATOM   591  C  CD1  . LEU A 1 70  ? 28.574  28.066  -6.228  1.00 21.15 ? 196 LEU A CD1  1 
ATOM   592  C  CD2  . LEU A 1 70  ? 30.886  29.057  -6.241  1.00 20.17 ? 196 LEU A CD2  1 
ATOM   593  N  N    . LYS A 1 71  ? 29.372  32.086  -10.666 1.00 20.39 ? 197 LYS A N    1 
ATOM   594  C  CA   . LYS A 1 71  ? 29.383  32.254  -12.117 1.00 22.42 ? 197 LYS A CA   1 
ATOM   595  C  C    . LYS A 1 71  ? 30.795  32.361  -12.714 1.00 21.32 ? 197 LYS A C    1 
ATOM   596  O  O    . LYS A 1 71  ? 31.026  31.930  -13.849 1.00 22.56 ? 197 LYS A O    1 
ATOM   597  C  CB   . LYS A 1 71  ? 28.561  33.500  -12.495 1.00 22.84 ? 197 LYS A CB   1 
ATOM   598  C  CG   . LYS A 1 71  ? 28.141  33.578  -13.937 1.00 26.93 ? 197 LYS A CG   1 
ATOM   599  C  CD   . LYS A 1 71  ? 27.446  34.904  -14.219 1.00 27.96 ? 197 LYS A CD   1 
ATOM   600  C  CE   . LYS A 1 71  ? 27.166  35.077  -15.696 1.00 29.94 ? 197 LYS A CE   1 
ATOM   601  N  NZ   . LYS A 1 71  ? 26.634  36.437  -15.999 1.00 30.42 ? 197 LYS A NZ   1 
ATOM   602  N  N    . HIS A 1 72  ? 31.733  32.916  -11.948 1.00 21.77 ? 198 HIS A N    1 
ATOM   603  C  CA   . HIS A 1 72  ? 33.069  33.219  -12.456 1.00 22.19 ? 198 HIS A CA   1 
ATOM   604  C  C    . HIS A 1 72  ? 34.092  32.121  -12.157 1.00 21.31 ? 198 HIS A C    1 
ATOM   605  O  O    . HIS A 1 72  ? 35.271  32.257  -12.492 1.00 22.17 ? 198 HIS A O    1 
ATOM   606  C  CB   . HIS A 1 72  ? 33.556  34.556  -11.881 1.00 23.64 ? 198 HIS A CB   1 
ATOM   607  C  CG   . HIS A 1 72  ? 32.612  35.694  -12.116 1.00 27.52 ? 198 HIS A CG   1 
ATOM   608  N  ND1  . HIS A 1 72  ? 32.021  36.396  -11.087 1.00 32.06 ? 198 HIS A ND1  1 
ATOM   609  C  CD2  . HIS A 1 72  ? 32.150  36.246  -13.262 1.00 30.48 ? 198 HIS A CD2  1 
ATOM   610  C  CE1  . HIS A 1 72  ? 31.239  37.335  -11.590 1.00 30.27 ? 198 HIS A CE1  1 
ATOM   611  N  NE2  . HIS A 1 72  ? 31.297  37.263  -12.907 1.00 32.99 ? 198 HIS A NE2  1 
ATOM   612  N  N    . VAL A 1 73  ? 33.655  31.040  -11.525 1.00 19.22 ? 199 VAL A N    1 
ATOM   613  C  CA   . VAL A 1 73  ? 34.588  29.973  -11.142 1.00 18.57 ? 199 VAL A CA   1 
ATOM   614  C  C    . VAL A 1 73  ? 35.199  29.332  -12.383 1.00 18.27 ? 199 VAL A C    1 
ATOM   615  O  O    . VAL A 1 73  ? 34.494  29.032  -13.355 1.00 19.15 ? 199 VAL A O    1 
ATOM   616  C  CB   . VAL A 1 73  ? 33.910  28.895  -10.263 1.00 17.49 ? 199 VAL A CB   1 
ATOM   617  C  CG1  . VAL A 1 73  ? 34.875  27.740  -10.001 1.00 16.64 ? 199 VAL A CG1  1 
ATOM   618  C  CG2  . VAL A 1 73  ? 33.441  29.494  -8.937  1.00 18.37 ? 199 VAL A CG2  1 
ATOM   619  N  N    . LYS A 1 74  ? 36.520  29.170  -12.355 1.00 18.59 ? 200 LYS A N    1 
ATOM   620  C  CA   . LYS A 1 74  ? 37.257  28.418  -13.361 1.00 18.94 ? 200 LYS A CA   1 
ATOM   621  C  C    . LYS A 1 74  ? 38.029  27.281  -12.701 1.00 17.25 ? 200 LYS A C    1 
ATOM   622  O  O    . LYS A 1 74  ? 38.722  27.468  -11.700 1.00 17.78 ? 200 LYS A O    1 
ATOM   623  C  CB   . LYS A 1 74  ? 38.218  29.331  -14.132 1.00 19.89 ? 200 LYS A CB   1 
ATOM   624  C  CG   . LYS A 1 74  ? 37.501  30.412  -14.949 1.00 23.89 ? 200 LYS A CG   1 
ATOM   625  C  CD   . LYS A 1 74  ? 36.583  29.819  -16.035 1.00 28.55 ? 200 LYS A CD   1 
ATOM   626  C  CE   . LYS A 1 74  ? 35.435  30.754  -16.416 1.00 31.89 ? 200 LYS A CE   1 
ATOM   627  N  NZ   . LYS A 1 74  ? 34.275  30.712  -15.455 1.00 34.50 ? 200 LYS A NZ   1 
ATOM   628  N  N    . HIS A 1 75  ? 37.902  26.094  -13.275 1.00 16.36 ? 201 HIS A N    1 
ATOM   629  C  CA   . HIS A 1 75  ? 38.547  24.899  -12.740 1.00 15.62 ? 201 HIS A CA   1 
ATOM   630  C  C    . HIS A 1 75  ? 40.064  25.073  -12.811 1.00 15.56 ? 201 HIS A C    1 
ATOM   631  O  O    . HIS A 1 75  ? 40.632  25.229  -13.898 1.00 16.02 ? 201 HIS A O    1 
ATOM   632  C  CB   . HIS A 1 75  ? 38.054  23.699  -13.536 1.00 16.02 ? 201 HIS A CB   1 
ATOM   633  C  CG   . HIS A 1 75  ? 38.456  22.367  -13.000 1.00 15.74 ? 201 HIS A CG   1 
ATOM   634  N  ND1  . HIS A 1 75  ? 38.127  21.200  -13.660 1.00 16.24 ? 201 HIS A ND1  1 
ATOM   635  C  CD2  . HIS A 1 75  ? 39.202  22.003  -11.928 1.00 17.26 ? 201 HIS A CD2  1 
ATOM   636  C  CE1  . HIS A 1 75  ? 38.626  20.173  -12.994 1.00 14.59 ? 201 HIS A CE1  1 
ATOM   637  N  NE2  . HIS A 1 75  ? 39.288  20.630  -11.944 1.00 15.83 ? 201 HIS A NE2  1 
ATOM   638  N  N    . MET A 1 76  ? 40.706  25.029  -11.644 1.00 15.90 ? 202 MET A N    1 
ATOM   639  C  CA   . MET A 1 76  ? 42.147  25.337  -11.539 1.00 16.36 ? 202 MET A CA   1 
ATOM   640  C  C    . MET A 1 76  ? 43.042  24.351  -12.288 1.00 16.62 ? 202 MET A C    1 
ATOM   641  O  O    . MET A 1 76  ? 44.006  24.757  -12.954 1.00 17.18 ? 202 MET A O    1 
ATOM   642  C  CB   . MET A 1 76  ? 42.561  25.429  -10.076 1.00 16.24 ? 202 MET A CB   1 
ATOM   643  C  CG   . MET A 1 76  ? 42.108  26.703  -9.406  1.00 16.46 ? 202 MET A CG   1 
ATOM   644  S  SD   . MET A 1 76  ? 42.380  26.661  -7.622  1.00 18.88 ? 202 MET A SD   1 
ATOM   645  C  CE   . MET A 1 76  ? 42.146  28.363  -7.175  1.00 18.28 ? 202 MET A CE   1 
ATOM   646  N  N    . LEU A 1 77  ? 42.708  23.072  -12.184 1.00 14.48 ? 203 LEU A N    1 
ATOM   647  C  CA   . LEU A 1 77  ? 43.409  21.974  -12.878 1.00 14.65 ? 203 LEU A CA   1 
ATOM   648  C  C    . LEU A 1 77  ? 44.873  21.811  -12.470 1.00 14.49 ? 203 LEU A C    1 
ATOM   649  O  O    . LEU A 1 77  ? 45.731  21.520  -13.306 1.00 15.34 ? 203 LEU A O    1 
ATOM   650  C  CB   . LEU A 1 77  ? 43.259  22.100  -14.394 1.00 15.62 ? 203 LEU A CB   1 
ATOM   651  C  CG   . LEU A 1 77  ? 41.825  21.872  -14.868 1.00 15.70 ? 203 LEU A CG   1 
ATOM   652  C  CD1  . LEU A 1 77  ? 41.646  22.405  -16.280 1.00 18.86 ? 203 LEU A CD1  1 
ATOM   653  C  CD2  . LEU A 1 77  ? 41.437  20.380  -14.817 1.00 18.72 ? 203 LEU A CD2  1 
ATOM   654  N  N    . LEU A 1 78  ? 45.153  21.963  -11.178 1.00 14.38 ? 204 LEU A N    1 
ATOM   655  C  CA   . LEU A 1 78  ? 46.516  21.770  -10.690 1.00 14.51 ? 204 LEU A CA   1 
ATOM   656  C  C    . LEU A 1 78  ? 46.558  20.699  -9.585  1.00 15.18 ? 204 LEU A C    1 
ATOM   657  O  O    . LEU A 1 78  ? 45.974  19.634  -9.758  1.00 15.64 ? 204 LEU A O    1 
ATOM   658  C  CB   . LEU A 1 78  ? 47.146  23.114  -10.315 1.00 14.71 ? 204 LEU A CB   1 
ATOM   659  C  CG   . LEU A 1 78  ? 47.326  24.090  -11.483 1.00 14.01 ? 204 LEU A CG   1 
ATOM   660  C  CD1  . LEU A 1 78  ? 47.693  25.482  -10.959 1.00 19.13 ? 204 LEU A CD1  1 
ATOM   661  C  CD2  . LEU A 1 78  ? 48.380  23.590  -12.482 1.00 16.33 ? 204 LEU A CD2  1 
ATOM   662  N  N    . LEU A 1 79  ? 47.243  20.940  -8.470  1.00 15.21 ? 205 LEU A N    1 
ATOM   663  C  CA   . LEU A 1 79  ? 47.437  19.893  -7.460  1.00 15.56 ? 205 LEU A CA   1 
ATOM   664  C  C    . LEU A 1 79  ? 46.341  19.888  -6.377  1.00 16.04 ? 205 LEU A C    1 
ATOM   665  O  O    . LEU A 1 79  ? 45.258  20.440  -6.610  1.00 15.23 ? 205 LEU A O    1 
ATOM   666  C  CB   . LEU A 1 79  ? 48.852  20.003  -6.882  1.00 15.94 ? 205 LEU A CB   1 
ATOM   667  C  CG   . LEU A 1 79  ? 49.948  19.926  -7.947  1.00 17.14 ? 205 LEU A CG   1 
ATOM   668  C  CD1  . LEU A 1 79  ? 51.321  20.180  -7.352  1.00 19.35 ? 205 LEU A CD1  1 
ATOM   669  C  CD2  . LEU A 1 79  ? 49.927  18.600  -8.710  1.00 18.29 ? 205 LEU A CD2  1 
ATOM   670  N  N    . THR A 1 80  ? 46.589  19.247  -5.230  1.00 16.97 ? 206 THR A N    1 
ATOM   671  C  CA   . THR A 1 80  ? 45.554  19.006  -4.212  1.00 17.37 ? 206 THR A CA   1 
ATOM   672  C  C    . THR A 1 80  ? 46.108  19.373  -2.824  1.00 16.50 ? 206 THR A C    1 
ATOM   673  O  O    . THR A 1 80  ? 46.299  18.499  -1.941  1.00 15.75 ? 206 THR A O    1 
ATOM   674  C  CB   . THR A 1 80  ? 45.096  17.529  -4.204  1.00 18.30 ? 206 THR A CB   1 
ATOM   675  O  OG1  . THR A 1 80  ? 44.869  17.048  -5.544  1.00 18.94 ? 206 THR A OG1  1 
ATOM   676  C  CG2  . THR A 1 80  ? 43.801  17.337  -3.387  1.00 18.59 ? 206 THR A CG2  1 
ATOM   677  N  N    . ASN A 1 81  ? 46.383  20.656  -2.616  1.00 16.58 ? 207 ASN A N    1 
ATOM   678  C  CA   . ASN A 1 81  ? 47.090  21.069  -1.390  1.00 16.34 ? 207 ASN A CA   1 
ATOM   679  C  C    . ASN A 1 81  ? 46.120  21.344  -0.225  1.00 14.97 ? 207 ASN A C    1 
ATOM   680  O  O    . ASN A 1 81  ? 45.929  22.485  0.224   1.00 15.14 ? 207 ASN A O    1 
ATOM   681  C  CB   . ASN A 1 81  ? 48.030  22.238  -1.663  1.00 16.10 ? 207 ASN A CB   1 
ATOM   682  C  CG   . ASN A 1 81  ? 49.232  21.831  -2.517  1.00 14.83 ? 207 ASN A CG   1 
ATOM   683  O  OD1  . ASN A 1 81  ? 49.682  20.687  -2.464  1.00 17.73 ? 207 ASN A OD1  1 
ATOM   684  N  ND2  . ASN A 1 81  ? 49.765  22.788  -3.281  1.00 14.00 ? 207 ASN A ND2  1 
ATOM   685  N  N    . THR A 1 82  ? 45.554  20.257  0.275   1.00 14.82 ? 208 THR A N    1 
ATOM   686  C  CA   . THR A 1 82  ? 44.453  20.296  1.246   1.00 15.29 ? 208 THR A CA   1 
ATOM   687  C  C    . THR A 1 82  ? 44.816  20.900  2.603   1.00 14.33 ? 208 THR A C    1 
ATOM   688  O  O    . THR A 1 82  ? 44.000  21.635  3.188   1.00 14.06 ? 208 THR A O    1 
ATOM   689  C  CB   . THR A 1 82  ? 43.903  18.888  1.449   1.00 15.31 ? 208 THR A CB   1 
ATOM   690  O  OG1  . THR A 1 82  ? 43.742  18.244  0.168   1.00 15.44 ? 208 THR A OG1  1 
ATOM   691  C  CG2  . THR A 1 82  ? 42.577  18.903  2.226   1.00 16.25 ? 208 THR A CG2  1 
ATOM   692  N  N    . PHE A 1 83  ? 46.015  20.617  3.131   1.00 13.49 ? 209 PHE A N    1 
ATOM   693  C  CA   . PHE A 1 83  ? 46.385  21.157  4.453   1.00 14.49 ? 209 PHE A CA   1 
ATOM   694  C  C    . PHE A 1 83  ? 46.373  22.688  4.420   1.00 14.83 ? 209 PHE A C    1 
ATOM   695  O  O    . PHE A 1 83  ? 45.763  23.335  5.273   1.00 13.93 ? 209 PHE A O    1 
ATOM   696  C  CB   . PHE A 1 83  ? 47.786  20.694  4.882   1.00 14.05 ? 209 PHE A CB   1 
ATOM   697  C  CG   . PHE A 1 83  ? 47.854  19.284  5.424   1.00 13.53 ? 209 PHE A CG   1 
ATOM   698  C  CD1  . PHE A 1 83  ? 47.799  19.038  6.801   1.00 16.20 ? 209 PHE A CD1  1 
ATOM   699  C  CD2  . PHE A 1 83  ? 48.035  18.210  4.574   1.00 13.56 ? 209 PHE A CD2  1 
ATOM   700  C  CE1  . PHE A 1 83  ? 47.931  17.734  7.308   1.00 16.75 ? 209 PHE A CE1  1 
ATOM   701  C  CE2  . PHE A 1 83  ? 48.161  16.901  5.081   1.00 15.20 ? 209 PHE A CE2  1 
ATOM   702  C  CZ   . PHE A 1 83  ? 48.102  16.672  6.437   1.00 15.35 ? 209 PHE A CZ   1 
ATOM   703  N  N    . GLY A 1 84  ? 47.069  23.262  3.440   1.00 14.92 ? 210 GLY A N    1 
ATOM   704  C  CA   . GLY A 1 84  ? 47.154  24.698  3.312   1.00 15.17 ? 210 GLY A CA   1 
ATOM   705  C  C    . GLY A 1 84  ? 45.783  25.305  3.065   1.00 14.49 ? 210 GLY A C    1 
ATOM   706  O  O    . GLY A 1 84  ? 45.496  26.405  3.547   1.00 15.16 ? 210 GLY A O    1 
ATOM   707  N  N    . ALA A 1 85  ? 44.944  24.583  2.311   1.00 14.46 ? 211 ALA A N    1 
ATOM   708  C  CA   . ALA A 1 85  ? 43.594  25.045  1.958   1.00 14.20 ? 211 ALA A CA   1 
ATOM   709  C  C    . ALA A 1 85  ? 42.754  25.255  3.213   1.00 14.69 ? 211 ALA A C    1 
ATOM   710  O  O    . ALA A 1 85  ? 42.062  26.269  3.352   1.00 14.18 ? 211 ALA A O    1 
ATOM   711  C  CB   . ALA A 1 85  ? 42.903  24.036  1.032   1.00 14.15 ? 211 ALA A CB   1 
ATOM   712  N  N    . ILE A 1 86  ? 42.803  24.285  4.125   1.00 14.34 ? 212 ILE A N    1 
ATOM   713  C  CA   . ILE A 1 86  ? 42.043  24.363  5.378   1.00 13.39 ? 212 ILE A CA   1 
ATOM   714  C  C    . ILE A 1 86  ? 42.540  25.520  6.258   1.00 13.93 ? 212 ILE A C    1 
ATOM   715  O  O    . ILE A 1 86  ? 41.758  26.310  6.803   1.00 13.88 ? 212 ILE A O    1 
ATOM   716  C  CB   . ILE A 1 86  ? 42.093  23.008  6.124   1.00 13.73 ? 212 ILE A CB   1 
ATOM   717  C  CG1  . ILE A 1 86  ? 41.325  21.948  5.307   1.00 14.33 ? 212 ILE A CG1  1 
ATOM   718  C  CG2  . ILE A 1 86  ? 41.496  23.125  7.519   1.00 13.48 ? 212 ILE A CG2  1 
ATOM   719  C  CD1  . ILE A 1 86  ? 41.666  20.493  5.697   1.00 15.15 ? 212 ILE A CD1  1 
ATOM   720  N  N    . ASN A 1 87  ? 43.857  25.657  6.370   1.00 13.53 ? 213 ASN A N    1 
ATOM   721  C  CA   . ASN A 1 87  ? 44.430  26.789  7.081   1.00 14.32 ? 213 ASN A CA   1 
ATOM   722  C  C    . ASN A 1 87  ? 44.057  28.136  6.457   1.00 13.82 ? 213 ASN A C    1 
ATOM   723  O  O    . ASN A 1 87  ? 43.821  29.102  7.174   1.00 14.41 ? 213 ASN A O    1 
ATOM   724  C  CB   . ASN A 1 87  ? 45.952  26.641  7.153   1.00 14.38 ? 213 ASN A CB   1 
ATOM   725  C  CG   . ASN A 1 87  ? 46.388  25.545  8.113   1.00 17.76 ? 213 ASN A CG   1 
ATOM   726  O  OD1  . ASN A 1 87  ? 45.897  25.461  9.232   1.00 22.27 ? 213 ASN A OD1  1 
ATOM   727  N  ND2  . ASN A 1 87  ? 47.306  24.696  7.674   1.00 16.37 ? 213 ASN A ND2  1 
ATOM   728  N  N    . TYR A 1 88  ? 43.994  28.192  5.129   1.00 13.75 ? 214 TYR A N    1 
ATOM   729  C  CA   . TYR A 1 88  ? 43.589  29.400  4.414   1.00 13.61 ? 214 TYR A CA   1 
ATOM   730  C  C    . TYR A 1 88  ? 42.176  29.817  4.810   1.00 14.23 ? 214 TYR A C    1 
ATOM   731  O  O    . TYR A 1 88  ? 41.910  31.004  5.061   1.00 13.68 ? 214 TYR A O    1 
ATOM   732  C  CB   . TYR A 1 88  ? 43.682  29.160  2.911   1.00 13.76 ? 214 TYR A CB   1 
ATOM   733  C  CG   . TYR A 1 88  ? 43.180  30.293  2.062   1.00 13.57 ? 214 TYR A CG   1 
ATOM   734  C  CD1  . TYR A 1 88  ? 44.044  31.271  1.580   1.00 14.76 ? 214 TYR A CD1  1 
ATOM   735  C  CD2  . TYR A 1 88  ? 41.839  30.387  1.740   1.00 14.33 ? 214 TYR A CD2  1 
ATOM   736  C  CE1  . TYR A 1 88  ? 43.573  32.307  0.780   1.00 15.29 ? 214 TYR A CE1  1 
ATOM   737  C  CE2  . TYR A 1 88  ? 41.354  31.421  0.962   1.00 16.58 ? 214 TYR A CE2  1 
ATOM   738  C  CZ   . TYR A 1 88  ? 42.219  32.375  0.482   1.00 15.84 ? 214 TYR A CZ   1 
ATOM   739  O  OH   . TYR A 1 88  ? 41.744  33.400  -0.302  1.00 17.78 ? 214 TYR A OH   1 
ATOM   740  N  N    . VAL A 1 89  ? 41.268  28.844  4.867   1.00 14.28 ? 215 VAL A N    1 
ATOM   741  C  CA   . VAL A 1 89  ? 39.897  29.141  5.298   1.00 14.61 ? 215 VAL A CA   1 
ATOM   742  C  C    . VAL A 1 89  ? 39.891  29.733  6.704   1.00 14.78 ? 215 VAL A C    1 
ATOM   743  O  O    . VAL A 1 89  ? 39.251  30.769  6.948   1.00 14.62 ? 215 VAL A O    1 
ATOM   744  C  CB   . VAL A 1 89  ? 38.994  27.911  5.214   1.00 14.67 ? 215 VAL A CB   1 
ATOM   745  C  CG1  . VAL A 1 89  ? 37.641  28.167  5.933   1.00 15.40 ? 215 VAL A CG1  1 
ATOM   746  C  CG2  . VAL A 1 89  ? 38.782  27.544  3.758   1.00 15.59 ? 215 VAL A CG2  1 
ATOM   747  N  N    . ALA A 1 90  ? 40.620  29.091  7.606   1.00 14.46 ? 216 ALA A N    1 
ATOM   748  C  CA   . ALA A 1 90  ? 40.710  29.511  9.002   1.00 14.88 ? 216 ALA A CA   1 
ATOM   749  C  C    . ALA A 1 90  ? 41.219  30.940  9.163   1.00 15.95 ? 216 ALA A C    1 
ATOM   750  O  O    . ALA A 1 90  ? 40.676  31.711  9.961   1.00 16.59 ? 216 ALA A O    1 
ATOM   751  C  CB   . ALA A 1 90  ? 41.602  28.542  9.788   1.00 14.82 ? 216 ALA A CB   1 
ATOM   752  N  N    . THR A 1 91  ? 42.239  31.306  8.392   1.00 16.18 ? 217 THR A N    1 
ATOM   753  C  CA   . THR A 1 91  ? 42.904  32.599  8.573   1.00 16.77 ? 217 THR A CA   1 
ATOM   754  C  C    . THR A 1 91  ? 42.405  33.702  7.634   1.00 16.42 ? 217 THR A C    1 
ATOM   755  O  O    . THR A 1 91  ? 42.449  34.879  8.006   1.00 18.01 ? 217 THR A O    1 
ATOM   756  C  CB   . THR A 1 91  ? 44.437  32.474  8.423   1.00 16.79 ? 217 THR A CB   1 
ATOM   757  O  OG1  . THR A 1 91  ? 44.774  32.112  7.085   1.00 21.60 ? 217 THR A OG1  1 
ATOM   758  C  CG2  . THR A 1 91  ? 44.985  31.432  9.384   1.00 18.79 ? 217 THR A CG2  1 
ATOM   759  N  N    . GLU A 1 92  ? 41.926  33.328  6.446   1.00 15.45 ? 218 GLU A N    1 
ATOM   760  C  CA   . GLU A 1 92  ? 41.591  34.293  5.379   1.00 14.95 ? 218 GLU A CA   1 
ATOM   761  C  C    . GLU A 1 92  ? 40.117  34.461  5.045   1.00 15.30 ? 218 GLU A C    1 
ATOM   762  O  O    . GLU A 1 92  ? 39.777  35.408  4.347   1.00 15.62 ? 218 GLU A O    1 
ATOM   763  C  CB   . GLU A 1 92  ? 42.332  33.958  4.082   1.00 15.39 ? 218 GLU A CB   1 
ATOM   764  C  CG   . GLU A 1 92  ? 43.836  33.807  4.268   1.00 18.21 ? 218 GLU A CG   1 
ATOM   765  C  CD   . GLU A 1 92  ? 44.461  35.040  4.856   1.00 21.71 ? 218 GLU A CD   1 
ATOM   766  O  OE1  . GLU A 1 92  ? 44.015  36.156  4.519   1.00 23.47 ? 218 GLU A OE1  1 
ATOM   767  O  OE2  . GLU A 1 92  ? 45.401  34.898  5.662   1.00 27.32 ? 218 GLU A OE2  1 
ATOM   768  N  N    . VAL A 1 93  ? 39.259  33.546  5.502   1.00 15.68 ? 219 VAL A N    1 
ATOM   769  C  CA   . VAL A 1 93  ? 37.835  33.590  5.160   1.00 15.83 ? 219 VAL A CA   1 
ATOM   770  C  C    . VAL A 1 93  ? 36.952  33.892  6.370   1.00 15.35 ? 219 VAL A C    1 
ATOM   771  O  O    . VAL A 1 93  ? 36.013  34.677  6.269   1.00 14.61 ? 219 VAL A O    1 
ATOM   772  C  CB   . VAL A 1 93  ? 37.389  32.285  4.476   1.00 15.81 ? 219 VAL A CB   1 
ATOM   773  C  CG1  . VAL A 1 93  ? 35.889  32.312  4.167   1.00 18.42 ? 219 VAL A CG1  1 
ATOM   774  C  CG2  . VAL A 1 93  ? 38.203  32.061  3.213   1.00 17.79 ? 219 VAL A CG2  1 
ATOM   775  N  N    . PHE A 1 94  ? 37.242  33.254  7.504   1.00 14.80 ? 220 PHE A N    1 
ATOM   776  C  CA   . PHE A 1 94  ? 36.537  33.514  8.748   1.00 13.96 ? 220 PHE A CA   1 
ATOM   777  C  C    . PHE A 1 94  ? 37.107  34.788  9.373   1.00 15.15 ? 220 PHE A C    1 
ATOM   778  O  O    . PHE A 1 94  ? 37.871  34.739  10.347  1.00 16.32 ? 220 PHE A O    1 
ATOM   779  C  CB   . PHE A 1 94  ? 36.648  32.319  9.701   1.00 14.32 ? 220 PHE A CB   1 
ATOM   780  C  CG   . PHE A 1 94  ? 35.743  31.161  9.345   1.00 13.65 ? 220 PHE A CG   1 
ATOM   781  C  CD1  . PHE A 1 94  ? 34.368  31.259  9.502   1.00 13.22 ? 220 PHE A CD1  1 
ATOM   782  C  CD2  . PHE A 1 94  ? 36.271  29.972  8.873   1.00 14.31 ? 220 PHE A CD2  1 
ATOM   783  C  CE1  . PHE A 1 94  ? 33.539  30.193  9.190   1.00 13.78 ? 220 PHE A CE1  1 
ATOM   784  C  CE2  . PHE A 1 94  ? 35.457  28.895  8.566   1.00 14.20 ? 220 PHE A CE2  1 
ATOM   785  C  CZ   . PHE A 1 94  ? 34.069  29.008  8.727   1.00 13.13 ? 220 PHE A CZ   1 
ATOM   786  N  N    . ARG A 1 95  ? 36.749  35.921  8.774   1.00 14.51 ? 221 ARG A N    1 
ATOM   787  C  CA   . ARG A 1 95  ? 37.181  37.246  9.226   1.00 15.67 ? 221 ARG A CA   1 
ATOM   788  C  C    . ARG A 1 95  ? 35.984  38.187  9.270   1.00 15.54 ? 221 ARG A C    1 
ATOM   789  O  O    . ARG A 1 95  ? 35.226  38.286  8.295   1.00 15.41 ? 221 ARG A O    1 
ATOM   790  C  CB   . ARG A 1 95  ? 38.223  37.821  8.278   1.00 16.29 ? 221 ARG A CB   1 
ATOM   791  C  CG   . ARG A 1 95  ? 39.502  37.012  8.176   1.00 19.26 ? 221 ARG A CG   1 
ATOM   792  C  CD   . ARG A 1 95  ? 40.446  37.653  7.195   1.00 22.90 ? 221 ARG A CD   1 
ATOM   793  N  NE   . ARG A 1 95  ? 40.873  38.984  7.636   1.00 26.33 ? 221 ARG A NE   1 
ATOM   794  C  CZ   . ARG A 1 95  ? 41.146  40.009  6.822   1.00 31.65 ? 221 ARG A CZ   1 
ATOM   795  N  NH1  . ARG A 1 95  ? 41.028  39.899  5.497   1.00 34.04 ? 221 ARG A NH1  1 
ATOM   796  N  NH2  . ARG A 1 95  ? 41.534  41.169  7.334   1.00 34.99 ? 221 ARG A NH2  1 
ATOM   797  N  N    . GLU A 1 96  ? 35.832  38.896  10.385  1.00 16.35 ? 222 GLU A N    1 
ATOM   798  C  CA   . GLU A 1 96  ? 34.701  39.800  10.566  1.00 17.55 ? 222 GLU A CA   1 
ATOM   799  C  C    . GLU A 1 96  ? 34.652  40.874  9.473   1.00 18.18 ? 222 GLU A C    1 
ATOM   800  O  O    . GLU A 1 96  ? 33.574  41.274  9.028   1.00 18.12 ? 222 GLU A O    1 
ATOM   801  C  CB   . GLU A 1 96  ? 34.750  40.450  11.954  1.00 18.40 ? 222 GLU A CB   1 
ATOM   802  C  CG   . GLU A 1 96  ? 33.464  41.181  12.323  1.00 21.72 ? 222 GLU A CG   1 
ATOM   803  C  CD   . GLU A 1 96  ? 33.422  41.627  13.770  1.00 24.37 ? 222 GLU A CD   1 
ATOM   804  O  OE1  . GLU A 1 96  ? 34.342  41.278  14.545  1.00 27.55 ? 222 GLU A OE1  1 
ATOM   805  O  OE2  . GLU A 1 96  ? 32.453  42.326  14.131  1.00 30.15 ? 222 GLU A OE2  1 
ATOM   806  N  N    . GLU A 1 97  ? 35.819  41.323  9.027   1.00 18.59 ? 223 GLU A N    1 
ATOM   807  C  CA   . GLU A 1 97  ? 35.892  42.348  7.982   1.00 19.50 ? 223 GLU A CA   1 
ATOM   808  C  C    . GLU A 1 97  ? 35.420  41.855  6.612   1.00 18.22 ? 223 GLU A C    1 
ATOM   809  O  O    . GLU A 1 97  ? 35.159  42.673  5.728   1.00 18.38 ? 223 GLU A O    1 
ATOM   810  C  CB   . GLU A 1 97  ? 37.304  42.939  7.871   1.00 21.70 ? 223 GLU A CB   1 
ATOM   811  C  CG   . GLU A 1 97  ? 38.445  41.934  7.793   1.00 25.34 ? 223 GLU A CG   1 
ATOM   812  C  CD   . GLU A 1 97  ? 39.018  41.578  9.171   1.00 29.44 ? 223 GLU A CD   1 
ATOM   813  O  OE1  . GLU A 1 97  ? 38.306  40.938  9.980   1.00 29.46 ? 223 GLU A OE1  1 
ATOM   814  O  OE2  . GLU A 1 97  ? 40.185  41.958  9.451   1.00 36.85 ? 223 GLU A OE2  1 
ATOM   815  N  N    . LEU A 1 98  ? 35.324  40.535  6.440   1.00 16.37 ? 224 LEU A N    1 
ATOM   816  C  CA   . LEU A 1 98  ? 34.797  39.930  5.214   1.00 16.00 ? 224 LEU A CA   1 
ATOM   817  C  C    . LEU A 1 98  ? 33.386  39.378  5.424   1.00 15.81 ? 224 LEU A C    1 
ATOM   818  O  O    . LEU A 1 98  ? 32.889  38.604  4.597   1.00 15.97 ? 224 LEU A O    1 
ATOM   819  C  CB   . LEU A 1 98  ? 35.733  38.815  4.730   1.00 17.16 ? 224 LEU A CB   1 
ATOM   820  C  CG   . LEU A 1 98  ? 37.176  39.281  4.502   1.00 17.09 ? 224 LEU A CG   1 
ATOM   821  C  CD1  . LEU A 1 98  ? 38.044  38.094  4.107   1.00 19.60 ? 224 LEU A CD1  1 
ATOM   822  C  CD2  . LEU A 1 98  ? 37.235  40.375  3.445   1.00 19.61 ? 224 LEU A CD2  1 
ATOM   823  N  N    . GLY A 1 99  ? 32.755  39.758  6.532   1.00 15.32 ? 225 GLY A N    1 
ATOM   824  C  CA   . GLY A 1 99  ? 31.349  39.425  6.763   1.00 15.45 ? 225 GLY A CA   1 
ATOM   825  C  C    . GLY A 1 99  ? 31.075  38.300  7.738   1.00 16.06 ? 225 GLY A C    1 
ATOM   826  O  O    . GLY A 1 99  ? 29.907  37.997  8.012   1.00 16.92 ? 225 GLY A O    1 
ATOM   827  N  N    . ALA A 1 100 ? 32.122  37.663  8.261   1.00 15.63 ? 226 ALA A N    1 
ATOM   828  C  CA   . ALA A 1 100 ? 31.942  36.619  9.272   1.00 16.40 ? 226 ALA A CA   1 
ATOM   829  C  C    . ALA A 1 100 ? 31.328  37.226  10.529  1.00 16.73 ? 226 ALA A C    1 
ATOM   830  O  O    . ALA A 1 100 ? 31.660  38.344  10.923  1.00 16.38 ? 226 ALA A O    1 
ATOM   831  C  CB   . ALA A 1 100 ? 33.267  35.945  9.603   1.00 15.51 ? 226 ALA A CB   1 
ATOM   832  N  N    . ARG A 1 101 ? 30.424  36.477  11.155  1.00 17.11 ? 227 ARG A N    1 
ATOM   833  C  CA   . ARG A 1 101 ? 29.705  36.942  12.342  1.00 17.01 ? 227 ARG A CA   1 
ATOM   834  C  C    . ARG A 1 101 ? 30.309  36.331  13.604  1.00 18.31 ? 227 ARG A C    1 
ATOM   835  O  O    . ARG A 1 101 ? 30.355  35.113  13.733  1.00 18.40 ? 227 ARG A O    1 
ATOM   836  C  CB   . ARG A 1 101 ? 28.237  36.545  12.226  1.00 16.89 ? 227 ARG A CB   1 
ATOM   837  C  CG   . ARG A 1 101 ? 27.512  37.242  11.080  1.00 16.61 ? 227 ARG A CG   1 
ATOM   838  C  CD   . ARG A 1 101 ? 26.129  36.659  10.849  1.00 16.26 ? 227 ARG A CD   1 
ATOM   839  N  NE   . ARG A 1 101 ? 26.192  35.284  10.385  1.00 15.35 ? 227 ARG A NE   1 
ATOM   840  C  CZ   . ARG A 1 101 ? 25.140  34.518  10.125  1.00 14.61 ? 227 ARG A CZ   1 
ATOM   841  N  NH1  . ARG A 1 101 ? 23.901  34.992  10.283  1.00 15.40 ? 227 ARG A NH1  1 
ATOM   842  N  NH2  . ARG A 1 101 ? 25.324  33.276  9.700   1.00 15.60 ? 227 ARG A NH2  1 
ATOM   843  N  N    . PRO A 1 102 ? 30.769  37.171  14.547  1.00 20.56 ? 228 PRO A N    1 
ATOM   844  C  CA   . PRO A 1 102 ? 31.348  36.652  15.790  1.00 21.31 ? 228 PRO A CA   1 
ATOM   845  C  C    . PRO A 1 102 ? 30.484  35.650  16.576  1.00 21.29 ? 228 PRO A C    1 
ATOM   846  O  O    . PRO A 1 102 ? 31.042  34.769  17.228  1.00 22.84 ? 228 PRO A O    1 
ATOM   847  C  CB   . PRO A 1 102 ? 31.583  37.920  16.612  1.00 21.98 ? 228 PRO A CB   1 
ATOM   848  C  CG   . PRO A 1 102 ? 31.848  38.955  15.588  1.00 22.69 ? 228 PRO A CG   1 
ATOM   849  C  CD   . PRO A 1 102 ? 30.901  38.638  14.467  1.00 21.13 ? 228 PRO A CD   1 
ATOM   850  N  N    . ASP A 1 103 ? 29.159  35.762  16.504  1.00 20.78 ? 229 ASP A N    1 
ATOM   851  C  CA   . ASP A 1 103 ? 28.278  34.862  17.261  1.00 21.23 ? 229 ASP A CA   1 
ATOM   852  C  C    . ASP A 1 103 ? 27.972  33.531  16.565  1.00 20.47 ? 229 ASP A C    1 
ATOM   853  O  O    . ASP A 1 103 ? 27.377  32.639  17.169  1.00 21.38 ? 229 ASP A O    1 
ATOM   854  C  CB   . ASP A 1 103 ? 26.974  35.571  17.701  1.00 21.92 ? 229 ASP A CB   1 
ATOM   855  C  CG   . ASP A 1 103 ? 26.013  35.889  16.548  1.00 22.53 ? 229 ASP A CG   1 
ATOM   856  O  OD1  . ASP A 1 103 ? 26.230  35.478  15.394  1.00 25.09 ? 229 ASP A OD1  1 
ATOM   857  O  OD2  . ASP A 1 103 ? 25.004  36.582  16.815  1.00 28.82 ? 229 ASP A OD2  1 
ATOM   858  N  N    . ALA A 1 104 ? 28.407  33.380  15.319  1.00 18.47 ? 230 ALA A N    1 
ATOM   859  C  CA   . ALA A 1 104 ? 28.018  32.233  14.514  1.00 17.65 ? 230 ALA A CA   1 
ATOM   860  C  C    . ALA A 1 104 ? 28.895  31.019  14.802  1.00 16.79 ? 230 ALA A C    1 
ATOM   861  O  O    . ALA A 1 104 ? 30.075  31.152  15.127  1.00 17.82 ? 230 ALA A O    1 
ATOM   862  C  CB   . ALA A 1 104 ? 28.101  32.581  13.016  1.00 17.04 ? 230 ALA A CB   1 
ATOM   863  N  N    . THR A 1 105 ? 28.304  29.840  14.661  1.00 15.74 ? 231 THR A N    1 
ATOM   864  C  CA   . THR A 1 105 ? 29.068  28.600  14.621  1.00 15.89 ? 231 THR A CA   1 
ATOM   865  C  C    . THR A 1 105 ? 29.802  28.519  13.285  1.00 14.44 ? 231 THR A C    1 
ATOM   866  O  O    . THR A 1 105 ? 29.185  28.656  12.220  1.00 14.52 ? 231 THR A O    1 
ATOM   867  C  CB   . THR A 1 105 ? 28.158  27.369  14.775  1.00 15.99 ? 231 THR A CB   1 
ATOM   868  O  OG1  . THR A 1 105 ? 27.526  27.425  16.052  1.00 17.51 ? 231 THR A OG1  1 
ATOM   869  C  CG2  . THR A 1 105 ? 28.959  26.074  14.654  1.00 16.35 ? 231 THR A CG2  1 
ATOM   870  N  N    . LYS A 1 106 ? 31.113  28.280  13.338  1.00 13.97 ? 232 LYS A N    1 
ATOM   871  C  CA   . LYS A 1 106 ? 31.916  28.136  12.121  1.00 14.48 ? 232 LYS A CA   1 
ATOM   872  C  C    . LYS A 1 106 ? 31.896  26.694  11.634  1.00 13.69 ? 232 LYS A C    1 
ATOM   873  O  O    . LYS A 1 106 ? 32.225  25.779  12.400  1.00 13.71 ? 232 LYS A O    1 
ATOM   874  C  CB   . LYS A 1 106 ? 33.371  28.532  12.399  1.00 14.88 ? 232 LYS A CB   1 
ATOM   875  C  CG   . LYS A 1 106 ? 33.568  29.961  12.835  1.00 16.31 ? 232 LYS A CG   1 
ATOM   876  C  CD   . LYS A 1 106 ? 35.037  30.197  13.153  1.00 20.44 ? 232 LYS A CD   1 
ATOM   877  C  CE   . LYS A 1 106 ? 35.320  31.617  13.504  1.00 24.33 ? 232 LYS A CE   1 
ATOM   878  N  NZ   . LYS A 1 106 ? 36.784  31.836  13.607  1.00 27.22 ? 232 LYS A NZ   1 
ATOM   879  N  N    . VAL A 1 107 ? 31.524  26.500  10.370  1.00 14.03 ? 233 VAL A N    1 
ATOM   880  C  CA   . VAL A 1 107 ? 31.419  25.169  9.759   1.00 13.38 ? 233 VAL A CA   1 
ATOM   881  C  C    . VAL A 1 107 ? 32.157  25.158  8.420   1.00 14.33 ? 233 VAL A C    1 
ATOM   882  O  O    . VAL A 1 107 ? 32.075  26.110  7.648   1.00 14.00 ? 233 VAL A O    1 
ATOM   883  C  CB   . VAL A 1 107 ? 29.942  24.726  9.567   1.00 14.23 ? 233 VAL A CB   1 
ATOM   884  C  CG1  . VAL A 1 107 ? 29.864  23.323  8.930   1.00 12.99 ? 233 VAL A CG1  1 
ATOM   885  C  CG2  . VAL A 1 107 ? 29.190  24.767  10.894  1.00 14.15 ? 233 VAL A CG2  1 
ATOM   886  N  N    . LEU A 1 108 ? 32.877  24.066  8.164   1.00 14.51 ? 234 LEU A N    1 
ATOM   887  C  CA   . LEU A 1 108 ? 33.567  23.826  6.900   1.00 14.92 ? 234 LEU A CA   1 
ATOM   888  C  C    . LEU A 1 108 ? 33.028  22.549  6.278   1.00 15.70 ? 234 LEU A C    1 
ATOM   889  O  O    . LEU A 1 108 ? 32.889  21.548  6.980   1.00 15.75 ? 234 LEU A O    1 
ATOM   890  C  CB   . LEU A 1 108 ? 35.063  23.628  7.159   1.00 16.27 ? 234 LEU A CB   1 
ATOM   891  C  CG   . LEU A 1 108 ? 36.082  24.594  6.581   1.00 18.37 ? 234 LEU A CG   1 
ATOM   892  C  CD1  . LEU A 1 108 ? 37.482  24.181  7.053   1.00 16.35 ? 234 LEU A CD1  1 
ATOM   893  C  CD2  . LEU A 1 108 ? 36.031  24.641  5.052   1.00 16.77 ? 234 LEU A CD2  1 
ATOM   894  N  N    . ILE A 1 109 ? 32.707  22.595  4.984   1.00 14.67 ? 235 ILE A N    1 
ATOM   895  C  CA   . ILE A 1 109 ? 32.462  21.390  4.196   1.00 14.58 ? 235 ILE A CA   1 
ATOM   896  C  C    . ILE A 1 109 ? 33.578  21.312  3.162   1.00 14.54 ? 235 ILE A C    1 
ATOM   897  O  O    . ILE A 1 109 ? 33.655  22.147  2.260   1.00 14.95 ? 235 ILE A O    1 
ATOM   898  C  CB   . ILE A 1 109 ? 31.093  21.411  3.502   1.00 15.08 ? 235 ILE A CB   1 
ATOM   899  C  CG1  . ILE A 1 109 ? 29.987  21.476  4.548   1.00 17.67 ? 235 ILE A CG1  1 
ATOM   900  C  CG2  . ILE A 1 109 ? 30.937  20.172  2.644   1.00 16.39 ? 235 ILE A CG2  1 
ATOM   901  C  CD1  . ILE A 1 109 ? 28.592  21.441  3.933   1.00 19.00 ? 235 ILE A CD1  1 
ATOM   902  N  N    . ILE A 1 110 ? 34.474  20.342  3.343   1.00 14.63 ? 236 ILE A N    1 
ATOM   903  C  CA   . ILE A 1 110 ? 35.607  20.127  2.437   1.00 15.49 ? 236 ILE A CA   1 
ATOM   904  C  C    . ILE A 1 110 ? 35.200  19.042  1.448   1.00 14.54 ? 236 ILE A C    1 
ATOM   905  O  O    . ILE A 1 110 ? 34.670  18.005  1.856   1.00 15.61 ? 236 ILE A O    1 
ATOM   906  C  CB   . ILE A 1 110 ? 36.840  19.663  3.226   1.00 15.33 ? 236 ILE A CB   1 
ATOM   907  C  CG1  . ILE A 1 110 ? 37.148  20.616  4.384   1.00 17.78 ? 236 ILE A CG1  1 
ATOM   908  C  CG2  . ILE A 1 110 ? 38.046  19.490  2.314   1.00 16.08 ? 236 ILE A CG2  1 
ATOM   909  C  CD1  . ILE A 1 110 ? 37.862  19.960  5.527   1.00 16.27 ? 236 ILE A CD1  1 
ATOM   910  N  N    . ILE A 1 111 ? 35.398  19.281  0.154   1.00 14.09 ? 237 ILE A N    1 
ATOM   911  C  CA   . ILE A 1 111 ? 34.972  18.344  -0.891  1.00 14.61 ? 237 ILE A CA   1 
ATOM   912  C  C    . ILE A 1 111 ? 36.183  18.012  -1.752  1.00 15.14 ? 237 ILE A C    1 
ATOM   913  O  O    . ILE A 1 111 ? 36.787  18.912  -2.337  1.00 15.21 ? 237 ILE A O    1 
ATOM   914  C  CB   . ILE A 1 111 ? 33.853  18.934  -1.774  1.00 14.32 ? 237 ILE A CB   1 
ATOM   915  C  CG1  . ILE A 1 111 ? 32.729  19.504  -0.891  1.00 17.82 ? 237 ILE A CG1  1 
ATOM   916  C  CG2  . ILE A 1 111 ? 33.325  17.829  -2.722  1.00 17.19 ? 237 ILE A CG2  1 
ATOM   917  C  CD1  . ILE A 1 111 ? 31.645  20.231  -1.657  1.00 20.58 ? 237 ILE A CD1  1 
ATOM   918  N  N    . THR A 1 112 ? 36.537  16.729  -1.827  1.00 14.92 ? 238 THR A N    1 
ATOM   919  C  CA   . THR A 1 112 ? 37.772  16.315  -2.510  1.00 15.14 ? 238 THR A CA   1 
ATOM   920  C  C    . THR A 1 112 ? 37.641  14.943  -3.175  1.00 15.61 ? 238 THR A C    1 
ATOM   921  O  O    . THR A 1 112 ? 36.833  14.117  -2.742  1.00 14.46 ? 238 THR A O    1 
ATOM   922  C  CB   . THR A 1 112 ? 38.955  16.312  -1.509  1.00 14.78 ? 238 THR A CB   1 
ATOM   923  O  OG1  . THR A 1 112 ? 40.181  16.075  -2.206  1.00 16.79 ? 238 THR A OG1  1 
ATOM   924  C  CG2  . THR A 1 112 ? 38.770  15.242  -0.438  1.00 13.99 ? 238 THR A CG2  1 
ATOM   925  N  N    . ASP A 1 113 ? 38.447  14.696  -4.216  1.00 15.87 ? 239 ASP A N    1 
ATOM   926  C  CA   . ASP A 1 113 ? 38.459  13.392  -4.895  1.00 16.02 ? 239 ASP A CA   1 
ATOM   927  C  C    . ASP A 1 113 ? 39.770  12.643  -4.687  1.00 15.73 ? 239 ASP A C    1 
ATOM   928  O  O    . ASP A 1 113 ? 39.991  11.626  -5.344  1.00 16.06 ? 239 ASP A O    1 
ATOM   929  C  CB   . ASP A 1 113 ? 38.160  13.507  -6.403  1.00 16.93 ? 239 ASP A CB   1 
ATOM   930  C  CG   . ASP A 1 113 ? 39.395  13.789  -7.240  1.00 20.10 ? 239 ASP A CG   1 
ATOM   931  O  OD1  . ASP A 1 113 ? 40.336  14.386  -6.693  1.00 22.81 ? 239 ASP A OD1  1 
ATOM   932  O  OD2  . ASP A 1 113 ? 39.420  13.403  -8.440  1.00 19.27 ? 239 ASP A OD2  1 
ATOM   933  N  N    . GLY A 1 114 ? 40.644  13.128  -3.800  1.00 15.15 ? 240 GLY A N    1 
ATOM   934  C  CA   . GLY A 1 114 ? 41.884  12.394  -3.554  1.00 16.16 ? 240 GLY A CA   1 
ATOM   935  C  C    . GLY A 1 114 ? 42.693  12.858  -2.384  1.00 15.81 ? 240 GLY A C    1 
ATOM   936  O  O    . GLY A 1 114 ? 42.294  13.756  -1.665  1.00 17.68 ? 240 GLY A O    1 
ATOM   937  N  N    . GLU A 1 115 ? 43.832  12.201  -2.193  1.00 15.35 ? 241 GLU A N    1 
ATOM   938  C  CA   . GLU A 1 115 ? 44.703  12.470  -1.049  1.00 16.01 ? 241 GLU A CA   1 
ATOM   939  C  C    . GLU A 1 115 ? 45.467  13.768  -1.263  1.00 15.41 ? 241 GLU A C    1 
ATOM   940  O  O    . GLU A 1 115 ? 45.741  14.185  -2.403  1.00 15.58 ? 241 GLU A O    1 
ATOM   941  C  CB   . GLU A 1 115 ? 45.648  11.290  -0.813  1.00 16.41 ? 241 GLU A CB   1 
ATOM   942  C  CG   . GLU A 1 115 ? 44.902  10.001  -0.435  1.00 16.99 ? 241 GLU A CG   1 
ATOM   943  C  CD   . GLU A 1 115 ? 45.800  8.802   -0.191  1.00 20.93 ? 241 GLU A CD   1 
ATOM   944  O  OE1  . GLU A 1 115 ? 46.940  8.957   0.313   1.00 18.77 ? 241 GLU A OE1  1 
ATOM   945  O  OE2  . GLU A 1 115 ? 45.355  7.674   -0.496  1.00 22.57 ? 241 GLU A OE2  1 
ATOM   946  N  N    . ALA A 1 116 ? 45.798  14.419  -0.146  1.00 16.20 ? 242 ALA A N    1 
ATOM   947  C  CA   . ALA A 1 116 ? 46.532  15.675  -0.172  1.00 15.89 ? 242 ALA A CA   1 
ATOM   948  C  C    . ALA A 1 116 ? 47.912  15.533  -0.806  1.00 16.27 ? 242 ALA A C    1 
ATOM   949  O  O    . ALA A 1 116 ? 48.588  14.515  -0.616  1.00 16.51 ? 242 ALA A O    1 
ATOM   950  C  CB   . ALA A 1 116 ? 46.666  16.235  1.262   1.00 17.02 ? 242 ALA A CB   1 
ATOM   951  N  N    . THR A 1 117 ? 48.325  16.560  -1.549  1.00 14.91 ? 243 THR A N    1 
ATOM   952  C  CA   . THR A 1 117 ? 49.681  16.635  -2.094  1.00 15.43 ? 243 THR A CA   1 
ATOM   953  C  C    . THR A 1 117 ? 50.625  17.489  -1.248  1.00 15.82 ? 243 THR A C    1 
ATOM   954  O  O    . THR A 1 117 ? 51.815  17.608  -1.581  1.00 17.29 ? 243 THR A O    1 
ATOM   955  C  CB   . THR A 1 117 ? 49.677  17.167  -3.548  1.00 15.55 ? 243 THR A CB   1 
ATOM   956  O  OG1  . THR A 1 117 ? 48.882  18.353  -3.637  1.00 15.68 ? 243 THR A OG1  1 
ATOM   957  C  CG2  . THR A 1 117 ? 49.090  16.117  -4.488  1.00 16.79 ? 243 THR A CG2  1 
ATOM   958  N  N    . ASP A 1 118 ? 50.110  18.095  -0.177  1.00 14.71 ? 244 ASP A N    1 
ATOM   959  C  CA   . ASP A 1 118 ? 50.948  18.805  0.794   1.00 14.19 ? 244 ASP A CA   1 
ATOM   960  C  C    . ASP A 1 118 ? 50.926  18.096  2.162   1.00 13.86 ? 244 ASP A C    1 
ATOM   961  O  O    . ASP A 1 118 ? 50.409  16.967  2.300   1.00 14.56 ? 244 ASP A O    1 
ATOM   962  C  CB   . ASP A 1 118 ? 50.556  20.295  0.899   1.00 13.80 ? 244 ASP A CB   1 
ATOM   963  C  CG   . ASP A 1 118 ? 49.138  20.517  1.402   1.00 11.82 ? 244 ASP A CG   1 
ATOM   964  O  OD1  . ASP A 1 118 ? 48.357  19.535  1.514   1.00 14.39 ? 244 ASP A OD1  1 
ATOM   965  O  OD2  . ASP A 1 118 ? 48.825  21.696  1.685   1.00 12.92 ? 244 ASP A OD2  1 
ATOM   966  N  N    . SER A 1 119 ? 51.508  18.747  3.168   1.00 14.02 ? 245 SER A N    1 
ATOM   967  C  CA   . SER A 1 119 ? 51.542  18.191  4.517   1.00 14.05 ? 245 SER A CA   1 
ATOM   968  C  C    . SER A 1 119 ? 51.504  19.331  5.534   1.00 14.05 ? 245 SER A C    1 
ATOM   969  O  O    . SER A 1 119 ? 51.126  20.464  5.206   1.00 14.31 ? 245 SER A O    1 
ATOM   970  C  CB   . SER A 1 119 ? 52.766  17.272  4.699   1.00 16.11 ? 245 SER A CB   1 
ATOM   971  O  OG   . SER A 1 119 ? 53.958  17.964  4.468   1.00 19.59 ? 245 SER A OG   1 
ATOM   972  N  N    . GLY A 1 120 ? 51.820  19.020  6.779   1.00 14.34 ? 246 GLY A N    1 
ATOM   973  C  CA   . GLY A 1 120 ? 51.837  20.011  7.849   1.00 14.69 ? 246 GLY A CA   1 
ATOM   974  C  C    . GLY A 1 120 ? 50.789  19.674  8.887   1.00 15.33 ? 246 GLY A C    1 
ATOM   975  O  O    . GLY A 1 120 ? 50.667  18.518  9.310   1.00 15.41 ? 246 GLY A O    1 
ATOM   976  N  N    . ASN A 1 121 ? 50.055  20.691  9.330   1.00 15.37 ? 247 ASN A N    1 
ATOM   977  C  CA   . ASN A 1 121 ? 48.982  20.505  10.301  1.00 14.80 ? 247 ASN A CA   1 
ATOM   978  C  C    . ASN A 1 121 ? 47.867  21.506  10.052  1.00 14.93 ? 247 ASN A C    1 
ATOM   979  O  O    . ASN A 1 121 ? 48.069  22.495  9.355   1.00 15.00 ? 247 ASN A O    1 
ATOM   980  C  CB   . ASN A 1 121 ? 49.526  20.681  11.708  1.00 16.42 ? 247 ASN A CB   1 
ATOM   981  C  CG   . ASN A 1 121 ? 49.913  22.112  11.997  1.00 17.29 ? 247 ASN A CG   1 
ATOM   982  O  OD1  . ASN A 1 121 ? 49.052  22.968  12.214  1.00 15.58 ? 247 ASN A OD1  1 
ATOM   983  N  ND2  . ASN A 1 121 ? 51.216  22.387  11.991  1.00 18.40 ? 247 ASN A ND2  1 
ATOM   984  N  N    . ILE A 1 122 ? 46.711  21.263  10.656  1.00 15.23 ? 248 ILE A N    1 
ATOM   985  C  CA   . ILE A 1 122 ? 45.580  22.191  10.553  1.00 15.05 ? 248 ILE A CA   1 
ATOM   986  C  C    . ILE A 1 122 ? 45.190  22.749  11.937  1.00 15.69 ? 248 ILE A C    1 
ATOM   987  O  O    . ILE A 1 122 ? 44.023  23.050  12.216  1.00 15.66 ? 248 ILE A O    1 
ATOM   988  C  CB   . ILE A 1 122 ? 44.354  21.556  9.829   1.00 14.63 ? 248 ILE A CB   1 
ATOM   989  C  CG1  . ILE A 1 122 ? 43.896  20.269  10.519  1.00 15.36 ? 248 ILE A CG1  1 
ATOM   990  C  CG2  . ILE A 1 122 ? 44.675  21.286  8.343   1.00 16.65 ? 248 ILE A CG2  1 
ATOM   991  C  CD1  . ILE A 1 122 ? 42.411  19.991  10.315  1.00 15.95 ? 248 ILE A CD1  1 
ATOM   992  N  N    . ASP A 1 123 ? 46.178  22.930  12.806  1.00 15.80 ? 249 ASP A N    1 
ATOM   993  C  CA   . ASP A 1 123 ? 45.922  23.490  14.127  1.00 17.28 ? 249 ASP A CA   1 
ATOM   994  C  C    . ASP A 1 123 ? 45.138  24.803  14.093  1.00 17.44 ? 249 ASP A C    1 
ATOM   995  O  O    . ASP A 1 123 ? 44.311  25.052  14.966  1.00 17.43 ? 249 ASP A O    1 
ATOM   996  C  CB   . ASP A 1 123 ? 47.233  23.727  14.872  1.00 18.36 ? 249 ASP A CB   1 
ATOM   997  C  CG   . ASP A 1 123 ? 47.951  22.446  15.217  1.00 21.99 ? 249 ASP A CG   1 
ATOM   998  O  OD1  . ASP A 1 123 ? 47.333  21.359  15.177  1.00 25.90 ? 249 ASP A OD1  1 
ATOM   999  O  OD2  . ASP A 1 123 ? 49.157  22.541  15.522  1.00 24.74 ? 249 ASP A OD2  1 
ATOM   1000 N  N    . ALA A 1 124 ? 45.378  25.630  13.080  1.00 17.20 ? 250 ALA A N    1 
ATOM   1001 C  CA   . ALA A 1 124 ? 44.714  26.929  12.983  1.00 17.92 ? 250 ALA A CA   1 
ATOM   1002 C  C    . ALA A 1 124 ? 43.199  26.806  12.808  1.00 17.54 ? 250 ALA A C    1 
ATOM   1003 O  O    . ALA A 1 124 ? 42.455  27.762  13.103  1.00 16.59 ? 250 ALA A O    1 
ATOM   1004 C  CB   . ALA A 1 124 ? 45.305  27.736  11.841  1.00 19.23 ? 250 ALA A CB   1 
ATOM   1005 N  N    . ALA A 1 125 ? 42.748  25.644  12.341  1.00 16.89 ? 251 ALA A N    1 
ATOM   1006 C  CA   . ALA A 1 125 ? 41.340  25.413  12.039  1.00 17.69 ? 251 ALA A CA   1 
ATOM   1007 C  C    . ALA A 1 125 ? 40.627  24.566  13.090  1.00 19.63 ? 251 ALA A C    1 
ATOM   1008 O  O    . ALA A 1 125 ? 39.481  24.163  12.871  1.00 17.91 ? 251 ALA A O    1 
ATOM   1009 C  CB   . ALA A 1 125 ? 41.205  24.738  10.650  1.00 17.45 ? 251 ALA A CB   1 
ATOM   1010 N  N    . LYS A 1 126 ? 41.269  24.335  14.237  1.00 21.53 ? 252 LYS A N    1 
ATOM   1011 C  CA   A LYS A 1 126 ? 40.748  23.426  15.280  0.60 23.70 ? 252 LYS A CA   1 
ATOM   1012 C  CA   B LYS A 1 126 ? 40.713  23.390  15.216  0.40 23.31 ? 252 LYS A CA   1 
ATOM   1013 C  C    . LYS A 1 126 ? 39.362  23.807  15.813  1.00 23.76 ? 252 LYS A C    1 
ATOM   1014 O  O    . LYS A 1 126 ? 38.575  22.939  16.194  1.00 26.72 ? 252 LYS A O    1 
ATOM   1015 C  CB   A LYS A 1 126 ? 41.742  23.313  16.453  0.60 24.30 ? 252 LYS A CB   1 
ATOM   1016 C  CB   B LYS A 1 126 ? 41.727  23.052  16.316  0.40 23.67 ? 252 LYS A CB   1 
ATOM   1017 C  CG   A LYS A 1 126 ? 41.577  24.341  17.572  0.60 25.85 ? 252 LYS A CG   1 
ATOM   1018 C  CG   B LYS A 1 126 ? 42.379  21.682  16.128  0.40 24.21 ? 252 LYS A CG   1 
ATOM   1019 C  CD   A LYS A 1 126 ? 42.126  25.717  17.212  0.60 27.45 ? 252 LYS A CD   1 
ATOM   1020 C  CD   B LYS A 1 126 ? 42.806  21.432  14.684  0.40 23.85 ? 252 LYS A CD   1 
ATOM   1021 C  CE   A LYS A 1 126 ? 43.567  25.888  17.690  0.60 28.88 ? 252 LYS A CE   1 
ATOM   1022 C  CE   B LYS A 1 126 ? 43.774  20.252  14.568  0.40 25.36 ? 252 LYS A CE   1 
ATOM   1023 N  NZ   A LYS A 1 126 ? 44.281  26.971  16.948  0.60 30.53 ? 252 LYS A NZ   1 
ATOM   1024 N  NZ   B LYS A 1 126 ? 43.084  18.949  14.341  0.40 24.73 ? 252 LYS A NZ   1 
ATOM   1025 N  N    . ASP A 1 127 ? 39.067  25.103  15.858  1.00 23.69 ? 253 ASP A N    1 
ATOM   1026 C  CA   . ASP A 1 127 ? 37.769  25.577  16.384  1.00 24.02 ? 253 ASP A CA   1 
ATOM   1027 C  C    . ASP A 1 127 ? 36.634  25.584  15.336  1.00 22.23 ? 253 ASP A C    1 
ATOM   1028 O  O    . ASP A 1 127 ? 35.501  25.990  15.635  1.00 24.00 ? 253 ASP A O    1 
ATOM   1029 C  CB   . ASP A 1 127 ? 37.914  26.959  17.029  1.00 25.04 ? 253 ASP A CB   1 
ATOM   1030 C  CG   . ASP A 1 127 ? 38.772  26.934  18.301  1.00 29.52 ? 253 ASP A CG   1 
ATOM   1031 O  OD1  . ASP A 1 127 ? 38.886  25.864  18.944  1.00 35.13 ? 253 ASP A OD1  1 
ATOM   1032 O  OD2  . ASP A 1 127 ? 39.326  27.995  18.671  1.00 34.46 ? 253 ASP A OD2  1 
ATOM   1033 N  N    . ILE A 1 128 ? 36.923  25.136  14.121  1.00 17.55 ? 254 ILE A N    1 
ATOM   1034 C  CA   . ILE A 1 128 ? 35.917  25.039  13.076  1.00 16.01 ? 254 ILE A CA   1 
ATOM   1035 C  C    . ILE A 1 128 ? 35.367  23.624  13.064  1.00 14.27 ? 254 ILE A C    1 
ATOM   1036 O  O    . ILE A 1 128 ? 36.123  22.653  13.172  1.00 15.42 ? 254 ILE A O    1 
ATOM   1037 C  CB   . ILE A 1 128 ? 36.522  25.380  11.699  1.00 16.36 ? 254 ILE A CB   1 
ATOM   1038 C  CG1  . ILE A 1 128 ? 37.147  26.779  11.731  1.00 16.89 ? 254 ILE A CG1  1 
ATOM   1039 C  CG2  . ILE A 1 128 ? 35.469  25.247  10.593  1.00 16.13 ? 254 ILE A CG2  1 
ATOM   1040 C  CD1  . ILE A 1 128 ? 37.995  27.083  10.527  1.00 16.48 ? 254 ILE A CD1  1 
ATOM   1041 N  N    . ILE A 1 129 ? 34.042  23.492  12.958  1.00 13.97 ? 255 ILE A N    1 
ATOM   1042 C  CA   . ILE A 1 129 ? 33.422  22.181  12.817  1.00 14.14 ? 255 ILE A CA   1 
ATOM   1043 C  C    . ILE A 1 129 ? 33.631  21.755  11.352  1.00 14.45 ? 255 ILE A C    1 
ATOM   1044 O  O    . ILE A 1 129 ? 33.178  22.456  10.437  1.00 14.13 ? 255 ILE A O    1 
ATOM   1045 C  CB   . ILE A 1 129 ? 31.929  22.247  13.173  1.00 14.51 ? 255 ILE A CB   1 
ATOM   1046 C  CG1  . ILE A 1 129 ? 31.736  22.710  14.626  1.00 16.02 ? 255 ILE A CG1  1 
ATOM   1047 C  CG2  . ILE A 1 129 ? 31.265  20.896  12.924  1.00 16.40 ? 255 ILE A CG2  1 
ATOM   1048 C  CD1  . ILE A 1 129 ? 30.289  22.938  14.988  1.00 19.43 ? 255 ILE A CD1  1 
ATOM   1049 N  N    . ARG A 1 130 ? 34.362  20.651  11.132  1.00 13.54 ? 256 ARG A N    1 
ATOM   1050 C  CA   . ARG A 1 130 ? 34.843  20.268  9.803   1.00 14.62 ? 256 ARG A CA   1 
ATOM   1051 C  C    . ARG A 1 130 ? 34.260  18.940  9.302   1.00 13.40 ? 256 ARG A C    1 
ATOM   1052 O  O    . ARG A 1 130 ? 34.510  17.890  9.901   1.00 13.68 ? 256 ARG A O    1 
ATOM   1053 C  CB   . ARG A 1 130 ? 36.376  20.197  9.812   1.00 15.48 ? 256 ARG A CB   1 
ATOM   1054 C  CG   . ARG A 1 130 ? 37.013  21.567  10.005  1.00 17.97 ? 256 ARG A CG   1 
ATOM   1055 C  CD   . ARG A 1 130 ? 38.437  21.482  10.548  1.00 18.24 ? 256 ARG A CD   1 
ATOM   1056 N  NE   . ARG A 1 130 ? 38.449  21.243  11.990  1.00 24.64 ? 256 ARG A NE   1 
ATOM   1057 C  CZ   . ARG A 1 130 ? 38.902  20.152  12.595  1.00 25.20 ? 256 ARG A CZ   1 
ATOM   1058 N  NH1  . ARG A 1 130 ? 39.404  19.133  11.907  1.00 26.45 ? 256 ARG A NH1  1 
ATOM   1059 N  NH2  . ARG A 1 130 ? 38.854  20.078  13.915  1.00 27.71 ? 256 ARG A NH2  1 
ATOM   1060 N  N    . TYR A 1 131 ? 33.474  19.010  8.234   1.00 13.92 ? 257 TYR A N    1 
ATOM   1061 C  CA   . TYR A 1 131 ? 33.028  17.836  7.496   1.00 12.68 ? 257 TYR A CA   1 
ATOM   1062 C  C    . TYR A 1 131 ? 33.916  17.698  6.275   1.00 13.96 ? 257 TYR A C    1 
ATOM   1063 O  O    . TYR A 1 131 ? 34.325  18.701  5.677   1.00 15.30 ? 257 TYR A O    1 
ATOM   1064 C  CB   . TYR A 1 131 ? 31.568  17.979  7.024   1.00 12.91 ? 257 TYR A CB   1 
ATOM   1065 C  CG   . TYR A 1 131 ? 30.588  17.878  8.157   1.00 13.62 ? 257 TYR A CG   1 
ATOM   1066 C  CD1  . TYR A 1 131 ? 30.026  16.654  8.493   1.00 14.33 ? 257 TYR A CD1  1 
ATOM   1067 C  CD2  . TYR A 1 131 ? 30.259  18.999  8.931   1.00 15.54 ? 257 TYR A CD2  1 
ATOM   1068 C  CE1  . TYR A 1 131 ? 29.138  16.537  9.564   1.00 15.40 ? 257 TYR A CE1  1 
ATOM   1069 C  CE2  . TYR A 1 131 ? 29.357  18.892  9.997   1.00 15.63 ? 257 TYR A CE2  1 
ATOM   1070 C  CZ   . TYR A 1 131 ? 28.811  17.663  10.306  1.00 16.22 ? 257 TYR A CZ   1 
ATOM   1071 O  OH   . TYR A 1 131 ? 27.941  17.540  11.373  1.00 16.57 ? 257 TYR A OH   1 
ATOM   1072 N  N    . ILE A 1 132 ? 34.187  16.458  5.875   1.00 14.55 ? 258 ILE A N    1 
ATOM   1073 C  CA   . ILE A 1 132 ? 34.901  16.198  4.631   1.00 14.02 ? 258 ILE A CA   1 
ATOM   1074 C  C    . ILE A 1 132 ? 34.158  15.123  3.848   1.00 14.20 ? 258 ILE A C    1 
ATOM   1075 O  O    . ILE A 1 132 ? 33.707  14.118  4.419   1.00 14.09 ? 258 ILE A O    1 
ATOM   1076 C  CB   . ILE A 1 132 ? 36.392  15.840  4.869   1.00 14.46 ? 258 ILE A CB   1 
ATOM   1077 C  CG1  . ILE A 1 132 ? 37.151  15.772  3.536   1.00 15.22 ? 258 ILE A CG1  1 
ATOM   1078 C  CG2  . ILE A 1 132 ? 36.538  14.531  5.647   1.00 14.44 ? 258 ILE A CG2  1 
ATOM   1079 C  CD1  . ILE A 1 132 ? 38.661  15.979  3.714   1.00 15.75 ? 258 ILE A CD1  1 
ATOM   1080 N  N    . ILE A 1 133 ? 33.984  15.402  2.560   1.00 14.01 ? 259 ILE A N    1 
ATOM   1081 C  CA   . ILE A 1 133 ? 33.323  14.509  1.619   1.00 13.81 ? 259 ILE A CA   1 
ATOM   1082 C  C    . ILE A 1 133 ? 34.392  14.056  0.637   1.00 13.97 ? 259 ILE A C    1 
ATOM   1083 O  O    . ILE A 1 133 ? 34.911  14.872  -0.137  1.00 13.67 ? 259 ILE A O    1 
ATOM   1084 C  CB   . ILE A 1 133 ? 32.199  15.231  0.862   1.00 14.32 ? 259 ILE A CB   1 
ATOM   1085 C  CG1  . ILE A 1 133 ? 31.216  15.872  1.847   1.00 16.73 ? 259 ILE A CG1  1 
ATOM   1086 C  CG2  . ILE A 1 133 ? 31.486  14.271  -0.111  1.00 16.15 ? 259 ILE A CG2  1 
ATOM   1087 C  CD1  . ILE A 1 133 ? 30.215  16.825  1.194   1.00 15.25 ? 259 ILE A CD1  1 
ATOM   1088 N  N    . GLY A 1 134 ? 34.728  12.769  0.714   1.00 13.10 ? 260 GLY A N    1 
ATOM   1089 C  CA   . GLY A 1 134 ? 35.689  12.146  -0.185  1.00 13.95 ? 260 GLY A CA   1 
ATOM   1090 C  C    . GLY A 1 134 ? 34.933  11.355  -1.223  1.00 13.56 ? 260 GLY A C    1 
ATOM   1091 O  O    . GLY A 1 134 ? 34.148  10.470  -0.862  1.00 14.41 ? 260 GLY A O    1 
ATOM   1092 N  N    . ILE A 1 135 ? 35.166  11.654  -2.502  1.00 13.86 ? 261 ILE A N    1 
ATOM   1093 C  CA   . ILE A 1 135 ? 34.328  11.122  -3.572  1.00 14.55 ? 261 ILE A CA   1 
ATOM   1094 C  C    . ILE A 1 135 ? 35.146  10.303  -4.562  1.00 15.63 ? 261 ILE A C    1 
ATOM   1095 O  O    . ILE A 1 135 ? 36.194  10.746  -5.013  1.00 15.06 ? 261 ILE A O    1 
ATOM   1096 C  CB   . ILE A 1 135 ? 33.626  12.254  -4.365  1.00 14.44 ? 261 ILE A CB   1 
ATOM   1097 C  CG1  . ILE A 1 135 ? 32.909  13.214  -3.417  1.00 15.49 ? 261 ILE A CG1  1 
ATOM   1098 C  CG2  . ILE A 1 135 ? 32.647  11.657  -5.359  1.00 15.79 ? 261 ILE A CG2  1 
ATOM   1099 C  CD1  . ILE A 1 135 ? 32.247  14.382  -4.100  1.00 17.96 ? 261 ILE A CD1  1 
ATOM   1100 N  N    . GLY A 1 136 ? 34.649  9.121   -4.905  1.00 14.96 ? 262 GLY A N    1 
ATOM   1101 C  CA   . GLY A 1 136 ? 35.160  8.385   -6.052  1.00 15.35 ? 262 GLY A CA   1 
ATOM   1102 C  C    . GLY A 1 136 ? 36.199  7.327   -5.765  1.00 15.98 ? 262 GLY A C    1 
ATOM   1103 O  O    . GLY A 1 136 ? 36.475  6.978   -4.609  1.00 15.89 ? 262 GLY A O    1 
ATOM   1104 N  N    . LYS A 1 137 ? 36.780  6.815   -6.844  1.00 16.52 ? 263 LYS A N    1 
ATOM   1105 C  CA   . LYS A 1 137 ? 37.587  5.605   -6.782  1.00 17.51 ? 263 LYS A CA   1 
ATOM   1106 C  C    . LYS A 1 137 ? 38.912  5.744   -6.040  1.00 16.11 ? 263 LYS A C    1 
ATOM   1107 O  O    . LYS A 1 137 ? 39.501  4.726   -5.663  1.00 16.75 ? 263 LYS A O    1 
ATOM   1108 C  CB   . LYS A 1 137 ? 37.835  5.051   -8.189  1.00 18.75 ? 263 LYS A CB   1 
ATOM   1109 C  CG   . LYS A 1 137 ? 38.657  5.950   -9.051  1.00 22.53 ? 263 LYS A CG   1 
ATOM   1110 C  CD   . LYS A 1 137 ? 38.710  5.468   -10.492 1.00 27.97 ? 263 LYS A CD   1 
ATOM   1111 C  CE   . LYS A 1 137 ? 39.751  6.254   -11.277 1.00 30.46 ? 263 LYS A CE   1 
ATOM   1112 N  NZ   . LYS A 1 137 ? 39.688  7.716   -10.982 1.00 33.95 ? 263 LYS A NZ   1 
ATOM   1113 N  N    . HIS A 1 138 ? 39.376  6.970   -5.781  1.00 15.57 ? 264 HIS A N    1 
ATOM   1114 C  CA   . HIS A 1 138 ? 40.586  7.112   -4.978  1.00 15.64 ? 264 HIS A CA   1 
ATOM   1115 C  C    . HIS A 1 138 ? 40.359  6.782   -3.516  1.00 15.33 ? 264 HIS A C    1 
ATOM   1116 O  O    . HIS A 1 138 ? 41.327  6.651   -2.777  1.00 16.40 ? 264 HIS A O    1 
ATOM   1117 C  CB   . HIS A 1 138 ? 41.217  8.492   -5.123  1.00 15.64 ? 264 HIS A CB   1 
ATOM   1118 C  CG   . HIS A 1 138 ? 41.587  8.824   -6.528  1.00 18.31 ? 264 HIS A CG   1 
ATOM   1119 N  ND1  . HIS A 1 138 ? 41.758  10.118  -6.969  1.00 20.73 ? 264 HIS A ND1  1 
ATOM   1120 C  CD2  . HIS A 1 138 ? 41.791  8.030   -7.604  1.00 20.32 ? 264 HIS A CD2  1 
ATOM   1121 C  CE1  . HIS A 1 138 ? 42.058  10.102  -8.256  1.00 19.47 ? 264 HIS A CE1  1 
ATOM   1122 N  NE2  . HIS A 1 138 ? 42.078  8.849   -8.668  1.00 20.73 ? 264 HIS A NE2  1 
ATOM   1123 N  N    . PHE A 1 139 ? 39.095  6.612   -3.102  1.00 15.69 ? 265 PHE A N    1 
ATOM   1124 C  CA   . PHE A 1 139 ? 38.780  6.238   -1.727  1.00 15.18 ? 265 PHE A CA   1 
ATOM   1125 C  C    . PHE A 1 139 ? 38.125  4.863   -1.602  1.00 15.80 ? 265 PHE A C    1 
ATOM   1126 O  O    . PHE A 1 139 ? 37.329  4.629   -0.698  1.00 16.89 ? 265 PHE A O    1 
ATOM   1127 C  CB   . PHE A 1 139 ? 37.932  7.330   -1.077  1.00 15.62 ? 265 PHE A CB   1 
ATOM   1128 C  CG   . PHE A 1 139 ? 38.622  8.650   -1.004  1.00 14.91 ? 265 PHE A CG   1 
ATOM   1129 C  CD1  . PHE A 1 139 ? 39.723  8.824   -0.175  1.00 15.25 ? 265 PHE A CD1  1 
ATOM   1130 C  CD2  . PHE A 1 139 ? 38.200  9.711   -1.777  1.00 14.42 ? 265 PHE A CD2  1 
ATOM   1131 C  CE1  . PHE A 1 139 ? 40.374  10.038  -0.113  1.00 14.78 ? 265 PHE A CE1  1 
ATOM   1132 C  CE2  . PHE A 1 139 ? 38.857  10.942  -1.724  1.00 15.18 ? 265 PHE A CE2  1 
ATOM   1133 C  CZ   . PHE A 1 139 ? 39.945  11.101  -0.888  1.00 15.82 ? 265 PHE A CZ   1 
ATOM   1134 N  N    . GLN A 1 140 ? 38.509  3.932   -2.474  1.00 15.36 ? 266 GLN A N    1 
ATOM   1135 C  CA   . GLN A 1 140 ? 38.006  2.554   -2.407  1.00 15.94 ? 266 GLN A CA   1 
ATOM   1136 C  C    . GLN A 1 140 ? 38.520  1.760   -1.216  1.00 16.06 ? 266 GLN A C    1 
ATOM   1137 O  O    . GLN A 1 140 ? 37.823  0.867   -0.727  1.00 17.11 ? 266 GLN A O    1 
ATOM   1138 C  CB   . GLN A 1 140 ? 38.353  1.796   -3.676  1.00 16.94 ? 266 GLN A CB   1 
ATOM   1139 C  CG   . GLN A 1 140 ? 37.553  2.224   -4.863  1.00 20.12 ? 266 GLN A CG   1 
ATOM   1140 C  CD   . GLN A 1 140 ? 37.680  1.254   -6.019  1.00 22.14 ? 266 GLN A CD   1 
ATOM   1141 O  OE1  . GLN A 1 140 ? 36.687  0.894   -6.647  1.00 29.72 ? 266 GLN A OE1  1 
ATOM   1142 N  NE2  . GLN A 1 140 ? 38.900  0.807   -6.290  1.00 27.51 ? 266 GLN A NE2  1 
ATOM   1143 N  N    . THR A 1 141 ? 39.751  2.030   -0.789  1.00 14.66 ? 267 THR A N    1 
ATOM   1144 C  CA   . THR A 1 141 ? 40.369  1.263   0.290   1.00 14.84 ? 267 THR A CA   1 
ATOM   1145 C  C    . THR A 1 141 ? 40.160  1.930   1.636   1.00 14.53 ? 267 THR A C    1 
ATOM   1146 O  O    . THR A 1 141 ? 40.089  3.151   1.727   1.00 13.91 ? 267 THR A O    1 
ATOM   1147 C  CB   . THR A 1 141 ? 41.890  1.072   0.069   1.00 14.79 ? 267 THR A CB   1 
ATOM   1148 O  OG1  . THR A 1 141 ? 42.574  2.328   0.215   1.00 14.30 ? 267 THR A OG1  1 
ATOM   1149 C  CG2  . THR A 1 141 ? 42.166  0.478   -1.300  1.00 15.13 ? 267 THR A CG2  1 
ATOM   1150 N  N    . LYS A 1 142 ? 40.066  1.111   2.682   1.00 15.41 ? 268 LYS A N    1 
ATOM   1151 C  CA   . LYS A 1 142 ? 39.955  1.617   4.053   1.00 16.65 ? 268 LYS A CA   1 
ATOM   1152 C  C    . LYS A 1 142 ? 41.089  2.596   4.335   1.00 15.98 ? 268 LYS A C    1 
ATOM   1153 O  O    . LYS A 1 142 ? 40.887  3.649   4.924   1.00 15.87 ? 268 LYS A O    1 
ATOM   1154 C  CB   . LYS A 1 142 ? 40.013  0.459   5.057   1.00 18.61 ? 268 LYS A CB   1 
ATOM   1155 C  CG   . LYS A 1 142 ? 40.098  0.874   6.526   1.00 22.32 ? 268 LYS A CG   1 
ATOM   1156 C  CD   . LYS A 1 142 ? 39.887  -0.328  7.447   1.00 26.47 ? 268 LYS A CD   1 
ATOM   1157 C  CE   . LYS A 1 142 ? 39.894  0.059   8.938   1.00 29.28 ? 268 LYS A CE   1 
ATOM   1158 N  NZ   . LYS A 1 142 ? 41.268  0.214   9.524   1.00 31.81 ? 268 LYS A NZ   1 
ATOM   1159 N  N    . GLU A 1 143 ? 42.287  2.226   3.910   1.00 16.54 ? 269 GLU A N    1 
ATOM   1160 C  CA   . GLU A 1 143 ? 43.476  3.027   4.191   1.00 16.37 ? 269 GLU A CA   1 
ATOM   1161 C  C    . GLU A 1 143 ? 43.356  4.435   3.584   1.00 15.94 ? 269 GLU A C    1 
ATOM   1162 O  O    . GLU A 1 143 ? 43.632  5.423   4.259   1.00 15.39 ? 269 GLU A O    1 
ATOM   1163 C  CB   . GLU A 1 143 ? 44.719  2.308   3.659   1.00 17.30 ? 269 GLU A CB   1 
ATOM   1164 C  CG   . GLU A 1 143 ? 45.049  0.984   4.378   1.00 21.39 ? 269 GLU A CG   1 
ATOM   1165 C  CD   . GLU A 1 143 ? 44.185  -0.230  3.961   1.00 23.78 ? 269 GLU A CD   1 
ATOM   1166 O  OE1  . GLU A 1 143 ? 44.212  -1.238  4.705   1.00 29.15 ? 269 GLU A OE1  1 
ATOM   1167 O  OE2  . GLU A 1 143 ? 43.493  -0.200  2.916   1.00 21.65 ? 269 GLU A OE2  1 
ATOM   1168 N  N    . SER A 1 144 ? 42.907  4.525   2.333   1.00 15.12 ? 270 SER A N    1 
ATOM   1169 C  CA   . SER A 1 144 ? 42.726  5.823   1.685   1.00 14.67 ? 270 SER A CA   1 
ATOM   1170 C  C    . SER A 1 144 ? 41.656  6.666   2.386   1.00 14.30 ? 270 SER A C    1 
ATOM   1171 O  O    . SER A 1 144 ? 41.800  7.863   2.541   1.00 14.91 ? 270 SER A O    1 
ATOM   1172 C  CB   . SER A 1 144 ? 42.369  5.671   0.200   1.00 15.38 ? 270 SER A CB   1 
ATOM   1173 O  OG   . SER A 1 144 ? 41.102  5.044   0.023   1.00 17.60 ? 270 SER A OG   1 
ATOM   1174 N  N    . GLN A 1 145 ? 40.561  6.025   2.781   1.00 14.32 ? 271 GLN A N    1 
ATOM   1175 C  CA   . GLN A 1 145 ? 39.494  6.717   3.497   1.00 14.06 ? 271 GLN A CA   1 
ATOM   1176 C  C    . GLN A 1 145 ? 39.998  7.301   4.814   1.00 14.28 ? 271 GLN A C    1 
ATOM   1177 O  O    . GLN A 1 145 ? 39.670  8.432   5.167   1.00 14.69 ? 271 GLN A O    1 
ATOM   1178 C  CB   . GLN A 1 145 ? 38.318  5.766   3.739   1.00 14.41 ? 271 GLN A CB   1 
ATOM   1179 C  CG   . GLN A 1 145 ? 37.655  5.293   2.452   1.00 14.27 ? 271 GLN A CG   1 
ATOM   1180 C  CD   . GLN A 1 145 ? 36.572  4.264   2.691   1.00 15.96 ? 271 GLN A CD   1 
ATOM   1181 O  OE1  . GLN A 1 145 ? 36.064  4.129   3.814   1.00 18.23 ? 271 GLN A OE1  1 
ATOM   1182 N  NE2  . GLN A 1 145 ? 36.175  3.560   1.627   1.00 16.25 ? 271 GLN A NE2  1 
ATOM   1183 N  N    . GLU A 1 146 ? 40.819  6.533   5.527   1.00 13.66 ? 272 GLU A N    1 
ATOM   1184 C  CA   . GLU A 1 146 ? 41.348  6.959   6.814   1.00 14.94 ? 272 GLU A CA   1 
ATOM   1185 C  C    . GLU A 1 146 ? 42.276  8.166   6.707   1.00 14.54 ? 272 GLU A C    1 
ATOM   1186 O  O    . GLU A 1 146 ? 42.404  8.917   7.675   1.00 15.42 ? 272 GLU A O    1 
ATOM   1187 C  CB   . GLU A 1 146 ? 42.026  5.794   7.527   1.00 15.60 ? 272 GLU A CB   1 
ATOM   1188 C  CG   . GLU A 1 146 ? 41.021  4.806   8.085   1.00 18.64 ? 272 GLU A CG   1 
ATOM   1189 C  CD   . GLU A 1 146 ? 41.630  3.560   8.691   1.00 23.44 ? 272 GLU A CD   1 
ATOM   1190 O  OE1  . GLU A 1 146 ? 42.819  3.249   8.451   1.00 28.17 ? 272 GLU A OE1  1 
ATOM   1191 O  OE2  . GLU A 1 146 ? 40.885  2.866   9.413   1.00 29.88 ? 272 GLU A OE2  1 
ATOM   1192 N  N    . THR A 1 147 ? 42.880  8.390   5.538   1.00 13.12 ? 273 THR A N    1 
ATOM   1193 C  CA   . THR A 1 147 ? 43.708  9.592   5.352   1.00 13.69 ? 273 THR A CA   1 
ATOM   1194 C  C    . THR A 1 147 ? 42.910  10.892  5.518   1.00 14.52 ? 273 THR A C    1 
ATOM   1195 O  O    . THR A 1 147 ? 43.485  11.949  5.761   1.00 15.46 ? 273 THR A O    1 
ATOM   1196 C  CB   . THR A 1 147 ? 44.418  9.661   3.964   1.00 13.15 ? 273 THR A CB   1 
ATOM   1197 O  OG1  . THR A 1 147 ? 43.458  9.929   2.915   1.00 14.00 ? 273 THR A OG1  1 
ATOM   1198 C  CG2  . THR A 1 147 ? 45.206  8.389   3.668   1.00 13.95 ? 273 THR A CG2  1 
ATOM   1199 N  N    . LEU A 1 148 ? 41.584  10.821  5.372   1.00 14.02 ? 274 LEU A N    1 
ATOM   1200 C  CA   . LEU A 1 148 ? 40.756  12.005  5.477   1.00 14.60 ? 274 LEU A CA   1 
ATOM   1201 C  C    . LEU A 1 148 ? 40.413  12.379  6.913   1.00 14.22 ? 274 LEU A C    1 
ATOM   1202 O  O    . LEU A 1 148 ? 39.978  13.504  7.173   1.00 14.68 ? 274 LEU A O    1 
ATOM   1203 C  CB   . LEU A 1 148 ? 39.465  11.831  4.684   1.00 15.01 ? 274 LEU A CB   1 
ATOM   1204 C  CG   . LEU A 1 148 ? 39.626  11.671  3.169   1.00 16.60 ? 274 LEU A CG   1 
ATOM   1205 C  CD1  . LEU A 1 148 ? 38.267  11.644  2.520   1.00 20.35 ? 274 LEU A CD1  1 
ATOM   1206 C  CD2  . LEU A 1 148 ? 40.469  12.778  2.517   1.00 17.47 ? 274 LEU A CD2  1 
ATOM   1207 N  N    . HIS A 1 149 ? 40.608  11.445  7.844   1.00 14.53 ? 275 HIS A N    1 
ATOM   1208 C  CA   . HIS A 1 149 ? 40.162  11.652  9.227   1.00 14.19 ? 275 HIS A CA   1 
ATOM   1209 C  C    . HIS A 1 149 ? 40.862  12.863  9.865   1.00 14.91 ? 275 HIS A C    1 
ATOM   1210 O  O    . HIS A 1 149 ? 40.229  13.645  10.578  1.00 15.69 ? 275 HIS A O    1 
ATOM   1211 C  CB   . HIS A 1 149 ? 40.395  10.405  10.072  1.00 14.61 ? 275 HIS A CB   1 
ATOM   1212 C  CG   . HIS A 1 149 ? 39.528  9.245   9.703   1.00 13.78 ? 275 HIS A CG   1 
ATOM   1213 N  ND1  . HIS A 1 149 ? 39.319  8.178   10.554  1.00 15.94 ? 275 HIS A ND1  1 
ATOM   1214 C  CD2  . HIS A 1 149 ? 38.787  8.996   8.599   1.00 15.28 ? 275 HIS A CD2  1 
ATOM   1215 C  CE1  . HIS A 1 149 ? 38.515  7.309   9.973   1.00 15.21 ? 275 HIS A CE1  1 
ATOM   1216 N  NE2  . HIS A 1 149 ? 38.183  7.776   8.784   1.00 15.88 ? 275 HIS A NE2  1 
ATOM   1217 N  N    . LYS A 1 150 ? 42.146  13.037  9.568   1.00 14.02 ? 276 LYS A N    1 
ATOM   1218 C  CA   . LYS A 1 150 ? 42.944  14.141  10.147  1.00 13.90 ? 276 LYS A CA   1 
ATOM   1219 C  C    . LYS A 1 150 ? 42.412  15.533  9.786   1.00 14.75 ? 276 LYS A C    1 
ATOM   1220 O  O    . LYS A 1 150 ? 42.710  16.501  10.475  1.00 16.26 ? 276 LYS A O    1 
ATOM   1221 C  CB   . LYS A 1 150 ? 44.422  14.047  9.736   1.00 15.20 ? 276 LYS A CB   1 
ATOM   1222 C  CG   . LYS A 1 150 ? 44.693  14.178  8.249   1.00 14.68 ? 276 LYS A CG   1 
ATOM   1223 C  CD   . LYS A 1 150 ? 46.182  14.129  7.912   1.00 17.07 ? 276 LYS A CD   1 
ATOM   1224 C  CE   . LYS A 1 150 ? 46.763  12.731  7.975   1.00 18.81 ? 276 LYS A CE   1 
ATOM   1225 N  NZ   . LYS A 1 150 ? 46.245  11.868  6.873   1.00 20.20 ? 276 LYS A NZ   1 
ATOM   1226 N  N    . PHE A 1 151 ? 41.625  15.643  8.716   1.00 13.35 ? 277 PHE A N    1 
ATOM   1227 C  CA   . PHE A 1 151 ? 41.097  16.944  8.278   1.00 14.07 ? 277 PHE A CA   1 
