data_3FA6
# 
_entry.id   3FA6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3FA6         
RCSB  RCSB050339   
WWPDB D_1000050339 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3CR6 'Another CRABPII mutant complexed with C15-aldehyde'                  unspecified 
PDB 3F8A 'Another CRABPII mutant complexed with C15-aldehyde'                  unspecified 
PDB 3F9D 'Another CRABPII R132K:R111L:T54E mutant complexed with C15-aldehyde' unspecified 
PDB 3FA7 'CRABPII R132K:R111L:L121E:R59E MUTANT'                               unspecified 
PDB 3FA8 'CRABPII R132K:Y134F:R111L:L121E MUTANT'                              unspecified 
PDB 3FA9 'CRABPII R132K:Y134F:R111L:L121D MUTANT'                              unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3FA6 
_pdbx_database_status.recvd_initial_deposition_date   2008-11-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Jia, X.'      1 
'Geiger, J.H.' 2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Two distinctive orientations of binding determined by a 
single mutation in the CRABPII mutant-C15-aldehyde complexes
;
'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 
1       'Protein engineering: wavelength regulation mechanism investigated in a rhodopsin mimic'                                
'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Jia, X.'       1  
primary 'Lee, K.S.'     2  
primary 'Vasileiou, C.' 3  
primary 'Borhan, B.'    4  
primary 'Geiger, J.H.'  5  
1       'Lee, K.S.'     6  
1       'Jia, X.'       7  
1       'Vasileiou, C.' 8  
1       'Geiger, J.H.'  9  
1       'Borhan, B.'    10 
# 
_cell.entry_id           3FA6 
_cell.length_a           37.261 
_cell.length_b           89.634 
_cell.length_c           90.621 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3FA6 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Cellular retinoic acid-binding protein 2'                           15493.708 2   ? 
'R132K, Y134F, R111L, L121D, T54V' ? ? 
2 non-polymer syn '1,3,3-trimethyl-2-[(1E,3E)-3-methylpenta-1,3-dien-1-yl]cyclohexene' 204.351   2   ? ? ? ? 
3 water       nat water                                                                18.015    365 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Cellular retinoic acid-binding protein II, CRABP-II' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKVSTTVRTTEINFKVGEEFEEQTVDGRP
CKSLVKWESENKMVCEQKLLKGEGPKTSWTLELTNDGELIDTMTADDVVCTKVFVRE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKVSTTVRTTEINFKVGEEFEEQTVDGRP
CKSLVKWESENKMVCEQKLLKGEGPKTSWTLELTNDGELIDTMTADDVVCTKVFVRE
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   ASN n 
1 3   PHE n 
1 4   SER n 
1 5   GLY n 
1 6   ASN n 
1 7   TRP n 
1 8   LYS n 
1 9   ILE n 
1 10  ILE n 
1 11  ARG n 
1 12  SER n 
1 13  GLU n 
1 14  ASN n 
1 15  PHE n 
1 16  GLU n 
1 17  GLU n 
1 18  LEU n 
1 19  LEU n 
1 20  LYS n 
1 21  VAL n 
1 22  LEU n 
1 23  GLY n 
1 24  VAL n 
1 25  ASN n 
1 26  VAL n 
1 27  MET n 
1 28  LEU n 
1 29  ARG n 
1 30  LYS n 
1 31  ILE n 
1 32  ALA n 
1 33  VAL n 
1 34  ALA n 
1 35  ALA n 
1 36  ALA n 
1 37  SER n 
1 38  LYS n 
1 39  PRO n 
1 40  ALA n 
1 41  VAL n 
1 42  GLU n 
1 43  ILE n 
1 44  LYS n 
1 45  GLN n 
1 46  GLU n 
1 47  GLY n 
1 48  ASP n 
1 49  THR n 
1 50  PHE n 
1 51  TYR n 
1 52  ILE n 
1 53  LYS n 
1 54  VAL n 
1 55  SER n 
1 56  THR n 
1 57  THR n 
1 58  VAL n 
1 59  ARG n 
1 60  THR n 
1 61  THR n 
1 62  GLU n 
1 63  ILE n 
1 64  ASN n 
1 65  PHE n 
1 66  LYS n 
1 67  VAL n 
1 68  GLY n 
1 69  GLU n 
1 70  GLU n 
1 71  PHE n 
1 72  GLU n 
1 73  GLU n 
1 74  GLN n 
1 75  THR n 
1 76  VAL n 
1 77  ASP n 
1 78  GLY n 
1 79  ARG n 
1 80  PRO n 
1 81  CYS n 
1 82  LYS n 
1 83  SER n 
1 84  LEU n 
1 85  VAL n 
1 86  LYS n 
1 87  TRP n 
1 88  GLU n 
1 89  SER n 
1 90  GLU n 
1 91  ASN n 
1 92  LYS n 
1 93  MET n 
1 94  VAL n 
1 95  CYS n 
1 96  GLU n 
1 97  GLN n 
1 98  LYS n 
1 99  LEU n 
1 100 LEU n 
1 101 LYS n 
1 102 GLY n 
1 103 GLU n 
1 104 GLY n 
1 105 PRO n 
1 106 LYS n 
1 107 THR n 
1 108 SER n 
1 109 TRP n 
1 110 THR n 
1 111 LEU n 
1 112 GLU n 
1 113 LEU n 
1 114 THR n 
1 115 ASN n 
1 116 ASP n 
1 117 GLY n 
1 118 GLU n 
1 119 LEU n 
1 120 ILE n 
1 121 ASP n 
1 122 THR n 
1 123 MET n 
1 124 THR n 
1 125 ALA n 
1 126 ASP n 
1 127 ASP n 
1 128 VAL n 
1 129 VAL n 
1 130 CYS n 
1 131 THR n 
1 132 LYS n 
1 133 VAL n 
1 134 PHE n 
1 135 VAL n 
1 136 ARG n 
1 137 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 CRABP2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       CRABPII-pET17b-KFLDV 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RABP2_HUMAN 
_struct_ref.pdbx_db_accession          P29373 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP
CKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
;
_struct_ref.pdbx_align_begin           2 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3FA6 A 1 ? 137 ? P29373 2 ? 138 ? 1 137 
2 1 3FA6 B 1 ? 137 ? P29373 2 ? 138 ? 1 137 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3FA6 VAL A 54  ? UNP P29373 THR 55  ENGINEERED 54  1  
1 3FA6 LEU A 111 ? UNP P29373 ARG 112 ENGINEERED 111 2  
1 3FA6 ASP A 121 ? UNP P29373 LEU 122 ENGINEERED 121 3  
1 3FA6 LYS A 132 ? UNP P29373 ARG 133 ENGINEERED 132 4  
1 3FA6 PHE A 134 ? UNP P29373 TYR 135 ENGINEERED 134 5  
2 3FA6 VAL B 54  ? UNP P29373 THR 55  ENGINEERED 54  6  
2 3FA6 LEU B 111 ? UNP P29373 ARG 112 ENGINEERED 111 7  
2 3FA6 ASP B 121 ? UNP P29373 LEU 122 ENGINEERED 121 8  
2 3FA6 LYS B 132 ? UNP P29373 ARG 133 ENGINEERED 132 9  
2 3FA6 PHE B 134 ? UNP P29373 TYR 135 ENGINEERED 134 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                      ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                             ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                              ? 'C2 H5 N O2'     75.067  
HOH non-polymer         . WATER                                                                ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                              ? 'C6 H13 N O2'    131.173 
LSR non-polymer         . '1,3,3-trimethyl-2-[(1E,3E)-3-methylpenta-1,3-dien-1-yl]cyclohexene' ? 'C15 H24'        204.351 