ATOM   1228 C  C    . PHE A 1 151 ? 39.765  17.278  8.931   1.00 13.64 ? 277 PHE A C    1 
ATOM   1229 O  O    . PHE A 1 151 ? 39.391  18.434  8.990   1.00 15.01 ? 277 PHE A O    1 
ATOM   1230 C  CB   . PHE A 1 151 ? 40.907  16.941  6.761   1.00 12.53 ? 277 PHE A CB   1 
ATOM   1231 C  CG   . PHE A 1 151 ? 42.174  16.699  6.006   1.00 14.32 ? 277 PHE A CG   1 
ATOM   1232 C  CD1  . PHE A 1 151 ? 43.266  17.504  6.225   1.00 11.87 ? 277 PHE A CD1  1 
ATOM   1233 C  CD2  . PHE A 1 151 ? 42.283  15.671  5.090   1.00 16.30 ? 277 PHE A CD2  1 
ATOM   1234 C  CE1  . PHE A 1 151 ? 44.436  17.302  5.544   1.00 10.76 ? 277 PHE A CE1  1 
ATOM   1235 C  CE2  . PHE A 1 151 ? 43.471  15.461  4.400   1.00 16.91 ? 277 PHE A CE2  1 
ATOM   1236 C  CZ   . PHE A 1 151 ? 44.549  16.279  4.642   1.00 13.23 ? 277 PHE A CZ   1 
ATOM   1237 N  N    . ALA A 1 152 ? 39.066  16.258  9.408   1.00 14.40 ? 278 ALA A N    1 
ATOM   1238 C  CA   . ALA A 1 152 ? 37.692  16.417  9.884   1.00 14.35 ? 278 ALA A CA   1 
ATOM   1239 C  C    . ALA A 1 152 ? 37.600  16.424  11.389  1.00 14.71 ? 278 ALA A C    1 
ATOM   1240 O  O    . ALA A 1 152 ? 38.513  15.984  12.096  1.00 14.79 ? 278 ALA A O    1 
ATOM   1241 C  CB   . ALA A 1 152 ? 36.835  15.284  9.335   1.00 14.48 ? 278 ALA A CB   1 
ATOM   1242 N  N    . SER A 1 153 ? 36.474  16.911  11.896  1.00 13.39 ? 279 SER A N    1 
ATOM   1243 C  CA   . SER A 1 153 ? 36.175  16.797  13.313  1.00 14.28 ? 279 SER A CA   1 
ATOM   1244 C  C    . SER A 1 153 ? 35.932  15.319  13.685  1.00 14.63 ? 279 SER A C    1 
ATOM   1245 O  O    . SER A 1 153 ? 35.865  14.444  12.802  1.00 14.72 ? 279 SER A O    1 
ATOM   1246 C  CB   . SER A 1 153 ? 34.967  17.692  13.665  1.00 14.98 ? 279 SER A CB   1 
ATOM   1247 O  OG   . SER A 1 153 ? 35.276  19.065  13.442  1.00 14.85 ? 279 SER A OG   1 
ATOM   1248 N  N    . LYS A 1 154 ? 35.818  15.058  14.983  1.00 14.95 ? 280 LYS A N    1 
ATOM   1249 C  CA   . LYS A 1 154 ? 35.631  13.714  15.510  1.00 15.08 ? 280 LYS A CA   1 
ATOM   1250 C  C    . LYS A 1 154 ? 34.257  13.598  16.183  1.00 14.67 ? 280 LYS A C    1 
ATOM   1251 O  O    . LYS A 1 154 ? 33.837  14.529  16.898  1.00 15.03 ? 280 LYS A O    1 
ATOM   1252 C  CB   . LYS A 1 154 ? 36.744  13.376  16.493  1.00 16.71 ? 280 LYS A CB   1 
ATOM   1253 C  CG   . LYS A 1 154 ? 38.105  13.321  15.814  1.00 20.17 ? 280 LYS A CG   1 
ATOM   1254 C  CD   . LYS A 1 154 ? 39.248  13.279  16.800  1.00 24.09 ? 280 LYS A CD   1 
ATOM   1255 C  CE   . LYS A 1 154 ? 39.468  11.899  17.354  1.00 26.25 ? 280 LYS A CE   1 
ATOM   1256 N  NZ   . LYS A 1 154 ? 40.785  11.801  18.064  1.00 27.28 ? 280 LYS A NZ   1 
ATOM   1257 N  N    . PRO A 1 155 ? 33.576  12.451  16.000  1.00 14.74 ? 281 PRO A N    1 
ATOM   1258 C  CA   . PRO A 1 155 ? 34.072  11.224  15.370  1.00 14.62 ? 281 PRO A CA   1 
ATOM   1259 C  C    . PRO A 1 155 ? 34.039  11.223  13.847  1.00 14.65 ? 281 PRO A C    1 
ATOM   1260 O  O    . PRO A 1 155 ? 33.141  11.804  13.225  1.00 15.23 ? 281 PRO A O    1 
ATOM   1261 C  CB   . PRO A 1 155 ? 33.129  10.149  15.924  1.00 14.69 ? 281 PRO A CB   1 
ATOM   1262 C  CG   . PRO A 1 155 ? 31.848  10.880  16.156  1.00 14.88 ? 281 PRO A CG   1 
ATOM   1263 C  CD   . PRO A 1 155 ? 32.237  12.253  16.592  1.00 13.94 ? 281 PRO A CD   1 
ATOM   1264 N  N    . ALA A 1 156 ? 35.013  10.554  13.244  1.00 14.32 ? 282 ALA A N    1 
ATOM   1265 C  CA   . ALA A 1 156 ? 35.033  10.363  11.806  1.00 15.03 ? 282 ALA A CA   1 
ATOM   1266 C  C    . ALA A 1 156 ? 33.714  9.804   11.267  1.00 14.14 ? 282 ALA A C    1 
ATOM   1267 O  O    . ALA A 1 156 ? 33.304  10.142  10.159  1.00 16.78 ? 282 ALA A O    1 
ATOM   1268 C  CB   . ALA A 1 156 ? 36.194  9.450   11.405  1.00 16.01 ? 282 ALA A CB   1 
ATOM   1269 N  N    . SER A 1 157 ? 33.045  8.942   12.031  1.00 14.83 ? 283 SER A N    1 
ATOM   1270 C  CA   . SER A 1 157 ? 31.798  8.361   11.556  1.00 15.80 ? 283 SER A CA   1 
ATOM   1271 C  C    . SER A 1 157 ? 30.715  9.413   11.326  1.00 16.62 ? 283 SER A C    1 
ATOM   1272 O  O    . SER A 1 157 ? 29.805  9.187   10.530  1.00 16.82 ? 283 SER A O    1 
ATOM   1273 C  CB   . SER A 1 157 ? 31.307  7.245   12.485  1.00 15.91 ? 283 SER A CB   1 
ATOM   1274 O  OG   . SER A 1 157 ? 31.189  7.692   13.818  1.00 16.35 ? 283 SER A OG   1 
ATOM   1275 N  N    . GLU A 1 158 ? 30.816  10.555  12.004  1.00 15.70 ? 284 GLU A N    1 
ATOM   1276 C  CA   . GLU A 1 158 ? 29.906  11.678  11.756  1.00 15.32 ? 284 GLU A CA   1 
ATOM   1277 C  C    . GLU A 1 158 ? 30.441  12.618  10.674  1.00 14.52 ? 284 GLU A C    1 
ATOM   1278 O  O    . GLU A 1 158 ? 29.695  13.058  9.787   1.00 16.22 ? 284 GLU A O    1 
ATOM   1279 C  CB   . GLU A 1 158 ? 29.663  12.462  13.041  1.00 15.54 ? 284 GLU A CB   1 
ATOM   1280 C  CG   . GLU A 1 158 ? 29.035  13.855  12.862  1.00 16.73 ? 284 GLU A CG   1 
ATOM   1281 C  CD   . GLU A 1 158 ? 27.620  13.843  12.292  1.00 19.19 ? 284 GLU A CD   1 
ATOM   1282 O  OE1  . GLU A 1 158 ? 26.974  12.770  12.209  1.00 19.77 ? 284 GLU A OE1  1 
ATOM   1283 O  OE2  . GLU A 1 158 ? 27.142  14.944  11.945  1.00 17.18 ? 284 GLU A OE2  1 
ATOM   1284 N  N    . PHE A 1 159 ? 31.736  12.935  10.741  1.00 13.99 ? 285 PHE A N    1 
ATOM   1285 C  CA   . PHE A 1 159 ? 32.277  14.054  9.970   1.00 13.31 ? 285 PHE A CA   1 
ATOM   1286 C  C    . PHE A 1 159 ? 32.950  13.689  8.647   1.00 13.79 ? 285 PHE A C    1 
ATOM   1287 O  O    . PHE A 1 159 ? 33.176  14.578  7.833   1.00 14.91 ? 285 PHE A O    1 
ATOM   1288 C  CB   . PHE A 1 159 ? 33.226  14.870  10.840  1.00 12.69 ? 285 PHE A CB   1 
ATOM   1289 C  CG   . PHE A 1 159 ? 32.533  15.562  11.996  1.00 13.49 ? 285 PHE A CG   1 
ATOM   1290 C  CD1  . PHE A 1 159 ? 31.767  16.711  11.774  1.00 13.03 ? 285 PHE A CD1  1 
ATOM   1291 C  CD2  . PHE A 1 159 ? 32.617  15.053  13.287  1.00 14.24 ? 285 PHE A CD2  1 
ATOM   1292 C  CE1  . PHE A 1 159 ? 31.110  17.349  12.827  1.00 13.29 ? 285 PHE A CE1  1 
ATOM   1293 C  CE2  . PHE A 1 159 ? 31.978  15.694  14.344  1.00 15.31 ? 285 PHE A CE2  1 
ATOM   1294 C  CZ   . PHE A 1 159 ? 31.200  16.843  14.096  1.00 14.37 ? 285 PHE A CZ   1 
ATOM   1295 N  N    . VAL A 1 160 ? 33.260  12.408  8.440   1.00 14.65 ? 286 VAL A N    1 
ATOM   1296 C  CA   . VAL A 1 160 ? 33.869  11.948  7.186   1.00 15.30 ? 286 VAL A CA   1 
ATOM   1297 C  C    . VAL A 1 160 ? 32.822  11.190  6.389   1.00 15.85 ? 286 VAL A C    1 
ATOM   1298 O  O    . VAL A 1 160 ? 32.291  10.159  6.861   1.00 16.16 ? 286 VAL A O    1 
ATOM   1299 C  CB   . VAL A 1 160 ? 35.091  11.037  7.448   1.00 15.39 ? 286 VAL A CB   1 
ATOM   1300 C  CG1  . VAL A 1 160 ? 35.668  10.499  6.121   1.00 15.17 ? 286 VAL A CG1  1 
ATOM   1301 C  CG2  . VAL A 1 160 ? 36.159  11.775  8.241   1.00 15.34 ? 286 VAL A CG2  1 
ATOM   1302 N  N    . LYS A 1 161 ? 32.498  11.717  5.206   1.00 17.25 ? 287 LYS A N    1 
ATOM   1303 C  CA   . LYS A 1 161 ? 31.540  11.077  4.305   1.00 18.78 ? 287 LYS A CA   1 
ATOM   1304 C  C    . LYS A 1 161 ? 32.317  10.541  3.112   1.00 19.29 ? 287 LYS A C    1 
ATOM   1305 O  O    . LYS A 1 161 ? 33.054  11.288  2.472   1.00 20.20 ? 287 LYS A O    1 
ATOM   1306 C  CB   . LYS A 1 161 ? 30.469  12.057  3.821   1.00 20.23 ? 287 LYS A CB   1 
ATOM   1307 C  CG   . LYS A 1 161 ? 29.869  12.934  4.909   1.00 24.17 ? 287 LYS A CG   1 
ATOM   1308 C  CD   . LYS A 1 161 ? 29.176  12.134  5.999   1.00 27.42 ? 287 LYS A CD   1 
ATOM   1309 C  CE   . LYS A 1 161 ? 28.288  13.033  6.865   1.00 27.13 ? 287 LYS A CE   1 
ATOM   1310 N  NZ   . LYS A 1 161 ? 27.669  12.311  7.997   1.00 27.16 ? 287 LYS A NZ   1 
ATOM   1311 N  N    . ILE A 1 162 ? 32.139  9.260   2.819   1.00 18.67 ? 288 ILE A N    1 
ATOM   1312 C  CA   . ILE A 1 162 ? 32.761  8.638   1.652   1.00 19.00 ? 288 ILE A CA   1 
ATOM   1313 C  C    . ILE A 1 162 ? 31.656  8.296   0.672   1.00 18.80 ? 288 ILE A C    1 
ATOM   1314 O  O    . ILE A 1 162 ? 30.748  7.521   1.001   1.00 19.61 ? 288 ILE A O    1 
ATOM   1315 C  CB   . ILE A 1 162 ? 33.575  7.378   2.030   1.00 19.88 ? 288 ILE A CB   1 
ATOM   1316 C  CG1  . ILE A 1 162 ? 34.627  7.706   3.104   1.00 19.30 ? 288 ILE A CG1  1 
ATOM   1317 C  CG2  . ILE A 1 162 ? 34.230  6.764   0.791   1.00 20.47 ? 288 ILE A CG2  1 
ATOM   1318 C  CD1  . ILE A 1 162 ? 35.662  8.738   2.688   1.00 21.69 ? 288 ILE A CD1  1 
ATOM   1319 N  N    . LEU A 1 163 ? 31.741  8.905   -0.508  1.00 19.36 ? 289 LEU A N    1 
ATOM   1320 C  CA   A LEU A 1 163 ? 30.772  8.698   -1.584  0.60 20.05 ? 289 LEU A CA   1 
ATOM   1321 C  CA   B LEU A 1 163 ? 30.772  8.699   -1.582  0.40 19.85 ? 289 LEU A CA   1 
ATOM   1322 C  C    . LEU A 1 163 ? 31.446  7.965   -2.739  1.00 21.16 ? 289 LEU A C    1 
ATOM   1323 O  O    . LEU A 1 163 ? 32.514  8.361   -3.192  1.00 22.12 ? 289 LEU A O    1 
ATOM   1324 C  CB   A LEU A 1 163 ? 30.248  10.044  -2.074  0.60 20.87 ? 289 LEU A CB   1 
ATOM   1325 C  CB   B LEU A 1 163 ? 30.238  10.047  -2.063  0.40 20.08 ? 289 LEU A CB   1 
ATOM   1326 C  CG   A LEU A 1 163 ? 29.565  10.938  -1.041  0.60 20.88 ? 289 LEU A CG   1 
ATOM   1327 C  CG   B LEU A 1 163 ? 29.103  10.666  -1.246  0.40 19.04 ? 289 LEU A CG   1 
ATOM   1328 C  CD1  A LEU A 1 163 ? 29.002  12.184  -1.721  0.60 20.62 ? 289 LEU A CD1  1 
ATOM   1329 C  CD1  B LEU A 1 163 ? 29.463  10.787  0.236   0.40 19.10 ? 289 LEU A CD1  1 
ATOM   1330 C  CD2  A LEU A 1 163 ? 28.477  10.188  -0.287  0.60 23.30 ? 289 LEU A CD2  1 
ATOM   1331 C  CD2  B LEU A 1 163 ? 28.740  12.016  -1.831  0.40 18.39 ? 289 LEU A CD2  1 
ATOM   1332 N  N    . ASP A 1 164 ? 30.842  6.888   -3.224  1.00 22.19 ? 290 ASP A N    1 
ATOM   1333 C  CA   . ASP A 1 164 ? 31.506  6.149   -4.312  1.00 23.57 ? 290 ASP A CA   1 
ATOM   1334 C  C    . ASP A 1 164 ? 31.387  6.842   -5.668  1.00 22.92 ? 290 ASP A C    1 
ATOM   1335 O  O    . ASP A 1 164 ? 32.221  6.602   -6.537  1.00 23.31 ? 290 ASP A O    1 
ATOM   1336 C  CB   . ASP A 1 164 ? 31.109  4.670   -4.391  1.00 25.54 ? 290 ASP A CB   1 
ATOM   1337 C  CG   . ASP A 1 164 ? 29.645  4.459   -4.615  1.00 26.24 ? 290 ASP A CG   1 
ATOM   1338 O  OD1  . ASP A 1 164 ? 28.873  5.425   -4.547  1.00 30.42 ? 290 ASP A OD1  1 
ATOM   1339 O  OD2  . ASP A 1 164 ? 29.257  3.292   -4.855  1.00 34.77 ? 290 ASP A OD2  1 
ATOM   1340 N  N    . THR A 1 165 ? 30.372  7.697   -5.840  1.00 22.00 ? 291 THR A N    1 
ATOM   1341 C  CA   . THR A 1 165 ? 30.169  8.438   -7.092  1.00 22.31 ? 291 THR A CA   1 
ATOM   1342 C  C    . THR A 1 165 ? 29.783  9.896   -6.823  1.00 20.62 ? 291 THR A C    1 
ATOM   1343 O  O    . THR A 1 165 ? 29.285  10.233  -5.750  1.00 20.10 ? 291 THR A O    1 
ATOM   1344 C  CB   . THR A 1 165 ? 29.054  7.796   -7.959  1.00 21.20 ? 291 THR A CB   1 
ATOM   1345 O  OG1  . THR A 1 165 ? 27.773  8.074   -7.385  1.00 25.23 ? 291 THR A OG1  1 
ATOM   1346 C  CG2  . THR A 1 165 ? 29.203  6.283   -8.083  1.00 23.48 ? 291 THR A CG2  1 
ATOM   1347 N  N    . PHE A 1 166 ? 30.009  10.762  -7.808  1.00 21.62 ? 292 PHE A N    1 
ATOM   1348 C  CA   . PHE A 1 166 ? 29.598  12.154  -7.689  1.00 22.41 ? 292 PHE A CA   1 
ATOM   1349 C  C    . PHE A 1 166 ? 28.081  12.304  -7.689  1.00 22.42 ? 292 PHE A C    1 
ATOM   1350 O  O    . PHE A 1 166 ? 27.557  13.265  -7.132  1.00 23.35 ? 292 PHE A O    1 
ATOM   1351 C  CB   . PHE A 1 166 ? 30.244  13.022  -8.772  1.00 22.72 ? 292 PHE A CB   1 
ATOM   1352 C  CG   . PHE A 1 166 ? 31.692  13.251  -8.543  1.00 22.06 ? 292 PHE A CG   1 
ATOM   1353 C  CD1  . PHE A 1 166 ? 32.137  14.416  -7.928  1.00 22.23 ? 292 PHE A CD1  1 
ATOM   1354 C  CD2  . PHE A 1 166 ? 32.621  12.280  -8.886  1.00 23.05 ? 292 PHE A CD2  1 
ATOM   1355 C  CE1  . PHE A 1 166 ? 33.482  14.618  -7.685  1.00 24.99 ? 292 PHE A CE1  1 
ATOM   1356 C  CE2  . PHE A 1 166 ? 33.964  12.484  -8.650  1.00 25.51 ? 292 PHE A CE2  1 
ATOM   1357 C  CZ   . PHE A 1 166 ? 34.394  13.651  -8.043  1.00 24.93 ? 292 PHE A CZ   1 
ATOM   1358 N  N    . GLU A 1 167 ? 27.380  11.331  -8.266  1.00 23.51 ? 293 GLU A N    1 
ATOM   1359 C  CA   . GLU A 1 167 ? 25.918  11.343  -8.258  1.00 24.30 ? 293 GLU A CA   1 
ATOM   1360 C  C    . GLU A 1 167 ? 25.351  11.207  -6.844  1.00 23.97 ? 293 GLU A C    1 
ATOM   1361 O  O    . GLU A 1 167 ? 24.216  11.590  -6.596  1.00 25.10 ? 293 GLU A O    1 
ATOM   1362 C  CB   . GLU A 1 167 ? 25.368  10.234  -9.163  1.00 25.23 ? 293 GLU A CB   1 
ATOM   1363 C  CG   . GLU A 1 167 ? 25.503  10.529  -10.653 1.00 28.64 ? 293 GLU A CG   1 
ATOM   1364 C  CD   . GLU A 1 167 ? 26.905  10.309  -11.222 1.00 31.35 ? 293 GLU A CD   1 
ATOM   1365 O  OE1  . GLU A 1 167 ? 27.796  9.789   -10.520 1.00 33.60 ? 293 GLU A OE1  1 
ATOM   1366 O  OE2  . GLU A 1 167 ? 27.120  10.657  -12.405 1.00 36.40 ? 293 GLU A OE2  1 
ATOM   1367 N  N    . LYS A 1 168 ? 26.131  10.664  -5.912  1.00 22.93 ? 294 LYS A N    1 
ATOM   1368 C  CA   . LYS A 1 168 ? 25.664  10.473  -4.539  1.00 22.94 ? 294 LYS A CA   1 
ATOM   1369 C  C    . LYS A 1 168 ? 25.639  11.763  -3.720  1.00 22.15 ? 294 LYS A C    1 
ATOM   1370 O  O    . LYS A 1 168 ? 25.160  11.759  -2.591  1.00 22.96 ? 294 LYS A O    1 
ATOM   1371 C  CB   . LYS A 1 168 ? 26.518  9.428   -3.813  1.00 24.33 ? 294 LYS A CB   1 
ATOM   1372 C  CG   . LYS A 1 168 ? 26.537  8.050   -4.448  1.00 27.61 ? 294 LYS A CG   1 
ATOM   1373 C  CD   . LYS A 1 168 ? 25.390  7.192   -4.000  1.00 29.79 ? 294 LYS A CD   1 
ATOM   1374 C  CE   . LYS A 1 168 ? 25.429  5.797   -4.649  1.00 31.37 ? 294 LYS A CE   1 
ATOM   1375 N  NZ   . LYS A 1 168 ? 26.314  4.832   -3.919  1.00 32.48 ? 294 LYS A NZ   1 
ATOM   1376 N  N    . LEU A 1 169 ? 26.169  12.864  -4.249  1.00 22.26 ? 295 LEU A N    1 
ATOM   1377 C  CA   . LEU A 1 169 ? 26.165  14.127  -3.493  1.00 22.59 ? 295 LEU A CA   1 
ATOM   1378 C  C    . LEU A 1 169 ? 24.738  14.509  -3.086  1.00 24.62 ? 295 LEU A C    1 
ATOM   1379 O  O    . LEU A 1 169 ? 24.496  15.030  -1.995  1.00 24.24 ? 295 LEU A O    1 
ATOM   1380 C  CB   . LEU A 1 169 ? 26.813  15.241  -4.310  1.00 22.89 ? 295 LEU A CB   1 
ATOM   1381 C  CG   . LEU A 1 169 ? 28.341  15.275  -4.259  1.00 22.02 ? 295 LEU A CG   1 
ATOM   1382 C  CD1  . LEU A 1 169 ? 28.901  16.147  -5.395  1.00 22.82 ? 295 LEU A CD1  1 
ATOM   1383 C  CD2  . LEU A 1 169 ? 28.824  15.771  -2.899  1.00 22.86 ? 295 LEU A CD2  1 
ATOM   1384 N  N    . LYS A 1 170 ? 23.796  14.155  -3.948  1.00 26.37 ? 296 LYS A N    1 
ATOM   1385 C  CA   A LYS A 1 170 ? 22.378  14.470  -3.765  0.50 27.61 ? 296 LYS A CA   1 
ATOM   1386 C  CA   B LYS A 1 170 ? 22.412  14.517  -3.741  0.50 27.18 ? 296 LYS A CA   1 
ATOM   1387 C  C    . LYS A 1 170 ? 21.810  13.786  -2.525  1.00 28.16 ? 296 LYS A C    1 
ATOM   1388 O  O    . LYS A 1 170 ? 20.843  14.258  -1.924  1.00 29.33 ? 296 LYS A O    1 
ATOM   1389 C  CB   A LYS A 1 170 ? 21.554  14.028  -4.988  0.50 27.93 ? 296 LYS A CB   1 
ATOM   1390 C  CB   B LYS A 1 170 ? 21.629  14.264  -5.033  0.50 26.91 ? 296 LYS A CB   1 
ATOM   1391 C  CG   A LYS A 1 170 ? 22.161  14.339  -6.364  0.50 28.82 ? 296 LYS A CG   1 
ATOM   1392 C  CG   B LYS A 1 170 ? 22.078  15.159  -6.222  0.50 26.98 ? 296 LYS A CG   1 
ATOM   1393 C  CD   A LYS A 1 170 ? 22.394  15.828  -6.568  0.50 30.21 ? 296 LYS A CD   1 
ATOM   1394 C  CD   B LYS A 1 170 ? 23.119  14.514  -7.188  0.50 24.28 ? 296 LYS A CD   1 
ATOM   1395 C  CE   A LYS A 1 170 ? 21.342  16.444  -7.458  0.50 29.48 ? 296 LYS A CE   1 
ATOM   1396 C  CE   B LYS A 1 170 ? 24.591  14.862  -6.863  0.50 22.81 ? 296 LYS A CE   1 
ATOM   1397 N  NZ   A LYS A 1 170 ? 21.484  16.014  -8.876  0.50 30.01 ? 296 LYS A NZ   1 
ATOM   1398 N  NZ   B LYS A 1 170 ? 25.540  14.994  -8.040  0.50 15.49 ? 296 LYS A NZ   1 
ATOM   1399 N  N    . ASP A 1 171 ? 22.403  12.662  -2.140  1.00 29.28 ? 297 ASP A N    1 
ATOM   1400 C  CA   . ASP A 1 171 ? 21.944  11.905  -0.971  1.00 30.33 ? 297 ASP A CA   1 
ATOM   1401 C  C    . ASP A 1 171 ? 22.284  12.566  0.378   1.00 29.78 ? 297 ASP A C    1 
ATOM   1402 O  O    . ASP A 1 171 ? 21.833  12.092  1.425   1.00 30.96 ? 297 ASP A O    1 
ATOM   1403 C  CB   . ASP A 1 171 ? 22.513  10.476  -1.000  1.00 31.62 ? 297 ASP A CB   1 
ATOM   1404 C  CG   . ASP A 1 171 ? 22.034  9.661   -2.205  1.00 32.80 ? 297 ASP A CG   1 
ATOM   1405 O  OD1  . ASP A 1 171 ? 21.038  10.035  -2.862  1.00 34.96 ? 297 ASP A OD1  1 
ATOM   1406 O  OD2  . ASP A 1 171 ? 22.667  8.624   -2.494  1.00 36.46 ? 297 ASP A OD2  1 
ATOM   1407 N  N    . LEU A 1 172 ? 23.076  13.642  0.362   1.00 27.21 ? 298 LEU A N    1 
ATOM   1408 C  CA   . LEU A 1 172 ? 23.474  14.334  1.594   1.00 26.29 ? 298 LEU A CA   1 
ATOM   1409 C  C    . LEU A 1 172 ? 22.534  15.464  2.018   1.00 25.24 ? 298 LEU A C    1 
ATOM   1410 O  O    . LEU A 1 172 ? 22.636  15.955  3.142   1.00 24.33 ? 298 LEU A O    1 
ATOM   1411 C  CB   . LEU A 1 172 ? 24.885  14.911  1.447   1.00 25.87 ? 298 LEU A CB   1 
ATOM   1412 C  CG   . LEU A 1 172 ? 26.000  13.889  1.265   1.00 27.23 ? 298 LEU A CG   1 
ATOM   1413 C  CD1  . LEU A 1 172 ? 27.331  14.614  1.054   1.00 28.28 ? 298 LEU A CD1  1 
ATOM   1414 C  CD2  . LEU A 1 172 ? 26.095  12.934  2.455   1.00 30.23 ? 298 LEU A CD2  1 
ATOM   1415 N  N    . PHE A 1 173 ? 21.631  15.888  1.136   1.00 24.75 ? 299 PHE A N    1 
ATOM   1416 C  CA   . PHE A 1 173 ? 20.837  17.094  1.398   1.00 24.37 ? 299 PHE A CA   1 
ATOM   1417 C  C    . PHE A 1 173 ? 19.981  16.975  2.659   1.00 24.01 ? 299 PHE A C    1 
ATOM   1418 O  O    . PHE A 1 173 ? 19.965  17.880  3.475   1.00 23.79 ? 299 PHE A O    1 
ATOM   1419 C  CB   . PHE A 1 173 ? 19.895  17.424  0.234   1.00 24.97 ? 299 PHE A CB   1 
ATOM   1420 C  CG   . PHE A 1 173 ? 20.576  17.778  -1.072  1.00 25.25 ? 299 PHE A CG   1 
ATOM   1421 C  CD1  . PHE A 1 173 ? 21.639  18.667  -1.125  1.00 25.57 ? 299 PHE A CD1  1 
ATOM   1422 C  CD2  . PHE A 1 173 ? 20.069  17.278  -2.271  1.00 26.37 ? 299 PHE A CD2  1 
ATOM   1423 C  CE1  . PHE A 1 173 ? 22.231  19.000  -2.350  1.00 24.99 ? 299 PHE A CE1  1 
ATOM   1424 C  CE2  . PHE A 1 173 ? 20.647  17.613  -3.493  1.00 26.37 ? 299 PHE A CE2  1 
ATOM   1425 C  CZ   . PHE A 1 173 ? 21.740  18.473  -3.523  1.00 27.03 ? 299 PHE A CZ   1 
ATOM   1426 N  N    . THR A 1 174 ? 19.236  15.881  2.801   1.00 24.16 ? 300 THR A N    1 
ATOM   1427 C  CA   . THR A 1 174 ? 18.360  15.726  3.965   1.00 25.07 ? 300 THR A CA   1 
ATOM   1428 C  C    . THR A 1 174 ? 19.149  15.812  5.269   1.00 24.80 ? 300 THR A C    1 
ATOM   1429 O  O    . THR A 1 174 ? 18.724  16.490  6.207   1.00 25.47 ? 300 THR A O    1 
ATOM   1430 C  CB   . THR A 1 174 ? 17.569  14.401  3.929   1.00 25.34 ? 300 THR A CB   1 
ATOM   1431 O  OG1  . THR A 1 174 ? 16.746  14.372  2.761   1.00 28.02 ? 300 THR A OG1  1 
ATOM   1432 C  CG2  . THR A 1 174 ? 16.694  14.261  5.165   1.00 26.46 ? 300 THR A CG2  1 
ATOM   1433 N  N    . GLU A 1 175 ? 20.302  15.143  5.315   1.00 24.82 ? 301 GLU A N    1 
ATOM   1434 C  CA   . GLU A 1 175 ? 21.135  15.139  6.509   1.00 25.29 ? 301 GLU A CA   1 
ATOM   1435 C  C    . GLU A 1 175 ? 21.671  16.521  6.830   1.00 24.51 ? 301 GLU A C    1 
ATOM   1436 O  O    . GLU A 1 175 ? 21.655  16.947  7.975   1.00 24.20 ? 301 GLU A O    1 
ATOM   1437 C  CB   . GLU A 1 175 ? 22.319  14.187  6.349   1.00 25.86 ? 301 GLU A CB   1 
ATOM   1438 C  CG   . GLU A 1 175 ? 23.286  14.288  7.503   1.00 29.18 ? 301 GLU A CG   1 
ATOM   1439 C  CD   . GLU A 1 175 ? 24.446  13.326  7.414   1.00 31.59 ? 301 GLU A CD   1 
ATOM   1440 O  OE1  . GLU A 1 175 ? 24.507  12.519  6.450   1.00 32.67 ? 301 GLU A OE1  1 
ATOM   1441 O  OE2  . GLU A 1 175 ? 25.294  13.392  8.332   1.00 34.03 ? 301 GLU A OE2  1 
ATOM   1442 N  N    . LEU A 1 176 ? 22.169  17.208  5.812   1.00 25.02 ? 302 LEU A N    1 
ATOM   1443 C  CA   . LEU A 1 176 ? 22.743  18.532  5.992   1.00 26.17 ? 302 LEU A CA   1 
ATOM   1444 C  C    . LEU A 1 176 ? 21.684  19.513  6.502   1.00 26.32 ? 302 LEU A C    1 
ATOM   1445 O  O    . LEU A 1 176 ? 21.946  20.306  7.416   1.00 25.89 ? 302 LEU A O    1 
ATOM   1446 C  CB   . LEU A 1 176 ? 23.361  19.007  4.670   1.00 27.44 ? 302 LEU A CB   1 
ATOM   1447 C  CG   . LEU A 1 176 ? 24.160  20.314  4.621   1.00 30.32 ? 302 LEU A CG   1 
ATOM   1448 C  CD1  . LEU A 1 176 ? 25.147  20.280  3.453   1.00 31.28 ? 302 LEU A CD1  1 
ATOM   1449 C  CD2  . LEU A 1 176 ? 23.244  21.523  4.507   1.00 33.28 ? 302 LEU A CD2  1 
ATOM   1450 N  N    . GLN A 1 177 ? 20.483  19.432  5.933   1.00 26.51 ? 303 GLN A N    1 
ATOM   1451 C  CA   . GLN A 1 177 ? 19.375  20.312  6.326   1.00 27.28 ? 303 GLN A CA   1 
ATOM   1452 C  C    . GLN A 1 177 ? 18.940  20.109  7.770   1.00 27.06 ? 303 GLN A C    1 
ATOM   1453 O  O    . GLN A 1 177 ? 18.510  21.058  8.421   1.00 27.16 ? 303 GLN A O    1 
ATOM   1454 C  CB   . GLN A 1 177 ? 18.166  20.125  5.399   1.00 27.17 ? 303 GLN A CB   1 
ATOM   1455 C  CG   . GLN A 1 177 ? 18.315  20.835  4.070   1.00 31.49 ? 303 GLN A CG   1 
ATOM   1456 C  CD   . GLN A 1 177 ? 17.291  20.404  3.044   1.00 34.25 ? 303 GLN A CD   1 
ATOM   1457 O  OE1  . GLN A 1 177 ? 17.435  19.356  2.403   1.00 38.73 ? 303 GLN A OE1  1 
ATOM   1458 N  NE2  . GLN A 1 177 ? 16.262  21.220  2.860   1.00 34.31 ? 303 GLN A NE2  1 
ATOM   1459 N  N    . LYS A 1 178 ? 19.058  18.877  8.261   1.00 26.04 ? 304 LYS A N    1 
ATOM   1460 C  CA   . LYS A 1 178 ? 18.619  18.530  9.614   1.00 26.07 ? 304 LYS A CA   1 
ATOM   1461 C  C    . LYS A 1 178 ? 19.632  18.888  10.707  1.00 24.68 ? 304 LYS A C    1 
ATOM   1462 O  O    . LYS A 1 178 ? 19.301  18.790  11.887  1.00 25.77 ? 304 LYS A O    1 
ATOM   1463 C  CB   . LYS A 1 178 ? 18.322  17.026  9.710   1.00 26.99 ? 304 LYS A CB   1 
ATOM   1464 C  CG   . LYS A 1 178 ? 17.005  16.590  9.111   1.00 29.41 ? 304 LYS A CG   1 
ATOM   1465 C  CD   . LYS A 1 178 ? 16.918  15.075  9.114   1.00 30.87 ? 304 LYS A CD   1 
ATOM   1466 C  CE   . LYS A 1 178 ? 15.620  14.572  8.532   1.00 33.58 ? 304 LYS A CE   1 
ATOM   1467 N  NZ   . LYS A 1 178 ? 15.667  13.091  8.364   1.00 35.18 ? 304 LYS A NZ   1 
ATOM   1468 N  N    . LYS A 1 179 ? 20.853  19.287  10.348  1.00 23.36 ? 305 LYS A N    1 
ATOM   1469 C  CA   . LYS A 1 179 ? 21.858  19.578  11.385  1.00 22.71 ? 305 LYS A CA   1 
ATOM   1470 C  C    . LYS A 1 179 ? 21.420  20.735  12.269  1.00 22.29 ? 305 LYS A C    1 
ATOM   1471 O  O    . LYS A 1 179 ? 20.875  21.733  11.778  1.00 21.89 ? 305 LYS A O    1 
ATOM   1472 C  CB   . LYS A 1 179 ? 23.229  19.926  10.799  1.00 22.99 ? 305 LYS A CB   1 
ATOM   1473 C  CG   . LYS A 1 179 ? 23.889  18.843  10.019  1.00 26.40 ? 305 LYS A CG   1 
ATOM   1474 C  CD   . LYS A 1 179 ? 24.212  17.598  10.824  1.00 25.50 ? 305 LYS A CD   1 
ATOM   1475 C  CE   . LYS A 1 179 ? 24.813  16.550  9.909   1.00 25.91 ? 305 LYS A CE   1 
ATOM   1476 N  NZ   . LYS A 1 179 ? 24.845  15.210  10.506  1.00 25.03 ? 305 LYS A NZ   1 
ATOM   1477 N  N    . ILE A 1 180 ? 21.641  20.581  13.573  1.00 21.12 ? 306 ILE A N    1 
ATOM   1478 C  CA   . ILE A 1 180 ? 21.421  21.653  14.540  1.00 21.08 ? 306 ILE A CA   1 
ATOM   1479 C  C    . ILE A 1 180 ? 22.733  21.790  15.299  1.00 21.18 ? 306 ILE A C    1 
ATOM   1480 O  O    . ILE A 1 180 ? 23.119  20.876  16.020  1.00 21.10 ? 306 ILE A O    1 
ATOM   1481 C  CB   . ILE A 1 180 ? 20.272  21.353  15.500  1.00 21.64 ? 306 ILE A CB   1 
ATOM   1482 C  CG1  . ILE A 1 180 ? 18.948  21.230  14.736  1.00 23.06 ? 306 ILE A CG1  1 
ATOM   1483 C  CG2  . ILE A 1 180 ? 20.163  22.454  16.557  1.00 22.97 ? 306 ILE A CG2  1 
ATOM   1484 C  CD1  . ILE A 1 180 ? 17.754  20.916  15.626  1.00 25.93 ? 306 ILE A CD1  1 
ATOM   1485 N  N    . TYR A 1 181 ? 23.417  22.914  15.105  1.00 21.12 ? 307 TYR A N    1 
ATOM   1486 C  CA   . TYR A 1 181 ? 24.768  23.102  15.640  1.00 21.73 ? 307 TYR A CA   1 
ATOM   1487 C  C    . TYR A 1 181 ? 24.726  23.550  17.083  1.00 22.31 ? 307 TYR A C    1 
ATOM   1488 O  O    . TYR A 1 181 ? 24.145  24.589  17.436  1.00 23.23 ? 307 TYR A O    1 
ATOM   1489 C  CB   . TYR A 1 181 ? 25.573  24.061  14.764  1.00 21.78 ? 307 TYR A CB   1 
ATOM   1490 C  CG   . TYR A 1 181 ? 25.833  23.444  13.413  1.00 20.71 ? 307 TYR A CG   1 
ATOM   1491 C  CD1  . TYR A 1 181 ? 24.966  23.663  12.353  1.00 22.03 ? 307 TYR A CD1  1 
ATOM   1492 C  CD2  . TYR A 1 181 ? 26.911  22.579  13.209  1.00 22.09 ? 307 TYR A CD2  1 
ATOM   1493 C  CE1  . TYR A 1 181 ? 25.177  23.063  11.114  1.00 23.25 ? 307 TYR A CE1  1 
ATOM   1494 C  CE2  . TYR A 1 181 ? 27.120  21.972  11.983  1.00 22.59 ? 307 TYR A CE2  1 
ATOM   1495 C  CZ   . TYR A 1 181 ? 26.258  22.230  10.931  1.00 22.74 ? 307 TYR A CZ   1 
ATOM   1496 O  OH   . TYR A 1 181 ? 26.439  21.640  9.697   1.00 25.15 ? 307 TYR A OH   1 
ATOM   1497 O  OXT  . TYR A 1 181 ? 25.272  22.824  17.920  1.00 22.81 ? 307 TYR A OXT  1 
ATOM   1498 N  N    . GLY B 1 2   ? 41.571  2.813   16.616  1.00 27.14 ? 128 GLY B N    1 
ATOM   1499 C  CA   . GLY B 1 2   ? 42.345  3.665   17.569  1.00 25.92 ? 128 GLY B CA   1 
ATOM   1500 C  C    . GLY B 1 2   ? 41.839  3.526   18.989  1.00 25.55 ? 128 GLY B C    1 
ATOM   1501 O  O    . GLY B 1 2   ? 40.685  3.165   19.211  1.00 25.97 ? 128 GLY B O    1 
ATOM   1502 N  N    . ASN B 1 3   ? 42.703  3.816   19.957  1.00 24.55 ? 129 ASN B N    1 
ATOM   1503 C  CA   . ASN B 1 3   ? 42.329  3.734   21.370  1.00 23.51 ? 129 ASN B CA   1 
ATOM   1504 C  C    . ASN B 1 3   ? 41.330  4.827   21.766  1.00 22.44 ? 129 ASN B C    1 
ATOM   1505 O  O    . ASN B 1 3   ? 41.434  5.975   21.319  1.00 21.71 ? 129 ASN B O    1 
ATOM   1506 C  CB   . ASN B 1 3   ? 43.566  3.834   22.262  1.00 23.77 ? 129 ASN B CB   1 
ATOM   1507 C  CG   . ASN B 1 3   ? 44.519  2.667   22.080  1.00 25.04 ? 129 ASN B CG   1 
ATOM   1508 O  OD1  . ASN B 1 3   ? 44.121  1.583   21.662  1.00 26.03 ? 129 ASN B OD1  1 
ATOM   1509 N  ND2  . ASN B 1 3   ? 45.787  2.892   22.391  1.00 26.19 ? 129 ASN B ND2  1 
ATOM   1510 N  N    . VAL B 1 4   ? 40.360  4.446   22.593  1.00 21.20 ? 130 VAL B N    1 
ATOM   1511 C  CA   . VAL B 1 4   ? 39.376  5.375   23.148  1.00 20.49 ? 130 VAL B CA   1 
ATOM   1512 C  C    . VAL B 1 4   ? 39.370  5.245   24.675  1.00 19.86 ? 130 VAL B C    1 
ATOM   1513 O  O    . VAL B 1 4   ? 39.235  4.139   25.209  1.00 20.14 ? 130 VAL B O    1 
ATOM   1514 C  CB   . VAL B 1 4   ? 37.966  5.084   22.596  1.00 19.99 ? 130 VAL B CB   1 
ATOM   1515 C  CG1  . VAL B 1 4   ? 36.936  6.079   23.167  1.00 20.28 ? 130 VAL B CG1  1 
ATOM   1516 C  CG2  . VAL B 1 4   ? 37.976  5.109   21.067  1.00 22.10 ? 130 VAL B CG2  1 
ATOM   1517 N  N    . ASP B 1 5   ? 39.540  6.375   25.362  1.00 19.04 ? 131 ASP B N    1 
ATOM   1518 C  CA   . ASP B 1 5   ? 39.420  6.445   26.819  1.00 18.52 ? 131 ASP B CA   1 
ATOM   1519 C  C    . ASP B 1 5   ? 38.068  7.118   27.078  1.00 18.54 ? 131 ASP B C    1 
ATOM   1520 O  O    . ASP B 1 5   ? 37.932  8.311   26.830  1.00 18.51 ? 131 ASP B O    1 
ATOM   1521 C  CB   . ASP B 1 5   ? 40.556  7.284   27.431  1.00 18.61 ? 131 ASP B CB   1 
ATOM   1522 C  CG   . ASP B 1 5   ? 41.896  6.519   27.563  1.00 19.28 ? 131 ASP B CG   1 
ATOM   1523 O  OD1  . ASP B 1 5   ? 41.992  5.329   27.214  1.00 20.71 ? 131 ASP B OD1  1 
ATOM   1524 O  OD2  . ASP B 1 5   ? 42.875  7.143   28.037  1.00 21.56 ? 131 ASP B OD2  1 
ATOM   1525 N  N    . LEU B 1 6   ? 37.083  6.342   27.529  1.00 18.57 ? 132 LEU B N    1 
ATOM   1526 C  CA   . LEU B 1 6   ? 35.708  6.825   27.677  1.00 18.85 ? 132 LEU B CA   1 
ATOM   1527 C  C    . LEU B 1 6   ? 35.320  6.904   29.147  1.00 18.61 ? 132 LEU B C    1 
ATOM   1528 O  O    . LEU B 1 6   ? 35.488  5.944   29.898  1.00 19.74 ? 132 LEU B O    1 
ATOM   1529 C  CB   . LEU B 1 6   ? 34.737  5.913   26.917  1.00 19.47 ? 132 LEU B CB   1 
ATOM   1530 C  CG   . LEU B 1 6   ? 33.298  6.443   26.764  1.00 19.81 ? 132 LEU B CG   1 
ATOM   1531 C  CD1  . LEU B 1 6   ? 32.701  6.077   25.409  1.00 21.65 ? 132 LEU B CD1  1 
ATOM   1532 C  CD2  . LEU B 1 6   ? 32.420  5.936   27.901  1.00 19.95 ? 132 LEU B CD2  1 
ATOM   1533 N  N    . VAL B 1 7   ? 34.811  8.061   29.557  1.00 18.42 ? 133 VAL B N    1 
ATOM   1534 C  CA   . VAL B 1 7   ? 34.311  8.246   30.905  1.00 19.37 ? 133 VAL B CA   1 
ATOM   1535 C  C    . VAL B 1 7   ? 32.796  8.399   30.873  1.00 18.94 ? 133 VAL B C    1 
ATOM   1536 O  O    . VAL B 1 7   ? 32.266  9.244   30.146  1.00 19.45 ? 133 VAL B O    1 
ATOM   1537 C  CB   . VAL B 1 7   ? 34.912  9.509   31.546  1.00 19.35 ? 133 VAL B CB   1 
ATOM   1538 C  CG1  . VAL B 1 7   ? 34.342  9.733   32.955  1.00 21.25 ? 133 VAL B CG1  1 
ATOM   1539 C  CG2  . VAL B 1 7   ? 36.444  9.398   31.586  1.00 18.33 ? 133 VAL B CG2  1 
ATOM   1540 N  N    . PHE B 1 8   ? 32.109  7.591   31.679  1.00 19.07 ? 134 PHE B N    1 
ATOM   1541 C  CA   . PHE B 1 8   ? 30.697  7.826   31.969  1.00 19.20 ? 134 PHE B CA   1 
ATOM   1542 C  C    . PHE B 1 8   ? 30.615  8.802   33.145  1.00 18.90 ? 134 PHE B C    1 
ATOM   1543 O  O    . PHE B 1 8   ? 31.195  8.560   34.205  1.00 20.11 ? 134 PHE B O    1 
ATOM   1544 C  CB   . PHE B 1 8   ? 29.973  6.545   32.379  1.00 20.01 ? 134 PHE B CB   1 
ATOM   1545 C  CG   . PHE B 1 8   ? 30.065  5.420   31.382  1.00 21.26 ? 134 PHE B CG   1 
ATOM   1546 C  CD1  . PHE B 1 8   ? 29.262  5.401   30.245  1.00 21.51 ? 134 PHE B CD1  1 
ATOM   1547 C  CD2  . PHE B 1 8   ? 30.894  4.336   31.627  1.00 20.64 ? 134 PHE B CD2  1 
ATOM   1548 C  CE1  . PHE B 1 8   ? 29.325  4.343   29.345  1.00 23.25 ? 134 PHE B CE1  1 
ATOM   1549 C  CE2  . PHE B 1 8   ? 30.961  3.268   30.724  1.00 24.50 ? 134 PHE B CE2  1 
ATOM   1550 C  CZ   . PHE B 1 8   ? 30.167  3.278   29.585  1.00 22.90 ? 134 PHE B CZ   1 
ATOM   1551 N  N    . LEU B 1 9   ? 29.868  9.889   32.959  1.00 19.30 ? 135 LEU B N    1 
ATOM   1552 C  CA   . LEU B 1 9   ? 29.650  10.885  34.013  1.00 18.73 ? 135 LEU B CA   1 
ATOM   1553 C  C    . LEU B 1 9   ? 28.153  10.909  34.253  1.00 19.20 ? 135 LEU B C    1 
ATOM   1554 O  O    . LEU B 1 9   ? 27.409  11.422  33.437  1.00 19.15 ? 135 LEU B O    1 
ATOM   1555 C  CB   . LEU B 1 9   ? 30.167  12.264  33.585  1.00 18.75 ? 135 LEU B CB   1 
ATOM   1556 C  CG   . LEU B 1 9   ? 29.990  13.424  34.573  1.00 18.31 ? 135 LEU B CG   1 
ATOM   1557 C  CD1  . LEU B 1 9   ? 30.714  13.137  35.910  1.00 20.37 ? 135 LEU B CD1  1 
ATOM   1558 C  CD2  . LEU B 1 9   ? 30.478  14.733  33.973  1.00 21.50 ? 135 LEU B CD2  1 
ATOM   1559 N  N    . PHE B 1 10  ? 27.720  10.330  35.369  1.00 19.23 ? 136 PHE B N    1 
ATOM   1560 C  CA   . PHE B 1 10  ? 26.308  10.044  35.576  1.00 19.26 ? 136 PHE B CA   1 
ATOM   1561 C  C    . PHE B 1 10  ? 25.725  10.702  36.821  1.00 19.42 ? 136 PHE B C    1 
ATOM   1562 O  O    . PHE B 1 10  ? 26.312  10.674  37.897  1.00 18.76 ? 136 PHE B O    1 
ATOM   1563 C  CB   . PHE B 1 10  ? 26.039  8.534   35.550  1.00 19.65 ? 136 PHE B CB   1 
ATOM   1564 C  CG   . PHE B 1 10  ? 26.639  7.755   36.690  1.00 19.51 ? 136 PHE B CG   1 
ATOM   1565 C  CD1  . PHE B 1 10  ? 25.860  7.362   37.769  1.00 22.22 ? 136 PHE B CD1  1 
ATOM   1566 C  CD2  . PHE B 1 10  ? 27.965  7.353   36.651  1.00 19.37 ? 136 PHE B CD2  1 
ATOM   1567 C  CE1  . PHE B 1 10  ? 26.406  6.599   38.799  1.00 19.71 ? 136 PHE B CE1  1 
ATOM   1568 C  CE2  . PHE B 1 10  ? 28.515  6.596   37.684  1.00 19.89 ? 136 PHE B CE2  1 
ATOM   1569 C  CZ   . PHE B 1 10  ? 27.743  6.226   38.750  1.00 21.26 ? 136 PHE B CZ   1 
ATOM   1570 N  N    . ASP B 1 11  ? 24.536  11.262  36.619  1.00 19.71 ? 137 ASP B N    1 
ATOM   1571 C  CA   . ASP B 1 11  ? 23.779  12.042  37.596  1.00 20.61 ? 137 ASP B CA   1 
ATOM   1572 C  C    . ASP B 1 11  ? 23.286  11.131  38.729  1.00 20.81 ? 137 ASP B C    1 
ATOM   1573 O  O    . ASP B 1 11  ? 22.757  10.047  38.476  1.00 23.17 ? 137 ASP B O    1 
ATOM   1574 C  CB   . ASP B 1 11  ? 22.594  12.634  36.805  1.00 20.59 ? 137 ASP B CB   1 
ATOM   1575 C  CG   . ASP B 1 11  ? 21.821  13.716  37.523  1.00 23.50 ? 137 ASP B CG   1 
ATOM   1576 O  OD1  . ASP B 1 11  ? 22.011  13.987  38.730  1.00 23.75 ? 137 ASP B OD1  1 
ATOM   1577 O  OD2  . ASP B 1 11  ? 20.989  14.326  36.814  1.00 23.12 ? 137 ASP B OD2  1 
ATOM   1578 N  N    . GLY B 1 12  ? 23.485  11.572  39.969  1.00 20.61 ? 138 GLY B N    1 
ATOM   1579 C  CA   . GLY B 1 12  ? 22.956  10.896  41.150  1.00 19.93 ? 138 GLY B CA   1 
ATOM   1580 C  C    . GLY B 1 12  ? 22.053  11.798  41.969  1.00 19.87 ? 138 GLY B C    1 
ATOM   1581 O  O    . GLY B 1 12  ? 21.962  11.645  43.188  1.00 19.99 ? 138 GLY B O    1 
ATOM   1582 N  N    . SER B 1 13  ? 21.368  12.732  41.317  1.00 19.86 ? 139 SER B N    1 
ATOM   1583 C  CA   . SER B 1 13  ? 20.545  13.677  42.063  1.00 19.99 ? 139 SER B CA   1 
ATOM   1584 C  C    . SER B 1 13  ? 19.307  13.056  42.716  1.00 18.85 ? 139 SER B C    1 
ATOM   1585 O  O    . SER B 1 13  ? 18.843  11.968  42.364  1.00 18.45 ? 139 SER B O    1 
ATOM   1586 C  CB   . SER B 1 13  ? 20.096  14.818  41.169  1.00 21.47 ? 139 SER B CB   1 
ATOM   1587 O  OG   . SER B 1 13  ? 19.127  14.349  40.269  1.00 25.04 ? 139 SER B OG   1 
ATOM   1588 N  N    . MET B 1 14  ? 18.775  13.813  43.668  1.00 19.17 ? 140 MET B N    1 
ATOM   1589 C  CA   . MET B 1 14  ? 17.577  13.461  44.405  1.00 19.76 ? 140 MET B CA   1 
ATOM   1590 C  C    . MET B 1 14  ? 16.347  13.270  43.510  1.00 19.35 ? 140 MET B C    1 
ATOM   1591 O  O    . MET B 1 14  ? 15.410  12.569  43.902  1.00 21.36 ? 140 MET B O    1 
ATOM   1592 C  CB   . MET B 1 14  ? 17.338  14.552  45.453  1.00 20.61 ? 140 MET B CB   1 
ATOM   1593 C  CG   . MET B 1 14  ? 16.149  14.333  46.353  1.00 22.69 ? 140 MET B CG   1 
ATOM   1594 S  SD   . MET B 1 14  ? 15.799  15.783  47.350  1.00 22.72 ? 140 MET B SD   1 
ATOM   1595 C  CE   . MET B 1 14  ? 17.295  15.825  48.338  1.00 23.06 ? 140 MET B CE   1 
ATOM   1596 N  N    . SER B 1 15  ? 16.342  13.881  42.325  1.00 19.02 ? 141 SER B N    1 
ATOM   1597 C  CA   A SER B 1 15  ? 15.181  13.757  41.442  0.30 18.48 ? 141 SER B CA   1 
ATOM   1598 C  CA   B SER B 1 15  ? 15.201  13.767  41.412  0.30 19.47 ? 141 SER B CA   1 
ATOM   1599 C  CA   C SER B 1 15  ? 15.246  13.783  41.346  0.40 19.28 ? 141 SER B CA   1 
ATOM   1600 C  C    . SER B 1 15  ? 15.066  12.369  40.803  1.00 19.45 ? 141 SER B C    1 
ATOM   1601 O  O    . SER B 1 15  ? 13.964  11.963  40.402  1.00 19.37 ? 141 SER B O    1 
ATOM   1602 C  CB   A SER B 1 15  ? 15.187  14.847  40.373  0.30 18.37 ? 141 SER B CB   1 
ATOM   1603 C  CB   B SER B 1 15  ? 15.301  14.814  40.301  0.30 19.53 ? 141 SER B CB   1 
ATOM   1604 C  CB   C SER B 1 15  ? 15.528  14.749  40.175  0.40 19.23 ? 141 SER B CB   1 
ATOM   1605 O  OG   A SER B 1 15  ? 16.345  14.765  39.575  0.30 14.69 ? 141 SER B OG   1 
ATOM   1606 O  OG   B SER B 1 15  ? 14.101  14.865  39.545  0.30 21.83 ? 141 SER B OG   1 
ATOM   1607 O  OG   C SER B 1 15  ? 14.791  14.422  39.002  0.40 20.90 ? 141 SER B OG   1 
ATOM   1608 N  N    . LEU B 1 16  ? 16.166  11.631  40.736  1.00 18.81 ? 142 LEU B N    1 
ATOM   1609 C  CA   . LEU B 1 16  ? 16.153  10.301  40.144  1.00 19.26 ? 142 LEU B CA   1 
ATOM   1610 C  C    . LEU B 1 16  ? 15.510  9.274   41.058  1.00 18.88 ? 142 LEU B C    1 
ATOM   1611 O  O    . LEU B 1 16  ? 15.873  9.165   42.220  1.00 18.57 ? 142 LEU B O    1 
ATOM   1612 C  CB   . LEU B 1 16  ? 17.577  9.843   39.832  1.00 20.02 ? 142 LEU B CB   1 
ATOM   1613 C  CG   . LEU B 1 16  ? 18.177  10.485  38.593  1.00 21.80 ? 142 LEU B CG   1 
ATOM   1614 C  CD1  . LEU B 1 16  ? 19.714  10.412  38.676  1.00 25.00 ? 142 LEU B CD1  1 
ATOM   1615 C  CD2  . LEU B 1 16  ? 17.649  9.778   37.369  1.00 23.38 ? 142 LEU B CD2  1 
ATOM   1616 N  N    . GLN B 1 17  ? 14.562  8.524   40.510  1.00 19.68 ? 143 GLN B N    1 
ATOM   1617 C  CA   . GLN B 1 17  ? 13.944  7.411   41.239  1.00 20.71 ? 143 GLN B CA   1 
ATOM   1618 C  C    . GLN B 1 17  ? 14.891  6.218   41.290  1.00 20.76 ? 143 GLN B C    1 
ATOM   1619 O  O    . GLN B 1 17  ? 15.763  6.099   40.450  1.00 20.38 ? 143 GLN B O    1 
ATOM   1620 C  CB   . GLN B 1 17  ? 12.632  7.008   40.567  1.00 21.67 ? 143 GLN B CB   1 
ATOM   1621 C  CG   . GLN B 1 17  ? 11.659  8.166   40.431  1.00 23.34 ? 143 GLN B CG   1 
ATOM   1622 C  CD   . GLN B 1 17  ? 11.431  8.864   41.757  1.00 25.63 ? 143 GLN B CD   1 
ATOM   1623 O  OE1  . GLN B 1 17  ? 10.807  8.301   42.662  1.00 26.50 ? 143 GLN B OE1  1 
ATOM   1624 N  NE2  . GLN B 1 17  ? 11.955  10.078  41.891  1.00 26.29 ? 143 GLN B NE2  1 
ATOM   1625 N  N    . PRO B 1 18  ? 14.721  5.324   42.277  1.00 20.72 ? 144 PRO B N    1 
ATOM   1626 C  CA   . PRO B 1 18  ? 15.633  4.189   42.385  1.00 21.48 ? 144 PRO B CA   1 
ATOM   1627 C  C    . PRO B 1 18  ? 15.774  3.346   41.112  1.00 21.71 ? 144 PRO B C    1 
ATOM   1628 O  O    . PRO B 1 18  ? 16.890  2.989   40.741  1.00 22.00 ? 144 PRO B O    1 
ATOM   1629 C  CB   . PRO B 1 18  ? 15.029  3.372   43.529  1.00 21.96 ? 144 PRO B CB   1 
ATOM   1630 C  CG   . PRO B 1 18  ? 14.348  4.369   44.354  1.00 22.33 ? 144 PRO B CG   1 
ATOM   1631 C  CD   . PRO B 1 18  ? 13.775  5.358   43.403  1.00 21.37 ? 144 PRO B CD   1 
ATOM   1632 N  N    . ASP B 1 19  ? 14.666  3.046   40.442  1.00 22.32 ? 145 ASP B N    1 
ATOM   1633 C  CA   . ASP B 1 19  ? 14.725  2.219   39.231  1.00 22.98 ? 145 ASP B CA   1 
ATOM   1634 C  C    . ASP B 1 19  ? 15.416  2.948   38.076  1.00 21.32 ? 145 ASP B C    1 
ATOM   1635 O  O    . ASP B 1 19  ? 16.046  2.313   37.236  1.00 21.88 ? 145 ASP B O    1 
ATOM   1636 C  CB   . ASP B 1 19  ? 13.329  1.763   38.809  1.00 23.92 ? 145 ASP B CB   1 
ATOM   1637 C  CG   . ASP B 1 19  ? 12.546  2.853   38.104  1.00 28.42 ? 145 ASP B CG   1 
ATOM   1638 O  OD1  . ASP B 1 19  ? 11.956  3.714   38.799  1.00 32.96 ? 145 ASP B OD1  1 
ATOM   1639 O  OD2  . ASP B 1 19  ? 12.532  2.852   36.846  1.00 33.57 ? 145 ASP B OD2  1 
ATOM   1640 N  N    . GLU B 1 20  ? 15.287  4.273   38.047  1.00 20.65 ? 146 GLU B N    1 
ATOM   1641 C  CA   . GLU B 1 20  ? 15.882  5.097   37.003  1.00 20.46 ? 146 GLU B CA   1 
ATOM   1642 C  C    . GLU B 1 20  ? 17.396  5.082   37.157  1.00 19.96 ? 146 GLU B C    1 
ATOM   1643 O  O    . GLU B 1 20  ? 18.126  4.884   36.193  1.00 20.44 ? 146 GLU B O    1 
ATOM   1644 C  CB   . GLU B 1 20  ? 15.351  6.540   37.085  1.00 20.99 ? 146 GLU B CB   1 
ATOM   1645 C  CG   . GLU B 1 20  ? 13.848  6.625   36.833  1.00 21.36 ? 146 GLU B CG   1 
ATOM   1646 C  CD   . GLU B 1 20  ? 13.234  8.009   37.058  1.00 25.33 ? 146 GLU B CD   1 
ATOM   1647 O  OE1  . GLU B 1 20  ? 13.802  8.870   37.774  1.00 22.53 ? 146 GLU B OE1  1 
ATOM   1648 O  OE2  . GLU B 1 20  ? 12.136  8.229   36.511  1.00 27.87 ? 146 GLU B OE2  1 
ATOM   1649 N  N    . PHE B 1 21  ? 17.854  5.269   38.382  1.00 20.28 ? 147 PHE B N    1 
ATOM   1650 C  CA   . PHE B 1 21  ? 19.287  5.240   38.683  1.00 20.50 ? 147 PHE B CA   1 
ATOM   1651 C  C    . PHE B 1 21  ? 19.862  3.852   38.359  1.00 21.10 ? 147 PHE B C    1 
ATOM   1652 O  O    . PHE B 1 21  ? 20.975  3.732   37.829  1.00 21.52 ? 147 PHE B O    1 
ATOM   1653 C  CB   . PHE B 1 21  ? 19.505  5.635   40.149  1.00 20.84 ? 147 PHE B CB   1 
ATOM   1654 C  CG   . PHE B 1 21  ? 20.955  5.779   40.553  1.00 19.77 ? 147 PHE B CG   1 
ATOM   1655 C  CD1  . PHE B 1 21  ? 21.683  6.907   40.202  1.00 19.81 ? 147 PHE B CD1  1 
ATOM   1656 C  CD2  . PHE B 1 21  ? 21.580  4.786   41.294  1.00 22.10 ? 147 PHE B CD2  1 
ATOM   1657 C  CE1  . PHE B 1 21  ? 23.018  7.052   40.581  1.00 21.29 ? 147 PHE B CE1  1 
ATOM   1658 C  CE2  . PHE B 1 21  ? 22.916  4.920   41.693  1.00 22.18 ? 147 PHE B CE2  1 
ATOM   1659 C  CZ   . PHE B 1 21  ? 23.633  6.056   41.339  1.00 20.25 ? 147 PHE B CZ   1 
ATOM   1660 N  N    . GLN B 1 22  ? 19.095  2.802   38.645  1.00 21.70 ? 148 GLN B N    1 
ATOM   1661 C  CA   . GLN B 1 22  ? 19.537  1.445   38.326  1.00 21.86 ? 148 GLN B CA   1 
ATOM   1662 C  C    . GLN B 1 22  ? 19.671  1.249   36.820  1.00 21.42 ? 148 GLN B C    1 
ATOM   1663 O  O    . GLN B 1 22  ? 20.594  0.575   36.363  1.00 21.78 ? 148 GLN B O    1 
ATOM   1664 C  CB   . GLN B 1 22  ? 18.573  0.400   38.913  1.00 22.65 ? 148 GLN B CB   1 
ATOM   1665 C  CG   . GLN B 1 22  ? 19.040  -1.059  38.758  1.00 24.60 ? 148 GLN B CG   1 
ATOM   1666 C  CD   . GLN B 1 22  ? 20.361  -1.335  39.457  1.00 25.79 ? 148 GLN B CD   1 
ATOM   1667 O  OE1  . GLN B 1 22  ? 20.545  -0.990  40.627  1.00 27.72 ? 148 GLN B OE1  1 
ATOM   1668 N  NE2  . GLN B 1 22  ? 21.294  -1.950  38.736  1.00 29.69 ? 148 GLN B NE2  1 
ATOM   1669 N  N    . LYS B 1 23  ? 18.745  1.820   36.051  1.00 20.80 ? 149 LYS B N    1 
ATOM   1670 C  CA   . LYS B 1 23  ? 18.790  1.705   34.592  1.00 21.53 ? 149 LYS B CA   1 
ATOM   1671 C  C    . LYS B 1 23  ? 20.014  2.430   34.026  1.00 20.68 ? 149 LYS B C    1 
ATOM   1672 O  O    . LYS B 1 23  ? 20.581  1.982   33.034  1.00 21.22 ? 149 LYS B O    1 
ATOM   1673 C  CB   . LYS B 1 23  ? 17.499  2.219   33.952  1.00 21.67 ? 149 LYS B CB   1 
ATOM   1674 C  CG   . LYS B 1 23  ? 16.308  1.278   34.125  1.00 23.52 ? 149 LYS B CG   1 
ATOM   1675 C  CD   . LYS B 1 23  ? 15.025  1.977   33.746  1.00 24.52 ? 149 LYS B CD   1 
ATOM   1676 C  CE   . LYS B 1 23  ? 13.833  1.030   33.730  1.00 26.36 ? 149 LYS B CE   1 
ATOM   1677 N  NZ   . LYS B 1 23  ? 13.437  0.600   35.090  1.00 28.30 ? 149 LYS B NZ   1 
ATOM   1678 N  N    . ILE B 1 24  ? 20.428  3.521   34.669  1.00 20.54 ? 150 ILE B N    1 
ATOM   1679 C  CA   . ILE B 1 24  ? 21.682  4.190   34.297  1.00 20.93 ? 150 ILE B CA   1 
ATOM   1680 C  C    . ILE B 1 24  ? 22.860  3.245   34.557  1.00 20.62 ? 150 ILE B C    1 
ATOM   1681 O  O    . ILE B 1 24  ? 23.720  3.074   33.693  1.00 21.70 ? 150 ILE B O    1 
ATOM   1682 C  CB   . ILE B 1 24  ? 21.905  5.522   35.042  1.00 20.99 ? 150 ILE B CB   1 
ATOM   1683 C  CG1  . ILE B 1 24  ? 20.850  6.553   34.632  1.00 22.20 ? 150 ILE B CG1  1 
ATOM   1684 C  CG2  . ILE B 1 24  ? 23.307  6.078   34.744  1.00 23.12 ? 150 ILE B CG2  1 
ATOM   1685 C  CD1  . ILE B 1 24  ? 20.837  7.820   35.489  1.00 23.82 ? 150 ILE B CD1  1 
ATOM   1686 N  N    . LEU B 1 25  ? 22.893  2.616   35.733  1.00 20.85 ? 151 LEU B N    1 
ATOM   1687 C  CA   . LEU B 1 25  ? 23.955  1.660   36.048  1.00 21.89 ? 151 LEU B CA   1 
ATOM   1688 C  C    . LEU B 1 25  ? 23.971  0.492   35.058  1.00 22.46 ? 151 LEU B C    1 
ATOM   1689 O  O    . LEU B 1 25  ? 25.029  0.098   34.568  1.00 23.09 ? 151 LEU B O    1 
ATOM   1690 C  CB   . LEU B 1 25  ? 23.820  1.143   37.485  1.00 22.74 ? 151 LEU B CB   1 
ATOM   1691 C  CG   . LEU B 1 25  ? 23.944  2.182   38.600  1.00 22.64 ? 151 LEU B CG   1 
ATOM   1692 C  CD1  . LEU B 1 25  ? 23.714  1.506   39.954  1.00 24.79 ? 151 LEU B CD1  1 
ATOM   1693 C  CD2  . LEU B 1 25  ? 25.285  2.891   38.573  1.00 26.82 ? 151 LEU B CD2  1 
ATOM   1694 N  N    . ASP B 1 26  ? 22.798  -0.057  34.766  1.00 22.90 ? 152 ASP B N    1 
ATOM   1695 C  CA   . ASP B 1 26  ? 22.691  -1.179  33.837  1.00 24.33 ? 152 ASP B CA   1 
ATOM   1696 C  C    . ASP B 1 26  ? 23.163  -0.788  32.438  1.00 23.21 ? 152 ASP B C    1 
ATOM   1697 O  O    . ASP B 1 26  ? 23.778  -1.597  31.743  1.00 23.42 ? 152 ASP B O    1 
ATOM   1698 C  CB   . ASP B 1 26  ? 21.248  -1.700  33.780  1.00 24.70 ? 152 ASP B CB   1 
ATOM   1699 C  CG   . ASP B 1 26  ? 20.827  -2.410  35.058  1.00 27.84 ? 152 ASP B CG   1 
ATOM   1700 O  OD1  . ASP B 1 26  ? 21.680  -2.661  35.939  1.00 30.10 ? 152 ASP B OD1  1 
ATOM   1701 O  OD2  . ASP B 1 26  ? 19.626  -2.721  35.185  1.00 31.11 ? 152 ASP B OD2  1 
ATOM   1702 N  N    . PHE B 1 27  ? 22.871  0.447   32.032  1.00 23.57 ? 153 PHE B N    1 
ATOM   1703 C  CA   . PHE B 1 27  ? 23.278  0.954   30.722  1.00 23.23 ? 153 PHE B CA   1 
ATOM   1704 C  C    . PHE B 1 27  ? 24.794  0.973   30.600  1.00 23.23 ? 153 PHE B C    1 
ATOM   1705 O  O    . PHE B 1 27  ? 25.343  0.501   29.599  1.00 23.10 ? 153 PHE B O    1 
ATOM   1706 C  CB   . PHE B 1 27  ? 22.732  2.363   30.494  1.00 23.87 ? 153 PHE B CB   1 
ATOM   1707 C  CG   . PHE B 1 27  ? 23.297  3.046   29.280  1.00 23.36 ? 153 PHE B CG   1 
ATOM   1708 C  CD1  . PHE B 1 27  ? 22.913  2.655   28.007  1.00 24.00 ? 153 PHE B CD1  1 
ATOM   1709 C  CD2  . PHE B 1 27  ? 24.205  4.090   29.412  1.00 23.14 ? 153 PHE B CD2  1 
ATOM   1710 C  CE1  . PHE B 1 27  ? 23.421  3.290   26.879  1.00 24.45 ? 153 PHE B CE1  1 
ATOM   1711 C  CE2  . PHE B 1 27  ? 24.719  4.731   28.285  1.00 23.86 ? 153 PHE B CE2  1 
ATOM   1712 C  CZ   . PHE B 1 27  ? 24.320  4.332   27.023  1.00 23.20 ? 153 PHE B CZ   1 
ATOM   1713 N  N    . MET B 1 28  ? 25.452  1.505   31.626  1.00 22.57 ? 154 MET B N    1 
ATOM   1714 C  CA   . MET B 1 28  ? 26.911  1.593   31.649  1.00 23.07 ? 154 MET B CA   1 
ATOM   1715 C  C    . MET B 1 28  ? 27.520  0.192   31.626  1.00 23.42 ? 154 MET B C    1 
ATOM   1716 O  O    . MET B 1 28  ? 28.437  -0.075  30.848  1.00 23.07 ? 154 MET B O    1 
ATOM   1717 C  CB   . MET B 1 28  ? 27.392  2.406   32.861  1.00 22.91 ? 154 MET B CB   1 
ATOM   1718 C  CG   . MET B 1 28  ? 26.954  3.874   32.831  1.00 22.31 ? 154 MET B CG   1 
ATOM   1719 S  SD   . MET B 1 28  ? 27.624  4.827   34.216  1.00 23.47 ? 154 MET B SD   1 
ATOM   1720 C  CE   . MET B 1 28  ? 26.724  4.112   35.590  1.00 22.52 ? 154 MET B CE   1 
ATOM   1721 N  N    . LYS B 1 29  ? 26.998  -0.703  32.461  1.00 24.11 ? 155 LYS B N    1 
ATOM   1722 C  CA   . LYS B 1 29  ? 27.458  -2.103  32.477  1.00 24.97 ? 155 LYS B CA   1 
ATOM   1723 C  C    . LYS B 1 29  ? 27.313  -2.765  31.112  1.00 25.39 ? 155 LYS B C    1 
ATOM   1724 O  O    . LYS B 1 29  ? 28.227  -3.446  30.635  1.00 24.40 ? 155 LYS B O    1 
ATOM   1725 C  CB   . LYS B 1 29  ? 26.673  -2.915  33.509  1.00 24.95 ? 155 LYS B CB   1 
ATOM   1726 C  CG   . LYS B 1 29  ? 27.028  -2.627  34.958  1.00 27.89 ? 155 LYS B CG   1 
ATOM   1727 C  CD   . LYS B 1 29  ? 26.087  -3.397  35.891  1.00 29.87 ? 155 LYS B CD   1 
ATOM   1728 C  CE   . LYS B 1 29  ? 26.045  -2.808  37.277  1.00 32.25 ? 155 LYS B CE   1 
ATOM   1729 N  NZ   . LYS B 1 29  ? 25.027  -3.502  38.116  1.00 34.33 ? 155 LYS B NZ   1 
ATOM   1730 N  N    . ASP B 1 30  ? 26.156  -2.574  30.483  1.00 25.00 ? 156 ASP B N    1 
ATOM   1731 C  CA   . ASP B 1 30  ? 25.883  -3.202  29.190  1.00 25.81 ? 156 ASP B CA   1 
ATOM   1732 C  C    . ASP B 1 30  ? 26.788  -2.683  28.078  1.00 25.58 ? 156 ASP B C    1 
ATOM   1733 O  O    . ASP B 1 30  ? 27.276  -3.465  27.265  1.00 25.75 ? 156 ASP B O    1 
ATOM   1734 C  CB   . ASP B 1 30  ? 24.415  -3.027  28.806  1.00 26.39 ? 156 ASP B CB   1 
ATOM   1735 C  CG   . ASP B 1 30  ? 23.500  -3.956  29.578  1.00 28.47 ? 156 ASP B CG   1 
ATOM   1736 O  OD1  . ASP B 1 30  ? 23.990  -4.976  30.108  1.00 32.95 ? 156 ASP B OD1  1 
ATOM   1737 O  OD2  . ASP B 1 30  ? 22.285  -3.675  29.646  1.00 33.21 ? 156 ASP B OD2  1 
ATOM   1738 N  N    . VAL B 1 31  ? 27.015  -1.373  28.050  1.00 24.74 ? 157 VAL B N    1 
ATOM   1739 C  CA   . VAL B 1 31  ? 27.939  -0.777  27.083  1.00 24.63 ? 157 VAL B CA   1 
ATOM   1740 C  C    . VAL B 1 31  ? 29.337  -1.385  27.222  1.00 24.40 ? 157 VAL B C    1 
ATOM   1741 O  O    . VAL B 1 31  ? 29.954  -1.801  26.236  1.00 23.78 ? 157 VAL B O    1 
ATOM   1742 C  CB   . VAL B 1 31  ? 28.029  0.746   27.262  1.00 25.11 ? 157 VAL B CB   1 
ATOM   1743 C  CG1  . VAL B 1 31  ? 29.193  1.315   26.458  1.00 24.65 ? 157 VAL B CG1  1 
ATOM   1744 C  CG2  . VAL B 1 31  ? 26.717  1.401   26.863  1.00 25.03 ? 157 VAL B CG2  1 
ATOM   1745 N  N    . MET B 1 32  ? 29.828  -1.451  28.452  1.00 23.14 ? 158 MET B N    1 
ATOM   1746 C  CA   . MET B 1 32  ? 31.152  -2.004  28.704  1.00 23.46 ? 158 MET B CA   1 
ATOM   1747 C  C    . MET B 1 32  ? 31.251  -3.480  28.347  1.00 24.14 ? 158 MET B C    1 
ATOM   1748 O  O    . MET B 1 32  ? 32.274  -3.910  27.822  1.00 23.83 ? 158 MET B O    1 
ATOM   1749 C  CB   . MET B 1 32  ? 31.553  -1.788  30.162  1.00 23.74 ? 158 MET B CB   1 
ATOM   1750 C  CG   . MET B 1 32  ? 31.875  -0.342  30.478  1.00 22.72 ? 158 MET B CG   1 
ATOM   1751 S  SD   . MET B 1 32  ? 32.612  -0.191  32.110  1.00 26.94 ? 158 MET B SD   1 
ATOM   1752 C  CE   . MET B 1 32  ? 31.133  -0.168  33.093  1.00 23.02 ? 158 MET B CE   1 
ATOM   1753 N  N    . LYS B 1 33  ? 30.200  -4.250  28.624  1.00 24.61 ? 159 LYS B N    1 
ATOM   1754 C  CA   . LYS B 1 33  ? 30.190  -5.683  28.300  1.00 25.07 ? 159 LYS B CA   1 
ATOM   1755 C  C    . LYS B 1 33  ? 30.218  -5.910  26.795  1.00 24.86 ? 159 LYS B C    1 
ATOM   1756 O  O    . LYS B 1 33  ? 30.920  -6.795  26.301  1.00 24.41 ? 159 LYS B O    1 
ATOM   1757 C  CB   . LYS B 1 33  ? 28.971  -6.388  28.902  1.00 25.67 ? 159 LYS B CB   1 
ATOM   1758 C  CG   . LYS B 1 33  ? 29.043  -6.574  30.413  1.00 27.65 ? 159 LYS B CG   1 
ATOM   1759 C  CD   . LYS B 1 33  ? 27.752  -7.159  30.972  1.00 29.04 ? 159 LYS B CD   1 
ATOM   1760 C  CE   . LYS B 1 33  ? 27.715  -7.075  32.489  1.00 30.44 ? 159 LYS B CE   1 
ATOM   1761 N  NZ   . LYS B 1 33  ? 26.394  -7.495  33.051  1.00 31.46 ? 159 LYS B NZ   1 
ATOM   1762 N  N    . LYS B 1 34  ? 29.456  -5.104  26.067  1.00 24.94 ? 160 LYS B N    1 
ATOM   1763 C  CA   . LYS B 1 34  ? 29.413  -5.199  24.610  1.00 25.20 ? 160 LYS B CA   1 
ATOM   1764 C  C    . LYS B 1 34  ? 30.736  -4.778  23.962  1.00 24.92 ? 160 LYS B C    1 
ATOM   1765 O  O    . LYS B 1 34  ? 31.033  -5.196  22.849  1.00 25.10 ? 160 LYS B O    1 
ATOM   1766 C  CB   . LYS B 1 34  ? 28.260  -4.353  24.059  1.00 25.22 ? 160 LYS B CB   1 
ATOM   1767 C  CG   . LYS B 1 34  ? 26.880  -4.877  24.448  1.00 27.44 ? 160 LYS B CG   1 
ATOM   1768 C  CD   . LYS B 1 34  ? 25.799  -3.819  24.291  1.00 28.72 ? 160 LYS B CD   1 
ATOM   1769 C  CE   . LYS B 1 34  ? 24.436  -4.328  24.758  1.00 29.55 ? 160 LYS B CE   1 
ATOM   1770 N  NZ   . LYS B 1 34  ? 23.845  -5.307  23.821  1.00 29.82 ? 160 LYS B NZ   1 
ATOM   1771 N  N    . LEU B 1 35  ? 31.526  -3.963  24.664  1.00 24.62 ? 161 LEU B N    1 
ATOM   1772 C  CA   . LEU B 1 35  ? 32.827  -3.494  24.167  1.00 24.18 ? 161 LEU B CA   1 
ATOM   1773 C  C    . LEU B 1 35  ? 34.030  -4.123  24.883  1.00 24.70 ? 161 LEU B C    1 
ATOM   1774 O  O    . LEU B 1 35  ? 35.123  -3.554  24.880  1.00 24.17 ? 161 LEU B O    1 
ATOM   1775 C  CB   . LEU B 1 35  ? 32.902  -1.966  24.285  1.00 24.01 ? 161 LEU B CB   1 
ATOM   1776 C  CG   . LEU B 1 35  ? 31.904  -1.202  23.417  1.00 24.50 ? 161 LEU B CG   1 
ATOM   1777 C  CD1  . LEU B 1 35  ? 31.928  0.282   23.737  1.00 24.69 ? 161 LEU B CD1  1 
ATOM   1778 C  CD2  . LEU B 1 35  ? 32.205  -1.431  21.944  1.00 24.89 ? 161 LEU B CD2  1 
ATOM   1779 N  N    . SER B 1 36  ? 33.845  -5.293  25.487  1.00 25.33 ? 162 SER B N    1 
ATOM   1780 C  CA   . SER B 1 36  ? 34.959  -5.989  26.143  1.00 26.43 ? 162 SER B CA   1 
ATOM   1781 C  C    . SER B 1 36  ? 36.051  -6.368  25.142  1.00 26.43 ? 162 SER B C    1 
ATOM   1782 O  O    . SER B 1 36  ? 35.756  -6.656  23.979  1.00 25.79 ? 162 SER B O    1 
ATOM   1783 C  CB   . SER B 1 36  ? 34.456  -7.244  26.860  1.00 26.62 ? 162 SER B CB   1 
ATOM   1784 O  OG   . SER B 1 36  ? 33.727  -8.070  25.970  1.00 30.39 ? 162 SER B OG   1 
ATOM   1785 N  N    . ASN B 1 37  ? 37.302  -6.358  25.604  1.00 26.92 ? 163 ASN B N    1 
ATOM   1786 C  CA   A ASN B 1 37  ? 38.454  -6.723  24.772  0.50 27.38 ? 163 ASN B CA   1 
ATOM   1787 C  CA   B ASN B 1 37  ? 38.456  -6.724  24.773  0.50 27.41 ? 163 ASN B CA   1 
ATOM   1788 C  C    . ASN B 1 37  ? 38.461  -5.980  23.430  1.00 27.17 ? 163 ASN B C    1 
ATOM   1789 O  O    . ASN B 1 37  ? 38.635  -6.580  22.365  1.00 28.13 ? 163 ASN B O    1 
ATOM   1790 C  CB   A ASN B 1 37  ? 38.498  -8.241  24.552  0.50 27.51 ? 163 ASN B CB   1 
ATOM   1791 C  CB   B ASN B 1 37  ? 38.505  -8.245  24.558  0.50 27.61 ? 163 ASN B CB   1 
ATOM   1792 C  CG   A ASN B 1 37  ? 38.583  -9.014  25.852  0.50 27.92 ? 163 ASN B CG   1 
ATOM   1793 C  CG   B ASN B 1 37  ? 39.837  -8.717  23.993  0.50 28.08 ? 163 ASN B CG   1 
ATOM   1794 O  OD1  A ASN B 1 37  ? 39.518  -8.836  26.634  0.50 28.76 ? 163 ASN B OD1  1 
ATOM   1795 O  OD1  B ASN B 1 37  ? 40.902  -8.366  24.504  0.50 29.58 ? 163 ASN B OD1  1 
ATOM   1796 N  ND2  A ASN B 1 37  ? 37.603  -9.878  26.092  0.50 28.24 ? 163 ASN B ND2  1 
ATOM   1797 N  ND2  B ASN B 1 37  ? 39.782  -9.518  22.934  0.50 28.84 ? 163 ASN B ND2  1 
ATOM   1798 N  N    . THR B 1 38  ? 38.257  -4.665  23.493  1.00 26.77 ? 164 THR B N    1 
ATOM   1799 C  CA   . THR B 1 38  ? 38.329  -3.792  22.322  1.00 25.67 ? 164 THR B CA   1 
ATOM   1800 C  C    . THR B 1 38  ? 39.378  -2.733  22.643  1.00 25.20 ? 164 THR B C    1 
ATOM   1801 O  O    . THR B 1 38  ? 40.062  -2.835  23.663  1.00 26.56 ? 164 THR B O    1 
ATOM   1802 C  CB   . THR B 1 38  ? 36.979  -3.107  22.028  1.00 26.15 ? 164 THR B CB   1 
ATOM   1803 O  OG1  . THR B 1 38  ? 36.622  -2.264  23.134  1.00 25.16 ? 164 THR B OG1  1 
ATOM   1804 C  CG2  . THR B 1 38  ? 35.880  -4.140  21.795  1.00 25.56 ? 164 THR B CG2  1 
ATOM   1805 N  N    . SER B 1 39  ? 39.492  -1.706  21.805  1.00 24.11 ? 165 SER B N    1 
ATOM   1806 C  CA   . SER B 1 39  ? 40.435  -0.612  22.059  1.00 23.74 ? 165 SER B CA   1 
ATOM   1807 C  C    . SER B 1 39  ? 39.922  0.375   23.124  1.00 22.37 ? 165 SER B C    1 
ATOM   1808 O  O    . SER B 1 39  ? 40.621  1.323   23.487  1.00 21.91 ? 165 SER B O    1 
ATOM   1809 C  CB   . SER B 1 39  ? 40.734  0.138   20.759  1.00 23.55 ? 165 SER B CB   1 
ATOM   1810 O  OG   . SER B 1 39  ? 39.642  0.951   20.368  1.00 26.74 ? 165 SER B OG   1 
ATOM   1811 N  N    . TYR B 1 40  ? 38.701  0.159   23.606  1.00 21.55 ? 166 TYR B N    1 
ATOM   1812 C  CA   . TYR B 1 40  ? 38.125  0.990   24.661  1.00 21.12 ? 166 TYR B CA   1 
ATOM   1813 C  C    . TYR B 1 40  ? 38.642  0.643   26.045  1.00 20.42 ? 166 TYR B C    1 
ATOM   1814 O  O    . TYR B 1 40  ? 38.809  -0.535  26.371  1.00 20.84 ? 166 TYR B O    1 
ATOM   1815 C  CB   . TYR B 1 40  ? 36.607  0.796   24.724  1.00 20.82 ? 166 TYR B CB   1 
ATOM   1816 C  CG   . TYR B 1 40  ? 35.792  1.500   23.666  1.00 21.22 ? 166 TYR B CG   1 
ATOM   1817 C  CD1  . TYR B 1 40  ? 35.217  2.744   23.926  1.00 22.46 ? 166 TYR B CD1  1 
ATOM   1818 C  CD2  . TYR B 1 40  ? 35.533  0.905   22.440  1.00 20.60 ? 166 TYR B CD2  1 
ATOM   1819 C  CE1  . TYR B 1 40  ? 34.448  3.388   22.972  1.00 21.38 ? 166 TYR B CE1  1 
ATOM   1820 C  CE2  . TYR B 1 40  ? 34.757  1.545   21.477  1.00 21.64 ? 166 TYR B CE2  1 
ATOM   1821 C  CZ   . TYR B 1 40  ? 34.220  2.788   21.758  1.00 22.27 ? 166 TYR B CZ   1 
ATOM   1822 O  OH   . TYR B 1 40  ? 33.445  3.444   20.826  1.00 24.87 ? 166 TYR B OH   1 
ATOM   1823 N  N    . GLN B 1 41  ? 38.881  1.679   26.851  1.00 20.01 ? 167 GLN B N    1 
ATOM   1824 C  CA   A GLN B 1 41  ? 38.978  1.521   28.299  0.70 20.33 ? 167 GLN B CA   1 
ATOM   1825 C  CA   B GLN B 1 41  ? 39.030  1.533   28.292  0.30 19.62 ? 167 GLN B CA   1 
ATOM   1826 C  C    . GLN B 1 41  ? 38.104  2.573   28.951  1.00 20.18 ? 167 GLN B C    1 
ATOM   1827 O  O    . GLN B 1 41  ? 37.860  3.640   28.371  1.00 19.93 ? 167 GLN B O    1 
ATOM   1828 C  CB   A GLN B 1 41  ? 40.423  1.582   28.800  0.70 21.77 ? 167 GLN B CB   1 
ATOM   1829 C  CB   B GLN B 1 41  ? 40.521  1.627   28.696  0.30 19.83 ? 167 GLN B CB   1 
ATOM   1830 C  CG   A GLN B 1 41  ? 41.038  2.954   28.831  0.70 22.62 ? 167 GLN B CG   1 
ATOM   1831 C  CG   B GLN B 1 41  ? 41.263  0.279   28.450  0.30 18.02 ? 167 GLN B CG   1 
ATOM   1832 C  CD   A GLN B 1 41  ? 42.482  2.935   29.308  0.70 23.72 ? 167 GLN B CD   1 
ATOM   1833 C  CD   B GLN B 1 41  ? 42.805  0.328   28.432  0.30 17.08 ? 167 GLN B CD   1 
ATOM   1834 O  OE1  A GLN B 1 41  ? 43.126  1.886   29.361  0.70 29.88 ? 167 GLN B OE1  1 
ATOM   1835 O  OE1  B GLN B 1 41  ? 43.436  1.281   28.887  0.30 16.39 ? 167 GLN B OE1  1 
ATOM   1836 N  NE2  A GLN B 1 41  ? 42.996  4.101   29.648  0.70 22.03 ? 167 GLN B NE2  1 
ATOM   1837 N  NE2  B GLN B 1 41  ? 43.410  -0.740  27.912  0.30 12.96 ? 167 GLN B NE2  1 
ATOM   1838 N  N    . PHE B 1 42  ? 37.594  2.246   30.137  1.00 19.20 ? 168 PHE B N    1 
ATOM   1839 C  CA   . PHE B 1 42  ? 36.523  3.036   30.755  1.00 20.04 ? 168 PHE B CA   1 
ATOM   1840 C  C    . PHE B 1 42  ? 36.844  3.537   32.156  1.00 20.21 ? 168 PHE B C    1 
ATOM   1841 O  O    . PHE B 1 42  ? 37.621  2.940   32.895  1.00 20.10 ? 168 PHE B O    1 
ATOM   1842 C  CB   . PHE B 1 42  ? 35.252  2.184   30.830  1.00 20.51 ? 168 PHE B CB   1 
ATOM   1843 C  CG   . PHE B 1 42  ? 34.778  1.675   29.496  1.00 22.59 ? 168 PHE B CG   1 
ATOM   1844 C  CD1  . PHE B 1 42  ? 33.953  2.451   28.691  1.00 22.85 ? 168 PHE B CD1  1 
ATOM   1845 C  CD2  . PHE B 1 42  ? 35.151  0.414   29.045  1.00 23.56 ? 168 PHE B CD2  1 
ATOM   1846 C  CE1  . PHE B 1 42  ? 33.510  1.988   27.471  1.00 24.81 ? 168 PHE B CE1  1 
ATOM   1847 C  CE2  . PHE B 1 42  ? 34.701  -0.060  27.819  1.00 22.70 ? 168 PHE B CE2  1 
ATOM   1848 C  CZ   . PHE B 1 42  ? 33.886  0.738   27.030  1.00 22.52 ? 168 PHE B CZ   1 
ATOM   1849 N  N    . ALA B 1 43  ? 36.220  4.648   32.516  1.00 20.09 ? 169 ALA B N    1 
ATOM   1850 C  CA   . ALA B 1 43  ? 36.153  5.099   33.892  1.00 19.93 ? 169 ALA B CA   1 
ATOM   1851 C  C    . ALA B 1 43  ? 34.721  5.561   34.115  1.00 20.12 ? 169 ALA B C    1 
ATOM   1852 O  O    . ALA B 1 43  ? 33.996  5.824   33.149  1.00 19.37 ? 169 ALA B O    1 
ATOM   1853 C  CB   . ALA B 1 43  ? 37.145  6.225   34.141  1.00 20.41 ? 169 ALA B CB   1 
ATOM   1854 N  N    . ALA B 1 44  ? 34.295  5.640   35.371  1.00 19.43 ? 170 ALA B N    1 
ATOM   1855 C  CA   . ALA B 1 44  ? 32.957  6.158   35.680  1.00 19.34 ? 170 ALA B CA   1 
ATOM   1856 C  C    . ALA B 1 44  ? 32.986  7.048   36.914  1.00 19.60 ? 170 ALA B C    1 
ATOM   1857 O  O    . ALA B 1 44  ? 33.652  6.735   37.912  1.00 19.75 ? 170 ALA B O    1 
ATOM   1858 C  CB   . ALA B 1 44  ? 31.960  5.034   35.863  1.00 19.66 ? 170 ALA B CB   1 
ATOM   1859 N  N    . VAL B 1 45  ? 32.242  8.145   36.827  1.00 18.79 ? 171 VAL B N    1 
ATOM   1860 C  CA   . VAL B 1 45  ? 32.178  9.177   37.849  1.00 18.75 ? 171 VAL B CA   1 
ATOM   1861 C  C    . VAL B 1 45  ? 30.717  9.493   38.112  1.00 18.91 ? 171 VAL B C    1 
ATOM   1862 O  O    . VAL B 1 45  ? 29.984  9.842   37.190  1.00 18.74 ? 171 VAL B O    1 
ATOM   1863 C  CB   . VAL B 1 45  ? 32.914  10.459  37.395  1.00 18.80 ? 171 VAL B CB   1 
ATOM   1864 C  CG1  . VAL B 1 45  ? 32.785  11.576  38.427  1.00 21.06 ? 171 VAL B CG1  1 
ATOM   1865 C  CG2  . VAL B 1 45  ? 34.401  10.153  37.133  1.00 20.15 ? 171 VAL B CG2  1 
ATOM   1866 N  N    . GLN B 1 46  ? 30.289  9.342   39.360  1.00 18.46 ? 172 GLN B N    1 
ATOM   1867 C  CA   . GLN B 1 46  ? 28.956  9.813   39.757  1.00 18.18 ? 172 GLN B CA   1 
ATOM   1868 C  C    . GLN B 1 46  ? 29.046  11.284  40.166  1.00 18.05 ? 172 GLN B C    1 
ATOM   1869 O  O    . GLN B 1 46  ? 29.978  11.674  40.883  1.00 18.87 ? 172 GLN B O    1 
ATOM   1870 C  CB   . GLN B 1 46  ? 28.391  8.989   40.926  1.00 19.40 ? 172 GLN B CB   1 
ATOM   1871 C  CG   . GLN B 1 46  ? 26.940  9.374   41.274  1.00 18.93 ? 172 GLN B CG   1 
ATOM   1872 C  CD   . GLN B 1 46  ? 26.338  8.680   42.497  1.00 20.24 ? 172 GLN B CD   1 
ATOM   1873 O  OE1  . GLN B 1 46  ? 25.186  8.975   42.864  1.00 19.37 ? 172 GLN B OE1  1 
ATOM   1874 N  NE2  . GLN B 1 46  ? 27.100  7.779   43.152  1.00 19.77 ? 172 GLN B NE2  1 
ATOM   1875 N  N    . PHE B 1 47  ? 28.074  12.099  39.749  1.00 18.43 ? 173 PHE B N    1 
ATOM   1876 C  CA   . PHE B 1 47  ? 28.029  13.485  40.208  1.00 18.41 ? 173 PHE B CA   1 
ATOM   1877 C  C    . PHE B 1 47  ? 26.653  13.830  40.737  1.00 19.22 ? 173 PHE B C    1 
ATOM   1878 O  O    . PHE B 1 47  ? 25.644  13.363  40.213  1.00 19.52 ? 173 PHE B O    1 
ATOM   1879 C  CB   . PHE B 1 47  ? 28.459  14.468  39.107  1.00 18.89 ? 173 PHE B CB   1 
ATOM   1880 C  CG   . PHE B 1 47  ? 27.430  14.718  38.039  1.00 19.29 ? 173 PHE B CG   1 
ATOM   1881 C  CD1  . PHE B 1 47  ? 26.677  15.881  38.054  1.00 20.63 ? 173 PHE B CD1  1 
ATOM   1882 C  CD2  . PHE B 1 47  ? 27.264  13.834  36.989  1.00 19.87 ? 173 PHE B CD2  1 
ATOM   1883 C  CE1  . PHE B 1 47  ? 25.744  16.143  37.048  1.00 21.54 ? 173 PHE B CE1  1 
ATOM   1884 C  CE2  . PHE B 1 47  ? 26.320  14.078  35.983  1.00 20.62 ? 173 PHE B CE2  1 
ATOM   1885 C  CZ   . PHE B 1 47  ? 25.571  15.243  36.011  1.00 21.41 ? 173 PHE B CZ   1 
ATOM   1886 N  N    . SER B 1 48  ? 26.634  14.649  41.782  1.00 19.13 ? 174 SER B N    1 
ATOM   1887 C  CA   . SER B 1 48  ? 25.396  15.181  42.317  1.00 19.60 ? 174 SER B CA   1 
ATOM   1888 C  C    . SER B 1 48  ? 25.772  16.571  42.858  1.00 19.62 ? 174 SER B C    1 
ATOM   1889 O  O    . SER B 1 48  ? 25.944  17.508  42.078  1.00 18.86 ? 174 SER B O    1 
ATOM   1890 C  CB   . SER B 1 48  ? 24.788  14.214  43.356  1.00 19.54 ? 174 SER B CB   1 
ATOM   1891 O  OG   . SER B 1 48  ? 23.487  14.624  43.771  1.00 19.14 ? 174 SER B OG   1 
ATOM   1892 N  N    . THR B 1 49  ? 25.951  16.717  44.167  1.00 20.37 ? 175 THR B N    1 
ATOM   1893 C  CA   . THR B 1 49  ? 26.591  17.923  44.683  1.00 20.41 ? 175 THR B CA   1 
ATOM   1894 C  C    . THR B 1 49  ? 28.103  17.870  44.494  1.00 22.11 ? 175 THR B C    1 
ATOM   1895 O  O    . THR B 1 49  ? 28.733  18.852  44.078  1.00 22.04 ? 175 THR B O    1 
ATOM   1896 C  CB   . THR B 1 49  ? 26.230  18.118  46.160  1.00 21.44 ? 175 THR B CB   1 
ATOM   1897 O  OG1  . THR B 1 49  ? 24.840  18.428  46.222  1.00 19.57 ? 175 THR B OG1  1 
ATOM   1898 C  CG2  . THR B 1 49  ? 27.011  19.246  46.774  1.00 20.19 ? 175 THR B CG2  1 
ATOM   1899 N  N    . SER B 1 50  ? 28.674  16.726  44.834  1.00 22.02 ? 176 SER B N    1 
ATOM   1900 C  CA   . SER B 1 50  ? 30.101  16.492  44.692  1.00 23.50 ? 176 SER B CA   1 
ATOM   1901 C  C    . SER B 1 50  ? 30.310  15.349  43.708  1.00 22.39 ? 176 SER B C    1 
ATOM   1902 O  O    . SER B 1 50  ? 29.345  14.861  43.100  1.00 22.26 ? 176 SER B O    1 
ATOM   1903 C  CB   . SER B 1 50  ? 30.726  16.219  46.062  1.00 25.21 ? 176 SER B CB   1 
ATOM   1904 O  OG   . SER B 1 50  ? 30.289  14.992  46.617  1.00 29.67 ? 176 SER B OG   1 
ATOM   1905 N  N    . TYR B 1 51  ? 31.573  14.961  43.516  1.00 21.51 ? 177 TYR B N    1 
ATOM   1906 C  CA   . TYR B 1 51  ? 31.961  14.068  42.421  1.00 20.70 ? 177 TYR B CA   1 
ATOM   1907 C  C    . TYR B 1 51  ? 32.725  12.895  42.998  1.00 20.95 ? 177 TYR B C    1 
ATOM   1908 O  O    . TYR B 1 51  ? 33.514  13.066  43.929  1.00 22.69 ? 177 TYR B O    1 
ATOM   1909 C  CB   . TYR B 1 51  ? 32.806  14.844  41.398  1.00 21.47 ? 177 TYR B CB   1 
ATOM   1910 C  CG   . TYR B 1 51  ? 32.363  16.287  41.339  1.00 21.77 ? 177 TYR B CG   1 
ATOM   1911 C  CD1  . TYR B 1 51  ? 31.097  16.606  40.879  1.00 24.06 ? 177 TYR B CD1  1 
ATOM   1912 C  CD2  . TYR B 1 51  ? 33.168  17.316  41.811  1.00 24.15 ? 177 TYR B CD2  1 
ATOM   1913 C  CE1  . TYR B 1 51  ? 30.654  17.900  40.853  1.00 24.65 ? 177 TYR B CE1  1 
ATOM   1914 C  CE2  . TYR B 1 51  ? 32.724  18.628  41.800  1.00 25.30 ? 177 TYR B CE2  1 
ATOM   1915 C  CZ   . TYR B 1 51  ? 31.462  18.908  41.315  1.00 25.48 ? 177 TYR B CZ   1 
ATOM   1916 O  OH   . TYR B 1 51  ? 30.983  20.200  41.299  1.00 28.87 ? 177 TYR B OH   1 
ATOM   1917 N  N    . LYS B 1 52  ? 32.457  11.699  42.494  1.00 20.37 ? 178 LYS B N    1 
ATOM   1918 C  CA   . LYS B 1 52  ? 33.143  10.508  42.984  1.00 19.90 ? 178 LYS B CA   1 
ATOM   1919 C  C    . LYS B 1 52  ? 33.509  9.618   41.831  1.00 21.12 ? 178 LYS B C    1 
ATOM   1920 O  O    . LYS B 1 52  ? 32.651  9.217   41.054  1.00 20.09 ? 178 LYS B O    1 
ATOM   1921 C  CB   . LYS B 1 52  ? 32.305  9.717   43.980  1.00 20.72 ? 178 LYS B CB   1 
ATOM   1922 C  CG   . LYS B 1 52  ? 33.018  8.465   44.545  1.00 21.09 ? 178 LYS B CG   1 
ATOM   1923 C  CD   . LYS B 1 52  ? 32.144  7.717   45.519  1.00 23.34 ? 178 LYS B CD   1 
ATOM   1924 C  CE   . LYS B 1 52  ? 32.848  6.533   46.149  1.00 26.87 ? 178 LYS B CE   1 
ATOM   1925 N  NZ   . LYS B 1 52  ? 33.073  5.430   45.182  1.00 28.32 ? 178 LYS B NZ   1 
ATOM   1926 N  N    . THR B 1 53  ? 34.802  9.334   41.713  1.00 21.78 ? 179 THR B N    1 
ATOM   1927 C  CA   . THR B 1 53  ? 35.272  8.363   40.737  1.00 21.99 ? 179 THR B CA   1 
ATOM   1928 C  C    . THR B 1 53  ? 34.919  6.993   41.276  1.00 22.37 ? 179 THR B C    1 
ATOM   1929 O  O    . THR B 1 53  ? 35.464  6.563   42.299  1.00 23.81 ? 179 THR B O    1 
ATOM   1930 C  CB   . THR B 1 53  ? 36.783  8.476   40.498  1.00 22.13 ? 179 THR B CB   1 
ATOM   1931 O  OG1  . THR B 1 53  ? 37.081  9.791   40.023  1.00 22.16 ? 179 THR B OG1  1 
ATOM   1932 C  CG2  . THR B 1 53  ? 37.239  7.448   39.462  1.00 22.43 ? 179 THR B CG2  1 
ATOM   1933 N  N    . GLU B 1 54  ? 33.974  6.329   40.623  1.00 20.85 ? 180 GLU B N    1 
ATOM   1934 C  CA   . GLU B 1 54  ? 33.515  5.012   41.067  1.00 21.15 ? 180 GLU B CA   1 
ATOM   1935 C  C    . GLU B 1 54  ? 34.512  3.923   40.640  1.00 21.21 ? 180 GLU B C    1 
ATOM   1936 O  O    . GLU B 1 54  ? 34.731  2.949   41.365  1.00 21.59 ? 180 GLU B O    1 
ATOM   1937 C  CB   . GLU B 1 54  ? 32.112  4.712   40.536  1.00 20.40 ? 180 GLU B CB   1 
ATOM   1938 C  CG   . GLU B 1 54  ? 31.027  5.715   40.977  1.00 21.53 ? 180 GLU B CG   1 
ATOM   1939 C  CD   . GLU B 1 54  ? 30.653  5.636   42.447  1.00 22.52 ? 180 GLU B CD   1 
ATOM   1940 O  OE1  . GLU B 1 54  ? 31.267  4.846   43.191  1.00 23.58 ? 180 GLU B OE1  1 
ATOM   1941 O  OE2  . GLU B 1 54  ? 29.738  6.398   42.863  1.00 23.00 ? 180 GLU B OE2  1 
ATOM   1942 N  N    . PHE B 1 55  ? 35.098  4.081   39.457  1.00 20.88 ? 181 PHE B N    1 
ATOM   1943 C  CA   . PHE B 1 55  ? 36.290  3.312   39.076  1.00 20.94 ? 181 PHE B CA   1 
ATOM   1944 C  C    . PHE B 1 55  ? 37.064  4.109   38.042  1.00 20.59 ? 181 PHE B C    1 
ATOM   1945 O  O    . PHE B 1 55  ? 36.494  4.911   37.324  1.00 20.36 ? 181 PHE B O    1 
ATOM   1946 C  CB   . PHE B 1 55  ? 35.953  1.894   38.571  1.00 20.73 ? 181 PHE B CB   1 
ATOM   1947 C  CG   . PHE B 1 55  ? 35.212  1.853   37.265  1.00 21.18 ? 181 PHE B CG   1 
ATOM   1948 C  CD1  . PHE B 1 55  ? 35.901  1.777   36.060  1.00 21.96 ? 181 PHE B CD1  1 
ATOM   1949 C  CD2  . PHE B 1 55  ? 33.821  1.871   37.234  1.00 21.60 ? 181 PHE B CD2  1 
ATOM   1950 C  CE1  . PHE B 1 55  ? 35.228  1.729   34.860  1.00 22.86 ? 181 PHE B CE1  1 
ATOM   1951 C  CE2  . PHE B 1 55  ? 33.139  1.820   36.030  1.00 21.60 ? 181 PHE B CE2  1 
ATOM   1952 C  CZ   . PHE B 1 55  ? 33.844  1.745   34.839  1.00 23.47 ? 181 PHE B CZ   1 
ATOM   1953 N  N    . ASP B 1 56  ? 38.374  3.904   37.993  1.00 21.18 ? 182 ASP B N    1 
ATOM   1954 C  CA   . ASP B 1 56  ? 39.201  4.604   37.028  1.00 21.67 ? 182 ASP B CA   1 
ATOM   1955 C  C    . ASP B 1 56  ? 39.699  3.656   35.933  1.00 21.29 ? 182 ASP B C    1 
ATOM   1956 O  O    . ASP B 1 56  ? 39.401  2.457   35.947  1.00 21.31 ? 182 ASP B O    1 
ATOM   1957 C  CB   . ASP B 1 56  ? 40.337  5.369   37.733  1.00 22.50 ? 182 ASP B CB   1 
ATOM   1958 C  CG   . ASP B 1 56  ? 41.334  4.471   38.438  1.00 23.28 ? 182 ASP B CG   1 
ATOM   1959 O  OD1  . ASP B 1 56  ? 41.559  3.320   38.007  1.00 24.96 ? 182 ASP B OD1  1 
ATOM   1960 O  OD2  . ASP B 1 56  ? 41.930  4.961   39.421  1.00 25.88 ? 182 ASP B OD2  1 
ATOM   1961 N  N    . PHE B 1 57  ? 40.425  4.202   34.961  1.00 20.70 ? 183 PHE B N    1 
ATOM   1962 C  CA   . PHE B 1 57  ? 40.923  3.402   33.847  1.00 20.36 ? 183 PHE B CA   1 
ATOM   1963 C  C    . PHE B 1 57  ? 41.777  2.225   34.305  1.00 20.69 ? 183 PHE B C    1 
ATOM   1964 O  O    . PHE B 1 57  ? 41.607  1.112   33.811  1.00 21.07 ? 183 PHE B O    1 
ATOM   1965 C  CB   . PHE B 1 57  ? 41.711  4.262   32.856  1.00 19.34 ? 183 PHE B CB   1 
ATOM   1966 C  CG   . PHE B 1 57  ? 40.886  5.338   32.199  1.00 20.27 ? 183 PHE B CG   1 
ATOM   1967 C  CD1  . PHE B 1 57  ? 39.829  5.002   31.372  1.00 18.82 ? 183 PHE B CD1  1 
ATOM   1968 C  CD2  . PHE B 1 57  ? 41.173  6.681   32.398  1.00 22.91 ? 183 PHE B CD2  1 
ATOM   1969 C  CE1  . PHE B 1 57  ? 39.063  5.987   30.766  1.00 20.29 ? 183 PHE B CE1  1 
ATOM   1970 C  CE2  . PHE B 1 57  ? 40.398  7.670   31.801  1.00 24.04 ? 183 PHE B CE2  1 
ATOM   1971 C  CZ   . PHE B 1 57  ? 39.362  7.322   30.983  1.00 21.70 ? 183 PHE B CZ   1 
ATOM   1972 N  N    . SER B 1 58  ? 42.685  2.466   35.247  1.00 20.99 ? 184 SER B N    1 
ATOM   1973 C  CA   . SER B 1 58  ? 43.525  1.390   35.769  1.00 21.24 ? 184 SER B CA   1 
ATOM   1974 C  C    . SER B 1 58  ? 42.681  0.276   36.411  1.00 20.78 ? 184 SER B C    1 
ATOM   1975 O  O    . SER B 1 58  ? 43.024  -0.898  36.298  1.00 21.09 ? 184 SER B O    1 
ATOM   1976 C  CB   . SER B 1 58  ? 44.580  1.936   36.740  1.00 21.85 ? 184 SER B CB   1 
ATOM   1977 O  OG   . SER B 1 58  ? 43.982  2.478   37.905  1.00 25.54 ? 184 SER B OG   1 
ATOM   1978 N  N    . ASP B 1 59  ? 41.565  0.634   37.050  1.00 20.15 ? 185 ASP B N    1 
ATOM   1979 C  CA   . ASP B 1 59  ? 40.660  -0.367  37.623  1.00 20.03 ? 185 ASP B CA   1 
ATOM   1980 C  C    . ASP B 1 59  ? 40.004  -1.198  36.544  1.00 20.42 ? 185 ASP B C    1 
ATOM   1981 O  O    . ASP B 1 59  ? 39.911  -2.419  36.671  1.00 20.21 ? 185 ASP B O    1 
ATOM   1982 C  CB   . ASP B 1 59  ? 39.554  0.274   38.464  1.00 20.22 ? 185 ASP B CB   1 
ATOM   1983 C  CG   . ASP B 1 59  ? 40.085  1.046   39.646  1.00 20.77 ? 185 ASP B CG   1 
ATOM   1984 O  OD1  . ASP B 1 59  ? 41.115  0.618   40.225  1.00 20.71 ? 185 ASP B OD1  1 
ATOM   1985 O  OD2  . ASP B 1 59  ? 39.469  2.083   39.986  1.00 22.69 ? 185 ASP B OD2  1 
ATOM   1986 N  N    . TYR B 1 60  ? 39.542  -0.537  35.480  1.00 20.93 ? 186 TYR B N    1 
ATOM   1987 C  CA   . TYR B 1 60  ? 38.930  -1.244  34.361  1.00 21.13 ? 186 TYR B CA   1 
ATOM   1988 C  C    . TYR B 1 60  ? 39.910  -2.260  33.751  1.00 21.33 ? 186 TYR B C    1 
ATOM   1989 O  O    . TYR B 1 60  ? 39.546  -3.403  33.497  1.00 21.18 ? 186 TYR B O    1 
ATOM   1990 C  CB   . TYR B 1 60  ? 38.419  -0.281  33.276  1.00 21.27 ? 186 TYR B CB   1 
ATOM   1991 C  CG   . TYR B 1 60  ? 37.898  -1.043  32.088  1.00 20.95 ? 186 TYR B CG   1 
ATOM   1992 C  CD1  . TYR B 1 60  ? 36.653  -1.657  32.131  1.00 21.76 ? 186 TYR B CD1  1 
ATOM   1993 C  CD2  . TYR B 1 60  ? 38.684  -1.226  30.948  1.00 22.40 ? 186 TYR B CD2  1 
ATOM   1994 C  CE1  . TYR B 1 60  ? 36.186  -2.399  31.065  1.00 23.80 ? 186 TYR B CE1  1 
ATOM   1995 C  CE2  . TYR B 1 60  ? 38.225  -1.970  29.877  1.00 23.79 ? 186 TYR B CE2  1 
ATOM   1996 C  CZ   . TYR B 1 60  ? 36.973  -2.553  29.940  1.00 23.74 ? 186 TYR B CZ   1 
ATOM   1997 O  OH   . TYR B 1 60  ? 36.516  -3.289  28.872  1.00 26.27 ? 186 TYR B OH   1 
ATOM   1998 N  N    . VAL B 1 61  ? 41.151  -1.839  33.535  1.00 21.35 ? 187 VAL B N    1 
ATOM   1999 C  CA   . VAL B 1 61  ? 42.169  -2.713  32.936  1.00 21.86 ? 187 VAL B CA   1 
ATOM   2000 C  C    . VAL B 1 61  ? 42.517  -3.893  33.858  1.00 21.63 ? 187 VAL B C    1 
ATOM   2001 O  O    . VAL B 1 61  ? 42.682  -5.028  33.393  1.00 22.82 ? 187 VAL B O    1 
ATOM   2002 C  CB   . VAL B 1 61  ? 43.452  -1.915  32.594  1.00 21.72 ? 187 VAL B CB   1 
ATOM   2003 C  CG1  . VAL B 1 61  ? 44.596  -2.850  32.211  1.00 22.86 ? 187 VAL B CG1  1 
ATOM   2004 C  CG2  . VAL B 1 61  ? 43.183  -0.934  31.470  1.00 24.30 ? 187 VAL B CG2  1 
ATOM   2005 N  N    . LYS B 1 62  ? 42.626  -3.620  35.157  1.00 21.61 ? 188 LYS B N    1 
ATOM   2006 C  CA   . LYS B 1 62  ? 43.006  -4.648  36.138  1.00 22.08 ? 188 LYS B CA   1 
ATOM   2007 C  C    . LYS B 1 62  ? 41.931  -5.728  36.270  1.00 22.68 ? 188 LYS B C    1 
ATOM   2008 O  O    . LYS B 1 62  ? 42.252  -6.915  36.286  1.00 22.76 ? 188 LYS B O    1 
ATOM   2009 C  CB   . LYS B 1 62  ? 43.274  -4.010  37.506  1.00 22.36 ? 188 LYS B CB   1 
ATOM   2010 C  CG   . LYS B 1 62  ? 43.769  -4.973  38.593  1.00 23.33 ? 188 LYS B CG   1 
ATOM   2011 C  CD   . LYS B 1 62  ? 44.062  -4.227  39.893  1.00 25.63 ? 188 LYS B CD   1 
ATOM   2012 C  CE   . LYS B 1 62  ? 44.595  -5.153  40.984  1.00 26.99 ? 188 LYS B CE   1 
ATOM   2013 N  NZ   . LYS B 1 62  ? 44.903  -4.433  42.265  1.00 26.59 ? 188 LYS B NZ   1 
ATOM   2014 N  N    . TRP B 1 63  ? 40.663  -5.312  36.352  1.00 23.15 ? 189 TRP B N    1 
ATOM   2015 C  CA   . TRP B 1 63  ? 39.544  -6.234  36.634  1.00 23.84 ? 189 TRP B CA   1 
ATOM   2016 C  C    . TRP B 1 63  ? 38.666  -6.624  35.430  1.00 24.68 ? 189 TRP B C    1 
ATOM   2017 O  O    . TRP B 1 63  ? 38.187  -7.758  35.370  1.00 24.71 ? 189 TRP B O    1 
ATOM   2018 C  CB   . TRP B 1 63  ? 38.666  -5.659  37.741  1.00 24.57 ? 189 TRP B CB   1 
ATOM   2019 C  CG   . TRP B 1 63  ? 39.416  -5.390  39.013  1.00 25.24 ? 189 TRP B CG   1 
ATOM   2020 C  CD1  . TRP B 1 63  ? 39.691  -4.169  39.553  1.00 26.28 ? 189 TRP B CD1  1 
ATOM   2021 C  CD2  . TRP B 1 63  ? 40.004  -6.359  39.894  1.00 25.01 ? 189 TRP B CD2  1 
ATOM   2022 N  NE1  . TRP B 1 63  ? 40.401  -4.314  40.724  1.00 26.45 ? 189 TRP B NE1  1 
ATOM   2023 C  CE2  . TRP B 1 63  ? 40.605  -5.648  40.957  1.00 25.64 ? 189 TRP B CE2  1 
ATOM   2024 C  CE3  . TRP B 1 63  ? 40.075  -7.760  39.895  1.00 25.72 ? 189 TRP B CE3  1 
ATOM   2025 C  CZ2  . TRP B 1 63  ? 41.275  -6.292  42.011  1.00 25.46 ? 189 TRP B CZ2  1 
ATOM   2026 C  CZ3  . TRP B 1 63  ? 40.737  -8.398  40.945  1.00 26.21 ? 189 TRP B CZ3  1 
ATOM   2027 C  CH2  . TRP B 1 63  ? 41.328  -7.660  41.990  1.00 24.95 ? 189 TRP B CH2  1 
ATOM   2028 N  N    . LYS B 1 64  ? 38.451  -5.699  34.492  1.00 25.09 ? 190 LYS B N    1 
ATOM   2029 C  CA   . LYS B 1 64  ? 37.651  -5.960  33.279  1.00 25.36 ? 190 LYS B CA   1 
ATOM   2030 C  C    . LYS B 1 64  ? 36.313  -6.632  33.602  1.00 25.45 ? 190 LYS B C    1 
ATOM   2031 O  O    . LYS B 1 64  ? 35.866  -7.528  32.884  1.00 25.76 ? 190 LYS B O    1 
ATOM   2032 C  CB   . LYS B 1 64  ? 38.425  -6.832  32.290  1.00 26.21 ? 190 LYS B CB   1 
ATOM   2033 C  CG   . LYS B 1 64  ? 39.797  -6.306  31.916  1.00 28.81 ? 190 LYS B CG   1 
ATOM   2034 C  CD   . LYS B 1 64  ? 40.465  -7.206  30.883  1.00 30.59 ? 190 LYS B CD   1 
ATOM   2035 C  CE   . LYS B 1 64  ? 41.997  -7.151  30.966  1.00 32.00 ? 190 LYS B CE   1 
ATOM   2036 N  NZ   . LYS B 1 64  ? 42.526  -5.776  30.722  1.00 33.24 ? 190 LYS B NZ   1 
ATOM   2037 N  N    . ASP B 1 65  ? 35.684  -6.185  34.685  1.00 25.24 ? 191 ASP B N    1 
ATOM   2038 C  CA   . ASP B 1 65  ? 34.478  -6.807  35.225  1.00 24.82 ? 191 ASP B CA   1 
ATOM   2039 C  C    . ASP B 1 65  ? 33.459  -5.705  35.545  1.00 24.82 ? 191 ASP B C    1 
ATOM   2040 O  O    . ASP B 1 65  ? 33.413  -5.219  36.672  1.00 24.23 ? 191 ASP B O    1 
ATOM   2041 C  CB   . ASP B 1 65  ? 34.854  -7.595  36.487  1.00 25.07 ? 191 ASP B CB   1 
ATOM   2042 C  CG   . ASP B 1 65  ? 33.707  -8.437  37.033  1.00 25.92 ? 191 ASP B CG   1 
ATOM   2043 O  OD1  . ASP B 1 65  ? 32.528  -8.140  36.739  1.00 25.21 ? 191 ASP B OD1  1 
ATOM   2044 O  OD2  . ASP B 1 65  ? 33.992  -9.400  37.778  1.00 27.35 ? 191 ASP B OD2  1 
ATOM   2045 N  N    . PRO B 1 66  ? 32.653  -5.291  34.543  1.00 25.38 ? 192 PRO B N    1 
ATOM   2046 C  CA   . PRO B 1 66  ? 31.704  -4.175  34.744  1.00 25.91 ? 192 PRO B CA   1 
ATOM   2047 C  C    . PRO B 1 66  ? 30.751  -4.344  35.940  1.00 25.28 ? 192 PRO B C    1 
ATOM   2048 O  O    . PRO B 1 66  ? 30.498  -3.374  36.660  1.00 25.17 ? 192 PRO B O    1 
ATOM   2049 C  CB   . PRO B 1 66  ? 30.924  -4.131  33.422  1.00 26.66 ? 192 PRO B CB   1 
ATOM   2050 C  CG   . PRO B 1 66  ? 31.845  -4.728  32.413  1.00 26.54 ? 192 PRO B CG   1 
ATOM   2051 C  CD   . PRO B 1 66  ? 32.686  -5.748  33.140  1.00 26.05 ? 192 PRO B CD   1 
ATOM   2052 N  N    . ASP B 1 67  ? 30.232  -5.555  36.154  1.00 25.42 ? 193 ASP B N    1 
ATOM   2053 C  CA   . ASP B 1 67  ? 29.350  -5.810  37.298  1.00 25.26 ? 193 ASP B CA   1 
ATOM   2054 C  C    . ASP B 1 67  ? 30.070  -5.466  38.603  1.00 24.17 ? 193 ASP B C    1 
ATOM   2055 O  O    . ASP B 1 67  ? 29.517  -4.783  39.465  1.00 24.00 ? 193 ASP B O    1 
ATOM   2056 C  CB   . ASP B 1 67  ? 28.882  -7.272  37.352  1.00 26.27 ? 193 ASP B CB   1 
ATOM   2057 C  CG   . ASP B 1 67  ? 27.832  -7.617  36.288  1.00 28.18 ? 193 ASP B CG   1 
ATOM   2058 O  OD1  . ASP B 1 67  ? 27.197  -6.712  35.721  1.00 30.65 ? 193 ASP B OD1  1 
ATOM   2059 O  OD2  . ASP B 1 67  ? 27.647  -8.826  36.025  1.00 32.82 ? 193 ASP B OD2  1 
ATOM   2060 N  N    . ALA B 1 68  ? 31.305  -5.939  38.736  1.00 23.29 ? 194 ALA B N    1 
ATOM   2061 C  CA   . ALA B 1 68  ? 32.097  -5.731  39.953  1.00 22.75 ? 194 ALA B CA   1 
ATOM   2062 C  C    . ALA B 1 68  ? 32.510  -4.267  40.116  1.00 22.86 ? 194 ALA B C    1 
ATOM   2063 O  O    . ALA B 1 68  ? 32.498  -3.733  41.226  1.00 22.38 ? 194 ALA B O    1 
ATOM   2064 C  CB   . ALA B 1 68  ? 33.331  -6.632  39.941  1.00 22.47 ? 194 ALA B CB   1 
ATOM   2065 N  N    . LEU B 1 69  ? 32.867  -3.624  39.009  1.00 22.86 ? 195 LEU B N    1 
ATOM   2066 C  CA   . LEU B 1 69  ? 33.346  -2.242  39.049  1.00 23.27 ? 195 LEU B CA   1 
ATOM   2067 C  C    . LEU B 1 69  ? 32.270  -1.240  39.485  1.00 23.64 ? 195 LEU B C    1 
ATOM   2068 O  O    . LEU B 1 69  ? 32.591  -0.188  40.052  1.00 22.93 ? 195 LEU B O    1 
ATOM   2069 C  CB   . LEU B 1 69  ? 33.918  -1.846  37.683  1.00 24.18 ? 195 LEU B CB   1 
ATOM   2070 C  CG   . LEU B 1 69  ? 35.219  -2.543  37.265  1.00 24.25 ? 195 LEU B CG   1 
ATOM   2071 C  CD1  . LEU B 1 69  ? 35.463  -2.364  35.774  1.00 25.88 ? 195 LEU B CD1  1 
ATOM   2072 C  CD2  . LEU B 1 69  ? 36.409  -2.046  38.079  1.00 27.33 ? 195 LEU B CD2  1 
ATOM   2073 N  N    . LEU B 1 70  ? 31.004  -1.577  39.242  1.00 23.31 ? 196 LEU B N    1 
ATOM   2074 C  CA   . LEU B 1 70  ? 29.888  -0.678  39.584  1.00 23.30 ? 196 LEU B CA   1 
ATOM   2075 C  C    . LEU B 1 70  ? 28.978  -1.223  40.676  1.00 23.04 ? 196 LEU B C    1 
ATOM   2076 O  O    . LEU B 1 70  ? 27.925  -0.638  40.952  1.00 23.66 ? 196 LEU B O    1 
ATOM   2077 C  CB   . LEU B 1 70  ? 29.065  -0.380  38.327  1.00 22.95 ? 196 LEU B CB   1 
ATOM   2078 C  CG   . LEU B 1 70  ? 29.730  0.594   37.347  1.00 24.64 ? 196 LEU B CG   1 
ATOM   2079 C  CD1  . LEU B 1 70  ? 28.987  0.619   36.024  1.00 26.51 ? 196 LEU B CD1  1 
ATOM   2080 C  CD2  . LEU B 1 70  ? 29.821  1.990   37.941  1.00 25.05 ? 196 LEU B CD2  1 
ATOM   2081 N  N    . LYS B 1 71  ? 29.394  -2.309  41.319  1.00 22.08 ? 197 LYS B N    1 
ATOM   2082 C  CA   . LYS B 1 71  ? 28.549  -2.994  42.290  1.00 22.81 ? 197 LYS B CA   1 
ATOM   2083 C  C    . LYS B 1 71  ? 28.233  -2.141  43.510  1.00 23.61 ? 197 LYS B C    1 
ATOM   2084 O  O    . LYS B 1 71  ? 27.155  -2.270  44.093  1.00 24.23 ? 197 LYS B O    1 
ATOM   2085 C  CB   . LYS B 1 71  ? 29.201  -4.302  42.744  1.00 22.68 ? 197 LYS B CB   1 
ATOM   2086 C  CG   . LYS B 1 71  ? 28.345  -5.112  43.701  1.00 23.12 ? 197 LYS B CG   1 
ATOM   2087 C  CD   . LYS B 1 71  ? 29.019  -6.381  44.130  1.00 23.46 ? 197 LYS B CD   1 
ATOM   2088 C  CE   . LYS B 1 71  ? 28.233  -7.050  45.249  1.00 23.86 ? 197 LYS B CE   1 
ATOM   2089 N  NZ   . LYS B 1 71  ? 28.797  -8.353  45.642  1.00 25.58 ? 197 LYS B NZ   1 
ATOM   2090 N  N    . HIS B 1 72  ? 29.172  -1.284  43.906  1.00 24.27 ? 198 HIS B N    1 
ATOM   2091 C  CA   . HIS B 1 72  ? 29.050  -0.574  45.174  1.00 25.14 ? 198 HIS B CA   1 
ATOM   2092 C  C    . HIS B 1 72  ? 28.878  0.924   44.999  1.00 25.88 ? 198 HIS B C    1 
ATOM   2093 O  O    . HIS B 1 72  ? 29.262  1.729   45.851  1.00 27.60 ? 198 HIS B O    1 
ATOM   2094 C  CB   . HIS B 1 72  ? 30.211  -0.961  46.094  1.00 26.18 ? 198 HIS B CB   1 
ATOM   2095 C  CG   . HIS B 1 72  ? 30.115  -2.376  46.572  1.00 26.39 ? 198 HIS B CG   1 
ATOM   2096 N  ND1  . HIS B 1 72  ? 29.074  -2.821  47.361  1.00 28.15 ? 198 HIS B ND1  1 
ATOM   2097 C  CD2  . HIS B 1 72  ? 30.896  -3.457  46.337  1.00 28.45 ? 198 HIS B CD2  1 
ATOM   2098 C  CE1  . HIS B 1 72  ? 29.234  -4.108  47.614  1.00 30.01 ? 198 HIS B CE1  1 
ATOM   2099 N  NE2  . HIS B 1 72  ? 30.326  -4.519  46.996  1.00 27.36 ? 198 HIS B NE2  1 
ATOM   2100 N  N    . VAL B 1 73  ? 28.233  1.291   43.899  1.00 24.20 ? 199 VAL B N    1 
ATOM   2101 C  CA   . VAL B 1 73  ? 27.792  2.658   43.714  1.00 23.27 ? 199 VAL B CA   1 
ATOM   2102 C  C    . VAL B 1 73  ? 26.624  2.903   44.661  1.00 23.12 ? 199 VAL B C    1 
ATOM   2103 O  O    . VAL B 1 73  ? 25.689  2.094   44.732  1.00 24.65 ? 199 VAL B O    1 
ATOM   2104 C  CB   . VAL B 1 73  ? 27.342  2.888   42.275  1.00 22.93 ? 199 VAL B CB   1 
ATOM   2105 C  CG1  . VAL B 1 73  ? 26.744  4.282   42.112  1.00 22.75 ? 199 VAL B CG1  1 
ATOM   2106 C  CG2  . VAL B 1 73  ? 28.518  2.669   41.318  1.00 23.43 ? 199 VAL B CG2  1 
ATOM   2107 N  N    . LYS B 1 74  ? 26.689  4.006   45.399  1.00 21.80 ? 200 LYS B N    1 
ATOM   2108 C  CA   . LYS B 1 74  ? 25.576  4.428   46.237  1.00 21.30 ? 200 LYS B CA   1 
ATOM   2109 C  C    . LYS B 1 74  ? 25.040  5.758   45.716  1.00 20.34 ? 200 LYS B C    1 
ATOM   2110 O  O    . LYS B 1 74  ? 25.780  6.747   45.580  1.00 19.81 ? 200 LYS B O    1 
ATOM   2111 C  CB   . LYS B 1 74  ? 25.983  4.554   47.700  1.00 21.52 ? 200 LYS B CB   1 
ATOM   2112 C  CG   . LYS B 1 74  ? 24.843  5.016   48.622  1.00 23.39 ? 200 LYS B CG   1 
ATOM   2113 C  CD   . LYS B 1 74  ? 25.240  4.838   50.076  1.00 26.03 ? 200 LYS B CD   1 
ATOM   2114 C  CE   . LYS B 1 74  ? 24.231  5.467   51.037  1.00 30.04 ? 200 LYS B CE   1 
ATOM   2115 N  NZ   . LYS B 1 74  ? 22.855  4.979   50.778  1.00 30.69 ? 200 LYS B NZ   1 
ATOM   2116 N  N    . HIS B 1 75  ? 23.744  5.758   45.440  1.00 19.20 ? 201 HIS B N    1 
ATOM   2117 C  CA   . HIS B 1 75  ? 23.050  6.918   44.892  1.00 19.31 ? 201 HIS B CA   1 
ATOM   2118 C  C    . HIS B 1 75  ? 23.187  8.110   45.848  1.00 18.77 ? 201 HIS B C    1 
ATOM   2119 O  O    . HIS B 1 75  ? 22.746  8.044   46.994  1.00 19.43 ? 201 HIS B O    1 
ATOM   2120 C  CB   . HIS B 1 75  ? 21.589  6.521   44.703  1.00 18.72 ? 201 HIS B CB   1 
ATOM   2121 C  CG   . HIS B 1 75  ? 20.771  7.508   43.944  1.00 19.61 ? 201 HIS B CG   1 
ATOM   2122 N  ND1  . HIS B 1 75  ? 19.442  7.283   43.659  1.00 19.63 ? 201 HIS B ND1  1 
ATOM   2123 C  CD2  . HIS B 1 75  ? 21.082  8.704   43.394  1.00 18.28 ? 201 HIS B CD2  1 
ATOM   2124 C  CE1  . HIS B 1 75  ? 18.964  8.312   42.980  1.00 18.87 ? 201 HIS B CE1  1 
ATOM   2125 N  NE2  . HIS B 1 75  ? 19.931  9.196   42.823  1.00 19.01 ? 201 HIS B NE2  1 
ATOM   2126 N  N    . MET B 1 76  ? 23.810  9.193   45.378  1.00 17.91 ? 202 MET B N    1 
ATOM   2127 C  CA   . MET B 1 76  ? 24.136  10.342  46.222  1.00 18.54 ? 202 MET B CA   1 
ATOM   2128 C  C    . MET B 1 76  ? 22.902  11.096  46.738  1.00 18.85 ? 202 MET B C    1 
ATOM   2129 O  O    . MET B 1 76  ? 22.896  11.550  47.891  1.00 19.12 ? 202 MET B O    1 
ATOM   2130 C  CB   . MET B 1 76  ? 25.059  11.312  45.488  1.00 19.67 ? 202 MET B CB   1 
ATOM   2131 C  CG   . MET B 1 76  ? 26.501  10.812  45.379  1.00 19.52 ? 202 MET B CG   1 
ATOM   2132 S  SD   . MET B 1 76  ? 27.415  11.776  44.166  1.00 21.21 ? 202 MET B SD   1 
ATOM   2133 C  CE   . MET B 1 76  ? 29.102  11.177  44.434  1.00 19.91 ? 202 MET B CE   1 
ATOM   2134 N  N    . LEU B 1 77  ? 21.893  11.237  45.877  1.00 18.66 ? 203 LEU B N    1 
ATOM   2135 C  CA   . LEU B 1 77  ? 20.591  11.858  46.214  1.00 19.04 ? 203 LEU B CA   1 
ATOM   2136 C  C    . LEU B 1 77  ? 20.679  13.347  46.628  1.00 18.37 ? 203 LEU B C    1 
ATOM   2137 O  O    . LEU B 1 77  ? 20.006  13.771  47.569  1.00 19.68 ? 203 LEU B O    1 
ATOM   2138 C  CB   . LEU B 1 77  ? 19.821  11.019  47.264  1.00 20.41 ? 203 LEU B CB   1 
ATOM   2139 C  CG   . LEU B 1 77  ? 19.275  9.675   46.764  1.00 20.77 ? 203 LEU B CG   1 
ATOM   2140 C  CD1  . LEU B 1 77  ? 19.048  8.700   47.924  1.00 23.66 ? 203 LEU B CD1  1 
ATOM   2141 C  CD2  . LEU B 1 77  ? 18.006  9.859   45.924  1.00 20.80 ? 203 LEU B CD2  1 
ATOM   2142 N  N    . LEU B 1 78  ? 21.496  14.127  45.920  1.00 18.21 ? 204 LEU B N    1 
ATOM   2143 C  CA   . LEU B 1 78  ? 21.668  15.560  46.206  1.00 18.37 ? 204 LEU B CA   1 
ATOM   2144 C  C    . LEU B 1 78  ? 21.463  16.399  44.928  1.00 18.82 ? 204 LEU B C    1 
ATOM   2145 O  O    . LEU B 1 78  ? 20.473  16.179  44.230  1.00 18.52 ? 204 LEU B O    1 
ATOM   2146 C  CB   . LEU B 1 78  ? 23.014  15.824  46.903  1.00 18.69 ? 204 LEU B CB   1 
ATOM   2147 C  CG   . LEU B 1 78  ? 23.131  15.216  48.292  1.00 18.96 ? 204 LEU B CG   1 
ATOM   2148 C  CD1  . LEU B 1 78  ? 24.583  15.331  48.806  1.00 21.43 ? 204 LEU B CD1  1 
ATOM   2149 C  CD2  . LEU B 1 78  ? 22.130  15.881  49.260  1.00 17.53 ? 204 LEU B CD2  1 
ATOM   2150 N  N    . LEU B 1 79  ? 22.378  17.325  44.603  1.00 18.61 ? 205 LEU B N    1 
ATOM   2151 C  CA   . LEU B 1 79  ? 22.171  18.276  43.497  1.00 20.03 ? 205 LEU B CA   1 
ATOM   2152 C  C    . LEU B 1 79  ? 22.569  17.689  42.114  1.00 19.73 ? 205 LEU B C    1 
ATOM   2153 O  O    . LEU B 1 79  ? 22.715  16.470  41.975  1.00 19.21 ? 205 LEU B O    1 
ATOM   2154 C  CB   . LEU B 1 79  ? 22.937  19.582  43.787  1.00 20.06 ? 205 LEU B CB   1 
ATOM   2155 C  CG   . LEU B 1 79  ? 22.492  20.359  45.025  1.00 20.21 ? 205 LEU B CG   1 
ATOM   2156 C  CD1  . LEU B 1 79  ? 23.413  21.545  45.312  1.00 21.75 ? 205 LEU B CD1  1 
ATOM   2157 C  CD2  . LEU B 1 79  ? 21.040  20.842  44.855  1.00 22.34 ? 205 LEU B CD2  1 
ATOM   2158 N  N    . THR B 1 80  ? 22.703  18.555  41.096  1.00 20.67 ? 206 THR B N    1 
ATOM   2159 C  CA   . THR B 1 80  ? 23.122  18.169  39.738  1.00 21.29 ? 206 THR B CA   1 
ATOM   2160 C  C    . THR B 1 80  ? 24.169  19.175  39.226  1.00 21.08 ? 206 THR B C    1 
ATOM   2161 O  O    . THR B 1 80  ? 23.911  19.950  38.309  1.00 19.62 ? 206 THR B O    1 
ATOM   2162 C  CB   . THR B 1 80  ? 21.896  18.165  38.783  1.00 23.58 ? 206 THR B CB   1 
ATOM   2163 O  OG1  . THR B 1 80  ? 20.850  17.381  39.365  1.00 26.86 ? 206 THR B OG1  1 
ATOM   2164 C  CG2  . THR B 1 80  ? 22.256  17.618  37.398  1.00 24.95 ? 206 THR B CG2  1 
ATOM   2165 N  N    . ASN B 1 81  ? 25.341  19.165  39.848  1.00 21.00 ? 207 ASN B N    1 
ATOM   2166 C  CA   . ASN B 1 81  ? 26.371  20.166  39.573  1.00 20.91 ? 207 ASN B CA   1 
ATOM   2167 C  C    . ASN B 1 81  ? 27.224  19.796  38.361  1.00 21.06 ? 207 ASN B C    1 
ATOM   2168 O  O    . ASN B 1 81  ? 28.397  19.395  38.481  1.00 20.31 ? 207 ASN B O    1 
ATOM   2169 C  CB   . ASN B 1 81  ? 27.237  20.389  40.815  1.00 20.47 ? 207 ASN B CB   1 
ATOM   2170 C  CG   . ASN B 1 81  ? 26.523  21.207  41.896  1.00 21.05 ? 207 ASN B CG   1 
ATOM   2171 O  OD1  . ASN B 1 81  ? 25.575  21.953  41.617  1.00 22.44 ? 207 ASN B OD1  1 
ATOM   2172 N  ND2  . ASN B 1 81  ? 26.991  21.077  43.132  1.00 21.58 ? 207 ASN B ND2  1 
ATOM   2173 N  N    . THR B 1 82  ? 26.615  19.957  37.198  1.00 20.85 ? 208 THR B N    1 
ATOM   2174 C  CA   . THR B 1 82  ? 27.166  19.483  35.929  1.00 20.30 ? 208 THR B CA   1 
ATOM   2175 C  C    . THR B 1 82  ? 28.441  20.200  35.531  1.00 20.30 ? 208 THR B C    1 
ATOM   2176 O  O    . THR B 1 82  ? 29.352  19.565  35.009  1.00 19.81 ? 208 THR B O    1 
ATOM   2177 C  CB   . THR B 1 82  ? 26.114  19.602  34.801  1.00 21.19 ? 208 THR B CB   1 
ATOM   2178 O  OG1  . THR B 1 82  ? 24.854  19.099  35.270  1.00 21.00 ? 208 THR B OG1  1 
ATOM   2179 C  CG2  . THR B 1 82  ? 26.537  18.818  33.542  1.00 19.51 ? 208 THR B CG2  1 
ATOM   2180 N  N    . PHE B 1 83  ? 28.519  21.512  35.749  1.00 19.70 ? 209 PHE B N    1 
ATOM   2181 C  CA   . PHE B 1 83  ? 29.740  22.239  35.389  1.00 19.86 ? 209 PHE B CA   1 
ATOM   2182 C  C    . PHE B 1 83  ? 30.915  21.709  36.197  1.00 19.73 ? 209 PHE B C    1 
ATOM   2183 O  O    . PHE B 1 83  ? 31.987  21.400  35.648  1.00 19.89 ? 209 PHE B O    1 
ATOM   2184 C  CB   . PHE B 1 83  ? 29.611  23.737  35.637  1.00 20.18 ? 209 PHE B CB   1 
ATOM   2185 C  CG   . PHE B 1 83  ? 28.891  24.489  34.547  1.00 19.94 ? 209 PHE B CG   1 
ATOM   2186 C  CD1  . PHE B 1 83  ? 29.557  24.878  33.382  1.00 19.67 ? 209 PHE B CD1  1 
ATOM   2187 C  CD2  . PHE B 1 83  ? 27.578  24.880  34.716  1.00 20.29 ? 209 PHE B CD2  1 
ATOM   2188 C  CE1  . PHE B 1 83  ? 28.912  25.597  32.398  1.00 19.59 ? 209 PHE B CE1  1 
ATOM   2189 C  CE2  . PHE B 1 83  ? 26.922  25.601  33.730  1.00 19.96 ? 209 PHE B CE2  1 
ATOM   2190 C  CZ   . PHE B 1 83  ? 27.585  25.956  32.569  1.00 19.61 ? 209 PHE B CZ   1 
ATOM   2191 N  N    . GLY B 1 84  ? 30.738  21.626  37.512  1.00 20.01 ? 210 GLY B N    1 
ATOM   2192 C  CA   . GLY B 1 84  ? 31.827  21.153  38.375  1.00 19.69 ? 210 GLY B CA   1 
ATOM   2193 C  C    . GLY B 1 84  ? 32.220  19.722  38.048  1.00 19.71 ? 210 GLY B C    1 
ATOM   2194 O  O    . GLY B 1 84  ? 33.398  19.364  38.121  1.00 20.04 ? 210 GLY B O    1 
ATOM   2195 N  N    . ALA B 1 85  ? 31.225  18.914  37.684  1.00 19.34 ? 211 ALA B N    1 
ATOM   2196 C  CA   . ALA B 1 85  ? 31.416  17.502  37.364  1.00 19.86 ? 211 ALA B CA   1 
ATOM   2197 C  C    . ALA B 1 85  ? 32.284  17.328  36.121  1.00 20.06 ? 211 ALA B C    1 
ATOM   2198 O  O    . ALA B 1 85  ? 33.218  16.527  36.111  1.00 19.06 ? 211 ALA B O    1 
ATOM   2199 C  CB   . ALA B 1 85  ? 30.046  16.813  37.182  1.00 19.45 ? 211 ALA B CB   1 
ATOM   2200 N  N    . ILE B 1 86  ? 31.989  18.103  35.084  1.00 19.71 ? 212 ILE B N    1 
ATOM   2201 C  CA   . ILE B 1 86  ? 32.756  18.050  33.843  1.00 19.47 ? 212 ILE B CA   1 
ATOM   2202 C  C    . ILE B 1 86  ? 34.194  18.527  34.059  1.00 19.98 ? 212 ILE B C    1 
ATOM   2203 O  O    . ILE B 1 86  ? 35.136  17.912  33.549  1.00 19.96 ? 212 ILE B O    1 
ATOM   2204 C  CB   . ILE B 1 86  ? 32.049  18.844  32.715  1.00 18.68 ? 212 ILE B CB   1 
ATOM   2205 C  CG1  . ILE B 1 86  ? 30.769  18.117  32.304  1.00 19.81 ? 212 ILE B CG1  1 
ATOM   2206 C  CG2  . ILE B 1 86  ? 32.978  19.008  31.511  1.00 20.10 ? 212 ILE B CG2  1 
ATOM   2207 C  CD1  . ILE B 1 86  ? 29.824  18.977  31.467  1.00 20.85 ? 212 ILE B CD1  1 
ATOM   2208 N  N    . ASN B 1 87  ? 34.370  19.606  34.817  1.00 20.13 ? 213 ASN B N    1 
ATOM   2209 C  CA   . ASN B 1 87  ? 35.707  20.076  35.175  1.00 20.79 ? 213 ASN B CA   1 
ATOM   2210 C  C    . ASN B 1 87  ? 36.477  19.024  35.965  1.00 20.99 ? 213 ASN B C    1 
ATOM   2211 O  O    . ASN B 1 87  ? 37.665  18.812  35.716  1.00 20.74 ? 213 ASN B O    1 
ATOM   2212 C  CB   . ASN B 1 87  ? 35.642  21.393  35.961  1.00 21.26 ? 213 ASN B CB   1 
ATOM   2213 C  CG   . ASN B 1 87  ? 35.481  22.595  35.059  1.00 22.66 ? 213 ASN B CG   1 
ATOM   2214 O  OD1  . ASN B 1 87  ? 36.461  23.113  34.522  1.00 26.54 ? 213 ASN B OD1  1 
ATOM   2215 N  ND2  . ASN B 1 87  ? 34.248  23.064  34.907  1.00 22.18 ? 213 ASN B ND2  1 
ATOM   2216 N  N    . TYR B 1 88  ? 35.795  18.352  36.892  1.00 20.43 ? 214 TYR B N    1 
ATOM   2217 C  CA   . TYR B 1 88  ? 36.408  17.263  37.661  1.00 19.87 ? 214 TYR B CA   1 
ATOM   2218 C  C    . TYR B 1 88  ? 36.931  16.145  36.760  1.00 20.45 ? 214 TYR B C    1 
ATOM   2219 O  O    . TYR B 1 88  ? 38.058  15.676  36.938  1.00 18.70 ? 214 TYR B O    1 
ATOM   2220 C  CB   . TYR B 1 88  ? 35.406  16.697  38.658  1.00 20.01 ? 214 TYR B CB   1 
ATOM   2221 C  CG   . TYR B 1 88  ? 35.890  15.486  39.447  1.00 19.35 ? 214 TYR B CG   1 
ATOM   2222 C  CD1  . TYR B 1 88  ? 36.599  15.630  40.639  1.00 21.54 ? 214 TYR B CD1  1 
ATOM   2223 C  CD2  . TYR B 1 88  ? 35.605  14.196  39.006  1.00 21.91 ? 214 TYR B CD2  1 
ATOM   2224 C  CE1  . TYR B 1 88  ? 37.030  14.505  41.356  1.00 21.59 ? 214 TYR B CE1  1 
ATOM   2225 C  CE2  . TYR B 1 88  ? 36.010  13.082  39.713  1.00 21.30 ? 214 TYR B CE2  1 
ATOM   2226 C  CZ   . TYR B 1 88  ? 36.731  13.234  40.881  1.00 22.50 ? 214 TYR B CZ   1 
ATOM   2227 O  OH   . TYR B 1 88  ? 37.118  12.113  41.569  1.00 24.48 ? 214 TYR B OH   1 
ATOM   2228 N  N    . VAL B 1 89  ? 36.117  15.710  35.802  1.00 20.14 ? 215 VAL B N    1 
ATOM   2229 C  CA   . VAL B 1 89  ? 36.548  14.654  34.886  1.00 20.82 ? 215 VAL B CA   1 
ATOM   2230 C  C    . VAL B 1 89  ? 37.799  15.090  34.127  1.00 21.15 ? 215 VAL B C    1 
ATOM   2231 O  O    . VAL B 1 89  ? 38.775  14.334  34.053  1.00 21.49 ? 215 VAL B O    1 
ATOM   2232 C  CB   . VAL B 1 89  ? 35.418  14.264  33.922  1.00 21.06 ? 215 VAL B CB   1 
ATOM   2233 C  CG1  . VAL B 1 89  ? 35.940  13.402  32.748  1.00 19.63 ? 215 VAL B CG1  1 
ATOM   2234 C  CG2  . VAL B 1 89  ? 34.310  13.539  34.701  1.00 20.44 ? 215 VAL B CG2  1 
ATOM   2235 N  N    . ALA B 1 90  ? 37.774  16.315  33.607  1.00 21.70 ? 216 ALA B N    1 
ATOM   2236 C  CA   . ALA B 1 90  ? 38.857  16.844  32.777  1.00 21.66 ? 216 ALA B CA   1 
ATOM   2237 C  C    . ALA B 1 90  ? 40.197  16.870  33.504  1.00 22.65 ? 216 ALA B C    1 
ATOM   2238 O  O    . ALA B 1 90  ? 41.230  16.556  32.907  1.00 24.22 ? 216 ALA B O    1 
ATOM   2239 C  CB   . ALA B 1 90  ? 38.501  18.251  32.265  1.00 21.59 ? 216 ALA B CB   1 
ATOM   2240 N  N    . THR B 1 91  ? 40.187  17.231  34.781  1.00 22.27 ? 217 THR B N    1 
ATOM   2241 C  CA   . THR B 1 91  ? 41.438  17.427  35.525  1.00 22.95 ? 217 THR B CA   1 
ATOM   2242 C  C    . THR B 1 91  ? 41.807  16.260  36.452  1.00 23.45 ? 217 THR B C    1 
ATOM   2243 O  O    . THR B 1 91  ? 42.997  16.044  36.730  1.00 23.94 ? 217 THR B O    1 
ATOM   2244 C  CB   . THR B 1 91  ? 41.407  18.754  36.325  1.00 23.08 ? 217 THR B CB   1 
ATOM   2245 O  OG1  . THR B 1 91  ? 40.410  18.688  37.344  1.00 25.57 ? 217 THR B OG1  1 
ATOM   2246 C  CG2  . THR B 1 91  ? 41.102  19.932  35.407  1.00 24.42 ? 217 THR B CG2  1 
ATOM   2247 N  N    . GLU B 1 92  ? 40.813  15.500  36.916  1.00 23.02 ? 218 GLU B N    1 
ATOM   2248 C  CA   . GLU B 1 92  ? 41.035  14.460  37.930  1.00 23.33 ? 218 GLU B CA   1 
ATOM   2249 C  C    . GLU B 1 92  ? 40.880  13.020  37.447  1.00 23.03 ? 218 GLU B C    1 
ATOM   2250 O  O    . GLU B 1 92  ? 41.262  12.093  38.166  1.00 23.43 ? 218 GLU B O    1 
ATOM   2251 C  CB   . GLU B 1 92  ? 40.097  14.661  39.126  1.00 23.96 ? 218 GLU B CB   1 
ATOM   2252 C  CG   . GLU B 1 92  ? 40.013  16.078  39.651  1.00 26.13 ? 218 GLU B CG   1 
ATOM   2253 C  CD   . GLU B 1 92  ? 41.356  16.642  40.048  1.00 28.99 ? 218 GLU B CD   1 
ATOM   2254 O  OE1  . GLU B 1 92  ? 42.070  15.978  40.829  1.00 29.52 ? 218 GLU B OE1  1 
ATOM   2255 O  OE2  . GLU B 1 92  ? 41.704  17.746  39.569  1.00 32.01 ? 218 GLU B OE2  1 
ATOM   2256 N  N    . VAL B 1 93  ? 40.308  12.817  36.260  1.00 21.79 ? 219 VAL B N    1 
ATOM   2257 C  CA   . VAL B 1 93  ? 40.072  11.467  35.748  1.00 21.96 ? 219 VAL B CA   1 
ATOM   2258 C  C    . VAL B 1 93  ? 40.952  11.141  34.546  1.00 22.11 ? 219 VAL B C    1 
ATOM   2259 O  O    . VAL B 1 93  ? 41.582  10.079  34.503  1.00 21.57 ? 219 VAL B O    1 
ATOM   2260 C  CB   . VAL B 1 93  ? 38.576  11.263  35.420  1.00 21.85 ? 219 VAL B CB   1 
ATOM   2261 C  CG1  . VAL B 1 93  ? 38.325  9.850   34.872  1.00 22.81 ? 219 VAL B CG1  1 
ATOM   2262 C  CG2  . VAL B 1 93  ? 37.734  11.535  36.663  1.00 23.91 ? 219 VAL B CG2  1 
ATOM   2263 N  N    . PHE B 1 94  ? 41.015  12.052  33.578  1.00 21.85 ? 220 PHE B N    1 
ATOM   2264 C  CA   . PHE B 1 94  ? 41.916  11.896  32.444  1.00 21.66 ? 220 PHE B CA   1 
ATOM   2265 C  C    . PHE B 1 94  ? 43.352  12.198  32.877  1.00 22.34 ? 220 PHE B C    1 
ATOM   2266 O  O    . PHE B 1 94  ? 43.900  13.273  32.598  1.00 22.69 ? 220 PHE B O    1 
ATOM   2267 C  CB   . PHE B 1 94  ? 41.479  12.778  31.277  1.00 21.69 ? 220 PHE B CB   1 
ATOM   2268 C  CG   . PHE B 1 94  ? 40.266  12.262  30.561  1.00 20.12 ? 220 PHE B CG   1 
ATOM   2269 C  CD1  . PHE B 1 94  ? 40.351  11.143  29.750  1.00 20.27 ? 220 PHE B CD1  1 
ATOM   2270 C  CD2  . PHE B 1 94  ? 39.041  12.890  30.686  1.00 21.29 ? 220 PHE B CD2  1 
ATOM   2271 C  CE1  . PHE B 1 94  ? 39.241  10.662  29.074  1.00 17.82 ? 220 PHE B CE1  1 
ATOM   2272 C  CE2  . PHE B 1 94  ? 37.935  12.407  30.013  1.00 20.71 ? 220 PHE B CE2  1 
ATOM   2273 C  CZ   . PHE B 1 94  ? 38.039  11.283  29.208  1.00 19.58 ? 220 PHE B CZ   1 
ATOM   2274 N  N    . ARG B 1 95  ? 43.922  11.230  33.588  1.00 22.05 ? 221 ARG B N    1 
ATOM   2275 C  CA   A ARG B 1 95  ? 45.282  11.316  34.113  0.70 22.45 ? 221 ARG B CA   1 
ATOM   2276 C  CA   B ARG B 1 95  ? 45.285  11.320  34.100  0.30 22.59 ? 221 ARG B CA   1 
ATOM   2277 C  C    . ARG B 1 95  ? 46.023  10.014  33.825  1.00 22.87 ? 221 ARG B C    1 
ATOM   2278 O  O    . ARG B 1 95  ? 45.507  8.929   34.088  1.00 22.55 ? 221 ARG B O    1 
ATOM   2279 C  CB   A ARG B 1 95  ? 45.255  11.559  35.620  0.70 22.60 ? 221 ARG B CB   1 
ATOM   2280 C  CB   B ARG B 1 95  ? 45.269  11.614  35.600  0.30 22.72 ? 221 ARG B CB   1 
ATOM   2281 C  CG   A ARG B 1 95  ? 44.630  12.882  36.047  0.70 23.07 ? 221 ARG B CG   1 
ATOM   2282 C  CG   B ARG B 1 95  ? 44.660  12.963  35.960  0.30 23.20 ? 221 ARG B CG   1 
ATOM   2283 C  CD   A ARG B 1 95  ? 44.719  13.036  37.560  0.70 24.77 ? 221 ARG B CD   1 
ATOM   2284 C  CD   B ARG B 1 95  ? 44.779  13.256  37.449  0.30 24.29 ? 221 ARG B CD   1 
ATOM   2285 N  NE   A ARG B 1 95  ? 46.108  13.189  37.996  0.70 26.85 ? 221 ARG B NE   1 
ATOM   2286 N  NE   B ARG B 1 95  ? 46.151  13.562  37.845  0.30 25.65 ? 221 ARG B NE   1 
ATOM   2287 C  CZ   A ARG B 1 95  ? 46.583  12.868  39.200  0.70 27.01 ? 221 ARG B CZ   1 
ATOM   2288 C  CZ   B ARG B 1 95  ? 46.743  14.736  37.646  0.30 26.04 ? 221 ARG B CZ   1 
ATOM   2289 N  NH1  A ARG B 1 95  ? 45.796  12.353  40.142  0.70 27.68 ? 221 ARG B NH1  1 
ATOM   2290 N  NH1  B ARG B 1 95  ? 46.087  15.718  37.044  0.30 27.56 ? 221 ARG B NH1  1 
ATOM   2291 N  NH2  A ARG B 1 95  ? 47.872  13.060  39.462  0.70 27.95 ? 221 ARG B NH2  1 
ATOM   2292 N  NH2  B ARG B 1 95  ? 47.995  14.924  38.042  0.30 26.90 ? 221 ARG B NH2  1 
ATOM   2293 N  N    . GLU B 1 96  ? 47.238  10.119  33.297  1.00 23.74 ? 222 GLU B N    1 
ATOM   2294 C  CA   . GLU B 1 96  ? 48.034  8.935   32.975  1.00 25.05 ? 222 GLU B CA   1 
ATOM   2295 C  C    . GLU B 1 96  ? 48.315  8.085   34.219  1.00 25.58 ? 222 GLU B C    1 
ATOM   2296 O  O    . GLU B 1 96  ? 48.317  6.855   34.162  1.00 25.67 ? 222 GLU B O    1 
ATOM   2297 C  CB   . GLU B 1 96  ? 49.339  9.344   32.283  1.00 26.00 ? 222 GLU B CB   1 
ATOM   2298 C  CG   . GLU B 1 96  ? 50.136  8.162   31.731  1.00 28.47 ? 222 GLU B CG   1 
ATOM   2299 C  CD   . GLU B 1 96  ? 51.280  8.574   30.818  1.00 30.73 ? 222 GLU B CD   1 
ATOM   2300 O  OE1  . GLU B 1 96  ? 51.517  9.793   30.651  1.00 32.85 ? 222 GLU B OE1  1 
ATOM   2301 O  OE2  . GLU B 1 96  ? 51.942  7.668   30.261  1.00 33.37 ? 222 GLU B OE2  1 
ATOM   2302 N  N    . GLU B 1 97  ? 48.514  8.750   35.349  1.00 26.31 ? 223 GLU B N    1 
ATOM   2303 C  CA   . GLU B 1 97  ? 48.770  8.070   36.623  1.00 27.61 ? 223 GLU B CA   1 
ATOM   2304 C  C    . GLU B 1 97  ? 47.590  7.199   37.051  1.00 26.86 ? 223 GLU B C    1 
ATOM   2305 O  O    . GLU B 1 97  ? 47.762  6.251   37.815  1.00 27.44 ? 223 GLU B O    1 
ATOM   2306 C  CB   . GLU B 1 97  ? 49.130  9.074   37.734  1.00 29.07 ? 223 GLU B CB   1 
ATOM   2307 C  CG   . GLU B 1 97  ? 48.423  10.435  37.658  1.00 32.38 ? 223 GLU B CG   1 
ATOM   2308 C  CD   . GLU B 1 97  ? 49.013  11.377  36.599  1.00 34.72 ? 223 GLU B CD   1 
ATOM   2309 O  OE1  . GLU B 1 97  ? 49.959  10.975  35.890  1.00 40.95 ? 223 GLU B OE1  1 
ATOM   2310 O  OE2  . GLU B 1 97  ? 48.528  12.518  36.464  1.00 38.60 ? 223 GLU B OE2  1 
ATOM   2311 N  N    . LEU B 1 98  ? 46.402  7.522   36.546  1.00 24.81 ? 224 LEU B N    1 
ATOM   2312 C  CA   . LEU B 1 98  ? 45.195  6.748   36.818  1.00 24.15 ? 224 LEU B CA   1 
ATOM   2313 C  C    . LEU B 1 98  ? 44.812  5.813   35.668  1.00 22.82 ? 224 LEU B C    1 
ATOM   2314 O  O    . LEU B 1 98  ? 43.708  5.287   35.651  1.00 22.21 ? 224 LEU B O    1 
ATOM   2315 C  CB   . LEU B 1 98  ? 44.040  7.695   37.128  1.00 23.97 ? 224 LEU B CB   1 
ATOM   2316 C  CG   . LEU B 1 98  ? 44.282  8.664   38.288  1.00 25.21 ? 224 LEU B CG   1 
ATOM   2317 C  CD1  . LEU B 1 98  ? 43.069  9.556   38.512  1.00 26.98 ? 224 LEU B CD1  1 
ATOM   2318 C  CD2  . LEU B 1 98  ? 44.647  7.908   39.571  1.00 26.61 ? 224 LEU B CD2  1 
ATOM   2319 N  N    . GLY B 1 99  ? 45.737  5.581   34.735  1.00 21.60 ? 225 GLY B N    1 
ATOM   2320 C  CA   . GLY B 1 99  ? 45.535  4.613   33.652  1.00 21.32 ? 225 GLY B CA   1 
ATOM   2321 C  C    . GLY B 1 99  ? 45.133  5.186   32.304  1.00 20.89 ? 225 GLY B C    1 
ATOM   2322 O  O    . GLY B 1 99  ? 44.976  4.431   31.337  1.00 21.00 ? 225 GLY B O    1 
ATOM   2323 N  N    . ALA B 1 100 ? 44.962  6.504   32.215  1.00 20.30 ? 226 ALA B N    1 
ATOM   2324 C  CA   . ALA B 1 100 ? 44.642  7.134   30.928  1.00 20.10 ? 226 ALA B CA   1 
ATOM   2325 C  C    . ALA B 1 100 ? 45.811  6.980   29.957  1.00 20.41 ? 226 ALA B C    1 
ATOM   2326 O  O    . ALA B 1 100 ? 46.976  6.970   30.372  1.00 20.20 ? 226 ALA B O    1 
ATOM   2327 C  CB   . ALA B 1 100 ? 44.291  8.611   31.106  1.00 19.64 ? 226 ALA B CB   1 
ATOM   2328 N  N    . ARG B 1 101 ? 45.482  6.841   28.676  1.00 20.76 ? 227 ARG B N    1 
ATOM   2329 C  CA   . ARG B 1 101 ? 46.475  6.608   27.630  1.00 20.97 ? 227 ARG B CA   1 
ATOM   2330 C  C    . ARG B 1 101 ? 46.682  7.886   26.824  1.00 22.25 ? 227 ARG B C    1 
ATOM   2331 O  O    . ARG B 1 101 ? 45.726  8.416   26.247  1.00 20.79 ? 227 ARG B O    1 
ATOM   2332 C  CB   . ARG B 1 101 ? 46.013  5.479   26.710  1.00 20.87 ? 227 ARG B CB   1 
ATOM   2333 C  CG   . ARG B 1 101 ? 45.960  4.118   27.386  1.00 21.11 ? 227 ARG B CG   1 
ATOM   2334 C  CD   . ARG B 1 101 ? 45.295  3.078   26.509  1.00 22.04 ? 227 ARG B CD   1 
ATOM   2335 N  NE   . ARG B 1 101 ? 43.880  3.370   26.256  1.00 20.23 ? 227 ARG B NE   1 
ATOM   2336 C  CZ   . ARG B 1 101 ? 43.056  2.580   25.569  1.00 22.77 ? 227 ARG B CZ   1 
ATOM   2337 N  NH1  . ARG B 1 101 ? 43.494  1.441   25.033  1.00 22.48 ? 227 ARG B NH1  1 
ATOM   2338 N  NH2  . ARG B 1 101 ? 41.783  2.938   25.394  1.00 22.61 ? 227 ARG B NH2  1 
ATOM   2339 N  N    . PRO B 1 102 ? 47.926  8.404   26.792  1.00 23.50 ? 228 PRO B N    1 
ATOM   2340 C  CA   . PRO B 1 102 ? 48.227  9.622   26.039  1.00 24.51 ? 228 PRO B CA   1 
ATOM   2341 C  C    . PRO B 1 102 ? 47.773  9.601   24.574  1.00 24.94 ? 228 PRO B C    1 
ATOM   2342 O  O    . PRO B 1 102 ? 47.393  10.647  24.050  1.00 26.51 ? 228 PRO B O    1 
ATOM   2343 C  CB   . PRO B 1 102 ? 49.753  9.711   26.126  1.00 24.84 ? 228 PRO B CB   1 
ATOM   2344 C  CG   . PRO B 1 102 ? 50.079  9.079   27.423  1.00 25.96 ? 228 PRO B CG   1 
ATOM   2345 C  CD   . PRO B 1 102 ? 49.065  7.991   27.634  1.00 23.77 ? 228 PRO B CD   1 
ATOM   2346 N  N    . ASP B 1 103 ? 47.797  8.439   23.922  1.00 24.68 ? 229 ASP B N    1 
ATOM   2347 C  CA   . ASP B 1 103 ? 47.411  8.373   22.506  1.00 24.90 ? 229 ASP B CA   1 
ATOM   2348 C  C    . ASP B 1 103 ? 45.908  8.231   22.249  1.00 23.53 ? 229 ASP B C    1 
ATOM   2349 O  O    . ASP B 1 103 ? 45.481  8.286   21.099  1.00 24.47 ? 229 ASP B O    1 
ATOM   2350 C  CB   . ASP B 1 103 ? 48.211  7.299   21.741  1.00 25.95 ? 229 ASP B CB   1 
ATOM   2351 C  CG   . ASP B 1 103 ? 47.909  5.864   22.187  1.00 27.57 ? 229 ASP B CG   1 
ATOM   2352 O  OD1  . ASP B 1 103 ? 46.894  5.600   22.865  1.00 28.98 ? 229 ASP B OD1  1 
ATOM   2353 O  OD2  . ASP B 1 103 ? 48.715  4.977   21.825  1.00 32.52 ? 229 ASP B OD2  1 
ATOM   2354 N  N    . ALA B 1 104 ? 45.115  8.065   23.307  1.00 21.54 ? 230 ALA B N    1 
ATOM   2355 C  CA   . ALA B 1 104 ? 43.687  7.758   23.165  1.00 20.92 ? 230 ALA B CA   1 
ATOM   2356 C  C    . ALA B 1 104 ? 42.828  8.979   22.853  1.00 20.50 ? 230 ALA B C    1 
ATOM   2357 O  O    . ALA B 1 104 ? 43.135  10.099  23.260  1.00 20.52 ? 230 ALA B O    1 
ATOM   2358 C  CB   . ALA B 1 104 ? 43.166  7.073   24.422  1.00 20.10 ? 230 ALA B CB   1 
ATOM   2359 N  N    . THR B 1 105 ? 41.748  8.749   22.119  1.00 19.69 ? 231 THR B N    1 
ATOM   2360 C  CA   . THR B 1 105 ? 40.708  9.756   21.973  1.00 19.24 ? 231 THR B CA   1 
ATOM   2361 C  C    . THR B 1 105 ? 39.937  9.802   23.294  1.00 18.43 ? 231 THR B C    1 
ATOM   2362 O  O    . THR B 1 105 ? 39.508  8.756   23.794  1.00 19.25 ? 231 THR B O    1 
ATOM   2363 C  CB   . THR B 1 105 ? 39.748  9.419   20.818  1.00 19.65 ? 231 THR B CB   1 
ATOM   2364 O  OG1  . THR B 1 105 ? 40.468  9.422   19.579  1.00 20.59 ? 231 THR B OG1  1 
ATOM   2365 C  CG2  . THR B 1 105 ? 38.616  10.422  20.763  1.00 19.83 ? 231 THR B CG2  1 
ATOM   2366 N  N    . LYS B 1 106 ? 39.800  11.000  23.866  1.00 18.47 ? 232 LYS B N    1 
ATOM   2367 C  CA   . LYS B 1 106 ? 39.057  11.195  25.117  1.00 18.07 ? 232 LYS B CA   1 
ATOM   2368 C  C    . LYS B 1 106 ? 37.581  11.444  24.820  1.00 18.25 ? 232 LYS B C    1 
ATOM   2369 O  O    . LYS B 1 106 ? 37.237  12.348  24.057  1.00 18.23 ? 232 LYS B O    1 
ATOM   2370 C  CB   . LYS B 1 106 ? 39.600  12.385  25.898  1.00 17.86 ? 232 LYS B CB   1 
ATOM   2371 C  CG   . LYS B 1 106 ? 41.034  12.266  26.355  1.00 19.95 ? 232 LYS B CG   1 
ATOM   2372 C  CD   . LYS B 1 106 ? 41.411  13.494  27.164  1.00 22.80 ? 232 LYS B CD   1 
ATOM   2373 C  CE   . LYS B 1 106 ? 42.861  13.468  27.576  1.00 25.16 ? 232 LYS B CE   1 
ATOM   2374 N  NZ   . LYS B 1 106 ? 43.793  13.538  26.419  1.00 29.95 ? 232 LYS B NZ   1 
ATOM   2375 N  N    . VAL B 1 107 ? 36.715  10.643  25.436  1.00 17.33 ? 233 VAL B N    1 
ATOM   2376 C  CA   . VAL B 1 107 ? 35.281  10.724  25.210  1.00 17.96 ? 233 VAL B CA   1 
ATOM   2377 C  C    . VAL B 1 107 ? 34.567  10.757  26.555  1.00 18.08 ? 233 VAL B C    1 
ATOM   2378 O  O    . VAL B 1 107 ? 34.921  10.015  27.475  1.00 18.06 ? 233 VAL B O    1 
ATOM   2379 C  CB   . VAL B 1 107 ? 34.791  9.537   24.364  1.00 17.65 ? 233 VAL B CB   1 
ATOM   2380 C  CG1  . VAL B 1 107 ? 33.262  9.625   24.124  1.00 18.40 ? 233 VAL B CG1  1 
ATOM   2381 C  CG2  . VAL B 1 107 ? 35.571  9.475   23.037  1.00 17.51 ? 233 VAL B CG2  1 
ATOM   2382 N  N    . LEU B 1 108 ? 33.544  11.612  26.642  1.00 18.34 ? 234 LEU B N    1 
ATOM   2383 C  CA   . LEU B 1 108 ? 32.677  11.750  27.808  1.00 18.61 ? 234 LEU B CA   1 
ATOM   2384 C  C    . LEU B 1 108 ? 31.253  11.420  27.382  1.00 18.66 ? 234 LEU B C    1 
ATOM   2385 O  O    . LEU B 1 108 ? 30.777  11.918  26.360  1.00 19.39 ? 234 LEU B O    1 
ATOM   2386 C  CB   . LEU B 1 108 ? 32.718  13.183  28.354  1.00 19.26 ? 234 LEU B CB   1 
ATOM   2387 C  CG   . LEU B 1 108 ? 33.286  13.452  29.745  1.00 21.62 ? 234 LEU B CG   1 
ATOM   2388 C  CD1  . LEU B 1 108 ? 33.209  14.948  30.028  1.00 22.48 ? 234 LEU B CD1  1 
ATOM   2389 C  CD2  . LEU B 1 108 ? 32.568  12.631  30.832  1.00 20.39 ? 234 LEU B CD2  1 
ATOM   2390 N  N    . ILE B 1 109 ? 30.590  10.564  28.148  1.00 18.78 ? 235 ILE B N    1 
ATOM   2391 C  CA   . ILE B 1 109 ? 29.151  10.380  28.027  1.00 19.27 ? 235 ILE B CA   1 
ATOM   2392 C  C    . ILE B 1 109 ? 28.531  10.852  29.330  1.00 19.28 ? 235 ILE B C    1 
ATOM   2393 O  O    . ILE B 1 109 ? 28.700  10.208  30.374  1.00 18.99 ? 235 ILE B O    1 
ATOM   2394 C  CB   . ILE B 1 109 ? 28.733  8.916   27.781  1.00 19.20 ? 235 ILE B CB   1 
ATOM   2395 C  CG1  . ILE B 1 109 ? 29.313  8.394   26.465  1.00 21.16 ? 235 ILE B CG1  1 
ATOM   2396 C  CG2  . ILE B 1 109 ? 27.202  8.810   27.738  1.00 20.28 ? 235 ILE B CG2  1 
ATOM   2397 C  CD1  . ILE B 1 109 ? 28.891  6.975   26.124  1.00 22.16 ? 235 ILE B CD1  1 
ATOM   2398 N  N    . ILE B 1 110 ? 27.827  11.981  29.252  1.00 18.80 ? 236 ILE B N    1 
ATOM   2399 C  CA   . ILE B 1 110 ? 27.185  12.606  30.406  1.00 18.58 ? 236 ILE B CA   1 
ATOM   2400 C  C    . ILE B 1 110 ? 25.729  12.159  30.408  1.00 18.81 ? 236 ILE B C    1 
ATOM   2401 O  O    . ILE B 1 110 ? 25.065  12.229  29.385  1.00 19.73 ? 236 ILE B O    1 
ATOM   2402 C  CB   . ILE B 1 110 ? 27.270  14.137  30.330  1.00 18.73 ? 236 ILE B CB   1 
ATOM   2403 C  CG1  . ILE B 1 110 ? 28.730  14.597  30.181  1.00 21.38 ? 236 ILE B CG1  1 
ATOM   2404 C  CG2  . ILE B 1 110 ? 26.634  14.788  31.583  1.00 19.75 ? 236 ILE B CG2  1 
ATOM   2405 C  CD1  . ILE B 1 110 ? 28.866  15.905  29.474  1.00 22.48 ? 236 ILE B CD1  1 
ATOM   2406 N  N    . ILE B 1 111 ? 25.241  11.694  31.551  1.00 19.69 ? 237 ILE B N    1 
ATOM   2407 C  CA   . ILE B 1 111 ? 23.870  11.172  31.647  1.00 18.81 ? 237 ILE B CA   1 
ATOM   2408 C  C    . ILE B 1 111 ? 23.171  11.922  32.760  1.00 19.13 ? 237 ILE B C    1 
ATOM   2409 O  O    . ILE B 1 111 ? 23.656  11.919  33.884  1.00 18.93 ? 237 ILE B O    1 
ATOM   2410 C  CB   . ILE B 1 111 ? 23.858  9.663   31.958  1.00 19.63 ? 237 ILE B CB   1 
ATOM   2411 C  CG1  . ILE B 1 111 ? 24.763  8.891   30.981  1.00 21.72 ? 237 ILE B CG1  1 
ATOM   2412 C  CG2  . ILE B 1 111 ? 22.444  9.115   31.877  1.00 20.49 ? 237 ILE B CG2  1 
ATOM   2413 C  CD1  . ILE B 1 111 ? 24.886  7.398   31.297  1.00 23.01 ? 237 ILE B CD1  1 
ATOM   2414 N  N    . THR B 1 112 ? 22.044  12.561  32.450  1.00 19.26 ? 238 THR B N    1 
ATOM   2415 C  CA   . THR B 1 112 ? 21.383  13.447  33.414  1.00 19.72 ? 238 THR B CA   1 
ATOM   2416 C  C    . THR B 1 112 ? 19.871  13.439  33.258  1.00 19.82 ? 238 THR B C    1 
ATOM   2417 O  O    . THR B 1 112 ? 19.357  13.196  32.172  1.00 19.79 ? 238 THR B O    1 
ATOM   2418 C  CB   . THR B 1 112 ? 21.921  14.892  33.296  1.00 19.96 ? 238 THR B CB   1 
ATOM   2419 O  OG1  . THR B 1 112 ? 21.401  15.691  34.360  1.00 19.77 ? 238 THR B OG1  1 
ATOM   2420 C  CG2  . THR B 1 112 ? 21.564  15.507  31.945  1.00 20.43 ? 238 THR B CG2  1 
ATOM   2421 N  N    . ASP B 1 113 ? 19.166  13.696  34.364  1.00 20.42 ? 239 ASP B N    1 
ATOM   2422 C  CA   . ASP B 1 113 ? 17.713  13.838  34.315  1.00 20.93 ? 239 ASP B CA   1 
ATOM   2423 C  C    . ASP B 1 113 ? 17.220  15.279  34.480  1.00 20.93 ? 239 ASP B C    1 
ATOM   2424 O  O    . ASP B 1 113 ? 16.022  15.513  34.602  1.00 21.17 ? 239 ASP B O    1 
ATOM   2425 C  CB   . ASP B 1 113 ? 17.052  12.936  35.362  1.00 22.32 ? 239 ASP B CB   1 
ATOM   2426 C  CG   . ASP B 1 113 ? 16.986  13.575  36.727  1.00 24.38 ? 239 ASP B CG   1 
ATOM   2427 O  OD1  . ASP B 1 113 ? 17.822  14.455  37.035  1.00 27.76 ? 239 ASP B OD1  1 
ATOM   2428 O  OD2  . ASP B 1 113 ? 16.088  13.179  37.500  1.00 27.64 ? 239 ASP B OD2  1 
ATOM   2429 N  N    . GLY B 1 114 ? 18.108  16.256  34.450  1.00 20.53 ? 240 GLY B N    1 
ATOM   2430 C  CA   . GLY B 1 114 ? 17.677  17.636  34.620  1.00 21.94 ? 240 GLY B CA   1 
ATOM   2431 C  C    . GLY B 1 114 ? 18.732  18.686  34.361  1.00 22.45 ? 240 GLY B C    1 
ATOM   2432 O  O    . GLY B 1 114 ? 19.857  18.378  34.004  1.00 22.44 ? 240 GLY B O    1 
ATOM   2433 N  N    . GLU B 1 115 ? 18.324  19.940  34.517  1.00 22.07 ? 241 GLU B N    1 
ATOM   2434 C  CA   . GLU B 1 115 ? 19.203  21.067  34.282  1.00 21.76 ? 241 GLU B CA   1 
ATOM   2435 C  C    . GLU B 1 115 ? 20.222  21.177  35.399  1.00 20.91 ? 241 GLU B C    1 
ATOM   2436 O  O    . GLU B 1 115 ? 19.951  20.805  36.550  1.00 20.81 ? 241 GLU B O    1 
ATOM   2437 C  CB   . GLU B 1 115 ? 18.395  22.361  34.142  1.00 22.15 ? 241 GLU B CB   1 
ATOM   2438 C  CG   . GLU B 1 115 ? 17.475  22.343  32.912  1.00 22.88 ? 241 GLU B CG   1 
ATOM   2439 C  CD   . GLU B 1 115 ? 16.591  23.564  32.786  1.00 25.52 ? 241 GLU B CD   1 
ATOM   2440 O  OE1  . GLU B 1 115 ? 17.038  24.677  33.134  1.00 26.41 ? 241 GLU B OE1  1 
ATOM   2441 O  OE2  . GLU B 1 115 ? 15.450  23.404  32.300  1.00 27.52 ? 241 GLU B OE2  1 
ATOM   2442 N  N    . ALA B 1 116 ? 21.395  21.690  35.043  1.00 21.17 ? 242 ALA B N    1 
ATOM   2443 C  CA   . ALA B 1 116 ? 22.480  21.883  35.988  1.00 20.29 ? 242 ALA B CA   1 
ATOM   2444 C  C    . ALA B 1 116 ? 22.075  22.818  37.106  1.00 20.45 ? 242 ALA B C    1 
ATOM   2445 O  O    . ALA B 1 116 ? 21.377  23.808  36.873  1.00 20.11 ? 242 ALA B O    1 
ATOM   2446 C  CB   . ALA B 1 116 ? 23.710  22.437  35.271  1.00 20.11 ? 242 ALA B CB   1 
ATOM   2447 N  N    . THR B 1 117 ? 22.544  22.505  38.309  1.00 20.13 ? 243 THR B N    1 
ATOM   2448 C  CA   . THR B 1 117 ? 22.288  23.305  39.505  1.00 19.96 ? 243 THR B CA   1 
ATOM   2449 C  C    . THR B 1 117 ? 23.452  24.247  39.828  1.00 20.00 ? 243 THR B C    1 
ATOM   2450 O  O    . THR B 1 117 ? 23.422  24.940  40.848  1.00 20.73 ? 243 THR B O    1 
ATOM   2451 C  CB   . THR B 1 117 ? 22.023  22.399  40.727  1.00 20.24 ? 243 THR B CB   1 
ATOM   2452 O  OG1  . THR B 1 117 ? 23.045  21.399  40.806  1.00 20.49 ? 243 THR B OG1  1 
ATOM   2453 C  CG2  . THR B 1 117 ? 20.672  21.718  40.618  1.00 22.15 ? 243 THR B CG2  1 
ATOM   2454 N  N    . ASP B 1 118 ? 24.477  24.275  38.977  1.00 19.30 ? 244 ASP B N    1 
ATOM   2455 C  CA   . ASP B 1 118 ? 25.599  25.191  39.160  1.00 20.60 ? 244 ASP B CA   1 
ATOM   2456 C  C    . ASP B 1 118 ? 25.872  26.033  37.912  1.00 20.17 ? 244 ASP B C    1 
ATOM   2457 O  O    . ASP B 1 118 ? 25.126  25.971  36.926  1.00 20.84 ? 244 ASP B O    1 
ATOM   2458 C  CB   . ASP B 1 118 ? 26.853  24.429  39.640  1.00 20.37 ? 244 ASP B CB   1 
ATOM   2459 C  CG   . ASP B 1 118 ? 27.387  23.416  38.627  1.00 22.18 ? 244 ASP B CG   1 
ATOM   2460 O  OD1  . ASP B 1 118 ? 26.766  23.180  37.559  1.00 21.18 ? 244 ASP B OD1  1 
ATOM   2461 O  OD2  . ASP B 1 118 ? 28.463  22.836  38.939  1.00 24.08 ? 244 ASP B OD2  1 
ATOM   2462 N  N    . SER B 1 119 ? 26.922  26.847  37.986  1.00 21.20 ? 245 SER B N    1 
ATOM   2463 C  CA   . SER B 1 119 ? 27.320  27.740  36.913  1.00 21.40 ? 245 SER B CA   1 
ATOM   2464 C  C    . SER B 1 119 ? 28.816  27.634  36.696  1.00 21.58 ? 245 SER B C    1 
ATOM   2465 O  O    . SER B 1 119 ? 29.541  27.094  37.526  1.00 21.09 ? 245 SER B O    1 
ATOM   2466 C  CB   . SER B 1 119 ? 26.987  29.185  37.262  1.00 22.26 ? 245 SER B CB   1 
ATOM   2467 O  OG   . SER B 1 119 ? 25.638  29.317  37.663  1.00 22.26 ? 245 SER B OG   1 
ATOM   2468 N  N    . GLY B 1 120 ? 29.281  28.173  35.583  1.00 21.87 ? 246 GLY B N    1 
ATOM   2469 C  CA   . GLY B 1 120 ? 30.718  28.196  35.306  1.00 21.38 ? 246 GLY B CA   1 
ATOM   2470 C  C    . GLY B 1 120 ? 30.984  28.065  33.827  1.00 21.15 ? 246 GLY B C    1 
ATOM   2471 O  O    . GLY B 1 120 ? 30.198  28.541  33.014  1.00 21.55 ? 246 GLY B O    1 
ATOM   2472 N  N    . ASN B 1 121 ? 32.116  27.447  33.486  1.00 20.30 ? 247 ASN B N    1 
ATOM   2473 C  CA   . ASN B 1 121 ? 32.442  27.110  32.109  1.00 20.72 ? 247 ASN B CA   1 
ATOM   2474 C  C    . ASN B 1 121 ? 33.109  25.729  32.069  1.00 20.60 ? 247 ASN B C    1 
ATOM   2475 O  O    . ASN B 1 121 ? 33.498  25.190  33.115  1.00 20.90 ? 247 ASN B O    1 
ATOM   2476 C  CB   . ASN B 1 121 ? 33.313  28.219  31.465  1.00 20.47 ? 247 ASN B CB   1 
ATOM   2477 C  CG   . ASN B 1 121 ? 34.755  28.220  31.963  1.00 20.65 ? 247 ASN B CG   1 
ATOM   2478 O  OD1  . ASN B 1 121 ? 35.411  27.190  31.975  1.00 20.51 ? 247 ASN B OD1  1 
ATOM   2479 N  ND2  . ASN B 1 121 ? 35.257  29.399  32.350  1.00 23.25 ? 247 ASN B ND2  1 
ATOM   2480 N  N    . ILE B 1 122 ? 33.222  25.154  30.879  1.00 20.85 ? 248 ILE B N    1 
ATOM   2481 C  CA   . ILE B 1 122 ? 33.908  23.872  30.724  1.00 21.61 ? 248 ILE B CA   1 
ATOM   2482 C  C    . ILE B 1 122 ? 35.091  23.989  29.757  1.00 21.83 ? 248 ILE B C    1 
ATOM   2483 O  O    . ILE B 1 122 ? 35.429  23.045  29.030  1.00 21.05 ? 248 ILE B O    1 
ATOM   2484 C  CB   . ILE B 1 122 ? 32.931  22.738  30.307  1.00 21.73 ? 248 ILE B CB   1 
ATOM   2485 C  CG1  . ILE B 1 122 ? 32.259  23.024  28.974  1.00 22.02 ? 248 ILE B CG1  1 
ATOM   2486 C  CG2  . ILE B 1 122 ? 31.887  22.505  31.398  1.00 23.56 ? 248 ILE B CG2  1 
ATOM   2487 C  CD1  . ILE B 1 122 ? 31.722  21.761  28.321  1.00 23.99 ? 248 ILE B CD1  1 
ATOM   2488 N  N    . ASP B 1 123 ? 35.735  25.154  29.778  1.00 22.09 ? 249 ASP B N    1 
ATOM   2489 C  CA   . ASP B 1 123 ? 36.954  25.386  29.010  1.00 22.14 ? 249 ASP B CA   1 
ATOM   2490 C  C    . ASP B 1 123 ? 37.967  24.256  29.206  1.00 21.64 ? 249 ASP B C    1 
ATOM   2491 O  O    . ASP B 1 123 ? 38.652  23.861  28.260  1.00 22.13 ? 249 ASP B O    1 
ATOM   2492 C  CB   . ASP B 1 123 ? 37.617  26.708  29.426  1.00 22.81 ? 249 ASP B CB   1 
ATOM   2493 C  CG   . ASP B 1 123 ? 36.804  27.942  29.047  1.00 24.89 ? 249 ASP B CG   1 
ATOM   2494 O  OD1  . ASP B 1 123 ? 35.704  27.818  28.456  1.00 29.86 ? 249 ASP B OD1  1 
ATOM   2495 O  OD2  . ASP B 1 123 ? 37.277  29.059  29.354  1.00 28.32 ? 249 ASP B OD2  1 
ATOM   2496 N  N    . ALA B 1 124 ? 38.075  23.745  30.433  1.00 20.68 ? 250 ALA B N    1 
ATOM   2497 C  CA   . ALA B 1 124 ? 39.073  22.719  30.755  1.00 20.79 ? 250 ALA B CA   1 
ATOM   2498 C  C    . ALA B 1 124 ? 38.826  21.384  30.043  1.00 20.01 ? 250 ALA B C    1 
ATOM   2499 O  O    . ALA B 1 124 ? 39.745  20.557  29.921  1.00 20.15 ? 250 ALA B O    1 
ATOM   2500 C  CB   . ALA B 1 124 ? 39.156  22.510  32.256  1.00 20.87 ? 250 ALA B CB   1 
ATOM   2501 N  N    . ALA B 1 125 ? 37.597  21.189  29.567  1.00 18.42 ? 251 ALA B N    1 
ATOM   2502 C  CA   . ALA B 1 125 ? 37.192  19.968  28.891  1.00 18.22 ? 251 ALA B CA   1 