LYS 'L-peptide linking' y LYSINE                                                               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                           ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                        ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                               ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                               ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3FA6 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.44 
_exptl_crystal.density_percent_sol   49.57 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1M sodium acetate, 18% PEG6000, pH 5.8, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2007-08-08 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'C(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97869 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 21-ID-D' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-D 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97869 
# 
_reflns.entry_id                     3FA6 
_reflns.observed_criterion_sigma_I   1 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             63.76 
_reflns.d_resolution_high            1.54 
_reflns.number_obs                   45260 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.7 
_reflns.pdbx_Rmerge_I_obs            0.054 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        31.3 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.54 
_reflns_shell.d_res_low              1.60 
_reflns_shell.percent_possible_all   96.7 
_reflns_shell.Rmerge_I_obs           0.366 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.5 
_reflns_shell.pdbx_redundancy        3.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3FA6 
_refine.ls_number_reflns_obs                     42922 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             32.16 
_refine.ls_d_res_high                            1.54 
_refine.ls_percent_reflns_obs                    98.72 
_refine.ls_R_factor_obs                          0.17388 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.17142 
_refine.ls_R_factor_R_free                       0.22055 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2279 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.967 
_refine.correlation_coeff_Fo_to_Fc_free          0.945 
_refine.B_iso_mean                               25.613 
_refine.aniso_B[1][1]                            -0.43 
_refine.aniso_B[2][2]                            0.13 
_refine.aniso_B[3][3]                            0.30 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.102 
_refine.pdbx_overall_ESU_R_Free                  0.087 
_refine.overall_SU_ML                            0.052 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             3.080 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2170 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         30 
_refine_hist.number_atoms_solvent             365 
_refine_hist.number_atoms_total               2565 
_refine_hist.d_res_high                       1.54 
_refine_hist.d_res_low                        32.16 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.014  0.022  ? 2337 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.623  1.986  ? 3176 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.128  5.000  ? 304  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       35.934 25.842 ? 101  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       12.490 15.000 ? 456  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       20.809 15.000 ? 11   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.108  0.200  ? 372  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.020  ? 1709 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.288  0.300  ? 1081 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.324  0.500  ? 1596 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.229  0.500  ? 501  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.193  0.300  ? 37   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.249  0.500  ? 40   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  2.558  2.000  ? 1463 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 3.063  3.000  ? 2322 'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.359  2.000  ? 988  'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.962  3.000  ? 836  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           2.829  3.000  ? 2451 'X-RAY DIFFRACTION' ? 
r_sphericity_free            5.583  3.000  ? 394  'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          5.172  3.000  ? 2289 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.540 
_refine_ls_shell.d_res_low                        1.580 
_refine_ls_shell.number_reflns_R_work             3001 
_refine_ls_shell.R_factor_R_work                  0.217 
_refine_ls_shell.percent_reflns_obs               95.75 
_refine_ls_shell.R_factor_R_free                  0.244 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             178 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                  3FA6 
_struct.title                     
;Crystal structure of the R132K:Y134F:R111L:L121D:T54V mutant of cellular retinoic acid-binding protein II complexed with C15-aldehyde (a retinal analog) at 1.54 angstrom resolution
;
_struct.pdbx_descriptor           'Cellular retinoic acid-binding protein 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3FA6 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
_struct_keywords.text            
;CRABPII, retinal, protonated Schiff base, PSB, C15-aldehyde, retinoic acid, retinoid, Cytoplasm, Nucleus, Retinol-binding, Transport, Vitamin A, TRANSPORT PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASN A 14 ? LEU A 22 ? ASN A 14 LEU A 22 1 ? 9  
HELX_P HELX_P2 2 ASN A 25 ? ALA A 36 ? ASN A 25 ALA A 36 1 ? 12 
HELX_P HELX_P3 3 ASN B 14 ? LEU B 22 ? ASN B 14 LEU B 22 1 ? 9  
HELX_P HELX_P4 4 ASN B 25 ? ALA B 34 ? ASN B 25 ALA B 34 1 ? 10 
HELX_P HELX_P5 5 ALA B 35 ? LYS B 38 ? ALA B 35 LYS B 38 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A LYS 132 NZ ? ? ? 1_555 C LSR . CAF ? ? A LYS 132 A LSR 138 1_555 ? ? ? ? ? ? ? 1.299 ? 
covale2 covale ? ? B LYS 132 NZ ? ? ? 1_555 D LSR . CAF ? ? B LYS 132 B LSR 138 1_555 ? ? ? ? ? ? ? 1.279 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   20 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? anti-parallel 
A 3  4  ? anti-parallel 
A 4  5  ? anti-parallel 
A 5  6  ? anti-parallel 
A 6  7  ? anti-parallel 
A 7  8  ? anti-parallel 
A 8  9  ? anti-parallel 
A 9  10 ? anti-parallel 
A 10 11 ? parallel      
A 11 12 ? anti-parallel 
A 12 13 ? anti-parallel 
A 13 14 ? anti-parallel 
A 14 15 ? anti-parallel 
A 15 16 ? anti-parallel 
A 16 17 ? anti-parallel 
A 17 18 ? anti-parallel 
A 18 19 ? anti-parallel 
A 19 20 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  PHE A 71  ? GLN A 74  ? PHE A 71  GLN A 74  
A 2  PRO A 80  ? SER A 89  ? PRO A 80  SER A 89  
A 3  LYS A 92  ? LEU A 99  ? LYS A 92  LEU A 99  
A 4  THR A 107 ? LEU A 113 ? THR A 107 LEU A 113 
A 5  GLU A 118 ? ALA A 125 ? GLU A 118 ALA A 125 
A 6  VAL A 128 ? ARG A 136 ? VAL A 128 ARG A 136 
A 7  GLY A 5   ? GLU A 13  ? GLY A 5   GLU A 13  
A 8  ALA A 40  ? GLU A 46  ? ALA A 40  GLU A 46  
A 9  THR A 49  ? SER A 55  ? THR A 49  SER A 55  
A 10 ARG A 59  ? LYS A 66  ? ARG A 59  LYS A 66  
A 11 THR B 60  ? LYS B 66  ? THR B 60  LYS B 66  
A 12 THR B 49  ? SER B 55  ? THR B 49  SER B 55  
A 13 ALA B 40  ? GLU B 46  ? ALA B 40  GLU B 46  
A 14 GLY B 5   ? GLU B 13  ? GLY B 5   GLU B 13  
A 15 VAL B 128 ? ARG B 136 ? VAL B 128 ARG B 136 
A 16 GLU B 118 ? ALA B 125 ? GLU B 118 ALA B 125 
A 17 THR B 107 ? LEU B 113 ? THR B 107 LEU B 113 
A 18 LYS B 92  ? LEU B 99  ? LYS B 92  LEU B 99  
A 19 PRO B 80  ? SER B 89  ? PRO B 80  SER B 89  
A 20 PHE B 71  ? GLN B 74  ? PHE B 71  GLN B 74  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N PHE A 71  ? N PHE A 71  O SER A 83  ? O SER A 83  
A 2  3  N GLU A 88  ? N GLU A 88  O LYS A 92  ? O LYS A 92  
A 3  4  N CYS A 95  ? N CYS A 95  O TRP A 109 ? O TRP A 109 
A 4  5  N GLU A 112 ? N GLU A 112 O ILE A 120 ? O ILE A 120 
A 5  6  N MET A 123 ? N MET A 123 O CYS A 130 ? O CYS A 130 
A 6  7  O VAL A 133 ? O VAL A 133 N ILE A 10  ? N ILE A 10  
A 7  8  N TRP A 7   ? N TRP A 7   O VAL A 41  ? O VAL A 41  
A 8  9  N GLU A 46  ? N GLU A 46  O THR A 49  ? O THR A 49  
A 9  10 N PHE A 50  ? N PHE A 50  O PHE A 65  ? O PHE A 65  
A 10 11 N GLU A 62  ? N GLU A 62  O GLU B 62  ? O GLU B 62  
A 11 12 O PHE B 65  ? O PHE B 65  N PHE B 50  ? N PHE B 50  
A 12 13 O SER B 55  ? O SER B 55  N ALA B 40  ? N ALA B 40  
A 13 14 O VAL B 41  ? O VAL B 41  N TRP B 7   ? N TRP B 7   
A 14 15 N ILE B 10  ? N ILE B 10  O VAL B 133 ? O VAL B 133 
A 15 16 O CYS B 130 ? O CYS B 130 N MET B 123 ? N MET B 123 
A 16 17 O ILE B 120 ? O ILE B 120 N GLU B 112 ? N GLU B 112 
A 17 18 O TRP B 109 ? O TRP B 109 N CYS B 95  ? N CYS B 95  
A 18 19 O LYS B 98  ? O LYS B 98  N LYS B 82  ? N LYS B 82  
A 19 20 O SER B 83  ? O SER B 83  N PHE B 71  ? N PHE B 71  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE LSR A 138' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE LSR B 138' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ALA A 36  ? ALA A 36  . ? 1_555 ? 