ATOM   2503 C  C    . ALA B 1 125 ? 37.068  20.127  27.375  1.00 18.32 ? 251 ALA B C    1 
ATOM   2504 O  O    . ALA B 1 125 ? 36.496  19.256  26.717  1.00 17.39 ? 251 ALA B O    1 
ATOM   2505 C  CB   . ALA B 1 125 ? 35.846  19.485  29.461  1.00 17.72 ? 251 ALA B CB   1 
ATOM   2506 N  N    . LYS B 1 126 ? 37.593  21.210  26.806  1.00 19.22 ? 252 LYS B N    1 
ATOM   2507 C  CA   . LYS B 1 126 ? 37.384  21.456  25.368  1.00 21.73 ? 252 LYS B CA   1 
ATOM   2508 C  C    . LYS B 1 126 ? 38.024  20.411  24.439  1.00 21.77 ? 252 LYS B C    1 
ATOM   2509 O  O    . LYS B 1 126 ? 37.582  20.257  23.299  1.00 23.95 ? 252 LYS B O    1 
ATOM   2510 C  CB   . LYS B 1 126 ? 37.818  22.873  24.956  1.00 22.81 ? 252 LYS B CB   1 
ATOM   2511 C  CG   . LYS B 1 126 ? 36.920  24.023  25.477  1.00 26.69 ? 252 LYS B CG   1 
ATOM   2512 C  CD   . LYS B 1 126 ? 35.417  23.693  25.532  1.00 28.12 ? 252 LYS B CD   1 
ATOM   2513 C  CE   . LYS B 1 126 ? 34.539  24.943  25.395  1.00 30.34 ? 252 LYS B CE   1 
ATOM   2514 N  NZ   . LYS B 1 126 ? 35.010  26.098  26.219  1.00 30.71 ? 252 LYS B NZ   1 
ATOM   2515 N  N    . ASP B 1 127 ? 39.030  19.683  24.909  1.00 20.94 ? 253 ASP B N    1 
ATOM   2516 C  CA   . ASP B 1 127 ? 39.656  18.620  24.094  1.00 21.58 ? 253 ASP B CA   1 
ATOM   2517 C  C    . ASP B 1 127 ? 39.014  17.237  24.267  1.00 19.70 ? 253 ASP B C    1 
ATOM   2518 O  O    . ASP B 1 127 ? 39.522  16.235  23.750  1.00 21.12 ? 253 ASP B O    1 
ATOM   2519 C  CB   . ASP B 1 127 ? 41.158  18.527  24.400  1.00 22.14 ? 253 ASP B CB   1 
ATOM   2520 C  CG   . ASP B 1 127 ? 41.951  19.689  23.822  1.00 26.44 ? 253 ASP B CG   1 
ATOM   2521 O  OD1  . ASP B 1 127 ? 41.374  20.510  23.066  1.00 32.55 ? 253 ASP B OD1  1 
ATOM   2522 O  OD2  . ASP B 1 127 ? 43.166  19.779  24.117  1.00 33.35 ? 253 ASP B OD2  1 
ATOM   2523 N  N    . ILE B 1 128 ? 37.912  17.174  25.000  1.00 16.95 ? 254 ILE B N    1 
ATOM   2524 C  CA   . ILE B 1 128 ? 37.188  15.930  25.207  1.00 15.68 ? 254 ILE B CA   1 
ATOM   2525 C  C    . ILE B 1 128 ? 35.969  15.944  24.308  1.00 15.16 ? 254 ILE B C    1 
ATOM   2526 O  O    . ILE B 1 128 ? 35.297  16.961  24.216  1.00 15.35 ? 254 ILE B O    1 
ATOM   2527 C  CB   . ILE B 1 128 ? 36.741  15.790  26.678  1.00 15.17 ? 254 ILE B CB   1 
ATOM   2528 C  CG1  . ILE B 1 128 ? 37.959  15.815  27.606  1.00 14.81 ? 254 ILE B CG1  1 
ATOM   2529 C  CG2  . ILE B 1 128 ? 35.959  14.485  26.873  1.00 14.59 ? 254 ILE B CG2  1 
ATOM   2530 C  CD1  . ILE B 1 128 ? 37.627  16.059  29.077  1.00 15.23 ? 254 ILE B CD1  1 
ATOM   2531 N  N    . ILE B 1 129 ? 35.695  14.828  23.638  1.00 14.43 ? 255 ILE B N    1 
ATOM   2532 C  CA   . ILE B 1 129 ? 34.477  14.691  22.823  1.00 15.25 ? 255 ILE B CA   1 
ATOM   2533 C  C    . ILE B 1 129 ? 33.336  14.384  23.787  1.00 15.44 ? 255 ILE B C    1 
ATOM   2534 O  O    . ILE B 1 129 ? 33.395  13.391  24.500  1.00 16.34 ? 255 ILE B O    1 
ATOM   2535 C  CB   . ILE B 1 129 ? 34.602  13.545  21.804  1.00 14.96 ? 255 ILE B CB   1 
ATOM   2536 C  CG1  . ILE B 1 129 ? 35.775  13.803  20.844  1.00 15.35 ? 255 ILE B CG1  1 
ATOM   2537 C  CG2  . ILE B 1 129 ? 33.293  13.364  21.036  1.00 16.55 ? 255 ILE B CG2  1 
ATOM   2538 C  CD1  . ILE B 1 129 ? 36.044  12.683  19.904  1.00 19.40 ? 255 ILE B CD1  1 
ATOM   2539 N  N    . ARG B 1 130 ? 32.305  15.229  23.799  1.00 15.47 ? 256 ARG B N    1 
ATOM   2540 C  CA   . ARG B 1 130 ? 31.286  15.195  24.843  1.00 16.02 ? 256 ARG B CA   1 
ATOM   2541 C  C    . ARG B 1 130 ? 29.894  14.916  24.288  1.00 15.90 ? 256 ARG B C    1 
ATOM   2542 O  O    . ARG B 1 130 ? 29.346  15.730  23.530  1.00 15.97 ? 256 ARG B O    1 
ATOM   2543 C  CB   . ARG B 1 130 ? 31.288  16.516  25.624  1.00 16.20 ? 256 ARG B CB   1 
ATOM   2544 C  CG   . ARG B 1 130 ? 32.537  16.690  26.491  1.00 19.00 ? 256 ARG B CG   1 
ATOM   2545 C  CD   . ARG B 1 130 ? 32.778  18.123  26.892  1.00 21.07 ? 256 ARG B CD   1 
ATOM   2546 N  NE   . ARG B 1 130 ? 33.503  18.813  25.837  1.00 27.86 ? 256 ARG B NE   1 
ATOM   2547 C  CZ   . ARG B 1 130 ? 33.020  19.751  25.027  1.00 27.64 ? 256 ARG B CZ   1 
ATOM   2548 N  NH1  . ARG B 1 130 ? 31.776  20.203  25.130  1.00 29.53 ? 256 ARG B NH1  1 
ATOM   2549 N  NH2  . ARG B 1 130 ? 33.823  20.263  24.111  1.00 29.56 ? 256 ARG B NH2  1 
ATOM   2550 N  N    . TYR B 1 131 ? 29.347  13.756  24.666  1.00 16.31 ? 257 TYR B N    1 
ATOM   2551 C  CA   . TYR B 1 131 ? 27.945  13.415  24.440  1.00 16.43 ? 257 TYR B CA   1 
ATOM   2552 C  C    . TYR B 1 131 ? 27.184  13.685  25.732  1.00 16.64 ? 257 TYR B C    1 
ATOM   2553 O  O    . TYR B 1 131 ? 27.718  13.454  26.831  1.00 16.00 ? 257 TYR B O    1 
ATOM   2554 C  CB   . TYR B 1 131 ? 27.780  11.934  24.050  1.00 16.47 ? 257 TYR B CB   1 
ATOM   2555 C  CG   . TYR B 1 131 ? 28.240  11.629  22.633  1.00 15.31 ? 257 TYR B CG   1 
ATOM   2556 C  CD1  . TYR B 1 131 ? 27.348  11.656  21.563  1.00 16.66 ? 257 TYR B CD1  1 
ATOM   2557 C  CD2  . TYR B 1 131 ? 29.565  11.335  22.362  1.00 18.48 ? 257 TYR B CD2  1 
ATOM   2558 C  CE1  . TYR B 1 131 ? 27.755  11.399  20.277  1.00 16.53 ? 257 TYR B CE1  1 
ATOM   2559 C  CE2  . TYR B 1 131 ? 29.986  11.082  21.074  1.00 15.58 ? 257 TYR B CE2  1 
ATOM   2560 C  CZ   . TYR B 1 131 ? 29.088  11.114  20.029  1.00 16.86 ? 257 TYR B CZ   1 
ATOM   2561 O  OH   . TYR B 1 131 ? 29.499  10.872  18.741  1.00 17.58 ? 257 TYR B OH   1 
ATOM   2562 N  N    . ILE B 1 132 ? 25.949  14.169  25.611  1.00 15.58 ? 258 ILE B N    1 
ATOM   2563 C  CA   . ILE B 1 132 ? 25.077  14.304  26.774  1.00 16.10 ? 258 ILE B CA   1 
ATOM   2564 C  C    . ILE B 1 132 ? 23.728  13.655  26.467  1.00 16.01 ? 258 ILE B C    1 
ATOM   2565 O  O    . ILE B 1 132 ? 23.189  13.818  25.376  1.00 16.98 ? 258 ILE B O    1 
ATOM   2566 C  CB   . ILE B 1 132 ? 24.959  15.776  27.245  1.00 16.09 ? 258 ILE B CB   1 
ATOM   2567 C  CG1  . ILE B 1 132 ? 24.277  15.869  28.611  1.00 15.91 ? 258 ILE B CG1  1 
ATOM   2568 C  CG2  . ILE B 1 132 ? 24.254  16.655  26.209  1.00 16.34 ? 258 ILE B CG2  1 
ATOM   2569 C  CD1  . ILE B 1 132 ? 24.586  17.152  29.369  1.00 16.09 ? 258 ILE B CD1  1 
ATOM   2570 N  N    . ILE B 1 133 ? 23.248  12.870  27.423  1.00 16.26 ? 259 ILE B N    1 
ATOM   2571 C  CA   . ILE B 1 133 ? 21.974  12.162  27.318  1.00 16.33 ? 259 ILE B CA   1 
ATOM   2572 C  C    . ILE B 1 133 ? 21.060  12.741  28.382  1.00 16.16 ? 259 ILE B C    1 
ATOM   2573 O  O    . ILE B 1 133 ? 21.331  12.584  29.578  1.00 15.67 ? 259 ILE B O    1 
ATOM   2574 C  CB   . ILE B 1 133 ? 22.133  10.643  27.554  1.00 16.74 ? 259 ILE B CB   1 
ATOM   2575 C  CG1  . ILE B 1 133 ? 23.214  10.052  26.641  1.00 19.06 ? 259 ILE B CG1  1 
ATOM   2576 C  CG2  . ILE B 1 133 ? 20.804  9.919   27.317  1.00 18.70 ? 259 ILE B CG2  1 
ATOM   2577 C  CD1  . ILE B 1 133 ? 23.491  8.596   26.906  1.00 21.71 ? 259 ILE B CD1  1 
ATOM   2578 N  N    . GLY B 1 134 ? 20.032  13.465  27.943  1.00 16.06 ? 260 GLY B N    1 
ATOM   2579 C  CA   . GLY B 1 134 ? 19.055  14.075  28.848  1.00 15.76 ? 260 GLY B CA   1 
ATOM   2580 C  C    . GLY B 1 134 ? 17.800  13.233  28.851  1.00 16.28 ? 260 GLY B C    1 
ATOM   2581 O  O    . GLY B 1 134 ? 17.221  12.991  27.798  1.00 16.45 ? 260 GLY B O    1 
ATOM   2582 N  N    . ILE B 1 135 ? 17.405  12.755  30.021  1.00 15.38 ? 261 ILE B N    1 
ATOM   2583 C  CA   . ILE B 1 135 ? 16.333  11.755  30.113  1.00 15.89 ? 261 ILE B CA   1 
ATOM   2584 C  C    . ILE B 1 135 ? 15.161  12.260  30.935  1.00 16.45 ? 261 ILE B C    1 
ATOM   2585 O  O    . ILE B 1 135 ? 15.335  12.775  32.048  1.00 16.00 ? 261 ILE B O    1 
ATOM   2586 C  CB   . ILE B 1 135 ? 16.840  10.430  30.735  1.00 15.77 ? 261 ILE B CB   1 
ATOM   2587 C  CG1  . ILE B 1 135 ? 18.117  9.960   30.030  1.00 15.05 ? 261 ILE B CG1  1 
ATOM   2588 C  CG2  . ILE B 1 135 ? 15.746  9.357   30.647  1.00 15.78 ? 261 ILE B CG2  1 
ATOM   2589 C  CD1  . ILE B 1 135 ? 18.804  8.773   30.693  1.00 18.50 ? 261 ILE B CD1  1 
ATOM   2590 N  N    . GLY B 1 136 ? 13.957  12.105  30.378  1.00 16.38 ? 262 GLY B N    1 
ATOM   2591 C  CA   . GLY B 1 136 ? 12.742  12.208  31.165  1.00 17.06 ? 262 GLY B CA   1 
ATOM   2592 C  C    . GLY B 1 136 ? 11.992  13.509  31.060  1.00 16.96 ? 262 GLY B C    1 
ATOM   2593 O  O    . GLY B 1 136 ? 12.272  14.343  30.196  1.00 16.10 ? 262 GLY B O    1 
ATOM   2594 N  N    . LYS B 1 137 ? 11.024  13.663  31.962  1.00 17.80 ? 263 LYS B N    1 
ATOM   2595 C  CA   . LYS B 1 137 ? 10.026  14.726  31.885  1.00 18.61 ? 263 LYS B CA   1 
ATOM   2596 C  C    . LYS B 1 137 ? 10.590  16.138  32.058  1.00 18.50 ? 263 LYS B C    1 
ATOM   2597 O  O    . LYS B 1 137 ? 9.965   17.099  31.620  1.00 17.89 ? 263 LYS B O    1 
ATOM   2598 C  CB   . LYS B 1 137 ? 8.918   14.480  32.914  1.00 19.43 ? 263 LYS B CB   1 
ATOM   2599 C  CG   . LYS B 1 137 ? 9.352   14.745  34.339  1.00 20.90 ? 263 LYS B CG   1 
ATOM   2600 C  CD   . LYS B 1 137 ? 8.448   14.090  35.356  1.00 24.93 ? 263 LYS B CD   1 
ATOM   2601 C  CE   . LYS B 1 137 ? 8.919   14.408  36.759  1.00 25.06 ? 263 LYS B CE   1 
ATOM   2602 N  NZ   . LYS B 1 137 ? 10.093  13.589  37.205  1.00 26.57 ? 263 LYS B NZ   1 
ATOM   2603 N  N    . HIS B 1 138 ? 11.774  16.271  32.657  1.00 18.21 ? 264 HIS B N    1 
ATOM   2604 C  CA   . HIS B 1 138 ? 12.367  17.595  32.833  1.00 18.81 ? 264 HIS B CA   1 
ATOM   2605 C  C    . HIS B 1 138 ? 12.887  18.158  31.508  1.00 18.83 ? 264 HIS B C    1 
ATOM   2606 O  O    . HIS B 1 138 ? 13.210  19.337  31.429  1.00 18.33 ? 264 HIS B O    1 
ATOM   2607 C  CB   . HIS B 1 138 ? 13.484  17.581  33.886  1.00 19.34 ? 264 HIS B CB   1 
ATOM   2608 C  CG   . HIS B 1 138 ? 13.009  17.237  35.266  1.00 20.28 ? 264 HIS B CG   1 
ATOM   2609 N  ND1  . HIS B 1 138 ? 11.805  17.683  35.770  1.00 24.00 ? 264 HIS B ND1  1 
ATOM   2610 C  CD2  . HIS B 1 138 ? 13.578  16.503  36.250  1.00 21.37 ? 264 HIS B CD2  1 
ATOM   2611 C  CE1  . HIS B 1 138 ? 11.649  17.226  36.999  1.00 24.76 ? 264 HIS B CE1  1 
ATOM   2612 N  NE2  . HIS B 1 138 ? 12.713  16.511  37.316  1.00 23.49 ? 264 HIS B NE2  1 
ATOM   2613 N  N    . PHE B 1 139 ? 12.966  17.321  30.473  1.00 20.16 ? 265 PHE B N    1 
ATOM   2614 C  CA   . PHE B 1 139 ? 13.379  17.777  29.143  1.00 20.09 ? 265 PHE B CA   1 
ATOM   2615 C  C    . PHE B 1 139 ? 12.232  17.800  28.127  1.00 21.27 ? 265 PHE B C    1 
ATOM   2616 O  O    . PHE B 1 139 ? 12.454  17.680  26.919  1.00 21.22 ? 265 PHE B O    1 
ATOM   2617 C  CB   . PHE B 1 139 ? 14.579  16.960  28.641  1.00 19.94 ? 265 PHE B CB   1 
ATOM   2618 C  CG   . PHE B 1 139 ? 15.798  17.139  29.496  1.00 18.09 ? 265 PHE B CG   1 
ATOM   2619 C  CD1  . PHE B 1 139 ? 16.444  18.366  29.545  1.00 18.90 ? 265 PHE B CD1  1 
ATOM   2620 C  CD2  . PHE B 1 139 ? 16.253  16.108  30.312  1.00 19.20 ? 265 PHE B CD2  1 
ATOM   2621 C  CE1  . PHE B 1 139 ? 17.563  18.554  30.364  1.00 19.98 ? 265 PHE B CE1  1 
ATOM   2622 C  CE2  . PHE B 1 139 ? 17.370  16.282  31.125  1.00 19.82 ? 265 PHE B CE2  1 
ATOM   2623 C  CZ   . PHE B 1 139 ? 18.014  17.506  31.163  1.00 19.71 ? 265 PHE B CZ   1 
ATOM   2624 N  N    . GLN B 1 140 ? 11.011  17.984  28.631  1.00 22.33 ? 266 GLN B N    1 
ATOM   2625 C  CA   . GLN B 1 140 ? 9.822   18.121  27.803  1.00 24.02 ? 266 GLN B CA   1 
ATOM   2626 C  C    . GLN B 1 140 ? 9.923   19.303  26.839  1.00 23.73 ? 266 GLN B C    1 
ATOM   2627 O  O    . GLN B 1 140 ? 9.668   19.155  25.646  1.00 24.05 ? 266 GLN B O    1 
ATOM   2628 C  CB   . GLN B 1 140 ? 8.591   18.299  28.704  1.00 25.19 ? 266 GLN B CB   1 
ATOM   2629 C  CG   . GLN B 1 140 ? 7.303   18.694  27.982  1.00 28.70 ? 266 GLN B CG   1 
ATOM   2630 C  CD   . GLN B 1 140 ? 6.890   17.688  26.930  1.00 32.19 ? 266 GLN B CD   1 
ATOM   2631 O  OE1  . GLN B 1 140 ? 7.170   16.492  27.055  1.00 36.02 ? 266 GLN B OE1  1 
ATOM   2632 N  NE2  . GLN B 1 140 ? 6.211   18.164  25.886  1.00 34.67 ? 266 GLN B NE2  1 
ATOM   2633 N  N    . THR B 1 141 ? 10.292  20.470  27.366  1.00 23.35 ? 267 THR B N    1 
ATOM   2634 C  CA   . THR B 1 141 ? 10.350  21.684  26.562  1.00 23.20 ? 267 THR B CA   1 
ATOM   2635 C  C    . THR B 1 141 ? 11.619  21.755  25.729  1.00 23.84 ? 267 THR B C    1 
ATOM   2636 O  O    . THR B 1 141 ? 12.691  21.282  26.141  1.00 22.20 ? 267 THR B O    1 
ATOM   2637 C  CB   . THR B 1 141 ? 10.257  22.960  27.429  1.00 22.99 ? 267 THR B CB   1 
ATOM   2638 O  OG1  . THR B 1 141 ? 11.426  23.087  28.246  1.00 24.53 ? 267 THR B OG1  1 
ATOM   2639 C  CG2  . THR B 1 141 ? 8.999   22.923  28.317  1.00 21.45 ? 267 THR B CG2  1 
ATOM   2640 N  N    . LYS B 1 142 ? 11.497  22.365  24.556  1.00 23.84 ? 268 LYS B N    1 
ATOM   2641 C  CA   A LYS B 1 142 ? 12.652  22.581  23.696  0.60 24.03 ? 268 LYS B CA   1 
ATOM   2642 C  CA   B LYS B 1 142 ? 12.641  22.607  23.684  0.40 23.72 ? 268 LYS B CA   1 
ATOM   2643 C  C    . LYS B 1 142 ? 13.678  23.451  24.420  1.00 23.75 ? 268 LYS B C    1 
ATOM   2644 O  O    . LYS B 1 142 ? 14.878  23.243  24.280  1.00 23.10 ? 268 LYS B O    1 
ATOM   2645 C  CB   A LYS B 1 142 ? 12.241  23.235  22.375  0.60 24.42 ? 268 LYS B CB   1 
ATOM   2646 C  CB   B LYS B 1 142 ? 12.180  23.325  22.414  0.40 23.84 ? 268 LYS B CB   1 
ATOM   2647 C  CG   A LYS B 1 142 ? 11.303  22.392  21.501  0.60 25.91 ? 268 LYS B CG   1 
ATOM   2648 C  CG   B LYS B 1 142 ? 13.234  23.467  21.326  0.40 23.98 ? 268 LYS B CG   1 
ATOM   2649 C  CD   A LYS B 1 142 ? 11.943  21.072  21.070  0.60 26.44 ? 268 LYS B CD   1 
ATOM   2650 C  CD   B LYS B 1 142 ? 12.564  23.692  19.975  0.40 23.97 ? 268 LYS B CD   1 
ATOM   2651 C  CE   A LYS B 1 142 ? 11.089  20.365  20.019  0.60 27.98 ? 268 LYS B CE   1 
ATOM   2652 C  CE   B LYS B 1 142 ? 13.567  23.983  18.869  0.40 23.76 ? 268 LYS B CE   1 
ATOM   2653 N  NZ   A LYS B 1 142 ? 11.637  19.017  19.686  0.60 28.90 ? 268 LYS B NZ   1 
ATOM   2654 N  NZ   B LYS B 1 142 ? 13.951  25.421  18.832  0.40 24.57 ? 268 LYS B NZ   1 
ATOM   2655 N  N    . GLU B 1 143 ? 13.193  24.405  25.206  1.00 23.24 ? 269 GLU B N    1 
ATOM   2656 C  CA   A GLU B 1 143 ? 14.061  25.281  25.980  0.60 23.27 ? 269 GLU B CA   1 
ATOM   2657 C  CA   B GLU B 1 143 ? 14.053  25.284  26.003  0.40 23.20 ? 269 GLU B CA   1 
ATOM   2658 C  C    . GLU B 1 143 ? 14.931  24.494  26.977  1.00 22.37 ? 269 GLU B C    1 
ATOM   2659 O  O    . GLU B 1 143 ? 16.128  24.766  27.103  1.00 22.27 ? 269 GLU B O    1 
ATOM   2660 C  CB   A GLU B 1 143 ? 13.231  26.345  26.703  0.60 23.94 ? 269 GLU B CB   1 
ATOM   2661 C  CB   B GLU B 1 143 ? 13.201  26.293  26.779  0.40 23.80 ? 269 GLU B CB   1 
ATOM   2662 C  CG   A GLU B 1 143 ? 12.580  27.389  25.772  0.60 24.58 ? 269 GLU B CG   1 
ATOM   2663 C  CG   B GLU B 1 143 ? 13.986  27.393  27.484  0.40 24.62 ? 269 GLU B CG   1 
ATOM   2664 C  CD   A GLU B 1 143 ? 11.353  26.883  24.998  0.60 25.55 ? 269 GLU B CD   1 
ATOM   2665 C  CD   B GLU B 1 143 ? 13.074  28.416  28.144  0.40 25.78 ? 269 GLU B CD   1 
ATOM   2666 O  OE1  A GLU B 1 143 ? 10.668  25.944  25.461  0.60 22.75 ? 269 GLU B OE1  1 
ATOM   2667 O  OE1  B GLU B 1 143 ? 11.965  28.036  28.578  0.40 27.04 ? 269 GLU B OE1  1 
ATOM   2668 O  OE2  A GLU B 1 143 ? 11.072  27.441  23.912  0.60 27.98 ? 269 GLU B OE2  1 
ATOM   2669 O  OE2  B GLU B 1 143 ? 13.467  29.600  28.232  0.40 26.73 ? 269 GLU B OE2  1 
ATOM   2670 N  N    . SER B 1 144 ? 14.343  23.521  27.680  1.00 20.62 ? 270 SER B N    1 
ATOM   2671 C  CA   . SER B 1 144 ? 15.118  22.720  28.651  1.00 20.35 ? 270 SER B CA   1 
ATOM   2672 C  C    . SER B 1 144 ? 16.182  21.901  27.939  1.00 20.18 ? 270 SER B C    1 
ATOM   2673 O  O    . SER B 1 144 ? 17.311  21.785  28.420  1.00 20.04 ? 270 SER B O    1 
ATOM   2674 C  CB   . SER B 1 144 ? 14.231  21.790  29.483  1.00 20.64 ? 270 SER B CB   1 
ATOM   2675 O  OG   . SER B 1 144 ? 13.512  20.880  28.666  1.00 21.26 ? 270 SER B OG   1 
ATOM   2676 N  N    . GLN B 1 145 ? 15.810  21.346  26.791  1.00 19.88 ? 271 GLN B N    1 
ATOM   2677 C  CA   . GLN B 1 145 ? 16.735  20.556  25.978  1.00 19.99 ? 271 GLN B CA   1 
ATOM   2678 C  C    . GLN B 1 145 ? 17.937  21.393  25.546  1.00 20.50 ? 271 GLN B C    1 
ATOM   2679 O  O    . GLN B 1 145 ? 19.079  20.933  25.602  1.00 20.18 ? 271 GLN B O    1 
ATOM   2680 C  CB   . GLN B 1 145 ? 16.025  19.993  24.750  1.00 20.22 ? 271 GLN B CB   1 
ATOM   2681 C  CG   . GLN B 1 145 ? 14.900  18.997  25.068  1.00 20.85 ? 271 GLN B CG   1 
ATOM   2682 C  CD   . GLN B 1 145 ? 14.011  18.690  23.882  1.00 21.35 ? 271 GLN B CD   1 
ATOM   2683 O  OE1  . GLN B 1 145 ? 14.432  18.789  22.732  1.00 23.40 ? 271 GLN B OE1  1 
ATOM   2684 N  NE2  . GLN B 1 145 ? 12.759  18.335  24.158  1.00 20.37 ? 271 GLN B NE2  1 
ATOM   2685 N  N    . GLU B 1 146 ? 17.676  22.638  25.164  1.00 20.40 ? 272 GLU B N    1 
ATOM   2686 C  CA   . GLU B 1 146 ? 18.725  23.528  24.686  1.00 21.51 ? 272 GLU B CA   1 
ATOM   2687 C  C    . GLU B 1 146 ? 19.738  23.905  25.778  1.00 20.82 ? 272 GLU B C    1 
ATOM   2688 O  O    . GLU B 1 146 ? 20.886  24.221  25.470  1.00 20.36 ? 272 GLU B O    1 
ATOM   2689 C  CB   . GLU B 1 146 ? 18.103  24.754  24.008  1.00 22.51 ? 272 GLU B CB   1 
ATOM   2690 C  CG   . GLU B 1 146 ? 17.522  24.354  22.649  1.00 26.78 ? 272 GLU B CG   1 
ATOM   2691 C  CD   . GLU B 1 146 ? 16.611  25.363  21.999  1.00 29.83 ? 272 GLU B CD   1 
ATOM   2692 O  OE1  . GLU B 1 146 ? 16.061  26.257  22.684  1.00 31.65 ? 272 GLU B OE1  1 
ATOM   2693 O  OE2  . GLU B 1 146 ? 16.425  25.228  20.767  1.00 33.90 ? 272 GLU B OE2  1 
ATOM   2694 N  N    . THR B 1 147 ? 19.336  23.832  27.049  1.00 19.78 ? 273 THR B N    1 
ATOM   2695 C  CA   . THR B 1 147 ? 20.275  24.071  28.157  1.00 20.28 ? 273 THR B CA   1 
ATOM   2696 C  C    . THR B 1 147 ? 21.435  23.065  28.180  1.00 19.96 ? 273 THR B C    1 
ATOM   2697 O  O    . THR B 1 147 ? 22.497  23.345  28.747  1.00 20.97 ? 273 THR B O    1 
ATOM   2698 C  CB   . THR B 1 147 ? 19.598  24.090  29.551  1.00 20.32 ? 273 THR B CB   1 
ATOM   2699 O  OG1  . THR B 1 147 ? 19.258  22.759  29.959  1.00 20.07 ? 273 THR B OG1  1 
ATOM   2700 C  CG2  . THR B 1 147 ? 18.356  24.993  29.559  1.00 20.24 ? 273 THR B CG2  1 
ATOM   2701 N  N    . LEU B 1 148 ? 21.244  21.903  27.555  1.00 19.64 ? 274 LEU B N    1 
ATOM   2702 C  CA   . LEU B 1 148 ? 22.280  20.876  27.547  1.00 19.89 ? 274 LEU B CA   1 
ATOM   2703 C  C    . LEU B 1 148 ? 23.336  21.109  26.486  1.00 19.82 ? 274 LEU B C    1 
ATOM   2704 O  O    . LEU B 1 148 ? 24.415  20.518  26.561  1.00 19.49 ? 274 LEU B O    1 
ATOM   2705 C  CB   . LEU B 1 148 ? 21.673  19.502  27.324  1.00 20.62 ? 274 LEU B CB   1 
ATOM   2706 C  CG   . LEU B 1 148 ? 20.660  19.059  28.372  1.00 21.01 ? 274 LEU B CG   1 
ATOM   2707 C  CD1  . LEU B 1 148 ? 20.188  17.640  28.069  1.00 23.57 ? 274 LEU B CD1  1 
ATOM   2708 C  CD2  . LEU B 1 148 ? 21.258  19.159  29.795  1.00 22.29 ? 274 LEU B CD2  1 
ATOM   2709 N  N    . HIS B 1 149 ? 23.032  21.938  25.488  1.00 19.79 ? 275 HIS B N    1 
ATOM   2710 C  CA   . HIS B 1 149 ? 23.935  22.102  24.345  1.00 19.26 ? 275 HIS B CA   1 
ATOM   2711 C  C    . HIS B 1 149 ? 25.310  22.608  24.770  1.00 19.59 ? 275 HIS B C    1 
ATOM   2712 O  O    . HIS B 1 149 ? 26.337  22.204  24.200  1.00 20.15 ? 275 HIS B O    1 
ATOM   2713 C  CB   . HIS B 1 149 ? 23.335  23.046  23.297  1.00 19.73 ? 275 HIS B CB   1 
ATOM   2714 C  CG   . HIS B 1 149 ? 22.121  22.501  22.601  1.00 17.83 ? 275 HIS B CG   1 
ATOM   2715 N  ND1  . HIS B 1 149 ? 21.646  23.039  21.426  1.00 19.38 ? 275 HIS B ND1  1 
ATOM   2716 C  CD2  . HIS B 1 149 ? 21.304  21.463  22.894  1.00 19.10 ? 275 HIS B CD2  1 
ATOM   2717 C  CE1  . HIS B 1 149 ? 20.569  22.375  21.039  1.00 22.21 ? 275 HIS B CE1  1 
ATOM   2718 N  NE2  . HIS B 1 149 ? 20.342  21.406  21.906  1.00 20.19 ? 275 HIS B NE2  1 
ATOM   2719 N  N    . LYS B 1 150 ? 25.335  23.489  25.763  1.00 19.12 ? 276 LYS B N    1 
ATOM   2720 C  CA   . LYS B 1 150 ? 26.590  24.088  26.222  1.00 19.50 ? 276 LYS B CA   1 
ATOM   2721 C  C    . LYS B 1 150 ? 27.584  23.091  26.837  1.00 20.08 ? 276 LYS B C    1 
ATOM   2722 O  O    . LYS B 1 150 ? 28.761  23.413  26.955  1.00 21.02 ? 276 LYS B O    1 
ATOM   2723 C  CB   . LYS B 1 150 ? 26.316  25.234  27.191  1.00 20.62 ? 276 LYS B CB   1 
ATOM   2724 C  CG   . LYS B 1 150 ? 25.607  24.849  28.478  1.00 19.81 ? 276 LYS B CG   1 
ATOM   2725 C  CD   . LYS B 1 150 ? 25.359  26.091  29.342  1.00 21.59 ? 276 LYS B CD   1 
ATOM   2726 C  CE   . LYS B 1 150 ? 24.570  25.778  30.592  1.00 23.64 ? 276 LYS B CE   1 
ATOM   2727 N  NZ   . LYS B 1 150 ? 23.143  25.519  30.306  1.00 22.78 ? 276 LYS B NZ   1 
ATOM   2728 N  N    . PHE B 1 151 ? 27.110  21.911  27.224  1.00 19.79 ? 277 PHE B N    1 
ATOM   2729 C  CA   . PHE B 1 151 ? 27.956  20.890  27.842  1.00 19.82 ? 277 PHE B CA   1 
ATOM   2730 C  C    . PHE B 1 151 ? 28.555  19.925  26.821  1.00 20.16 ? 277 PHE B C    1 
ATOM   2731 O  O    . PHE B 1 151 ? 29.560  19.281  27.096  1.00 20.19 ? 277 PHE B O    1 
ATOM   2732 C  CB   . PHE B 1 151 ? 27.141  20.089  28.858  1.00 19.35 ? 277 PHE B CB   1 
ATOM   2733 C  CG   . PHE B 1 151 ? 26.615  20.918  29.997  1.00 18.91 ? 277 PHE B CG   1 
ATOM   2734 C  CD1  . PHE B 1 151 ? 27.488  21.630  30.803  1.00 19.53 ? 277 PHE B CD1  1 
ATOM   2735 C  CD2  . PHE B 1 151 ? 25.265  20.970  30.273  1.00 19.76 ? 277 PHE B CD2  1 
ATOM   2736 C  CE1  . PHE B 1 151 ? 27.026  22.405  31.856  1.00 19.58 ? 277 PHE B CE1  1 
ATOM   2737 C  CE2  . PHE B 1 151 ? 24.791  21.741  31.335  1.00 20.39 ? 277 PHE B CE2  1 
ATOM   2738 C  CZ   . PHE B 1 151 ? 25.671  22.450  32.127  1.00 18.95 ? 277 PHE B CZ   1 
ATOM   2739 N  N    . ALA B 1 152 ? 27.922  19.840  25.656  1.00 19.60 ? 278 ALA B N    1 
ATOM   2740 C  CA   . ALA B 1 152 ? 28.225  18.843  24.637  1.00 20.52 ? 278 ALA B CA   1 
ATOM   2741 C  C    . ALA B 1 152 ? 29.019  19.415  23.482  1.00 19.02 ? 278 ALA B C    1 
ATOM   2742 O  O    . ALA B 1 152 ? 29.062  20.625  23.256  1.00 19.89 ? 278 ALA B O    1 
ATOM   2743 C  CB   . ALA B 1 152 ? 26.933  18.244  24.101  1.00 20.68 ? 278 ALA B CB   1 
ATOM   2744 N  N    . SER B 1 153 ? 29.619  18.516  22.719  1.00 19.02 ? 279 SER B N    1 
ATOM   2745 C  CA   . SER B 1 153 ? 30.298  18.904  21.500  1.00 18.53 ? 279 SER B CA   1 
ATOM   2746 C  C    . SER B 1 153 ? 29.263  19.314  20.463  1.00 19.00 ? 279 SER B C    1 
ATOM   2747 O  O    . SER B 1 153 ? 28.059  19.142  20.694  1.00 19.23 ? 279 SER B O    1 
ATOM   2748 C  CB   . SER B 1 153 ? 31.182  17.760  21.001  1.00 18.98 ? 279 SER B CB   1 
ATOM   2749 O  OG   . SER B 1 153 ? 32.248  17.500  21.905  1.00 19.34 ? 279 SER B OG   1 
ATOM   2750 N  N    . LYS B 1 154 ? 29.722  19.873  19.341  1.00 18.37 ? 280 LYS B N    1 
ATOM   2751 C  CA   . LYS B 1 154 ? 28.829  20.319  18.264  1.00 19.15 ? 280 LYS B CA   1 
ATOM   2752 C  C    . LYS B 1 154 ? 29.046  19.500  16.998  1.00 18.42 ? 280 LYS B C    1 
ATOM   2753 O  O    . LYS B 1 154 ? 30.191  19.120  16.700  1.00 18.51 ? 280 LYS B O    1 
ATOM   2754 C  CB   . LYS B 1 154 ? 29.062  21.783  17.944  1.00 19.99 ? 280 LYS B CB   1 
ATOM   2755 C  CG   . LYS B 1 154 ? 28.810  22.753  19.071  1.00 23.38 ? 280 LYS B CG   1 
ATOM   2756 C  CD   . LYS B 1 154 ? 28.646  24.114  18.433  1.00 27.84 ? 280 LYS B CD   1 
ATOM   2757 C  CE   . LYS B 1 154 ? 28.865  25.226  19.369  1.00 30.57 ? 280 LYS B CE   1 
ATOM   2758 N  NZ   . LYS B 1 154 ? 28.817  26.488  18.564  1.00 27.78 ? 280 LYS B NZ   1 
ATOM   2759 N  N    . PRO B 1 155 ? 27.974  19.244  16.215  1.00 17.78 ? 281 PRO B N    1 
ATOM   2760 C  CA   . PRO B 1 155 ? 26.602  19.756  16.374  1.00 17.71 ? 281 PRO B CA   1 
ATOM   2761 C  C    . PRO B 1 155 ? 25.803  19.067  17.479  1.00 18.49 ? 281 PRO B C    1 
ATOM   2762 O  O    . PRO B 1 155 ? 25.962  17.872  17.720  1.00 18.25 ? 281 PRO B O    1 
ATOM   2763 C  CB   . PRO B 1 155 ? 25.965  19.476  15.012  1.00 17.08 ? 281 PRO B CB   1 
ATOM   2764 C  CG   . PRO B 1 155 ? 26.683  18.291  14.501  1.00 18.10 ? 281 PRO B CG   1 
ATOM   2765 C  CD   . PRO B 1 155 ? 28.103  18.405  15.009  1.00 17.96 ? 281 PRO B CD   1 
ATOM   2766 N  N    . ALA B 1 156 ? 24.948  19.840  18.146  1.00 18.71 ? 282 ALA B N    1 
ATOM   2767 C  CA   . ALA B 1 156 ? 24.037  19.307  19.148  1.00 19.30 ? 282 ALA B CA   1 
ATOM   2768 C  C    . ALA B 1 156 ? 23.195  18.152  18.585  1.00 18.81 ? 282 ALA B C    1 
ATOM   2769 O  O    . ALA B 1 156 ? 22.860  17.215  19.318  1.00 19.81 ? 282 ALA B O    1 
ATOM   2770 C  CB   . ALA B 1 156 ? 23.139  20.419  19.662  1.00 18.74 ? 282 ALA B CB   1 
ATOM   2771 N  N    . SER B 1 157 ? 22.858  18.193  17.299  1.00 19.23 ? 283 SER B N    1 
ATOM   2772 C  CA   . SER B 1 157 ? 22.066  17.107  16.708  1.00 19.55 ? 283 SER B CA   1 
ATOM   2773 C  C    . SER B 1 157 ? 22.782  15.739  16.729  1.00 19.87 ? 283 SER B C    1 
ATOM   2774 O  O    . SER B 1 157 ? 22.120  14.698  16.698  1.00 21.27 ? 283 SER B O    1 
ATOM   2775 C  CB   . SER B 1 157 ? 21.564  17.472  15.304  1.00 20.42 ? 283 SER B CB   1 
ATOM   2776 O  OG   . SER B 1 157 ? 22.627  17.866  14.467  1.00 19.26 ? 283 SER B OG   1 
ATOM   2777 N  N    . GLU B 1 158 ? 24.118  15.743  16.789  1.00 18.39 ? 284 GLU B N    1 
ATOM   2778 C  CA   . GLU B 1 158 ? 24.913  14.521  16.981  1.00 18.53 ? 284 GLU B CA   1 
ATOM   2779 C  C    . GLU B 1 158 ? 25.124  14.219  18.462  1.00 18.62 ? 284 GLU B C    1 
ATOM   2780 O  O    . GLU B 1 158 ? 24.962  13.073  18.894  1.00 19.45 ? 284 GLU B O    1 
ATOM   2781 C  CB   . GLU B 1 158 ? 26.283  14.638  16.281  1.00 18.70 ? 284 GLU B CB   1 
ATOM   2782 C  CG   . GLU B 1 158 ? 27.317  13.589  16.701  1.00 20.10 ? 284 GLU B CG   1 
ATOM   2783 C  CD   . GLU B 1 158 ? 26.947  12.152  16.347  1.00 22.33 ? 284 GLU B CD   1 
ATOM   2784 O  OE1  . GLU B 1 158 ? 25.984  11.932  15.583  1.00 23.96 ? 284 GLU B OE1  1 
ATOM   2785 O  OE2  . GLU B 1 158 ? 27.656  11.227  16.814  1.00 22.66 ? 284 GLU B OE2  1 
ATOM   2786 N  N    . PHE B 1 159 ? 25.493  15.239  19.235  1.00 18.76 ? 285 PHE B N    1 
ATOM   2787 C  CA   . PHE B 1 159 ? 26.027  15.023  20.581  1.00 17.73 ? 285 PHE B CA   1 
ATOM   2788 C  C    . PHE B 1 159 ? 25.034  15.125  21.732  1.00 18.89 ? 285 PHE B C    1 
ATOM   2789 O  O    . PHE B 1 159 ? 25.326  14.649  22.823  1.00 19.60 ? 285 PHE B O    1 
ATOM   2790 C  CB   . PHE B 1 159 ? 27.220  15.948  20.827  1.00 18.00 ? 285 PHE B CB   1 
ATOM   2791 C  CG   . PHE B 1 159 ? 28.408  15.631  19.953  1.00 17.92 ? 285 PHE B CG   1 
ATOM   2792 C  CD1  . PHE B 1 159 ? 29.215  14.537  20.231  1.00 18.06 ? 285 PHE B CD1  1 
ATOM   2793 C  CD2  . PHE B 1 159 ? 28.713  16.420  18.848  1.00 19.49 ? 285 PHE B CD2  1 
ATOM   2794 C  CE1  . PHE B 1 159 ? 30.305  14.235  19.410  1.00 18.01 ? 285 PHE B CE1  1 
ATOM   2795 C  CE2  . PHE B 1 159 ? 29.793  16.130  18.041  1.00 19.24 ? 285 PHE B CE2  1 
ATOM   2796 C  CZ   . PHE B 1 159 ? 30.598  15.037  18.325  1.00 17.35 ? 285 PHE B CZ   1 
ATOM   2797 N  N    . VAL B 1 160 ? 23.870  15.726  21.493  1.00 18.77 ? 286 VAL B N    1 
ATOM   2798 C  CA   . VAL B 1 160 ? 22.832  15.833  22.524  1.00 19.28 ? 286 VAL B CA   1 
ATOM   2799 C  C    . VAL B 1 160 ? 21.704  14.857  22.197  1.00 19.38 ? 286 VAL B C    1 
ATOM   2800 O  O    . VAL B 1 160 ? 21.046  14.982  21.171  1.00 20.67 ? 286 VAL B O    1 
ATOM   2801 C  CB   . VAL B 1 160 ? 22.285  17.266  22.631  1.00 19.79 ? 286 VAL B CB   1 
ATOM   2802 C  CG1  . VAL B 1 160 ? 21.175  17.364  23.706  1.00 18.58 ? 286 VAL B CG1  1 
ATOM   2803 C  CG2  . VAL B 1 160 ? 23.407  18.259  22.961  1.00 20.42 ? 286 VAL B CG2  1 
ATOM   2804 N  N    . LYS B 1 161 ? 21.505  13.877  23.071  1.00 20.11 ? 287 LYS B N    1 
ATOM   2805 C  CA   . LYS B 1 161 ? 20.438  12.899  22.922  1.00 19.92 ? 287 LYS B CA   1 
ATOM   2806 C  C    . LYS B 1 161 ? 19.369  13.206  23.963  1.00 19.77 ? 287 LYS B C    1 
ATOM   2807 O  O    . LYS B 1 161 ? 19.667  13.286  25.157  1.00 19.63 ? 287 LYS B O    1 
ATOM   2808 C  CB   . LYS B 1 161 ? 20.963  11.479  23.137  1.00 20.75 ? 287 LYS B CB   1 
ATOM   2809 C  CG   . LYS B 1 161 ? 22.235  11.122  22.384  1.00 24.74 ? 287 LYS B CG   1 
ATOM   2810 C  CD   . LYS B 1 161 ? 22.068  11.183  20.883  1.00 26.14 ? 287 LYS B CD   1 
ATOM   2811 C  CE   . LYS B 1 161 ? 23.343  10.692  20.191  1.00 27.03 ? 287 LYS B CE   1 
ATOM   2812 N  NZ   . LYS B 1 161 ? 23.287  10.851  18.715  1.00 27.07 ? 287 LYS B NZ   1 
ATOM   2813 N  N    . ILE B 1 162 ? 18.131  13.360  23.513  1.00 19.64 ? 288 ILE B N    1 
ATOM   2814 C  CA   . ILE B 1 162 ? 16.995  13.562  24.410  1.00 19.62 ? 288 ILE B CA   1 
ATOM   2815 C  C    . ILE B 1 162 ? 16.135  12.300  24.373  1.00 20.07 ? 288 ILE B C    1 
ATOM   2816 O  O    . ILE B 1 162 ? 15.627  11.909  23.307  1.00 20.46 ? 288 ILE B O    1 
ATOM   2817 C  CB   . ILE B 1 162 ? 16.161  14.788  23.997  1.00 19.53 ? 288 ILE B CB   1 
ATOM   2818 C  CG1  . ILE B 1 162 ? 17.022  16.062  23.940  1.00 19.94 ? 288 ILE B CG1  1 
ATOM   2819 C  CG2  . ILE B 1 162 ? 14.954  14.983  24.937  1.00 19.86 ? 288 ILE B CG2  1 
ATOM   2820 C  CD1  . ILE B 1 162 ? 17.732  16.418  25.246  1.00 19.75 ? 288 ILE B CD1  1 
ATOM   2821 N  N    . LEU B 1 163 ? 16.010  11.652  25.530  1.00 19.56 ? 289 LEU B N    1 
ATOM   2822 C  CA   A LEU B 1 163 ? 15.218  10.434  25.679  0.60 20.20 ? 289 LEU B CA   1 
ATOM   2823 C  CA   B LEU B 1 163 ? 15.222  10.435  25.673  0.40 19.92 ? 289 LEU B CA   1 
ATOM   2824 C  C    . LEU B 1 163 ? 14.000  10.702  26.545  1.00 20.68 ? 289 LEU B C    1 
ATOM   2825 O  O    . LEU B 1 163 ? 14.110  11.297  27.611  1.00 21.63 ? 289 LEU B O    1 
ATOM   2826 C  CB   A LEU B 1 163 ? 16.039  9.332   26.342  0.60 20.39 ? 289 LEU B CB   1 
ATOM   2827 C  CB   B LEU B 1 163 ? 16.071  9.325   26.297  0.40 19.75 ? 289 LEU B CB   1 
ATOM   2828 C  CG   A LEU B 1 163 ? 17.298  8.852   25.623  0.60 20.58 ? 289 LEU B CG   1 
ATOM   2829 C  CG   B LEU B 1 163 ? 16.965  8.521   25.349  0.40 18.64 ? 289 LEU B CG   1 
ATOM   2830 C  CD1  A LEU B 1 163 ? 17.997  7.801   26.477  0.60 21.02 ? 289 LEU B CD1  1 
ATOM   2831 C  CD1  B LEU B 1 163 ? 17.921  9.406   24.541  0.40 18.26 ? 289 LEU B CD1  1 
ATOM   2832 C  CD2  A LEU B 1 163 ? 16.988  8.314   24.230  0.60 21.34 ? 289 LEU B CD2  1 
ATOM   2833 C  CD2  B LEU B 1 163 ? 17.741  7.481   26.140  0.40 18.61 ? 289 LEU B CD2  1 
ATOM   2834 N  N    . ASP B 1 164 ? 12.837  10.242  26.108  1.00 21.23 ? 290 ASP B N    1 
ATOM   2835 C  CA   . ASP B 1 164 ? 11.628  10.471  26.898  1.00 22.36 ? 290 ASP B CA   1 
ATOM   2836 C  C    . ASP B 1 164 ? 11.544  9.605   28.157  1.00 21.03 ? 290 ASP B C    1 
ATOM   2837 O  O    . ASP B 1 164 ? 10.904  9.998   29.129  1.00 21.70 ? 290 ASP B O    1 
ATOM   2838 C  CB   . ASP B 1 164 ? 10.375  10.276  26.049  1.00 23.76 ? 290 ASP B CB   1 
ATOM   2839 C  CG   . ASP B 1 164 ? 10.108  8.827   25.727  1.00 26.69 ? 290 ASP B CG   1 
ATOM   2840 O  OD1  . ASP B 1 164 ? 11.080  8.100   25.453  1.00 33.76 ? 290 ASP B OD1  1 
ATOM   2841 O  OD2  . ASP B 1 164 ? 8.927   8.409   25.749  1.00 35.22 ? 290 ASP B OD2  1 
ATOM   2842 N  N    . THR B 1 165 ? 12.168  8.428   28.133  1.00 20.15 ? 291 THR B N    1 
ATOM   2843 C  CA   . THR B 1 165 ? 12.129  7.506   29.266  1.00 20.36 ? 291 THR B CA   1 
ATOM   2844 C  C    . THR B 1 165 ? 13.475  6.827   29.479  1.00 19.78 ? 291 THR B C    1 
ATOM   2845 O  O    . THR B 1 165 ? 14.303  6.801   28.575  1.00 18.76 ? 291 THR B O    1 
ATOM   2846 C  CB   . THR B 1 165 ? 11.078  6.400   29.062  1.00 20.69 ? 291 THR B CB   1 
ATOM   2847 O  OG1  . THR B 1 165 ? 11.544  5.470   28.074  1.00 22.96 ? 291 THR B OG1  1 
ATOM   2848 C  CG2  . THR B 1 165 ? 9.741   6.987   28.631  1.00 22.70 ? 291 THR B CG2  1 
ATOM   2849 N  N    . PHE B 1 166 ? 13.677  6.256   30.670  1.00 20.05 ? 292 PHE B N    1 
ATOM   2850 C  CA   . PHE B 1 166 ? 14.927  5.545   30.980  1.00 20.39 ? 292 PHE B CA   1 
ATOM   2851 C  C    . PHE B 1 166 ? 15.003  4.205   30.252  1.00 21.12 ? 292 PHE B C    1 
ATOM   2852 O  O    . PHE B 1 166 ? 16.090  3.700   29.992  1.00 21.22 ? 292 PHE B O    1 
ATOM   2853 C  CB   . PHE B 1 166 ? 15.109  5.378   32.491  1.00 20.63 ? 292 PHE B CB   1 
ATOM   2854 C  CG   . PHE B 1 166 ? 15.392  6.665   33.181  1.00 20.52 ? 292 PHE B CG   1 
ATOM   2855 C  CD1  . PHE B 1 166 ? 16.695  7.056   33.447  1.00 21.15 ? 292 PHE B CD1  1 
ATOM   2856 C  CD2  . PHE B 1 166 ? 14.356  7.531   33.506  1.00 20.64 ? 292 PHE B CD2  1 
ATOM   2857 C  CE1  . PHE B 1 166 ? 16.957  8.271   34.050  1.00 23.77 ? 292 PHE B CE1  1 
ATOM   2858 C  CE2  . PHE B 1 166 ? 14.616  8.746   34.100  1.00 22.16 ? 292 PHE B CE2  1 
ATOM   2859 C  CZ   . PHE B 1 166 ? 15.922  9.117   34.373  1.00 20.29 ? 292 PHE B CZ   1 
ATOM   2860 N  N    . GLU B 1 167 ? 13.846  3.656   29.893  1.00 21.41 ? 293 GLU B N    1 
ATOM   2861 C  CA   . GLU B 1 167 ? 13.794  2.446   29.078  1.00 22.75 ? 293 GLU B CA   1 
ATOM   2862 C  C    . GLU B 1 167 ? 14.445  2.632   27.708  1.00 22.64 ? 293 GLU B C    1 
ATOM   2863 O  O    . GLU B 1 167 ? 14.935  1.668   27.123  1.00 23.84 ? 293 GLU B O    1 
ATOM   2864 C  CB   . GLU B 1 167 ? 12.346  1.959   28.916  1.00 23.28 ? 293 GLU B CB   1 
ATOM   2865 C  CG   . GLU B 1 167 ? 11.768  1.338   30.189  1.00 26.26 ? 293 GLU B CG   1 
ATOM   2866 C  CD   . GLU B 1 167 ? 11.263  2.361   31.211  1.00 27.99 ? 293 GLU B CD   1 
ATOM   2867 O  OE1  . GLU B 1 167 ? 11.430  3.579   30.997  1.00 30.15 ? 293 GLU B OE1  1 
ATOM   2868 O  OE2  . GLU B 1 167 ? 10.687  1.933   32.240  1.00 32.45 ? 293 GLU B OE2  1 
ATOM   2869 N  N    . LYS B 1 168 ? 14.473  3.865   27.206  1.00 22.56 ? 294 LYS B N    1 
ATOM   2870 C  CA   . LYS B 1 168 ? 15.100  4.150   25.912  1.00 22.49 ? 294 LYS B CA   1 
ATOM   2871 C  C    . LYS B 1 168 ? 16.643  4.120   25.912  1.00 22.17 ? 294 LYS B C    1 
ATOM   2872 O  O    . LYS B 1 168 ? 17.247  4.176   24.850  1.00 21.49 ? 294 LYS B O    1 
ATOM   2873 C  CB   . LYS B 1 168 ? 14.603  5.481   25.349  1.00 23.31 ? 294 LYS B CB   1 
ATOM   2874 C  CG   . LYS B 1 168 ? 13.141  5.432   24.906  1.00 25.72 ? 294 LYS B CG   1 
ATOM   2875 C  CD   . LYS B 1 168 ? 12.888  6.373   23.750  1.00 29.27 ? 294 LYS B CD   1 
ATOM   2876 C  CE   . LYS B 1 168 ? 11.510  6.165   23.143  1.00 29.72 ? 294 LYS B CE   1 
ATOM   2877 N  NZ   . LYS B 1 168 ? 10.457  5.953   24.170  1.00 30.19 ? 294 LYS B NZ   1 
ATOM   2878 N  N    . LEU B 1 169 ? 17.281  4.022   27.075  1.00 22.45 ? 295 LEU B N    1 
ATOM   2879 C  CA   . LEU B 1 169 ? 18.747  3.862   27.113  1.00 23.36 ? 295 LEU B CA   1 
ATOM   2880 C  C    . LEU B 1 169 ? 19.182  2.625   26.320  1.00 25.65 ? 295 LEU B C    1 
ATOM   2881 O  O    . LEU B 1 169 ? 20.235  2.628   25.670  1.00 25.44 ? 295 LEU B O    1 
ATOM   2882 C  CB   . LEU B 1 169 ? 19.252  3.764   28.557  1.00 23.25 ? 295 LEU B CB   1 
ATOM   2883 C  CG   . LEU B 1 169 ? 19.380  5.087   29.308  1.00 21.00 ? 295 LEU B CG   1 
ATOM   2884 C  CD1  . LEU B 1 169 ? 19.517  4.843   30.818  1.00 22.04 ? 295 LEU B CD1  1 
ATOM   2885 C  CD2  . LEU B 1 169 ? 20.558  5.925   28.762  1.00 22.72 ? 295 LEU B CD2  1 
ATOM   2886 N  N    . LYS B 1 170 ? 18.348  1.587   26.360  1.00 27.35 ? 296 LYS B N    1 
ATOM   2887 C  CA   . LYS B 1 170 ? 18.566  0.348   25.600  1.00 29.39 ? 296 LYS B CA   1 
ATOM   2888 C  C    . LYS B 1 170 ? 18.710  0.580   24.098  1.00 29.91 ? 296 LYS B C    1 
ATOM   2889 O  O    . LYS B 1 170 ? 19.417  -0.162  23.418  1.00 30.53 ? 296 LYS B O    1 
ATOM   2890 C  CB   . LYS B 1 170 ? 17.400  -0.621  25.821  1.00 30.02 ? 296 LYS B CB   1 
ATOM   2891 C  CG   . LYS B 1 170 ? 17.224  -1.113  27.256  1.00 32.76 ? 296 LYS B CG   1 
ATOM   2892 C  CD   . LYS B 1 170 ? 18.277  -2.144  27.619  1.00 35.12 ? 296 LYS B CD   1 
ATOM   2893 C  CE   . LYS B 1 170 ? 18.018  -2.739  28.986  1.00 35.78 ? 296 LYS B CE   1 
ATOM   2894 N  NZ   . LYS B 1 170 ? 19.134  -3.618  29.420  1.00 37.79 ? 296 LYS B NZ   1 
ATOM   2895 N  N    . ASP B 1 171 ? 18.032  1.603   23.581  1.00 30.11 ? 297 ASP B N    1 
ATOM   2896 C  CA   . ASP B 1 171 ? 18.024  1.884   22.146  1.00 30.72 ? 297 ASP B CA   1 
ATOM   2897 C  C    . ASP B 1 171 ? 19.273  2.598   21.635  1.00 30.72 ? 297 ASP B C    1 
ATOM   2898 O  O    . ASP B 1 171 ? 19.414  2.788   20.430  1.00 30.65 ? 297 ASP B O    1 
ATOM   2899 C  CB   . ASP B 1 171 ? 16.790  2.714   21.780  1.00 31.48 ? 297 ASP B CB   1 
ATOM   2900 C  CG   . ASP B 1 171 ? 15.489  2.031   22.162  1.00 32.14 ? 297 ASP B CG   1 
ATOM   2901 O  OD1  . ASP B 1 171 ? 15.499  0.806   22.427  1.00 36.45 ? 297 ASP B OD1  1 
ATOM   2902 O  OD2  . ASP B 1 171 ? 14.448  2.718   22.194  1.00 35.32 ? 297 ASP B OD2  1 
ATOM   2903 N  N    . LEU B 1 172 ? 20.172  3.007   22.535  1.00 30.01 ? 298 LEU B N    1 
ATOM   2904 C  CA   . LEU B 1 172 ? 21.388  3.721   22.136  1.00 30.35 ? 298 LEU B CA   1 
ATOM   2905 C  C    . LEU B 1 172 ? 22.566  2.811   21.753  1.00 30.72 ? 298 LEU B C    1 
ATOM   2906 O  O    . LEU B 1 172 ? 23.509  3.274   21.105  1.00 30.95 ? 298 LEU B O    1 
ATOM   2907 C  CB   . LEU B 1 172 ? 21.825  4.671   23.255  1.00 30.48 ? 298 LEU B CB   1 
ATOM   2908 C  CG   . LEU B 1 172 ? 21.024  5.960   23.419  1.00 30.63 ? 298 LEU B CG   1 
ATOM   2909 C  CD1  . LEU B 1 172 ? 21.485  6.708   24.662  1.00 31.78 ? 298 LEU B CD1  1 
ATOM   2910 C  CD2  . LEU B 1 172 ? 21.171  6.852   22.189  1.00 31.57 ? 298 LEU B CD2  1 
ATOM   2911 N  N    . PHE B 1 173 ? 22.516  1.531   22.135  1.00 31.20 ? 299 PHE B N    1 
ATOM   2912 C  CA   . PHE B 1 173 ? 23.672  0.624   21.974  1.00 31.05 ? 299 PHE B CA   1 
ATOM   2913 C  C    . PHE B 1 173 ? 24.210  0.527   20.549  1.00 31.05 ? 299 PHE B C    1 
ATOM   2914 O  O    . PHE B 1 173 ? 25.426  0.628   20.330  1.00 31.03 ? 299 PHE B O    1 
ATOM   2915 C  CB   . PHE B 1 173 ? 23.342  -0.799  22.447  1.00 31.19 ? 299 PHE B CB   1 
ATOM   2916 C  CG   . PHE B 1 173 ? 23.038  -0.911  23.916  1.00 31.49 ? 299 PHE B CG   1 
ATOM   2917 C  CD1  . PHE B 1 173 ? 23.888  -0.362  24.868  1.00 31.41 ? 299 PHE B CD1  1 
ATOM   2918 C  CD2  . PHE B 1 173 ? 21.913  -1.609  24.349  1.00 32.12 ? 299 PHE B CD2  1 
ATOM   2919 C  CE1  . PHE B 1 173 ? 23.605  -0.481  26.223  1.00 32.03 ? 299 PHE B CE1  1 
ATOM   2920 C  CE2  . PHE B 1 173 ? 21.628  -1.731  25.700  1.00 31.48 ? 299 PHE B CE2  1 
ATOM   2921 C  CZ   . PHE B 1 173 ? 22.479  -1.164  26.638  1.00 31.50 ? 299 PHE B CZ   1 
ATOM   2922 N  N    . THR B 1 174 ? 23.318  0.296   19.587  1.00 30.75 ? 300 THR B N    1 
ATOM   2923 C  CA   . THR B 1 174 ? 23.730  0.133   18.194  1.00 31.20 ? 300 THR B CA   1 
ATOM   2924 C  C    . THR B 1 174 ? 24.485  1.367   17.713  1.00 30.99 ? 300 THR B C    1 
ATOM   2925 O  O    . THR B 1 174 ? 25.520  1.242   17.054  1.00 31.61 ? 300 THR B O    1 
ATOM   2926 C  CB   . THR B 1 174 ? 22.532  -0.130  17.256  1.00 31.33 ? 300 THR B CB   1 
ATOM   2927 O  OG1  . THR B 1 174 ? 21.841  -1.310  17.679  1.00 32.88 ? 300 THR B OG1  1 
ATOM   2928 C  CG2  . THR B 1 174 ? 23.001  -0.315  15.813  1.00 31.88 ? 300 THR B CG2  1 
ATOM   2929 N  N    . GLU B 1 175 ? 23.978  2.548   18.060  1.00 30.75 ? 301 GLU B N    1 
ATOM   2930 C  CA   . GLU B 1 175 ? 24.613  3.804   17.650  1.00 30.62 ? 301 GLU B CA   1 
ATOM   2931 C  C    . GLU B 1 175 ? 25.981  3.992   18.299  1.00 30.31 ? 301 GLU B C    1 
ATOM   2932 O  O    . GLU B 1 175 ? 26.958  4.337   17.632  1.00 30.19 ? 301 GLU B O    1 
ATOM   2933 C  CB   . GLU B 1 175 ? 23.725  5.007   17.983  1.00 30.95 ? 301 GLU B CB   1 
ATOM   2934 C  CG   . GLU B 1 175 ? 24.195  6.271   17.280  1.00 31.88 ? 301 GLU B CG   1 
ATOM   2935 C  CD   . GLU B 1 175 ? 23.578  7.544   17.819  1.00 32.88 ? 301 GLU B CD   1 
ATOM   2936 O  OE1  . GLU B 1 175 ? 22.409  7.509   18.272  1.00 29.80 ? 301 GLU B OE1  1 
ATOM   2937 O  OE2  . GLU B 1 175 ? 24.271  8.586   17.753  1.00 31.67 ? 301 GLU B OE2  1 
ATOM   2938 N  N    . LEU B 1 176 ? 26.034  3.778   19.606  1.00 30.02 ? 302 LEU B N    1 
ATOM   2939 C  CA   . LEU B 1 176 ? 27.270  3.914   20.363  1.00 30.28 ? 302 LEU B CA   1 
ATOM   2940 C  C    . LEU B 1 176 ? 28.349  2.985   19.792  1.00 30.39 ? 302 LEU B C    1 
ATOM   2941 O  O    . LEU B 1 176 ? 29.490  3.410   19.568  1.00 30.48 ? 302 LEU B O    1 
ATOM   2942 C  CB   . LEU B 1 176 ? 27.006  3.608   21.842  1.00 30.31 ? 302 LEU B CB   1 
ATOM   2943 C  CG   . LEU B 1 176 ? 28.164  3.762   22.836  1.00 30.30 ? 302 LEU B CG   1 
ATOM   2944 C  CD1  . LEU B 1 176 ? 27.626  4.025   24.241  1.00 30.05 ? 302 LEU B CD1  1 
ATOM   2945 C  CD2  . LEU B 1 176 ? 29.071  2.533   22.849  1.00 30.38 ? 302 LEU B CD2  1 
ATOM   2946 N  N    . GLN B 1 177 ? 27.978  1.739   19.517  1.00 30.24 ? 303 GLN B N    1 
ATOM   2947 C  CA   . GLN B 1 177 ? 28.936  0.736   19.030  1.00 30.87 ? 303 GLN B CA   1 
ATOM   2948 C  C    . GLN B 1 177 ? 29.441  1.015   17.615  1.00 30.84 ? 303 GLN B C    1 
ATOM   2949 O  O    . GLN B 1 177 ? 30.545  0.598   17.258  1.00 31.20 ? 303 GLN B O    1 
ATOM   2950 C  CB   . GLN B 1 177 ? 28.335  -0.667  19.104  1.00 31.55 ? 303 GLN B CB   1 
ATOM   2951 C  CG   . GLN B 1 177 ? 28.172  -1.160  20.530  1.00 33.81 ? 303 GLN B CG   1 
ATOM   2952 C  CD   . GLN B 1 177 ? 27.416  -2.469  20.616  1.00 36.12 ? 303 GLN B CD   1 
ATOM   2953 O  OE1  . GLN B 1 177 ? 26.391  -2.563  21.292  1.00 38.68 ? 303 GLN B OE1  1 
ATOM   2954 N  NE2  . GLN B 1 177 ? 27.913  -3.489  19.919  1.00 38.41 ? 303 GLN B NE2  1 
ATOM   2955 N  N    . LYS B 1 178 ? 28.637  1.715   16.818  1.00 30.42 ? 304 LYS B N    1 
ATOM   2956 C  CA   . LYS B 1 178 ? 29.011  2.039   15.442  1.00 31.00 ? 304 LYS B CA   1 
ATOM   2957 C  C    . LYS B 1 178 ? 29.950  3.243   15.334  1.00 30.45 ? 304 LYS B C    1 
ATOM   2958 O  O    . LYS B 1 178 ? 30.438  3.522   14.243  1.00 30.83 ? 304 LYS B O    1 
ATOM   2959 C  CB   . LYS B 1 178 ? 27.764  2.290   14.576  1.00 31.37 ? 304 LYS B CB   1 
ATOM   2960 C  CG   . LYS B 1 178 ? 27.039  1.031   14.148  1.00 33.43 ? 304 LYS B CG   1 
ATOM   2961 C  CD   . LYS B 1 178 ? 25.768  1.348   13.358  1.00 35.61 ? 304 LYS B CD   1 
ATOM   2962 C  CE   . LYS B 1 178 ? 25.273  0.143   12.551  1.00 36.36 ? 304 LYS B CE   1 
ATOM   2963 N  NZ   . LYS B 1 178 ? 24.786  -0.983  13.408  1.00 37.85 ? 304 LYS B NZ   1 
ATOM   2964 N  N    . LYS B 1 179 ? 30.199  3.967   16.427  1.00 29.80 ? 305 LYS B N    1 
ATOM   2965 C  CA   . LYS B 1 179 ? 31.057  5.161   16.335  1.00 29.38 ? 305 LYS B CA   1 
ATOM   2966 C  C    . LYS B 1 179 ? 32.484  4.778   15.967  1.00 28.37 ? 305 LYS B C    1 
ATOM   2967 O  O    . LYS B 1 179 ? 33.024  3.788   16.464  1.00 28.24 ? 305 LYS B O    1 
ATOM   2968 C  CB   . LYS B 1 179 ? 31.094  5.971   17.636  1.00 30.87 ? 305 LYS B CB   1 
ATOM   2969 C  CG   . LYS B 1 179 ? 29.751  6.507   18.120  1.00 31.37 ? 305 LYS B CG   1 
ATOM   2970 C  CD   . LYS B 1 179 ? 29.123  7.513   17.171  1.00 30.12 ? 305 LYS B CD   1 
ATOM   2971 C  CE   . LYS B 1 179 ? 27.834  8.053   17.767  1.00 29.51 ? 305 LYS B CE   1 
ATOM   2972 N  NZ   . LYS B 1 179 ? 26.905  8.605   16.733  1.00 27.88 ? 305 LYS B NZ   1 
ATOM   2973 N  N    . ILE B 1 180 ? 33.063  5.573   15.072  1.00 27.35 ? 306 ILE B N    1 
ATOM   2974 C  CA   . ILE B 1 180 ? 34.475  5.481   14.715  1.00 27.82 ? 306 ILE B CA   1 
ATOM   2975 C  C    . ILE B 1 180 ? 35.037  6.876   14.949  1.00 27.33 ? 306 ILE B C    1 
ATOM   2976 O  O    . ILE B 1 180 ? 34.684  7.816   14.238  1.00 26.21 ? 306 ILE B O    1 
ATOM   2977 C  CB   . ILE B 1 180 ? 34.676  5.061   13.254  1.00 28.10 ? 306 ILE B CB   1 
ATOM   2978 C  CG1  . ILE B 1 180 ? 34.024  3.691   12.997  1.00 28.85 ? 306 ILE B CG1  1 
ATOM   2979 C  CG2  . ILE B 1 180 ? 36.164  5.017   12.926  1.00 27.79 ? 306 ILE B CG2  1 
ATOM   2980 C  CD1  . ILE B 1 180 ? 33.896  3.318   11.542  1.00 30.12 ? 306 ILE B CD1  1 
ATOM   2981 N  N    . TYR B 1 181 ? 35.880  7.009   15.967  1.00 27.51 ? 307 TYR B N    1 
ATOM   2982 C  CA   . TYR B 1 181 ? 36.382  8.313   16.392  1.00 27.74 ? 307 TYR B CA   1 
ATOM   2983 C  C    . TYR B 1 181 ? 37.535  8.785   15.530  1.00 27.80 ? 307 TYR B C    1 
ATOM   2984 O  O    . TYR B 1 181 ? 38.555  8.079   15.393  1.00 29.63 ? 307 TYR B O    1 
ATOM   2985 C  CB   . TYR B 1 181 ? 36.771  8.293   17.877  1.00 27.59 ? 307 TYR B CB   1 
ATOM   2986 C  CG   . TYR B 1 181 ? 35.535  8.140   18.741  1.00 27.63 ? 307 TYR B CG   1 
ATOM   2987 C  CD1  . TYR B 1 181 ? 34.751  9.244   19.080  1.00 27.20 ? 307 TYR B CD1  1 
ATOM   2988 C  CD2  . TYR B 1 181 ? 35.111  6.887   19.159  1.00 29.58 ? 307 TYR B CD2  1 
ATOM   2989 C  CE1  . TYR B 1 181 ? 33.595  9.102   19.831  1.00 27.59 ? 307 TYR B CE1  1 
ATOM   2990 C  CE2  . TYR B 1 181 ? 33.965  6.743   19.921  1.00 28.03 ? 307 TYR B CE2  1 
ATOM   2991 C  CZ   . TYR B 1 181 ? 33.211  7.853   20.245  1.00 28.07 ? 307 TYR B CZ   1 
ATOM   2992 O  OH   . TYR B 1 181 ? 32.075  7.702   20.994  1.00 30.04 ? 307 TYR B OH   1 
ATOM   2993 O  OXT  . TYR B 1 181 ? 37.448  9.884   14.967  1.00 28.32 ? 307 TYR B OXT  1 
ATOM   2994 N  N    . GLY C 1 2   ? 3.883   -23.812 5.983   1.00 24.12 ? 128 GLY C N    1 
ATOM   2995 C  CA   . GLY C 1 2   ? 4.929   -22.738 6.109   1.00 23.66 ? 128 GLY C CA   1 
ATOM   2996 C  C    . GLY C 1 2   ? 4.772   -21.576 5.134   1.00 22.58 ? 128 GLY C C    1 
ATOM   2997 O  O    . GLY C 1 2   ? 5.618   -20.676 5.065   1.00 23.76 ? 128 GLY C O    1 
ATOM   2998 N  N    . ASN C 1 3   ? 3.684   -21.592 4.375   1.00 19.74 ? 129 ASN C N    1 
ATOM   2999 C  CA   . ASN C 1 3   ? 3.393   -20.525 3.442   1.00 18.61 ? 129 ASN C CA   1 
ATOM   3000 C  C    . ASN C 1 3   ? 2.837   -19.295 4.173   1.00 17.74 ? 129 ASN C C    1 
ATOM   3001 O  O    . ASN C 1 3   ? 2.029   -19.407 5.111   1.00 17.65 ? 129 ASN C O    1 
ATOM   3002 C  CB   . ASN C 1 3   ? 2.418   -21.004 2.360   1.00 18.83 ? 129 ASN C CB   1 
ATOM   3003 C  CG   . ASN C 1 3   ? 3.030   -22.063 1.447   1.00 20.66 ? 129 ASN C CG   1 
ATOM   3004 O  OD1  . ASN C 1 3   ? 4.246   -22.086 1.222   1.00 22.24 ? 129 ASN C OD1  1 
ATOM   3005 N  ND2  . ASN C 1 3   ? 2.190   -22.952 0.929   1.00 24.56 ? 129 ASN C ND2  1 
ATOM   3006 N  N    . VAL C 1 4   ? 3.302   -18.126 3.742   1.00 16.49 ? 130 VAL C N    1 
ATOM   3007 C  CA   . VAL C 1 4   ? 2.901   -16.836 4.301   1.00 16.12 ? 130 VAL C CA   1 
ATOM   3008 C  C    . VAL C 1 4   ? 2.455   -15.899 3.175   1.00 16.65 ? 130 VAL C C    1 
ATOM   3009 O  O    . VAL C 1 4   ? 3.197   -15.682 2.220   1.00 16.67 ? 130 VAL C O    1 
ATOM   3010 C  CB   . VAL C 1 4   ? 4.086   -16.161 5.073   1.00 15.48 ? 130 VAL C CB   1 
ATOM   3011 C  CG1  . VAL C 1 4   ? 3.718   -14.721 5.502   1.00 17.78 ? 130 VAL C CG1  1 
ATOM   3012 C  CG2  . VAL C 1 4   ? 4.527   -17.039 6.265   1.00 18.29 ? 130 VAL C CG2  1 
ATOM   3013 N  N    . ASP C 1 5   ? 1.253   -15.352 3.293   1.00 16.03 ? 131 ASP C N    1 
ATOM   3014 C  CA   . ASP C 1 5   ? 0.725   -14.327 2.388   1.00 16.64 ? 131 ASP C CA   1 
ATOM   3015 C  C    . ASP C 1 5   ? 0.726   -13.025 3.167   1.00 16.51 ? 131 ASP C C    1 
ATOM   3016 O  O    . ASP C 1 5   ? -0.071  -12.854 4.095   1.00 16.76 ? 131 ASP C O    1 
ATOM   3017 C  CB   . ASP C 1 5   ? -0.726  -14.647 1.984   1.00 16.85 ? 131 ASP C CB   1 
ATOM   3018 C  CG   . ASP C 1 5   ? -0.830  -15.683 0.871   1.00 19.09 ? 131 ASP C CG   1 
ATOM   3019 O  OD1  . ASP C 1 5   ? 0.205   -16.214 0.402   1.00 19.24 ? 131 ASP C OD1  1 
ATOM   3020 O  OD2  . ASP C 1 5   ? -1.986  -15.980 0.469   1.00 19.48 ? 131 ASP C OD2  1 
ATOM   3021 N  N    . LEU C 1 6   ? 1.634   -12.117 2.820   1.00 16.57 ? 132 LEU C N    1 
ATOM   3022 C  CA   . LEU C 1 6   ? 1.855   -10.910 3.600   1.00 15.72 ? 132 LEU C CA   1 
ATOM   3023 C  C    . LEU C 1 6   ? 1.502   -9.659  2.811   1.00 16.53 ? 132 LEU C C    1 
ATOM   3024 O  O    . LEU C 1 6   ? 1.930   -9.473  1.678   1.00 16.79 ? 132 LEU C O    1 
ATOM   3025 C  CB   . LEU C 1 6   ? 3.330   -10.842 4.045   1.00 15.81 ? 132 LEU C CB   1 
ATOM   3026 C  CG   . LEU C 1 6   ? 3.701   -9.755  5.067   1.00 16.79 ? 132 LEU C CG   1 
ATOM   3027 C  CD1  . LEU C 1 6   ? 4.840   -10.228 5.962   1.00 18.97 ? 132 LEU C CD1  1 
ATOM   3028 C  CD2  . LEU C 1 6   ? 4.050   -8.415  4.408   1.00 18.94 ? 132 LEU C CD2  1 
ATOM   3029 N  N    . VAL C 1 7   ? 0.701   -8.798  3.430   1.00 16.16 ? 133 VAL C N    1 
ATOM   3030 C  CA   . VAL C 1 7   ? 0.351   -7.512  2.867   1.00 15.76 ? 133 VAL C CA   1 
ATOM   3031 C  C    . VAL C 1 7   ? 1.029   -6.392  3.640   1.00 16.06 ? 133 VAL C C    1 
ATOM   3032 O  O    . VAL C 1 7   ? 0.965   -6.356  4.877   1.00 16.59 ? 133 VAL C O    1 
ATOM   3033 C  CB   . VAL C 1 7   ? -1.184  -7.285  2.914   1.00 16.36 ? 133 VAL C CB   1 
ATOM   3034 C  CG1  . VAL C 1 7   ? -1.542  -5.911  2.359   1.00 18.73 ? 133 VAL C CG1  1 
ATOM   3035 C  CG2  . VAL C 1 7   ? -1.904  -8.393  2.144   1.00 16.63 ? 133 VAL C CG2  1 
ATOM   3036 N  N    . PHE C 1 8   ? 1.673   -5.484  2.909   1.00 16.40 ? 134 PHE C N    1 
ATOM   3037 C  CA   . PHE C 1 8   ? 2.141   -4.221  3.468   1.00 16.98 ? 134 PHE C CA   1 
ATOM   3038 C  C    . PHE C 1 8   ? 1.021   -3.179  3.297   1.00 17.02 ? 134 PHE C C    1 
ATOM   3039 O  O    . PHE C 1 8   ? 0.548   -2.957  2.179   1.00 17.81 ? 134 PHE C O    1 
ATOM   3040 C  CB   . PHE C 1 8   ? 3.381   -3.691  2.743   1.00 17.09 ? 134 PHE C CB   1 
ATOM   3041 C  CG   . PHE C 1 8   ? 4.555   -4.649  2.685   1.00 16.99 ? 134 PHE C CG   1 
ATOM   3042 C  CD1  . PHE C 1 8   ? 5.431   -4.764  3.752   1.00 17.44 ? 134 PHE C CD1  1 
ATOM   3043 C  CD2  . PHE C 1 8   ? 4.807   -5.384  1.539   1.00 18.24 ? 134 PHE C CD2  1 
ATOM   3044 C  CE1  . PHE C 1 8   ? 6.543   -5.605  3.675   1.00 17.25 ? 134 PHE C CE1  1 
ATOM   3045 C  CE2  . PHE C 1 8   ? 5.899   -6.240  1.466   1.00 18.60 ? 134 PHE C CE2  1 
ATOM   3046 C  CZ   . PHE C 1 8   ? 6.760   -6.349  2.538   1.00 18.12 ? 134 PHE C CZ   1 
ATOM   3047 N  N    . LEU C 1 9   ? 0.636   -2.535  4.393   1.00 15.79 ? 135 LEU C N    1 
ATOM   3048 C  CA   . LEU C 1 9   ? -0.383  -1.481  4.382   1.00 16.47 ? 135 LEU C CA   1 
ATOM   3049 C  C    . LEU C 1 9   ? 0.310   -0.219  4.875   1.00 15.51 ? 135 LEU C C    1 
ATOM   3050 O  O    . LEU C 1 9   ? 0.692   -0.121  6.061   1.00 16.44 ? 135 LEU C O    1 
ATOM   3051 C  CB   . LEU C 1 9   ? -1.546  -1.871  5.286   1.00 16.00 ? 135 LEU C CB   1 
ATOM   3052 C  CG   . LEU C 1 9   ? -2.687  -0.868  5.375   1.00 15.88 ? 135 LEU C CG   1 
ATOM   3053 C  CD1  . LEU C 1 9   ? -3.311  -0.600  4.000   1.00 15.82 ? 135 LEU C CD1  1 
ATOM   3054 C  CD2  . LEU C 1 9   ? -3.717  -1.413  6.341   1.00 16.87 ? 135 LEU C CD2  1 
ATOM   3055 N  N    . PHE C 1 10  ? 0.539   0.711   3.957   1.00 15.43 ? 136 PHE C N    1 
ATOM   3056 C  CA   . PHE C 1 10  ? 1.400   1.844   4.233   1.00 15.57 ? 136 PHE C CA   1 
ATOM   3057 C  C    . PHE C 1 10  ? 0.717   3.197   4.063   1.00 16.29 ? 136 PHE C C    1 
ATOM   3058 O  O    . PHE C 1 10  ? 0.008   3.456   3.082   1.00 17.11 ? 136 PHE C O    1 
ATOM   3059 C  CB   . PHE C 1 10  ? 2.731   1.757   3.458   1.00 15.39 ? 136 PHE C CB   1 
ATOM   3060 C  CG   . PHE C 1 10  ? 2.608   1.885   1.962   1.00 15.32 ? 136 PHE C CG   1 
ATOM   3061 C  CD1  . PHE C 1 10  ? 2.942   3.080   1.329   1.00 17.49 ? 136 PHE C CD1  1 
ATOM   3062 C  CD2  . PHE C 1 10  ? 2.226   0.809   1.178   1.00 17.43 ? 136 PHE C CD2  1 
ATOM   3063 C  CE1  . PHE C 1 10  ? 2.869   3.199   -0.054  1.00 16.29 ? 136 PHE C CE1  1 
ATOM   3064 C  CE2  . PHE C 1 10  ? 2.141   0.917   -0.205  1.00 15.91 ? 136 PHE C CE2  1 
ATOM   3065 C  CZ   . PHE C 1 10  ? 2.458   2.124   -0.826  1.00 17.19 ? 136 PHE C CZ   1 
ATOM   3066 N  N    . ASP C 1 11  ? 0.971   4.034   5.060   1.00 16.65 ? 137 ASP C N    1 
ATOM   3067 C  CA   . ASP C 1 11  ? 0.411   5.383   5.233   1.00 17.74 ? 137 ASP C CA   1 
ATOM   3068 C  C    . ASP C 1 11  ? 0.965   6.307   4.150   1.00 17.74 ? 137 ASP C C    1 
ATOM   3069 O  O    . ASP C 1 11  ? 2.184   6.380   3.960   1.00 18.85 ? 137 ASP C O    1 
ATOM   3070 C  CB   . ASP C 1 11  ? 0.870   5.825   6.633   1.00 18.13 ? 137 ASP C CB   1 
ATOM   3071 C  CG   . ASP C 1 11  ? 0.306   7.140   7.114   1.00 19.39 ? 137 ASP C CG   1 
ATOM   3072 O  OD1  . ASP C 1 11  ? 0.046   8.074   6.323   1.00 22.79 ? 137 ASP C OD1  1 
ATOM   3073 O  OD2  . ASP C 1 11  ? 0.196   7.246   8.361   1.00 18.89 ? 137 ASP C OD2  1 
ATOM   3074 N  N    . GLY C 1 12  ? 0.078   6.971   3.420   1.00 17.57 ? 138 GLY C N    1 
ATOM   3075 C  CA   . GLY C 1 12  ? 0.464   7.985   2.434   1.00 16.57 ? 138 GLY C CA   1 
ATOM   3076 C  C    . GLY C 1 12  ? -0.061  9.369   2.783   1.00 16.34 ? 138 GLY C C    1 
ATOM   3077 O  O    . GLY C 1 12  ? -0.324  10.185  1.895   1.00 16.27 ? 138 GLY C O    1 
ATOM   3078 N  N    . SER C 1 13  ? -0.205  9.651   4.075   1.00 16.41 ? 139 SER C N    1 
ATOM   3079 C  CA   . SER C 1 13  ? -0.793  10.916  4.534   1.00 16.92 ? 139 SER C CA   1 
ATOM   3080 C  C    . SER C 1 13  ? 0.086   12.134  4.243   1.00 18.18 ? 139 SER C C    1 
ATOM   3081 O  O    . SER C 1 13  ? 1.281   12.012  3.967   1.00 16.55 ? 139 SER C O    1 
ATOM   3082 C  CB   . SER C 1 13  ? -1.109  10.873  6.038   1.00 17.52 ? 139 SER C CB   1 
ATOM   3083 O  OG   . SER C 1 13  ? 0.061   10.683  6.815   1.00 19.86 ? 139 SER C OG   1 
ATOM   3084 N  N    . MET C 1 14  ? -0.527  13.307  4.329   1.00 19.18 ? 140 MET C N    1 
ATOM   3085 C  CA   . MET C 1 14  ? 0.137   14.569  4.006   1.00 20.50 ? 140 MET C CA   1 
ATOM   3086 C  C    . MET C 1 14  ? 1.283   14.925  4.949   1.00 21.16 ? 140 MET C C    1 
ATOM   3087 O  O    . MET C 1 14  ? 2.125   15.737  4.598   1.00 20.66 ? 140 MET C O    1 
ATOM   3088 C  CB   . MET C 1 14  ? -0.873  15.724  3.960   1.00 22.36 ? 140 MET C CB   1 
ATOM   3089 C  CG   . MET C 1 14  ? -1.612  15.963  5.250   1.00 25.26 ? 140 MET C CG   1 
ATOM   3090 S  SD   . MET C 1 14  ? -2.750  17.353  5.141   1.00 34.48 ? 140 MET C SD   1 
ATOM   3091 C  CE   . MET C 1 14  ? -4.242  16.616  5.804   1.00 31.03 ? 140 MET C CE   1 
ATOM   3092 N  N    . SER C 1 15  ? 1.324   14.317  6.130   1.00 21.69 ? 141 SER C N    1 
ATOM   3093 C  CA   . SER C 1 15  ? 2.345   14.640  7.114   1.00 22.21 ? 141 SER C CA   1 
ATOM   3094 C  C    . SER C 1 15  ? 3.703   14.047  6.757   1.00 21.66 ? 141 SER C C    1 
ATOM   3095 O  O    . SER C 1 15  ? 4.732   14.486  7.281   1.00 22.29 ? 141 SER C O    1 
ATOM   3096 C  CB   . SER C 1 15  ? 1.911   14.156  8.493   1.00 22.84 ? 141 SER C CB   1 
ATOM   3097 O  OG   . SER C 1 15  ? 1.689   12.761  8.470   1.00 25.10 ? 141 SER C OG   1 
ATOM   3098 N  N    . LEU C 1 16  ? 3.719   13.063  5.863   1.00 21.14 ? 142 LEU C N    1 
ATOM   3099 C  CA   . LEU C 1 16  ? 4.970   12.414  5.474   1.00 20.54 ? 142 LEU C CA   1 
ATOM   3100 C  C    . LEU C 1 16  ? 5.773   13.282  4.508   1.00 20.47 ? 142 LEU C C    1 
ATOM   3101 O  O    . LEU C 1 16  ? 5.266   13.707  3.475   1.00 21.19 ? 142 LEU C O    1 
ATOM   3102 C  CB   . LEU C 1 16  ? 4.697   11.051  4.839   1.00 20.92 ? 142 LEU C CB   1 
ATOM   3103 C  CG   . LEU C 1 16  ? 4.249   9.983   5.833   1.00 22.22 ? 142 LEU C CG   1 
ATOM   3104 C  CD1  . LEU C 1 16  ? 3.471   8.890   5.120   1.00 26.15 ? 142 LEU C CD1  1 
ATOM   3105 C  CD2  . LEU C 1 16  ? 5.445   9.410   6.569   1.00 24.30 ? 142 LEU C CD2  1 
ATOM   3106 N  N    . GLN C 1 17  ? 7.032   13.535  4.855   1.00 20.60 ? 143 GLN C N    1 
ATOM   3107 C  CA   . GLN C 1 17  ? 7.961   14.202  3.956   1.00 21.25 ? 143 GLN C CA   1 
ATOM   3108 C  C    . GLN C 1 17  ? 8.317   13.249  2.814   1.00 21.23 ? 143 GLN C C    1 
ATOM   3109 O  O    . GLN C 1 17  ? 8.217   12.027  2.971   1.00 20.43 ? 143 GLN C O    1 
ATOM   3110 C  CB   . GLN C 1 17  ? 9.232   14.622  4.706   1.00 22.10 ? 143 GLN C CB   1 
ATOM   3111 C  CG   . GLN C 1 17  ? 8.982   15.556  5.892   1.00 25.54 ? 143 GLN C CG   1 
ATOM   3112 C  CD   . GLN C 1 17  ? 8.237   16.810  5.500   1.00 28.48 ? 143 GLN C CD   1 
ATOM   3113 O  OE1  . GLN C 1 17  ? 8.669   17.547  4.615   1.00 30.41 ? 143 GLN C OE1  1 
ATOM   3114 N  NE2  . GLN C 1 17  ? 7.096   17.055  6.149   1.00 32.52 ? 143 GLN C NE2  1 
ATOM   3115 N  N    . PRO C 1 18  ? 8.731   13.795  1.657   1.00 21.23 ? 144 PRO C N    1 
ATOM   3116 C  CA   . PRO C 1 18  ? 9.085   12.941  0.512   1.00 21.61 ? 144 PRO C CA   1 
ATOM   3117 C  C    . PRO C 1 18  ? 10.081  11.823  0.856   1.00 21.20 ? 144 PRO C C    1 
ATOM   3118 O  O    . PRO C 1 18  ? 9.879   10.659  0.463   1.00 20.89 ? 144 PRO C O    1 
ATOM   3119 C  CB   . PRO C 1 18  ? 9.699   13.930  -0.478  1.00 21.62 ? 144 PRO C CB   1 
ATOM   3120 C  CG   . PRO C 1 18  ? 9.038   15.213  -0.175  1.00 22.46 ? 144 PRO C CG   1 
ATOM   3121 C  CD   . PRO C 1 18  ? 8.779   15.227  1.305   1.00 21.75 ? 144 PRO C CD   1 
ATOM   3122 N  N    . ASP C 1 19  ? 11.130  12.161  1.604   1.00 21.30 ? 145 ASP C N    1 
ATOM   3123 C  CA   . ASP C 1 19  ? 12.164  11.182  1.946   1.00 21.64 ? 145 ASP C CA   1 
ATOM   3124 C  C    . ASP C 1 19  ? 11.642  10.127  2.925   1.00 20.10 ? 145 ASP C C    1 
ATOM   3125 O  O    . ASP C 1 19  ? 12.104  8.992   2.914   1.00 20.57 ? 145 ASP C O    1 
ATOM   3126 C  CB   . ASP C 1 19  ? 13.426  11.870  2.507   1.00 22.61 ? 145 ASP C CB   1 
ATOM   3127 C  CG   . ASP C 1 19  ? 13.306  12.227  3.983   1.00 24.54 ? 145 ASP C CG   1 
ATOM   3128 O  OD1  . ASP C 1 19  ? 12.678  13.261  4.299   1.00 26.57 ? 145 ASP C OD1  1 
ATOM   3129 O  OD2  . ASP C 1 19  ? 13.851  11.466  4.824   1.00 27.32 ? 145 ASP C OD2  1 
ATOM   3130 N  N    . GLU C 1 20  ? 10.684  10.514  3.764   1.00 19.83 ? 146 GLU C N    1 
ATOM   3131 C  CA   . GLU C 1 20  ? 10.083  9.604   4.741   1.00 18.92 ? 146 GLU C CA   1 
ATOM   3132 C  C    . GLU C 1 20  ? 9.245   8.566   3.999   1.00 18.41 ? 146 GLU C C    1 
ATOM   3133 O  O    . GLU C 1 20  ? 9.356   7.358   4.245   1.00 17.97 ? 146 GLU C O    1 
ATOM   3134 C  CB   . GLU C 1 20  ? 9.246   10.385  5.765   1.00 19.07 ? 146 GLU C CB   1 
ATOM   3135 C  CG   . GLU C 1 20  ? 10.080  11.360  6.602   1.00 20.37 ? 146 GLU C CG   1 
ATOM   3136 C  CD   . GLU C 1 20  ? 9.273   12.251  7.539   1.00 22.66 ? 146 GLU C CD   1 
ATOM   3137 O  OE1  . GLU C 1 20  ? 8.042   12.411  7.350   1.00 21.76 ? 146 GLU C OE1  1 
ATOM   3138 O  OE2  . GLU C 1 20  ? 9.897   12.811  8.474   1.00 24.07 ? 146 GLU C OE2  1 
ATOM   3139 N  N    . PHE C 1 21  ? 8.439   9.038   3.052   1.00 17.77 ? 147 PHE C N    1 