2  AC1 6 ILE A 63  ? ILE A 63  . ? 1_555 ? 
3  AC1 6 ASP A 121 ? ASP A 121 . ? 1_555 ? 
4  AC1 6 MET A 123 ? MET A 123 . ? 1_555 ? 
5  AC1 6 LYS A 132 ? LYS A 132 . ? 1_555 ? 
6  AC1 6 HOH E .   ? HOH A 180 . ? 1_555 ? 
7  AC2 4 TRP B 109 ? TRP B 109 . ? 1_555 ? 
8  AC2 4 ASP B 121 ? ASP B 121 . ? 1_555 ? 
9  AC2 4 MET B 123 ? MET B 123 . ? 1_555 ? 
10 AC2 4 LYS B 132 ? LYS B 132 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3FA6 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3FA6 
_atom_sites.fract_transf_matrix[1][1]   0.026838 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011156 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011035 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A 1 1   ? -8.479  -20.720 -8.572  0.40  34.44 ? 1   PRO A N   1 
ATOM   2    C CA  . PRO A 1 1   ? -7.454  -19.691 -8.732  0.70  33.44 ? 1   PRO A CA  1 
ATOM   3    C C   . PRO A 1 1   ? -7.486  -19.029 -10.119 1.00  32.45 ? 1   PRO A C   1 
ATOM   4    O O   . PRO A 1 1   ? -7.253  -19.703 -11.133 0.70  33.66 ? 1   PRO A O   1 
ATOM   5    C CB  . PRO A 1 1   ? -6.153  -20.474 -8.546  0.50  34.28 ? 1   PRO A CB  1 
ATOM   6    C CG  . PRO A 1 1   ? -6.507  -21.863 -9.000  0.50  34.79 ? 1   PRO A CG  1 
ATOM   7    C CD  . PRO A 1 1   ? -7.889  -22.065 -8.465  0.50  34.65 ? 1   PRO A CD  1 
ATOM   8    N N   . ASN A 1 2   ? -7.769  -17.725 -10.151 1.00  29.88 ? 2   ASN A N   1 
ATOM   9    C CA  . ASN A 1 2   ? -7.787  -16.955 -11.397 1.00  26.92 ? 2   ASN A CA  1 
ATOM   10   C C   . ASN A 1 2   ? -6.770  -15.825 -11.213 1.00  24.66 ? 2   ASN A C   1 
ATOM   11   O O   . ASN A 1 2   ? -6.998  -14.866 -10.471 1.00  25.30 ? 2   ASN A O   1 
ATOM   12   C CB  . ASN A 1 2   ? -9.169  -16.346 -11.677 1.00  27.35 ? 2   ASN A CB  1 
ATOM   13   C CG  . ASN A 1 2   ? -9.304  -15.797 -13.096 1.00  27.96 ? 2   ASN A CG  1 
ATOM   14   O OD1 . ASN A 1 2   ? -8.303  -15.520 -13.748 1.00  25.65 ? 2   ASN A OD1 1 
ATOM   15   N ND2 . ASN A 1 2   ? -10.550 -15.650 -13.590 1.00  24.43 ? 2   ASN A ND2 1 
ATOM   16   N N   . PHE A 1 3   ? -5.635  -15.958 -11.886 1.00  22.03 ? 3   PHE A N   1 
ATOM   17   C CA  . PHE A 1 3   ? -4.592  -14.947 -11.833 1.00  19.75 ? 3   PHE A CA  1 
ATOM   18   C C   . PHE A 1 3   ? -4.949  -13.679 -12.641 1.00  18.50 ? 3   PHE A C   1 
ATOM   19   O O   . PHE A 1 3   ? -4.154  -12.725 -12.654 1.00  21.23 ? 3   PHE A O   1 
ATOM   20   C CB  . PHE A 1 3   ? -3.296  -15.567 -12.412 1.00  19.38 ? 3   PHE A CB  1 
ATOM   21   C CG  . PHE A 1 3   ? -2.586  -16.533 -11.512 1.00  18.62 ? 3   PHE A CG  1 
ATOM   22   C CD1 . PHE A 1 3   ? -3.055  -17.815 -11.278 1.00  18.27 ? 3   PHE A CD1 1 
ATOM   23   C CD2 . PHE A 1 3   ? -1.381  -16.162 -10.904 1.00  18.02 ? 3   PHE A CD2 1 
ATOM   24   C CE1 . PHE A 1 3   ? -2.346  -18.712 -10.446 1.00  18.97 ? 3   PHE A CE1 1 
ATOM   25   C CE2 . PHE A 1 3   ? -0.658  -17.021 -10.110 1.00  18.05 ? 3   PHE A CE2 1 
ATOM   26   C CZ  . PHE A 1 3   ? -1.125  -18.327 -9.864  1.00  18.55 ? 3   PHE A CZ  1 
ATOM   27   N N   . SER A 1 4   ? -6.097  -13.649 -13.342 1.00  20.25 ? 4   SER A N   1 
ATOM   28   C CA  . SER A 1 4   ? -6.383  -12.550 -14.268 1.00  18.45 ? 4   SER A CA  1 
ATOM   29   C C   . SER A 1 4   ? -6.498  -11.243 -13.497 1.00  20.53 ? 4   SER A C   1 
ATOM   30   O O   . SER A 1 4   ? -7.115  -11.203 -12.435 1.00  23.29 ? 4   SER A O   1 
ATOM   31   C CB  . SER A 1 4   ? -7.716  -12.771 -15.032 1.00  21.59 ? 4   SER A CB  1 
ATOM   32   O OG  . SER A 1 4   ? -7.608  -13.957 -15.781 1.00  20.09 ? 4   SER A OG  1 
ATOM   33   N N   . GLY A 1 5   ? -5.991  -10.166 -14.086 1.00  20.15 ? 5   GLY A N   1 
ATOM   34   C CA  . GLY A 1 5   ? -6.079  -8.853  -13.437 1.00  21.92 ? 5   GLY A CA  1 
ATOM   35   C C   . GLY A 1 5   ? -4.938  -7.939  -13.875 1.00  16.18 ? 5   GLY A C   1 
ATOM   36   O O   . GLY A 1 5   ? -4.020  -8.358  -14.579 1.00  21.99 ? 5   GLY A O   1 