ATOM   3140 C  CA   . PHE C 1 21  ? 7.642   8.149   2.203   1.00 17.74 ? 147 PHE C CA   1 
ATOM   3141 C  C    . PHE C 1 21  ? 8.561   7.165   1.449   1.00 18.42 ? 147 PHE C C    1 
ATOM   3142 O  O    . PHE C 1 21  ? 8.313   5.948   1.433   1.00 18.39 ? 147 PHE C O    1 
ATOM   3143 C  CB   . PHE C 1 21  ? 6.779   8.982   1.239   1.00 17.95 ? 147 PHE C CB   1 
ATOM   3144 C  CG   . PHE C 1 21  ? 5.747   8.187   0.481   1.00 17.58 ? 147 PHE C CG   1 
ATOM   3145 C  CD1  . PHE C 1 21  ? 4.629   7.677   1.120   1.00 16.46 ? 147 PHE C CD1  1 
ATOM   3146 C  CD2  . PHE C 1 21  ? 5.899   7.951   -0.882  1.00 17.10 ? 147 PHE C CD2  1 
ATOM   3147 C  CE1  . PHE C 1 21  ? 3.675   6.943   0.414   1.00 16.25 ? 147 PHE C CE1  1 
ATOM   3148 C  CE2  . PHE C 1 21  ? 4.942   7.232   -1.598  1.00 18.77 ? 147 PHE C CE2  1 
ATOM   3149 C  CZ   . PHE C 1 21  ? 3.834   6.724   -0.950  1.00 16.22 ? 147 PHE C CZ   1 
ATOM   3150 N  N    . GLN C 1 22  ? 9.647   7.679   0.872   1.00 18.25 ? 148 GLN C N    1 
ATOM   3151 C  CA   . GLN C 1 22  ? 10.606  6.833   0.176   1.00 18.75 ? 148 GLN C CA   1 
ATOM   3152 C  C    . GLN C 1 22  ? 11.212  5.756   1.082   1.00 17.73 ? 148 GLN C C    1 
ATOM   3153 O  O    . GLN C 1 22  ? 11.390  4.607   0.663   1.00 18.13 ? 148 GLN C O    1 
ATOM   3154 C  CB   . GLN C 1 22  ? 11.729  7.674   -0.428  1.00 18.94 ? 148 GLN C CB   1 
ATOM   3155 C  CG   . GLN C 1 22  ? 12.639  6.886   -1.342  1.00 20.58 ? 148 GLN C CG   1 
ATOM   3156 C  CD   . GLN C 1 22  ? 11.895  6.269   -2.512  1.00 24.04 ? 148 GLN C CD   1 
ATOM   3157 O  OE1  . GLN C 1 22  ? 11.195  6.969   -3.250  1.00 27.49 ? 148 GLN C OE1  1 
ATOM   3158 N  NE2  . GLN C 1 22  ? 12.026  4.958   -2.679  1.00 25.10 ? 148 GLN C NE2  1 
ATOM   3159 N  N    . LYS C 1 23  ? 11.523  6.127   2.322   1.00 16.95 ? 149 LYS C N    1 
ATOM   3160 C  CA   . LYS C 1 23  ? 12.088  5.186   3.277   1.00 17.15 ? 149 LYS C CA   1 
ATOM   3161 C  C    . LYS C 1 23  ? 11.097  4.051   3.592   1.00 17.54 ? 149 LYS C C    1 
ATOM   3162 O  O    . LYS C 1 23  ? 11.508  2.906   3.813   1.00 17.85 ? 149 LYS C O    1 
ATOM   3163 C  CB   . LYS C 1 23  ? 12.547  5.917   4.544   1.00 17.67 ? 149 LYS C CB   1 
ATOM   3164 C  CG   . LYS C 1 23  ? 13.892  6.654   4.362   1.00 20.97 ? 149 LYS C CG   1 
ATOM   3165 C  CD   . LYS C 1 23  ? 14.310  7.415   5.608   1.00 23.26 ? 149 LYS C CD   1 
ATOM   3166 C  CE   . LYS C 1 23  ? 15.675  8.096   5.403   1.00 25.53 ? 149 LYS C CE   1 
ATOM   3167 N  NZ   . LYS C 1 23  ? 15.587  9.234   4.441   1.00 26.10 ? 149 LYS C NZ   1 
ATOM   3168 N  N    . ILE C 1 24  ? 9.798   4.358   3.576   1.00 16.87 ? 150 ILE C N    1 
ATOM   3169 C  CA   . ILE C 1 24  ? 8.780   3.318   3.753   1.00 17.58 ? 150 ILE C CA   1 
ATOM   3170 C  C    . ILE C 1 24  ? 8.829   2.346   2.567   1.00 17.23 ? 150 ILE C C    1 
ATOM   3171 O  O    . ILE C 1 24  ? 8.807   1.129   2.754   1.00 18.06 ? 150 ILE C O    1 
ATOM   3172 C  CB   . ILE C 1 24  ? 7.352   3.897   3.913   1.00 17.60 ? 150 ILE C CB   1 
ATOM   3173 C  CG1  . ILE C 1 24  ? 7.245   4.706   5.207   1.00 18.89 ? 150 ILE C CG1  1 
ATOM   3174 C  CG2  . ILE C 1 24  ? 6.316   2.762   3.904   1.00 19.98 ? 150 ILE C CG2  1 
ATOM   3175 C  CD1  . ILE C 1 24  ? 5.933   5.520   5.343   1.00 19.93 ? 150 ILE C CD1  1 
ATOM   3176 N  N    . LEU C 1 25  ? 8.903   2.882   1.352   1.00 17.59 ? 151 LEU C N    1 
ATOM   3177 C  CA   . LEU C 1 25  ? 8.954   2.045   0.153   1.00 18.10 ? 151 LEU C CA   1 
ATOM   3178 C  C    . LEU C 1 25  ? 10.192  1.165   0.175   1.00 17.77 ? 151 LEU C C    1 
ATOM   3179 O  O    . LEU C 1 25  ? 10.116  -0.030  -0.142  1.00 18.55 ? 151 LEU C O    1 
ATOM   3180 C  CB   . LEU C 1 25  ? 8.923   2.894   -1.120  1.00 18.95 ? 151 LEU C CB   1 
ATOM   3181 C  CG   . LEU C 1 25  ? 7.678   3.773   -1.309  1.00 21.07 ? 151 LEU C CG   1 
ATOM   3182 C  CD1  . LEU C 1 25  ? 7.812   4.665   -2.542  1.00 20.38 ? 151 LEU C CD1  1 
ATOM   3183 C  CD2  . LEU C 1 25  ? 6.431   2.905   -1.397  1.00 22.48 ? 151 LEU C CD2  1 
ATOM   3184 N  N    . ASP C 1 26  ? 11.321  1.754   0.558   1.00 18.05 ? 152 ASP C N    1 
ATOM   3185 C  CA   . ASP C 1 26  ? 12.595  1.027   0.608   1.00 18.41 ? 152 ASP C CA   1 
ATOM   3186 C  C    . ASP C 1 26  ? 12.554  -0.099  1.635   1.00 18.27 ? 152 ASP C C    1 
ATOM   3187 O  O    . ASP C 1 26  ? 13.080  -1.193  1.382   1.00 18.34 ? 152 ASP C O    1 
ATOM   3188 C  CB   . ASP C 1 26  ? 13.760  1.984   0.889   1.00 19.43 ? 152 ASP C CB   1 
ATOM   3189 C  CG   . ASP C 1 26  ? 13.994  2.966   -0.244  1.00 21.76 ? 152 ASP C CG   1 
ATOM   3190 O  OD1  . ASP C 1 26  ? 13.408  2.781   -1.333  1.00 28.26 ? 152 ASP C OD1  1 
ATOM   3191 O  OD2  . ASP C 1 26  ? 14.769  3.924   -0.045  1.00 27.07 ? 152 ASP C OD2  1 
ATOM   3192 N  N    . PHE C 1 27  ? 11.921  0.156   2.782   1.00 18.28 ? 153 PHE C N    1 
ATOM   3193 C  CA   . PHE C 1 27  ? 11.693  -0.886  3.789   1.00 17.95 ? 153 PHE C CA   1 
ATOM   3194 C  C    . PHE C 1 27  ? 10.895  -2.069  3.217   1.00 17.36 ? 153 PHE C C    1 
ATOM   3195 O  O    . PHE C 1 27  ? 11.285  -3.230  3.396   1.00 17.77 ? 153 PHE C O    1 
ATOM   3196 C  CB   . PHE C 1 27  ? 10.988  -0.309  5.024   1.00 18.20 ? 153 PHE C CB   1 
ATOM   3197 C  CG   . PHE C 1 27  ? 10.482  -1.358  5.979   1.00 16.90 ? 153 PHE C CG   1 
ATOM   3198 C  CD1  . PHE C 1 27  ? 11.358  -2.079  6.766   1.00 15.93 ? 153 PHE C CD1  1 
ATOM   3199 C  CD2  . PHE C 1 27  ? 9.131   -1.660  6.052   1.00 17.82 ? 153 PHE C CD2  1 
ATOM   3200 C  CE1  . PHE C 1 27  ? 10.899  -3.064  7.634   1.00 16.79 ? 153 PHE C CE1  1 
ATOM   3201 C  CE2  . PHE C 1 27  ? 8.671   -2.641  6.923   1.00 17.95 ? 153 PHE C CE2  1 
ATOM   3202 C  CZ   . PHE C 1 27  ? 9.556   -3.349  7.703   1.00 17.46 ? 153 PHE C CZ   1 
ATOM   3203 N  N    . MET C 1 28  ? 9.796   -1.784  2.516   1.00 16.77 ? 154 MET C N    1 
ATOM   3204 C  CA   . MET C 1 28  ? 8.980   -2.845  1.933   1.00 16.77 ? 154 MET C CA   1 
ATOM   3205 C  C    . MET C 1 28  ? 9.791   -3.662  0.917   1.00 16.34 ? 154 MET C C    1 
ATOM   3206 O  O    . MET C 1 28  ? 9.763   -4.898  0.931   1.00 16.57 ? 154 MET C O    1 
ATOM   3207 C  CB   . MET C 1 28  ? 7.713   -2.267  1.301   1.00 17.00 ? 154 MET C CB   1 
ATOM   3208 C  CG   . MET C 1 28  ? 6.786   -1.674  2.329   1.00 18.69 ? 154 MET C CG   1 
ATOM   3209 S  SD   . MET C 1 28  ? 5.275   -1.004  1.582   1.00 23.71 ? 154 MET C SD   1 
ATOM   3210 C  CE   . MET C 1 28  ? 5.904   0.356   0.656   1.00 21.73 ? 154 MET C CE   1 
ATOM   3211 N  N    . LYS C 1 29  ? 10.552  -2.974  0.075   1.00 16.94 ? 155 LYS C N    1 
ATOM   3212 C  CA   . LYS C 1 29  ? 11.403  -3.656  -0.911  1.00 17.94 ? 155 LYS C CA   1 
ATOM   3213 C  C    . LYS C 1 29  ? 12.434  -4.565  -0.253  1.00 18.06 ? 155 LYS C C    1 
ATOM   3214 O  O    . LYS C 1 29  ? 12.682  -5.683  -0.726  1.00 17.53 ? 155 LYS C O    1 
ATOM   3215 C  CB   . LYS C 1 29  ? 12.131  -2.645  -1.792  1.00 18.49 ? 155 LYS C CB   1 
ATOM   3216 C  CG   . LYS C 1 29  ? 11.273  -1.810  -2.698  1.00 21.92 ? 155 LYS C CG   1 
ATOM   3217 C  CD   . LYS C 1 29  ? 12.147  -0.737  -3.347  1.00 23.89 ? 155 LYS C CD   1 
ATOM   3218 C  CE   . LYS C 1 29  ? 11.392  0.095   -4.344  1.00 27.88 ? 155 LYS C CE   1 
ATOM   3219 N  NZ   . LYS C 1 29  ? 12.352  0.819   -5.233  1.00 28.84 ? 155 LYS C NZ   1 
ATOM   3220 N  N    . ASP C 1 30  ? 13.038  -4.087  0.833   1.00 17.64 ? 156 ASP C N    1 
ATOM   3221 C  CA   . ASP C 1 30  ? 14.041  -4.869  1.549   1.00 18.20 ? 156 ASP C CA   1 
ATOM   3222 C  C    . ASP C 1 30  ? 13.427  -6.143  2.145   1.00 16.92 ? 156 ASP C C    1 
ATOM   3223 O  O    . ASP C 1 30  ? 14.022  -7.214  2.076   1.00 16.26 ? 156 ASP C O    1 
ATOM   3224 C  CB   . ASP C 1 30  ? 14.692  -4.021  2.634   1.00 19.25 ? 156 ASP C CB   1 
ATOM   3225 C  CG   . ASP C 1 30  ? 15.869  -4.718  3.305   1.00 20.09 ? 156 ASP C CG   1 
ATOM   3226 O  OD1  . ASP C 1 30  ? 16.824  -5.082  2.590   1.00 23.29 ? 156 ASP C OD1  1 
ATOM   3227 O  OD2  . ASP C 1 30  ? 15.827  -4.874  4.538   1.00 23.76 ? 156 ASP C OD2  1 
ATOM   3228 N  N    . VAL C 1 31  ? 12.247  -6.028  2.745   1.00 16.15 ? 157 VAL C N    1 
ATOM   3229 C  CA   . VAL C 1 31  ? 11.600  -7.189  3.323   1.00 15.67 ? 157 VAL C CA   1 
ATOM   3230 C  C    . VAL C 1 31  ? 11.345  -8.233  2.219   1.00 16.05 ? 157 VAL C C    1 
ATOM   3231 O  O    . VAL C 1 31  ? 11.631  -9.421  2.397   1.00 15.52 ? 157 VAL C O    1 
ATOM   3232 C  CB   . VAL C 1 31  ? 10.277  -6.816  4.038   1.00 16.00 ? 157 VAL C CB   1 
ATOM   3233 C  CG1  . VAL C 1 31  ? 9.546   -8.074  4.501   1.00 16.03 ? 157 VAL C CG1  1 
ATOM   3234 C  CG2  . VAL C 1 31  ? 10.567  -5.894  5.235   1.00 16.82 ? 157 VAL C CG2  1 
ATOM   3235 N  N    . MET C 1 32  ? 10.796  -7.773  1.090   1.00 15.89 ? 158 MET C N    1 
ATOM   3236 C  CA   . MET C 1 32  ? 10.523  -8.645  -0.060  1.00 15.24 ? 158 MET C CA   1 
ATOM   3237 C  C    . MET C 1 32  ? 11.764  -9.339  -0.612  1.00 14.99 ? 158 MET C C    1 
ATOM   3238 O  O    . MET C 1 32  ? 11.723  -10.526 -0.912  1.00 14.12 ? 158 MET C O    1 
ATOM   3239 C  CB   . MET C 1 32  ? 9.819   -7.870  -1.163  1.00 16.31 ? 158 MET C CB   1 
ATOM   3240 C  CG   . MET C 1 32  ? 8.407   -7.525  -0.771  1.00 17.09 ? 158 MET C CG   1 
ATOM   3241 S  SD   . MET C 1 32  ? 7.472   -6.802  -2.128  1.00 23.67 ? 158 MET C SD   1 
ATOM   3242 C  CE   . MET C 1 32  ? 7.896   -5.120  -1.939  1.00 21.65 ? 158 MET C CE   1 
ATOM   3243 N  N    . LYS C 1 33  ? 12.855  -8.594  -0.745  1.00 14.84 ? 159 LYS C N    1 
ATOM   3244 C  CA   . LYS C 1 33  ? 14.103  -9.165  -1.258  1.00 15.63 ? 159 LYS C CA   1 
ATOM   3245 C  C    . LYS C 1 33  ? 14.715  -10.198 -0.299  1.00 15.30 ? 159 LYS C C    1 
ATOM   3246 O  O    . LYS C 1 33  ? 15.231  -11.233 -0.725  1.00 15.61 ? 159 LYS C O    1 
ATOM   3247 C  CB   . LYS C 1 33  ? 15.108  -8.054  -1.586  1.00 16.04 ? 159 LYS C CB   1 
ATOM   3248 C  CG   . LYS C 1 33  ? 14.636  -7.213  -2.776  1.00 18.12 ? 159 LYS C CG   1 
ATOM   3249 C  CD   . LYS C 1 33  ? 15.409  -5.916  -2.977  1.00 21.12 ? 159 LYS C CD   1 
ATOM   3250 C  CE   . LYS C 1 33  ? 14.686  -5.029  -4.001  1.00 24.32 ? 159 LYS C CE   1 
ATOM   3251 N  NZ   . LYS C 1 33  ? 15.361  -3.739  -4.306  1.00 23.91 ? 159 LYS C NZ   1 
ATOM   3252 N  N    . LYS C 1 34  ? 14.629  -9.936  0.999   1.00 14.07 ? 160 LYS C N    1 
ATOM   3253 C  CA   . LYS C 1 34  ? 15.191  -10.834 2.010   1.00 14.68 ? 160 LYS C CA   1 
ATOM   3254 C  C    . LYS C 1 34  ? 14.377  -12.124 2.166   1.00 14.23 ? 160 LYS C C    1 
ATOM   3255 O  O    . LYS C 1 34  ? 14.918  -13.146 2.542   1.00 13.42 ? 160 LYS C O    1 
ATOM   3256 C  CB   . LYS C 1 34  ? 15.323  -10.098 3.356   1.00 15.31 ? 160 LYS C CB   1 
ATOM   3257 C  CG   . LYS C 1 34  ? 16.510  -9.142  3.436   1.00 16.96 ? 160 LYS C CG   1 
ATOM   3258 C  CD   . LYS C 1 34  ? 16.503  -8.380  4.776   1.00 21.24 ? 160 LYS C CD   1 
ATOM   3259 C  CE   . LYS C 1 34  ? 17.830  -7.704  5.105   1.00 24.45 ? 160 LYS C CE   1 
ATOM   3260 N  NZ   . LYS C 1 34  ? 18.360  -6.868  4.020   1.00 24.52 ? 160 LYS C NZ   1 
ATOM   3261 N  N    . LEU C 1 35  ? 13.080  -12.057 1.875   1.00 14.85 ? 161 LEU C N    1 
ATOM   3262 C  CA   . LEU C 1 35  ? 12.163  -13.197 1.980   1.00 15.93 ? 161 LEU C CA   1 
ATOM   3263 C  C    . LEU C 1 35  ? 11.645  -13.629 0.601   1.00 17.03 ? 161 LEU C C    1 
ATOM   3264 O  O    . LEU C 1 35  ? 10.500  -14.059 0.446   1.00 17.77 ? 161 LEU C O    1 
ATOM   3265 C  CB   . LEU C 1 35  ? 11.013  -12.859 2.937   1.00 15.20 ? 161 LEU C CB   1 
ATOM   3266 C  CG   . LEU C 1 35  ? 11.419  -12.753 4.400   1.00 15.61 ? 161 LEU C CG   1 
ATOM   3267 C  CD1  . LEU C 1 35  ? 10.307  -12.110 5.258   1.00 16.63 ? 161 LEU C CD1  1 
ATOM   3268 C  CD2  . LEU C 1 35  ? 11.806  -14.108 4.970   1.00 14.85 ? 161 LEU C CD2  1 
ATOM   3269 N  N    . SER C 1 36  ? 12.522  -13.547 -0.402  1.00 16.97 ? 162 SER C N    1 
ATOM   3270 C  CA   . SER C 1 36  ? 12.164  -13.856 -1.785  1.00 17.70 ? 162 SER C CA   1 
ATOM   3271 C  C    . SER C 1 36  ? 12.294  -15.353 -2.065  1.00 17.49 ? 162 SER C C    1 
ATOM   3272 O  O    . SER C 1 36  ? 13.255  -15.810 -2.673  1.00 17.43 ? 162 SER C O    1 
ATOM   3273 C  CB   . SER C 1 36  ? 13.049  -13.058 -2.731  1.00 17.49 ? 162 SER C CB   1 
ATOM   3274 O  OG   . SER C 1 36  ? 14.426  -13.249 -2.394  1.00 19.26 ? 162 SER C OG   1 
ATOM   3275 N  N    . ASN C 1 37  ? 11.336  -16.124 -1.558  1.00 17.55 ? 163 ASN C N    1 
ATOM   3276 C  CA   . ASN C 1 37  ? 11.290  -17.569 -1.789  1.00 16.94 ? 163 ASN C CA   1 
ATOM   3277 C  C    . ASN C 1 37  ? 9.845   -17.973 -1.896  1.00 16.19 ? 163 ASN C C    1 
ATOM   3278 O  O    . ASN C 1 37  ? 8.959   -17.190 -1.531  1.00 16.97 ? 163 ASN C O    1 
ATOM   3279 C  CB   . ASN C 1 37  ? 11.991  -18.360 -0.700  1.00 16.38 ? 163 ASN C CB   1 
ATOM   3280 C  CG   . ASN C 1 37  ? 11.377  -18.173 0.657   1.00 19.86 ? 163 ASN C CG   1 
ATOM   3281 O  OD1  . ASN C 1 37  ? 10.310  -18.718 0.966   1.00 19.15 ? 163 ASN C OD1  1 
ATOM   3282 N  ND2  . ASN C 1 37  ? 12.074  -17.438 1.509   1.00 22.40 ? 163 ASN C ND2  1 
ATOM   3283 N  N    . THR C 1 38  ? 9.627   -19.182 -2.394  1.00 15.47 ? 164 THR C N    1 
ATOM   3284 C  CA   . THR C 1 38  ? 8.281   -19.638 -2.764  1.00 16.16 ? 164 THR C CA   1 
ATOM   3285 C  C    . THR C 1 38  ? 7.304   -19.759 -1.587  1.00 16.80 ? 164 THR C C    1 
ATOM   3286 O  O    . THR C 1 38  ? 6.094   -19.758 -1.808  1.00 17.23 ? 164 THR C O    1 
ATOM   3287 C  CB   . THR C 1 38  ? 8.327   -20.967 -3.532  1.00 16.57 ? 164 THR C CB   1 
ATOM   3288 O  OG1  . THR C 1 38  ? 9.163   -21.905 -2.852  1.00 15.02 ? 164 THR C OG1  1 
ATOM   3289 C  CG2  . THR C 1 38  ? 8.849   -20.745 -4.966  1.00 18.29 ? 164 THR C CG2  1 
ATOM   3290 N  N    . SER C 1 39  ? 7.802   -19.823 -0.358  1.00 16.41 ? 165 SER C N    1 
ATOM   3291 C  CA   . SER C 1 39  ? 6.911   -19.814 0.809   1.00 16.90 ? 165 SER C CA   1 
ATOM   3292 C  C    . SER C 1 39  ? 6.190   -18.478 1.007   1.00 16.07 ? 165 SER C C    1 
ATOM   3293 O  O    . SER C 1 39  ? 5.093   -18.450 1.575   1.00 17.36 ? 165 SER C O    1 
ATOM   3294 C  CB   . SER C 1 39  ? 7.678   -20.155 2.078   1.00 17.23 ? 165 SER C CB   1 
ATOM   3295 O  OG   . SER C 1 39  ? 8.217   -21.451 1.988   1.00 19.80 ? 165 SER C OG   1 
ATOM   3296 N  N    . TYR C 1 40  ? 6.793   -17.379 0.561   1.00 15.84 ? 166 TYR C N    1 
ATOM   3297 C  CA   . TYR C 1 40  ? 6.250   -16.031 0.783   1.00 15.94 ? 166 TYR C CA   1 
ATOM   3298 C  C    . TYR C 1 40  ? 5.666   -15.437 -0.509  1.00 17.10 ? 166 TYR C C    1 
ATOM   3299 O  O    . TYR C 1 40  ? 6.290   -15.516 -1.581  1.00 17.76 ? 166 TYR C O    1 
ATOM   3300 C  CB   . TYR C 1 40  ? 7.335   -15.095 1.345   1.00 16.58 ? 166 TYR C CB   1 
ATOM   3301 C  CG   . TYR C 1 40  ? 7.671   -15.374 2.796   1.00 15.56 ? 166 TYR C CG   1 
ATOM   3302 C  CD1  . TYR C 1 40  ? 7.175   -14.559 3.815   1.00 16.74 ? 166 TYR C CD1  1 
ATOM   3303 C  CD2  . TYR C 1 40  ? 8.440   -16.470 3.157   1.00 18.07 ? 166 TYR C CD2  1 
ATOM   3304 C  CE1  . TYR C 1 40  ? 7.454   -14.824 5.148   1.00 16.94 ? 166 TYR C CE1  1 
ATOM   3305 C  CE2  . TYR C 1 40  ? 8.717   -16.743 4.486   1.00 17.14 ? 166 TYR C CE2  1 
ATOM   3306 C  CZ   . TYR C 1 40  ? 8.214   -15.916 5.473   1.00 17.20 ? 166 TYR C CZ   1 
ATOM   3307 O  OH   . TYR C 1 40  ? 8.490   -16.196 6.790   1.00 18.50 ? 166 TYR C OH   1 
ATOM   3308 N  N    . GLN C 1 41  ? 4.461   -14.870 -0.393  1.00 17.26 ? 167 GLN C N    1 
ATOM   3309 C  CA   . GLN C 1 41  ? 3.883   -13.984 -1.399  1.00 18.10 ? 167 GLN C CA   1 
ATOM   3310 C  C    . GLN C 1 41  ? 3.583   -12.654 -0.732  1.00 17.68 ? 167 GLN C C    1 
ATOM   3311 O  O    . GLN C 1 41  ? 3.292   -12.612 0.473   1.00 17.52 ? 167 GLN C O    1 
ATOM   3312 C  CB   . GLN C 1 41  ? 2.543   -14.529 -1.910  1.00 19.71 ? 167 GLN C CB   1 
ATOM   3313 C  CG   . GLN C 1 41  ? 2.618   -15.798 -2.670  1.00 23.99 ? 167 GLN C CG   1 
ATOM   3314 C  CD   . GLN C 1 41  ? 1.246   -16.224 -3.226  1.00 24.63 ? 167 GLN C CD   1 
ATOM   3315 O  OE1  . GLN C 1 41  ? 0.179   -15.826 -2.719  1.00 26.45 ? 167 GLN C OE1  1 
ATOM   3316 N  NE2  . GLN C 1 41  ? 1.279   -17.059 -4.251  1.00 28.73 ? 167 GLN C NE2  1 
ATOM   3317 N  N    . PHE C 1 42  ? 3.638   -11.584 -1.522  1.00 17.10 ? 168 PHE C N    1 
ATOM   3318 C  CA   . PHE C 1 42  ? 3.429   -10.229 -1.026  1.00 16.79 ? 168 PHE C CA   1 
ATOM   3319 C  C    . PHE C 1 42  ? 2.403   -9.452  -1.851  1.00 17.23 ? 168 PHE C C    1 
ATOM   3320 O  O    . PHE C 1 42  ? 2.231   -9.682  -3.056  1.00 16.43 ? 168 PHE C O    1 
ATOM   3321 C  CB   . PHE C 1 42  ? 4.749   -9.464  -1.030  1.00 17.50 ? 168 PHE C CB   1 
ATOM   3322 C  CG   . PHE C 1 42  ? 5.796   -10.062 -0.141  1.00 16.67 ? 168 PHE C CG   1 
ATOM   3323 C  CD1  . PHE C 1 42  ? 5.816   -9.774  1.212   1.00 17.76 ? 168 PHE C CD1  1 
ATOM   3324 C  CD2  . PHE C 1 42  ? 6.761   -10.920 -0.661  1.00 20.85 ? 168 PHE C CD2  1 
ATOM   3325 C  CE1  . PHE C 1 42  ? 6.779   -10.328 2.031   1.00 20.14 ? 168 PHE C CE1  1 
ATOM   3326 C  CE2  . PHE C 1 42  ? 7.732   -11.485 0.167   1.00 19.21 ? 168 PHE C CE2  1 
ATOM   3327 C  CZ   . PHE C 1 42  ? 7.741   -11.188 1.499   1.00 19.61 ? 168 PHE C CZ   1 
ATOM   3328 N  N    . ALA C 1 43  ? 1.732   -8.532  -1.166  1.00 16.61 ? 169 ALA C N    1 
ATOM   3329 C  CA   . ALA C 1 43  ? 0.916   -7.491  -1.769  1.00 16.93 ? 169 ALA C CA   1 
ATOM   3330 C  C    . ALA C 1 43  ? 1.181   -6.178  -1.029  1.00 16.71 ? 169 ALA C C    1 
ATOM   3331 O  O    . ALA C 1 43  ? 1.693   -6.172  0.108   1.00 16.90 ? 169 ALA C O    1 
ATOM   3332 C  CB   . ALA C 1 43  ? -0.570  -7.868  -1.695  1.00 16.90 ? 169 ALA C CB   1 
ATOM   3333 N  N    . ALA C 1 44  ? 0.817   -5.057  -1.652  1.00 16.89 ? 170 ALA C N    1 
ATOM   3334 C  CA   . ALA C 1 44  ? 0.997   -3.755  -1.013  1.00 16.74 ? 170 ALA C CA   1 
ATOM   3335 C  C    . ALA C 1 44  ? -0.202  -2.856  -1.288  1.00 16.36 ? 170 ALA C C    1 
ATOM   3336 O  O    . ALA C 1 44  ? -0.699  -2.803  -2.422  1.00 17.33 ? 170 ALA C O    1 
ATOM   3337 C  CB   . ALA C 1 44  ? 2.280   -3.076  -1.471  1.00 16.24 ? 170 ALA C CB   1 
ATOM   3338 N  N    . VAL C 1 45  ? -0.651  -2.173  -0.234  1.00 16.14 ? 171 VAL C N    1 
ATOM   3339 C  CA   . VAL C 1 45  ? -1.785  -1.249  -0.272  1.00 16.02 ? 171 VAL C CA   1 
ATOM   3340 C  C    . VAL C 1 45  ? -1.349  0.068   0.373   1.00 15.49 ? 171 VAL C C    1 
ATOM   3341 O  O    . VAL C 1 45  ? -0.864  0.080   1.504   1.00 14.99 ? 171 VAL C O    1 
ATOM   3342 C  CB   . VAL C 1 45  ? -2.987  -1.827  0.516   1.00 14.75 ? 171 VAL C CB   1 
ATOM   3343 C  CG1  . VAL C 1 45  ? -4.180  -0.813  0.628   1.00 15.72 ? 171 VAL C CG1  1 
ATOM   3344 C  CG2  . VAL C 1 45  ? -3.456  -3.160  -0.098  1.00 16.46 ? 171 VAL C CG2  1 
ATOM   3345 N  N    . GLN C 1 46  ? -1.512  1.167   -0.360  1.00 15.93 ? 172 GLN C N    1 
ATOM   3346 C  CA   . GLN C 1 46  ? -1.350  2.508   0.194   1.00 15.63 ? 172 GLN C CA   1 
ATOM   3347 C  C    . GLN C 1 46  ? -2.702  2.972   0.744   1.00 15.62 ? 172 GLN C C    1 
ATOM   3348 O  O    . GLN C 1 46  ? -3.741  2.759   0.109   1.00 16.67 ? 172 GLN C O    1 
ATOM   3349 C  CB   . GLN C 1 46  ? -0.858  3.522   -0.860  1.00 16.58 ? 172 GLN C CB   1 
ATOM   3350 C  CG   . GLN C 1 46  ? -0.468  4.879   -0.236  1.00 17.00 ? 172 GLN C CG   1 
ATOM   3351 C  CD   . GLN C 1 46  ? -0.036  5.960   -1.222  1.00 17.30 ? 172 GLN C CD   1 
ATOM   3352 O  OE1  . GLN C 1 46  ? 0.179   7.107   -0.814  1.00 17.08 ? 172 GLN C OE1  1 
ATOM   3353 N  NE2  . GLN C 1 46  ? 0.042   5.629   -2.514  1.00 16.86 ? 172 GLN C NE2  1 
ATOM   3354 N  N    . PHE C 1 47  ? -2.682  3.611   1.907   1.00 15.06 ? 173 PHE C N    1 
ATOM   3355 C  CA   . PHE C 1 47  ? -3.877  4.219   2.476   1.00 15.98 ? 173 PHE C CA   1 
ATOM   3356 C  C    . PHE C 1 47  ? -3.627  5.644   2.918   1.00 16.30 ? 173 PHE C C    1 
ATOM   3357 O  O    . PHE C 1 47  ? -2.556  5.993   3.412   1.00 16.29 ? 173 PHE C O    1 
ATOM   3358 C  CB   . PHE C 1 47  ? -4.474  3.373   3.616   1.00 16.89 ? 173 PHE C CB   1 
ATOM   3359 C  CG   . PHE C 1 47  ? -3.765  3.506   4.950   1.00 15.83 ? 173 PHE C CG   1 
ATOM   3360 C  CD1  . PHE C 1 47  ? -4.309  4.275   5.966   1.00 17.44 ? 173 PHE C CD1  1 
ATOM   3361 C  CD2  . PHE C 1 47  ? -2.591  2.809   5.213   1.00 15.98 ? 173 PHE C CD2  1 
ATOM   3362 C  CE1  . PHE C 1 47  ? -3.675  4.378   7.200   1.00 17.59 ? 173 PHE C CE1  1 
ATOM   3363 C  CE2  . PHE C 1 47  ? -1.949  2.915   6.441   1.00 17.73 ? 173 PHE C CE2  1 
ATOM   3364 C  CZ   . PHE C 1 47  ? -2.486  3.691   7.437   1.00 18.43 ? 173 PHE C CZ   1 
ATOM   3365 N  N    . SER C 1 48  ? -4.649  6.470   2.729   1.00 15.95 ? 174 SER C N    1 
ATOM   3366 C  CA   . SER C 1 48  ? -4.649  7.819   3.251   1.00 16.08 ? 174 SER C CA   1 
ATOM   3367 C  C    . SER C 1 48  ? -6.110  8.135   3.580   1.00 16.20 ? 174 SER C C    1 
ATOM   3368 O  O    . SER C 1 48  ? -6.613  7.641   4.591   1.00 16.30 ? 174 SER C O    1 
ATOM   3369 C  CB   . SER C 1 48  ? -3.967  8.779   2.262   1.00 16.36 ? 174 SER C CB   1 
ATOM   3370 O  OG   . SER C 1 48  ? -3.760  10.061  2.819   1.00 16.10 ? 174 SER C OG   1 
ATOM   3371 N  N    . THR C 1 49  ? -6.799  8.926   2.764   1.00 15.53 ? 175 THR C N    1 
ATOM   3372 C  CA   . THR C 1 49  ? -8.245  9.038   2.907   1.00 15.82 ? 175 THR C CA   1 
ATOM   3373 C  C    . THR C 1 49  ? -8.921  7.807   2.320   1.00 16.52 ? 175 THR C C    1 
ATOM   3374 O  O    . THR C 1 49  ? -9.857  7.268   2.922   1.00 16.61 ? 175 THR C O    1 
ATOM   3375 C  CB   . THR C 1 49  ? -8.773  10.311  2.259   1.00 15.67 ? 175 THR C CB   1 
ATOM   3376 O  OG1  . THR C 1 49  ? -8.258  11.427  2.987   1.00 16.42 ? 175 THR C OG1  1 
ATOM   3377 C  CG2  . THR C 1 49  ? -10.295 10.345  2.286   1.00 15.61 ? 175 THR C CG2  1 
ATOM   3378 N  N    . SER C 1 50  ? -8.462  7.374   1.145   1.00 17.67 ? 176 SER C N    1 
ATOM   3379 C  CA   . SER C 1 50  ? -8.935  6.132   0.548   1.00 18.96 ? 176 SER C CA   1 
ATOM   3380 C  C    . SER C 1 50  ? -7.781  5.142   0.364   1.00 18.89 ? 176 SER C C    1 
ATOM   3381 O  O    . SER C 1 50  ? -6.687  5.359   0.892   1.00 18.38 ? 176 SER C O    1 
ATOM   3382 C  CB   . SER C 1 50  ? -9.669  6.385   -0.768  1.00 20.73 ? 176 SER C CB   1 
ATOM   3383 O  OG   . SER C 1 50  ? -10.312 5.185   -1.176  1.00 24.51 ? 176 SER C OG   1 
ATOM   3384 N  N    . TYR C 1 51  ? -8.034  4.058   -0.368  1.00 17.98 ? 177 TYR C N    1 
ATOM   3385 C  CA   . TYR C 1 51  ? -7.139  2.898   -0.392  1.00 17.90 ? 177 TYR C CA   1 
ATOM   3386 C  C    . TYR C 1 51  ? -6.847  2.510   -1.816  1.00 17.45 ? 177 TYR C C    1 
ATOM   3387 O  O    . TYR C 1 51  ? -7.727  2.592   -2.690  1.00 17.97 ? 177 TYR C O    1 
ATOM   3388 C  CB   . TYR C 1 51  ? -7.781  1.719   0.352   1.00 17.80 ? 177 TYR C CB   1 
ATOM   3389 C  CG   . TYR C 1 51  ? -8.709  2.210   1.428   1.00 18.50 ? 177 TYR C CG   1 
ATOM   3390 C  CD1  . TYR C 1 51  ? -8.211  2.886   2.534   1.00 18.85 ? 177 TYR C CD1  1 
ATOM   3391 C  CD2  . TYR C 1 51  ? -10.084 2.066   1.306   1.00 20.90 ? 177 TYR C CD2  1 
ATOM   3392 C  CE1  . TYR C 1 51  ? -9.063  3.387   3.513   1.00 20.54 ? 177 TYR C CE1  1 
ATOM   3393 C  CE2  . TYR C 1 51  ? -10.936 2.555   2.279   1.00 21.56 ? 177 TYR C CE2  1 
ATOM   3394 C  CZ   . TYR C 1 51  ? -10.419 3.209   3.380   1.00 20.76 ? 177 TYR C CZ   1 
ATOM   3395 O  OH   . TYR C 1 51  ? -11.269 3.712   4.348   1.00 24.35 ? 177 TYR C OH   1 
ATOM   3396 N  N    . LYS C 1 52  ? -5.600  2.103   -2.062  1.00 17.16 ? 178 LYS C N    1 
ATOM   3397 C  CA   . LYS C 1 52  ? -5.208  1.647   -3.380  1.00 17.10 ? 178 LYS C CA   1 
ATOM   3398 C  C    . LYS C 1 52  ? -4.314  0.433   -3.254  1.00 17.74 ? 178 LYS C C    1 
ATOM   3399 O  O    . LYS C 1 52  ? -3.279  0.492   -2.600  1.00 17.37 ? 178 LYS C O    1 
ATOM   3400 C  CB   . LYS C 1 52  ? -4.468  2.749   -4.152  1.00 16.63 ? 178 LYS C CB   1 
ATOM   3401 C  CG   . LYS C 1 52  ? -4.070  2.338   -5.580  1.00 17.19 ? 178 LYS C CG   1 
ATOM   3402 C  CD   . LYS C 1 52  ? -3.350  3.465   -6.284  1.00 18.82 ? 178 LYS C CD   1 
ATOM   3403 C  CE   . LYS C 1 52  ? -3.078  3.145   -7.744  1.00 21.79 ? 178 LYS C CE   1 
ATOM   3404 N  NZ   . LYS C 1 52  ? -2.005  2.171   -7.888  1.00 23.75 ? 178 LYS C NZ   1 
ATOM   3405 N  N    . THR C 1 53  ? -4.714  -0.656  -3.901  1.00 18.22 ? 179 THR C N    1 
ATOM   3406 C  CA   . THR C 1 53  ? -3.829  -1.803  -4.087  1.00 18.47 ? 179 THR C CA   1 
ATOM   3407 C  C    . THR C 1 53  ? -2.764  -1.422  -5.104  1.00 18.51 ? 179 THR C C    1 
ATOM   3408 O  O    . THR C 1 53  ? -3.080  -1.141  -6.270  1.00 20.51 ? 179 THR C O    1 
ATOM   3409 C  CB   . THR C 1 53  ? -4.607  -3.024  -4.576  1.00 18.97 ? 179 THR C CB   1 
ATOM   3410 O  OG1  . THR C 1 53  ? -5.594  -3.368  -3.596  1.00 20.11 ? 179 THR C OG1  1 
ATOM   3411 C  CG2  . THR C 1 53  ? -3.686  -4.213  -4.805  1.00 19.72 ? 179 THR C CG2  1 
ATOM   3412 N  N    . GLU C 1 54  ? -1.507  -1.381  -4.659  1.00 17.42 ? 180 GLU C N    1 
ATOM   3413 C  CA   . GLU C 1 54  ? -0.405  -1.000  -5.544  1.00 17.42 ? 180 GLU C CA   1 
ATOM   3414 C  C    . GLU C 1 54  ? 0.061   -2.206  -6.361  1.00 16.79 ? 180 GLU C C    1 
ATOM   3415 O  O    . GLU C 1 54  ? 0.407   -2.065  -7.533  1.00 17.01 ? 180 GLU C O    1 
ATOM   3416 C  CB   . GLU C 1 54  ? 0.747   -0.377  -4.751  1.00 16.73 ? 180 GLU C CB   1 
ATOM   3417 C  CG   . GLU C 1 54  ? 0.368   0.901   -3.983  1.00 18.25 ? 180 GLU C CG   1 
ATOM   3418 C  CD   . GLU C 1 54  ? 0.087   2.127   -4.857  1.00 16.37 ? 180 GLU C CD   1 
ATOM   3419 O  OE1  . GLU C 1 54  ? 0.108   2.039   -6.107  1.00 17.81 ? 180 GLU C OE1  1 
ATOM   3420 O  OE2  . GLU C 1 54  ? -0.186  3.199   -4.280  1.00 18.09 ? 180 GLU C OE2  1 
ATOM   3421 N  N    . PHE C 1 55  ? 0.043   -3.380  -5.728  1.00 17.51 ? 181 PHE C N    1 
ATOM   3422 C  CA   . PHE C 1 55  ? 0.185   -4.674  -6.411  1.00 17.68 ? 181 PHE C CA   1 
ATOM   3423 C  C    . PHE C 1 55  ? -0.425  -5.769  -5.548  1.00 17.81 ? 181 PHE C C    1 
ATOM   3424 O  O    . PHE C 1 55  ? -0.442  -5.668  -4.320  1.00 18.44 ? 181 PHE C O    1 
ATOM   3425 C  CB   . PHE C 1 55  ? 1.656   -5.009  -6.769  1.00 17.89 ? 181 PHE C CB   1 
ATOM   3426 C  CG   . PHE C 1 55  ? 2.562   -5.266  -5.586  1.00 17.38 ? 181 PHE C CG   1 
ATOM   3427 C  CD1  . PHE C 1 55  ? 2.729   -6.556  -5.070  1.00 17.33 ? 181 PHE C CD1  1 
ATOM   3428 C  CD2  . PHE C 1 55  ? 3.295   -4.234  -5.019  1.00 16.48 ? 181 PHE C CD2  1 
ATOM   3429 C  CE1  . PHE C 1 55  ? 3.583   -6.790  -4.005  1.00 17.53 ? 181 PHE C CE1  1 
ATOM   3430 C  CE2  . PHE C 1 55  ? 4.157   -4.475  -3.953  1.00 17.54 ? 181 PHE C CE2  1 
ATOM   3431 C  CZ   . PHE C 1 55  ? 4.280   -5.750  -3.443  1.00 17.28 ? 181 PHE C CZ   1 
ATOM   3432 N  N    . ASP C 1 56  ? -0.922  -6.817  -6.183  1.00 18.76 ? 182 ASP C N    1 
ATOM   3433 C  CA   . ASP C 1 56  ? -1.540  -7.909  -5.436  1.00 19.40 ? 182 ASP C CA   1 
ATOM   3434 C  C    . ASP C 1 56  ? -0.695  -9.178  -5.506  1.00 19.25 ? 182 ASP C C    1 
ATOM   3435 O  O    . ASP C 1 56  ? 0.339   -9.198  -6.162  1.00 19.12 ? 182 ASP C O    1 
ATOM   3436 C  CB   . ASP C 1 56  ? -2.994  -8.126  -5.883  1.00 19.52 ? 182 ASP C CB   1 
ATOM   3437 C  CG   . ASP C 1 56  ? -3.122  -8.642  -7.285  1.00 21.06 ? 182 ASP C CG   1 
ATOM   3438 O  OD1  . ASP C 1 56  ? -2.218  -9.357  -7.766  1.00 23.92 ? 182 ASP C OD1  1 
ATOM   3439 O  OD2  . ASP C 1 56  ? -4.167  -8.335  -7.916  1.00 23.14 ? 182 ASP C OD2  1 
ATOM   3440 N  N    . PHE C 1 57  ? -1.111  -10.225 -4.802  1.00 19.44 ? 183 PHE C N    1 
ATOM   3441 C  CA   . PHE C 1 57  ? -0.326  -11.462 -4.746  1.00 18.89 ? 183 PHE C CA   1 
ATOM   3442 C  C    . PHE C 1 57  ? -0.050  -12.054 -6.134  1.00 18.74 ? 183 PHE C C    1 
ATOM   3443 O  O    . PHE C 1 57  ? 1.050   -12.518 -6.419  1.00 18.18 ? 183 PHE C O    1 
ATOM   3444 C  CB   . PHE C 1 57  ? -1.028  -12.517 -3.884  1.00 19.03 ? 183 PHE C CB   1 
ATOM   3445 C  CG   . PHE C 1 57  ? -1.157  -12.140 -2.436  1.00 19.02 ? 183 PHE C CG   1 
ATOM   3446 C  CD1  . PHE C 1 57  ? -0.040  -11.827 -1.680  1.00 18.12 ? 183 PHE C CD1  1 
ATOM   3447 C  CD2  . PHE C 1 57  ? -2.393  -12.142 -1.813  1.00 20.87 ? 183 PHE C CD2  1 
ATOM   3448 C  CE1  . PHE C 1 57  ? -0.152  -11.488 -0.346  1.00 19.55 ? 183 PHE C CE1  1 
ATOM   3449 C  CE2  . PHE C 1 57  ? -2.515  -11.788 -0.464  1.00 20.13 ? 183 PHE C CE2  1 
ATOM   3450 C  CZ   . PHE C 1 57  ? -1.395  -11.460 0.263   1.00 19.20 ? 183 PHE C CZ   1 
ATOM   3451 N  N    . SER C 1 58  ? -1.043  -12.037 -7.009  1.00 18.34 ? 184 SER C N    1 
ATOM   3452 C  CA   . SER C 1 58  ? -0.834  -12.564 -8.351  1.00 19.23 ? 184 SER C CA   1 
ATOM   3453 C  C    . SER C 1 58  ? 0.195   -11.732 -9.124  1.00 18.71 ? 184 SER C C    1 
ATOM   3454 O  O    . SER C 1 58  ? 0.976   -12.284 -9.897  1.00 17.74 ? 184 SER C O    1 
ATOM   3455 C  CB   . SER C 1 58  ? -2.157  -12.661 -9.116  1.00 19.78 ? 184 SER C CB   1 
ATOM   3456 O  OG   . SER C 1 58  ? -2.662  -11.382 -9.402  1.00 24.29 ? 184 SER C OG   1 
ATOM   3457 N  N    . ASP C 1 59  ? 0.187   -10.411 -8.932  1.00 19.01 ? 185 ASP C N    1 
ATOM   3458 C  CA   . ASP C 1 59  ? 1.186   -9.541  -9.591  1.00 18.33 ? 185 ASP C CA   1 
ATOM   3459 C  C    . ASP C 1 59  ? 2.584   -9.880  -9.083  1.00 18.23 ? 185 ASP C C    1 
ATOM   3460 O  O    . ASP C 1 59  ? 3.548   -9.939  -9.850  1.00 18.01 ? 185 ASP C O    1 
ATOM   3461 C  CB   . ASP C 1 59  ? 0.926   -8.063  -9.302  1.00 18.74 ? 185 ASP C CB   1 
ATOM   3462 C  CG   . ASP C 1 59  ? -0.462  -7.600  -9.724  1.00 17.45 ? 185 ASP C CG   1 
ATOM   3463 O  OD1  . ASP C 1 59  ? -0.990  -8.079  -10.758 1.00 21.07 ? 185 ASP C OD1  1 
ATOM   3464 O  OD2  . ASP C 1 59  ? -1.009  -6.726  -9.013  1.00 20.14 ? 185 ASP C OD2  1 
ATOM   3465 N  N    . TYR C 1 60  ? 2.685   -10.067 -7.773  1.00 18.21 ? 186 TYR C N    1 
ATOM   3466 C  CA   . TYR C 1 60  ? 3.947   -10.431 -7.154  1.00 18.69 ? 186 TYR C CA   1 
ATOM   3467 C  C    . TYR C 1 60  ? 4.517   -11.714 -7.764  1.00 18.80 ? 186 TYR C C    1 
ATOM   3468 O  O    . TYR C 1 60  ? 5.696   -11.760 -8.120  1.00 19.30 ? 186 TYR C O    1 
ATOM   3469 C  CB   . TYR C 1 60  ? 3.808   -10.572 -5.634  1.00 19.08 ? 186 TYR C CB   1 
ATOM   3470 C  CG   . TYR C 1 60  ? 5.095   -11.066 -5.051  1.00 18.32 ? 186 TYR C CG   1 
ATOM   3471 C  CD1  . TYR C 1 60  ? 6.170   -10.209 -4.913  1.00 20.51 ? 186 TYR C CD1  1 
ATOM   3472 C  CD2  . TYR C 1 60  ? 5.266   -12.410 -4.711  1.00 19.70 ? 186 TYR C CD2  1 
ATOM   3473 C  CE1  . TYR C 1 60  ? 7.381   -10.663 -4.425  1.00 21.10 ? 186 TYR C CE1  1 
ATOM   3474 C  CE2  . TYR C 1 60  ? 6.468   -12.870 -4.227  1.00 20.43 ? 186 TYR C CE2  1 
ATOM   3475 C  CZ   . TYR C 1 60  ? 7.526   -11.990 -4.088  1.00 23.01 ? 186 TYR C CZ   1 
ATOM   3476 O  OH   . TYR C 1 60  ? 8.741   -12.423 -3.595  1.00 26.34 ? 186 TYR C OH   1 
ATOM   3477 N  N    . VAL C 1 61  ? 3.685   -12.750 -7.858  1.00 19.37 ? 187 VAL C N    1 
ATOM   3478 C  CA   . VAL C 1 61  ? 4.120   -14.047 -8.392  1.00 20.95 ? 187 VAL C CA   1 
ATOM   3479 C  C    . VAL C 1 61  ? 4.541   -13.931 -9.860  1.00 21.27 ? 187 VAL C C    1 
ATOM   3480 O  O    . VAL C 1 61  ? 5.525   -14.553 -10.289 1.00 21.59 ? 187 VAL C O    1 
ATOM   3481 C  CB   . VAL C 1 61  ? 3.020   -15.120 -8.222  1.00 20.89 ? 187 VAL C CB   1 
ATOM   3482 C  CG1  . VAL C 1 61  ? 3.352   -16.399 -9.009  1.00 23.76 ? 187 VAL C CG1  1 
ATOM   3483 C  CG2  . VAL C 1 61  ? 2.839   -15.430 -6.750  1.00 23.28 ? 187 VAL C CG2  1 
ATOM   3484 N  N    . LYS C 1 62  ? 3.810   -13.118 -10.617 1.00 21.05 ? 188 LYS C N    1 
ATOM   3485 C  CA   . LYS C 1 62  ? 4.070   -12.944 -12.037 1.00 22.34 ? 188 LYS C CA   1 
ATOM   3486 C  C    . LYS C 1 62  ? 5.408   -12.240 -12.278 1.00 22.53 ? 188 LYS C C    1 
ATOM   3487 O  O    . LYS C 1 62  ? 6.193   -12.673 -13.126 1.00 22.16 ? 188 LYS C O    1 
ATOM   3488 C  CB   . LYS C 1 62  ? 2.916   -12.165 -12.682 1.00 22.85 ? 188 LYS C CB   1 
ATOM   3489 C  CG   . LYS C 1 62  ? 2.919   -12.136 -14.192 1.00 26.02 ? 188 LYS C CG   1 
ATOM   3490 C  CD   . LYS C 1 62  ? 1.623   -11.502 -14.711 1.00 29.07 ? 188 LYS C CD   1 
ATOM   3491 C  CE   . LYS C 1 62  ? 1.565   -11.483 -16.224 1.00 30.38 ? 188 LYS C CE   1 
ATOM   3492 N  NZ   . LYS C 1 62  ? 0.359   -10.755 -16.704 1.00 32.69 ? 188 LYS C NZ   1 
ATOM   3493 N  N    . TRP C 1 63  ? 5.676   -11.189 -11.503 1.00 22.50 ? 189 TRP C N    1 
ATOM   3494 C  CA   . TRP C 1 63  ? 6.832   -10.313 -11.723 1.00 23.86 ? 189 TRP C CA   1 
ATOM   3495 C  C    . TRP C 1 63  ? 8.039   -10.566 -10.810 1.00 24.51 ? 189 TRP C C    1 
ATOM   3496 O  O    . TRP C 1 63  ? 9.182   -10.449 -11.265 1.00 25.25 ? 189 TRP C O    1 
ATOM   3497 C  CB   . TRP C 1 63  ? 6.398   -8.852  -11.584 1.00 24.76 ? 189 TRP C CB   1 
ATOM   3498 C  CG   . TRP C 1 63  ? 5.723   -8.289  -12.780 1.00 25.66 ? 189 TRP C CG   1 
ATOM   3499 C  CD1  . TRP C 1 63  ? 5.201   -8.974  -13.841 1.00 27.16 ? 189 TRP C CD1  1 
ATOM   3500 C  CD2  . TRP C 1 63  ? 5.492   -6.902  -13.044 1.00 28.19 ? 189 TRP C CD2  1 
ATOM   3501 N  NE1  . TRP C 1 63  ? 4.664   -8.099  -14.747 1.00 27.49 ? 189 TRP C NE1  1 
ATOM   3502 C  CE2  . TRP C 1 63  ? 4.831   -6.818  -14.284 1.00 28.83 ? 189 TRP C CE2  1 
ATOM   3503 C  CE3  . TRP C 1 63  ? 5.785   -5.719  -12.350 1.00 29.14 ? 189 TRP C CE3  1 
ATOM   3504 C  CZ2  . TRP C 1 63  ? 4.456   -5.594  -14.850 1.00 29.62 ? 189 TRP C CZ2  1 
ATOM   3505 C  CZ3  . TRP C 1 63  ? 5.412   -4.507  -12.912 1.00 29.38 ? 189 TRP C CZ3  1 
ATOM   3506 C  CH2  . TRP C 1 63  ? 4.751   -4.454  -14.146 1.00 29.88 ? 189 TRP C CH2  1 
ATOM   3507 N  N    . LYS C 1 64  ? 7.793   -10.866 -9.532  1.00 24.66 ? 190 LYS C N    1 
ATOM   3508 C  CA   . LYS C 1 64  ? 8.855   -11.128 -8.539  1.00 25.13 ? 190 LYS C CA   1 
ATOM   3509 C  C    . LYS C 1 64  ? 9.973   -10.072 -8.516  1.00 24.19 ? 190 LYS C C    1 
ATOM   3510 O  O    . LYS C 1 64  ? 11.151  -10.394 -8.319  1.00 25.51 ? 190 LYS C O    1 
ATOM   3511 C  CB   . LYS C 1 64  ? 9.473   -12.504 -8.779  1.00 25.71 ? 190 LYS C CB   1 
ATOM   3512 C  CG   . LYS C 1 64  ? 8.496   -13.661 -8.688  1.00 28.26 ? 190 LYS C CG   1 
ATOM   3513 C  CD   . LYS C 1 64  ? 8.158   -13.996 -7.245  1.00 29.81 ? 190 LYS C CD   1 
ATOM   3514 C  CE   . LYS C 1 64  ? 7.624   -15.424 -7.121  1.00 30.89 ? 190 LYS C CE   1 
ATOM   3515 N  NZ   . LYS C 1 64  ? 8.613   -16.454 -7.527  1.00 34.10 ? 190 LYS C NZ   1 
ATOM   3516 N  N    . ASP C 1 65  ? 9.588   -8.822  -8.724  1.00 22.01 ? 191 ASP C N    1 
ATOM   3517 C  CA   . ASP C 1 65  ? 10.501  -7.714  -8.940  1.00 20.79 ? 191 ASP C CA   1 
ATOM   3518 C  C    . ASP C 1 65  ? 9.993   -6.543  -8.087  1.00 20.19 ? 191 ASP C C    1 
ATOM   3519 O  O    . ASP C 1 65  ? 9.185   -5.738  -8.553  1.00 19.65 ? 191 ASP C O    1 
ATOM   3520 C  CB   . ASP C 1 65  ? 10.481  -7.370  -10.437 1.00 21.29 ? 191 ASP C CB   1 
ATOM   3521 C  CG   . ASP C 1 65  ? 11.482  -6.301  -10.833 1.00 22.02 ? 191 ASP C CG   1 
ATOM   3522 O  OD1  . ASP C 1 65  ? 11.977  -5.536  -9.970  1.00 22.54 ? 191 ASP C OD1  1 
ATOM   3523 O  OD2  . ASP C 1 65  ? 11.762  -6.223  -12.056 1.00 23.12 ? 191 ASP C OD2  1 
ATOM   3524 N  N    . PRO C 1 66  ? 10.443  -6.457  -6.822  1.00 19.47 ? 192 PRO C N    1 
ATOM   3525 C  CA   . PRO C 1 66  ? 9.911   -5.419  -5.931  1.00 20.01 ? 192 PRO C CA   1 
ATOM   3526 C  C    . PRO C 1 66  ? 10.082  -3.985  -6.446  1.00 19.67 ? 192 PRO C C    1 
ATOM   3527 O  O    . PRO C 1 66  ? 9.153   -3.161  -6.295  1.00 19.50 ? 192 PRO C O    1 
ATOM   3528 C  CB   . PRO C 1 66  ? 10.688  -5.645  -4.631  1.00 20.64 ? 192 PRO C CB   1 
ATOM   3529 C  CG   . PRO C 1 66  ? 11.093  -7.077  -4.670  1.00 20.19 ? 192 PRO C CG   1 
ATOM   3530 C  CD   . PRO C 1 66  ? 11.348  -7.386  -6.113  1.00 19.94 ? 192 PRO C CD   1 
ATOM   3531 N  N    . ASP C 1 67  ? 11.226  -3.669  -7.060  1.00 19.27 ? 193 ASP C N    1 
ATOM   3532 C  CA   . ASP C 1 67  ? 11.418  -2.323  -7.611  1.00 19.92 ? 193 ASP C CA   1 
ATOM   3533 C  C    . ASP C 1 67  ? 10.341  -1.992  -8.649  1.00 18.71 ? 193 ASP C C    1 
ATOM   3534 O  O    . ASP C 1 67  ? 9.765   -0.896  -8.626  1.00 20.49 ? 193 ASP C O    1 
ATOM   3535 C  CB   . ASP C 1 67  ? 12.796  -2.153  -8.238  1.00 20.96 ? 193 ASP C CB   1 
ATOM   3536 C  CG   . ASP C 1 67  ? 13.913  -2.153  -7.212  1.00 25.34 ? 193 ASP C CG   1 
ATOM   3537 O  OD1  . ASP C 1 67  ? 13.623  -2.147  -5.994  1.00 26.20 ? 193 ASP C OD1  1 
ATOM   3538 O  OD2  . ASP C 1 67  ? 15.088  -2.166  -7.643  1.00 28.06 ? 193 ASP C OD2  1 
ATOM   3539 N  N    . ALA C 1 68  ? 10.078  -2.929  -9.555  1.00 17.48 ? 194 ALA C N    1 
ATOM   3540 C  CA   . ALA C 1 68  ? 9.082   -2.712  -10.614 1.00 17.51 ? 194 ALA C CA   1 
ATOM   3541 C  C    . ALA C 1 68  ? 7.668   -2.641  -10.025 1.00 17.40 ? 194 ALA C C    1 
ATOM   3542 O  O    . ALA C 1 68  ? 6.847   -1.821  -10.449 1.00 18.23 ? 194 ALA C O    1 
ATOM   3543 C  CB   . ALA C 1 68  ? 9.174   -3.802  -11.662 1.00 17.56 ? 194 ALA C CB   1 
ATOM   3544 N  N    . LEU C 1 69  ? 7.395   -3.486  -9.032  1.00 17.99 ? 195 LEU C N    1 
ATOM   3545 C  CA   . LEU C 1 69  ? 6.062   -3.564  -8.442  1.00 17.88 ? 195 LEU C CA   1 
ATOM   3546 C  C    . LEU C 1 69  ? 5.674   -2.267  -7.717  1.00 18.01 ? 195 LEU C C    1 
ATOM   3547 O  O    . LEU C 1 69  ? 4.485   -1.944  -7.622  1.00 18.29 ? 195 LEU C O    1 
ATOM   3548 C  CB   . LEU C 1 69  ? 5.963   -4.763  -7.484  1.00 17.61 ? 195 LEU C CB   1 
ATOM   3549 C  CG   . LEU C 1 69  ? 5.976   -6.159  -8.121  1.00 18.71 ? 195 LEU C CG   1 
ATOM   3550 C  CD1  . LEU C 1 69  ? 6.341   -7.258  -7.124  1.00 19.18 ? 195 LEU C CD1  1 
ATOM   3551 C  CD2  . LEU C 1 69  ? 4.636   -6.469  -8.795  1.00 19.44 ? 195 LEU C CD2  1 
ATOM   3552 N  N    . LEU C 1 70  ? 6.665   -1.519  -7.224  1.00 17.88 ? 196 LEU C N    1 
ATOM   3553 C  CA   . LEU C 1 70  ? 6.420   -0.280  -6.472  1.00 18.25 ? 196 LEU C CA   1 
ATOM   3554 C  C    . LEU C 1 70  ? 6.823   1.001   -7.231  1.00 18.51 ? 196 LEU C C    1 
ATOM   3555 O  O    . LEU C 1 70  ? 6.759   2.106   -6.691  1.00 18.87 ? 196 LEU C O    1 
ATOM   3556 C  CB   . LEU C 1 70  ? 7.135   -0.347  -5.120  1.00 18.13 ? 196 LEU C CB   1 
ATOM   3557 C  CG   . LEU C 1 70  ? 6.544   -1.331  -4.112  1.00 18.02 ? 196 LEU C CG   1 
ATOM   3558 C  CD1  . LEU C 1 70  ? 7.526   -1.565  -2.957  1.00 21.24 ? 196 LEU C CD1  1 
ATOM   3559 C  CD2  . LEU C 1 70  ? 5.168   -0.848  -3.604  1.00 20.78 ? 196 LEU C CD2  1 
ATOM   3560 N  N    . LYS C 1 71  ? 7.199   0.852   -8.490  1.00 18.48 ? 197 LYS C N    1 
ATOM   3561 C  CA   . LYS C 1 71  ? 7.764   1.961   -9.255  1.00 18.56 ? 197 LYS C CA   1 
ATOM   3562 C  C    . LYS C 1 71  ? 6.794   3.128   -9.425  1.00 20.30 ? 197 LYS C C    1 
ATOM   3563 O  O    . LYS C 1 71  ? 7.221   4.290   -9.456  1.00 20.51 ? 197 LYS C O    1 
ATOM   3564 C  CB   . LYS C 1 71  ? 8.220   1.460   -10.634 1.00 19.21 ? 197 LYS C CB   1 
ATOM   3565 C  CG   . LYS C 1 71  ? 8.711   2.545   -11.566 1.00 19.79 ? 197 LYS C CG   1 
ATOM   3566 C  CD   . LYS C 1 71  ? 9.254   1.964   -12.873 1.00 22.10 ? 197 LYS C CD   1 
ATOM   3567 C  CE   . LYS C 1 71  ? 9.593   3.075   -13.861 1.00 23.01 ? 197 LYS C CE   1 
ATOM   3568 N  NZ   . LYS C 1 71  ? 10.236  2.553   -15.099 1.00 24.03 ? 197 LYS C NZ   1 
ATOM   3569 N  N    . HIS C 1 72  ? 5.506   2.815   -9.534  1.00 20.39 ? 198 HIS C N    1 
ATOM   3570 C  CA   . HIS C 1 72  ? 4.485   3.815   -9.882  1.00 21.01 ? 198 HIS C CA   1 
ATOM   3571 C  C    . HIS C 1 72  ? 3.564   4.173   -8.736  1.00 21.68 ? 198 HIS C C    1 
ATOM   3572 O  O    . HIS C 1 72  ? 2.447   4.658   -8.953  1.00 22.27 ? 198 HIS C O    1 
ATOM   3573 C  CB   . HIS C 1 72  ? 3.699   3.350   -11.105 1.00 21.87 ? 198 HIS C CB   1 
ATOM   3574 C  CG   . HIS C 1 72  ? 4.551   3.217   -12.327 1.00 22.49 ? 198 HIS C CG   1 
ATOM   3575 N  ND1  . HIS C 1 72  ? 5.210   4.288   -12.886 1.00 27.04 ? 198 HIS C ND1  1 
ATOM   3576 C  CD2  . HIS C 1 72  ? 4.896   2.137   -13.066 1.00 25.00 ? 198 HIS C CD2  1 
ATOM   3577 C  CE1  . HIS C 1 72  ? 5.911   3.877   -13.928 1.00 26.17 ? 198 HIS C CE1  1 
ATOM   3578 N  NE2  . HIS C 1 72  ? 5.731   2.577   -14.061 1.00 25.00 ? 198 HIS C NE2  1 
ATOM   3579 N  N    . VAL C 1 73  ? 4.041   3.964   -7.517  1.00 20.34 ? 199 VAL C N    1 
ATOM   3580 C  CA   . VAL C 1 73  ? 3.342   4.436   -6.333  1.00 20.08 ? 199 VAL C CA   1 
ATOM   3581 C  C    . VAL C 1 73  ? 3.419   5.961   -6.337  1.00 20.82 ? 199 VAL C C    1 
ATOM   3582 O  O    . VAL C 1 73  ? 4.506   6.532   -6.509  1.00 21.38 ? 199 VAL C O    1 
ATOM   3583 C  CB   . VAL C 1 73  ? 3.980   3.895   -5.040  1.00 19.18 ? 199 VAL C CB   1 
ATOM   3584 C  CG1  . VAL C 1 73  ? 3.364   4.568   -3.809  1.00 20.70 ? 199 VAL C CG1  1 
ATOM   3585 C  CG2  . VAL C 1 73  ? 3.836   2.356   -4.943  1.00 21.06 ? 199 VAL C CG2  1 
ATOM   3586 N  N    . LYS C 1 74  ? 2.267   6.609   -6.188  1.00 21.27 ? 200 LYS C N    1 
ATOM   3587 C  CA   . LYS C 1 74  ? 2.196   8.067   -6.041  1.00 22.20 ? 200 LYS C CA   1 
ATOM   3588 C  C    . LYS C 1 74  ? 1.658   8.384   -4.649  1.00 21.47 ? 200 LYS C C    1 
ATOM   3589 O  O    . LYS C 1 74  ? 0.594   7.899   -4.251  1.00 19.93 ? 200 LYS C O    1 
ATOM   3590 C  CB   . LYS C 1 74  ? 1.297   8.686   -7.116  1.00 23.42 ? 200 LYS C CB   1 
ATOM   3591 C  CG   . LYS C 1 74  ? 1.158   10.205  -7.043  1.00 26.41 ? 200 LYS C CG   1 
ATOM   3592 C  CD   . LYS C 1 74  ? 0.527   10.774  -8.325  1.00 30.30 ? 200 LYS C CD   1 
ATOM   3593 C  CE   . LYS C 1 74  ? 0.455   12.301  -8.311  1.00 31.57 ? 200 LYS C CE   1 
ATOM   3594 N  NZ   . LYS C 1 74  ? -0.094  12.865  -9.595  1.00 33.62 ? 200 LYS C NZ   1 
ATOM   3595 N  N    . HIS C 1 75  ? 2.421   9.188   -3.921  1.00 20.31 ? 201 HIS C N    1 
ATOM   3596 C  CA   . HIS C 1 75  ? 2.102   9.582   -2.551  1.00 20.12 ? 201 HIS C CA   1 
ATOM   3597 C  C    . HIS C 1 75  ? 0.756   10.324  -2.540  1.00 20.15 ? 201 HIS C C    1 
ATOM   3598 O  O    . HIS C 1 75  ? 0.594   11.349  -3.214  1.00 19.73 ? 201 HIS C O    1 
ATOM   3599 C  CB   . HIS C 1 75  ? 3.230   10.469  -2.024  1.00 20.28 ? 201 HIS C CB   1 
ATOM   3600 C  CG   . HIS C 1 75  ? 3.119   10.818  -0.575  1.00 20.51 ? 201 HIS C CG   1 
ATOM   3601 N  ND1  . HIS C 1 75  ? 4.060   11.595  0.067   1.00 21.07 ? 201 HIS C ND1  1 
ATOM   3602 C  CD2  . HIS C 1 75  ? 2.201   10.484  0.362   1.00 19.96 ? 201 HIS C CD2  1 
ATOM   3603 C  CE1  . HIS C 1 75  ? 3.721   11.728  1.337   1.00 20.81 ? 201 HIS C CE1  1 
ATOM   3604 N  NE2  . HIS C 1 75  ? 2.594   11.070  1.540   1.00 20.26 ? 201 HIS C NE2  1 
ATOM   3605 N  N    . MET C 1 76  ? -0.208  9.783   -1.803  1.00 19.85 ? 202 MET C N    1 
ATOM   3606 C  CA   . MET C 1 76  ? -1.578  10.288  -1.821  1.00 19.97 ? 202 MET C CA   1 
ATOM   3607 C  C    . MET C 1 76  ? -1.754  11.688  -1.206  1.00 19.65 ? 202 MET C C    1 
ATOM   3608 O  O    . MET C 1 76  ? -2.512  12.516  -1.736  1.00 19.23 ? 202 MET C O    1 
ATOM   3609 C  CB   . MET C 1 76  ? -2.491  9.297   -1.100  1.00 20.18 ? 202 MET C CB   1 
ATOM   3610 C  CG   . MET C 1 76  ? -2.806  8.067   -1.911  1.00 20.34 ? 202 MET C CG   1 
ATOM   3611 S  SD   . MET C 1 76  ? -3.617  6.835   -0.898  1.00 21.58 ? 202 MET C SD   1 
ATOM   3612 C  CE   . MET C 1 76  ? -4.140  5.638   -2.122  1.00 22.60 ? 202 MET C CE   1 
ATOM   3613 N  N    . LEU C 1 77  ? -1.066  11.928  -0.090  1.00 19.46 ? 203 LEU C N    1 
ATOM   3614 C  CA   . LEU C 1 77  ? -1.017  13.228  0.596   1.00 19.74 ? 203 LEU C CA   1 
ATOM   3615 C  C    . LEU C 1 77  ? -2.371  13.684  1.184   1.00 19.70 ? 203 LEU C C    1 
ATOM   3616 O  O    . LEU C 1 77  ? -2.694  14.868  1.155   1.00 20.16 ? 203 LEU C O    1 
ATOM   3617 C  CB   . LEU C 1 77  ? -0.413  14.309  -0.311  1.00 20.85 ? 203 LEU C CB   1 
ATOM   3618 C  CG   . LEU C 1 77  ? 1.050   14.091  -0.719  1.00 23.46 ? 203 LEU C CG   1 
ATOM   3619 C  CD1  . LEU C 1 77  ? 1.392   14.887  -1.967  1.00 26.73 ? 203 LEU C CD1  1 
ATOM   3620 C  CD2  . LEU C 1 77  ? 1.988   14.456  0.435   1.00 24.46 ? 203 LEU C CD2  1 
ATOM   3621 N  N    . LEU C 1 78  ? -3.129  12.746  1.757   1.00 19.39 ? 204 LEU C N    1 
ATOM   3622 C  CA   . LEU C 1 78  ? -4.431  13.088  2.368   1.00 19.58 ? 204 LEU C CA   1 
ATOM   3623 C  C    . LEU C 1 78  ? -4.474  12.662  3.855   1.00 19.50 ? 204 LEU C C    1 
ATOM   3624 O  O    . LEU C 1 78  ? -3.526  12.936  4.575   1.00 19.35 ? 204 LEU C O    1 
ATOM   3625 C  CB   . LEU C 1 78  ? -5.573  12.512  1.523   1.00 19.75 ? 204 LEU C CB   1 
ATOM   3626 C  CG   . LEU C 1 78  ? -5.653  13.057  0.089   1.00 20.23 ? 204 LEU C CG   1 
ATOM   3627 C  CD1  . LEU C 1 78  ? -6.627  12.223  -0.725  1.00 22.04 ? 204 LEU C CD1  1 
ATOM   3628 C  CD2  . LEU C 1 78  ? -6.045  14.536  0.068   1.00 21.11 ? 204 LEU C CD2  1 
ATOM   3629 N  N    . LEU C 1 79  ? -5.547  12.007  4.318   1.00 19.31 ? 205 LEU C N    1 
ATOM   3630 C  CA   . LEU C 1 79  ? -5.723  11.699  5.751   1.00 19.65 ? 205 LEU C CA   1 
ATOM   3631 C  C    . LEU C 1 79  ? -5.109  10.327  6.160   1.00 20.31 ? 205 LEU C C    1 
ATOM   3632 O  O    . LEU C 1 79  ? -4.250  9.807   5.446   1.00 19.04 ? 205 LEU C O    1 
ATOM   3633 C  CB   . LEU C 1 79  ? -7.216  11.811  6.116   1.00 19.84 ? 205 LEU C CB   1 
ATOM   3634 C  CG   . LEU C 1 79  ? -7.850  13.172  5.800   1.00 20.46 ? 205 LEU C CG   1 
ATOM   3635 C  CD1  . LEU C 1 79  ? -9.364  13.149  6.077   1.00 19.97 ? 205 LEU C CD1  1 
ATOM   3636 C  CD2  . LEU C 1 79  ? -7.184  14.298  6.580   1.00 20.84 ? 205 LEU C CD2  1 
ATOM   3637 N  N    . THR C 1 80  ? -5.534  9.750   7.294   1.00 20.21 ? 206 THR C N    1 
ATOM   3638 C  CA   . THR C 1 80  ? -4.986  8.468   7.794   1.00 20.81 ? 206 THR C CA   1 
ATOM   3639 C  C    . THR C 1 80  ? -6.113  7.533   8.268   1.00 20.12 ? 206 THR C C    1 
ATOM   3640 O  O    . THR C 1 80  ? -6.256  7.251   9.458   1.00 20.66 ? 206 THR C O    1 
ATOM   3641 C  CB   . THR C 1 80  ? -3.987  8.720   8.937   1.00 20.57 ? 206 THR C CB   1 
ATOM   3642 O  OG1  . THR C 1 80  ? -3.080  9.766   8.545   1.00 23.15 ? 206 THR C OG1  1 
ATOM   3643 C  CG2  . THR C 1 80  ? -3.199  7.464   9.277   1.00 20.98 ? 206 THR C CG2  1 
ATOM   3644 N  N    . ASN C 1 81  ? -6.912  7.055   7.323   1.00 20.88 ? 207 ASN C N    1 
ATOM   3645 C  CA   . ASN C 1 81  ? -8.095  6.250   7.655   1.00 20.50 ? 207 ASN C CA   1 
ATOM   3646 C  C    . ASN C 1 81  ? -7.726  4.779   7.857   1.00 20.17 ? 207 ASN C C    1 
ATOM   3647 O  O    . ASN C 1 81  ? -8.020  3.908   7.038   1.00 19.37 ? 207 ASN C O    1 
ATOM   3648 C  CB   . ASN C 1 81  ? -9.175  6.454   6.595   1.00 21.10 ? 207 ASN C CB   1 
ATOM   3649 C  CG   . ASN C 1 81  ? -9.805  7.839   6.671   1.00 19.77 ? 207 ASN C CG   1 
ATOM   3650 O  OD1  . ASN C 1 81  ? -9.836  8.471   7.739   1.00 21.87 ? 207 ASN C OD1  1 
ATOM   3651 N  ND2  . ASN C 1 81  ? -10.341 8.307   5.548   1.00 18.96 ? 207 ASN C ND2  1 
ATOM   3652 N  N    . THR C 1 82  ? -7.055  4.530   8.973   1.00 19.84 ? 208 THR C N    1 
ATOM   3653 C  CA   . THR C 1 82  ? -6.485  3.225   9.290   1.00 19.59 ? 208 THR C CA   1 
ATOM   3654 C  C    . THR C 1 82  ? -7.525  2.111   9.452   1.00 18.64 ? 208 THR C C    1 
ATOM   3655 O  O    . THR C 1 82  ? -7.294  1.004   8.977   1.00 18.56 ? 208 THR C O    1 
ATOM   3656 C  CB   . THR C 1 82  ? -5.631  3.314   10.565  1.00 19.47 ? 208 THR C CB   1 
ATOM   3657 O  OG1  . THR C 1 82  ? -4.809  4.487   10.475  1.00 21.74 ? 208 THR C OG1  1 
ATOM   3658 C  CG2  . THR C 1 82  ? -4.737  2.063   10.743  1.00 22.13 ? 208 THR C CG2  1 
ATOM   3659 N  N    . PHE C 1 83  ? -8.661  2.383   10.102  1.00 18.96 ? 209 PHE C N    1 
ATOM   3660 C  CA   . PHE C 1 83  ? -9.709  1.350   10.245  1.00 19.04 ? 209 PHE C CA   1 
ATOM   3661 C  C    . PHE C 1 83  ? -10.239 0.913   8.884   1.00 18.90 ? 209 PHE C C    1 
ATOM   3662 O  O    . PHE C 1 83  ? -10.408 -0.279  8.616   1.00 18.93 ? 209 PHE C O    1 
ATOM   3663 C  CB   . PHE C 1 83  ? -10.916 1.857   11.051  1.00 19.29 ? 209 PHE C CB   1 
ATOM   3664 C  CG   . PHE C 1 83  ? -10.725 1.832   12.541  1.00 18.71 ? 209 PHE C CG   1 
ATOM   3665 C  CD1  . PHE C 1 83  ? -11.060 0.701   13.274  1.00 19.99 ? 209 PHE C CD1  1 
ATOM   3666 C  CD2  . PHE C 1 83  ? -10.239 2.938   13.213  1.00 19.58 ? 209 PHE C CD2  1 
ATOM   3667 C  CE1  . PHE C 1 83  ? -10.911 0.678   14.655  1.00 21.44 ? 209 PHE C CE1  1 
ATOM   3668 C  CE2  . PHE C 1 83  ? -10.091 2.916   14.596  1.00 20.49 ? 209 PHE C CE2  1 
ATOM   3669 C  CZ   . PHE C 1 83  ? -10.425 1.789   15.308  1.00 19.97 ? 209 PHE C CZ   1 
ATOM   3670 N  N    . GLY C 1 84  ? -10.526 1.893   8.031   1.00 18.62 ? 210 GLY C N    1 
ATOM   3671 C  CA   . GLY C 1 84  ? -11.045 1.613   6.705   1.00 19.60 ? 210 GLY C CA   1 
ATOM   3672 C  C    . GLY C 1 84  ? -10.043 0.846   5.874   1.00 19.25 ? 210 GLY C C    1 
ATOM   3673 O  O    . GLY C 1 84  ? -10.410 -0.037  5.096   1.00 20.32 ? 210 GLY C O    1 
ATOM   3674 N  N    . ALA C 1 85  ? -8.770  1.184   6.062   1.00 19.35 ? 211 ALA C N    1 
ATOM   3675 C  CA   . ALA C 1 85  ? -7.669  0.553   5.329   1.00 18.21 ? 211 ALA C CA   1 
ATOM   3676 C  C    . ALA C 1 85  ? -7.486  -0.927  5.683   1.00 17.99 ? 211 ALA C C    1 
ATOM   3677 O  O    . ALA C 1 85  ? -7.304  -1.773  4.797   1.00 18.45 ? 211 ALA C O    1 
ATOM   3678 C  CB   . ALA C 1 85  ? -6.388  1.324   5.580   1.00 17.60 ? 211 ALA C CB   1 
ATOM   3679 N  N    . ILE C 1 86  ? -7.536  -1.240  6.973   1.00 17.86 ? 212 ILE C N    1 
ATOM   3680 C  CA   . ILE C 1 86  ? -7.410  -2.608  7.446   1.00 18.07 ? 212 ILE C CA   1 
ATOM   3681 C  C    . ILE C 1 86  ? -8.600  -3.448  6.966   1.00 18.63 ? 212 ILE C C    1 
ATOM   3682 O  O    . ILE C 1 86  ? -8.438  -4.587  6.528   1.00 18.79 ? 212 ILE C O    1 
ATOM   3683 C  CB   . ILE C 1 86  ? -7.247  -2.673  8.996   1.00 18.39 ? 212 ILE C CB   1 
ATOM   3684 C  CG1  . ILE C 1 86  ? -5.889  -2.079  9.413   1.00 18.84 ? 212 ILE C CG1  1 
ATOM   3685 C  CG2  . ILE C 1 86  ? -7.380  -4.108  9.500   1.00 17.43 ? 212 ILE C CG2  1 
ATOM   3686 C  CD1  . ILE C 1 86  ? -5.760  -1.757  10.895  1.00 19.40 ? 212 ILE C CD1  1 
ATOM   3687 N  N    . ASN C 1 87  ? -9.798  -2.881  7.042   1.00 19.22 ? 213 ASN C N    1 
ATOM   3688 C  CA   . ASN C 1 87  ? -10.967 -3.558  6.493   1.00 19.01 ? 213 ASN C CA   1 
ATOM   3689 C  C    . ASN C 1 87  ? -10.847 -3.816  4.989   1.00 18.60 ? 213 ASN C C    1 
ATOM   3690 O  O    . ASN C 1 87  ? -11.217 -4.888  4.503   1.00 18.29 ? 213 ASN C O    1 
ATOM   3691 C  CB   . ASN C 1 87  ? -12.250 -2.784  6.835   1.00 18.77 ? 213 ASN C CB   1 
ATOM   3692 C  CG   . ASN C 1 87  ? -12.744 -3.078  8.236   1.00 20.53 ? 213 ASN C CG   1 
ATOM   3693 O  OD1  . ASN C 1 87  ? -13.322 -4.134  8.482   1.00 23.90 ? 213 ASN C OD1  1 
ATOM   3694 N  ND2  . ASN C 1 87  ? -12.513 -2.149  9.164   1.00 21.50 ? 213 ASN C ND2  1 
ATOM   3695 N  N    . TYR C 1 88  ? -10.325 -2.831  4.260   1.00 18.10 ? 214 TYR C N    1 
ATOM   3696 C  CA   . TYR C 1 88  ? -10.102 -2.970  2.824   1.00 17.88 ? 214 TYR C CA   1 
ATOM   3697 C  C    . TYR C 1 88  ? -9.156  -4.130  2.538   1.00 17.60 ? 214 TYR C C    1 
ATOM   3698 O  O    . TYR C 1 88  ? -9.395  -4.928  1.646   1.00 17.85 ? 214 TYR C O    1 
ATOM   3699 C  CB   . TYR C 1 88  ? -9.553  -1.653  2.253   1.00 18.26 ? 214 TYR C CB   1 
ATOM   3700 C  CG   . TYR C 1 88  ? -9.126  -1.725  0.810   1.00 19.08 ? 214 TYR C CG   1 
ATOM   3701 C  CD1  . TYR C 1 88  ? -10.008 -1.421  -0.217  1.00 19.69 ? 214 TYR C CD1  1 
ATOM   3702 C  CD2  . TYR C 1 88  ? -7.834  -2.121  0.470   1.00 21.01 ? 214 TYR C CD2  1 
ATOM   3703 C  CE1  . TYR C 1 88  ? -9.617  -1.490  -1.545  1.00 21.60 ? 214 TYR C CE1  1 
ATOM   3704 C  CE2  . TYR C 1 88  ? -7.436  -2.203  -0.857  1.00 21.83 ? 214 TYR C CE2  1 
ATOM   3705 C  CZ   . TYR C 1 88  ? -8.325  -1.889  -1.859  1.00 20.06 ? 214 TYR C CZ   1 
ATOM   3706 O  OH   . TYR C 1 88  ? -7.941  -1.963  -3.188  1.00 21.97 ? 214 TYR C OH   1 
ATOM   3707 N  N    . VAL C 1 89  ? -8.081  -4.238  3.314   1.00 17.48 ? 215 VAL C N    1 
ATOM   3708 C  CA   . VAL C 1 89  ? -7.138  -5.346  3.100   1.00 18.02 ? 215 VAL C CA   1 
ATOM   3709 C  C    . VAL C 1 89  ? -7.828  -6.697  3.324   1.00 18.04 ? 215 VAL C C    1 
ATOM   3710 O  O    . VAL C 1 89  ? -7.720  -7.608  2.509   1.00 17.43 ? 215 VAL C O    1 
ATOM   3711 C  CB   . VAL C 1 89  ? -5.881  -5.218  3.995   1.00 17.52 ? 215 VAL C CB   1 
ATOM   3712 C  CG1  . VAL C 1 89  ? -5.058  -6.506  3.970   1.00 19.50 ? 215 VAL C CG1  1 
ATOM   3713 C  CG2  . VAL C 1 89  ? -5.022  -4.032  3.529   1.00 20.17 ? 215 VAL C CG2  1 
ATOM   3714 N  N    . ALA C 1 90  ? -8.551  -6.804  4.429   1.00 18.58 ? 216 ALA C N    1 
ATOM   3715 C  CA   . ALA C 1 90  ? -9.220  -8.048  4.808   1.00 19.63 ? 216 ALA C CA   1 
ATOM   3716 C  C    . ALA C 1 90  ? -10.193 -8.531  3.737   1.00 21.02 ? 216 ALA C C    1 
ATOM   3717 O  O    . ALA C 1 90  ? -10.257 -9.729  3.460   1.00 21.33 ? 216 ALA C O    1 
ATOM   3718 C  CB   . ALA C 1 90  ? -9.951  -7.869  6.138   1.00 19.19 ? 216 ALA C CB   1 
ATOM   3719 N  N    . THR C 1 91  ? -10.941 -7.609  3.133   1.00 21.82 ? 217 THR C N    1 
ATOM   3720 C  CA   . THR C 1 91  ? -11.991 -8.000  2.190   1.00 22.40 ? 217 THR C CA   1 
ATOM   3721 C  C    . THR C 1 91  ? -11.608 -7.911  0.713   1.00 22.68 ? 217 THR C C    1 
ATOM   3722 O  O    . THR C 1 91  ? -12.170 -8.641  -0.109  1.00 22.93 ? 217 THR C O    1 
ATOM   3723 C  CB   . THR C 1 91  ? -13.301 -7.208  2.427   1.00 22.59 ? 217 THR C CB   1 
ATOM   3724 O  OG1  . THR C 1 91  ? -13.062 -5.819  2.221   1.00 24.30 ? 217 THR C OG1  1 
ATOM   3725 C  CG2  . THR C 1 91  ? -13.812 -7.429  3.844   1.00 24.78 ? 217 THR C CG2  1 
ATOM   3726 N  N    . GLU C 1 92  ? -10.662 -7.036  0.370   1.00 22.74 ? 218 GLU C N    1 
ATOM   3727 C  CA   . GLU C 1 92  ? -10.333 -6.760  -1.029  1.00 23.58 ? 218 GLU C CA   1 
ATOM   3728 C  C    . GLU C 1 92  ? -8.993  -7.308  -1.515  1.00 22.70 ? 218 GLU C C    1 
ATOM   3729 O  O    . GLU C 1 92  ? -8.782  -7.395  -2.729  1.00 24.19 ? 218 GLU C O    1 
ATOM   3730 C  CB   . GLU C 1 92  ? -10.357 -5.253  -1.304  1.00 24.64 ? 218 GLU C CB   1 
ATOM   3731 C  CG   . GLU C 1 92  ? -11.681 -4.580  -1.012  1.00 25.70 ? 218 GLU C CG   1 
ATOM   3732 C  CD   . GLU C 1 92  ? -12.767 -4.896  -2.036  1.00 28.37 ? 218 GLU C CD   1 
ATOM   3733 O  OE1  . GLU C 1 92  ? -12.501 -5.565  -3.063  1.00 32.20 ? 218 GLU C OE1  1 
ATOM   3734 O  OE2  . GLU C 1 92  ? -13.898 -4.451  -1.811  1.00 32.80 ? 218 GLU C OE2  1 
ATOM   3735 N  N    . VAL C 1 93  ? -8.088  -7.658  -0.599  1.00 21.36 ? 219 VAL C N    1 
ATOM   3736 C  CA   . VAL C 1 93  ? -6.748  -8.118  -0.992  1.00 20.41 ? 219 VAL C CA   1 
ATOM   3737 C  C    . VAL C 1 93  ? -6.544  -9.604  -0.737  1.00 19.68 ? 219 VAL C C    1 
ATOM   3738 O  O    . VAL C 1 93  ? -5.972  -10.304 -1.572  1.00 20.48 ? 219 VAL C O    1 
ATOM   3739 C  CB   . VAL C 1 93  ? -5.656  -7.296  -0.292  1.00 20.39 ? 219 VAL C CB   1 
ATOM   3740 C  CG1  . VAL C 1 93  ? -4.269  -7.810  -0.664  1.00 22.18 ? 219 VAL C CG1  1 
ATOM   3741 C  CG2  . VAL C 1 93  ? -5.809  -5.817  -0.648  1.00 22.08 ? 219 VAL C CG2  1 
ATOM   3742 N  N    . PHE C 1 94  ? -7.013  -10.088 0.406   1.00 20.08 ? 220 PHE C N    1 
ATOM   3743 C  CA   . PHE C 1 94  ? -6.899  -11.499 0.752   1.00 19.99 ? 220 PHE C CA   1 
ATOM   3744 C  C    . PHE C 1 94  ? -8.028  -12.278 0.066   1.00 21.71 ? 220 PHE C C    1 
ATOM   3745 O  O    . PHE C 1 94  ? -9.017  -12.660 0.700   1.00 22.62 ? 220 PHE C O    1 
ATOM   3746 C  CB   . PHE C 1 94  ? -6.925  -11.688 2.277   1.00 20.11 ? 220 PHE C CB   1 
ATOM   3747 C  CG   . PHE C 1 94  ? -5.605  -11.424 2.957   1.00 19.62 ? 220 PHE C CG   1 
ATOM   3748 C  CD1  . PHE C 1 94  ? -4.531  -12.293 2.774   1.00 20.94 ? 220 PHE C CD1  1 
ATOM   3749 C  CD2  . PHE C 1 94  ? -5.438  -10.331 3.786   1.00 17.69 ? 220 PHE C CD2  1 
ATOM   3750 C  CE1  . PHE C 1 94  ? -3.342  -12.063 3.391   1.00 21.07 ? 220 PHE C CE1  1 
ATOM   3751 C  CE2  . PHE C 1 94  ? -4.225  -10.094 4.419   1.00 19.22 ? 220 PHE C CE2  1 
ATOM   3752 C  CZ   . PHE C 1 94  ? -3.181  -10.966 4.219   1.00 20.39 ? 220 PHE C CZ   1 
ATOM   3753 N  N    . ARG C 1 95  ? -7.872  -12.462 -1.247  1.00 22.08 ? 221 ARG C N    1 
ATOM   3754 C  CA   . ARG C 1 95  ? -8.836  -13.155 -2.096  1.00 22.72 ? 221 ARG C CA   1 
ATOM   3755 C  C    . ARG C 1 95  ? -8.097  -14.118 -3.003  1.00 22.56 ? 221 ARG C C    1 
ATOM   3756 O  O    . ARG C 1 95  ? -7.136  -13.737 -3.666  1.00 21.23 ? 221 ARG C O    1 
ATOM   3757 C  CB   . ARG C 1 95  ? -9.586  -12.169 -2.989  1.00 23.78 ? 221 ARG C CB   1 
ATOM   3758 C  CG   . ARG C 1 95  ? -10.377 -11.086 -2.249  1.00 26.51 ? 221 ARG C CG   1 
ATOM   3759 C  CD   . ARG C 1 95  ? -10.935 -10.072 -3.240  1.00 30.32 ? 221 ARG C CD   1 
ATOM   3760 N  NE   . ARG C 1 95  ? -11.870 -10.682 -4.186  1.00 32.20 ? 221 ARG C NE   1 
ATOM   3761 C  CZ   . ARG C 1 95  ? -12.063 -10.282 -5.446  1.00 33.99 ? 221 ARG C CZ   1 
ATOM   3762 N  NH1  . ARG C 1 95  ? -11.382 -9.260  -5.964  1.00 35.69 ? 221 ARG C NH1  1 
ATOM   3763 N  NH2  . ARG C 1 95  ? -12.949 -10.916 -6.206  1.00 36.22 ? 221 ARG C NH2  1 
ATOM   3764 N  N    . GLU C 1 96  ? -8.573  -15.353 -3.064  1.00 22.99 ? 222 GLU C N    1 
ATOM   3765 C  CA   . GLU C 1 96  ? -7.983  -16.372 -3.928  1.00 24.01 ? 222 GLU C CA   1 
ATOM   3766 C  C    . GLU C 1 96  ? -7.958  -15.922 -5.398  1.00 23.83 ? 222 GLU C C    1 
ATOM   3767 O  O    . GLU C 1 96  ? -7.004  -16.191 -6.124  1.00 23.43 ? 222 GLU C O    1 
ATOM   3768 C  CB   . GLU C 1 96  ? -8.763  -17.678 -3.775  1.00 24.67 ? 222 GLU C CB   1 
ATOM   3769 C  CG   . GLU C 1 96  ? -8.000  -18.920 -4.162  1.00 28.76 ? 222 GLU C CG   1 
ATOM   3770 C  CD   . GLU C 1 96  ? -8.762  -20.190 -3.832  1.00 29.71 ? 222 GLU C CD   1 
ATOM   3771 O  OE1  . GLU C 1 96  ? -9.934  -20.100 -3.403  1.00 35.27 ? 222 GLU C OE1  1 
ATOM   3772 O  OE2  . GLU C 1 96  ? -8.185  -21.280 -4.003  1.00 34.30 ? 222 GLU C OE2  1 
ATOM   3773 N  N    . GLU C 1 97  ? -9.007  -15.228 -5.835  1.00 24.40 ? 223 GLU C N    1 
ATOM   3774 C  CA   . GLU C 1 97  ? -9.064  -14.726 -7.215  1.00 25.17 ? 223 GLU C CA   1 
ATOM   3775 C  C    . GLU C 1 97  ? -7.939  -13.737 -7.530  1.00 24.28 ? 223 GLU C C    1 
ATOM   3776 O  O    . GLU C 1 97  ? -7.582  -13.572 -8.694  1.00 24.59 ? 223 GLU C O    1 
ATOM   3777 C  CB   . GLU C 1 97  ? -10.444 -14.131 -7.578  1.00 26.43 ? 223 GLU C CB   1 