ATOM   37   N N   . ASN A 1 6   ? -5.031  -6.673  -13.451 1.00  21.63 ? 6   ASN A N   1 
ATOM   38   C CA  . ASN A 1 6   ? -3.928  -5.750  -13.565 1.00  20.44 ? 6   ASN A CA  1 
ATOM   39   C C   . ASN A 1 6   ? -3.331  -5.595  -12.168 1.00  18.77 ? 6   ASN A C   1 
ATOM   40   O O   . ASN A 1 6   ? -4.066  -5.241  -11.204 1.00  25.49 ? 6   ASN A O   1 
ATOM   41   C CB  . ASN A 1 6   ? -4.394  -4.419  -14.129 1.00  24.18 ? 6   ASN A CB  1 
ATOM   42   C CG  . ASN A 1 6   ? -4.874  -4.551  -15.549 1.00  27.53 ? 6   ASN A CG  1 
ATOM   43   O OD1 . ASN A 1 6   ? -4.071  -4.568  -16.493 0.80  30.70 ? 6   ASN A OD1 1 
ATOM   44   N ND2 . ASN A 1 6   ? -6.166  -4.706  -15.713 0.60  29.71 ? 6   ASN A ND2 1 
ATOM   45   N N   . TRP A 1 7   ? -2.034  -5.888  -12.073 1.00  19.81 ? 7   TRP A N   1 
ATOM   46   C CA  . TRP A 1 7   ? -1.405  -6.070  -10.782 1.00  17.55 ? 7   TRP A CA  1 
ATOM   47   C C   . TRP A 1 7   ? -0.448  -4.946  -10.524 1.00  17.79 ? 7   TRP A C   1 
ATOM   48   O O   . TRP A 1 7   ? 0.313   -4.558  -11.426 1.00  18.33 ? 7   TRP A O   1 
ATOM   49   C CB  . TRP A 1 7   ? -0.648  -7.394  -10.795 1.00  18.54 ? 7   TRP A CB  1 
ATOM   50   C CG  . TRP A 1 7   ? -1.592  -8.545  -10.865 1.00  18.42 ? 7   TRP A CG  1 
ATOM   51   C CD1 . TRP A 1 7   ? -2.005  -9.201  -11.988 1.00  18.79 ? 7   TRP A CD1 1 
ATOM   52   C CD2 . TRP A 1 7   ? -2.214  -9.199  -9.753  1.00  17.53 ? 7   TRP A CD2 1 
ATOM   53   N NE1 . TRP A 1 7   ? -2.886  -10.230 -11.637 1.00  19.29 ? 7   TRP A NE1 1 
ATOM   54   C CE2 . TRP A 1 7   ? -3.013  -10.242 -10.262 1.00  18.27 ? 7   TRP A CE2 1 
ATOM   55   C CE3 . TRP A 1 7   ? -2.172  -8.994  -8.369  1.00  17.71 ? 7   TRP A CE3 1 
ATOM   56   C CZ2 . TRP A 1 7   ? -3.732  -11.088 -9.427  1.00  19.41 ? 7   TRP A CZ2 1 
ATOM   57   C CZ3 . TRP A 1 7   ? -2.882  -9.845  -7.541  1.00  19.65 ? 7   TRP A CZ3 1 
ATOM   58   C CH2 . TRP A 1 7   ? -3.669  -10.864 -8.078  1.00  18.90 ? 7   TRP A CH2 1 
ATOM   59   N N   . LYS A 1 8   ? -0.498  -4.413  -9.300  1.00  18.00 ? 8   LYS A N   1 
ATOM   60   C CA  . LYS A 1 8   ? 0.345   -3.264  -9.001  0.90  18.57 ? 8   LYS A CA  1 
ATOM   61   C C   . LYS A 1 8   ? 1.304   -3.593  -7.844  1.00  16.91 ? 8   LYS A C   1 
ATOM   62   O O   . LYS A 1 8   ? 0.939   -4.239  -6.868  1.00  17.67 ? 8   LYS A O   1 
ATOM   63   C CB  . LYS A 1 8   ? -0.482  -2.030  -8.683  0.90  21.89 ? 8   LYS A CB  1 
ATOM   64   C CG  . LYS A 1 8   ? -1.262  -2.127  -7.465  0.60  21.72 ? 8   LYS A CG  1 
ATOM   65   C CD  . LYS A 1 8   ? -1.738  -0.739  -7.078  0.30  22.06 ? 8   LYS A CD  1 
ATOM   66   C CE  . LYS A 1 8   ? -3.067  -0.835  -6.376  0.30  24.20 ? 8   LYS A CE  1 
ATOM   67   N NZ  . LYS A 1 8   ? -3.228  0.253   -5.378  0.20  22.19 ? 8   LYS A NZ  1 
ATOM   68   N N   . ILE A 1 9   ? 2.543   -3.187  -8.002  1.00  17.43 ? 9   ILE A N   1 
ATOM   69   C CA  . ILE A 1 9   ? 3.548   -3.679  -7.063  1.00  16.20 ? 9   ILE A CA  1 
ATOM   70   C C   . ILE A 1 9   ? 3.428   -3.020  -5.688  1.00  17.70 ? 9   ILE A C   1 
ATOM   71   O O   . ILE A 1 9   ? 3.178   -1.802  -5.613  1.00  16.66 ? 9   ILE A O   1 
ATOM   72   C CB  . ILE A 1 9   ? 4.967   -3.478  -7.635  1.00  16.62 ? 9   ILE A CB  1 
ATOM   73   C CG1 . ILE A 1 9   ? 6.011   -4.324  -6.851  1.00  17.42 ? 9   ILE A CG1 1 
ATOM   74   C CG2 . ILE A 1 9   ? 5.325   -1.978  -7.735  1.00  20.36 ? 9   ILE A CG2 1 
ATOM   75   C CD1 . ILE A 1 9   ? 7.324   -4.447  -7.594  1.00  17.74 ? 9   ILE A CD1 1 
ATOM   76   N N   . ILE A 1 10  ? 3.568   -3.830  -4.635  1.00  15.23 ? 10  ILE A N   1 
ATOM   77   C CA  . ILE A 1 10  ? 3.634   -3.279  -3.271  1.00  17.71 ? 10  ILE A CA  1 
ATOM   78   C C   . ILE A 1 10  ? 4.964   -3.611  -2.544  1.00  14.89 ? 10  ILE A C   1 
ATOM   79   O O   . ILE A 1 10  ? 5.265   -2.998  -1.514  1.00  18.10 ? 10  ILE A O   1 
ATOM   80   C CB  . ILE A 1 10  ? 2.474   -3.751  -2.380  1.00  17.18 ? 10  ILE A CB  1 
ATOM   81   C CG1 . ILE A 1 10  ? 2.489   -5.288  -2.210  1.00  19.34 ? 10  ILE A CG1 1 