ATOM   3778 C  CG   . GLU C 1 97  ? -11.207 -13.494 -6.432  1.00 29.62 ? 223 GLU C CG   1 
ATOM   3779 C  CD   . GLU C 1 97  ? -11.985 -14.513 -5.608  1.00 32.00 ? 223 GLU C CD   1 
ATOM   3780 O  OE1  . GLU C 1 97  ? -11.486 -14.906 -4.529  1.00 32.40 ? 223 GLU C OE1  1 
ATOM   3781 O  OE2  . GLU C 1 97  ? -13.085 -14.929 -6.048  1.00 36.37 ? 223 GLU C OE2  1 
ATOM   3782 N  N    . LEU C 1 98  ? -7.376  -13.098 -6.501  1.00 23.15 ? 224 LEU C N    1 
ATOM   3783 C  CA   . LEU C 1 98  ? -6.241  -12.188 -6.674  1.00 22.30 ? 224 LEU C CA   1 
ATOM   3784 C  C    . LEU C 1 98  ? -4.910  -12.811 -6.263  1.00 21.40 ? 224 LEU C C    1 
ATOM   3785 O  O    . LEU C 1 98  ? -3.944  -12.093 -6.007  1.00 22.27 ? 224 LEU C O    1 
ATOM   3786 C  CB   . LEU C 1 98  ? -6.475  -10.896 -5.890  1.00 22.00 ? 224 LEU C CB   1 
ATOM   3787 C  CG   . LEU C 1 98  ? -7.744  -10.138 -6.284  1.00 22.68 ? 224 LEU C CG   1 
ATOM   3788 C  CD1  . LEU C 1 98  ? -7.902  -8.925  -5.389  1.00 25.48 ? 224 LEU C CD1  1 
ATOM   3789 C  CD2  . LEU C 1 98  ? -7.692  -9.759  -7.763  1.00 23.89 ? 224 LEU C CD2  1 
ATOM   3790 N  N    . GLY C 1 99  ? -4.865  -14.139 -6.190  1.00 20.94 ? 225 GLY C N    1 
ATOM   3791 C  CA   . GLY C 1 99  ? -3.607  -14.856 -5.941  1.00 20.42 ? 225 GLY C CA   1 
ATOM   3792 C  C    . GLY C 1 99  ? -3.361  -15.354 -4.524  1.00 20.28 ? 225 GLY C C    1 
ATOM   3793 O  O    . GLY C 1 99  ? -2.363  -16.053 -4.281  1.00 20.78 ? 225 GLY C O    1 
ATOM   3794 N  N    . ALA C 1 100 ? -4.229  -14.997 -3.580  1.00 19.46 ? 226 ALA C N    1 
ATOM   3795 C  CA   . ALA C 1 100 ? -4.086  -15.461 -2.203  1.00 19.85 ? 226 ALA C CA   1 
ATOM   3796 C  C    . ALA C 1 100 ? -4.210  -16.986 -2.142  1.00 19.41 ? 226 ALA C C    1 
ATOM   3797 O  O    . ALA C 1 100 ? -4.946  -17.594 -2.915  1.00 20.66 ? 226 ALA C O    1 
ATOM   3798 C  CB   . ALA C 1 100 ? -5.113  -14.803 -1.282  1.00 20.02 ? 226 ALA C CB   1 
ATOM   3799 N  N    . ARG C 1 101 ? -3.456  -17.589 -1.231  1.00 19.25 ? 227 ARG C N    1 
ATOM   3800 C  CA   . ARG C 1 101 ? -3.440  -19.037 -1.049  1.00 19.25 ? 227 ARG C CA   1 
ATOM   3801 C  C    . ARG C 1 101 ? -4.232  -19.408 0.202   1.00 20.09 ? 227 ARG C C    1 
ATOM   3802 O  O    . ARG C 1 101 ? -3.872  -18.990 1.302   1.00 19.01 ? 227 ARG C O    1 
ATOM   3803 C  CB   . ARG C 1 101 ? -1.996  -19.526 -0.899  1.00 18.71 ? 227 ARG C CB   1 
ATOM   3804 C  CG   . ARG C 1 101 ? -1.170  -19.346 -2.154  1.00 18.54 ? 227 ARG C CG   1 
ATOM   3805 C  CD   . ARG C 1 101 ? 0.305   -19.667 -1.902  1.00 18.80 ? 227 ARG C CD   1 
ATOM   3806 N  NE   . ARG C 1 101 ? 0.894   -18.708 -0.976  1.00 18.93 ? 227 ARG C NE   1 
ATOM   3807 C  CZ   . ARG C 1 101 ? 2.151   -18.752 -0.536  1.00 19.28 ? 227 ARG C CZ   1 
ATOM   3808 N  NH1  . ARG C 1 101 ? 2.980   -19.717 -0.933  1.00 19.11 ? 227 ARG C NH1  1 
ATOM   3809 N  NH2  . ARG C 1 101 ? 2.576   -17.813 0.294   1.00 20.01 ? 227 ARG C NH2  1 
ATOM   3810 N  N    . PRO C 1 102 ? -5.314  -20.202 0.052   1.00 21.24 ? 228 PRO C N    1 
ATOM   3811 C  CA   . PRO C 1 102 ? -6.075  -20.562 1.252   1.00 22.11 ? 228 PRO C CA   1 
ATOM   3812 C  C    . PRO C 1 102 ? -5.259  -21.233 2.371   1.00 23.19 ? 228 PRO C C    1 
ATOM   3813 O  O    . PRO C 1 102 ? -5.590  -21.065 3.543   1.00 24.57 ? 228 PRO C O    1 
ATOM   3814 C  CB   . PRO C 1 102 ? -7.150  -21.505 0.709   1.00 22.19 ? 228 PRO C CB   1 
ATOM   3815 C  CG   . PRO C 1 102 ? -7.357  -21.050 -0.701  1.00 21.64 ? 228 PRO C CG   1 
ATOM   3816 C  CD   . PRO C 1 102 ? -5.999  -20.621 -1.184  1.00 22.14 ? 228 PRO C CD   1 
ATOM   3817 N  N    . ASP C 1 103 ? -4.195  -21.949 2.018   1.00 23.94 ? 229 ASP C N    1 
ATOM   3818 C  CA   . ASP C 1 103 ? -3.375  -22.663 3.012   1.00 24.90 ? 229 ASP C CA   1 
ATOM   3819 C  C    . ASP C 1 103 ? -2.449  -21.744 3.807   1.00 24.19 ? 229 ASP C C    1 
ATOM   3820 O  O    . ASP C 1 103 ? -1.954  -22.125 4.876   1.00 24.62 ? 229 ASP C O    1 
ATOM   3821 C  CB   . ASP C 1 103 ? -2.544  -23.766 2.336   1.00 26.00 ? 229 ASP C CB   1 
ATOM   3822 C  CG   . ASP C 1 103 ? -1.384  -23.212 1.508   1.00 29.68 ? 229 ASP C CG   1 
ATOM   3823 O  OD1  . ASP C 1 103 ? -0.291  -22.988 2.067   1.00 34.36 ? 229 ASP C OD1  1 
ATOM   3824 O  OD2  . ASP C 1 103 ? -1.566  -23.012 0.290   1.00 34.71 ? 229 ASP C OD2  1 
ATOM   3825 N  N    . ALA C 1 104 ? -2.208  -20.540 3.291   1.00 22.30 ? 230 ALA C N    1 
ATOM   3826 C  CA   . ALA C 1 104 ? -1.162  -19.685 3.832   1.00 21.27 ? 230 ALA C CA   1 
ATOM   3827 C  C    . ALA C 1 104 ? -1.574  -18.976 5.116   1.00 20.44 ? 230 ALA C C    1 
ATOM   3828 O  O    . ALA C 1 104 ? -2.755  -18.682 5.351   1.00 20.42 ? 230 ALA C O    1 
ATOM   3829 C  CB   . ALA C 1 104 ? -0.698  -18.665 2.790   1.00 20.64 ? 230 ALA C CB   1 
ATOM   3830 N  N    . THR C 1 105 ? -0.581  -18.684 5.943   1.00 19.14 ? 231 THR C N    1 
ATOM   3831 C  CA   . THR C 1 105 ? -0.788  -17.811 7.093   1.00 19.93 ? 231 THR C CA   1 
ATOM   3832 C  C    . THR C 1 105 ? -0.883  -16.359 6.613   1.00 20.17 ? 231 THR C C    1 
ATOM   3833 O  O    . THR C 1 105 ? 0.011   -15.880 5.914   1.00 19.79 ? 231 THR C O    1 
ATOM   3834 C  CB   . THR C 1 105 ? 0.346   -17.971 8.103   1.00 20.87 ? 231 THR C CB   1 
ATOM   3835 O  OG1  . THR C 1 105 ? 0.336   -19.314 8.595   1.00 21.88 ? 231 THR C OG1  1 
ATOM   3836 C  CG2  . THR C 1 105 ? 0.212   -16.977 9.267   1.00 20.74 ? 231 THR C CG2  1 
ATOM   3837 N  N    . LYS C 1 106 ? -1.973  -15.676 6.969   1.00 19.02 ? 232 LYS C N    1 
ATOM   3838 C  CA   . LYS C 1 106 ? -2.169  -14.284 6.576   1.00 19.36 ? 232 LYS C CA   1 
ATOM   3839 C  C    . LYS C 1 106 ? -1.449  -13.344 7.538   1.00 19.97 ? 232 LYS C C    1 
ATOM   3840 O  O    . LYS C 1 106 ? -1.612  -13.437 8.756   1.00 20.20 ? 232 LYS C O    1 
ATOM   3841 C  CB   . LYS C 1 106 ? -3.663  -13.915 6.547   1.00 19.66 ? 232 LYS C CB   1 
ATOM   3842 C  CG   . LYS C 1 106 ? -4.517  -14.730 5.607   1.00 22.17 ? 232 LYS C CG   1 
ATOM   3843 C  CD   . LYS C 1 106 ? -5.974  -14.244 5.666   1.00 24.55 ? 232 LYS C CD   1 
ATOM   3844 C  CE   . LYS C 1 106 ? -6.842  -14.919 4.637   1.00 28.13 ? 232 LYS C CE   1 
ATOM   3845 N  NZ   . LYS C 1 106 ? -6.923  -16.392 4.821   1.00 32.20 ? 232 LYS C NZ   1 
ATOM   3846 N  N    . VAL C 1 107 ? -0.661  -12.431 6.977   1.00 19.92 ? 233 VAL C N    1 
ATOM   3847 C  CA   . VAL C 1 107 ? 0.079   -11.450 7.757   1.00 19.44 ? 233 VAL C CA   1 
ATOM   3848 C  C    . VAL C 1 107 ? -0.100  -10.047 7.174   1.00 19.02 ? 233 VAL C C    1 
ATOM   3849 O  O    . VAL C 1 107 ? -0.191  -9.879  5.954   1.00 18.38 ? 233 VAL C O    1 
ATOM   3850 C  CB   . VAL C 1 107 ? 1.585   -11.799 7.806   1.00 19.60 ? 233 VAL C CB   1 
ATOM   3851 C  CG1  . VAL C 1 107 ? 2.323   -10.779 8.655   1.00 20.08 ? 233 VAL C CG1  1 
ATOM   3852 C  CG2  . VAL C 1 107 ? 1.794   -13.216 8.350   1.00 19.19 ? 233 VAL C CG2  1 
ATOM   3853 N  N    . LEU C 1 108 ? -0.193  -9.062  8.064   1.00 18.28 ? 234 LEU C N    1 
ATOM   3854 C  CA   . LEU C 1 108 ? -0.310  -7.670  7.707   1.00 19.94 ? 234 LEU C CA   1 
ATOM   3855 C  C    . LEU C 1 108 ? 0.793   -6.907  8.439   1.00 19.89 ? 234 LEU C C    1 
ATOM   3856 O  O    . LEU C 1 108 ? 0.933   -7.023  9.660   1.00 21.62 ? 234 LEU C O    1 
ATOM   3857 C  CB   . LEU C 1 108 ? -1.710  -7.192  8.125   1.00 21.19 ? 234 LEU C CB   1 
ATOM   3858 C  CG   . LEU C 1 108 ? -2.328  -5.879  7.694   1.00 24.54 ? 234 LEU C CG   1 
ATOM   3859 C  CD1  . LEU C 1 108 ? -2.032  -5.463  6.269   1.00 22.64 ? 234 LEU C CD1  1 
ATOM   3860 C  CD2  . LEU C 1 108 ? -3.849  -5.978  7.963   1.00 23.01 ? 234 LEU C CD2  1 
ATOM   3861 N  N    . ILE C 1 109 ? 1.607   -6.167  7.693   1.00 19.03 ? 235 ILE C N    1 
ATOM   3862 C  CA   . ILE C 1 109 ? 2.516   -5.188  8.284   1.00 19.67 ? 235 ILE C CA   1 
ATOM   3863 C  C    . ILE C 1 109 ? 1.944   -3.808  7.957   1.00 19.74 ? 235 ILE C C    1 
ATOM   3864 O  O    . ILE C 1 109 ? 1.812   -3.431  6.779   1.00 20.72 ? 235 ILE C O    1 
ATOM   3865 C  CB   . ILE C 1 109 ? 3.974   -5.300  7.758   1.00 19.71 ? 235 ILE C CB   1 
ATOM   3866 C  CG1  . ILE C 1 109 ? 4.614   -6.633  8.165   1.00 20.90 ? 235 ILE C CG1  1 
ATOM   3867 C  CG2  . ILE C 1 109 ? 4.826   -4.145  8.292   1.00 21.49 ? 235 ILE C CG2  1 
ATOM   3868 C  CD1  . ILE C 1 109 ? 5.979   -6.877  7.514   1.00 22.05 ? 235 ILE C CD1  1 
ATOM   3869 N  N    . ILE C 1 110 ? 1.576   -3.077  9.006   1.00 19.89 ? 236 ILE C N    1 
ATOM   3870 C  CA   . ILE C 1 110 ? 1.015   -1.732  8.882   1.00 20.46 ? 236 ILE C CA   1 
ATOM   3871 C  C    . ILE C 1 110 ? 2.086   -0.716  9.273   1.00 20.38 ? 236 ILE C C    1 
ATOM   3872 O  O    . ILE C 1 110 ? 2.711   -0.862  10.320  1.00 21.49 ? 236 ILE C O    1 
ATOM   3873 C  CB   . ILE C 1 110 ? -0.229  -1.583  9.781   1.00 21.35 ? 236 ILE C CB   1 
ATOM   3874 C  CG1  . ILE C 1 110 ? -1.233  -2.699  9.462   1.00 22.08 ? 236 ILE C CG1  1 
ATOM   3875 C  CG2  . ILE C 1 110 ? -0.836  -0.187  9.610   1.00 22.04 ? 236 ILE C CG2  1 
ATOM   3876 C  CD1  . ILE C 1 110 ? -2.197  -3.017  10.559  1.00 24.28 ? 236 ILE C CD1  1 
ATOM   3877 N  N    . ILE C 1 111 ? 2.311   0.289   8.423   1.00 19.94 ? 237 ILE C N    1 
ATOM   3878 C  CA   . ILE C 1 111 ? 3.315   1.320   8.682   1.00 19.71 ? 237 ILE C CA   1 
ATOM   3879 C  C    . ILE C 1 111 ? 2.631   2.678   8.642   1.00 19.92 ? 237 ILE C C    1 
ATOM   3880 O  O    . ILE C 1 111 ? 2.021   3.031   7.639   1.00 19.09 ? 237 ILE C O    1 
ATOM   3881 C  CB   . ILE C 1 111 ? 4.468   1.285   7.662   1.00 20.12 ? 237 ILE C CB   1 
ATOM   3882 C  CG1  . ILE C 1 111 ? 5.013   -0.140  7.479   1.00 21.48 ? 237 ILE C CG1  1 
ATOM   3883 C  CG2  . ILE C 1 111 ? 5.583   2.246   8.086   1.00 20.73 ? 237 ILE C CG2  1 
ATOM   3884 C  CD1  . ILE C 1 111 ? 4.482   -0.827  6.218   1.00 27.90 ? 237 ILE C CD1  1 
ATOM   3885 N  N    . THR C 1 112 ? 2.722   3.425   9.739   1.00 20.13 ? 238 THR C N    1 
ATOM   3886 C  CA   . THR C 1 112 ? 1.996   4.702   9.871   1.00 20.30 ? 238 THR C CA   1 
ATOM   3887 C  C    . THR C 1 112 ? 2.788   5.745   10.646  1.00 20.91 ? 238 THR C C    1 
ATOM   3888 O  O    . THR C 1 112 ? 3.657   5.402   11.449  1.00 20.22 ? 238 THR C O    1 
ATOM   3889 C  CB   . THR C 1 112 ? 0.629   4.471   10.538  1.00 21.07 ? 238 THR C CB   1 
ATOM   3890 O  OG1  . THR C 1 112 ? -0.153  5.678   10.523  1.00 20.47 ? 238 THR C OG1  1 
ATOM   3891 C  CG2  . THR C 1 112 ? 0.801   3.992   11.980  1.00 21.30 ? 238 THR C CG2  1 
ATOM   3892 N  N    . ASP C 1 113 ? 2.464   7.019   10.416  1.00 20.71 ? 239 ASP C N    1 
ATOM   3893 C  CA   . ASP C 1 113 ? 3.143   8.121   11.107  1.00 21.47 ? 239 ASP C CA   1 
ATOM   3894 C  C    . ASP C 1 113 ? 2.217   8.953   11.990  1.00 21.90 ? 239 ASP C C    1 
ATOM   3895 O  O    . ASP C 1 113 ? 2.580   10.050  12.432  1.00 21.83 ? 239 ASP C O    1 
ATOM   3896 C  CB   . ASP C 1 113 ? 3.899   9.013   10.116  1.00 21.48 ? 239 ASP C CB   1 
ATOM   3897 C  CG   . ASP C 1 113 ? 3.023   10.062  9.475   1.00 24.19 ? 239 ASP C CG   1 
ATOM   3898 O  OD1  . ASP C 1 113 ? 1.817   9.810   9.314   1.00 24.43 ? 239 ASP C OD1  1 
ATOM   3899 O  OD2  . ASP C 1 113 ? 3.542   11.151  9.151   1.00 27.71 ? 239 ASP C OD2  1 
ATOM   3900 N  N    . GLY C 1 114 ? 1.018   8.449   12.256  1.00 22.50 ? 240 GLY C N    1 
ATOM   3901 C  CA   . GLY C 1 114 ? 0.128   9.145   13.168  1.00 22.82 ? 240 GLY C CA   1 
ATOM   3902 C  C    . GLY C 1 114 ? -1.117  8.356   13.498  1.00 22.46 ? 240 GLY C C    1 
ATOM   3903 O  O    . GLY C 1 114 ? -1.336  7.256   12.982  1.00 22.70 ? 240 GLY C O    1 
ATOM   3904 N  N    . GLU C 1 115 ? -1.936  8.936   14.367  1.00 22.06 ? 241 GLU C N    1 
ATOM   3905 C  CA   . GLU C 1 115 ? -3.153  8.277   14.826  1.00 22.15 ? 241 GLU C CA   1 
ATOM   3906 C  C    . GLU C 1 115 ? -4.186  8.213   13.706  1.00 21.92 ? 241 GLU C C    1 
ATOM   3907 O  O    . GLU C 1 115 ? -4.208  9.064   12.815  1.00 22.44 ? 241 GLU C O    1 
ATOM   3908 C  CB   . GLU C 1 115 ? -3.712  9.008   16.049  1.00 22.74 ? 241 GLU C CB   1 
ATOM   3909 C  CG   . GLU C 1 115 ? -2.832  8.859   17.282  1.00 22.46 ? 241 GLU C CG   1 
ATOM   3910 C  CD   . GLU C 1 115 ? -3.348  9.619   18.481  1.00 24.65 ? 241 GLU C CD   1 
ATOM   3911 O  OE1  . GLU C 1 115 ? -4.576  9.632   18.705  1.00 25.90 ? 241 GLU C OE1  1 
ATOM   3912 O  OE2  . GLU C 1 115 ? -2.519  10.208  19.200  1.00 24.79 ? 241 GLU C OE2  1 
ATOM   3913 N  N    . ALA C 1 116 ? -5.040  7.190   13.760  1.00 21.80 ? 242 ALA C N    1 
ATOM   3914 C  CA   . ALA C 1 116 ? -6.101  7.014   12.787  1.00 21.78 ? 242 ALA C CA   1 
ATOM   3915 C  C    . ALA C 1 116 ? -7.037  8.225   12.795  1.00 21.93 ? 242 ALA C C    1 
ATOM   3916 O  O    . ALA C 1 116 ? -7.364  8.775   13.864  1.00 22.03 ? 242 ALA C O    1 
ATOM   3917 C  CB   . ALA C 1 116 ? -6.884  5.725   13.079  1.00 20.72 ? 242 ALA C CB   1 
ATOM   3918 N  N    . THR C 1 117 ? -7.459  8.640   11.601  1.00 22.71 ? 243 THR C N    1 
ATOM   3919 C  CA   . THR C 1 117 ? -8.430  9.726   11.450  1.00 23.71 ? 243 THR C CA   1 
ATOM   3920 C  C    . THR C 1 117 ? -9.863  9.219   11.271  1.00 23.99 ? 243 THR C C    1 
ATOM   3921 O  O    . THR C 1 117 ? -10.781 10.016  11.033  1.00 25.83 ? 243 THR C O    1 
ATOM   3922 C  CB   . THR C 1 117 ? -8.061  10.647  10.270  1.00 24.60 ? 243 THR C CB   1 
ATOM   3923 O  OG1  . THR C 1 117 ? -7.806  9.863   9.101   1.00 23.57 ? 243 THR C OG1  1 
ATOM   3924 C  CG2  . THR C 1 117 ? -6.816  11.456  10.603  1.00 25.66 ? 243 THR C CG2  1 
ATOM   3925 N  N    . ASP C 1 118 ? -10.047 7.906   11.370  1.00 23.95 ? 244 ASP C N    1 
ATOM   3926 C  CA   . ASP C 1 118 ? -11.367 7.299   11.337  1.00 23.61 ? 244 ASP C CA   1 
ATOM   3927 C  C    . ASP C 1 118 ? -11.571 6.426   12.577  1.00 23.51 ? 244 ASP C C    1 
ATOM   3928 O  O    . ASP C 1 118 ? -10.714 6.355   13.453  1.00 24.48 ? 244 ASP C O    1 
ATOM   3929 C  CB   . ASP C 1 118 ? -11.615 6.518   10.026  1.00 22.77 ? 244 ASP C CB   1 
ATOM   3930 C  CG   . ASP C 1 118 ? -10.668 5.339   9.822   1.00 23.50 ? 244 ASP C CG   1 
ATOM   3931 O  OD1  . ASP C 1 118 ? -9.729  5.137   10.620  1.00 21.51 ? 244 ASP C OD1  1 
ATOM   3932 O  OD2  . ASP C 1 118 ? -10.882 4.593   8.836   1.00 22.74 ? 244 ASP C OD2  1 
ATOM   3933 N  N    . SER C 1 119 ? -12.732 5.795   12.648  1.00 23.42 ? 245 SER C N    1 
ATOM   3934 C  CA   . SER C 1 119 ? -13.109 4.966   13.775  1.00 22.89 ? 245 SER C CA   1 
ATOM   3935 C  C    . SER C 1 119 ? -13.850 3.769   13.237  1.00 21.93 ? 245 SER C C    1 
ATOM   3936 O  O    . SER C 1 119 ? -14.145 3.703   12.048  1.00 22.85 ? 245 SER C O    1 
ATOM   3937 C  CB   . SER C 1 119 ? -14.007 5.752   14.733  1.00 23.43 ? 245 SER C CB   1 
ATOM   3938 O  OG   . SER C 1 119 ? -15.197 6.177   14.092  1.00 26.64 ? 245 SER C OG   1 
ATOM   3939 N  N    . GLY C 1 120 ? -14.141 2.818   14.110  1.00 21.73 ? 246 GLY C N    1 
ATOM   3940 C  CA   . GLY C 1 120 ? -14.906 1.643   13.725  1.00 21.26 ? 246 GLY C CA   1 
ATOM   3941 C  C    . GLY C 1 120 ? -14.358 0.432   14.436  1.00 20.86 ? 246 GLY C C    1 
ATOM   3942 O  O    . GLY C 1 120 ? -14.027 0.497   15.622  1.00 21.06 ? 246 GLY C O    1 
ATOM   3943 N  N    . ASN C 1 121 ? -14.264 -0.673  13.706  1.00 20.59 ? 247 ASN C N    1 
ATOM   3944 C  CA   . ASN C 1 121 ? -13.702 -1.907  14.234  1.00 20.57 ? 247 ASN C CA   1 
ATOM   3945 C  C    . ASN C 1 121 ? -12.969 -2.657  13.127  1.00 21.09 ? 247 ASN C C    1 
ATOM   3946 O  O    . ASN C 1 121 ? -13.220 -2.424  11.940  1.00 21.20 ? 247 ASN C O    1 
ATOM   3947 C  CB   . ASN C 1 121 ? -14.807 -2.782  14.841  1.00 20.71 ? 247 ASN C CB   1 
ATOM   3948 C  CG   . ASN C 1 121 ? -15.638 -3.488  13.791  1.00 20.40 ? 247 ASN C CG   1 
ATOM   3949 O  OD1  . ASN C 1 121 ? -15.180 -4.436  13.162  1.00 20.24 ? 247 ASN C OD1  1 
ATOM   3950 N  ND2  . ASN C 1 121 ? -16.872 -3.033  13.603  1.00 20.74 ? 247 ASN C ND2  1 
ATOM   3951 N  N    . ILE C 1 122 ? -12.073 -3.559  13.518  1.00 20.68 ? 248 ILE C N    1 
ATOM   3952 C  CA   . ILE C 1 122 ? -11.362 -4.398  12.547  1.00 21.33 ? 248 ILE C CA   1 
ATOM   3953 C  C    . ILE C 1 122 ? -11.669 -5.882  12.754  1.00 21.68 ? 248 ILE C C    1 
ATOM   3954 O  O    . ILE C 1 122 ? -10.809 -6.744  12.554  1.00 22.12 ? 248 ILE C O    1 
ATOM   3955 C  CB   . ILE C 1 122 ? -9.829  -4.150  12.567  1.00 21.52 ? 248 ILE C CB   1 
ATOM   3956 C  CG1  . ILE C 1 122 ? -9.239  -4.390  13.955  1.00 21.57 ? 248 ILE C CG1  1 
ATOM   3957 C  CG2  . ILE C 1 122 ? -9.520  -2.737  12.101  1.00 22.63 ? 248 ILE C CG2  1 
ATOM   3958 C  CD1  . ILE C 1 122 ? -7.753  -4.754  13.906  1.00 22.21 ? 248 ILE C CD1  1 
ATOM   3959 N  N    . ASP C 1 123 ? -12.913 -6.182  13.125  1.00 21.95 ? 249 ASP C N    1 
ATOM   3960 C  CA   . ASP C 1 123 ? -13.333 -7.572  13.325  1.00 22.37 ? 249 ASP C CA   1 
ATOM   3961 C  C    . ASP C 1 123 ? -13.101 -8.448  12.075  1.00 21.53 ? 249 ASP C C    1 
ATOM   3962 O  O    . ASP C 1 123 ? -12.798 -9.644  12.190  1.00 21.47 ? 249 ASP C O    1 
ATOM   3963 C  CB   . ASP C 1 123 ? -14.814 -7.634  13.730  1.00 22.77 ? 249 ASP C CB   1 
ATOM   3964 C  CG   . ASP C 1 123 ? -15.090 -7.022  15.100  1.00 25.48 ? 249 ASP C CG   1 
ATOM   3965 O  OD1  . ASP C 1 123 ? -14.148 -6.825  15.898  1.00 27.96 ? 249 ASP C OD1  1 
ATOM   3966 O  OD2  . ASP C 1 123 ? -16.276 -6.728  15.377  1.00 27.83 ? 249 ASP C OD2  1 
ATOM   3967 N  N    . ALA C 1 124 ? -13.235 -7.857  10.887  1.00 20.46 ? 250 ALA C N    1 
ATOM   3968 C  CA   . ALA C 1 124 ? -13.049 -8.588  9.636   1.00 21.11 ? 250 ALA C CA   1 
ATOM   3969 C  C    . ALA C 1 124 ? -11.611 -9.073  9.465   1.00 21.06 ? 250 ALA C C    1 
ATOM   3970 O  O    . ALA C 1 124 ? -11.351 -10.001 8.694   1.00 21.26 ? 250 ALA C O    1 
ATOM   3971 C  CB   . ALA C 1 124 ? -13.451 -7.719  8.439   1.00 22.34 ? 250 ALA C CB   1 
ATOM   3972 N  N    . ALA C 1 125 ? -10.689 -8.439  10.184  1.00 21.27 ? 251 ALA C N    1 
ATOM   3973 C  CA   . ALA C 1 125 ? -9.258  -8.744  10.075  1.00 21.52 ? 251 ALA C CA   1 
ATOM   3974 C  C    . ALA C 1 125 ? -8.695  -9.548  11.246  1.00 23.22 ? 251 ALA C C    1 
ATOM   3975 O  O    . ALA C 1 125 ? -7.475  -9.717  11.337  1.00 21.82 ? 251 ALA C O    1 
ATOM   3976 C  CB   . ALA C 1 125 ? -8.468  -7.446  9.926   1.00 21.75 ? 251 ALA C CB   1 
ATOM   3977 N  N    . LYS C 1 126 ? -9.554  -10.070 12.124  1.00 24.51 ? 252 LYS C N    1 
ATOM   3978 C  CA   A LYS C 1 126 ? -9.050  -10.683 13.360  0.70 26.07 ? 252 LYS C CA   1 
ATOM   3979 C  CA   B LYS C 1 126 ? -9.109  -10.722 13.365  0.30 25.13 ? 252 LYS C CA   1 
ATOM   3980 C  C    . LYS C 1 126 ? -8.219  -11.949 13.134  1.00 26.00 ? 252 LYS C C    1 
ATOM   3981 O  O    . LYS C 1 126 ? -7.348  -12.263 13.956  1.00 27.26 ? 252 LYS C O    1 
ATOM   3982 C  CB   A LYS C 1 126 ? -10.168 -10.916 14.391  0.70 26.86 ? 252 LYS C CB   1 
ATOM   3983 C  CB   B LYS C 1 126 ? -10.320 -11.099 14.232  0.30 25.12 ? 252 LYS C CB   1 
ATOM   3984 C  CG   A LYS C 1 126 ? -10.107 -9.947  15.590  0.70 29.63 ? 252 LYS C CG   1 
ATOM   3985 C  CG   B LYS C 1 126 ? -11.247 -12.151 13.638  0.30 24.67 ? 252 LYS C CG   1 
ATOM   3986 C  CD   A LYS C 1 126 ? -10.029 -8.476  15.156  0.70 30.80 ? 252 LYS C CD   1 
ATOM   3987 C  CD   B LYS C 1 126 ? -11.018 -13.515 14.265  0.30 24.59 ? 252 LYS C CD   1 
ATOM   3988 C  CE   A LYS C 1 126 ? -10.437 -7.503  16.268  0.70 32.83 ? 252 LYS C CE   1 
ATOM   3989 C  CE   B LYS C 1 126 ? -12.262 -14.377 14.163  0.30 24.80 ? 252 LYS C CE   1 
ATOM   3990 N  NZ   A LYS C 1 126 ? -9.297  -7.144  17.160  0.70 34.19 ? 252 LYS C NZ   1 
ATOM   3991 N  NZ   B LYS C 1 126 ? -13.457 -13.686 14.720  0.30 24.36 ? 252 LYS C NZ   1 
ATOM   3992 N  N    . ASP C 1 127 ? -8.442  -12.640 12.018  1.00 25.14 ? 253 ASP C N    1 
ATOM   3993 C  CA   . ASP C 1 127 ? -7.682  -13.856 11.690  1.00 25.09 ? 253 ASP C CA   1 
ATOM   3994 C  C    . ASP C 1 127 ? -6.323  -13.567 11.024  1.00 23.57 ? 253 ASP C C    1 
ATOM   3995 O  O    . ASP C 1 127 ? -5.571  -14.490 10.729  1.00 24.31 ? 253 ASP C O    1 
ATOM   3996 C  CB   . ASP C 1 127 ? -8.515  -14.777 10.793  1.00 26.59 ? 253 ASP C CB   1 
ATOM   3997 C  CG   . ASP C 1 127 ? -8.749  -14.195 9.409   1.00 29.17 ? 253 ASP C CG   1 
ATOM   3998 O  OD1  . ASP C 1 127 ? -8.980  -12.968 9.307   1.00 36.09 ? 253 ASP C OD1  1 
ATOM   3999 O  OD2  . ASP C 1 127 ? -8.700  -14.962 8.427   1.00 35.58 ? 253 ASP C OD2  1 
ATOM   4000 N  N    . ILE C 1 128 ? -6.032  -12.300 10.766  1.00 21.00 ? 254 ILE C N    1 
ATOM   4001 C  CA   . ILE C 1 128 ? -4.756  -11.901 10.165  1.00 20.30 ? 254 ILE C CA   1 
ATOM   4002 C  C    . ILE C 1 128 ? -3.781  -11.532 11.276  1.00 19.70 ? 254 ILE C C    1 
ATOM   4003 O  O    . ILE C 1 128 ? -4.144  -10.822 12.215  1.00 20.57 ? 254 ILE C O    1 
ATOM   4004 C  CB   . ILE C 1 128 ? -4.960  -10.693 9.228   1.00 19.47 ? 254 ILE C CB   1 
ATOM   4005 C  CG1  . ILE C 1 128 ? -6.034  -11.015 8.179   1.00 19.68 ? 254 ILE C CG1  1 
ATOM   4006 C  CG2  . ILE C 1 128 ? -3.630  -10.283 8.558   1.00 18.81 ? 254 ILE C CG2  1 
ATOM   4007 C  CD1  . ILE C 1 128 ? -6.452  -9.808  7.348   1.00 20.03 ? 254 ILE C CD1  1 
ATOM   4008 N  N    . ILE C 1 129 ? -2.550  -12.042 11.193  1.00 19.28 ? 255 ILE C N    1 
ATOM   4009 C  CA   . ILE C 1 129 ? -1.489  -11.638 12.116  1.00 18.61 ? 255 ILE C CA   1 
ATOM   4010 C  C    . ILE C 1 129 ? -1.092  -10.208 11.758  1.00 18.64 ? 255 ILE C C    1 
ATOM   4011 O  O    . ILE C 1 129 ? -0.725  -9.929  10.634  1.00 18.42 ? 255 ILE C O    1 
ATOM   4012 C  CB   . ILE C 1 129 ? -0.250  -12.566 12.035  1.00 18.96 ? 255 ILE C CB   1 
ATOM   4013 C  CG1  . ILE C 1 129 ? -0.600  -13.994 12.437  1.00 20.02 ? 255 ILE C CG1  1 
ATOM   4014 C  CG2  . ILE C 1 129 ? 0.880   -12.044 12.925  1.00 19.49 ? 255 ILE C CG2  1 
ATOM   4015 C  CD1  . ILE C 1 129 ? 0.543   -14.974 12.248  1.00 22.23 ? 255 ILE C CD1  1 
ATOM   4016 N  N    . ARG C 1 130 ? -1.162  -9.307  12.728  1.00 18.42 ? 256 ARG C N    1 
ATOM   4017 C  CA   . ARG C 1 130 ? -0.984  -7.886  12.466  1.00 18.90 ? 256 ARG C CA   1 
ATOM   4018 C  C    . ARG C 1 130 ? 0.164   -7.290  13.270  1.00 19.25 ? 256 ARG C C    1 
ATOM   4019 O  O    . ARG C 1 130 ? 0.139   -7.282  14.500  1.00 20.19 ? 256 ARG C O    1 
ATOM   4020 C  CB   . ARG C 1 130 ? -2.284  -7.152  12.777  1.00 19.58 ? 256 ARG C CB   1 
ATOM   4021 C  CG   . ARG C 1 130 ? -3.346  -7.411  11.730  1.00 21.19 ? 256 ARG C CG   1 
ATOM   4022 C  CD   . ARG C 1 130 ? -4.732  -7.260  12.291  1.00 22.15 ? 256 ARG C CD   1 
ATOM   4023 N  NE   . ARG C 1 130 ? -5.081  -8.406  13.121  1.00 23.36 ? 256 ARG C NE   1 
ATOM   4024 C  CZ   . ARG C 1 130 ? -5.358  -8.365  14.422  1.00 23.91 ? 256 ARG C CZ   1 
ATOM   4025 N  NH1  . ARG C 1 130 ? -5.684  -9.487  15.055  1.00 24.63 ? 256 ARG C NH1  1 
ATOM   4026 N  NH2  . ARG C 1 130 ? -5.337  -7.219  15.094  1.00 24.03 ? 256 ARG C NH2  1 
ATOM   4027 N  N    . TYR C 1 131 ? 1.160   -6.794  12.544  1.00 19.15 ? 257 TYR C N    1 
ATOM   4028 C  CA   . TYR C 1 131 ? 2.327   -6.133  13.119  1.00 19.14 ? 257 TYR C CA   1 
ATOM   4029 C  C    . TYR C 1 131 ? 2.265   -4.679  12.662  1.00 19.52 ? 257 TYR C C    1 
ATOM   4030 O  O    . TYR C 1 131 ? 2.173   -4.423  11.460  1.00 20.70 ? 257 TYR C O    1 
ATOM   4031 C  CB   . TYR C 1 131 ? 3.590   -6.808  12.599  1.00 19.05 ? 257 TYR C CB   1 
ATOM   4032 C  CG   . TYR C 1 131 ? 4.879   -6.319  13.215  1.00 18.78 ? 257 TYR C CG   1 
ATOM   4033 C  CD1  . TYR C 1 131 ? 5.398   -6.913  14.364  1.00 19.46 ? 257 TYR C CD1  1 
ATOM   4034 C  CD2  . TYR C 1 131 ? 5.594   -5.277  12.645  1.00 20.75 ? 257 TYR C CD2  1 
ATOM   4035 C  CE1  . TYR C 1 131 ? 6.578   -6.466  14.936  1.00 20.29 ? 257 TYR C CE1  1 
ATOM   4036 C  CE2  . TYR C 1 131 ? 6.789   -4.831  13.215  1.00 19.58 ? 257 TYR C CE2  1 
ATOM   4037 C  CZ   . TYR C 1 131 ? 7.266   -5.429  14.354  1.00 20.01 ? 257 TYR C CZ   1 
ATOM   4038 O  OH   . TYR C 1 131 ? 8.445   -4.984  14.920  1.00 21.90 ? 257 TYR C OH   1 
ATOM   4039 N  N    . ILE C 1 132 ? 2.250   -3.734  13.604  1.00 18.47 ? 258 ILE C N    1 
ATOM   4040 C  CA   . ILE C 1 132 ? 2.120   -2.323  13.252  1.00 19.47 ? 258 ILE C CA   1 
ATOM   4041 C  C    . ILE C 1 132 ? 3.341   -1.540  13.700  1.00 19.37 ? 258 ILE C C    1 
ATOM   4042 O  O    . ILE C 1 132 ? 3.836   -1.715  14.825  1.00 20.23 ? 258 ILE C O    1 
ATOM   4043 C  CB   . ILE C 1 132 ? 0.802   -1.703  13.815  1.00 19.65 ? 258 ILE C CB   1 
ATOM   4044 C  CG1  . ILE C 1 132 ? 0.594   -0.283  13.274  1.00 20.41 ? 258 ILE C CG1  1 
ATOM   4045 C  CG2  . ILE C 1 132 ? 0.808   -1.696  15.345  1.00 21.18 ? 258 ILE C CG2  1 
ATOM   4046 C  CD1  . ILE C 1 132 ? -0.847  0.253   13.425  1.00 21.14 ? 258 ILE C CD1  1 
ATOM   4047 N  N    . ILE C 1 133 ? 3.827   -0.692  12.795  1.00 19.10 ? 259 ILE C N    1 
ATOM   4048 C  CA   . ILE C 1 133 ? 4.991   0.142   13.026  1.00 19.65 ? 259 ILE C CA   1 
ATOM   4049 C  C    . ILE C 1 133 ? 4.527   1.596   13.006  1.00 19.73 ? 259 ILE C C    1 
ATOM   4050 O  O    . ILE C 1 133 ? 4.036   2.079   11.986  1.00 19.90 ? 259 ILE C O    1 
ATOM   4051 C  CB   . ILE C 1 133 ? 6.046   -0.086  11.931  1.00 18.65 ? 259 ILE C CB   1 
ATOM   4052 C  CG1  . ILE C 1 133 ? 6.444   -1.562  11.870  1.00 18.84 ? 259 ILE C CG1  1 
ATOM   4053 C  CG2  . ILE C 1 133 ? 7.276   0.793   12.180  1.00 20.59 ? 259 ILE C CG2  1 
ATOM   4054 C  CD1  . ILE C 1 133 ? 7.136   -1.961  10.568  1.00 20.14 ? 259 ILE C CD1  1 
ATOM   4055 N  N    . GLY C 1 134 ? 4.663   2.274   14.144  1.00 19.69 ? 260 GLY C N    1 
ATOM   4056 C  CA   . GLY C 1 134 ? 4.334   3.699   14.270  1.00 19.94 ? 260 GLY C CA   1 
ATOM   4057 C  C    . GLY C 1 134 ? 5.622   4.495   14.336  1.00 19.96 ? 260 GLY C C    1 
ATOM   4058 O  O    . GLY C 1 134 ? 6.477   4.199   15.160  1.00 21.36 ? 260 GLY C O    1 
ATOM   4059 N  N    . ILE C 1 135 ? 5.762   5.503   13.480  1.00 19.55 ? 261 ILE C N    1 
ATOM   4060 C  CA   . ILE C 1 135 ? 7.035   6.197   13.312  1.00 20.29 ? 261 ILE C CA   1 
ATOM   4061 C  C    . ILE C 1 135 ? 6.909   7.694   13.565  1.00 20.93 ? 261 ILE C C    1 
ATOM   4062 O  O    . ILE C 1 135 ? 6.000   8.334   13.062  1.00 20.82 ? 261 ILE C O    1 
ATOM   4063 C  CB   . ILE C 1 135 ? 7.596   5.997   11.885  1.00 19.43 ? 261 ILE C CB   1 
ATOM   4064 C  CG1  . ILE C 1 135 ? 7.613   4.507   11.525  1.00 20.95 ? 261 ILE C CG1  1 
ATOM   4065 C  CG2  . ILE C 1 135 ? 9.010   6.592   11.783  1.00 20.61 ? 261 ILE C CG2  1 
ATOM   4066 C  CD1  . ILE C 1 135 ? 8.212   4.211   10.157  1.00 19.76 ? 261 ILE C CD1  1 
ATOM   4067 N  N    . GLY C 1 136 ? 7.828   8.237   14.357  1.00 21.75 ? 262 GLY C N    1 
ATOM   4068 C  CA   . GLY C 1 136 ? 8.050   9.683   14.411  1.00 22.69 ? 262 GLY C CA   1 
ATOM   4069 C  C    . GLY C 1 136 ? 7.380   10.464  15.523  1.00 23.27 ? 262 GLY C C    1 
ATOM   4070 O  O    . GLY C 1 136 ? 6.856   9.902   16.491  1.00 22.97 ? 262 GLY C O    1 
ATOM   4071 N  N    . LYS C 1 137 ? 7.406   11.782  15.359  1.00 24.43 ? 263 LYS C N    1 
ATOM   4072 C  CA   . LYS C 1 137 ? 7.018   12.725  16.411  1.00 25.28 ? 263 LYS C CA   1 
ATOM   4073 C  C    . LYS C 1 137 ? 5.583   12.577  16.931  1.00 25.38 ? 263 LYS C C    1 
ATOM   4074 O  O    . LYS C 1 137 ? 5.311   12.893  18.092  1.00 24.86 ? 263 LYS C O    1 
ATOM   4075 C  CB   . LYS C 1 137 ? 7.251   14.169  15.940  1.00 25.83 ? 263 LYS C CB   1 
ATOM   4076 C  CG   . LYS C 1 137 ? 6.463   14.574  14.700  1.00 27.83 ? 263 LYS C CG   1 
ATOM   4077 C  CD   . LYS C 1 137 ? 6.728   16.023  14.339  1.00 29.12 ? 263 LYS C CD   1 
ATOM   4078 C  CE   . LYS C 1 137 ? 6.051   16.395  13.039  1.00 29.77 ? 263 LYS C CE   1 
ATOM   4079 N  NZ   . LYS C 1 137 ? 6.451   17.756  12.601  1.00 31.79 ? 263 LYS C NZ   1 
ATOM   4080 N  N    . HIS C 1 138 ? 4.673   12.090  16.096  1.00 25.59 ? 264 HIS C N    1 
ATOM   4081 C  CA   . HIS C 1 138 ? 3.280   11.932  16.519  1.00 25.92 ? 264 HIS C CA   1 
ATOM   4082 C  C    . HIS C 1 138 ? 3.049   10.754  17.465  1.00 26.13 ? 264 HIS C C    1 
ATOM   4083 O  O    . HIS C 1 138 ? 1.951   10.608  18.010  1.00 26.73 ? 264 HIS C O    1 
ATOM   4084 C  CB   . HIS C 1 138 ? 2.351   11.864  15.304  1.00 26.00 ? 264 HIS C CB   1 
ATOM   4085 C  CG   . HIS C 1 138 ? 2.297   13.142  14.531  1.00 27.41 ? 264 HIS C CG   1 
ATOM   4086 N  ND1  . HIS C 1 138 ? 2.734   13.251  13.228  1.00 30.22 ? 264 HIS C ND1  1 
ATOM   4087 C  CD2  . HIS C 1 138 ? 1.876   14.378  14.890  1.00 27.06 ? 264 HIS C CD2  1 
ATOM   4088 C  CE1  . HIS C 1 138 ? 2.574   14.496  12.815  1.00 27.89 ? 264 HIS C CE1  1 
ATOM   4089 N  NE2  . HIS C 1 138 ? 2.060   15.200  13.806  1.00 29.46 ? 264 HIS C NE2  1 
ATOM   4090 N  N    . PHE C 1 139 ? 4.073   9.925   17.672  1.00 25.62 ? 265 PHE C N    1 
ATOM   4091 C  CA   . PHE C 1 139 ? 4.000   8.840   18.657  1.00 25.81 ? 265 PHE C CA   1 
ATOM   4092 C  C    . PHE C 1 139 ? 4.919   9.068   19.861  1.00 27.08 ? 265 PHE C C    1 
ATOM   4093 O  O    . PHE C 1 139 ? 5.384   8.116   20.499  1.00 27.84 ? 265 PHE C O    1 
ATOM   4094 C  CB   . PHE C 1 139 ? 4.263   7.491   17.985  1.00 25.59 ? 265 PHE C CB   1 
ATOM   4095 C  CG   . PHE C 1 139 ? 3.177   7.096   17.038  1.00 23.49 ? 265 PHE C CG   1 
ATOM   4096 C  CD1  . PHE C 1 139 ? 1.903   6.815   17.517  1.00 24.07 ? 265 PHE C CD1  1 
ATOM   4097 C  CD2  . PHE C 1 139 ? 3.404   7.042   15.675  1.00 22.43 ? 265 PHE C CD2  1 
ATOM   4098 C  CE1  . PHE C 1 139 ? 0.881   6.481   16.654  1.00 23.54 ? 265 PHE C CE1  1 
ATOM   4099 C  CE2  . PHE C 1 139 ? 2.386   6.712   14.803  1.00 21.57 ? 265 PHE C CE2  1 
ATOM   4100 C  CZ   . PHE C 1 139 ? 1.121   6.426   15.290  1.00 23.17 ? 265 PHE C CZ   1 
ATOM   4101 N  N    . GLN C 1 140 ? 5.151   10.339  20.181  1.00 27.45 ? 266 GLN C N    1 
ATOM   4102 C  CA   . GLN C 1 140 ? 5.954   10.705  21.343  1.00 28.25 ? 266 GLN C CA   1 
ATOM   4103 C  C    . GLN C 1 140 ? 5.273   10.243  22.629  1.00 27.72 ? 266 GLN C C    1 
ATOM   4104 O  O    . GLN C 1 140 ? 5.896   9.575   23.458  1.00 27.41 ? 266 GLN C O    1 
ATOM   4105 C  CB   . GLN C 1 140 ? 6.180   12.219  21.396  1.00 28.76 ? 266 GLN C CB   1 
ATOM   4106 C  CG   . GLN C 1 140 ? 7.187   12.663  22.477  1.00 31.81 ? 266 GLN C CG   1 
ATOM   4107 C  CD   . GLN C 1 140 ? 6.982   14.095  22.952  1.00 33.77 ? 266 GLN C CD   1 
ATOM   4108 O  OE1  . GLN C 1 140 ? 6.389   14.922  22.254  1.00 38.40 ? 266 GLN C OE1  1 
ATOM   4109 N  NE2  . GLN C 1 140 ? 7.479   14.396  24.151  1.00 36.80 ? 266 GLN C NE2  1 
ATOM   4110 N  N    . THR C 1 141 ? 3.998   10.598  22.793  1.00 26.66 ? 267 THR C N    1 
ATOM   4111 C  CA   . THR C 1 141 ? 3.290   10.281  24.031  1.00 26.10 ? 267 THR C CA   1 
ATOM   4112 C  C    . THR C 1 141 ? 2.944   8.802   24.115  1.00 25.58 ? 267 THR C C    1 
ATOM   4113 O  O    . THR C 1 141 ? 2.652   8.151   23.105  1.00 24.79 ? 267 THR C O    1 
ATOM   4114 C  CB   . THR C 1 141 ? 1.990   11.094  24.198  1.00 26.35 ? 267 THR C CB   1 
ATOM   4115 O  OG1  . THR C 1 141 ? 1.012   10.647  23.254  1.00 25.85 ? 267 THR C OG1  1 
ATOM   4116 C  CG2  . THR C 1 141 ? 2.250   12.587  24.016  1.00 25.77 ? 267 THR C CG2  1 
ATOM   4117 N  N    . LYS C 1 142 ? 2.960   8.285   25.338  1.00 25.18 ? 268 LYS C N    1 
ATOM   4118 C  CA   . LYS C 1 142 ? 2.573   6.910   25.606  1.00 25.12 ? 268 LYS C CA   1 
ATOM   4119 C  C    . LYS C 1 142 ? 1.142   6.671   25.124  1.00 24.28 ? 268 LYS C C    1 
ATOM   4120 O  O    . LYS C 1 142 ? 0.844   5.642   24.524  1.00 23.54 ? 268 LYS C O    1 
ATOM   4121 C  CB   . LYS C 1 142 ? 2.677   6.629   27.106  1.00 25.93 ? 268 LYS C CB   1 
ATOM   4122 C  CG   . LYS C 1 142 ? 2.495   5.173   27.501  1.00 28.14 ? 268 LYS C CG   1 
ATOM   4123 C  CD   . LYS C 1 142 ? 2.158   5.065   28.985  1.00 31.32 ? 268 LYS C CD   1 
ATOM   4124 C  CE   . LYS C 1 142 ? 2.101   3.617   29.455  1.00 32.19 ? 268 LYS C CE   1 
ATOM   4125 N  NZ   . LYS C 1 142 ? 1.063   3.419   30.509  1.00 34.06 ? 268 LYS C NZ   1 
ATOM   4126 N  N    . GLU C 1 143 ? 0.267   7.640   25.374  1.00 23.78 ? 269 GLU C N    1 
ATOM   4127 C  CA   . GLU C 1 143 ? -1.131  7.522   24.986  1.00 24.13 ? 269 GLU C CA   1 
ATOM   4128 C  C    . GLU C 1 143 ? -1.284  7.337   23.466  1.00 23.45 ? 269 GLU C C    1 
ATOM   4129 O  O    . GLU C 1 143 ? -2.070  6.499   23.020  1.00 23.08 ? 269 GLU C O    1 
ATOM   4130 C  CB   . GLU C 1 143 ? -1.928  8.737   25.483  1.00 24.60 ? 269 GLU C CB   1 
ATOM   4131 C  CG   . GLU C 1 143 ? -2.138  8.782   27.011  1.00 27.21 ? 269 GLU C CG   1 
ATOM   4132 C  CD   . GLU C 1 143 ? -0.953  9.351   27.810  1.00 28.10 ? 269 GLU C CD   1 
ATOM   4133 O  OE1  . GLU C 1 143 ? 0.157   9.519   27.257  1.00 29.57 ? 269 GLU C OE1  1 
ATOM   4134 O  OE2  . GLU C 1 143 ? -1.138  9.633   29.013  1.00 31.97 ? 269 GLU C OE2  1 
ATOM   4135 N  N    . SER C 1 144 ? -0.519  8.095   22.680  1.00 22.76 ? 270 SER C N    1 
ATOM   4136 C  CA   . SER C 1 144 ? -0.591  7.994   21.212  1.00 23.03 ? 270 SER C CA   1 
ATOM   4137 C  C    . SER C 1 144 ? -0.154  6.616   20.717  1.00 23.18 ? 270 SER C C    1 
ATOM   4138 O  O    . SER C 1 144 ? -0.738  6.069   19.777  1.00 22.82 ? 270 SER C O    1 
ATOM   4139 C  CB   . SER C 1 144 ? 0.264   9.079   20.542  1.00 23.42 ? 270 SER C CB   1 
ATOM   4140 O  OG   . SER C 1 144 ? 1.654   8.867   20.763  1.00 24.41 ? 270 SER C OG   1 
ATOM   4141 N  N    . GLN C 1 145 ? 0.886   6.076   21.354  1.00 22.54 ? 271 GLN C N    1 
ATOM   4142 C  CA   . GLN C 1 145 ? 1.413   4.750   21.023  1.00 22.91 ? 271 GLN C CA   1 
ATOM   4143 C  C    . GLN C 1 145 ? 0.389   3.671   21.345  1.00 22.13 ? 271 GLN C C    1 
ATOM   4144 O  O    . GLN C 1 145 ? 0.193   2.742   20.571  1.00 21.98 ? 271 GLN C O    1 
ATOM   4145 C  CB   . GLN C 1 145 ? 2.691   4.471   21.819  1.00 22.85 ? 271 GLN C CB   1 
ATOM   4146 C  CG   . GLN C 1 145 ? 3.843   5.400   21.500  1.00 24.34 ? 271 GLN C CG   1 
ATOM   4147 C  CD   . GLN C 1 145 ? 4.944   5.329   22.550  1.00 24.88 ? 271 GLN C CD   1 
ATOM   4148 O  OE1  . GLN C 1 145 ? 5.025   4.363   23.303  1.00 27.49 ? 271 GLN C OE1  1 
ATOM   4149 N  NE2  . GLN C 1 145 ? 5.788   6.354   22.608  1.00 27.67 ? 271 GLN C NE2  1 
ATOM   4150 N  N    . GLU C 1 146 ? -0.268  3.808   22.493  1.00 22.19 ? 272 GLU C N    1 
ATOM   4151 C  CA   . GLU C 1 146 ? -1.281  2.834   22.905  1.00 22.82 ? 272 GLU C CA   1 
ATOM   4152 C  C    . GLU C 1 146 ? -2.509  2.785   21.981  1.00 21.94 ? 272 GLU C C    1 
ATOM   4153 O  O    . GLU C 1 146 ? -3.198  1.765   21.941  1.00 21.28 ? 272 GLU C O    1 
ATOM   4154 C  CB   . GLU C 1 146 ? -1.682  3.067   24.366  1.00 23.36 ? 272 GLU C CB   1 
ATOM   4155 C  CG   . GLU C 1 146 ? -0.548  2.684   25.323  1.00 26.34 ? 272 GLU C CG   1 
ATOM   4156 C  CD   . GLU C 1 146 ? -0.854  2.910   26.790  1.00 29.77 ? 272 GLU C CD   1 
ATOM   4157 O  OE1  . GLU C 1 146 ? -1.803  3.654   27.127  1.00 33.37 ? 272 GLU C OE1  1 
ATOM   4158 O  OE2  . GLU C 1 146 ? -0.116  2.336   27.620  1.00 33.20 ? 272 GLU C OE2  1 
ATOM   4159 N  N    . THR C 1 147 ? -2.764  3.854   21.221  1.00 21.64 ? 273 THR C N    1 
ATOM   4160 C  CA   . THR C 1 147 ? -3.870  3.845   20.251  1.00 21.20 ? 273 THR C CA   1 
ATOM   4161 C  C    . THR C 1 147 ? -3.642  2.827   19.134  1.00 21.38 ? 273 THR C C    1 
ATOM   4162 O  O    . THR C 1 147 ? -4.588  2.437   18.456  1.00 21.62 ? 273 THR C O    1 
ATOM   4163 C  CB   . THR C 1 147 ? -4.134  5.222   19.594  1.00 21.58 ? 273 THR C CB   1 
ATOM   4164 O  OG1  . THR C 1 147 ? -3.090  5.539   18.655  1.00 21.28 ? 273 THR C OG1  1 
ATOM   4165 C  CG2  . THR C 1 147 ? -4.282  6.320   20.650  1.00 20.68 ? 273 THR C CG2  1 
ATOM   4166 N  N    . LEU C 1 148 ? -2.396  2.401   18.936  1.00 21.58 ? 274 LEU C N    1 
ATOM   4167 C  CA   . LEU C 1 148 ? -2.074  1.423   17.894  1.00 21.67 ? 274 LEU C CA   1 
ATOM   4168 C  C    . LEU C 1 148 ? -2.325  -0.015  18.326  1.00 21.41 ? 274 LEU C C    1 
ATOM   4169 O  O    . LEU C 1 148 ? -2.377  -0.906  17.477  1.00 21.32 ? 274 LEU C O    1 
ATOM   4170 C  CB   . LEU C 1 148 ? -0.615  1.558   17.455  1.00 22.12 ? 274 LEU C CB   1 
ATOM   4171 C  CG   . LEU C 1 148 ? -0.187  2.909   16.884  1.00 21.51 ? 274 LEU C CG   1 
ATOM   4172 C  CD1  . LEU C 1 148 ? 1.256   2.813   16.407  1.00 24.47 ? 274 LEU C CD1  1 
ATOM   4173 C  CD2  . LEU C 1 148 ? -1.132  3.354   15.750  1.00 23.99 ? 274 LEU C CD2  1 
ATOM   4174 N  N    . HIS C 1 149 ? -2.490  -0.244  19.631  1.00 20.99 ? 275 HIS C N    1 
ATOM   4175 C  CA   . HIS C 1 149 ? -2.580  -1.609  20.159  1.00 20.96 ? 275 HIS C CA   1 
ATOM   4176 C  C    . HIS C 1 149 ? -3.802  -2.343  19.605  1.00 21.28 ? 275 HIS C C    1 
ATOM   4177 O  O    . HIS C 1 149 ? -3.743  -3.546  19.287  1.00 21.03 ? 275 HIS C O    1 
ATOM   4178 C  CB   . HIS C 1 149 ? -2.613  -1.599  21.686  1.00 21.11 ? 275 HIS C CB   1 
ATOM   4179 C  CG   . HIS C 1 149 ? -1.319  -1.181  22.314  1.00 22.25 ? 275 HIS C CG   1 
ATOM   4180 N  ND1  . HIS C 1 149 ? -1.006  -1.458  23.627  1.00 24.38 ? 275 HIS C ND1  1 
ATOM   4181 C  CD2  . HIS C 1 149 ? -0.252  -0.519  21.806  1.00 22.53 ? 275 HIS C CD2  1 
ATOM   4182 C  CE1  . HIS C 1 149 ? 0.194   -0.976  23.902  1.00 23.32 ? 275 HIS C CE1  1 
ATOM   4183 N  NE2  . HIS C 1 149 ? 0.672   -0.399  22.816  1.00 23.21 ? 275 HIS C NE2  1 
ATOM   4184 N  N    . LYS C 1 150 ? -4.898  -1.603  19.449  1.00 20.54 ? 276 LYS C N    1 
ATOM   4185 C  CA   . LYS C 1 150 ? -6.134  -2.195  18.939  1.00 21.17 ? 276 LYS C CA   1 
ATOM   4186 C  C    . LYS C 1 150 ? -6.014  -2.733  17.517  1.00 20.95 ? 276 LYS C C    1 
ATOM   4187 O  O    . LYS C 1 150 ? -6.812  -3.578  17.119  1.00 21.78 ? 276 LYS C O    1 
ATOM   4188 C  CB   . LYS C 1 150 ? -7.304  -1.207  19.039  1.00 20.83 ? 276 LYS C CB   1 
ATOM   4189 C  CG   . LYS C 1 150 ? -7.176  0.034   18.176  1.00 21.85 ? 276 LYS C CG   1 
ATOM   4190 C  CD   . LYS C 1 150 ? -8.373  0.945   18.409  1.00 22.17 ? 276 LYS C CD   1 
ATOM   4191 C  CE   . LYS C 1 150 ? -8.119  2.339   17.901  1.00 24.68 ? 276 LYS C CE   1 
ATOM   4192 N  NZ   . LYS C 1 150 ? -7.200  3.097   18.788  1.00 24.79 ? 276 LYS C NZ   1 
ATOM   4193 N  N    . PHE C 1 151 ? -5.032  -2.257  16.749  1.00 20.13 ? 277 PHE C N    1 
ATOM   4194 C  CA   . PHE C 1 151 ? -4.841  -2.721  15.380  1.00 19.72 ? 277 PHE C CA   1 
ATOM   4195 C  C    . PHE C 1 151 ? -3.962  -3.964  15.281  1.00 20.26 ? 277 PHE C C    1 
ATOM   4196 O  O    . PHE C 1 151 ? -3.987  -4.650  14.257  1.00 19.24 ? 277 PHE C O    1 
ATOM   4197 C  CB   . PHE C 1 151 ? -4.218  -1.618  14.512  1.00 19.86 ? 277 PHE C CB   1 
ATOM   4198 C  CG   . PHE C 1 151 ? -5.037  -0.361  14.442  1.00 18.21 ? 277 PHE C CG   1 
ATOM   4199 C  CD1  . PHE C 1 151 ? -6.326  -0.387  13.937  1.00 18.76 ? 277 PHE C CD1  1 
ATOM   4200 C  CD2  . PHE C 1 151 ? -4.513  0.845   14.874  1.00 20.83 ? 277 PHE C CD2  1 
ATOM   4201 C  CE1  . PHE C 1 151 ? -7.091  0.785   13.869  1.00 18.85 ? 277 PHE C CE1  1 
ATOM   4202 C  CE2  . PHE C 1 151 ? -5.263  2.017   14.818  1.00 21.64 ? 277 PHE C CE2  1 
ATOM   4203 C  CZ   . PHE C 1 151 ? -6.552  1.985   14.316  1.00 19.45 ? 277 PHE C CZ   1 
ATOM   4204 N  N    . ALA C 1 152 ? -3.188  -4.243  16.330  1.00 19.58 ? 278 ALA C N    1 
ATOM   4205 C  CA   . ALA C 1 152 ? -2.153  -5.273  16.271  1.00 20.44 ? 278 ALA C CA   1 
ATOM   4206 C  C    . ALA C 1 152 ? -2.557  -6.565  16.960  1.00 19.66 ? 278 ALA C C    1 
ATOM   4207 O  O    . ALA C 1 152 ? -3.448  -6.599  17.810  1.00 20.54 ? 278 ALA C O    1 
ATOM   4208 C  CB   . ALA C 1 152 ? -0.874  -4.750  16.892  1.00 20.49 ? 278 ALA C CB   1 
ATOM   4209 N  N    . SER C 1 153 ? -1.874  -7.634  16.579  1.00 19.82 ? 279 SER C N    1 
ATOM   4210 C  CA   . SER C 1 153 ? -1.986  -8.906  17.265  1.00 20.13 ? 279 SER C CA   1 
ATOM   4211 C  C    . SER C 1 153 ? -1.466  -8.795  18.703  1.00 21.01 ? 279 SER C C    1 
ATOM   4212 O  O    . SER C 1 153 ? -0.806  -7.809  19.072  1.00 21.34 ? 279 SER C O    1 
ATOM   4213 C  CB   . SER C 1 153 ? -1.215  -9.983  16.490  1.00 20.86 ? 279 SER C CB   1 
ATOM   4214 O  OG   . SER C 1 153 ? -1.888  -10.317 15.277  1.00 19.20 ? 279 SER C OG   1 
ATOM   4215 N  N    . LYS C 1 154 ? -1.781  -9.798  19.515  1.00 21.54 ? 280 LYS C N    1 
ATOM   4216 C  CA   . LYS C 1 154 ? -1.338  -9.845  20.909  1.00 22.60 ? 280 LYS C CA   1 
ATOM   4217 C  C    . LYS C 1 154 ? -0.080  -10.697 21.096  1.00 22.66 ? 280 LYS C C    1 
ATOM   4218 O  O    . LYS C 1 154 ? 0.072   -11.741 20.456  1.00 22.60 ? 280 LYS C O    1 
ATOM   4219 C  CB   . LYS C 1 154 ? -2.446  -10.403 21.787  1.00 23.16 ? 280 LYS C CB   1 
ATOM   4220 C  CG   . LYS C 1 154 ? -3.691  -9.543  21.803  1.00 24.42 ? 280 LYS C CG   1 
ATOM   4221 C  CD   . LYS C 1 154 ? -4.796  -10.190 22.608  1.00 27.97 ? 280 LYS C CD   1 
ATOM   4222 C  CE   . LYS C 1 154 ? -6.094  -9.411  22.474  1.00 30.11 ? 280 LYS C CE   1 
ATOM   4223 N  NZ   . LYS C 1 154 ? -6.011  -8.043  23.057  1.00 33.40 ? 280 LYS C NZ   1 
ATOM   4224 N  N    . PRO C 1 155 ? 0.821   -10.280 22.004  1.00 22.86 ? 281 PRO C N    1 
ATOM   4225 C  CA   . PRO C 1 155 ? 0.782   -9.085  22.842  1.00 22.30 ? 281 PRO C CA   1 
ATOM   4226 C  C    . PRO C 1 155 ? 1.305   -7.846  22.112  1.00 22.18 ? 281 PRO C C    1 
ATOM   4227 O  O    . PRO C 1 155 ? 2.120   -7.958  21.183  1.00 21.16 ? 281 PRO C O    1 
ATOM   4228 C  CB   . PRO C 1 155 ? 1.693   -9.444  24.013  1.00 22.36 ? 281 PRO C CB   1 
ATOM   4229 C  CG   . PRO C 1 155 ? 2.617   -10.437 23.484  1.00 23.43 ? 281 PRO C CG   1 
ATOM   4230 C  CD   . PRO C 1 155 ? 1.928   -11.175 22.378  1.00 22.46 ? 281 PRO C CD   1 
ATOM   4231 N  N    . ALA C 1 156 ? 0.837   -6.676  22.539  1.00 21.99 ? 282 ALA C N    1 
ATOM   4232 C  CA   . ALA C 1 156 ? 1.264   -5.421  21.932  1.00 22.36 ? 282 ALA C CA   1 
ATOM   4233 C  C    . ALA C 1 156 ? 2.774   -5.248  22.050  1.00 22.07 ? 282 ALA C C    1 
ATOM   4234 O  O    . ALA C 1 156 ? 3.394   -4.680  21.166  1.00 22.48 ? 282 ALA C O    1 
ATOM   4235 C  CB   . ALA C 1 156 ? 0.540   -4.241  22.567  1.00 22.89 ? 282 ALA C CB   1 
ATOM   4236 N  N    . SER C 1 157 ? 3.361   -5.761  23.126  1.00 22.85 ? 283 SER C N    1 
ATOM   4237 C  CA   . SER C 1 157 ? 4.811   -5.670  23.316  1.00 22.88 ? 283 SER C CA   1 
ATOM   4238 C  C    . SER C 1 157 ? 5.603   -6.307  22.166  1.00 23.17 ? 283 SER C C    1 
ATOM   4239 O  O    . SER C 1 157 ? 6.731   -5.899  21.894  1.00 23.51 ? 283 SER C O    1 
ATOM   4240 C  CB   . SER C 1 157 ? 5.217   -6.305  24.648  1.00 23.54 ? 283 SER C CB   1 
ATOM   4241 O  OG   . SER C 1 157 ? 4.904   -7.686  24.679  1.00 23.21 ? 283 SER C OG   1 
ATOM   4242 N  N    . GLU C 1 158 ? 5.012   -7.304  21.509  1.00 22.72 ? 284 GLU C N    1 
ATOM   4243 C  CA   . GLU C 1 158 ? 5.672   -8.018  20.415  1.00 22.88 ? 284 GLU C CA   1 
ATOM   4244 C  C    . GLU C 1 158 ? 5.215   -7.561  19.032  1.00 22.23 ? 284 GLU C C    1 
ATOM   4245 O  O    . GLU C 1 158 ? 5.966   -7.694  18.067  1.00 22.85 ? 284 GLU C O    1 
ATOM   4246 C  CB   . GLU C 1 158 ? 5.443   -9.530  20.554  1.00 23.02 ? 284 GLU C CB   1 
ATOM   4247 C  CG   . GLU C 1 158 ? 5.967   -10.141 21.843  1.00 25.25 ? 284 GLU C CG   1 
ATOM   4248 C  CD   . GLU C 1 158 ? 7.447   -9.920  22.031  1.00 27.24 ? 284 GLU C CD   1 
ATOM   4249 O  OE1  . GLU C 1 158 ? 8.213   -10.169 21.078  1.00 30.06 ? 284 GLU C OE1  1 
ATOM   4250 O  OE2  . GLU C 1 158 ? 7.844   -9.483  23.127  1.00 31.69 ? 284 GLU C OE2  1 
ATOM   4251 N  N    . PHE C 1 159 ? 3.995   -7.034  18.920  1.00 21.48 ? 285 PHE C N    1 
ATOM   4252 C  CA   . PHE C 1 159 ? 3.422   -6.711  17.600  1.00 20.46 ? 285 PHE C CA   1 
ATOM   4253 C  C    . PHE C 1 159 ? 3.183   -5.229  17.317  1.00 20.27 ? 285 PHE C C    1 
ATOM   4254 O  O    . PHE C 1 159 ? 2.696   -4.881  16.238  1.00 21.01 ? 285 PHE C O    1 
ATOM   4255 C  CB   . PHE C 1 159 ? 2.133   -7.512  17.376  1.00 20.79 ? 285 PHE C CB   1 
ATOM   4256 C  CG   . PHE C 1 159 ? 2.384   -8.983  17.166  1.00 19.89 ? 285 PHE C CG   1 
ATOM   4257 C  CD1  . PHE C 1 159 ? 2.719   -9.466  15.911  1.00 19.88 ? 285 PHE C CD1  1 
ATOM   4258 C  CD2  . PHE C 1 159 ? 2.324   -9.874  18.230  1.00 20.61 ? 285 PHE C CD2  1 
ATOM   4259 C  CE1  . PHE C 1 159 ? 2.976   -10.823 15.711  1.00 20.59 ? 285 PHE C CE1  1 
ATOM   4260 C  CE2  . PHE C 1 159 ? 2.580   -11.237 18.037  1.00 21.79 ? 285 PHE C CE2  1 
ATOM   4261 C  CZ   . PHE C 1 159 ? 2.905   -11.707 16.776  1.00 20.62 ? 285 PHE C CZ   1 
ATOM   4262 N  N    . VAL C 1 160 ? 3.511   -4.368  18.277  1.00 19.65 ? 286 VAL C N    1 
ATOM   4263 C  CA   . VAL C 1 160 ? 3.536   -2.924  18.058  1.00 20.00 ? 286 VAL C CA   1 
ATOM   4264 C  C    . VAL C 1 160 ? 4.978   -2.449  18.187  1.00 19.46 ? 286 VAL C C    1 
ATOM   4265 O  O    . VAL C 1 160 ? 5.623   -2.672  19.218  1.00 20.64 ? 286 VAL C O    1 
ATOM   4266 C  CB   . VAL C 1 160 ? 2.649   -2.178  19.061  1.00 20.35 ? 286 VAL C CB   1 
ATOM   4267 C  CG1  . VAL C 1 160 ? 2.790   -0.651  18.902  1.00 20.52 ? 286 VAL C CG1  1 
ATOM   4268 C  CG2  . VAL C 1 160 ? 1.182   -2.609  18.890  1.00 20.77 ? 286 VAL C CG2  1 
ATOM   4269 N  N    . LYS C 1 161 ? 5.480   -1.808  17.139  1.00 19.20 ? 287 LYS C N    1 
ATOM   4270 C  CA   . LYS C 1 161 ? 6.834   -1.269  17.143  1.00 19.58 ? 287 LYS C CA   1 
ATOM   4271 C  C    . LYS C 1 161 ? 6.777   0.237   16.949  1.00 19.89 ? 287 LYS C C    1 
ATOM   4272 O  O    . LYS C 1 161 ? 6.247   0.719   15.946  1.00 20.19 ? 287 LYS C O    1 
ATOM   4273 C  CB   . LYS C 1 161 ? 7.665   -1.900  16.028  1.00 20.21 ? 287 LYS C CB   1 
ATOM   4274 C  CG   . LYS C 1 161 ? 9.125   -1.446  16.023  1.00 21.07 ? 287 LYS C CG   1 
ATOM   4275 C  CD   . LYS C 1 161 ? 9.882   -2.099  17.169  1.00 23.78 ? 287 LYS C CD   1 
ATOM   4276 C  CE   . LYS C 1 161 ? 11.152  -1.375  17.528  1.00 25.29 ? 287 LYS C CE   1 
ATOM   4277 N  NZ   . LYS C 1 161 ? 11.833  -2.044  18.694  1.00 26.06 ? 287 LYS C NZ   1 
ATOM   4278 N  N    . ILE C 1 162 ? 7.314   0.978   17.912  1.00 20.01 ? 288 ILE C N    1 
ATOM   4279 C  CA   . ILE C 1 162 ? 7.394   2.421   17.814  1.00 19.75 ? 288 ILE C CA   1 
ATOM   4280 C  C    . ILE C 1 162 ? 8.832   2.810   17.474  1.00 19.31 ? 288 ILE C C    1 
ATOM   4281 O  O    . ILE C 1 162 ? 9.757   2.442   18.188  1.00 20.43 ? 288 ILE C O    1 
ATOM   4282 C  CB   . ILE C 1 162 ? 6.981   3.103   19.126  1.00 20.33 ? 288 ILE C CB   1 
ATOM   4283 C  CG1  . ILE C 1 162 ? 5.619   2.591   19.614  1.00 21.15 ? 288 ILE C CG1  1 
ATOM   4284 C  CG2  . ILE C 1 162 ? 6.959   4.625   18.952  1.00 20.91 ? 288 ILE C CG2  1 
ATOM   4285 C  CD1  . ILE C 1 162 ? 4.468   2.830   18.644  1.00 23.70 ? 288 ILE C CD1  1 
ATOM   4286 N  N    . LEU C 1 163 ? 8.997   3.545   16.376  1.00 19.75 ? 289 LEU C N    1 
ATOM   4287 C  CA   . LEU C 1 163 ? 10.296  4.047   15.933  1.00 20.09 ? 289 LEU C CA   1 
ATOM   4288 C  C    . LEU C 1 163 ? 10.342  5.565   16.042  1.00 20.36 ? 289 LEU C C    1 
ATOM   4289 O  O    . LEU C 1 163 ? 9.412   6.248   15.639  1.00 21.06 ? 289 LEU C O    1 
ATOM   4290 C  CB   . LEU C 1 163 ? 10.542  3.653   14.476  1.00 20.07 ? 289 LEU C CB   1 
ATOM   4291 C  CG   . LEU C 1 163 ? 10.499  2.163   14.135  1.00 21.15 ? 289 LEU C CG   1 
ATOM   4292 C  CD1  . LEU C 1 163 ? 10.713  1.970   12.639  1.00 19.84 ? 289 LEU C CD1  1 
ATOM   4293 C  CD2  . LEU C 1 163 ? 11.563  1.420   14.945  1.00 19.72 ? 289 LEU C CD2  1 
ATOM   4294 N  N    . ASP C 1 164 ? 11.440  6.101   16.562  1.00 21.88 ? 290 ASP C N    1 
ATOM   4295 C  CA   . ASP C 1 164 ? 11.566  7.548   16.704  1.00 22.77 ? 290 ASP C CA   1 
ATOM   4296 C  C    . ASP C 1 164 ? 11.841  8.256   15.374  1.00 21.97 ? 290 ASP C C    1 
ATOM   4297 O  O    . ASP C 1 164 ? 11.456  9.407   15.197  1.00 23.12 ? 290 ASP C O    1 
ATOM   4298 C  CB   . ASP C 1 164 ? 12.636  7.906   17.740  1.00 24.33 ? 290 ASP C CB   1 
ATOM   4299 C  CG   . ASP C 1 164 ? 14.049  7.601   17.267  1.00 26.08 ? 290 ASP C CG   1 
ATOM   4300 O  OD1  . ASP C 1 164 ? 14.226  6.705   16.423  1.00 31.60 ? 290 ASP C OD1  1 
ATOM   4301 O  OD2  . ASP C 1 164 ? 14.992  8.269   17.755  1.00 32.02 ? 290 ASP C OD2  1 
ATOM   4302 N  N    . THR C 1 165 ? 12.516  7.577   14.450  1.00 21.36 ? 291 THR C N    1 
ATOM   4303 C  CA   . THR C 1 165 ? 12.821  8.152   13.136  1.00 21.87 ? 291 THR C CA   1 
ATOM   4304 C  C    . THR C 1 165 ? 12.599  7.144   12.015  1.00 21.07 ? 291 THR C C    1 
ATOM   4305 O  O    . THR C 1 165 ? 12.587  5.933   12.242  1.00 20.25 ? 291 THR C O    1 
ATOM   4306 C  CB   . THR C 1 165 ? 14.293  8.628   13.063  1.00 22.05 ? 291 THR C CB   1 
ATOM   4307 O  OG1  . THR C 1 165 ? 15.166  7.495   12.975  1.00 25.97 ? 291 THR C OG1  1 
ATOM   4308 C  CG2  . THR C 1 165 ? 14.656  9.462   14.290  1.00 23.78 ? 291 THR C CG2  1 
ATOM   4309 N  N    . PHE C 1 166 ? 12.446  7.657   10.799  1.00 20.28 ? 292 PHE C N    1 
ATOM   4310 C  CA   . PHE C 1 166 ? 12.302  6.807   9.624   1.00 20.48 ? 292 PHE C CA   1 
ATOM   4311 C  C    . PHE C 1 166 ? 13.596  6.094   9.272   1.00 20.79 ? 292 PHE C C    1 
ATOM   4312 O  O    . PHE C 1 166 ? 13.569  5.024   8.663   1.00 20.55 ? 292 PHE C O    1 
ATOM   4313 C  CB   . PHE C 1 166 ? 11.793  7.620   8.438   1.00 21.44 ? 292 PHE C CB   1 
ATOM   4314 C  CG   . PHE C 1 166 ? 10.371  8.035   8.589   1.00 21.98 ? 292 PHE C CG   1 
ATOM   4315 C  CD1  . PHE C 1 166 ? 10.045  9.187   9.288   1.00 22.42 ? 292 PHE C CD1  1 
ATOM   4316 C  CD2  . PHE C 1 166 ? 9.352   7.243   8.081   1.00 21.54 ? 292 PHE C CD2  1 
ATOM   4317 C  CE1  . PHE C 1 166 ? 8.722   9.559   9.450   1.00 24.95 ? 292 PHE C CE1  1 
ATOM   4318 C  CE2  . PHE C 1 166 ? 8.024   7.607   8.239   1.00 24.77 ? 292 PHE C CE2  1 
ATOM   4319 C  CZ   . PHE C 1 166 ? 7.713   8.761   8.927   1.00 22.76 ? 292 PHE C CZ   1 
ATOM   4320 N  N    . GLU C 1 167 ? 14.725  6.679   9.674   1.00 21.59 ? 293 GLU C N    1 
ATOM   4321 C  CA   . GLU C 1 167 ? 16.023  6.043   9.460   1.00 22.20 ? 293 GLU C CA   1 
ATOM   4322 C  C    . GLU C 1 167 ? 16.110  4.669   10.150  1.00 21.95 ? 293 GLU C C    1 
ATOM   4323 O  O    . GLU C 1 167 ? 16.837  3.781   9.688   1.00 22.48 ? 293 GLU C O    1 
ATOM   4324 C  CB   . GLU C 1 167 ? 17.162  6.958   9.922   1.00 22.74 ? 293 GLU C CB   1 
ATOM   4325 C  CG   . GLU C 1 167 ? 17.452  8.128   8.978   1.00 25.71 ? 293 GLU C CG   1 
ATOM   4326 C  CD   . GLU C 1 167 ? 16.425  9.254   9.041   1.00 27.72 ? 293 GLU C CD   1 
ATOM   4327 O  OE1  . GLU C 1 167 ? 15.633  9.318   10.007  1.00 30.48 ? 293 GLU C OE1  1 
ATOM   4328 O  OE2  . GLU C 1 167 ? 16.420  10.102  8.123   1.00 32.10 ? 293 GLU C OE2  1 
ATOM   4329 N  N    . LYS C 1 168 ? 15.349  4.485   11.229  1.00 21.67 ? 294 LYS C N    1 
ATOM   4330 C  CA   . LYS C 1 168 ? 15.330  3.214   11.968  1.00 21.97 ? 294 LYS C CA   1 
ATOM   4331 C  C    . LYS C 1 168 ? 14.740  2.038   11.179  1.00 21.88 ? 294 LYS C C    1 
ATOM   4332 O  O    . LYS C 1 168 ? 14.961  0.881   11.549  1.00 21.85 ? 294 LYS C O    1 
ATOM   4333 C  CB   . LYS C 1 168 ? 14.551  3.359   13.279  1.00 22.92 ? 294 LYS C CB   1 
ATOM   4334 C  CG   . LYS C 1 168 ? 15.168  4.323   14.287  1.00 24.49 ? 294 LYS C CG   1 
ATOM   4335 C  CD   . LYS C 1 168 ? 16.370  3.725   14.973  1.00 28.69 ? 294 LYS C CD   1 
ATOM   4336 C  CE   . LYS C 1 168 ? 17.001  4.709   15.958  1.00 31.36 ? 294 LYS C CE   1 
ATOM   4337 N  NZ   . LYS C 1 168 ? 16.112  5.023   17.116  1.00 33.32 ? 294 LYS C NZ   1 
ATOM   4338 N  N    . LEU C 1 169 ? 13.979  2.317   10.118  1.00 21.91 ? 295 LEU C N    1 
ATOM   4339 C  CA   . LEU C 1 169 ? 13.420  1.249   9.280   1.00 22.17 ? 295 LEU C CA   1 
ATOM   4340 C  C    . LEU C 1 169 ? 14.486  0.382   8.622   1.00 22.73 ? 295 LEU C C    1 
ATOM   4341 O  O    . LEU C 1 169 ? 14.281  -0.821  8.438   1.00 23.06 ? 295 LEU C O    1 
ATOM   4342 C  CB   . LEU C 1 169 ? 12.503  1.816   8.191   1.00 21.81 ? 295 LEU C CB   1 
ATOM   4343 C  CG   . LEU C 1 169 ? 11.106  2.256   8.627   1.00 22.33 ? 295 LEU C CG   1 
ATOM   4344 C  CD1  . LEU C 1 169 ? 10.415  3.051   7.501   1.00 22.59 ? 295 LEU C CD1  1 
ATOM   4345 C  CD2  . LEU C 1 169 ? 10.249  1.066   9.048   1.00 21.50 ? 295 LEU C CD2  1 
ATOM   4346 N  N    . LYS C 1 170 ? 15.619  0.991   8.284   1.00 23.28 ? 296 LYS C N    1 
ATOM   4347 C  CA   . LYS C 1 170 ? 16.688  0.304   7.566   1.00 24.71 ? 296 LYS C CA   1 
ATOM   4348 C  C    . LYS C 1 170 ? 17.186  -0.931  8.317   1.00 24.31 ? 296 LYS C C    1 
ATOM   4349 O  O    . LYS C 1 170 ? 17.605  -1.906  7.691   1.00 23.92 ? 296 LYS C O    1 
ATOM   4350 C  CB   . LYS C 1 170 ? 17.860  1.264   7.309   1.00 25.17 ? 296 LYS C CB   1 
ATOM   4351 C  CG   . LYS C 1 170 ? 18.899  0.707   6.346   1.00 29.04 ? 296 LYS C CG   1 
ATOM   4352 C  CD   . LYS C 1 170 ? 19.875  1.767   5.885   1.00 32.90 ? 296 LYS C CD   1 
ATOM   4353 C  CE   . LYS C 1 170 ? 20.909  1.172   4.935   1.00 33.89 ? 296 LYS C CE   1 
ATOM   4354 N  NZ   . LYS C 1 170 ? 21.957  2.159   4.576   1.00 36.80 ? 296 LYS C NZ   1 
ATOM   4355 N  N    . ASP C 1 171 ? 17.138  -0.891  9.647   1.00 24.08 ? 297 ASP C N    1 
ATOM   4356 C  CA   . ASP C 1 171 ? 17.660  -1.979  10.480  1.00 24.57 ? 297 ASP C CA   1 
ATOM   4357 C  C    . ASP C 1 171 ? 16.581  -2.809  11.195  1.00 23.60 ? 297 ASP C C    1 
ATOM   4358 O  O    . ASP C 1 171 ? 16.907  -3.613  12.073  1.00 23.76 ? 297 ASP C O    1 
ATOM   4359 C  CB   . ASP C 1 171 ? 18.617  -1.404  11.532  1.00 25.95 ? 297 ASP C CB   1 
ATOM   4360 C  CG   . ASP C 1 171 ? 19.873  -0.795  10.923  1.00 28.55 ? 297 ASP C CG   1 
ATOM   4361 O  OD1  . ASP C 1 171 ? 20.504  -1.442  10.057  1.00 33.85 ? 297 ASP C OD1  1 
ATOM   4362 O  OD2  . ASP C 1 171 ? 20.235  0.329   11.331  1.00 34.58 ? 297 ASP C OD2  1 
ATOM   4363 N  N    . LEU C 1 172 ? 15.309  -2.630  10.839  1.00 21.41 ? 298 LEU C N    1 
ATOM   4364 C  CA   . LEU C 1 172 ? 14.236  -3.271  11.595  1.00 21.17 ? 298 LEU C CA   1 
ATOM   4365 C  C    . LEU C 1 172 ? 14.062  -4.763  11.300  1.00 20.75 ? 298 LEU C C    1 
ATOM   4366 O  O    . LEU C 1 172 ? 13.477  -5.476  12.107  1.00 22.32 ? 298 LEU C O    1 
ATOM   4367 C  CB   . LEU C 1 172 ? 12.908  -2.548  11.335  1.00 21.25 ? 298 LEU C CB   1 
ATOM   4368 C  CG   . LEU C 1 172 ? 11.678  -3.022  12.113  1.00 21.41 ? 298 LEU C CG   1 
ATOM   4369 C  CD1  . LEU C 1 172 ? 11.883  -2.841  13.625  1.00 24.29 ? 298 LEU C CD1  1 
ATOM   4370 C  CD2  . LEU C 1 172 ? 10.459  -2.276  11.629  1.00 22.89 ? 298 LEU C CD2  1 
ATOM   4371 N  N    . PHE C 1 173 ? 14.540  -5.237  10.152  1.00 20.40 ? 299 PHE C N    1 
ATOM   4372 C  CA   . PHE C 1 173 ? 14.210  -6.607  9.709   1.00 19.84 ? 299 PHE C CA   1 
ATOM   4373 C  C    . PHE C 1 173 ? 14.526  -7.664  10.765  1.00 19.39 ? 299 PHE C C    1 
ATOM   4374 O  O    . PHE C 1 173 ? 13.783  -8.622  10.937  1.00 18.65 ? 299 PHE C O    1 
ATOM   4375 C  CB   . PHE C 1 173 ? 14.903  -6.943  8.392   1.00 19.27 ? 299 PHE C CB   1 
ATOM   4376 C  CG   . PHE C 1 173 ? 14.525  -8.285  7.831   1.00 19.26 ? 299 PHE C CG   1 
ATOM   4377 C  CD1  . PHE C 1 173 ? 13.398  -8.426  7.037   1.00 19.53 ? 299 PHE C CD1  1 
ATOM   4378 C  CD2  . PHE C 1 173 ? 15.302  -9.415  8.086   1.00 18.13 ? 299 PHE C CD2  1 
ATOM   4379 C  CE1  . PHE C 1 173 ? 13.047  -9.669  6.502   1.00 18.99 ? 299 PHE C CE1  1 
ATOM   4380 C  CE2  . PHE C 1 173 ? 14.963  -10.651 7.560   1.00 17.57 ? 299 PHE C CE2  1 
ATOM   4381 C  CZ   . PHE C 1 173 ? 13.824  -10.784 6.768   1.00 20.12 ? 299 PHE C CZ   1 
ATOM   4382 N  N    . THR C 1 174 ? 15.630  -7.513  11.484  1.00 20.61 ? 300 THR C N    1 
ATOM   4383 C  CA   . THR C 1 174 ? 15.980  -8.522  12.487  1.00 22.26 ? 300 THR C CA   1 
ATOM   4384 C  C    . THR C 1 174 ? 14.921  -8.656  13.590  1.00 22.04 ? 300 THR C C    1 
ATOM   4385 O  O    . THR C 1 174 ? 14.730  -9.734  14.133  1.00 22.68 ? 300 THR C O    1 
ATOM   4386 C  CB   . THR C 1 174 ? 17.365  -8.258  13.097  1.00 22.74 ? 300 THR C CB   1 
ATOM   4387 O  OG1  . THR C 1 174 ? 17.428  -6.909  13.573  1.00 26.48 ? 300 THR C OG1  1 
ATOM   4388 C  CG2  . THR C 1 174 ? 18.449  -8.485  12.042  1.00 25.76 ? 300 THR C CG2  1 
ATOM   4389 N  N    . GLU C 1 175 ? 14.209  -7.572  13.888  1.00 22.85 ? 301 GLU C N    1 
ATOM   4390 C  CA   . GLU C 1 175 ? 13.188  -7.586  14.928  1.00 23.07 ? 301 GLU C CA   1 
ATOM   4391 C  C    . GLU C 1 175 ? 11.866  -8.197  14.461  1.00 22.51 ? 301 GLU C C    1 
ATOM   4392 O  O    . GLU C 1 175 ? 10.953  -8.413  15.268  1.00 22.54 ? 301 GLU C O    1 
ATOM   4393 C  CB   . GLU C 1 175 ? 12.956  -6.168  15.450  1.00 23.80 ? 301 GLU C CB   1 
ATOM   4394 C  CG   . GLU C 1 175 ? 14.192  -5.505  16.018  1.00 26.54 ? 301 GLU C CG   1 
ATOM   4395 C  CD   . GLU C 1 175 ? 13.871  -4.219  16.762  1.00 29.64 ? 301 GLU C CD   1 
ATOM   4396 O  OE1  . GLU C 1 175 ? 12.850  -4.192  17.482  1.00 31.87 ? 301 GLU C OE1  1 
ATOM   4397 O  OE2  . GLU C 1 175 ? 14.636  -3.241  16.629  1.00 31.65 ? 301 GLU C OE2  1 
ATOM   4398 N  N    . LEU C 1 176 ? 11.763  -8.490  13.167  1.00 20.39 ? 302 LEU C N    1 
ATOM   4399 C  CA   . LEU C 1 176 ? 10.602  -9.170  12.623  1.00 20.44 ? 302 LEU C CA   1 
ATOM   4400 C  C    . LEU C 1 176 ? 10.694  -10.687 12.791  1.00 19.99 ? 302 LEU C C    1 
ATOM   4401 O  O    . LEU C 1 176 ? 9.738   -11.399 12.534  1.00 20.41 ? 302 LEU C O    1 
ATOM   4402 C  CB   . LEU C 1 176 ? 10.408  -8.803  11.157  1.00 21.26 ? 302 LEU C CB   1 
ATOM   4403 C  CG   . LEU C 1 176 ? 10.332  -7.298  10.884  1.00 22.67 ? 302 LEU C CG   1 
ATOM   4404 C  CD1  . LEU C 1 176 ? 10.083  -7.062  9.403   1.00 23.59 ? 302 LEU C CD1  1 
ATOM   4405 C  CD2  . LEU C 1 176 ? 9.259   -6.613  11.738  1.00 25.18 ? 302 LEU C CD2  1 
ATOM   4406 N  N    . GLN C 1 177 ? 11.841  -11.190 13.231  1.00 19.90 ? 303 GLN C N    1 
ATOM   4407 C  CA   . GLN C 1 177 ? 11.943  -12.609 13.571  1.00 19.74 ? 303 GLN C CA   1 
ATOM   4408 C  C    . GLN C 1 177 ? 10.980  -12.947 14.709  1.00 19.63 ? 303 GLN C C    1 
ATOM   4409 O  O    . GLN C 1 177 ? 10.828  -12.159 15.652  1.00 19.33 ? 303 GLN C O    1 
ATOM   4410 C  CB   . GLN C 1 177 ? 13.368  -12.991 13.945  1.00 19.98 ? 303 GLN C CB   1 
ATOM   4411 C  CG   . GLN C 1 177 ? 13.537  -14.496 14.075  1.00 20.18 ? 303 GLN C CG   1 
ATOM   4412 C  CD   . GLN C 1 177 ? 14.973  -14.923 14.242  1.00 19.92 ? 303 GLN C CD   1 
ATOM   4413 O  OE1  . GLN C 1 177 ? 15.902  -14.231 13.803  1.00 20.69 ? 303 GLN C OE1  1 
ATOM   4414 N  NE2  . GLN C 1 177 ? 15.172  -16.074 14.877  1.00 19.66 ? 303 GLN C NE2  1 