ATOM   82   C CG2 . ILE A 1 10  ? 1.119   -3.250  -2.949  1.00  18.74 ? 10  ILE A CG2 1 
ATOM   83   C CD1 . ILE A 1 10  ? 1.513   -5.762  -1.147  1.00  20.22 ? 10  ILE A CD1 1 
ATOM   84   N N   . ARG A 1 11  ? 5.766   -4.557  -3.067  1.00  18.06 ? 11  ARG A N   1 
ATOM   85   C CA  . ARG A 1 11  ? 7.016   -4.892  -2.367  1.00  18.65 ? 11  ARG A CA  1 
ATOM   86   C C   . ARG A 1 11  ? 8.017   -5.493  -3.396  1.00  13.32 ? 11  ARG A C   1 
ATOM   87   O O   . ARG A 1 11  ? 7.579   -6.167  -4.356  1.00  18.47 ? 11  ARG A O   1 
ATOM   88   C CB  . ARG A 1 11  ? 6.747   -5.922  -1.272  1.00  20.89 ? 11  ARG A CB  1 
ATOM   89   C CG  . ARG A 1 11  ? 7.864   -6.160  -0.275  1.00  23.76 ? 11  ARG A CG  1 
ATOM   90   C CD  . ARG A 1 11  ? 7.376   -7.101  0.869   1.00  24.76 ? 11  ARG A CD  1 
ATOM   91   N NE  . ARG A 1 11  ? 6.095   -6.576  1.349   0.70  26.37 ? 11  ARG A NE  1 
ATOM   92   C CZ  . ARG A 1 11  ? 4.964   -7.267  1.474   0.70  27.48 ? 11  ARG A CZ  1 
ATOM   93   N NH1 . ARG A 1 11  ? 3.866   -6.633  1.886   0.70  28.14 ? 11  ARG A NH1 1 
ATOM   94   N NH2 . ARG A 1 11  ? 4.922   -8.573  1.225   0.70  26.88 ? 11  ARG A NH2 1 
ATOM   95   N N   . SER A 1 12  ? 9.322   -5.258  -3.159  1.00  18.59 ? 12  SER A N   1 
ATOM   96   C CA  . SER A 1 12  ? 10.296  -5.842  -4.040  1.00  15.94 ? 12  SER A CA  1 
ATOM   97   C C   . SER A 1 12  ? 11.518  -6.066  -3.217  1.00  18.36 ? 12  SER A C   1 
ATOM   98   O O   . SER A 1 12  ? 11.810  -5.232  -2.335  1.00  15.61 ? 12  SER A O   1 
ATOM   99   C CB  . SER A 1 12  ? 10.613  -4.869  -5.187  1.00  18.55 ? 12  SER A CB  1 
ATOM   100  O OG  . SER A 1 12  ? 11.638  -5.402  -6.033  1.00  18.32 ? 12  SER A OG  1 
ATOM   101  N N   . GLU A 1 13  ? 12.236  -7.140  -3.474  1.00  14.83 ? 13  GLU A N   1 
ATOM   102  C CA  . GLU A 1 13  ? 13.504  -7.368  -2.823  1.00  15.41 ? 13  GLU A CA  1 
ATOM   103  C C   . GLU A 1 13  ? 14.488  -7.934  -3.826  1.00  14.47 ? 13  GLU A C   1 
ATOM   104  O O   . GLU A 1 13  ? 14.132  -8.814  -4.604  1.00  16.40 ? 13  GLU A O   1 
ATOM   105  C CB  . GLU A 1 13  ? 13.352  -8.436  -1.736  1.00  17.71 ? 13  GLU A CB  1 
ATOM   106  C CG  . GLU A 1 13  ? 12.520  -8.030  -0.554  1.00  18.67 ? 13  GLU A CG  1 
ATOM   107  C CD  . GLU A 1 13  ? 13.258  -7.051  0.404   1.00  17.54 ? 13  GLU A CD  1 
ATOM   108  O OE1 . GLU A 1 13  ? 12.567  -6.415  1.225   1.00  23.10 ? 13  GLU A OE1 1 
ATOM   109  O OE2 . GLU A 1 13  ? 14.516  -6.940  0.366   1.00  19.60 ? 13  GLU A OE2 1 
ATOM   110  N N   . ASN A 1 14  ? 15.726  -7.437  -3.774  1.00  17.26 ? 14  ASN A N   1 
ATOM   111  C CA  A ASN A 1 14  ? 16.856  -8.072  -4.454  0.50  16.57 ? 14  ASN A CA  1 
ATOM   112  C CA  B ASN A 1 14  ? 16.855  -8.077  -4.454  0.50  16.98 ? 14  ASN A CA  1 
ATOM   113  C C   . ASN A 1 14  ? 16.878  -7.954  -5.983  1.00  15.82 ? 14  ASN A C   1 
ATOM   114  O O   . ASN A 1 14  ? 17.585  -8.736  -6.655  1.00  18.14 ? 14  ASN A O   1 
ATOM   115  C CB  A ASN A 1 14  ? 16.932  -9.563  -4.106  0.50  18.28 ? 14  ASN A CB  1 
ATOM   116  C CB  B ASN A 1 14  ? 16.910  -9.575  -4.126  0.50  19.50 ? 14  ASN A CB  1 
ATOM   117  C CG  A ASN A 1 14  ? 17.332  -9.805  -2.667  0.50  18.65 ? 14  ASN A CG  1 
ATOM   118  C CG  B ASN A 1 14  ? 18.013  -9.929  -3.138  0.50  19.80 ? 14  ASN A CG  1 
ATOM   119  O OD1 A ASN A 1 14  ? 17.772  -8.886  -1.965  0.50  18.25 ? 14  ASN A OD1 1 
ATOM   120  O OD1 B ASN A 1 14  ? 18.847  -9.099  -2.763  0.50  22.31 ? 14  ASN A OD1 1 
ATOM   121  N ND2 A ASN A 1 14  ? 17.168  -11.036 -2.214  0.50  20.54 ? 14  ASN A ND2 1 
ATOM   122  N ND2 B ASN A 1 14  ? 18.020  -11.177 -2.722  0.50  22.43 ? 14  ASN A ND2 1 
ATOM   123  N N   . PHE A 1 15  ? 16.141  -6.996  -6.541  1.00  15.34 ? 15  PHE A N   1 
ATOM   124  C CA  . PHE A 1 15  ? 16.127  -6.945  -7.992  1.00  16.39 ? 15  PHE A CA  1 
ATOM   125  C C   . PHE A 1 15  ? 17.504  -6.567  -8.530  1.00  18.80 ? 15  PHE A C   1 
ATOM   126  O O   . PHE A 1 15  ? 18.041  -7.253  -9.429  1.00  16.43 ? 15  PHE A O   1 
ATOM   127  C CB  . PHE A 1 15  ? 15.044  -6.005  -8.531  1.00  18.82 ? 15  PHE A CB  1 
ATOM   128  C CG  . PHE A 1 15  ? 14.997  -5.942  -10.026 1.00  20.88 ? 15  PHE A CG  1 
ATOM   129  C CD1 . PHE A 1 15  ? 14.751  -7.089  -10.771 1.00  22.75 ? 15  PHE A CD1 1 
ATOM   130  C CD2 . PHE A 1 15  ? 15.131  -4.749  -10.676 1.00  23.19 ? 15  PHE A CD2 1 
ATOM   131  C CE1 . PHE A 1 15  ? 14.677  -7.036  -12.166 1.00  24.18 ? 15  PHE A CE1 1 
ATOM   132  C CE2 . PHE A 1 15  ? 15.043  -4.699  -12.083 1.00  24.34 ? 15  PHE A CE2 1 
ATOM   133  C CZ  . PHE A 1 15  ? 14.842  -5.831  -12.796 1.00  23.51 ? 15  PHE A CZ  1 
ATOM   134  N N   . GLU A 1 16  ? 18.101  -5.483  -8.024  1.00  16.68 ? 16  GLU A N   1 
ATOM   135  C CA  . GLU A 1 16  ? 19.403  -5.098  -8.518  1.00  18.46 ? 16  GLU A CA  1 
ATOM   136  C C   . GLU A 1 16  ? 20.407  -6.188  -8.205  1.00  19.10 ? 16  GLU A C   1 
ATOM   137  O O   . GLU A 1 16  ? 21.310  -6.457  -9.009  1.00  17.94 ? 16  GLU A O   1 
ATOM   138  C CB  . GLU A 1 16  ? 19.890  -3.773  -7.915  1.00  18.29 ? 16  GLU A CB  1 
ATOM   139  C CG  . GLU A 1 16  ? 21.279  -3.418  -8.525  1.00  20.16 ? 16  GLU A CG  1 
ATOM   140  C CD  . GLU A 1 16  ? 21.728  -2.003  -8.287  1.00  22.66 ? 16  GLU A CD  1 
ATOM   141  O OE1 . GLU A 1 16  ? 20.973  -1.191  -7.699  0.90  20.65 ? 16  GLU A OE1 1 
ATOM   142  O OE2 . GLU A 1 16  ? 22.854  -1.675  -8.707  0.90  21.84 ? 16  GLU A OE2 1 
ATOM   143  N N   . GLU A 1 17  ? 20.288  -6.822  -7.043  1.00  18.16 ? 17  GLU A N   1 
ATOM   144  C CA  . GLU A 1 17  ? 21.234  -7.854  -6.677  1.00  20.31 ? 17  GLU A CA  1 
ATOM   145  C C   . GLU A 1 17  ? 21.183  -9.007  -7.670  1.00  21.30 ? 17  GLU A C   1 
ATOM   146  O O   . GLU A 1 17  ? 22.236  -9.537  -8.061  1.00  21.23 ? 17  GLU A O   1 
ATOM   147  C CB  . GLU A 1 17  ? 21.012  -8.333  -5.246  1.00  22.23 ? 17  GLU A CB  1 
ATOM   148  C CG  . GLU A 1 17  ? 22.056  -9.314  -4.739  1.00  24.76 ? 17  GLU A CG  1 
ATOM   149  C CD  . GLU A 1 17  ? 23.450  -8.731  -4.504  1.00  25.56 ? 17  GLU A CD  1 
ATOM   150  O OE1 . GLU A 1 17  ? 23.638  -7.503  -4.560  1.00  28.19 ? 17  GLU A OE1 1 
ATOM   151  O OE2 . GLU A 1 17  ? 24.378  -9.530  -4.244  1.00  28.31 ? 17  GLU A OE2 1 
ATOM   152  N N   . LEU A 1 18  ? 19.986  -9.383  -8.114  1.00  19.60 ? 18  LEU A N   1 
ATOM   153  C CA  . LEU A 1 18  ? 19.869  -10.429 -9.146  1.00  19.26 ? 18  LEU A CA  1 
ATOM   154  C C   . LEU A 1 18  ? 20.625  -10.018 -10.394 1.00  21.87 ? 18  LEU A C   1 
ATOM   155  O O   . LEU A 1 18  ? 21.392  -10.814 -10.952 1.00  20.21 ? 18  LEU A O   1 
ATOM   156  C CB  . LEU A 1 18  ? 18.396  -10.642 -9.480  1.00  21.50 ? 18  LEU A CB  1 
ATOM   157  C CG  . LEU A 1 18  ? 18.083  -11.650 -10.592 1.00  23.24 ? 18  LEU A CG  1 
ATOM   158  C CD1 . LEU A 1 18  ? 18.461  -13.057 -10.143 1.00  26.87 ? 18  LEU A CD1 1 
ATOM   159  C CD2 . LEU A 1 18  ? 16.627  -11.549 -10.939 1.00  24.08 ? 18  LEU A CD2 1 
ATOM   160  N N   . LEU A 1 19  ? 20.439  -8.803  -10.867 1.00  17.61 ? 19  LEU A N   1 
ATOM   161  C CA  . LEU A 1 19  ? 21.165  -8.385  -12.078 1.00  18.43 ? 19  LEU A CA  1 
ATOM   162  C C   . LEU A 1 19  ? 22.692  -8.363  -11.830 1.00  17.04 ? 19  LEU A C   1 
ATOM   163  O O   . LEU A 1 19  ? 23.478  -8.679  -12.748 1.00  24.06 ? 19  LEU A O   1 
ATOM   164  C CB  . LEU A 1 19  ? 20.737  -7.018  -12.553 1.00  18.14 ? 19  LEU A CB  1 
ATOM   165  C CG  . LEU A 1 19  ? 19.231  -6.883  -12.777 1.00  18.12 ? 19  LEU A CG  1 
ATOM   166  C CD1 . LEU A 1 19  ? 18.970  -5.468  -13.275 1.00  20.67 ? 19  LEU A CD1 1 
ATOM   167  C CD2 . LEU A 1 19  ? 18.762  -7.936  -13.787 1.00  21.20 ? 19  LEU A CD2 1 
ATOM   168  N N   . LYS A 1 20  ? 23.082  -7.921  -10.618 1.00  20.02 ? 20  LYS A N   1 
ATOM   169  C CA  . LYS A 1 20  ? 24.502  -7.827  -10.300 1.00  20.68 ? 20  LYS A CA  1 