ATOM   4415 N  N    . LYS C 1 178 ? 10.336  -14.111 14.577  1.00 19.54 ? 304 LYS C N    1 
ATOM   4416 C  CA   . LYS C 1 178 ? 9.239   -14.589 15.449  1.00 19.92 ? 304 LYS C CA   1 
ATOM   4417 C  C    . LYS C 1 178 ? 7.914   -13.848 15.232  1.00 20.89 ? 304 LYS C C    1 
ATOM   4418 O  O    . LYS C 1 178 ? 6.926   -14.097 15.940  1.00 21.02 ? 304 LYS C O    1 
ATOM   4419 C  CB   . LYS C 1 178 ? 9.627   -14.590 16.933  1.00 20.63 ? 304 LYS C CB   1 
ATOM   4420 C  CG   . LYS C 1 178 ? 10.952  -15.285 17.243  1.00 19.62 ? 304 LYS C CG   1 
ATOM   4421 C  CD   . LYS C 1 178 ? 11.102  -15.597 18.714  1.00 22.94 ? 304 LYS C CD   1 
ATOM   4422 C  CE   . LYS C 1 178 ? 12.444  -16.279 19.002  1.00 22.30 ? 304 LYS C CE   1 
ATOM   4423 N  NZ   . LYS C 1 178 ? 12.492  -16.821 20.394  1.00 24.66 ? 304 LYS C NZ   1 
ATOM   4424 N  N    . LYS C 1 179 ? 7.885   -12.930 14.267  1.00 20.62 ? 305 LYS C N    1 
ATOM   4425 C  CA   . LYS C 1 179 ? 6.655   -12.237 13.881  1.00 22.17 ? 305 LYS C CA   1 
ATOM   4426 C  C    . LYS C 1 179 ? 6.242   -12.599 12.455  1.00 21.75 ? 305 LYS C C    1 
ATOM   4427 O  O    . LYS C 1 179 ? 5.082   -12.945 12.215  1.00 21.57 ? 305 LYS C O    1 
ATOM   4428 C  CB   . LYS C 1 179 ? 6.804   -10.710 13.978  1.00 22.43 ? 305 LYS C CB   1 
ATOM   4429 C  CG   . LYS C 1 179 ? 7.693   -10.184 15.104  1.00 26.05 ? 305 LYS C CG   1 
ATOM   4430 C  CD   . LYS C 1 179 ? 7.159   -10.529 16.460  1.00 26.85 ? 305 LYS C CD   1 
ATOM   4431 C  CE   . LYS C 1 179 ? 8.209   -10.251 17.557  1.00 27.31 ? 305 LYS C CE   1 
ATOM   4432 N  NZ   . LYS C 1 179 ? 8.799   -8.872  17.533  1.00 28.29 ? 305 LYS C NZ   1 
ATOM   4433 N  N    . ILE C 1 180 ? 7.178   -12.491 11.508  1.00 21.46 ? 306 ILE C N    1 
ATOM   4434 C  CA   A ILE C 1 180 ? 6.862   -12.811 10.116  0.60 21.86 ? 306 ILE C CA   1 
ATOM   4435 C  CA   B ILE C 1 180 ? 6.935   -12.712 10.079  0.40 22.15 ? 306 ILE C CA   1 
ATOM   4436 C  C    . ILE C 1 180 ? 7.739   -13.906 9.513   1.00 21.90 ? 306 ILE C C    1 
ATOM   4437 O  O    . ILE C 1 180 ? 7.415   -14.435 8.444   1.00 22.58 ? 306 ILE C O    1 
ATOM   4438 C  CB   A ILE C 1 180 ? 6.836   -11.564 9.206   0.60 22.51 ? 306 ILE C CB   1 
ATOM   4439 C  CB   B ILE C 1 180 ? 7.237   -11.396 9.288   0.40 22.92 ? 306 ILE C CB   1 
ATOM   4440 C  CG1  A ILE C 1 180 ? 8.239   -11.163 8.749   0.60 20.93 ? 306 ILE C CG1  1 
ATOM   4441 C  CG1  B ILE C 1 180 ? 5.966   -10.542 9.156   0.40 23.43 ? 306 ILE C CG1  1 
ATOM   4442 C  CG2  A ILE C 1 180 ? 6.145   -10.390 9.913   0.60 22.79 ? 306 ILE C CG2  1 
ATOM   4443 C  CG2  B ILE C 1 180 ? 7.789   -11.668 7.896   0.40 23.42 ? 306 ILE C CG2  1 
ATOM   4444 C  CD1  A ILE C 1 180 ? 8.220   -10.040 7.759   0.60 20.97 ? 306 ILE C CD1  1 
ATOM   4445 C  CD1  B ILE C 1 180 ? 5.539   -9.834  10.425  0.40 23.56 ? 306 ILE C CD1  1 
ATOM   4446 N  N    . TYR C 1 181 ? 8.812   -14.277 10.210  1.00 21.04 ? 307 TYR C N    1 
ATOM   4447 C  CA   . TYR C 1 181 ? 9.642   -15.420 9.842   1.00 21.35 ? 307 TYR C CA   1 
ATOM   4448 C  C    . TYR C 1 181 ? 10.243  -15.997 11.114  1.00 21.32 ? 307 TYR C C    1 
ATOM   4449 O  O    . TYR C 1 181 ? 10.994  -16.987 11.124  1.00 21.72 ? 307 TYR C O    1 
ATOM   4450 C  CB   . TYR C 1 181 ? 10.757  -15.029 8.853   1.00 21.36 ? 307 TYR C CB   1 
ATOM   4451 C  CG   . TYR C 1 181 ? 11.761  -14.044 9.393   1.00 19.79 ? 307 TYR C CG   1 
ATOM   4452 C  CD1  . TYR C 1 181 ? 12.924  -14.476 10.031  1.00 20.23 ? 307 TYR C CD1  1 
ATOM   4453 C  CD2  . TYR C 1 181 ? 11.557  -12.674 9.261   1.00 21.04 ? 307 TYR C CD2  1 
ATOM   4454 C  CE1  . TYR C 1 181 ? 13.846  -13.553 10.536  1.00 19.44 ? 307 TYR C CE1  1 
ATOM   4455 C  CE2  . TYR C 1 181 ? 12.471  -11.756 9.759   1.00 19.93 ? 307 TYR C CE2  1 
ATOM   4456 C  CZ   . TYR C 1 181 ? 13.604  -12.201 10.390  1.00 18.81 ? 307 TYR C CZ   1 
ATOM   4457 O  OH   . TYR C 1 181 ? 14.524  -11.306 10.890  1.00 19.50 ? 307 TYR C OH   1 
ATOM   4458 O  OXT  . TYR C 1 181 ? 9.972   -15.447 12.189  1.00 21.91 ? 307 TYR C OXT  1 
HETATM 4459 F  FAC  . ICF D 2 .   ? 27.400  17.182  3.811   1.00 46.81 ? 1   ICF A FAC  1 
HETATM 4460 C  CAJ  . ICF D 2 .   ? 28.208  17.225  4.870   1.00 47.04 ? 1   ICF A CAJ  1 
HETATM 4461 F  FAD  . ICF D 2 .   ? 29.139  18.149  4.667   1.00 46.04 ? 1   ICF A FAD  1 
HETATM 4462 F  FAE  . ICF D 2 .   ? 28.809  16.065  5.039   1.00 44.66 ? 1   ICF A FAE  1 
HETATM 4463 C  CAI  . ICF D 2 .   ? 27.398  17.584  6.119   1.00 46.10 ? 1   ICF A CAI  1 
HETATM 4464 CL CLAF . ICF D 2 .   ? 26.202  16.280  6.624   1.00 51.56 ? 1   ICF A CLAF 1 
HETATM 4465 O  OAG  . ICF D 2 .   ? 26.699  18.792  5.791   1.00 48.09 ? 1   ICF A OAG  1 
HETATM 4466 C  CAH  . ICF D 2 .   ? 26.607  19.700  6.906   1.00 48.25 ? 1   ICF A CAH  1 
HETATM 4467 F  FAB  . ICF D 2 .   ? 26.315  19.023  8.030   1.00 48.71 ? 1   ICF A FAB  1 
HETATM 4468 F  FAA  . ICF D 2 .   ? 27.746  20.404  7.071   1.00 46.61 ? 1   ICF A FAA  1 
HETATM 4469 C  C1   . GOL E 3 .   ? 35.983  6.922   7.028   1.00 31.73 ? 2   GOL A C1   1 
HETATM 4470 O  O1   . GOL E 3 .   ? 36.848  5.933   7.494   1.00 38.49 ? 2   GOL A O1   1 
HETATM 4471 C  C2   . GOL E 3 .   ? 34.936  7.256   8.097   1.00 35.90 ? 2   GOL A C2   1 
HETATM 4472 O  O2   . GOL E 3 .   ? 34.731  6.256   9.089   1.00 39.85 ? 2   GOL A O2   1 
HETATM 4473 C  C3   . GOL E 3 .   ? 33.644  7.475   7.342   1.00 31.11 ? 2   GOL A C3   1 
HETATM 4474 O  O3   . GOL E 3 .   ? 32.614  7.782   8.227   1.00 37.34 ? 2   GOL A O3   1 
HETATM 4475 F  FAC  . ICF F 2 .   ? 24.658  9.062   23.068  1.00 49.71 ? 2   ICF B FAC  1 
HETATM 4476 C  CAJ  . ICF F 2 .   ? 25.593  8.209   23.452  1.00 50.39 ? 2   ICF B CAJ  1 
HETATM 4477 F  FAD  . ICF F 2 .   ? 25.033  7.062   23.844  1.00 50.19 ? 2   ICF B FAD  1 
HETATM 4478 F  FAE  . ICF F 2 .   ? 26.258  8.736   24.463  1.00 49.88 ? 2   ICF B FAE  1 
HETATM 4479 C  CAI  . ICF F 2 .   ? 26.569  7.958   22.305  1.00 50.15 ? 2   ICF B CAI  1 
HETATM 4480 CL CLAF . ICF F 2 .   ? 25.688  7.362   20.814  1.00 54.28 ? 2   ICF B CLAF 1 
HETATM 4481 O  OAG  . ICF F 2 .   ? 27.502  6.981   22.793  1.00 49.79 ? 2   ICF B OAG  1 
HETATM 4482 C  CAH  . ICF F 2 .   ? 28.826  7.160   22.278  1.00 49.53 ? 2   ICF B CAH  1 
HETATM 4483 F  FAB  . ICF F 2 .   ? 28.755  7.465   20.965  1.00 49.63 ? 2   ICF B FAB  1 
HETATM 4484 F  FAA  . ICF F 2 .   ? 29.467  8.123   22.968  1.00 48.39 ? 2   ICF B FAA  1 
HETATM 4485 C  C1   . GOL G 3 .   ? 36.848  28.308  35.364  1.00 33.21 ? 3   GOL B C1   1 
HETATM 4486 O  O1   . GOL G 3 .   ? 37.359  29.553  35.780  1.00 32.06 ? 3   GOL B O1   1 
HETATM 4487 C  C2   . GOL G 3 .   ? 35.499  28.071  36.021  1.00 32.86 ? 3   GOL B C2   1 
HETATM 4488 O  O2   . GOL G 3 .   ? 35.611  28.199  37.425  1.00 30.73 ? 3   GOL B O2   1 
HETATM 4489 C  C3   . GOL G 3 .   ? 34.999  26.669  35.702  1.00 32.32 ? 3   GOL B C3   1 
HETATM 4490 O  O3   . GOL G 3 .   ? 33.616  26.579  35.991  1.00 29.73 ? 3   GOL B O3   1 
HETATM 4491 C  C1   . GOL H 3 .   ? 26.701  25.571  46.293  1.00 47.13 ? 4   GOL B C1   1 
HETATM 4492 O  O1   . GOL H 3 .   ? 26.736  26.796  45.597  1.00 48.04 ? 4   GOL B O1   1 
HETATM 4493 C  C2   . GOL H 3 .   ? 25.641  24.678  45.665  1.00 47.23 ? 4   GOL B C2   1 
HETATM 4494 O  O2   . GOL H 3 .   ? 25.296  23.667  46.582  1.00 49.47 ? 4   GOL B O2   1 
HETATM 4495 C  C3   . GOL H 3 .   ? 26.184  24.058  44.378  1.00 46.72 ? 4   GOL B C3   1 
HETATM 4496 O  O3   . GOL H 3 .   ? 25.239  24.180  43.336  1.00 45.78 ? 4   GOL B O3   1 
HETATM 4497 MG MG   . MG  I 4 .   ? 0.451   11.420  9.050   1.00 35.97 ? 1   MG  C MG   1 
HETATM 4498 C  C1   . GOL J 3 .   ? 0.059   -13.496 17.603  1.00 32.88 ? 308 GOL C C1   1 
HETATM 4499 O  O1   . GOL J 3 .   ? -1.001  -13.238 18.502  1.00 30.00 ? 308 GOL C O1   1 
HETATM 4500 C  C2   . GOL J 3 .   ? -0.219  -14.789 16.847  1.00 33.22 ? 308 GOL C C2   1 
HETATM 4501 O  O2   . GOL J 3 .   ? -1.348  -14.618 16.026  1.00 31.72 ? 308 GOL C O2   1 
HETATM 4502 C  C3   . GOL J 3 .   ? 0.975   -15.168 15.977  1.00 33.86 ? 308 GOL C C3   1 
HETATM 4503 O  O3   . GOL J 3 .   ? 0.718   -16.441 15.424  1.00 35.35 ? 308 GOL C O3   1 
HETATM 4504 O  O    . HOH K 5 .   ? 42.295  16.049  -0.183  1.00 20.05 ? 4   HOH A O    1 
HETATM 4505 O  O    . HOH K 5 .   ? 37.821  12.729  11.796  1.00 17.18 ? 5   HOH A O    1 
HETATM 4506 O  O    . HOH K 5 .   ? 38.062  30.360  -10.255 1.00 20.56 ? 6   HOH A O    1 
HETATM 4507 O  O    . HOH K 5 .   ? 45.587  26.575  -7.957  1.00 19.56 ? 7   HOH A O    1 
HETATM 4508 O  O    . HOH K 5 .   ? 51.959  16.281  8.116   1.00 24.22 ? 9   HOH A O    1 
HETATM 4509 O  O    . HOH K 5 .   ? 51.361  23.880  -9.269  1.00 19.76 ? 10  HOH A O    1 
HETATM 4510 O  O    . HOH K 5 .   ? 44.002  10.858  8.781   1.00 14.84 ? 14  HOH A O    1 
HETATM 4511 O  O    . HOH K 5 .   ? 36.830  17.213  16.795  1.00 19.79 ? 15  HOH A O    1 
HETATM 4512 O  O    . HOH K 5 .   ? 35.972  25.767  -15.467 1.00 25.67 ? 16  HOH A O    1 
HETATM 4513 O  O    . HOH K 5 .   ? 45.139  12.896  2.313   1.00 28.21 ? 22  HOH A O    1 
HETATM 4514 O  O    . HOH K 5 .   ? 38.402  9.710   -6.337  1.00 14.84 ? 23  HOH A O    1 
HETATM 4515 O  O    . HOH K 5 .   ? 47.198  28.360  4.331   1.00 20.87 ? 25  HOH A O    1 
HETATM 4516 O  O    . HOH K 5 .   ? 40.552  29.604  -10.979 1.00 28.07 ? 26  HOH A O    1 
HETATM 4517 O  O    . HOH K 5 .   ? 24.401  21.915  7.918   1.00 21.92 ? 27  HOH A O    1 
HETATM 4518 O  O    . HOH K 5 .   ? 21.874  25.109  13.608  1.00 29.29 ? 34  HOH A O    1 
HETATM 4519 O  O    . HOH K 5 .   ? 36.691  21.521  -16.007 1.00 26.45 ? 36  HOH A O    1 
HETATM 4520 O  O    . HOH K 5 .   ? 43.226  12.838  -6.612  1.00 25.81 ? 37  HOH A O    1 
HETATM 4521 O  O    . HOH K 5 .   ? 46.671  18.812  12.173  1.00 23.11 ? 38  HOH A O    1 
HETATM 4522 O  O    . HOH K 5 .   ? 34.526  33.783  -8.089  1.00 26.70 ? 40  HOH A O    1 
HETATM 4523 O  O    . HOH K 5 .   ? 43.962  7.464   -2.875  1.00 18.00 ? 46  HOH A O    1 
HETATM 4524 O  O    . HOH K 5 .   ? 44.444  10.087  -4.051  1.00 18.42 ? 50  HOH A O    1 
HETATM 4525 O  O    . HOH K 5 .   ? 25.072  28.498  15.906  1.00 19.51 ? 52  HOH A O    1 
HETATM 4526 O  O    . HOH K 5 .   ? 32.435  33.175  11.748  1.00 21.06 ? 53  HOH A O    1 
HETATM 4527 O  O    . HOH K 5 .   ? 34.196  16.927  18.059  1.00 20.48 ? 55  HOH A O    1 
HETATM 4528 O  O    . HOH K 5 .   ? 25.568  17.721  -7.910  1.00 15.35 ? 57  HOH A O    1 
HETATM 4529 O  O    . HOH K 5 .   ? 28.583  6.001   -1.530  1.00 30.40 ? 59  HOH A O    1 
HETATM 4530 O  O    . HOH K 5 .   ? 40.735  14.881  13.519  1.00 26.57 ? 61  HOH A O    1 
HETATM 4531 O  O    . HOH K 5 .   ? 48.899  12.261  -2.470  1.00 26.58 ? 63  HOH A O    1 
HETATM 4532 O  O    . HOH K 5 .   ? 49.873  24.182  5.600   1.00 26.92 ? 68  HOH A O    1 
HETATM 4533 O  O    . HOH K 5 .   ? 22.821  37.575  10.860  1.00 20.31 ? 72  HOH A O    1 
HETATM 4534 O  O    . HOH K 5 .   ? 46.808  30.380  6.368   1.00 27.11 ? 74  HOH A O    1 
HETATM 4535 O  O    . HOH K 5 .   ? 41.549  37.454  3.833   1.00 21.71 ? 80  HOH A O    1 
HETATM 4536 O  O    . HOH K 5 .   ? 35.771  7.818   -9.339  1.00 22.03 ? 82  HOH A O    1 
HETATM 4537 O  O    . HOH K 5 .   ? 30.505  7.583   4.547   1.00 29.59 ? 83  HOH A O    1 
HETATM 4538 O  O    . HOH K 5 .   ? 32.354  28.455  15.945  1.00 26.20 ? 85  HOH A O    1 
HETATM 4539 O  O    . HOH K 5 .   ? 53.751  24.037  -7.773  1.00 29.94 ? 88  HOH A O    1 
HETATM 4540 O  O    . HOH K 5 .   ? 41.031  34.941  -3.094  1.00 24.06 ? 89  HOH A O    1 
HETATM 4541 O  O    . HOH K 5 .   ? 39.051  30.927  12.064  1.00 29.71 ? 96  HOH A O    1 
HETATM 4542 O  O    . HOH K 5 .   ? 45.542  5.692   6.099   1.00 20.80 ? 97  HOH A O    1 
HETATM 4543 O  O    . HOH K 5 .   ? 41.654  3.704   -2.654  1.00 20.85 ? 101 HOH A O    1 
HETATM 4544 O  O    . HOH K 5 .   ? 25.426  23.318  20.553  1.00 20.14 ? 103 HOH A O    1 
HETATM 4545 O  O    . HOH K 5 .   ? 46.853  23.112  -15.540 1.00 32.52 ? 105 HOH A O    1 
HETATM 4546 O  O    . HOH K 5 .   ? 20.572  22.976  9.433   1.00 24.08 ? 110 HOH A O    1 
HETATM 4547 O  O    . HOH K 5 .   ? 37.757  38.694  12.430  1.00 27.21 ? 111 HOH A O    1 
HETATM 4548 O  O    . HOH K 5 .   ? 32.909  26.145  15.336  1.00 26.27 ? 112 HOH A O    1 
HETATM 4549 O  O    . HOH K 5 .   ? 27.865  26.370  -12.835 1.00 27.00 ? 116 HOH A O    1 
HETATM 4550 O  O    . HOH K 5 .   ? 47.170  13.144  4.554   1.00 32.39 ? 118 HOH A O    1 
HETATM 4551 O  O    . HOH K 5 .   ? 20.853  12.817  3.791   1.00 29.82 ? 120 HOH A O    1 
HETATM 4552 O  O    . HOH K 5 .   ? 49.223  26.704  5.719   1.00 23.28 ? 122 HOH A O    1 
HETATM 4553 O  O    . HOH K 5 .   ? 53.405  20.471  11.352  1.00 33.52 ? 126 HOH A O    1 
HETATM 4554 O  O    . HOH K 5 .   ? 50.950  23.299  8.082   1.00 17.39 ? 308 HOH A O    1 
HETATM 4555 O  O    . HOH K 5 .   ? 42.206  16.048  -6.013  1.00 19.84 ? 309 HOH A O    1 
HETATM 4556 O  O    . HOH K 5 .   ? 47.744  25.322  11.309  1.00 18.99 ? 310 HOH A O    1 
HETATM 4557 O  O    . HOH K 5 .   ? 34.367  35.557  4.109   1.00 23.22 ? 311 HOH A O    1 
HETATM 4558 O  O    . HOH K 5 .   ? 39.828  13.882  19.992  1.00 36.41 ? 312 HOH A O    1 
HETATM 4559 O  O    . HOH K 5 .   ? 32.187  33.367  -9.175  1.00 28.24 ? 313 HOH A O    1 
HETATM 4560 O  O    . HOH K 5 .   ? 52.377  20.423  -3.276  1.00 36.38 ? 314 HOH A O    1 
HETATM 4561 O  O    . HOH K 5 .   ? 21.560  20.701  -9.508  1.00 40.87 ? 315 HOH A O    1 
HETATM 4562 O  O    . HOH K 5 .   ? 26.063  10.409  6.048   1.00 42.11 ? 316 HOH A O    1 
HETATM 4563 O  O    . HOH K 5 .   ? 38.576  3.630   10.573  1.00 33.19 ? 317 HOH A O    1 
HETATM 4564 O  O    . HOH K 5 .   ? 21.497  34.572  -11.420 1.00 35.72 ? 318 HOH A O    1 
HETATM 4565 O  O    . HOH K 5 .   ? 45.212  2.633   -0.260  1.00 32.91 ? 319 HOH A O    1 
HETATM 4566 O  O    . HOH K 5 .   ? 28.630  8.364   13.935  1.00 23.28 ? 320 HOH A O    1 
HETATM 4567 O  O    . HOH K 5 .   ? 29.749  28.052  -12.234 1.00 38.15 ? 321 HOH A O    1 
HETATM 4568 O  O    . HOH K 5 .   ? 38.683  35.536  1.643   1.00 21.53 ? 322 HOH A O    1 
HETATM 4569 O  O    . HOH K 5 .   ? 26.924  29.742  -11.707 1.00 27.22 ? 323 HOH A O    1 
HETATM 4570 O  O    . HOH K 5 .   ? 33.842  4.019   -1.737  1.00 32.15 ? 324 HOH A O    1 
HETATM 4571 O  O    . HOH K 5 .   ? 33.671  21.699  -15.504 1.00 23.55 ? 325 HOH A O    1 
HETATM 4572 O  O    . HOH K 5 .   ? 18.088  17.298  16.227  1.00 29.26 ? 326 HOH A O    1 
HETATM 4573 O  O    . HOH K 5 .   ? 45.306  14.219  -5.016  1.00 21.75 ? 327 HOH A O    1 
HETATM 4574 O  O    . HOH K 5 .   ? 34.045  41.827  2.065   1.00 41.96 ? 328 HOH A O    1 
HETATM 4575 O  O    . HOH K 5 .   ? 20.558  32.146  4.331   1.00 24.05 ? 329 HOH A O    1 
HETATM 4576 O  O    . HOH K 5 .   ? 36.724  3.976   6.403   1.00 29.23 ? 330 HOH A O    1 
HETATM 4577 O  O    . HOH K 5 .   ? 21.768  15.463  10.268  1.00 33.73 ? 331 HOH A O    1 
HETATM 4578 O  O    . HOH K 5 .   ? 46.042  5.406   0.470   1.00 31.24 ? 332 HOH A O    1 
HETATM 4579 O  O    . HOH K 5 .   ? 24.418  17.864  -10.591 1.00 21.69 ? 333 HOH A O    1 
HETATM 4580 O  O    . HOH K 5 .   ? 39.194  1.275   -9.347  1.00 36.97 ? 334 HOH A O    1 
HETATM 4581 O  O    . HOH K 5 .   ? 38.398  9.914   -8.982  1.00 31.61 ? 335 HOH A O    1 
HETATM 4582 O  O    . HOH K 5 .   ? 23.120  11.525  4.494   1.00 35.40 ? 336 HOH A O    1 
HETATM 4583 O  O    . HOH K 5 .   ? 26.894  10.249  12.994  1.00 26.14 ? 337 HOH A O    1 
HETATM 4584 O  O    . HOH K 5 .   ? 45.407  14.490  13.478  1.00 37.73 ? 338 HOH A O    1 
HETATM 4585 O  O    . HOH K 5 .   ? 32.142  23.579  -14.390 1.00 32.25 ? 339 HOH A O    1 
HETATM 4586 O  O    . HOH K 5 .   ? 33.512  26.030  -14.482 1.00 40.85 ? 340 HOH A O    1 
HETATM 4587 O  O    . HOH K 5 .   ? 27.549  38.278  15.539  1.00 31.86 ? 341 HOH A O    1 
HETATM 4588 O  O    . HOH K 5 .   ? 29.992  8.923   7.520   1.00 32.36 ? 342 HOH A O    1 
HETATM 4589 O  O    . HOH K 5 .   ? 54.449  17.172  0.037   1.00 34.75 ? 343 HOH A O    1 
HETATM 4590 O  O    . HOH K 5 .   ? 21.400  34.542  8.435   1.00 35.71 ? 344 HOH A O    1 
HETATM 4591 O  O    . HOH K 5 .   ? 53.782  18.557  -4.996  1.00 34.81 ? 345 HOH A O    1 
HETATM 4592 O  O    . HOH K 5 .   ? 40.197  27.602  14.606  1.00 29.88 ? 346 HOH A O    1 
HETATM 4593 O  O    . HOH K 5 .   ? 21.030  30.879  -0.685  1.00 24.77 ? 347 HOH A O    1 
HETATM 4594 O  O    . HOH K 5 .   ? 34.131  4.751   -6.596  1.00 27.90 ? 348 HOH A O    1 
HETATM 4595 O  O    . HOH K 5 .   ? 55.112  16.024  2.706   1.00 27.52 ? 349 HOH A O    1 
HETATM 4596 O  O    . HOH K 5 .   ? 50.320  14.206  8.010   1.00 25.58 ? 350 HOH A O    1 
HETATM 4597 O  O    . HOH K 5 .   ? 34.783  34.461  12.062  1.00 33.77 ? 351 HOH A O    1 
HETATM 4598 O  O    . HOH K 5 .   ? 32.001  32.899  14.499  1.00 20.54 ? 352 HOH A O    1 
HETATM 4599 O  O    . HOH K 5 .   ? 42.463  35.865  10.423  1.00 41.09 ? 353 HOH A O    1 
HETATM 4600 O  O    . HOH K 5 .   ? 17.968  17.458  13.655  1.00 33.66 ? 354 HOH A O    1 
HETATM 4601 O  O    . HOH K 5 .   ? 35.230  20.045  15.965  1.00 30.61 ? 355 HOH A O    1 
HETATM 4602 O  O    . HOH K 5 .   ? 35.051  24.292  18.277  1.00 39.87 ? 356 HOH A O    1 
HETATM 4603 O  O    . HOH K 5 .   ? 50.758  24.613  15.247  1.00 41.60 ? 357 HOH A O    1 
HETATM 4604 O  O    . HOH K 5 .   ? 30.040  40.798  -4.614  1.00 44.00 ? 358 HOH A O    1 
HETATM 4605 O  O    . HOH K 5 .   ? 23.155  26.595  16.020  1.00 23.60 ? 359 HOH A O    1 
HETATM 4606 O  O    . HOH K 5 .   ? 45.179  25.163  -15.405 1.00 25.65 ? 360 HOH A O    1 
HETATM 4607 O  O    . HOH K 5 .   ? 38.576  37.795  0.088   1.00 36.59 ? 361 HOH A O    1 
HETATM 4608 O  O    . HOH K 5 .   ? 47.768  10.811  2.287   1.00 21.97 ? 362 HOH A O    1 
HETATM 4609 O  O    . HOH K 5 .   ? 52.281  13.887  -3.536  1.00 50.05 ? 363 HOH A O    1 
HETATM 4610 O  O    . HOH K 5 .   ? 32.049  5.711   5.607   1.00 42.16 ? 364 HOH A O    1 
HETATM 4611 O  O    . HOH K 5 .   ? 45.213  3.454   7.735   1.00 33.46 ? 365 HOH A O    1 
HETATM 4612 O  O    . HOH K 5 .   ? 24.954  22.059  -14.601 1.00 33.02 ? 366 HOH A O    1 
HETATM 4613 O  O    . HOH K 5 .   ? 47.203  10.466  -4.316  1.00 37.34 ? 367 HOH A O    1 
HETATM 4614 O  O    . HOH K 5 .   ? 30.982  4.689   0.325   1.00 50.96 ? 368 HOH A O    1 
HETATM 4615 O  O    . HOH K 5 .   ? 48.651  9.398   4.430   1.00 26.60 ? 369 HOH A O    1 
HETATM 4616 O  O    . HOH K 5 .   ? 49.362  12.733  1.377   1.00 24.91 ? 370 HOH A O    1 
HETATM 4617 O  O    . HOH K 5 .   ? 53.546  13.912  2.312   1.00 21.26 ? 371 HOH A O    1 
HETATM 4618 O  O    . HOH K 5 .   ? 47.242  9.512   6.921   1.00 30.45 ? 372 HOH A O    1 
HETATM 4619 O  O    . HOH K 5 .   ? 55.498  18.438  6.598   1.00 30.84 ? 373 HOH A O    1 
HETATM 4620 O  O    . HOH K 5 .   ? 52.400  22.676  -4.290  1.00 34.26 ? 374 HOH A O    1 
HETATM 4621 O  O    . HOH K 5 .   ? 39.973  25.808  -16.429 1.00 31.46 ? 375 HOH A O    1 
HETATM 4622 O  O    . HOH K 5 .   ? 44.669  17.017  12.276  1.00 26.77 ? 376 HOH A O    1 
HETATM 4623 O  O    . HOH K 5 .   ? 23.872  32.967  16.685  1.00 33.53 ? 377 HOH A O    1 
HETATM 4624 O  O    . HOH K 5 .   ? 39.770  4.796   12.711  1.00 39.36 ? 378 HOH A O    1 
HETATM 4625 O  O    . HOH K 5 .   ? 30.449  12.170  -12.660 1.00 35.71 ? 379 HOH A O    1 
HETATM 4626 O  O    . HOH K 5 .   ? 25.912  6.491   -8.409  1.00 30.98 ? 380 HOH A O    1 
HETATM 4627 O  O    . HOH K 5 .   ? 22.165  23.272  -8.924  1.00 43.80 ? 381 HOH A O    1 
HETATM 4628 O  O    . HOH K 5 .   ? 23.460  18.607  -6.424  1.00 25.25 ? 382 HOH A O    1 
HETATM 4629 O  O    . HOH K 5 .   ? 43.072  30.269  13.659  1.00 30.61 ? 383 HOH A O    1 
HETATM 4630 O  O    . HOH K 5 .   ? 35.211  38.330  -2.755  1.00 52.26 ? 385 HOH A O    1 
HETATM 4631 O  O    . HOH K 5 .   ? 20.792  41.433  4.262   1.00 35.87 ? 390 HOH A O    1 
HETATM 4632 O  O    . HOH K 5 .   ? 49.478  17.092  11.263  1.00 36.81 ? 391 HOH A O    1 
HETATM 4633 O  O    . HOH K 5 .   ? 19.429  32.125  -2.133  1.00 39.97 ? 395 HOH A O    1 
HETATM 4634 O  O    . HOH K 5 .   ? 30.505  9.612   -10.598 1.00 39.91 ? 398 HOH A O    1 
HETATM 4635 O  O    . HOH K 5 .   ? 24.712  25.023  -12.299 1.00 36.48 ? 400 HOH A O    1 
HETATM 4636 O  O    . HOH K 5 .   ? 27.758  39.408  7.368   1.00 33.22 ? 402 HOH A O    1 
HETATM 4637 O  O    . HOH K 5 .   ? 44.512  11.091  -10.636 1.00 20.31 ? 405 HOH A O    1 
HETATM 4638 O  O    . HOH K 5 .   ? 49.714  13.331  5.303   1.00 24.00 ? 406 HOH A O    1 
HETATM 4639 O  O    . HOH K 5 .   ? 25.515  26.668  18.827  1.00 37.21 ? 409 HOH A O    1 
HETATM 4640 O  O    . HOH K 5 .   ? 32.346  10.326  -12.409 1.00 29.49 ? 411 HOH A O    1 
HETATM 4641 O  O    . HOH K 5 .   ? 39.798  17.373  -16.143 1.00 19.09 ? 412 HOH A O    1 
HETATM 4642 O  O    . HOH K 5 .   ? 27.311  42.801  1.730   1.00 23.78 ? 413 HOH A O    1 
HETATM 4643 O  O    . HOH K 5 .   ? 42.355  29.038  -13.267 1.00 26.94 ? 414 HOH A O    1 
HETATM 4644 O  O    . HOH K 5 .   ? 54.323  22.189  -6.093  1.00 36.39 ? 416 HOH A O    1 
HETATM 4645 O  O    . HOH K 5 .   ? 39.189  24.234  -18.545 1.00 43.88 ? 418 HOH A O    1 
HETATM 4646 O  O    . HOH K 5 .   ? 38.149  21.571  -18.236 1.00 36.52 ? 419 HOH A O    1 
HETATM 4647 O  O    . HOH K 5 .   ? 50.893  14.363  3.101   1.00 24.11 ? 421 HOH A O    1 
HETATM 4648 O  O    . HOH K 5 .   ? 36.539  21.434  -20.587 1.00 36.40 ? 422 HOH A O    1 
HETATM 4649 O  O    . HOH K 5 .   ? 27.921  17.591  -14.595 1.00 31.46 ? 423 HOH A O    1 
HETATM 4650 O  O    . HOH K 5 .   ? 50.589  22.632  3.532   1.00 14.10 ? 424 HOH A O    1 
HETATM 4651 O  O    . HOH K 5 .   ? 42.347  -2.428  1.952   1.00 22.92 ? 425 HOH A O    1 
HETATM 4652 O  O    . HOH K 5 .   ? 37.680  12.159  -9.873  1.00 28.41 ? 427 HOH A O    1 
HETATM 4653 O  O    . HOH K 5 .   ? 24.634  14.180  -10.575 1.00 31.94 ? 428 HOH A O    1 
HETATM 4654 O  O    . HOH K 5 .   ? 31.540  35.810  -6.542  1.00 41.96 ? 435 HOH A O    1 
HETATM 4655 O  O    . HOH K 5 .   ? 27.237  2.585   -5.819  1.00 34.67 ? 437 HOH A O    1 
HETATM 4656 O  O    . HOH K 5 .   ? 41.885  -3.409  6.053   1.00 41.85 ? 443 HOH A O    1 
HETATM 4657 O  O    . HOH K 5 .   ? 30.461  40.774  10.587  1.00 38.14 ? 445 HOH A O    1 
HETATM 4658 O  O    . HOH K 5 .   ? 17.598  35.512  -3.309  1.00 40.80 ? 447 HOH A O    1 
HETATM 4659 O  O    . HOH K 5 .   ? 48.222  18.349  14.206  1.00 33.84 ? 450 HOH A O    1 
HETATM 4660 O  O    . HOH K 5 .   ? 34.174  1.885   0.485   1.00 33.54 ? 451 HOH A O    1 
HETATM 4661 O  O    . HOH K 5 .   ? 26.664  9.055   10.298  1.00 43.59 ? 452 HOH A O    1 
HETATM 4662 O  O    . HOH K 5 .   ? 26.020  18.719  -12.541 1.00 45.67 ? 453 HOH A O    1 
HETATM 4663 O  O    . HOH K 5 .   ? 20.931  38.226  -8.442  1.00 43.07 ? 462 HOH A O    1 
HETATM 4664 O  O    . HOH K 5 .   ? 33.324  11.661  -15.255 1.00 49.39 ? 463 HOH A O    1 
HETATM 4665 O  O    . HOH K 5 .   ? 40.427  34.631  11.292  1.00 37.09 ? 464 HOH A O    1 
HETATM 4666 O  O    . HOH K 5 .   ? 17.328  19.983  -5.819  1.00 44.52 ? 465 HOH A O    1 
HETATM 4667 O  O    . HOH K 5 .   ? 53.275  16.347  -3.457  1.00 31.77 ? 467 HOH A O    1 
HETATM 4668 O  O    . HOH K 5 .   ? 34.767  6.569   -2.522  1.00 35.80 ? 473 HOH A O    1 
HETATM 4669 O  O    . HOH K 5 .   ? 28.866  18.875  -17.030 1.00 38.79 ? 474 HOH A O    1 
HETATM 4670 O  O    . HOH K 5 .   ? 41.491  17.265  12.696  1.00 39.73 ? 478 HOH A O    1 
HETATM 4671 O  O    . HOH K 5 .   ? 45.601  7.807   7.733   1.00 33.64 ? 481 HOH A O    1 
HETATM 4672 O  O    . HOH K 5 .   ? 33.569  15.031  -17.693 1.00 30.80 ? 486 HOH A O    1 
HETATM 4673 O  O    . HOH K 5 .   ? 35.977  22.404  16.491  1.00 42.93 ? 487 HOH A O    1 
HETATM 4674 O  O    . HOH K 5 .   ? 21.884  6.620   -3.952  1.00 46.37 ? 492 HOH A O    1 
HETATM 4675 O  O    . HOH K 5 .   ? 50.228  19.865  15.158  1.00 41.50 ? 495 HOH A O    1 
HETATM 4676 O  O    . HOH K 5 .   ? 24.330  12.481  11.579  1.00 32.04 ? 499 HOH A O    1 
HETATM 4677 O  O    . HOH K 5 .   ? 36.818  9.834   -12.616 1.00 38.79 ? 500 HOH A O    1 
HETATM 4678 O  O    . HOH K 5 .   ? 18.134  24.372  8.272   1.00 41.34 ? 503 HOH A O    1 
HETATM 4679 O  O    . HOH K 5 .   ? 33.273  7.104   -9.396  1.00 46.16 ? 507 HOH A O    1 
HETATM 4680 O  O    . HOH K 5 .   ? 14.427  24.090  1.284   1.00 30.12 ? 508 HOH A O    1 
HETATM 4681 O  O    . HOH K 5 .   ? 19.089  10.989  1.240   1.00 45.86 ? 512 HOH A O    1 
HETATM 4682 O  O    . HOH K 5 .   ? 27.500  9.247   7.849   1.00 38.93 ? 515 HOH A O    1 
HETATM 4683 O  O    . HOH K 5 .   ? 36.095  12.998  -18.588 1.00 35.68 ? 517 HOH A O    1 
HETATM 4684 O  O    . HOH K 5 .   ? 25.677  9.996   0.161   1.00 48.91 ? 529 HOH A O    1 
HETATM 4685 O  O    . HOH K 5 .   ? 20.683  31.328  -7.960  1.00 36.95 ? 533 HOH A O    1 
HETATM 4686 O  O    . HOH K 5 .   ? 29.258  46.959  -4.290  1.00 31.86 ? 535 HOH A O    1 
HETATM 4687 O  O    . HOH K 5 .   ? 38.419  29.437  14.024  1.00 37.35 ? 538 HOH A O    1 
HETATM 4688 O  O    . HOH K 5 .   ? 16.146  29.265  -2.527  1.00 38.85 ? 541 HOH A O    1 
HETATM 4689 O  O    . HOH K 5 .   ? 18.669  40.205  0.439   1.00 43.00 ? 543 HOH A O    1 
HETATM 4690 O  O    . HOH K 5 .   ? 29.678  6.706   8.992   1.00 37.67 ? 544 HOH A O    1 
HETATM 4691 O  O    . HOH K 5 .   ? 19.146  13.963  0.822   1.00 39.49 ? 545 HOH A O    1 
HETATM 4692 O  O    . HOH K 5 .   ? 46.220  -1.894  6.542   1.00 27.93 ? 547 HOH A O    1 
HETATM 4693 O  O    . HOH K 5 .   ? 13.849  31.933  0.068   1.00 37.64 ? 549 HOH A O    1 
HETATM 4694 O  O    . HOH K 5 .   ? 24.179  34.197  -12.549 1.00 42.89 ? 551 HOH A O    1 
HETATM 4695 O  O    . HOH K 5 .   ? 42.788  12.126  20.112  1.00 45.16 ? 552 HOH A O    1 
HETATM 4696 O  O    . HOH K 5 .   ? 29.414  42.050  -6.655  1.00 39.18 ? 557 HOH A O    1 
HETATM 4697 O  O    . HOH K 5 .   ? 19.379  18.854  -6.783  1.00 38.08 ? 563 HOH A O    1 
HETATM 4698 O  O    . HOH K 5 .   ? 48.080  -0.001  6.527   1.00 24.59 ? 567 HOH A O    1 
HETATM 4699 O  O    . HOH K 5 .   ? 18.329  30.619  -3.697  1.00 42.12 ? 568 HOH A O    1 
HETATM 4700 O  O    . HOH K 5 .   ? 47.125  12.523  -6.308  1.00 34.47 ? 570 HOH A O    1 
HETATM 4701 O  O    . HOH K 5 .   ? 50.593  25.605  9.581   1.00 34.79 ? 573 HOH A O    1 
HETATM 4702 O  O    . HOH K 5 .   ? 16.298  18.170  0.176   1.00 32.55 ? 574 HOH A O    1 
HETATM 4703 O  O    . HOH K 5 .   ? 18.428  12.560  7.246   1.00 50.62 ? 581 HOH A O    1 
HETATM 4704 O  O    . HOH K 5 .   ? 24.186  7.670   -0.787  1.00 45.57 ? 584 HOH A O    1 
HETATM 4705 O  O    . HOH K 5 .   ? 15.322  27.735  2.948   1.00 29.51 ? 590 HOH A O    1 
HETATM 4706 O  O    . HOH K 5 .   ? 15.394  11.842  10.772  1.00 41.80 ? 592 HOH A O    1 
HETATM 4707 O  O    . HOH K 5 .   ? 42.787  12.108  16.220  1.00 42.04 ? 594 HOH A O    1 
HETATM 4708 O  O    . HOH K 5 .   ? 50.096  27.936  7.868   1.00 31.48 ? 599 HOH A O    1 
HETATM 4709 O  O    . HOH K 5 .   ? 32.622  23.481  18.847  1.00 43.62 ? 600 HOH A O    1 
HETATM 4710 O  O    . HOH K 5 .   ? 20.537  15.648  12.515  1.00 41.29 ? 601 HOH A O    1 
HETATM 4711 O  O    . HOH K 5 .   ? 32.415  3.157   2.238   1.00 50.11 ? 602 HOH A O    1 
HETATM 4712 O  O    . HOH K 5 .   ? 27.249  9.983   3.492   1.00 48.44 ? 604 HOH A O    1 
HETATM 4713 O  O    . HOH K 5 .   ? 53.686  22.926  8.645   1.00 30.22 ? 605 HOH A O    1 
HETATM 4714 O  O    . HOH K 5 .   ? 45.013  10.486  11.203  1.00 38.83 ? 607 HOH A O    1 
HETATM 4715 O  O    . HOH K 5 .   ? 26.827  30.329  -14.317 1.00 43.78 ? 613 HOH A O    1 
HETATM 4716 O  O    . HOH K 5 .   ? 31.256  42.939  6.693   1.00 43.00 ? 618 HOH A O    1 
HETATM 4717 O  O    . HOH K 5 .   ? 57.339  20.378  5.694   1.00 40.53 ? 624 HOH A O    1 
HETATM 4718 O  O    . HOH K 5 .   ? 34.702  44.101  11.010  1.00 36.24 ? 625 HOH A O    1 
HETATM 4719 O  O    . HOH K 5 .   ? 42.951  3.262   -4.984  1.00 44.09 ? 628 HOH A O    1 
HETATM 4720 O  O    . HOH K 5 .   ? 19.949  27.199  13.661  1.00 41.14 ? 639 HOH A O    1 
HETATM 4721 O  O    . HOH K 5 .   ? 29.586  38.227  -8.275  1.00 61.38 ? 640 HOH A O    1 
HETATM 4722 O  O    . HOH K 5 .   ? 37.076  44.719  3.817   1.00 47.32 ? 643 HOH A O    1 
HETATM 4723 O  O    . HOH L 5 .   ? 26.104  20.905  21.646  1.00 19.66 ? 11  HOH B O    1 
HETATM 4724 O  O    . HOH L 5 .   ? 17.541  13.343  20.681  1.00 27.96 ? 12  HOH B O    1 
HETATM 4725 O  O    . HOH L 5 .   ? 32.907  19.129  17.220  1.00 24.05 ? 13  HOH B O    1 
HETATM 4726 O  O    . HOH L 5 .   ? 28.950  5.701   45.405  1.00 29.36 ? 17  HOH B O    1 
HETATM 4727 O  O    . HOH L 5 .   ? 36.920  4.274   17.144  1.00 33.58 ? 19  HOH B O    1 
HETATM 4728 O  O    . HOH L 5 .   ? 32.529  20.846  19.475  1.00 25.85 ? 20  HOH B O    1 
HETATM 4729 O  O    . HOH L 5 .   ? 14.874  8.534   44.732  1.00 21.84 ? 21  HOH B O    1 
HETATM 4730 O  O    . HOH L 5 .   ? 23.152  25.480  26.191  1.00 22.49 ? 28  HOH B O    1 
HETATM 4731 O  O    . HOH L 5 .   ? 39.247  10.930  13.370  1.00 22.25 ? 29  HOH B O    1 
HETATM 4732 O  O    . HOH L 5 .   ? 30.657  20.339  45.087  1.00 37.07 ? 31  HOH B O    1 
HETATM 4733 O  O    . HOH L 5 .   ? 43.149  9.834   28.004  1.00 25.42 ? 33  HOH B O    1 
HETATM 4734 O  O    . HOH L 5 .   ? 19.426  25.865  33.055  1.00 28.47 ? 41  HOH B O    1 
HETATM 4735 O  O    . HOH L 5 .   ? 21.348  22.359  32.127  1.00 25.06 ? 43  HOH B O    1 
HETATM 4736 O  O    . HOH L 5 .   ? 18.465  19.326  21.648  1.00 30.51 ? 44  HOH B O    1 
HETATM 4737 O  O    . HOH L 5 .   ? 35.114  20.744  39.835  1.00 28.37 ? 45  HOH B O    1 
HETATM 4738 O  O    . HOH L 5 .   ? 15.408  6.907   46.859  1.00 39.14 ? 48  HOH B O    1 
HETATM 4739 O  O    . HOH L 5 .   ? 27.089  14.491  45.913  1.00 22.76 ? 49  HOH B O    1 
HETATM 4740 O  O    . HOH L 5 .   ? 22.226  3.295   45.851  1.00 31.47 ? 56  HOH B O    1 
HETATM 4741 O  O    . HOH L 5 .   ? 23.147  15.431  13.240  1.00 29.11 ? 58  HOH B O    1 
HETATM 4742 O  O    . HOH L 5 .   ? 19.340  0.336   31.258  1.00 23.51 ? 64  HOH B O    1 
HETATM 4743 O  O    . HOH L 5 .   ? 13.776  14.259  33.679  1.00 24.06 ? 66  HOH B O    1 
HETATM 4744 O  O    . HOH L 5 .   ? 31.973  26.604  28.644  1.00 27.20 ? 75  HOH B O    1 
HETATM 4745 O  O    . HOH L 5 .   ? 22.628  18.351  33.826  1.00 26.92 ? 76  HOH B O    1 
HETATM 4746 O  O    . HOH L 5 .   ? 41.123  6.871   18.811  1.00 25.38 ? 79  HOH B O    1 
HETATM 4747 O  O    . HOH L 5 .   ? 19.277  17.030  20.239  1.00 26.89 ? 91  HOH B O    1 
HETATM 4748 O  O    . HOH L 5 .   ? 27.594  13.118  48.403  1.00 33.19 ? 92  HOH B O    1 
HETATM 4749 O  O    . HOH L 5 .   ? 29.077  23.389  22.800  1.00 32.12 ? 94  HOH B O    1 
HETATM 4750 O  O    . HOH L 5 .   ? 12.174  16.637  40.312  1.00 23.57 ? 95  HOH B O    1 
HETATM 4751 O  O    . HOH L 5 .   ? 36.989  25.035  32.814  1.00 21.76 ? 100 HOH B O    1 
HETATM 4752 O  O    . HOH L 5 .   ? 17.335  27.135  26.976  1.00 24.20 ? 104 HOH B O    1 
HETATM 4753 O  O    . HOH L 5 .   ? 44.444  10.832  25.658  1.00 25.46 ? 106 HOH B O    1 
HETATM 4754 O  O    . HOH L 5 .   ? 32.815  2.195   18.589  1.00 30.96 ? 113 HOH B O    1 
HETATM 4755 O  O    . HOH L 5 .   ? 15.422  20.358  35.191  1.00 29.60 ? 114 HOH B O    1 
HETATM 4756 O  O    . HOH L 5 .   ? 10.481  11.403  33.673  1.00 24.79 ? 115 HOH B O    1 
HETATM 4757 O  O    . HOH L 5 .   ? 21.478  6.106   48.602  1.00 30.32 ? 117 HOH B O    1 
HETATM 4758 O  O    . HOH L 5 .   ? 19.468  15.835  38.028  1.00 23.98 ? 308 HOH B O    1 
HETATM 4759 O  O    . HOH L 5 .   ? 17.065  1.199   30.179  1.00 31.70 ? 309 HOH B O    1 
HETATM 4760 O  O    . HOH L 5 .   ? 18.226  19.130  38.016  1.00 36.60 ? 310 HOH B O    1 
HETATM 4761 O  O    . HOH L 5 .   ? 34.471  18.194  20.670  1.00 31.39 ? 313 HOH B O    1 
HETATM 4762 O  O    . HOH L 5 .   ? 32.656  2.582   43.432  1.00 27.32 ? 314 HOH B O    1 
HETATM 4763 O  O    . HOH L 5 .   ? 13.876  21.364  33.171  1.00 29.84 ? 315 HOH B O    1 
HETATM 4764 O  O    . HOH L 5 .   ? 29.912  29.166  30.505  1.00 32.54 ? 316 HOH B O    1 
HETATM 4765 O  O    . HOH L 5 .   ? 37.962  -3.076  26.212  1.00 27.90 ? 317 HOH B O    1 
HETATM 4766 O  O    . HOH L 5 .   ? 10.852  20.598  30.218  1.00 19.98 ? 318 HOH B O    1 
HETATM 4767 O  O    . HOH L 5 .   ? 31.823  30.845  29.587  1.00 32.36 ? 320 HOH B O    1 
HETATM 4768 O  O    . HOH L 5 .   ? 36.597  9.850   43.894  1.00 27.83 ? 321 HOH B O    1 
HETATM 4769 O  O    . HOH L 5 .   ? 18.393  23.188  37.777  1.00 35.70 ? 322 HOH B O    1 
HETATM 4770 O  O    . HOH L 5 .   ? 39.934  30.176  35.497  1.00 38.95 ? 323 HOH B O    1 
HETATM 4771 O  O    . HOH L 5 .   ? 12.083  4.133   34.464  1.00 47.68 ? 324 HOH B O    1 
HETATM 4772 O  O    . HOH L 5 .   ? 16.111  20.231  21.180  1.00 34.42 ? 325 HOH B O    1 
HETATM 4773 O  O    . HOH L 5 .   ? 41.107  13.270  22.781  1.00 36.32 ? 326 HOH B O    1 
HETATM 4774 O  O    . HOH L 5 .   ? 27.175  29.326  33.799  1.00 25.99 ? 327 HOH B O    1 
HETATM 4775 O  O    . HOH L 5 .   ? 26.746  25.047  22.334  1.00 35.23 ? 328 HOH B O    1 
HETATM 4776 O  O    . HOH L 5 .   ? 45.603  -1.501  35.798  1.00 24.10 ? 329 HOH B O    1 
HETATM 4777 O  O    . HOH L 5 .   ? 21.852  26.366  21.723  1.00 55.32 ? 330 HOH B O    1 
HETATM 4778 O  O    . HOH L 5 .   ? 21.495  12.132  15.045  1.00 44.62 ? 331 HOH B O    1 
HETATM 4779 O  O    . HOH L 5 .   ? 14.058  11.434  36.985  1.00 33.75 ? 332 HOH B O    1 
HETATM 4780 O  O    . HOH L 5 .   ? 46.640  -1.073  38.558  1.00 35.92 ? 333 HOH B O    1 
HETATM 4781 O  O    . HOH L 5 .   ? 7.376   17.778  31.992  1.00 23.74 ? 334 HOH B O    1 
HETATM 4782 O  O    . HOH L 5 .   ? 35.061  0.190   41.545  1.00 29.14 ? 335 HOH B O    1 
HETATM 4783 O  O    . HOH L 5 .   ? 28.485  27.730  28.998  1.00 35.96 ? 336 HOH B O    1 
HETATM 4784 O  O    . HOH L 5 .   ? 17.798  23.703  19.002  1.00 32.10 ? 337 HOH B O    1 
HETATM 4785 O  O    . HOH L 5 .   ? 25.247  11.674  49.289  1.00 26.15 ? 338 HOH B O    1 
HETATM 4786 O  O    . HOH L 5 .   ? 20.064  27.360  26.896  1.00 31.44 ? 339 HOH B O    1 
HETATM 4787 O  O    . HOH L 5 .   ? 14.137  25.435  30.856  1.00 35.95 ? 340 HOH B O    1 
HETATM 4788 O  O    . HOH L 5 .   ? 33.682  -6.935  22.528  1.00 32.57 ? 341 HOH B O    1 
HETATM 4789 O  O    . HOH L 5 .   ? 42.250  -1.316  24.852  1.00 34.37 ? 342 HOH B O    1 
HETATM 4790 O  O    . HOH L 5 .   ? 35.976  6.605   44.917  1.00 37.79 ? 343 HOH B O    1 
HETATM 4791 O  O    . HOH L 5 .   ? 41.141  7.248   35.359  1.00 30.33 ? 344 HOH B O    1 
HETATM 4792 O  O    . HOH L 5 .   ? 27.867  7.887   47.166  1.00 42.36 ? 345 HOH B O    1 
HETATM 4793 O  O    . HOH L 5 .   ? 41.755  11.844  13.525  1.00 42.31 ? 346 HOH B O    1 
HETATM 4794 O  O    . HOH L 5 .   ? 9.325   19.383  38.370  1.00 20.68 ? 347 HOH B O    1 
HETATM 4795 O  O    . HOH L 5 .   ? 25.690  8.880   49.623  1.00 34.12 ? 348 HOH B O    1 
HETATM 4796 O  O    . HOH L 5 .   ? 29.876  -8.396  40.861  1.00 36.88 ? 349 HOH B O    1 
HETATM 4797 O  O    . HOH L 5 .   ? 21.967  24.938  32.796  1.00 27.34 ? 350 HOH B O    1 
HETATM 4798 O  O    . HOH L 5 .   ? 32.513  2.533   46.217  1.00 31.60 ? 351 HOH B O    1 
HETATM 4799 O  O    . HOH L 5 .   ? 21.311  27.517  29.328  1.00 38.12 ? 352 HOH B O    1 
HETATM 4800 O  O    . HOH L 5 .   ? 43.851  18.083  32.125  1.00 49.38 ? 353 HOH B O    1 
HETATM 4801 O  O    . HOH L 5 .   ? 39.401  5.809   16.786  1.00 32.35 ? 354 HOH B O    1 
HETATM 4802 O  O    . HOH L 5 .   ? 26.834  5.835   15.326  1.00 34.74 ? 355 HOH B O    1 
HETATM 4803 O  O    . HOH L 5 .   ? 32.825  24.510  37.465  1.00 26.24 ? 356 HOH B O    1 
HETATM 4804 O  O    . HOH L 5 .   ? 31.524  0.304   42.532  1.00 36.63 ? 357 HOH B O    1 
HETATM 4805 O  O    . HOH L 5 .   ? 14.931  11.525  48.313  1.00 25.77 ? 358 HOH B O    1 
HETATM 4806 O  O    . HOH L 5 .   ? 8.818   23.335  23.812  1.00 29.17 ? 359 HOH B O    1 
HETATM 4807 O  O    . HOH L 5 .   ? 30.704  25.153  38.988  1.00 36.34 ? 360 HOH B O    1 
HETATM 4808 O  O    . HOH L 5 .   ? 11.512  24.895  30.267  1.00 30.67 ? 361 HOH B O    1 
HETATM 4809 O  O    . HOH L 5 .   ? 38.438  29.371  32.256  1.00 30.52 ? 362 HOH B O    1 
HETATM 4810 O  O    . HOH L 5 .   ? 40.107  7.723   13.183  1.00 29.77 ? 363 HOH B O    1 
HETATM 4811 O  O    . HOH L 5 .   ? 16.837  27.979  24.479  1.00 38.40 ? 364 HOH B O    1 
HETATM 4812 O  O    . HOH L 5 .   ? 40.840  6.888   40.814  1.00 38.50 ? 365 HOH B O    1 
HETATM 4813 O  O    . HOH L 5 .   ? 18.619  2.438   42.693  1.00 30.01 ? 366 HOH B O    1 
HETATM 4814 O  O    . HOH L 5 .   ? 30.240  25.691  27.050  1.00 35.95 ? 367 HOH B O    1 
HETATM 4815 O  O    . HOH L 5 .   ? 18.258  4.944   44.541  1.00 33.67 ? 368 HOH B O    1 
HETATM 4816 O  O    . HOH L 5 .   ? 46.532  -3.997  35.281  1.00 32.42 ? 369 HOH B O    1 
HETATM 4817 O  O    . HOH L 5 .   ? 31.499  4.820   9.915   1.00 31.95 ? 370 HOH B O    1 
HETATM 4818 O  O    . HOH L 5 .   ? 26.723  -7.281  40.644  1.00 52.51 ? 371 HOH B O    1 
HETATM 4819 O  O    . HOH L 5 .   ? 12.383  12.803  35.476  1.00 28.79 ? 372 HOH B O    1 
HETATM 4820 O  O    . HOH L 5 .   ? 24.756  26.468  23.665  1.00 38.92 ? 373 HOH B O    1 
HETATM 4821 O  O    . HOH L 5 .   ? 31.196  5.107   21.196  1.00 27.07 ? 374 HOH B O    1 
HETATM 4822 O  O    . HOH L 5 .   ? 31.640  -9.013  27.921  1.00 41.20 ? 377 HOH B O    1 
HETATM 4823 O  O    . HOH L 5 .   ? 7.764   6.108   25.008  1.00 35.18 ? 378 HOH B O    1 
HETATM 4824 O  O    . HOH L 5 .   ? 11.904  3.439   41.375  1.00 30.64 ? 379 HOH B O    1 
HETATM 4825 O  O    . HOH L 5 .   ? 14.469  18.487  39.334  1.00 41.42 ? 380 HOH B O    1 
HETATM 4826 O  O    . HOH L 5 .   ? 19.449  19.045  18.289  1.00 30.69 ? 381 HOH B O    1 
HETATM 4827 O  O    . HOH L 5 .   ? 38.763  23.169  36.001  1.00 30.51 ? 382 HOH B O    1 
HETATM 4828 O  O    . HOH L 5 .   ? 45.951  0.041   24.955  1.00 30.35 ? 383 HOH B O    1 
HETATM 4829 O  O    . HOH L 5 .   ? 41.528  16.150  30.158  1.00 29.37 ? 384 HOH B O    1 
HETATM 4830 O  O    . HOH L 5 .   ? 24.216  13.044  13.859  1.00 28.25 ? 386 HOH B O    1 
HETATM 4831 O  O    . HOH L 5 .   ? 25.456  -1.623  40.622  1.00 35.37 ? 387 HOH B O    1 
HETATM 4832 O  O    . HOH L 5 .   ? 29.889  23.511  40.872  1.00 36.51 ? 389 HOH B O    1 
HETATM 4833 O  O    . HOH L 5 .   ? 22.489  24.881  19.600  1.00 27.69 ? 392 HOH B O    1 
HETATM 4834 O  O    . HOH L 5 .   ? 19.573  13.094  50.111  1.00 28.86 ? 394 HOH B O    1 
HETATM 4835 O  O    . HOH L 5 .   ? 39.779  9.707   39.363  1.00 33.96 ? 395 HOH B O    1 
HETATM 4836 O  O    . HOH L 5 .   ? 19.666  27.942  31.462  1.00 40.47 ? 396 HOH B O    1 
HETATM 4837 O  O    . HOH L 5 .   ? 16.193  17.145  37.666  1.00 36.86 ? 397 HOH B O    1 
HETATM 4838 O  O    . HOH L 5 .   ? 31.568  25.540  17.424  1.00 32.37 ? 398 HOH B O    1 
HETATM 4839 O  O    . HOH L 5 .   ? 43.028  12.840  40.434  1.00 29.76 ? 399 HOH B O    1 
HETATM 4840 O  O    . HOH L 5 .   ? 11.757  13.678  39.908  1.00 31.00 ? 401 HOH B O    1 
HETATM 4841 O  O    . HOH L 5 .   ? 20.774  1.081   42.121  1.00 46.29 ? 403 HOH B O    1 
HETATM 4842 O  O    . HOH L 5 .   ? 39.089  26.550  32.913  1.00 27.77 ? 415 HOH B O    1 
HETATM 4843 O  O    . HOH L 5 .   ? 37.472  24.648  37.908  1.00 36.20 ? 417 HOH B O    1 
HETATM 4844 O  O    . HOH L 5 .   ? 34.965  23.600  38.792  1.00 34.87 ? 420 HOH B O    1 
HETATM 4845 O  O    . HOH L 5 .   ? 33.886  31.699  31.114  1.00 30.98 ? 426 HOH B O    1 
HETATM 4846 O  O    . HOH L 5 .   ? 12.196  7.871   45.169  1.00 28.08 ? 427 HOH B O    1 
HETATM 4847 O  O    . HOH L 5 .   ? 11.664  11.066  44.728  1.00 24.80 ? 428 HOH B O    1 
HETATM 4848 O  O    . HOH L 5 .   ? 20.851  -1.439  29.605  1.00 30.37 ? 429 HOH B O    1 
HETATM 4849 O  O    . HOH L 5 .   ? 26.816  -4.748  39.768  1.00 33.25 ? 430 HOH B O    1 
HETATM 4850 O  O    . HOH L 5 .   ? 34.258  -4.553  29.390  1.00 26.76 ? 431 HOH B O    1 
HETATM 4851 O  O    . HOH L 5 .   ? 24.456  19.306  48.864  1.00 25.24 ? 432 HOH B O    1 
HETATM 4852 O  O    . HOH L 5 .   ? 9.601   16.749  24.491  1.00 39.63 ? 433 HOH B O    1 
HETATM 4853 O  O    . HOH L 5 .   ? 39.119  -0.890  43.351  1.00 24.65 ? 434 HOH B O    1 
HETATM 4854 O  O    . HOH L 5 .   ? 41.066  -1.678  41.750  1.00 28.26 ? 435 HOH B O    1 
HETATM 4855 O  O    . HOH L 5 .   ? 43.541  -1.852  42.434  1.00 27.72 ? 436 HOH B O    1 
HETATM 4856 O  O    . HOH L 5 .   ? 45.800  -3.490  44.833  1.00 34.52 ? 437 HOH B O    1 
HETATM 4857 O  O    . HOH L 5 .   ? 11.368  14.523  25.646  1.00 37.68 ? 438 HOH B O    1 
HETATM 4858 O  O    . HOH L 5 .   ? 36.566  -8.996  39.250  1.00 33.59 ? 439 HOH B O    1 
HETATM 4859 O  O    . HOH L 5 .   ? 30.845  -8.064  34.618  1.00 29.51 ? 440 HOH B O    1 
HETATM 4860 O  O    . HOH L 5 .   ? 23.370  26.051  34.748  1.00 25.73 ? 441 HOH B O    1 
HETATM 4861 O  O    . HOH L 5 .   ? 9.032   12.044  29.444  1.00 34.51 ? 442 HOH B O    1 
HETATM 4862 O  O    . HOH L 5 .   ? 28.524  15.643  48.873  1.00 40.62 ? 443 HOH B O    1 
HETATM 4863 O  O    . HOH L 5 .   ? 49.188  5.969   25.003  1.00 34.86 ? 444 HOH B O    1 
HETATM 4864 O  O    . HOH L 5 .   ? 25.837  13.100  51.661  1.00 30.59 ? 446 HOH B O    1 
HETATM 4865 O  O    . HOH L 5 .   ? 26.354  9.651   53.446  1.00 36.22 ? 447 HOH B O    1 
HETATM 4866 O  O    . HOH L 5 .   ? 38.029  -5.828  28.371  1.00 31.51 ? 448 HOH B O    1 
HETATM 4867 O  O    . HOH L 5 .   ? 15.280  8.680   49.339  1.00 38.49 ? 449 HOH B O    1 
HETATM 4868 O  O    . HOH L 5 .   ? 21.027  25.256  42.430  1.00 20.67 ? 450 HOH B O    1 
HETATM 4869 O  O    . HOH L 5 .   ? 16.855  15.842  19.961  1.00 42.20 ? 451 HOH B O    1 
HETATM 4870 O  O    . HOH L 5 .   ? 17.734  20.992  19.130  1.00 34.26 ? 452 HOH B O    1 
HETATM 4871 O  O    . HOH L 5 .   ? 32.956  21.938  42.551  1.00 50.56 ? 454 HOH B O    1 
HETATM 4872 O  O    . HOH L 5 .   ? 46.730  3.755   38.204  1.00 38.86 ? 455 HOH B O    1 
HETATM 4873 O  O    . HOH L 5 .   ? 25.219  9.524   14.650  1.00 33.11 ? 458 HOH B O    1 
HETATM 4874 O  O    . HOH L 5 .   ? 20.602  13.632  18.767  1.00 34.19 ? 459 HOH B O    1 
HETATM 4875 O  O    . HOH L 5 .   ? 36.025  12.529  44.860  1.00 43.89 ? 466 HOH B O    1 
HETATM 4876 O  O    . HOH L 5 .   ? 21.080  2.987   18.452  1.00 33.82 ? 468 HOH B O    1 
HETATM 4877 O  O    . HOH L 5 .   ? 32.732  -5.158  43.527  1.00 36.05 ? 469 HOH B O    1 
HETATM 4878 O  O    . HOH L 5 .   ? 33.861  15.835  44.857  1.00 44.49 ? 482 HOH B O    1 
HETATM 4879 O  O    . HOH L 5 .   ? 27.546  27.442  20.800  1.00 43.80 ? 483 HOH B O    1 
HETATM 4880 O  O    . HOH L 5 .   ? 44.496  4.443   39.773  1.00 36.84 ? 485 HOH B O    1 
HETATM 4881 O  O    . HOH L 5 .   ? 41.105  9.417   15.927  1.00 39.07 ? 489 HOH B O    1 
HETATM 4882 O  O    . HOH L 5 .   ? 48.272  12.801  32.510  1.00 35.68 ? 491 HOH B O    1 
HETATM 4883 O  O    . HOH L 5 .   ? 26.060  1.110   47.740  1.00 45.37 ? 493 HOH B O    1 
HETATM 4884 O  O    . HOH L 5 .   ? 18.031  -1.851  32.612  1.00 33.21 ? 494 HOH B O    1 
HETATM 4885 O  O    . HOH L 5 .   ? 44.776  14.327  30.183  1.00 45.71 ? 496 HOH B O    1 
HETATM 4886 O  O    . HOH L 5 .   ? 24.406  -5.531  32.593  1.00 53.65 ? 497 HOH B O    1 
HETATM 4887 O  O    . HOH L 5 .   ? 46.372  13.137  25.552  1.00 59.91 ? 502 HOH B O    1 
HETATM 4888 O  O    . HOH L 5 .   ? 39.137  21.068  37.772  1.00 37.46 ? 505 HOH B O    1 
HETATM 4889 O  O    . HOH L 5 .   ? 39.092  14.028  22.432  1.00 36.02 ? 506 HOH B O    1 
HETATM 4890 O  O    . HOH L 5 .   ? 23.399  1.570   47.749  1.00 42.66 ? 509 HOH B O    1 
HETATM 4891 O  O    . HOH L 5 .   ? 24.905  -3.786  44.128  1.00 57.85 ? 510 HOH B O    1 
HETATM 4892 O  O    . HOH L 5 .   ? 10.533  20.349  34.874  1.00 38.53 ? 511 HOH B O    1 
HETATM 4893 O  O    . HOH L 5 .   ? 30.334  3.552   11.824  1.00 36.65 ? 514 HOH B O    1 
HETATM 4894 O  O    . HOH L 5 .   ? 8.933   14.136  27.734  1.00 43.63 ? 519 HOH B O    1 
HETATM 4895 O  O    . HOH L 5 .   ? 42.178  20.587  31.133  1.00 33.66 ? 520 HOH B O    1 
HETATM 4896 O  O    . HOH L 5 .   ? 44.681  11.651  29.770  1.00 43.97 ? 524 HOH B O    1 
HETATM 4897 O  O    . HOH L 5 .   ? 37.595  19.913  39.481  1.00 40.53 ? 525 HOH B O    1 
HETATM 4898 O  O    . HOH L 5 .   ? 8.481   18.273  35.880  1.00 36.54 ? 526 HOH B O    1 
HETATM 4899 O  O    . HOH L 5 .   ? 6.428   17.506  34.525  1.00 24.12 ? 527 HOH B O    1 
HETATM 4900 O  O    . HOH L 5 .   ? 11.277  5.760   32.506  1.00 37.39 ? 530 HOH B O    1 
HETATM 4901 O  O    . HOH L 5 .   ? 9.801   10.647  22.903  1.00 47.49 ? 536 HOH B O    1 
HETATM 4902 O  O    . HOH L 5 .   ? 23.152  8.455   49.608  1.00 38.11 ? 537 HOH B O    1 
HETATM 4903 O  O    . HOH L 5 .   ? 12.215  20.001  37.492  1.00 33.10 ? 539 HOH B O    1 
HETATM 4904 O  O    . HOH L 5 .   ? 12.879  9.489   23.114  1.00 35.03 ? 542 HOH B O    1 
HETATM 4905 O  O    . HOH L 5 .   ? 17.657  17.092  39.322  1.00 39.45 ? 548 HOH B O    1 
HETATM 4906 O  O    . HOH L 5 .   ? 26.025  -1.424  16.156  1.00 40.75 ? 550 HOH B O    1 
HETATM 4907 O  O    . HOH L 5 .   ? 36.204  2.201   16.658  1.00 52.99 ? 555 HOH B O    1 
HETATM 4908 O  O    . HOH L 5 .   ? 38.485  -9.700  37.159  1.00 39.81 ? 556 HOH B O    1 
HETATM 4909 O  O    . HOH L 5 .   ? 13.021  13.966  27.668  1.00 34.66 ? 558 HOH B O    1 
HETATM 4910 O  O    . HOH L 5 .   ? 20.603  -0.294  20.135  1.00 41.89 ? 561 HOH B O    1 
HETATM 4911 O  O    . HOH L 5 .   ? 34.778  -7.244  30.262  1.00 38.06 ? 562 HOH B O    1 
HETATM 4912 O  O    . HOH L 5 .   ? 32.398  -8.128  30.257  1.00 37.85 ? 569 HOH B O    1 
HETATM 4913 O  O    . HOH L 5 .   ? 46.292  0.502   33.718  1.00 34.37 ? 571 HOH B O    1 
HETATM 4914 O  O    . HOH L 5 .   ? 26.448  7.708   51.756  1.00 46.02 ? 572 HOH B O    1 
HETATM 4915 O  O    . HOH L 5 .   ? 9.182   19.975  22.879  1.00 46.77 ? 579 HOH B O    1 
HETATM 4916 O  O    . HOH L 5 .   ? 10.885  6.445   35.010  1.00 40.30 ? 580 HOH B O    1 
HETATM 4917 O  O    . HOH L 5 .   ? 25.067  -0.259  42.941  1.00 45.85 ? 582 HOH B O    1 
HETATM 4918 O  O    . HOH L 5 .   ? 9.996   4.029   26.505  1.00 36.56 ? 585 HOH B O    1 
HETATM 4919 O  O    . HOH L 5 .   ? 8.319   8.350   23.190  1.00 35.97 ? 586 HOH B O    1 
HETATM 4920 O  O    . HOH L 5 .   ? 32.997  28.978  27.866  1.00 40.41 ? 587 HOH B O    1 
HETATM 4921 O  O    . HOH L 5 .   ? 8.508   10.676  35.312  1.00 39.73 ? 588 HOH B O    1 
HETATM 4922 O  O    . HOH L 5 .   ? 35.521  21.476  22.467  1.00 42.62 ? 593 HOH B O    1 
HETATM 4923 O  O    . HOH L 5 .   ? 28.726  -1.497  15.787  1.00 48.40 ? 595 HOH B O    1 
HETATM 4924 O  O    . HOH L 5 .   ? 23.049  1.359   43.464  1.00 43.64 ? 596 HOH B O    1 
HETATM 4925 O  O    . HOH L 5 .   ? 9.101   7.212   20.693  1.00 44.85 ? 598 HOH B O    1 
HETATM 4926 O  O    . HOH L 5 .   ? 14.682  21.200  37.621  1.00 50.70 ? 612 HOH B O    1 
HETATM 4927 O  O    . HOH L 5 .   ? 41.309  23.488  35.047  1.00 36.27 ? 615 HOH B O    1 
HETATM 4928 O  O    . HOH L 5 .   ? 41.015  25.953  31.079  1.00 35.24 ? 616 HOH B O    1 
HETATM 4929 O  O    . HOH L 5 .   ? 30.546  27.258  21.835  1.00 49.82 ? 617 HOH B O    1 
HETATM 4930 O  O    . HOH L 5 .   ? 39.170  9.368   43.691  1.00 39.58 ? 619 HOH B O    1 
HETATM 4931 O  O    . HOH L 5 .   ? 30.645  33.176  28.485  1.00 37.96 ? 621 HOH B O    1 
HETATM 4932 O  O    . HOH L 5 .   ? 45.092  5.783   42.516  1.00 47.36 ? 622 HOH B O    1 
HETATM 4933 O  O    . HOH L 5 .   ? 21.772  10.410  50.915  1.00 43.73 ? 626 HOH B O    1 
HETATM 4934 O  O    . HOH L 5 .   ? 23.599  29.025  31.206  1.00 42.54 ? 627 HOH B O    1 
HETATM 4935 O  O    . HOH L 5 .   ? 13.297  24.010  36.900  1.00 47.51 ? 629 HOH B O    1 
HETATM 4936 O  O    . HOH L 5 .   ? 10.930  23.259  36.482  1.00 35.73 ? 630 HOH B O    1 
HETATM 4937 O  O    . HOH L 5 .   ? 15.552  2.567   47.557  1.00 49.56 ? 631 HOH B O    1 
HETATM 4938 O  O    . HOH L 5 .   ? 12.590  5.187   47.282  1.00 51.43 ? 632 HOH B O    1 
HETATM 4939 O  O    . HOH L 5 .   ? 21.493  -0.680  47.389  1.00 53.94 ? 633 HOH B O    1 
HETATM 4940 O  O    . HOH L 5 .   ? 47.748  2.103   35.434  1.00 40.46 ? 634 HOH B O    1 
HETATM 4941 O  O    . HOH L 5 .   ? 20.227  -4.543  31.564  1.00 51.44 ? 635 HOH B O    1 
HETATM 4942 O  O    . HOH L 5 .   ? 21.874  -5.726  33.228  1.00 59.02 ? 636 HOH B O    1 
HETATM 4943 O  O    . HOH L 5 .   ? 38.680  28.377  38.939  1.00 61.85 ? 637 HOH B O    1 
HETATM 4944 O  O    . HOH L 5 .   ? 31.580  0.608   12.730  1.00 40.74 ? 641 HOH B O    1 
HETATM 4945 O  O    . HOH L 5 .   ? 17.318  4.908   47.006  1.00 45.01 ? 644 HOH B O    1 
HETATM 4946 O  O    . HOH M 5 .   ? 14.083  2.349   4.705   1.00 19.35 ? 3   HOH C O    1 
HETATM 4947 O  O    . HOH M 5 .   ? 15.198  3.903   6.820   1.00 21.32 ? 8   HOH C O    1 
HETATM 4948 O  O    . HOH M 5 .   ? 17.233  -11.839 10.433  1.00 20.55 ? 18  HOH C O    1 
HETATM 4949 O  O    . HOH M 5 .   ? -5.576  0.760   21.052  1.00 21.88 ? 24  HOH C O    1 
HETATM 4950 O  O    . HOH M 5 .   ? 18.054  -15.421 12.719  1.00 19.10 ? 30  HOH C O    1 
HETATM 4951 O  O    . HOH M 5 .   ? -4.790  -17.904 3.663   1.00 23.95 ? 32  HOH C O    1 
HETATM 4952 O  O    . HOH M 5 .   ? 17.449  -14.652 10.091  1.00 18.84 ? 35  HOH C O    1 
HETATM 4953 O  O    . HOH M 5 .   ? -14.555 -5.320  10.502  1.00 20.39 ? 39  HOH C O    1 
HETATM 4954 O  O    . HOH M 5 .   ? 4.965   10.819  13.297  1.00 21.19 ? 42  HOH C O    1 
HETATM 4955 O  O    . HOH M 5 .   ? -4.128  -17.078 8.374   1.00 28.00 ? 47  HOH C O    1 
HETATM 4956 O  O    . HOH M 5 .   ? -4.685  5.489   16.212  1.00 27.46 ? 51  HOH C O    1 
HETATM 4957 O  O    . HOH M 5 .   ? -3.816  -11.598 18.657  1.00 19.84 ? 54  HOH C O    1 
HETATM 4958 O  O    . HOH M 5 .   ? 18.808  -10.421 8.415   1.00 17.86 ? 60  HOH C O    1 
HETATM 4959 O  O    . HOH M 5 .   ? -1.207  -6.523  24.361  1.00 40.55 ? 62  HOH C O    1 
HETATM 4960 O  O    . HOH M 5 .   ? 4.503   -15.221 15.834  1.00 20.59 ? 65  HOH C O    1 
HETATM 4961 O  O    . HOH M 5 .   ? 3.778   0.553   -8.613  1.00 23.49 ? 67  HOH C O    1 
HETATM 4962 O  O    . HOH M 5 .   ? 2.685   -21.861 -2.923  1.00 24.87 ? 69  HOH C O    1 
HETATM 4963 O  O    . HOH M 5 .   ? 7.569   -4.567  19.656  1.00 25.42 ? 70  HOH C O    1 
HETATM 4964 O  O    . HOH M 5 .   ? -15.479 -0.303  10.841  1.00 23.97 ? 71  HOH C O    1 
HETATM 4965 O  O    . HOH M 5 .   ? -4.171  -15.764 2.089   1.00 20.83 ? 73  HOH C O    1 
HETATM 4966 O  O    . HOH M 5 .   ? -6.297  8.643   -0.262  1.00 20.08 ? 77  HOH C O    1 
HETATM 4967 O  O    . HOH M 5 .   ? 17.951  -5.963  10.087  1.00 28.95 ? 78  HOH C O    1 
HETATM 4968 O  O    . HOH M 5 .   ? -1.493  11.675  15.198  1.00 26.23 ? 81  HOH C O    1 
HETATM 4969 O  O    . HOH M 5 .   ? -12.925 -0.207  4.088   1.00 22.65 ? 84  HOH C O    1 
HETATM 4970 O  O    . HOH M 5 .   ? -9.131  -11.808 5.120   1.00 28.75 ? 86  HOH C O    1 
HETATM 4971 O  O    . HOH M 5 .   ? 1.096   0.728   -8.252  1.00 21.21 ? 87  HOH C O    1 
HETATM 4972 O  O    . HOH M 5 .   ? -0.111  5.205   -6.038  1.00 22.38 ? 90  HOH C O    1 
HETATM 4973 O  O    . HOH M 5 .   ? 8.986   -5.990  17.390  1.00 28.10 ? 93  HOH C O    1 
HETATM 4974 O  O    . HOH M 5 .   ? -12.216 10.659  5.667   1.00 21.20 ? 98  HOH C O    1 
HETATM 4975 O  O    . HOH M 5 .   ? -11.703 -3.656  16.413  1.00 30.49 ? 99  HOH C O    1 
HETATM 4976 O  O    . HOH M 5 .   ? 8.384   -22.974 -0.620  1.00 22.48 ? 102 HOH C O    1 
HETATM 4977 O  O    . HOH M 5 .   ? -5.846  -9.932  18.148  1.00 28.71 ? 107 HOH C O    1 
HETATM 4978 O  O    . HOH M 5 .   ? -3.944  -10.190 -3.682  1.00 26.50 ? 108 HOH C O    1 
HETATM 4979 O  O    . HOH M 5 .   ? 1.853   -6.076  25.624  1.00 24.53 ? 109 HOH C O    1 
HETATM 4980 O  O    . HOH M 5 .   ? -3.193  -12.516 16.075  1.00 24.46 ? 119 HOH C O    1 
HETATM 4981 O  O    . HOH M 5 .   ? -11.945 10.089  8.292   1.00 30.69 ? 121 HOH C O    1 
HETATM 4982 O  O    . HOH M 5 .   ? 8.579   10.391  -2.078  1.00 28.28 ? 123 HOH C O    1 
HETATM 4983 O  O    . HOH M 5 .   ? 13.227  4.148   17.823  1.00 34.43 ? 124 HOH C O    1 
HETATM 4984 O  O    . HOH M 5 .   ? 8.364   -0.268  20.313  1.00 28.04 ? 125 HOH C O    1 
HETATM 4985 O  O    . HOH M 5 .   ? 8.976   12.573  12.802  1.00 31.01 ? 311 HOH C O    1 
HETATM 4986 O  O    . HOH M 5 .   ? -0.629  9.597   9.245   1.00 17.25 ? 312 HOH C O    1 
HETATM 4987 O  O    . HOH M 5 .   ? -0.930  -16.197 -8.791  1.00 37.06 ? 313 HOH C O    1 
HETATM 4988 O  O    . HOH M 5 .   ? 2.472   -20.653 7.435   1.00 35.86 ? 314 HOH C O    1 
HETATM 4989 O  O    . HOH M 5 .   ? -10.620 -6.822  -4.602  1.00 28.71 ? 315 HOH C O    1 
HETATM 4990 O  O    . HOH M 5 .   ? 17.666  -4.502  -5.544  1.00 31.00 ? 316 HOH C O    1 
HETATM 4991 O  O    . HOH M 5 .   ? -2.703  4.956   11.875  1.00 23.02 ? 317 HOH C O    1 
HETATM 4992 O  O    . HOH M 5 .   ? 15.196  -17.586 20.252  1.00 25.81 ? 318 HOH C O    1 
HETATM 4993 O  O    . HOH M 5 .   ? -16.018 3.217   17.290  1.00 41.76 ? 319 HOH C O    1 
HETATM 4994 O  O    . HOH M 5 .   ? 5.452   -1.533  21.770  1.00 32.94 ? 320 HOH C O    1 
HETATM 4995 O  O    . HOH M 5 .   ? 17.327  -4.695  7.793   1.00 31.53 ? 321 HOH C O    1 
HETATM 4996 O  O    . HOH M 5 .   ? 6.489   -25.831 1.955   1.00 40.93 ? 322 HOH C O    1 
HETATM 4997 O  O    . HOH M 5 .   ? 6.278   12.616  11.797  1.00 35.81 ? 323 HOH C O    1 
HETATM 4998 O  O    . HOH M 5 .   ? 16.700  -11.699 14.040  1.00 28.05 ? 324 HOH C O    1 
HETATM 4999 O  O    . HOH M 5 .   ? -12.855 4.463   -0.067  1.00 37.62 ? 325 HOH C O    1 
HETATM 5000 O  O    . HOH M 5 .   ? 8.684   -15.093 -3.169  1.00 33.61 ? 326 HOH C O    1 
HETATM 5001 O  O    . HOH M 5 .   ? 13.443  -5.463  -7.682  1.00 24.04 ? 327 HOH C O    1 
HETATM 5002 O  O    . HOH M 5 .   ? 13.298  -17.886 15.796  1.00 25.50 ? 328 HOH C O    1 
HETATM 5003 O  O    . HOH M 5 .   ? -7.161  5.253   17.039  1.00 37.98 ? 329 HOH C O    1 
HETATM 5004 O  O    . HOH M 5 .   ? 17.738  7.865   13.579  1.00 36.04 ? 330 HOH C O    1 
HETATM 5005 O  O    . HOH M 5 .   ? 8.780   4.317   -6.083  1.00 40.23 ? 331 HOH C O    1 
HETATM 5006 O  O    . HOH M 5 .   ? 16.098  3.776   2.907   1.00 27.14 ? 332 HOH C O    1 
HETATM 5007 O  O    . HOH M 5 .   ? 13.622  -4.497  5.721   1.00 32.87 ? 333 HOH C O    1 
HETATM 5008 O  O    . HOH M 5 .   ? -1.876  -5.454  20.476  1.00 26.53 ? 334 HOH C O    1 
HETATM 5009 O  O    . HOH M 5 .   ? 14.721  -3.460  7.752   1.00 24.85 ? 335 HOH C O    1 
HETATM 5010 O  O    . HOH M 5 .   ? 4.990   -18.519 -4.134  1.00 32.49 ? 336 HOH C O    1 
HETATM 5011 O  O    . HOH M 5 .   ? 17.577  5.172   6.122   1.00 27.94 ? 337 HOH C O    1 
HETATM 5012 O  O    . HOH M 5 .   ? 1.795   -23.223 7.988   1.00 34.38 ? 338 HOH C O    1 
HETATM 5013 O  O    . HOH M 5 .   ? 2.516   11.888  20.677  1.00 27.18 ? 339 HOH C O    1 
HETATM 5014 O  O    . HOH M 5 .   ? 18.385  0.963   14.520  1.00 43.38 ? 340 HOH C O    1 
HETATM 5015 O  O    . HOH M 5 .   ? 4.997   10.043  -4.871  1.00 30.77 ? 341 HOH C O    1 
HETATM 5016 O  O    . HOH M 5 .   ? 15.492  -1.236  0.157   1.00 30.53 ? 342 HOH C O    1 
HETATM 5017 O  O    . HOH M 5 .   ? 11.381  -5.940  18.593  1.00 29.87 ? 343 HOH C O    1 
HETATM 5018 O  O    . HOH M 5 .   ? -2.379  -3.498  24.889  1.00 48.87 ? 344 HOH C O    1 
HETATM 5019 O  O    . HOH M 5 .   ? -6.876  -0.461  -5.743  1.00 23.56 ? 345 HOH C O    1 
HETATM 5020 O  O    . HOH M 5 .   ? -14.061 3.117   3.882   1.00 28.29 ? 346 HOH C O    1 
HETATM 5021 O  O    . HOH M 5 .   ? 4.696   -20.116 8.805   1.00 42.41 ? 347 HOH C O    1 
HETATM 5022 O  O    . HOH M 5 .   ? 0.348   -14.753 -10.931 1.00 24.97 ? 348 HOH C O    1 
HETATM 5023 O  O    . HOH M 5 .   ? 10.641  -10.696 -3.508  1.00 30.82 ? 349 HOH C O    1 
HETATM 5024 O  O    . HOH M 5 .   ? 7.171   -16.055 13.038  1.00 38.03 ? 350 HOH C O    1 
HETATM 5025 O  O    . HOH M 5 .   ? -2.235  -8.368  25.099  1.00 34.92 ? 351 HOH C O    1 
HETATM 5026 O  O    . HOH M 5 .   ? 19.748  -8.017  8.704   1.00 36.04 ? 352 HOH C O    1 
HETATM 5027 O  O    . HOH M 5 .   ? -16.816 -6.665  10.270  1.00 31.84 ? 353 HOH C O    1 
HETATM 5028 O  O    . HOH M 5 .   ? -18.364 -5.940  12.630  1.00 38.01 ? 354 HOH C O    1 
HETATM 5029 O  O    . HOH M 5 .   ? 6.371   -16.498 -4.112  1.00 33.42 ? 355 HOH C O    1 
HETATM 5030 O  O    . HOH M 5 .   ? -11.045 -15.852 -1.719  1.00 32.25 ? 356 HOH C O    1 
HETATM 5031 O  O    . HOH M 5 .   ? -3.188  -15.488 10.185  1.00 31.79 ? 357 HOH C O    1 
HETATM 5032 O  O    . HOH M 5 .   ? -17.210 -1.902  9.726   1.00 50.26 ? 358 HOH C O    1 
HETATM 5033 O  O    . HOH M 5 .   ? 8.815   -12.620 20.355  1.00 25.73 ? 359 HOH C O    1 
HETATM 5034 O  O    . HOH M 5 .   ? 2.212   -16.090 -12.568 1.00 34.21 ? 360 HOH C O    1 
HETATM 5035 O  O    . HOH M 5 .   ? 10.587  1.128   -7.157  1.00 29.06 ? 361 HOH C O    1 
HETATM 5036 O  O    . HOH M 5 .   ? 10.057  -8.620  20.092  1.00 36.31 ? 362 HOH C O    1 
HETATM 5037 O  O    . HOH M 5 .   ? 6.155   11.998  9.301   1.00 30.14 ? 363 HOH C O    1 
HETATM 5038 O  O    . HOH M 5 .   ? 3.235   0.356   22.427  1.00 32.57 ? 364 HOH C O    1 
HETATM 5039 O  O    . HOH M 5 .   ? 17.038  -3.608  15.027  1.00 40.30 ? 365 HOH C O    1 
HETATM 5040 O  O    . HOH M 5 .   ? 12.180  -11.016 17.589  1.00 39.77 ? 366 HOH C O    1 
HETATM 5041 O  O    . HOH M 5 .   ? -6.833  11.439  14.843  1.00 44.43 ? 367 HOH C O    1 
HETATM 5042 O  O    . HOH M 5 .   ? -4.342  5.880   24.188  1.00 29.70 ? 368 HOH C O    1 
HETATM 5043 O  O    . HOH M 5 .   ? -3.694  12.394  8.893   1.00 26.95 ? 369 HOH C O    1 
HETATM 5044 O  O    . HOH M 5 .   ? 20.777  -6.378  -0.108  1.00 49.01 ? 370 HOH C O    1 
HETATM 5045 O  O    . HOH M 5 .   ? -6.872  -15.277 1.408   1.00 27.84 ? 371 HOH C O    1 
HETATM 5046 O  O    . HOH M 5 .   ? 11.317  -11.998 19.981  1.00 37.50 ? 372 HOH C O    1 
HETATM 5047 O  O    . HOH M 5 .   ? -2.475  -16.762 14.796  1.00 43.77 ? 373 HOH C O    1 
HETATM 5048 O  O    . HOH M 5 .   ? -6.427  7.924   18.312  1.00 30.22 ? 374 HOH C O    1 
HETATM 5049 O  O    . HOH M 5 .   ? 16.040  -2.930  -1.737  1.00 40.90 ? 375 HOH C O    1 
HETATM 5050 O  O    . HOH M 5 .   ? -1.078  12.106  22.754  1.00 34.05 ? 376 HOH C O    1 
HETATM 5051 O  O    . HOH M 5 .   ? -1.797  -10.748 -11.917 1.00 38.56 ? 377 HOH C O    1 
HETATM 5052 O  O    . HOH M 5 .   ? 0.052   -7.896  -13.159 1.00 30.27 ? 378 HOH C O    1 
HETATM 5053 O  O    . HOH M 5 .   ? -9.399  -4.193  17.699  1.00 30.92 ? 379 HOH C O    1 
HETATM 5054 O  O    . HOH M 5 .   ? 13.854  10.713  7.554   1.00 36.64 ? 380 HOH C O    1 
HETATM 5055 O  O    . HOH M 5 .   ? 3.878   9.917   27.532  1.00 26.48 ? 381 HOH C O    1 
HETATM 5056 O  O    . HOH M 5 .   ? -12.239 6.451   1.976   1.00 36.23 ? 382 HOH C O    1 
HETATM 5057 O  O    . HOH M 5 .   ? -13.228 3.247   16.965  1.00 29.08 ? 383 HOH C O    1 
HETATM 5058 O  O    . HOH M 5 .   ? -8.090  8.715   16.385  1.00 38.21 ? 384 HOH C O    1 
HETATM 5059 O  O    . HOH M 5 .   ? 6.748   -20.720 7.596   1.00 47.71 ? 385 HOH C O    1 
HETATM 5060 O  O    . HOH M 5 .   ? 4.068   2.106   24.151  1.00 38.40 ? 386 HOH C O    1 
HETATM 5061 O  O    . HOH M 5 .   ? -2.570  -17.475 11.781  1.00 44.97 ? 388 HOH C O    1 
HETATM 5062 O  O    . HOH M 5 .   ? -8.833  1.369   -4.780  1.00 41.15 ? 392 HOH C O    1 
HETATM 5063 O  O    . HOH M 5 .   ? -17.829 -0.520  14.743  1.00 40.31 ? 393 HOH C O    1 
HETATM 5064 O  O    . HOH M 5 .   ? 0.711   12.151  11.196  1.00 40.18 ? 394 HOH C O    1 
HETATM 5065 O  O    . HOH M 5 .   ? -4.310  -20.138 -4.327  1.00 47.85 ? 396 HOH C O    1 
HETATM 5066 O  O    . HOH M 5 .   ? 9.717   -2.759  20.536  1.00 30.53 ? 399 HOH C O    1 
HETATM 5067 O  O    . HOH M 5 .   ? 2.120   12.832  -4.819  1.00 29.47 ? 402 HOH C O    1 
HETATM 5068 O  O    . HOH M 5 .   ? 18.072  -11.580 6.184   1.00 16.87 ? 404 HOH C O    1 
HETATM 5069 O  O    . HOH M 5 .   ? 12.759  -8.599  18.312  1.00 44.87 ? 405 HOH C O    1 
HETATM 5070 O  O    . HOH M 5 .   ? -15.112 -5.019  6.381   1.00 38.06 ? 406 HOH C O    1 
HETATM 5071 O  O    . HOH M 5 .   ? 1.408   15.455  -8.678  1.00 40.06 ? 407 HOH C O    1 
HETATM 5072 O  O    . HOH M 5 .   ? 17.659  -7.296  16.180  1.00 46.20 ? 408 HOH C O    1 
HETATM 5073 O  O    . HOH M 5 .   ? 18.617  -6.600  -1.352  1.00 41.79 ? 410 HOH C O    1 
HETATM 5074 O  O    . HOH M 5 .   ? -13.868 0.913   8.992   1.00 29.08 ? 411 HOH C O    1 
HETATM 5075 O  O    . HOH M 5 .   ? -6.747  -5.675  -4.371  1.00 31.99 ? 412 HOH C O    1 
HETATM 5076 O  O    . HOH M 5 .   ? 14.350  -8.323  -8.878  1.00 37.98 ? 413 HOH C O    1 
HETATM 5077 O  O    . HOH M 5 .   ? 14.082  2.238   -3.929  1.00 34.02 ? 414 HOH C O    1 
HETATM 5078 O  O    . HOH M 5 .   ? 6.266   8.951   29.104  1.00 36.96 ? 421 HOH C O    1 
HETATM 5079 O  O    . HOH M 5 .   ? 4.963   -23.662 -0.902  1.00 39.31 ? 424 HOH C O    1 
HETATM 5080 O  O    . HOH M 5 .   ? -4.384  11.599  -3.631  1.00 30.04 ? 425 HOH C O    1 
HETATM 5081 O  O    . HOH M 5 .   ? -0.582  11.668  17.835  1.00 28.18 ? 429 HOH C O    1 
HETATM 5082 O  O    . HOH M 5 .   ? -5.046  -13.593 14.581  1.00 34.71 ? 430 HOH C O    1 
HETATM 5083 O  O    . HOH M 5 .   ? -1.291  12.307  -5.288  1.00 40.56 ? 431 HOH C O    1 
HETATM 5084 O  O    . HOH M 5 .   ? 2.415   -2.775  -9.535  1.00 34.45 ? 432 HOH C O    1 
HETATM 5085 O  O    . HOH M 5 .   ? -11.272 5.324   -3.532  1.00 32.50 ? 434 HOH C O    1 
HETATM 5086 O  O    . HOH M 5 .   ? -1.827  -20.018 9.842   1.00 47.82 ? 436 HOH C O    1 
HETATM 5087 O  O    . HOH M 5 .   ? 2.623   -25.454 -0.452  1.00 36.92 ? 439 HOH C O    1 
HETATM 5088 O  O    . HOH M 5 .   ? 5.848   13.048  -1.288  1.00 37.41 ? 440 HOH C O    1 
HETATM 5089 O  O    . HOH M 5 .   ? 9.717   -17.007 -5.089  1.00 35.40 ? 441 HOH C O    1 
HETATM 5090 O  O    . HOH M 5 .   ? 15.066  8.570   1.479   1.00 46.67 ? 446 HOH C O    1 
HETATM 5091 O  O    . HOH M 5 .   ? 0.313   -23.929 -1.407  1.00 39.90 ? 449 HOH C O    1 
HETATM 5092 O  O    . HOH M 5 .   ? -5.647  3.692   23.332  1.00 30.24 ? 456 HOH C O    1 
HETATM 5093 O  O    . HOH M 5 .   ? -9.702  6.140   15.992  1.00 34.85 ? 457 HOH C O    1 
HETATM 5094 O  O    . HOH M 5 .   ? -3.675  -22.826 -0.612  1.00 28.22 ? 460 HOH C O    1 
HETATM 5095 O  O    . HOH M 5 .   ? -7.528  4.228   21.299  1.00 32.80 ? 461 HOH C O    1 
HETATM 5096 O  O    . HOH M 5 .   ? 3.881   8.019   -9.396  1.00 37.23 ? 470 HOH C O    1 
HETATM 5097 O  O    . HOH M 5 .   ? 15.691  -0.266  13.873  1.00 38.51 ? 471 HOH C O    1 
HETATM 5098 O  O    . HOH M 5 .   ? 17.401  -4.468  0.010   1.00 44.64 ? 472 HOH C O    1 
HETATM 5099 O  O    . HOH M 5 .   ? -11.282 4.978   17.779  1.00 49.23 ? 475 HOH C O    1 
HETATM 5100 O  O    . HOH M 5 .   ? 15.067  -0.148  4.065   1.00 31.88 ? 476 HOH C O    1 
HETATM 5101 O  O    . HOH M 5 .   ? 12.158  14.903  2.254   1.00 29.41 ? 477 HOH C O    1 
HETATM 5102 O  O    . HOH M 5 .   ? -3.483  14.239  7.086   1.00 33.66 ? 479 HOH C O    1 
HETATM 5103 O  O    . HOH M 5 .   ? 11.877  -0.948  -11.556 1.00 35.48 ? 480 HOH C O    1 
HETATM 5104 O  O    . HOH M 5 .   ? -5.723  -6.267  -7.251  1.00 31.33 ? 484 HOH C O    1 
HETATM 5105 O  O    . HOH M 5 .   ? 8.705   7.854   -2.980  1.00 39.84 ? 488 HOH C O    1 
HETATM 5106 O  O    . HOH M 5 .   ? -9.151  -16.136 2.508   1.00 41.94 ? 490 HOH C O    1 
HETATM 5107 O  O    . HOH M 5 .   ? 6.539   -23.303 3.039   1.00 31.23 ? 498 HOH C O    1 
HETATM 5108 O  O    . HOH M 5 .   ? -6.196  11.589  17.571  1.00 47.28 ? 501 HOH C O    1 
HETATM 5109 O  O    . HOH M 5 .   ? 14.030  3.790   -6.033  1.00 50.22 ? 504 HOH C O    1 
HETATM 5110 O  O    . HOH M 5 .   ? 10.863  -10.347 -13.371 1.00 48.78 ? 513 HOH C O    1 
HETATM 5111 O  O    . HOH M 5 .   ? 11.133  3.870   -5.010  1.00 35.68 ? 516 HOH C O    1 
HETATM 5112 O  O    . HOH M 5 .   ? 20.146  -4.910  5.262   1.00 44.28 ? 518 HOH C O    1 
HETATM 5113 O  O    . HOH M 5 .   ? 5.075   -25.117 4.264   1.00 50.45 ? 521 HOH C O    1 
HETATM 5114 O  O    . HOH M 5 .   ? -2.662  -18.729 -5.678  1.00 49.20 ? 522 HOH C O    1 
HETATM 5115 O  O    . HOH M 5 .   ? -1.863  7.388   -5.599  1.00 44.87 ? 523 HOH C O    1 
HETATM 5116 O  O    . HOH M 5 .   ? 2.398   -8.533  -13.283 1.00 49.70 ? 528 HOH C O    1 
HETATM 5117 O  O    . HOH M 5 .   ? 18.334  -7.476  0.850   1.00 41.46 ? 531 HOH C O    1 
HETATM 5118 O  O    . HOH M 5 .   ? -0.368  -15.613 -6.370  1.00 34.94 ? 532 HOH C O    1 
HETATM 5119 O  O    . HOH M 5 .   ? 12.990  10.548  10.618  1.00 35.83 ? 534 HOH C O    1 
HETATM 5120 O  O    . HOH M 5 .   ? -3.099  10.559  21.755  1.00 37.12 ? 540 HOH C O    1 
HETATM 5121 O  O    . HOH M 5 .   ? -12.832 5.280   7.211   1.00 37.04 ? 546 HOH C O    1 
HETATM 5122 O  O    . HOH M 5 .   ? -10.618 2.984   -1.727  1.00 42.61 ? 553 HOH C O    1 
HETATM 5123 O  O    . HOH M 5 .   ? -5.231  -18.094 -5.606  1.00 46.63 ? 554 HOH C O    1 
HETATM 5124 O  O    . HOH M 5 .   ? -14.485 -4.300  4.139   1.00 46.67 ? 559 HOH C O    1 
HETATM 5125 O  O    . HOH M 5 .   ? 1.026   -23.073 4.932   1.00 42.32 ? 560 HOH C O    1 
HETATM 5126 O  O    . HOH M 5 .   ? -15.179 6.858   10.661  1.00 48.83 ? 564 HOH C O    1 
HETATM 5127 O  O    . HOH M 5 .   ? -6.791  -17.013 7.980   1.00 48.61 ? 565 HOH C O    1 
HETATM 5128 O  O    . HOH M 5 .   ? 12.548  -8.350  -13.414 1.00 33.39 ? 566 HOH C O    1 
HETATM 5129 O  O    . HOH M 5 .   ? 12.508  -14.195 21.673  1.00 36.70 ? 575 HOH C O    1 
HETATM 5130 O  O    . HOH M 5 .   ? 18.053  6.049   19.506  1.00 42.08 ? 576 HOH C O    1 
HETATM 5131 O  O    . HOH M 5 .   ? 2.545   1.463   26.683  1.00 52.52 ? 577 HOH C O    1 
HETATM 5132 O  O    . HOH M 5 .   ? 19.433  -8.855  2.683   1.00 37.33 ? 578 HOH C O    1 
HETATM 5133 O  O    . HOH M 5 .   ? -5.473  -7.161  19.581  1.00 43.22 ? 583 HOH C O    1 
HETATM 5134 O  O    . HOH M 5 .   ? -1.236  12.104  9.652   1.00 40.82 ? 589 HOH C O    1 
HETATM 5135 O  O    . HOH M 5 .   ? -13.356 -13.281 -2.985  1.00 48.59 ? 591 HOH C O    1 
HETATM 5136 O  O    . HOH M 5 .   ? 13.612  -10.322 -5.235  1.00 35.22 ? 597 HOH C O    1 
HETATM 5137 O  O    . HOH M 5 .   ? 1.112   -21.746 -5.075  1.00 34.06 ? 603 HOH C O    1 
HETATM 5138 O  O    . HOH M 5 .   ? -3.558  -16.442 -9.106  1.00 46.59 ? 606 HOH C O    1 
HETATM 5139 O  O    . HOH M 5 .   ? 11.489  -11.313 -5.655  1.00 41.15 ? 608 HOH C O    1 
HETATM 5140 O  O    . HOH M 5 .   ? 10.929  -6.392  21.179  1.00 43.78 ? 609 HOH C O    1 
HETATM 5141 O  O    . HOH M 5 .   ? 8.143   -14.292 22.557  1.00 36.87 ? 610 HOH C O    1 
HETATM 5142 O  O    . HOH M 5 .   ? 2.319   -3.357  25.979  1.00 40.10 ? 611 HOH C O    1 
HETATM 5143 O  O    . HOH M 5 .   ? -7.801  6.792   20.433  1.00 31.13 ? 614 HOH C O    1 
HETATM 5144 O  O    . HOH M 5 .   ? -3.363  -5.468  22.664  1.00 35.73 ? 620 HOH C O    1 
HETATM 5145 O  O    . HOH M 5 .   ? -5.375  8.657   23.314  1.00 40.83 ? 623 HOH C O    1 
HETATM 5146 O  O    . HOH M 5 .   ? 14.186  -0.660  16.120  1.00 39.99 ? 638 HOH C O    1 
HETATM 5147 O  O    . HOH M 5 .   ? -13.566 -2.337  2.825   1.00 38.73 ? 642 HOH C O    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   127 ?   ?   ?   A . n 
A 1 2   GLY 2   128 128 GLY GLY A . n 
A 1 3   ASN 3   129 129 ASN ASN A . n 
A 1 4   VAL 4   130 130 VAL VAL A . n 
A 1 5   ASP 5   131 131 ASP ASP A . n 
A 1 6   LEU 6   132 132 LEU LEU A . n 
A 1 7   VAL 7   133 133 VAL VAL A . n 
A 1 8   PHE 8   134 134 PHE PHE A . n 
A 1 9   LEU 9   135 135 LEU LEU A . n 
A 1 10  PHE 10  136 136 PHE PHE A . n 
A 1 11  ASP 11  137 137 ASP ASP A . n 
A 1 12  GLY 12  138 138 GLY GLY A . n 
A 1 13  SER 13  139 139 SER SER A . n 
A 1 14  MET 14  140 140 MET MET A . n 
A 1 15  SER 15  141 141 SER SER A . n 
A 1 16  LEU 16  142 142 LEU LEU A . n 
A 1 17  GLN 17  143 143 GLN GLN A . n 
A 1 18  PRO 18  144 144 PRO PRO A . n 
A 1 19  ASP 19  145 145 ASP ASP A . n 
A 1 20  GLU 20  146 146 GLU GLU A . n 
A 1 21  PHE 21  147 147 PHE PHE A . n 
A 1 22  GLN 22  148 148 GLN GLN A . n 
A 1 23  LYS 23  149 149 LYS LYS A . n 
A 1 24  ILE 24  150 150 ILE ILE A . n 
A 1 25  LEU 25  151 151 LEU LEU A . n 
A 1 26  ASP 26  152 152 ASP ASP A . n 
A 1 27  PHE 27  153 153 PHE PHE A . n 
A 1 28  MET 28  154 154 MET MET A . n 
A 1 29  LYS 29  155 155 LYS LYS A . n 
A 1 30  ASP 30  156 156 ASP ASP A . n 
A 1 31  VAL 31  157 157 VAL VAL A . n 
A 1 32  MET 32  158 158 MET MET A . n 
A 1 33  LYS 33  159 159 LYS LYS A . n 
A 1 34  LYS 34  160 160 LYS LYS A . n 
A 1 35  LEU 35  161 161 LEU LEU A . n 
A 1 36  SER 36  162 162 SER SER A . n 
A 1 37  ASN 37  163 163 ASN ASN A . n 
A 1 38  THR 38  164 164 THR THR A . n 
A 1 39  SER 39  165 165 SER SER A . n 
A 1 40  TYR 40  166 166 TYR TYR A . n 
A 1 41  GLN 41  167 167 GLN GLN A . n 
A 1 42  PHE 42  168 168 PHE PHE A . n 
A 1 43  ALA 43  169 169 ALA ALA A . n 
A 1 44  ALA 44  170 170 ALA ALA A . n 
A 1 45  VAL 45  171 171 VAL VAL A . n 
A 1 46  GLN 46  172 172 GLN GLN A . n 
A 1 47  PHE 47  173 173 PHE PHE A . n 
A 1 48  SER 48  174 174 SER SER A . n 
A 1 49  THR 49  175 175 THR THR A . n 
A 1 50  SER 50  176 176 SER SER A . n 
A 1 51  TYR 51  177 177 TYR TYR A . n 
A 1 52  LYS 52  178 178 LYS LYS A . n 
A 1 53  THR 53  179 179 THR THR A . n 
A 1 54  GLU 54  180 180 GLU GLU A . n 
A 1 55  PHE 55  181 181 PHE PHE A . n 
A 1 56  ASP 56  182 182 ASP ASP A . n 
A 1 57  PHE 57  183 183 PHE PHE A . n 
A 1 58  SER 58  184 184 SER SER A . n 
A 1 59  ASP 59  185 185 ASP ASP A . n 
A 1 60  TYR 60  186 186 TYR TYR A . n 
A 1 61  VAL 61  187 187 VAL VAL A . n 
A 1 62  LYS 62  188 188 LYS LYS A . n 
A 1 63  TRP 63  189 189 TRP TRP A . n 
A 1 64  LYS 64  190 190 LYS LYS A . n 
A 1 65  ASP 65  191 191 ASP ASP A . n 
A 1 66  PRO 66  192 192 PRO PRO A . n 
A 1 67  ASP 67  193 193 ASP ASP A . n 
A 1 68  ALA 68  194 194 ALA ALA A . n 
A 1 69  LEU 69  195 195 LEU LEU A . n 
A 1 70  LEU 70  196 196 LEU LEU A . n 
A 1 71  LYS 71  197 197 LYS LYS A . n 
A 1 72  HIS 72  198 198 HIS HIS A . n 
A 1 73  VAL 73  199 199 VAL VAL A . n 
A 1 74  LYS 74  200 200 LYS LYS A . n 
A 1 75  HIS 75  201 201 HIS HIS A . n 
A 1 76  MET 76  202 202 MET MET A . n 
A 1 77  LEU 77  203 203 LEU LEU A . n 
A 1 78  LEU 78  204 204 LEU LEU A . n 
A 1 79  LEU 79  205 205 LEU LEU A . n 
A 1 80  THR 80  206 206 THR THR A . n 
A 1 81  ASN 81  207 207 ASN ASN A . n 
A 1 82  THR 82  208 208 THR THR A . n 
A 1 83  PHE 83  209 209 PHE PHE A . n 
A 1 84  GLY 84  210 210 GLY GLY A . n 
A 1 85  ALA 85  211 211 ALA ALA A . n 
A 1 86  ILE 86  212 212 ILE ILE A . n 
A 1 87  ASN 87  213 213 ASN ASN A . n 
A 1 88  TYR 88  214 214 TYR TYR A . n 
A 1 89  VAL 89  215 215 VAL VAL A . n 
A 1 90  ALA 90  216 216 ALA ALA A . n 
A 1 91  THR 91  217 217 THR THR A . n 
A 1 92  GLU 92  218 218 GLU GLU A . n 
A 1 93  VAL 93  219 219 VAL VAL A . n 
A 1 94  PHE 94  220 220 PHE PHE A . n 
A 1 95  ARG 95  221 221 ARG ARG A . n 
A 1 96  GLU 96  222 222 GLU GLU A . n 
A 1 97  GLU 97  223 223 GLU GLU A . n 
A 1 98  LEU 98  224 224 LEU LEU A . n 
A 1 99  GLY 99  225 225 GLY GLY A . n 
A 1 100 ALA 100 226 226 ALA ALA A . n 
A 1 101 ARG 101 227 227 ARG ARG A . n 
A 1 102 PRO 102 228 228 PRO PRO A . n 
A 1 103 ASP 103 229 229 ASP ASP A . n 
A 1 104 ALA 104 230 230 ALA ALA A . n 
A 1 105 THR 105 231 231 THR THR A . n 
A 1 106 LYS 106 232 232 LYS LYS A . n 
A 1 107 VAL 107 233 233 VAL VAL A . n 
A 1 108 LEU 108 234 234 LEU LEU A . n 
A 1 109 ILE 109 235 235 ILE ILE A . n 
A 1 110 ILE 110 236 236 ILE ILE A . n 
A 1 111 ILE 111 237 237 ILE ILE A . n 
A 1 112 THR 112 238 238 THR THR A . n 
A 1 113 ASP 113 239 239 ASP ASP A . n 
A 1 114 GLY 114 240 240 GLY GLY A . n 
A 1 115 GLU 115 241 241 GLU GLU A . n 
A 1 116 ALA 116 242 242 ALA ALA A . n 
A 1 117 THR 117 243 243 THR THR A . n 
A 1 118 ASP 118 244 244 ASP ASP A . n 
A 1 119 SER 119 245 245 SER SER A . n 
A 1 120 GLY 120 246 246 GLY GLY A . n 
A 1 121 ASN 121 247 247 ASN ASN A . n 
A 1 122 ILE 122 248 248 ILE ILE A . n 
A 1 123 ASP 123 249 249 ASP ASP A . n 
A 1 124 ALA 124 250 250 ALA ALA A . n 
A 1 125 ALA 125 251 251 ALA ALA A . n 
A 1 126 LYS 126 252 252 LYS LYS A . n 
A 1 127 ASP 127 253 253 ASP ASP A . n 
A 1 128 ILE 128 254 254 ILE ILE A . n 
A 1 129 ILE 129 255 255 ILE ILE A . n 
A 1 130 ARG 130 256 256 ARG ARG A . n 
A 1 131 TYR 131 257 257 TYR TYR A . n 
A 1 132 ILE 132 258 258 ILE ILE A . n 
A 1 133 ILE 133 259 259 ILE ILE A . n 
A 1 134 GLY 134 260 260 GLY GLY A . n 
A 1 135 ILE 135 261 261 ILE ILE A . n 
A 1 136 GLY 136 262 262 GLY GLY A . n 
A 1 137 LYS 137 263 263 LYS LYS A . n 
A 1 138 HIS 138 264 264 HIS HIS A . n 
A 1 139 PHE 139 265 265 PHE PHE A . n 
A 1 140 GLN 140 266 266 GLN GLN A . n 
A 1 141 THR 141 267 267 THR THR A . n 
A 1 142 LYS 142 268 268 LYS LYS A . n 
A 1 143 GLU 143 269 269 GLU GLU A . n 
A 1 144 SER 144 270 270 SER SER A . n 
A 1 145 GLN 145 271 271 GLN GLN A . n 
A 1 146 GLU 146 272 272 GLU GLU A . n 
A 1 147 THR 147 273 273 THR THR A . n 
A 1 148 LEU 148 274 274 LEU LEU A . n 
A 1 149 HIS 149 275 275 HIS HIS A . n 
A 1 150 LYS 150 276 276 LYS LYS A . n 
A 1 151 PHE 151 277 277 PHE PHE A . n 
A 1 152 ALA 152 278 278 ALA ALA A . n 
A 1 153 SER 153 279 279 SER SER A . n 
A 1 154 LYS 154 280 280 LYS LYS A . n 
A 1 155 PRO 155 281 281 PRO PRO A . n 
A 1 156 ALA 156 282 282 ALA ALA A . n 
A 1 157 SER 157 283 283 SER SER A . n 
A 1 158 GLU 158 284 284 GLU GLU A . n 
A 1 159 PHE 159 285 285 PHE PHE A . n 
A 1 160 VAL 160 286 286 VAL VAL A . n 
A 1 161 LYS 161 287 287 LYS LYS A . n 
A 1 162 ILE 162 288 288 ILE ILE A . n 
A 1 163 LEU 163 289 289 LEU LEU A . n 
A 1 164 ASP 164 290 290 ASP ASP A . n 
A 1 165 THR 165 291 291 THR THR A . n 
A 1 166 PHE 166 292 292 PHE PHE A . n 
A 1 167 GLU 167 293 293 GLU GLU A . n 
A 1 168 LYS 168 294 294 LYS LYS A . n 
A 1 169 LEU 169 295 295 LEU LEU A . n 
A 1 170 LYS 170 296 296 LYS LYS A . n 
A 1 171 ASP 171 297 297 ASP ASP A . n 
A 1 172 LEU 172 298 298 LEU LEU A . n 
A 1 173 PHE 173 299 299 PHE PHE A . n 
A 1 174 THR 174 300 300 THR THR A . n 
A 1 175 GLU 175 301 301 GLU GLU A . n 
A 1 176 LEU 176 302 302 LEU LEU A . n 
A 1 177 GLN 177 303 303 GLN GLN A . n 
A 1 178 LYS 178 304 304 LYS LYS A . n 
A 1 179 LYS 179 305 305 LYS LYS A . n 
A 1 180 ILE 180 306 306 ILE ILE A . n 
A 1 181 TYR 181 307 307 TYR TYR A . n 
B 1 1   MET 1   127 ?   ?   ?   B . n 
B 1 2   GLY 2   128 128 GLY GLY B . n 
B 1 3   ASN 3   129 129 ASN ASN B . n 
B 1 4   VAL 4   130 130 VAL VAL B . n 
B 1 5   ASP 5   131 131 ASP ASP B . n 
B 1 6   LEU 6   132 132 LEU LEU B . n 
B 1 7   VAL 7   133 133 VAL VAL B . n 
B 1 8   PHE 8   134 134 PHE PHE B . n 
B 1 9   LEU 9   135 135 LEU LEU B . n 
B 1 10  PHE 10  136 136 PHE PHE B . n 
B 1 11  ASP 11  137 137 ASP ASP B . n 
B 1 12  GLY 12  138 138 GLY GLY B . n 
B 1 13  SER 13  139 139 SER SER B . n 
B 1 14  MET 14  140 140 MET MET B . n 
B 1 15  SER 15  141 141 SER SER B . n 
B 1 16  LEU 16  142 142 LEU LEU B . n 
B 1 17  GLN 17  143 143 GLN GLN B . n 
B 1 18  PRO 18  144 144 PRO PRO B . n 
B 1 19  ASP 19  145 145 ASP ASP B . n 
B 1 20  GLU 20  146 146 GLU GLU B . n 
B 1 21  PHE 21  147 147 PHE PHE B . n 
B 1 22  GLN 22  148 148 GLN GLN B . n 
B 1 23  LYS 23  149 149 LYS LYS B . n 
B 1 24  ILE 24  150 150 ILE ILE B . n 
B 1 25  LEU 25  151 151 LEU LEU B . n 
B 1 26  ASP 26  152 152 ASP ASP B . n 
B 1 27  PHE 27  153 153 PHE PHE B . n 
B 1 28  MET 28  154 154 MET MET B . n 
B 1 29  LYS 29  155 155 LYS LYS B . n 
B 1 30  ASP 30  156 156 ASP ASP B . n 
B 1 31  VAL 31  157 157 VAL VAL B . n 
B 1 32  MET 32  158 158 MET MET B . n 
B 1 33  LYS 33  159 159 LYS LYS B . n 
B 1 34  LYS 34  160 160 LYS LYS B . n 
B 1 35  LEU 35  161 161 LEU LEU B . n 
B 1 36  SER 36  162 162 SER SER B . n 
B 1 37  ASN 37  163 163 ASN ASN B . n 
B 1 38  THR 38  164 164 THR THR B . n 
B 1 39  SER 39  165 165 SER SER B . n 
B 1 40  TYR 40  166 166 TYR TYR B . n 
B 1 41  GLN 41  167 167 GLN GLN B . n 
B 1 42  PHE 42  168 168 PHE PHE B . n 
B 1 43  ALA 43  169 169 ALA ALA B . n 
B 1 44  ALA 44  170 170 ALA ALA B . n 
B 1 45  VAL 45  171 171 VAL VAL B . n 
B 1 46  GLN 46  172 172 GLN GLN B . n 
B 1 47  PHE 47  173 173 PHE PHE B . n 
B 1 48  SER 48  174 174 SER SER B . n 
B 1 49  THR 49  175 175 THR THR B . n 
B 1 50  SER 50  176 176 SER SER B . n 
B 1 51  TYR 51  177 177 TYR TYR B . n 
B 1 52  LYS 52  178 178 LYS LYS B . n 
B 1 53  THR 53  179 179 THR THR B . n 
B 1 54  GLU 54  180 180 GLU GLU B . n 
B 1 55  PHE 55  181 181 PHE PHE B . n 
B 1 56  ASP 56  182 182 ASP ASP B . n 
B 1 57  PHE 57  183 183 PHE PHE B . n 
B 1 58  SER 58  184 184 SER SER B . n 
B 1 59  ASP 59  185 185 ASP ASP B . n 
B 1 60  TYR 60  186 186 TYR TYR B . n 
B 1 61  VAL 61  187 187 VAL VAL B . n 
B 1 62  LYS 62  188 188 LYS LYS B . n 
B 1 63  TRP 63  189 189 TRP TRP B . n 
B 1 64  LYS 64  190 190 LYS LYS B . n 
B 1 65  ASP 65  191 191 ASP ASP B . n 
B 1 66  PRO 66  192 192 PRO PRO B . n 
B 1 67  ASP 67  193 193 ASP ASP B . n 
B 1 68  ALA 68  194 194 ALA ALA B . n 
B 1 69  LEU 69  195 195 LEU LEU B . n 
B 1 70  LEU 70  196 196 LEU LEU B . n 
B 1 71  LYS 71  197 197 LYS LYS B . n 
B 1 72  HIS 72  198 198 HIS HIS B . n 
B 1 73  VAL 73  199 199 VAL VAL B . n 
B 1 74  LYS 74  200 200 LYS LYS B . n 
B 1 75  HIS 75  201 201 HIS HIS B . n 
B 1 76  MET 76  202 202 MET MET B . n 
B 1 77  LEU 77  203 203 LEU LEU B . n 
B 1 78  LEU 78  204 204 LEU LEU B . n 
B 1 79  LEU 79  205 205 LEU LEU B . n 
B 1 80  THR 80  206 206 THR THR B . n 
B 1 81  ASN 81  207 207 ASN ASN B . n 
B 1 82  THR 82  208 208 THR THR B . n 
B 1 83  PHE 83  209 209 PHE PHE B . n 
B 1 84  GLY 84  210 210 GLY GLY B . n 
B 1 85  ALA 85  211 211 ALA ALA B . n 
B 1 86  ILE 86  212 212 ILE ILE B . n 
B 1 87  ASN 87  213 213 ASN ASN B . n 
B 1 88  TYR 88  214 214 TYR TYR B . n 
B 1 89  VAL 89  215 215 VAL VAL B . n 
B 1 90  ALA 90  216 216 ALA ALA B . n 
B 1 91  THR 91  217 217 THR THR B . n 
B 1 92  GLU 92  218 218 GLU GLU B . n 
B 1 93  VAL 93  219 219 VAL VAL B . n 
B 1 94  PHE 94  220 220 PHE PHE B . n 
B 1 95  ARG 95  221 221 ARG ARG B . n 
B 1 96  GLU 96  222 222 GLU GLU B . n 
B 1 97  GLU 97  223 223 GLU GLU B . n 
B 1 98  LEU 98  224 224 LEU LEU B . n 
B 1 99  GLY 99  225 225 GLY GLY B . n 
B 1 100 ALA 100 226 226 ALA ALA B . n 
B 1 101 ARG 101 227 227 ARG ARG B . n 
B 1 102 PRO 102 228 228 PRO PRO B . n 
B 1 103 ASP 103 229 229 ASP ASP B . n 
B 1 104 ALA 104 230 230 ALA ALA B . n 
B 1 105 THR 105 231 231 THR THR B . n 
B 1 106 LYS 106 232 232 LYS LYS B . n 
B 1 107 VAL 107 233 233 VAL VAL B . n 
B 1 108 LEU 108 234 234 LEU LEU B . n 
B 1 109 ILE 109 235 235 ILE ILE B . n 
B 1 110 ILE 110 236 236 ILE ILE B . n 
B 1 111 ILE 111 237 237 ILE ILE B . n 
B 1 112 THR 112 238 238 THR THR B . n 
B 1 113 ASP 113 239 239 ASP ASP B . n 
B 1 114 GLY 114 240 240 GLY GLY B . n 
B 1 115 GLU 115 241 241 GLU GLU B . n 
B 1 116 ALA 116 242 242 ALA ALA B . n 
B 1 117 THR 117 243 243 THR THR B . n 
B 1 118 ASP 118 244 244 ASP ASP B . n 
B 1 119 SER 119 245 245 SER SER B . n 
B 1 120 GLY 120 246 246 GLY GLY B . n 
B 1 121 ASN 121 247 247 ASN ASN B . n 
B 1 122 ILE 122 248 248 ILE ILE B . n 
B 1 123 ASP 123 249 249 ASP ASP B . n 
B 1 124 ALA 124 250 250 ALA ALA B . n 
B 1 125 ALA 125 251 251 ALA ALA B . n 
B 1 126 LYS 126 252 252 LYS LYS B . n 
B 1 127 ASP 127 253 253 ASP ASP B . n 
B 1 128 ILE 128 254 254 ILE ILE B . n 
B 1 129 ILE 129 255 255 ILE ILE B . n 
B 1 130 ARG 130 256 256 ARG ARG B . n 
B 1 131 TYR 131 257 257 TYR TYR B . n 
B 1 132 ILE 132 258 258 ILE ILE B . n 
B 1 133 ILE 133 259 259 ILE ILE B . n 
B 1 134 GLY 134 260 260 GLY GLY B . n 
B 1 135 ILE 135 261 261 ILE ILE B . n 
B 1 136 GLY 136 262 262 GLY GLY B . n 
B 1 137 LYS 137 263 263 LYS LYS B . n 
B 1 138 HIS 138 264 264 HIS HIS B . n 
B 1 139 PHE 139 265 265 PHE PHE B . n 
B 1 140 GLN 140 266 266 GLN GLN B . n 
B 1 141 THR 141 267 267 THR THR B . n 
B 1 142 LYS 142 268 268 LYS LYS B . n 
B 1 143 GLU 143 269 269 GLU GLU B . n 
B 1 144 SER 144 270 270 SER SER B . n 
B 1 145 GLN 145 271 271 GLN GLN B . n 
B 1 146 GLU 146 272 272 GLU GLU B . n 
B 1 147 THR 147 273 273 THR THR B . n 
B 1 148 LEU 148 274 274 LEU LEU B . n 
B 1 149 HIS 149 275 275 HIS HIS B . n 
B 1 150 LYS 150 276 276 LYS LYS B . n 
B 1 151 PHE 151 277 277 PHE PHE B . n 
B 1 152 ALA 152 278 278 ALA ALA B . n 
B 1 153 SER 153 279 279 SER SER B . n 
B 1 154 LYS 154 280 280 LYS LYS B . n 
B 1 155 PRO 155 281 281 PRO PRO B . n 
B 1 156 ALA 156 282 282 ALA ALA B . n 
B 1 157 SER 157 283 283 SER SER B . n 
B 1 158 GLU 158 284 284 GLU GLU B . n 
B 1 159 PHE 159 285 285 PHE PHE B . n 
B 1 160 VAL 160 286 286 VAL VAL B . n 
B 1 161 LYS 161 287 287 LYS LYS B . n 
B 1 162 ILE 162 288 288 ILE ILE B . n 
B 1 163 LEU 163 289 289 LEU LEU B . n 
B 1 164 ASP 164 290 290 ASP ASP B . n 
B 1 165 THR 165 291 291 THR THR B . n 
B 1 166 PHE 166 292 292 PHE PHE B . n 
B 1 167 GLU 167 293 293 GLU GLU B . n 
B 1 168 LYS 168 294 294 LYS LYS B . n 
B 1 169 LEU 169 295 295 LEU LEU B . n 
B 1 170 LYS 170 296 296 LYS LYS B . n 
B 1 171 ASP 171 297 297 ASP ASP B . n 
B 1 172 LEU 172 298 298 LEU LEU B . n 
B 1 173 PHE 173 299 299 PHE PHE B . n 
B 1 174 THR 174 300 300 THR THR B . n 
B 1 175 GLU 175 301 301 GLU GLU B . n 
B 1 176 LEU 176 302 302 LEU LEU B . n 
B 1 177 GLN 177 303 303 GLN GLN B . n 
B 1 178 LYS 178 304 304 LYS LYS B . n 
B 1 179 LYS 179 305 305 LYS LYS B . n 
B 1 180 ILE 180 306 306 ILE ILE B . n 
B 1 181 TYR 181 307 307 TYR TYR B . n 
C 1 1   MET 1   127 ?   ?   ?   C . n 
C 1 2   GLY 2   128 128 GLY GLY C . n 
C 1 3   ASN 3   129 129 ASN ASN C . n 
C 1 4   VAL 4   130 130 VAL VAL C . n 
C 1 5   ASP 5   131 131 ASP ASP C . n 
C 1 6   LEU 6   132 132 LEU LEU C . n 
C 1 7   VAL 7   133 133 VAL VAL C . n 
C 1 8   PHE 8   134 134 PHE PHE C . n 
C 1 9   LEU 9   135 135 LEU LEU C . n 
C 1 10  PHE 10  136 136 PHE PHE C . n 
C 1 11  ASP 11  137 137 ASP ASP C . n 
C 1 12  GLY 12  138 138 GLY GLY C . n 
C 1 13  SER 13  139 139 SER SER C . n 
C 1 14  MET 14  140 140 MET MET C . n 
C 1 15  SER 15  141 141 SER SER C . n 
C 1 16  LEU 16  142 142 LEU LEU C . n 
C 1 17  GLN 17  143 143 GLN GLN C . n 
C 1 18  PRO 18  144 144 PRO PRO C . n 
C 1 19  ASP 19  145 145 ASP ASP C . n 
C 1 20  GLU 20  146 146 GLU GLU C . n 
C 1 21  PHE 21  147 147 PHE PHE C . n 
C 1 22  GLN 22  148 148 GLN GLN C . n 
C 1 23  LYS 23  149 149 LYS LYS C . n 
C 1 24  ILE 24  150 150 ILE ILE C . n 
C 1 25  LEU 25  151 151 LEU LEU C . n 
C 1 26  ASP 26  152 152 ASP ASP C . n 
C 1 27  PHE 27  153 153 PHE PHE C . n 
C 1 28  MET 28  154 154 MET MET C . n 
C 1 29  LYS 29  155 155 LYS LYS C . n 
C 1 30  ASP 30  156 156 ASP ASP C . n 
C 1 31  VAL 31  157 157 VAL VAL C . n 
C 1 32  MET 32  158 158 MET MET C . n 
C 1 33  LYS 33  159 159 LYS LYS C . n 
C 1 34  LYS 34  160 160 LYS LYS C . n 
C 1 35  LEU 35  161 161 LEU LEU C . n 
C 1 36  SER 36  162 162 SER SER C . n 
C 1 37  ASN 37  163 163 ASN ASN C . n 
C 1 38  THR 38  164 164 THR THR C . n 
C 1 39  SER 39  165 165 SER SER C . n 
C 1 40  TYR 40  166 166 TYR TYR C . n 
C 1 41  GLN 41  167 167 GLN GLN C . n 
C 1 42  PHE 42  168 168 PHE PHE C . n 
C 1 43  ALA 43  169 169 ALA ALA C . n 
C 1 44  ALA 44  170 170 ALA ALA C . n 
C 1 45  VAL 45  171 171 VAL VAL C . n 
C 1 46  GLN 46  172 172 GLN GLN C . n 
C 1 47  PHE 47  173 173 PHE PHE C . n 
C 1 48  SER 48  174 174 SER SER C . n 
C 1 49  THR 49  175 175 THR THR C . n 
C 1 50  SER 50  176 176 SER SER C . n 
C 1 51  TYR 51  177 177 TYR TYR C . n 
C 1 52  LYS 52  178 178 LYS LYS C . n 
C 1 53  THR 53  179 179 THR THR C . n 
C 1 54  GLU 54  180 180 GLU GLU C . n 
C 1 55  PHE 55  181 181 PHE PHE C . n 
C 1 56  ASP 56  182 182 ASP ASP C . n 
C 1 57  PHE 57  183 183 PHE PHE C . n 
C 1 58  SER 58  184 184 SER SER C . n 
C 1 59  ASP 59  185 185 ASP ASP C . n 
C 1 60  TYR 60  186 186 TYR TYR C . n 
C 1 61  VAL 61  187 187 VAL VAL C . n 
C 1 62  LYS 62  188 188 LYS LYS C . n 
C 1 63  TRP 63  189 189 TRP TRP C . n 
C 1 64  LYS 64  190 190 LYS LYS C . n 
C 1 65  ASP 65  191 191 ASP ASP C . n 
C 1 66  PRO 66  192 192 PRO PRO C . n 
C 1 67  ASP 67  193 193 ASP ASP C . n 
C 1 68  ALA 68  194 194 ALA ALA C . n 
C 1 69  LEU 69  195 195 LEU LEU C . n 
C 1 70  LEU 70  196 196 LEU LEU C . n 
C 1 71  LYS 71  197 197 LYS LYS C . n 
C 1 72  HIS 72  198 198 HIS HIS C . n 
C 1 73  VAL 73  199 199 VAL VAL C . n 
C 1 74  LYS 74  200 200 LYS LYS C . n 
C 1 75  HIS 75  201 201 HIS HIS C . n 
C 1 76  MET 76  202 202 MET MET C . n 
C 1 77  LEU 77  203 203 LEU LEU C . n 
C 1 78  LEU 78  204 204 LEU LEU C . n 
C 1 79  LEU 79  205 205 LEU LEU C . n 
C 1 80  THR 80  206 206 THR THR C . n 
C 1 81  ASN 81  207 207 ASN ASN C . n 
C 1 82  THR 82  208 208 THR THR C . n 
C 1 83  PHE 83  209 209 PHE PHE C . n 
C 1 84  GLY 84  210 210 GLY GLY C . n 
C 1 85  ALA 85  211 211 ALA ALA C . n 
C 1 86  ILE 86  212 212 ILE ILE C . n 
C 1 87  ASN 87  213 213 ASN ASN C . n 
C 1 88  TYR 88  214 214 TYR TYR C . n 
C 1 89  VAL 89  215 215 VAL VAL C . n 
C 1 90  ALA 90  216 216 ALA ALA C . n 
C 1 91  THR 91  217 217 THR THR C . n 
C 1 92  GLU 92  218 218 GLU GLU C . n 
C 1 93  VAL 93  219 219 VAL VAL C . n 
C 1 94  PHE 94  220 220 PHE PHE C . n 
C 1 95  ARG 95  221 221 ARG ARG C . n 
C 1 96  GLU 96  222 222 GLU GLU C . n 
C 1 97  GLU 97  223 223 GLU GLU C . n 
C 1 98  LEU 98  224 224 LEU LEU C . n 
C 1 99  GLY 99  225 225 GLY GLY C . n 
C 1 100 ALA 100 226 226 ALA ALA C . n 
C 1 101 ARG 101 227 227 ARG ARG C . n 
C 1 102 PRO 102 228 228 PRO PRO C . n 
C 1 103 ASP 103 229 229 ASP ASP C . n 
C 1 104 ALA 104 230 230 ALA ALA C . n 
C 1 105 THR 105 231 231 THR THR C . n 
C 1 106 LYS 106 232 232 LYS LYS C . n 
C 1 107 VAL 107 233 233 VAL VAL C . n 
C 1 108 LEU 108 234 234 LEU LEU C . n 
C 1 109 ILE 109 235 235 ILE ILE C . n 
C 1 110 ILE 110 236 236 ILE ILE C . n 
C 1 111 ILE 111 237 237 ILE ILE C . n 
C 1 112 THR 112 238 238 THR THR C . n 
C 1 113 ASP 113 239 239 ASP ASP C . n 
C 1 114 GLY 114 240 240 GLY GLY C . n 
C 1 115 GLU 115 241 241 GLU GLU C . n 
C 1 116 ALA 116 242 242 ALA ALA C . n 
C 1 117 THR 117 243 243 THR THR C . n 
C 1 118 ASP 118 244 244 ASP ASP C . n 
C 1 119 SER 119 245 245 SER SER C . n 
C 1 120 GLY 120 246 246 GLY GLY C . n 
C 1 121 ASN 121 247 247 ASN ASN C . n 
C 1 122 ILE 122 248 248 ILE ILE C . n 
C 1 123 ASP 123 249 249 ASP ASP C . n 
C 1 124 ALA 124 250 250 ALA ALA C . n 
C 1 125 ALA 125 251 251 ALA ALA C . n 
C 1 126 LYS 126 252 252 LYS LYS C . n 
C 1 127 ASP 127 253 253 ASP ASP C . n 
C 1 128 ILE 128 254 254 ILE ILE C . n 
C 1 129 ILE 129 255 255 ILE ILE C . n 
C 1 130 ARG 130 256 256 ARG ARG C . n 
C 1 131 TYR 131 257 257 TYR TYR C . n 
C 1 132 ILE 132 258 258 ILE ILE C . n 
C 1 133 ILE 133 259 259 ILE ILE C . n 
C 1 134 GLY 134 260 260 GLY GLY C . n 
C 1 135 ILE 135 261 261 ILE ILE C . n 
C 1 136 GLY 136 262 262 GLY GLY C . n 
C 1 137 LYS 137 263 263 LYS LYS C . n 
C 1 138 HIS 138 264 264 HIS HIS C . n 
C 1 139 PHE 139 265 265 PHE PHE C . n 
C 1 140 GLN 140 266 266 GLN GLN C . n 
C 1 141 THR 141 267 267 THR THR C . n 
C 1 142 LYS 142 268 268 LYS LYS C . n 
C 1 143 GLU 143 269 269 GLU GLU C . n 
C 1 144 SER 144 270 270 SER SER C . n 
C 1 145 GLN 145 271 271 GLN GLN C . n 
C 1 146 GLU 146 272 272 GLU GLU C . n 
C 1 147 THR 147 273 273 THR THR C . n 
C 1 148 LEU 148 274 274 LEU LEU C . n 
C 1 149 HIS 149 275 275 HIS HIS C . n 
C 1 150 LYS 150 276 276 LYS LYS C . n 
C 1 151 PHE 151 277 277 PHE PHE C . n 
C 1 152 ALA 152 278 278 ALA ALA C . n 
C 1 153 SER 153 279 279 SER SER C . n 
C 1 154 LYS 154 280 280 LYS LYS C . n 
C 1 155 PRO 155 281 281 PRO PRO C . n 
C 1 156 ALA 156 282 282 ALA ALA C . n 
C 1 157 SER 157 283 283 SER SER C . n 
C 1 158 GLU 158 284 284 GLU GLU C . n 
C 1 159 PHE 159 285 285 PHE PHE C . n 
C 1 160 VAL 160 286 286 VAL VAL C . n 
C 1 161 LYS 161 287 287 LYS LYS C . n 
C 1 162 ILE 162 288 288 ILE ILE C . n 
C 1 163 LEU 163 289 289 LEU LEU C . n 
C 1 164 ASP 164 290 290 ASP ASP C . n 
C 1 165 THR 165 291 291 THR THR C . n 
C 1 166 PHE 166 292 292 PHE PHE C . n 
C 1 167 GLU 167 293 293 GLU GLU C . n 
C 1 168 LYS 168 294 294 LYS LYS C . n 
C 1 169 LEU 169 295 295 LEU LEU C . n 
C 1 170 LYS 170 296 296 LYS LYS C . n 
C 1 171 ASP 171 297 297 ASP ASP C . n 
C 1 172 LEU 172 298 298 LEU LEU C . n 
C 1 173 PHE 173 299 299 PHE PHE C . n 
C 1 174 THR 174 300 300 THR THR C . n 
C 1 175 GLU 175 301 301 GLU GLU C . n 
C 1 176 LEU 176 302 302 LEU LEU C . n 
C 1 177 GLN 177 303 303 GLN GLN C . n 
C 1 178 LYS 178 304 304 LYS LYS C . n 
C 1 179 LYS 179 305 305 LYS LYS C . n 
C 1 180 ILE 180 306 306 ILE ILE C . n 
C 1 181 TYR 181 307 307 TYR TYR C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 ICF 1   1   1   ICF ICF A . 
E 3 GOL 1   2   2   GOL GOL A . 
F 2 ICF 1   2   2   ICF ICF B . 
G 3 GOL 1   3   3   GOL GOL B . 
H 3 GOL 1   4   4   GOL GOL B . 
I 4 MG  1   1   1   MG  MG  C . 
J 3 GOL 1   308 1   GOL GOL C . 
K 5 HOH 1   4   4   HOH HOH A . 
K 5 HOH 2   5   5   HOH HOH A . 
K 5 HOH 3   6   6   HOH HOH A . 
K 5 HOH 4   7   7   HOH HOH A . 
K 5 HOH 5   9   9   HOH HOH A . 
K 5 HOH 6   10  10  HOH HOH A . 
K 5 HOH 7   14  14  HOH HOH A . 
K 5 HOH 8   15  15  HOH HOH A . 
K 5 HOH 9   16  16  HOH HOH A . 
K 5 HOH 10  22  22  HOH HOH A . 
K 5 HOH 11  23  23  HOH HOH A . 
K 5 HOH 12  25  25  HOH HOH A . 
K 5 HOH 13  26  26  HOH HOH A . 
K 5 HOH 14  27  27  HOH HOH A . 
K 5 HOH 15  34  34  HOH HOH A . 
K 5 HOH 16  36  36  HOH HOH A . 
K 5 HOH 17  37  37  HOH HOH A . 
K 5 HOH 18  38  38  HOH HOH A . 
K 5 HOH 19  40  40  HOH HOH A . 
K 5 HOH 20  46  46  HOH HOH A . 
K 5 HOH 21  50  50  HOH HOH A . 
K 5 HOH 22  52  52  HOH HOH A . 
K 5 HOH 23  53  53  HOH HOH A . 
K 5 HOH 24  55  55  HOH HOH A . 
K 5 HOH 25  57  57  HOH HOH A . 
K 5 HOH 26  59  59  HOH HOH A . 
K 5 HOH 27  61  61  HOH HOH A . 
K 5 HOH 28  63  63  HOH HOH A . 
K 5 HOH 29  68  68  HOH HOH A . 
K 5 HOH 30  72  72  HOH HOH A . 
K 5 HOH 31  74  74  HOH HOH A . 
K 5 HOH 32  80  80  HOH HOH A . 
K 5 HOH 33  82  82  HOH HOH A . 
K 5 HOH 34  83  83  HOH HOH A . 
K 5 HOH 35  85  85  HOH HOH A . 
K 5 HOH 36  88  88  HOH HOH A . 
K 5 HOH 37  89  89  HOH HOH A . 
K 5 HOH 38  96  96  HOH HOH A . 
K 5 HOH 39  97  97  HOH HOH A . 
K 5 HOH 40  101 101 HOH HOH A . 
K 5 HOH 41  103 103 HOH HOH A . 
K 5 HOH 42  105 105 HOH HOH A . 
K 5 HOH 43  110 110 HOH HOH A . 
K 5 HOH 44  111 111 HOH HOH A . 
K 5 HOH 45  112 112 HOH HOH A . 
K 5 HOH 46  116 116 HOH HOH A . 
K 5 HOH 47  118 118 HOH HOH A . 
K 5 HOH 48  120 120 HOH HOH A . 
K 5 HOH 49  122 122 HOH HOH A . 
K 5 HOH 50  126 126 HOH HOH A . 
K 5 HOH 51  308 1   HOH HOH A . 
K 5 HOH 52  309 309 HOH HOH A . 
K 5 HOH 53  310 2   HOH HOH A . 
K 5 HOH 54  311 127 HOH HOH A . 
K 5 HOH 55  312 218 HOH HOH A . 
K 5 HOH 56  313 313 HOH HOH A . 
K 5 HOH 57  314 129 HOH HOH A . 
K 5 HOH 58  315 220 HOH HOH A . 
K 5 HOH 59  316 221 HOH HOH A . 
K 5 HOH 60  317 222 HOH HOH A . 
K 5 HOH 61  318 223 HOH HOH A . 
K 5 HOH 62  319 132 HOH HOH A . 
K 5 HOH 63  320 130 HOH HOH A . 
K 5 HOH 64  321 321 HOH HOH A . 
K 5 HOH 65  322 135 HOH HOH A . 
K 5 HOH 66  323 323 HOH HOH A . 
K 5 HOH 67  324 227 HOH HOH A . 
K 5 HOH 68  325 148 HOH HOH A . 
K 5 HOH 69  326 229 HOH HOH A . 
K 5 HOH 70  327 230 HOH HOH A . 
K 5 HOH 71  328 202 HOH HOH A . 
K 5 HOH 72  329 139 HOH HOH A . 
K 5 HOH 73  330 156 HOH HOH A . 
K 5 HOH 74  331 158 HOH HOH A . 
K 5 HOH 75  332 235 HOH HOH A . 
K 5 HOH 76  333 140 HOH HOH A . 
K 5 HOH 77  334 237 HOH HOH A . 
K 5 HOH 78  335 238 HOH HOH A . 
K 5 HOH 79  336 239 HOH HOH A . 
K 5 HOH 80  337 337 HOH HOH A . 
K 5 HOH 81  338 160 HOH HOH A . 
K 5 HOH 82  339 241 HOH HOH A . 
K 5 HOH 83  340 242 HOH HOH A . 
K 5 HOH 84  341 243 HOH HOH A . 
K 5 HOH 85  342 146 HOH HOH A . 
K 5 HOH 86  343 161 HOH HOH A . 
K 5 HOH 87  344 147 HOH HOH A . 
K 5 HOH 88  345 166 HOH HOH A . 
K 5 HOH 89  346 346 HOH HOH A . 
K 5 HOH 90  347 149 HOH HOH A . 
K 5 HOH 91  348 348 HOH HOH A . 
K 5 HOH 92  349 168 HOH HOH A . 
K 5 HOH 93  350 173 HOH HOH A . 
K 5 HOH 94  351 176 HOH HOH A . 
K 5 HOH 95  352 177 HOH HOH A . 
K 5 HOH 96  353 217 HOH HOH A . 
K 5 HOH 97  354 185 HOH HOH A . 
K 5 HOH 98  355 355 HOH HOH A . 
K 5 HOH 99  356 356 HOH HOH A . 
K 5 HOH 100 357 357 HOH HOH A . 
K 5 HOH 101 358 253 HOH HOH A . 
K 5 HOH 102 359 359 HOH HOH A . 
K 5 HOH 103 360 259 HOH HOH A . 
K 5 HOH 104 361 361 HOH HOH A . 
K 5 HOH 105 362 260 HOH HOH A . 
K 5 HOH 106 363 297 HOH HOH A . 
K 5 HOH 107 364 298 HOH HOH A . 
K 5 HOH 108 365 365 HOH HOH A . 
K 5 HOH 109 366 299 HOH HOH A . 
K 5 HOH 110 367 300 HOH HOH A . 
K 5 HOH 111 368 368 HOH HOH A . 
K 5 HOH 112 369 261 HOH HOH A . 
K 5 HOH 113 370 263 HOH HOH A . 
K 5 HOH 114 371 264 HOH HOH A . 
K 5 HOH 115 372 372 HOH HOH A . 
K 5 HOH 116 373 281 HOH HOH A . 
K 5 HOH 117 374 374 HOH HOH A . 
K 5 HOH 118 375 375 HOH HOH A . 
K 5 HOH 119 376 376 HOH HOH A . 
K 5 HOH 120 377 305 HOH HOH A . 
K 5 HOH 121 378 288 HOH HOH A . 
K 5 HOH 122 379 207 HOH HOH A . 
K 5 HOH 123 380 209 HOH HOH A . 
K 5 HOH 124 381 381 HOH HOH A . 
K 5 HOH 125 382 212 HOH HOH A . 
K 5 HOH 126 383 383 HOH HOH A . 
K 5 HOH 127 385 385 HOH HOH A . 
K 5 HOH 128 390 390 HOH HOH A . 
K 5 HOH 129 391 391 HOH HOH A . 
K 5 HOH 130 395 395 HOH HOH A . 
K 5 HOH 131 398 398 HOH HOH A . 
K 5 HOH 132 400 400 HOH HOH A . 
K 5 HOH 133 402 402 HOH HOH A . 
K 5 HOH 134 405 188 HOH HOH A . 
K 5 HOH 135 406 189 HOH HOH A . 
K 5 HOH 136 409 409 HOH HOH A . 
K 5 HOH 137 411 411 HOH HOH A . 
K 5 HOH 138 412 256 HOH HOH A . 
K 5 HOH 139 413 257 HOH HOH A . 
K 5 HOH 140 414 258 HOH HOH A . 
K 5 HOH 141 416 416 HOH HOH A . 
K 5 HOH 142 418 418 HOH HOH A . 
K 5 HOH 143 419 419 HOH HOH A . 
K 5 HOH 144 421 262 HOH HOH A . 
K 5 HOH 145 422 422 HOH HOH A . 
K 5 HOH 146 423 423 HOH HOH A . 
K 5 HOH 147 424 265 HOH HOH A . 
K 5 HOH 148 425 266 HOH HOH A . 
K 5 HOH 149 427 427 HOH HOH A . 
K 5 HOH 150 428 428 HOH HOH A . 
K 5 HOH 151 435 435 HOH HOH A . 
K 5 HOH 152 437 437 HOH HOH A . 
K 5 HOH 153 443 443 HOH HOH A . 
K 5 HOH 154 445 445 HOH HOH A . 
K 5 HOH 155 447 447 HOH HOH A . 
K 5 HOH 156 450 450 HOH HOH A . 
K 5 HOH 157 451 451 HOH HOH A . 
K 5 HOH 158 452 452 HOH HOH A . 
K 5 HOH 159 453 453 HOH HOH A . 
K 5 HOH 160 462 462 HOH HOH A . 
K 5 HOH 161 463 463 HOH HOH A . 
K 5 HOH 162 464 464 HOH HOH A . 
K 5 HOH 163 465 465 HOH HOH A . 
K 5 HOH 164 467 467 HOH HOH A . 
K 5 HOH 165 473 473 HOH HOH A . 
K 5 HOH 166 474 474 HOH HOH A . 
K 5 HOH 167 478 478 HOH HOH A . 
K 5 HOH 168 481 481 HOH HOH A . 
K 5 HOH 169 486 486 HOH HOH A . 
K 5 HOH 170 487 487 HOH HOH A . 
K 5 HOH 171 492 492 HOH HOH A . 
K 5 HOH 172 495 495 HOH HOH A . 
K 5 HOH 173 499 499 HOH HOH A . 
K 5 HOH 174 500 500 HOH HOH A . 
K 5 HOH 175 503 503 HOH HOH A . 
K 5 HOH 176 507 507 HOH HOH A . 
K 5 HOH 177 508 508 HOH HOH A . 
K 5 HOH 178 512 512 HOH HOH A . 
K 5 HOH 179 515 515 HOH HOH A . 
K 5 HOH 180 517 517 HOH HOH A . 
K 5 HOH 181 529 529 HOH HOH A . 
K 5 HOH 182 533 533 HOH HOH A . 
K 5 HOH 183 535 535 HOH HOH A . 
K 5 HOH 184 538 538 HOH HOH A . 
K 5 HOH 185 541 541 HOH HOH A . 
K 5 HOH 186 543 543 HOH HOH A . 
K 5 HOH 187 544 544 HOH HOH A . 
K 5 HOH 188 545 545 HOH HOH A . 
K 5 HOH 189 547 547 HOH HOH A . 
K 5 HOH 190 549 549 HOH HOH A . 
K 5 HOH 191 551 551 HOH HOH A . 
K 5 HOH 192 552 552 HOH HOH A . 
K 5 HOH 193 557 557 HOH HOH A . 
K 5 HOH 194 563 563 HOH HOH A . 
K 5 HOH 195 567 567 HOH HOH A . 
K 5 HOH 196 568 568 HOH HOH A . 
K 5 HOH 197 570 570 HOH HOH A . 
K 5 HOH 198 573 573 HOH HOH A . 
K 5 HOH 199 574 574 HOH HOH A . 
K 5 HOH 200 581 581 HOH HOH A . 
K 5 HOH 201 584 584 HOH HOH A . 
K 5 HOH 202 590 590 HOH HOH A . 
K 5 HOH 203 592 592 HOH HOH A . 
K 5 HOH 204 594 594 HOH HOH A . 
K 5 HOH 205 599 599 HOH HOH A . 
K 5 HOH 206 600 600 HOH HOH A . 
K 5 HOH 207 601 601 HOH HOH A . 
K 5 HOH 208 602 602 HOH HOH A . 
K 5 HOH 209 604 604 HOH HOH A . 
K 5 HOH 210 605 605 HOH HOH A . 
K 5 HOH 211 607 607 HOH HOH A . 
K 5 HOH 212 613 613 HOH HOH A . 
K 5 HOH 213 618 618 HOH HOH A . 
K 5 HOH 214 624 624 HOH HOH A . 
K 5 HOH 215 625 625 HOH HOH A . 
K 5 HOH 216 628 628 HOH HOH A . 
K 5 HOH 217 639 639 HOH HOH A . 
K 5 HOH 218 640 640 HOH HOH A . 
K 5 HOH 219 643 643 HOH HOH A . 
L 5 HOH 1   11  11  HOH HOH B . 
L 5 HOH 2   12  12  HOH HOH B . 
L 5 HOH 3   13  13  HOH HOH B . 
L 5 HOH 4   17  17  HOH HOH B . 
L 5 HOH 5   19  19  HOH HOH B . 
L 5 HOH 6   20  20  HOH HOH B . 
L 5 HOH 7   21  21  HOH HOH B . 
L 5 HOH 8   28  28  HOH HOH B . 
L 5 HOH 9   29  29  HOH HOH B . 
L 5 HOH 10  31  31  HOH HOH B . 
L 5 HOH 11  33  33  HOH HOH B . 
L 5 HOH 12  41  41  HOH HOH B . 
L 5 HOH 13  43  43  HOH HOH B . 
L 5 HOH 14  44  44  HOH HOH B . 
L 5 HOH 15  45  45  HOH HOH B . 
L 5 HOH 16  48  48  HOH HOH B . 
L 5 HOH 17  49  49  HOH HOH B . 
L 5 HOH 18  56  56  HOH HOH B . 
L 5 HOH 19  58  58  HOH HOH B . 
L 5 HOH 20  64  64  HOH HOH B . 
L 5 HOH 21  66  66  HOH HOH B . 
L 5 HOH 22  75  75  HOH HOH B . 
L 5 HOH 23  76  76  HOH HOH B . 
L 5 HOH 24  79  79  HOH HOH B . 
L 5 HOH 25  91  91  HOH HOH B . 
L 5 HOH 26  92  92  HOH HOH B . 
L 5 HOH 27  94  94  HOH HOH B . 
L 5 HOH 28  95  95  HOH HOH B . 
L 5 HOH 29  100 100 HOH HOH B . 
L 5 HOH 30  104 104 HOH HOH B . 
L 5 HOH 31  106 106 HOH HOH B . 
L 5 HOH 32  113 113 HOH HOH B . 
L 5 HOH 33  114 114 HOH HOH B . 
L 5 HOH 34  115 115 HOH HOH B . 
L 5 HOH 35  117 117 HOH HOH B . 
L 5 HOH 36  308 308 HOH HOH B . 
L 5 HOH 37  309 128 HOH HOH B . 
L 5 HOH 38  310 310 HOH HOH B . 
L 5 HOH 39  313 131 HOH HOH B . 
L 5 HOH 40  314 314 HOH HOH B . 
L 5 HOH 41  315 315 HOH HOH B . 
L 5 HOH 42  316 316 HOH HOH B . 
L 5 HOH 43  317 317 HOH HOH B . 
L 5 HOH 44  318 318 HOH HOH B . 
L 5 HOH 45  320 225 HOH HOH B . 
L 5 HOH 46  321 133 HOH HOH B . 
L 5 HOH 47  322 322 HOH HOH B . 
L 5 HOH 48  323 330 HOH HOH B . 
L 5 HOH 49  324 343 HOH HOH B . 
L 5 HOH 50  325 345 HOH HOH B . 
L 5 HOH 51  326 326 HOH HOH B . 
L 5 HOH 52  327 138 HOH HOH B . 
L 5 HOH 53  328 328 HOH HOH B . 
L 5 HOH 54  329 232 HOH HOH B . 
L 5 HOH 55  330 233 HOH HOH B . 
L 5 HOH 56  331 331 HOH HOH B . 
L 5 HOH 57  332 332 HOH HOH B . 
L 5 HOH 58  333 236 HOH HOH B . 
L 5 HOH 59  334 349 HOH HOH B . 
L 5 HOH 60  335 142 HOH HOH B . 
L 5 HOH 61  336 336 HOH HOH B . 
L 5 HOH 62  337 350 HOH HOH B . 
L 5 HOH 63  338 144 HOH HOH B . 
L 5 HOH 64  339 145 HOH HOH B . 
L 5 HOH 65  340 340 HOH HOH B . 
L 5 HOH 66  341 341 HOH HOH B . 
L 5 HOH 67  342 371 HOH HOH B . 
L 5 HOH 68  343 245 HOH HOH B . 
L 5 HOH 69  344 378 HOH HOH B . 
L 5 HOH 70  345 247 HOH HOH B . 
L 5 HOH 71  346 169 HOH HOH B . 
L 5 HOH 72  347 190 HOH HOH B . 
L 5 HOH 73  348 191 HOH HOH B . 
L 5 HOH 74  349 249 HOH HOH B . 
L 5 HOH 75  350 250 HOH HOH B . 
L 5 HOH 76  351 151 HOH HOH B . 
L 5 HOH 77  352 352 HOH HOH B . 
L 5 HOH 78  353 353 HOH HOH B . 
L 5 HOH 79  354 354 HOH HOH B . 
L 5 HOH 80  355 152 HOH HOH B . 
L 5 HOH 81  356 153 HOH HOH B . 
L 5 HOH 82  357 154 HOH HOH B . 
L 5 HOH 83  358 193 HOH HOH B . 
L 5 HOH 84  359 196 HOH HOH B . 
L 5 HOH 85  360 360 HOH HOH B . 
L 5 HOH 86  361 204 HOH HOH B . 
L 5 HOH 87  362 362 HOH HOH B . 
L 5 HOH 88  363 363 HOH HOH B . 
L 5 HOH 89  364 205 HOH HOH B . 
L 5 HOH 90  365 159 HOH HOH B . 
L 5 HOH 91  366 206 HOH HOH B . 
L 5 HOH 92  367 208 HOH HOH B . 
L 5 HOH 93  368 211 HOH HOH B . 
L 5 HOH 94  369 301 HOH HOH B . 
L 5 HOH 95  370 370 HOH HOH B . 
L 5 HOH 96  371 303 HOH HOH B . 
L 5 HOH 97  372 164 HOH HOH B . 
L 5 HOH 98  373 165 HOH HOH B . 
L 5 HOH 99  374 215 HOH HOH B . 
L 5 HOH 100 377 377 HOH HOH B . 
L 5 HOH 101 378 306 HOH HOH B . 
L 5 HOH 102 379 307 HOH HOH B . 
L 5 HOH 103 380 380 HOH HOH B . 
L 5 HOH 104 381 170 HOH HOH B . 
L 5 HOH 105 382 382 HOH HOH B . 
L 5 HOH 106 383 171 HOH HOH B . 
L 5 HOH 107 384 172 HOH HOH B . 
L 5 HOH 108 386 174 HOH HOH B . 
L 5 HOH 109 387 387 HOH HOH B . 
L 5 HOH 110 389 389 HOH HOH B . 
L 5 HOH 111 392 178 HOH HOH B . 
L 5 HOH 112 394 180 HOH HOH B . 
L 5 HOH 113 395 181 HOH HOH B . 
L 5 HOH 114 396 182 HOH HOH B . 
L 5 HOH 115 397 397 HOH HOH B . 
L 5 HOH 116 398 183 HOH HOH B . 
L 5 HOH 117 399 184 HOH HOH B . 
L 5 HOH 118 401 401 HOH HOH B . 
L 5 HOH 119 403 403 HOH HOH B . 
L 5 HOH 120 415 415 HOH HOH B . 
L 5 HOH 121 417 417 HOH HOH B . 
L 5 HOH 122 420 420 HOH HOH B . 
L 5 HOH 123 426 426 HOH HOH B . 
L 5 HOH 124 427 267 HOH HOH B . 
L 5 HOH 125 428 268 HOH HOH B . 
L 5 HOH 126 429 269 HOH HOH B . 
L 5 HOH 127 430 270 HOH HOH B . 
L 5 HOH 128 431 271 HOH HOH B . 
L 5 HOH 129 432 272 HOH HOH B . 
L 5 HOH 130 433 433 HOH HOH B . 
L 5 HOH 131 434 273 HOH HOH B . 
L 5 HOH 132 435 274 HOH HOH B . 
L 5 HOH 133 436 275 HOH HOH B . 
L 5 HOH 134 437 276 HOH HOH B . 
L 5 HOH 135 438 438 HOH HOH B . 
L 5 HOH 136 439 277 HOH HOH B . 
L 5 HOH 137 440 278 HOH HOH B . 
L 5 HOH 138 441 279 HOH HOH B . 
L 5 HOH 139 442 442 HOH HOH B . 
L 5 HOH 140 443 280 HOH HOH B . 
L 5 HOH 141 444 444 HOH HOH B . 
L 5 HOH 142 446 282 HOH HOH B . 
L 5 HOH 143 447 283 HOH HOH B . 
L 5 HOH 144 448 448 HOH HOH B . 
L 5 HOH 145 449 284 HOH HOH B . 
L 5 HOH 146 450 285 HOH HOH B . 
L 5 HOH 147 451 286 HOH HOH B . 
L 5 HOH 148 452 287 HOH HOH B . 
L 5 HOH 149 454 454 HOH HOH B . 
L 5 HOH 150 455 455 HOH HOH B . 
L 5 HOH 151 458 458 HOH HOH B . 
L 5 HOH 152 459 459 HOH HOH B . 
L 5 HOH 153 466 466 HOH HOH B . 
L 5 HOH 154 468 468 HOH HOH B . 
L 5 HOH 155 469 469 HOH HOH B . 
L 5 HOH 156 482 482 HOH HOH B . 
L 5 HOH 157 483 483 HOH HOH B . 
L 5 HOH 158 485 485 HOH HOH B . 
L 5 HOH 159 489 489 HOH HOH B . 
L 5 HOH 160 491 491 HOH HOH B . 
L 5 HOH 161 493 493 HOH HOH B . 
L 5 HOH 162 494 494 HOH HOH B . 
L 5 HOH 163 496 496 HOH HOH B . 
L 5 HOH 164 497 497 HOH HOH B . 
L 5 HOH 165 502 502 HOH HOH B . 
L 5 HOH 166 505 505 HOH HOH B . 
L 5 HOH 167 506 506 HOH HOH B . 
L 5 HOH 168 509 509 HOH HOH B . 
L 5 HOH 169 510 510 HOH HOH B . 
L 5 HOH 170 511 511 HOH HOH B . 
L 5 HOH 171 514 514 HOH HOH B . 
L 5 HOH 172 519 519 HOH HOH B . 
L 5 HOH 173 520 520 HOH HOH B . 
L 5 HOH 174 524 524 HOH HOH B . 
L 5 HOH 175 525 525 HOH HOH B . 
L 5 HOH 176 526 526 HOH HOH B . 
L 5 HOH 177 527 527 HOH HOH B . 
L 5 HOH 178 530 530 HOH HOH B . 
L 5 HOH 179 536 536 HOH HOH B . 
L 5 HOH 180 537 537 HOH HOH B . 
L 5 HOH 181 539 539 HOH HOH B . 
L 5 HOH 182 542 542 HOH HOH B . 
L 5 HOH 183 548 548 HOH HOH B . 
L 5 HOH 184 550 550 HOH HOH B . 
L 5 HOH 185 555 555 HOH HOH B . 
L 5 HOH 186 556 556 HOH HOH B . 
L 5 HOH 187 558 558 HOH HOH B . 
L 5 HOH 188 561 561 HOH HOH B . 
L 5 HOH 189 562 562 HOH HOH B . 
L 5 HOH 190 569 569 HOH HOH B . 
L 5 HOH 191 571 571 HOH HOH B . 
L 5 HOH 192 572 572 HOH HOH B . 
L 5 HOH 193 579 579 HOH HOH B . 
L 5 HOH 194 580 580 HOH HOH B . 
L 5 HOH 195 582 582 HOH HOH B . 
L 5 HOH 196 585 585 HOH HOH B . 
L 5 HOH 197 586 586 HOH HOH B . 
L 5 HOH 198 587 587 HOH HOH B . 
L 5 HOH 199 588 588 HOH HOH B . 
L 5 HOH 200 593 593 HOH HOH B . 
L 5 HOH 201 595 595 HOH HOH B . 
L 5 HOH 202 596 596 HOH HOH B . 
L 5 HOH 203 598 598 HOH HOH B . 
L 5 HOH 204 612 612 HOH HOH B . 
L 5 HOH 205 615 615 HOH HOH B . 
L 5 HOH 206 616 616 HOH HOH B . 
L 5 HOH 207 617 617 HOH HOH B . 
L 5 HOH 208 619 619 HOH HOH B . 
L 5 HOH 209 621 621 HOH HOH B . 
L 5 HOH 210 622 622 HOH HOH B . 
L 5 HOH 211 626 626 HOH HOH B . 
L 5 HOH 212 627 627 HOH HOH B . 
L 5 HOH 213 629 629 HOH HOH B . 
L 5 HOH 214 630 630 HOH HOH B . 
L 5 HOH 215 631 631 HOH HOH B . 
L 5 HOH 216 632 632 HOH HOH B . 
L 5 HOH 217 633 633 HOH HOH B . 
L 5 HOH 218 634 634 HOH HOH B . 
L 5 HOH 219 635 635 HOH HOH B . 
L 5 HOH 220 636 636 HOH HOH B . 
L 5 HOH 221 637 637 HOH HOH B . 
L 5 HOH 222 641 641 HOH HOH B . 
L 5 HOH 223 644 644 HOH HOH B . 
M 5 HOH 1   3   3   HOH HOH C . 
M 5 HOH 2   8   8   HOH HOH C . 
M 5 HOH 3   18  18  HOH HOH C . 
M 5 HOH 4   24  24  HOH HOH C . 
M 5 HOH 5   30  30  HOH HOH C . 
M 5 HOH 6   32  32  HOH HOH C . 
M 5 HOH 7   35  35  HOH HOH C . 
M 5 HOH 8   39  39  HOH HOH C . 
M 5 HOH 9   42  42  HOH HOH C . 
M 5 HOH 10  47  47  HOH HOH C . 
M 5 HOH 11  51  51  HOH HOH C . 
M 5 HOH 12  54  54  HOH HOH C . 
M 5 HOH 13  60  60  HOH HOH C . 
M 5 HOH 14  62  62  HOH HOH C . 
M 5 HOH 15  65  65  HOH HOH C . 
M 5 HOH 16  67  67  HOH HOH C . 
M 5 HOH 17  69  69  HOH HOH C . 
M 5 HOH 18  70  70  HOH HOH C . 
M 5 HOH 19  71  71  HOH HOH C . 
M 5 HOH 20  73  73  HOH HOH C . 
M 5 HOH 21  77  77  HOH HOH C . 
M 5 HOH 22  78  78  HOH HOH C . 
M 5 HOH 23  81  81  HOH HOH C . 
M 5 HOH 24  84  84  HOH HOH C . 
M 5 HOH 25  86  86  HOH HOH C . 
M 5 HOH 26  87  87  HOH HOH C . 
M 5 HOH 27  90  90  HOH HOH C . 
M 5 HOH 28  93  93  HOH HOH C . 
M 5 HOH 29  98  98  HOH HOH C . 
M 5 HOH 30  99  99  HOH HOH C . 
M 5 HOH 31  102 102 HOH HOH C . 
M 5 HOH 32  107 107 HOH HOH C . 
M 5 HOH 33  108 108 HOH HOH C . 
M 5 HOH 34  109 109 HOH HOH C . 
M 5 HOH 35  119 119 HOH HOH C . 
M 5 HOH 36  121 121 HOH HOH C . 
M 5 HOH 37  123 123 HOH HOH C . 
M 5 HOH 38  124 124 HOH HOH C . 
M 5 HOH 39  125 125 HOH HOH C . 
M 5 HOH 40  311 311 HOH HOH C . 
M 5 HOH 41  312 312 HOH HOH C . 
M 5 HOH 42  313 192 HOH HOH C . 
M 5 HOH 43  314 219 HOH HOH C . 
M 5 HOH 44  315 194 HOH HOH C . 
M 5 HOH 45  316 195 HOH HOH C . 
M 5 HOH 46  317 137 HOH HOH C . 
M 5 HOH 47  318 197 HOH HOH C . 
M 5 HOH 48  319 224 HOH HOH C . 
M 5 HOH 49  320 320 HOH HOH C . 
M 5 HOH 50  321 134 HOH HOH C . 
M 5 HOH 51  322 226 HOH HOH C . 
M 5 HOH 52  323 200 HOH HOH C . 
M 5 HOH 53  324 136 HOH HOH C . 
M 5 HOH 54  325 228 HOH HOH C . 
M 5 HOH 55  326 201 HOH HOH C . 
M 5 HOH 56  327 327 HOH HOH C . 
M 5 HOH 57  328 231 HOH HOH C . 
M 5 HOH 58  329 329 HOH HOH C . 
M 5 HOH 59  330 203 HOH HOH C . 
M 5 HOH 60  331 234 HOH HOH C . 
M 5 HOH 61  332 155 HOH HOH C . 
M 5 HOH 62  333 333 HOH HOH C . 
M 5 HOH 63  334 141 HOH HOH C . 
M 5 HOH 64  335 335 HOH HOH C . 
M 5 HOH 65  336 319 HOH HOH C . 
M 5 HOH 66  337 143 HOH HOH C . 
M 5 HOH 67  338 240 HOH HOH C . 
M 5 HOH 68  339 339 HOH HOH C . 
M 5 HOH 69  340 198 HOH HOH C . 
M 5 HOH 70  341 199 HOH HOH C . 
M 5 HOH 71  342 244 HOH HOH C . 
M 5 HOH 72  343 210 HOH HOH C . 
M 5 HOH 73  344 246 HOH HOH C . 
M 5 HOH 74  345 324 HOH HOH C . 
M 5 HOH 75  346 325 HOH HOH C . 
M 5 HOH 76  347 248 HOH HOH C . 
M 5 HOH 77  348 150 HOH HOH C . 
M 5 HOH 78  349 214 HOH HOH C . 
M 5 HOH 79  350 334 HOH HOH C . 
M 5 HOH 80  351 290 HOH HOH C . 
M 5 HOH 81  352 291 HOH HOH C . 
M 5 HOH 82  353 292 HOH HOH C . 
M 5 HOH 83  354 293 HOH HOH C . 
M 5 HOH 84  355 338 HOH HOH C . 
M 5 HOH 85  356 342 HOH HOH C . 
M 5 HOH 86  357 344 HOH HOH C . 
M 5 HOH 87  358 294 HOH HOH C . 
M 5 HOH 88  359 347 HOH HOH C . 
M 5 HOH 89  360 295 HOH HOH C . 
M 5 HOH 90  361 157 HOH HOH C . 
M 5 HOH 91  362 296 HOH HOH C . 
M 5 HOH 92  363 213 HOH HOH C . 
M 5 HOH 93  364 364 HOH HOH C . 
M 5 HOH 94  365 351 HOH HOH C . 
M 5 HOH 95  366 366 HOH HOH C . 
M 5 HOH 96  367 367 HOH HOH C . 
M 5 HOH 97  368 162 HOH HOH C . 
M 5 HOH 98  369 163 HOH HOH C . 
M 5 HOH 99  370 302 HOH HOH C . 
M 5 HOH 100 371 216 HOH HOH C . 
M 5 HOH 101 372 358 HOH HOH C . 
M 5 HOH 102 373 304 HOH HOH C . 
M 5 HOH 103 374 369 HOH HOH C . 
M 5 HOH 104 375 167 HOH HOH C . 
M 5 HOH 105 376 373 HOH HOH C . 
M 5 HOH 106 377 388 HOH HOH C . 
M 5 HOH 107 378 393 HOH HOH C . 
M 5 HOH 108 379 379 HOH HOH C . 
M 5 HOH 109 380 404 HOH HOH C . 
M 5 HOH 110 381 407 HOH HOH C . 
M 5 HOH 111 382 408 HOH HOH C . 
M 5 HOH 112 383 410 HOH HOH C . 
M 5 HOH 113 384 384 HOH HOH C . 
M 5 HOH 114 385 456 HOH HOH C . 
M 5 HOH 115 386 386 HOH HOH C . 
M 5 HOH 116 388 175 HOH HOH C . 
M 5 HOH 117 392 392 HOH HOH C . 
M 5 HOH 118 393 179 HOH HOH C . 
M 5 HOH 119 394 394 HOH HOH C . 
M 5 HOH 120 396 396 HOH HOH C . 
M 5 HOH 121 399 399 HOH HOH C . 
M 5 HOH 122 402 186 HOH HOH C . 
M 5 HOH 123 404 187 HOH HOH C . 
M 5 HOH 124 405 405 HOH HOH C . 
M 5 HOH 125 406 406 HOH HOH C . 
M 5 HOH 126 407 251 HOH HOH C . 
M 5 HOH 127 408 252 HOH HOH C . 
M 5 HOH 128 410 254 HOH HOH C . 
M 5 HOH 129 411 255 HOH HOH C . 
M 5 HOH 130 412 412 HOH HOH C . 
M 5 HOH 131 413 413 HOH HOH C . 
M 5 HOH 132 414 414 HOH HOH C . 
M 5 HOH 133 421 421 HOH HOH C . 
M 5 HOH 134 424 424 HOH HOH C . 
M 5 HOH 135 425 425 HOH HOH C . 
M 5 HOH 136 429 429 HOH HOH C . 
M 5 HOH 137 430 430 HOH HOH C . 
M 5 HOH 138 431 431 HOH HOH C . 
M 5 HOH 139 432 432 HOH HOH C . 
M 5 HOH 140 434 434 HOH HOH C . 
M 5 HOH 141 436 436 HOH HOH C . 
M 5 HOH 142 439 439 HOH HOH C . 
M 5 HOH 143 440 440 HOH HOH C . 
M 5 HOH 144 441 441 HOH HOH C . 
M 5 HOH 145 446 446 HOH HOH C . 
M 5 HOH 146 449 449 HOH HOH C . 
M 5 HOH 147 456 289 HOH HOH C . 
M 5 HOH 148 457 457 HOH HOH C . 
M 5 HOH 149 460 460 HOH HOH C . 
M 5 HOH 150 461 461 HOH HOH C . 
M 5 HOH 151 470 470 HOH HOH C . 
M 5 HOH 152 471 471 HOH HOH C . 
M 5 HOH 153 472 472 HOH HOH C . 
M 5 HOH 154 475 475 HOH HOH C . 
M 5 HOH 155 476 476 HOH HOH C . 
M 5 HOH 156 477 477 HOH HOH C . 
M 5 HOH 157 479 479 HOH HOH C . 
M 5 HOH 158 480 480 HOH HOH C . 
M 5 HOH 159 484 484 HOH HOH C . 
M 5 HOH 160 488 488 HOH HOH C . 
M 5 HOH 161 490 490 HOH HOH C . 
M 5 HOH 162 498 498 HOH HOH C . 
M 5 HOH 163 501 501 HOH HOH C . 
M 5 HOH 164 504 504 HOH HOH C . 
M 5 HOH 165 513 513 HOH HOH C . 
M 5 HOH 166 516 516 HOH HOH C . 
M 5 HOH 167 518 518 HOH HOH C . 
M 5 HOH 168 521 521 HOH HOH C . 
M 5 HOH 169 522 522 HOH HOH C . 
M 5 HOH 170 523 523 HOH HOH C . 
M 5 HOH 171 528 528 HOH HOH C . 
M 5 HOH 172 531 531 HOH HOH C . 
M 5 HOH 173 532 532 HOH HOH C . 
M 5 HOH 174 534 534 HOH HOH C . 
M 5 HOH 175 540 540 HOH HOH C . 
M 5 HOH 176 546 546 HOH HOH C . 
M 5 HOH 177 553 553 HOH HOH C . 
M 5 HOH 178 554 554 HOH HOH C . 
M 5 HOH 179 559 559 HOH HOH C . 
M 5 HOH 180 560 560 HOH HOH C . 
M 5 HOH 181 564 564 HOH HOH C . 
M 5 HOH 182 565 565 HOH HOH C . 
M 5 HOH 183 566 566 HOH HOH C . 
M 5 HOH 184 575 575 HOH HOH C . 
M 5 HOH 185 576 576 HOH HOH C . 
M 5 HOH 186 577 577 HOH HOH C . 
M 5 HOH 187 578 578 HOH HOH C . 
M 5 HOH 188 583 583 HOH HOH C . 
M 5 HOH 189 589 589 HOH HOH C . 
M 5 HOH 190 591 591 HOH HOH C . 
M 5 HOH 191 597 597 HOH HOH C . 
M 5 HOH 192 603 603 HOH HOH C . 
M 5 HOH 193 606 606 HOH HOH C . 
M 5 HOH 194 608 608 HOH HOH C . 
M 5 HOH 195 609 609 HOH HOH C . 
M 5 HOH 196 610 610 HOH HOH C . 
M 5 HOH 197 611 611 HOH HOH C . 
M 5 HOH 198 614 614 HOH HOH C . 
M 5 HOH 199 620 620 HOH HOH C . 
M 5 HOH 200 623 623 HOH HOH C . 
M 5 HOH 201 638 638 HOH HOH C . 
M 5 HOH 202 642 642 HOH HOH C . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
3 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,D,E,K   
2 1 B,F,G,H,L 
3 1 C,I,J,M   
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-06-23 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-10-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.pdbx_refine_id 
1  ? refined 29.6730 24.3990 -2.5750 -0.0177 0.0300  0.0490  -0.0050 0.0024  0.0121  1.0971  2.0845 1.5922 -0.4454 -0.3480 0.8998  
-0.0298 -0.0443 0.0740  0.0766  0.0236  0.2755  0.0643  0.0452  -0.2477 'X-RAY DIFFRACTION' 
2  ? refined 32.2790 32.9090 -5.0940 0.0136  0.0047  0.0537  0.0208  -0.0117 0.0171  2.0600  1.8107 0.5824 -1.4694 -0.8991 0.9580  
0.1174  -0.1073 -0.0102 0.1748  0.1030  0.1784  -0.1774 -0.1840 -0.1152 'X-RAY DIFFRACTION' 
3  ? refined 39.8660 30.1780 4.7510  0.0336  0.0137  0.0409  -0.0125 -0.0030 -0.0097 1.3110  1.3423 0.9667 -0.3830 0.1143  0.0355  
-0.0704 0.0467  0.0238  -0.1293 0.1687  0.0526  0.2045  -0.1431 -0.0034 'X-RAY DIFFRACTION' 
4  ? refined 38.8190 18.7810 5.3290  0.0236  0.0219  0.0139  -0.0022 -0.0081 -0.0007 1.5808  0.7614 0.9767 0.1211  -0.4508 -0.3114 
-0.0145 0.0420  -0.0275 -0.0980 0.0135  -0.0363 0.0781  0.0160  0.0166  'X-RAY DIFFRACTION' 
5  ? refined 38.2800 9.6220  7.6450  0.0285  0.0280  0.0318  -0.0104 -0.0062 0.0071  1.7489  2.5248 1.9047 -0.3218 -0.5407 0.8348  
-0.0468 0.0886  -0.0417 0.0148  -0.1574 -0.0927 0.0875  0.1822  -0.0014 'X-RAY DIFFRACTION' 
6  ? refined 24.8280 14.5410 1.5870  -0.0382 0.0305  0.0288  -0.0300 -0.0150 -0.0140 1.3429  2.2253 4.4203 -1.7287 -1.7064 2.1903  
0.0909  -0.2222 0.1314  0.1604  -0.2293 0.3467  -0.0933 -0.0592 -0.5370 'X-RAY DIFFRACTION' 
7  ? refined 30.2780 3.1040  35.1830 0.0414  0.0303  -0.0151 0.0590  0.0139  -0.0098 1.4447  1.0513 0.8613 -0.4616 -0.2468 -0.0225 
-0.0483 -0.0087 0.0570  0.0686  -0.1526 -0.0346 -0.0103 0.2520  0.0765  'X-RAY DIFFRACTION' 
8  ? refined 33.4310 15.2290 34.3380 -0.0101 0.0649  -0.0109 0.0239  -0.0120 -0.0110 0.7917  1.0244 1.3796 -0.4318 -0.5067 -0.2488 
-0.0164 0.0029  0.0135  -0.0491 0.0517  -0.1585 0.0088  -0.0035 0.2435  'X-RAY DIFFRACTION' 
9  ? refined 26.3350 15.5660 27.3430 0.0392  0.0497  -0.0011 0.0238  -0.0004 -0.0009 3.7154  2.0737 3.4642 -0.4408 -1.1936 0.0459  
-0.0579 0.1039  -0.0460 -0.0633 0.2461  -0.0541 0.0350  -0.0345 -0.0163 'X-RAY DIFFRACTION' 
10 ? refined 18.9420 16.2850 24.9140 -0.0247 0.0781  -0.0116 0.0170  -0.0092 0.0114  1.6635  1.5089 2.6073 -0.2041 -1.0895 -0.3664 
0.0057  0.0680  -0.0738 0.1256  -0.0134 0.1885  -0.0409 0.0128  -0.3929 'X-RAY DIFFRACTION' 
11 ? refined 27.1130 3.4440  18.9480 0.0702  -0.0424 -0.0203 -0.0284 0.0337  -0.0036 20.3293 4.3707 6.8197 6.2131  -8.8726 -1.1358 
-0.3599 -0.1062 0.4660  0.0883  -0.4319 0.2612  -0.0856 0.7398  -0.3413 'X-RAY DIFFRACTION' 
12 ? refined 4.3760  -3.0890 0.0210  0.0082  0.0260  0.0291  0.0283  -0.0076 0.0095  1.2976  2.0245 0.6564 -0.7523 -0.0715 0.1293  
0.0826  -0.0951 0.0125  0.0738  0.1037  -0.0756 -0.0831 -0.0680 -0.0463 'X-RAY DIFFRACTION' 
13 ? refined -1.0710 1.5110  -0.6160 -0.0082 0.0122  0.0289  0.0389  -0.0259 0.0056  1.7670  1.3678 1.8592 -0.6464 -0.7848 0.3851  
0.0926  -0.0765 -0.0162 0.1053  0.0195  0.0165  -0.1101 -0.0566 -0.0359 'X-RAY DIFFRACTION' 
14 ? refined -5.3770 -6.9020 5.4690  -0.0232 0.0397  0.0258  0.0077  -0.0060 -0.0081 1.4050  2.5130 0.9723 -0.9128 -0.3623 0.7220  
-0.0092 -0.0416 0.0509  0.0823  -0.1090 0.2919  0.0373  0.0027  -0.1952 'X-RAY DIFFRACTION' 
15 ? refined 1.0120  -0.5970 17.6040 0.0314  0.0414  -0.0081 0.0376  -0.0335 -0.0283 2.4744  3.8636 2.0122 0.1310  -0.4084 0.2088  
-0.0900 0.0733  0.0166  -0.2139 0.1385  -0.0075 0.3401  -0.0444 -0.0868 'X-RAY DIFFRACTION' 
16 ? refined 12.9620 -3.9910 11.7880 0.0002  -0.0006 0.0681  0.0075  -0.0220 -0.0207 0.4543  6.6407 1.4990 -0.5739 0.2245  -0.9934 
-0.0497 -0.0349 0.0847  -0.1345 0.2473  -0.3838 0.1802  -0.1290 0.0647  'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1  1  A 128 A 173 ? . . . . 'X-RAY DIFFRACTION' ? 
2  2  A 174 A 202 ? . . . . 'X-RAY DIFFRACTION' ? 
3  3  A 203 A 229 ? . . . . 'X-RAY DIFFRACTION' ? 
4  4  A 230 A 265 ? . . . . 'X-RAY DIFFRACTION' ? 
5  5  A 266 A 286 ? . . . . 'X-RAY DIFFRACTION' ? 
6  6  A 287 A 307 ? . . . . 'X-RAY DIFFRACTION' ? 
7  7  B 128 B 200 ? . . . . 'X-RAY DIFFRACTION' ? 
8  8  B 201 B 250 ? . . . . 'X-RAY DIFFRACTION' ? 
9  9  B 251 B 264 ? . . . . 'X-RAY DIFFRACTION' ? 
10 10 B 265 B 296 ? . . . . 'X-RAY DIFFRACTION' ? 
11 11 B 297 B 307 ? . . . . 'X-RAY DIFFRACTION' ? 
12 12 C 128 C 189 ? . . . . 'X-RAY DIFFRACTION' ? 
13 13 C 190 C 217 ? . . . . 'X-RAY DIFFRACTION' ? 
14 14 C 218 C 250 ? . . . . 'X-RAY DIFFRACTION' ? 
15 15 C 251 C 289 ? . . . . 'X-RAY DIFFRACTION' ? 
16 16 C 290 C 307 ? . . . . 'X-RAY DIFFRACTION' ? 
# 
_phasing.method   MR 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .        ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com            'data reduction'  
http://www.hkl-xray.com/                     ?          ? 1 
SCALEPACK   .        ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com            'data scaling'    
http://www.hkl-xray.com/                     ?          ? 2 
PHASER      .        ?               program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/  ?          ? 3 
REFMAC      5.5.0044 ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk       refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 4 
PDB_EXTRACT 3.006    'June 11, 2008' package PDB                  help@deposit.rcsb.org       'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 5 
HKL-3000    .        ?               ?       ?                    ?                           'data collection' ? ?          ? 6 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    326 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    506 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 174 ? ? -146.08 -107.50 
2 1 LEU A 204 ? ? -123.31 -133.59 
3 1 SER B 174 ? ? -148.09 -101.39 
4 1 LEU B 204 ? ? -128.12 -130.70 
5 1 SER C 174 ? ? -147.58 -103.91 
6 1 SER C 176 ? ? -119.21 -169.34 
7 1 LEU C 204 ? ? -123.11 -133.45 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 127 ? A MET 1 
2 1 Y 1 B MET 127 ? B MET 1 
3 1 Y 1 C MET 127 ? C MET 1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '1-CHLORO-2,2,2-TRIFLUOROETHYL DIFLUOROMETHYL ETHER' ICF 
3 GLYCEROL                                             GOL 
4 'MAGNESIUM ION'                                      MG  
5 water                                                HOH 
#