ATOM   170  C C   . LYS A 1 20  ? 25.164  -9.203  -10.387 1.00  21.02 ? 20  LYS A C   1 
ATOM   171  O O   . LYS A 1 20  ? 26.256  -9.348  -10.978 1.00  23.48 ? 20  LYS A O   1 
ATOM   172  C CB  . LYS A 1 20  ? 24.703  -7.248  -8.886  1.00  20.64 ? 20  LYS A CB  1 
ATOM   173  C CG  . LYS A 1 20  ? 26.210  -7.044  -8.504  1.00  21.64 ? 20  LYS A CG  1 
ATOM   174  C CD  . LYS A 1 20  ? 26.311  -6.240  -7.243  1.00  23.91 ? 20  LYS A CD  1 
ATOM   175  C CE  . LYS A 1 20  ? 27.741  -6.120  -6.763  1.00  26.18 ? 20  LYS A CE  1 
ATOM   176  N NZ  . LYS A 1 20  ? 27.698  -5.426  -5.421  1.00  27.23 ? 20  LYS A NZ  1 
ATOM   177  N N   . VAL A 1 21  ? 24.536  -10.224 -9.819  1.00  23.27 ? 21  VAL A N   1 
ATOM   178  C CA  . VAL A 1 21  ? 25.219  -11.528 -9.784  1.00  26.42 ? 21  VAL A CA  1 
ATOM   179  C C   . VAL A 1 21  ? 25.158  -12.223 -11.148 1.00  26.43 ? 21  VAL A C   1 
ATOM   180  O O   . VAL A 1 21  ? 25.914  -13.184 -11.406 1.00  27.61 ? 21  VAL A O   1 
ATOM   181  C CB  . VAL A 1 21  ? 24.648  -12.467 -8.708  1.00  27.34 ? 21  VAL A CB  1 
ATOM   182  C CG1 . VAL A 1 21  ? 24.786  -11.841 -7.324  1.00  30.28 ? 21  VAL A CG1 1 
ATOM   183  C CG2 . VAL A 1 21  ? 23.207  -12.837 -9.035  1.00  28.97 ? 21  VAL A CG2 1 
ATOM   184  N N   . LEU A 1 22  ? 24.299  -11.721 -12.039 1.00  24.97 ? 22  LEU A N   1 
ATOM   185  C CA  . LEU A 1 22  ? 24.240  -12.203 -13.421 1.00  26.23 ? 22  LEU A CA  1 
ATOM   186  C C   . LEU A 1 22  ? 25.280  -11.495 -14.258 1.00  27.63 ? 22  LEU A C   1 
ATOM   187  O O   . LEU A 1 22  ? 25.435  -11.843 -15.428 1.00  29.31 ? 22  LEU A O   1 
ATOM   188  C CB  . LEU A 1 22  ? 22.876  -11.976 -14.037 1.00  26.49 ? 22  LEU A CB  1 
ATOM   189  C CG  . LEU A 1 22  ? 21.800  -12.988 -13.619 1.00  26.26 ? 22  LEU A CG  1 
ATOM   190  C CD1 . LEU A 1 22  ? 20.392  -12.582 -14.049 1.00  27.08 ? 22  LEU A CD1 1 
ATOM   191  C CD2 . LEU A 1 22  ? 22.127  -14.399 -14.144 1.00  27.54 ? 22  LEU A CD2 1 
ATOM   192  N N   . GLY A 1 23  ? 25.983  -10.524 -13.676 1.00  25.92 ? 23  GLY A N   1 
ATOM   193  C CA  . GLY A 1 23  ? 27.073  -9.822  -14.370 1.00  25.57 ? 23  GLY A CA  1 
ATOM   194  C C   . GLY A 1 23  ? 26.708  -8.531  -15.079 1.00  26.71 ? 23  GLY A C   1 
ATOM   195  O O   . GLY A 1 23  ? 27.519  -7.950  -15.818 1.00  25.68 ? 23  GLY A O   1 
ATOM   196  N N   . VAL A 1 24  ? 25.495  -8.041  -14.843 1.00  22.84 ? 24  VAL A N   1 
ATOM   197  C CA  . VAL A 1 24  ? 25.102  -6.785  -15.484 1.00  24.40 ? 24  VAL A CA  1 
ATOM   198  C C   . VAL A 1 24  ? 25.896  -5.604  -14.903 1.00  25.07 ? 24  VAL A C   1 
ATOM   199  O O   . VAL A 1 24  ? 25.965  -5.439  -13.674 1.00  23.97 ? 24  VAL A O   1 
ATOM   200  C CB  . VAL A 1 24  ? 23.559  -6.558  -15.348 1.00  23.92 ? 24  VAL A CB  1 
ATOM   201  C CG1 . VAL A 1 24  ? 23.118  -5.294  -16.068 1.00  24.88 ? 24  VAL A CG1 1 
ATOM   202  C CG2 . VAL A 1 24  ? 22.797  -7.772  -15.888 1.00  23.86 ? 24  VAL A CG2 1 
ATOM   203  N N   . ASN A 1 25  ? 26.492  -4.761  -15.754 1.00  26.85 ? 25  ASN A N   1 
ATOM   204  C CA  . ASN A 1 25  ? 27.321  -3.692  -15.207 1.00  29.12 ? 25  ASN A CA  1 
ATOM   205  C C   . ASN A 1 25  ? 26.492  -2.581  -14.545 1.00  29.28 ? 25  ASN A C   1 
ATOM   206  O O   . ASN A 1 25  ? 25.289  -2.429  -14.826 1.00  28.43 ? 25  ASN A O   1 
ATOM   207  C CB  . ASN A 1 25  ? 28.348  -3.163  -16.226 1.00  32.73 ? 25  ASN A CB  1 
ATOM   208  C CG  . ASN A 1 25  ? 27.739  -2.258  -17.242 1.00  35.30 ? 25  ASN A CG  1 
ATOM   209  O OD1 . ASN A 1 25  ? 27.093  -1.275  -16.892 1.00  37.42 ? 25  ASN A OD1 1 
ATOM   210  N ND2 . ASN A 1 25  ? 27.966  -2.558  -18.529 1.00  38.36 ? 25  ASN A ND2 1 
ATOM   211  N N   . VAL A 1 26  ? 27.127  -1.840  -13.651 1.00  28.37 ? 26  VAL A N   1 
ATOM   212  C CA  . VAL A 1 26  ? 26.390  -0.953  -12.749 1.00  29.67 ? 26  VAL A CA  1 
ATOM   213  C C   . VAL A 1 26  ? 25.578  0.102   -13.496 1.00  29.92 ? 26  VAL A C   1 
ATOM   214  O O   . VAL A 1 26  ? 24.467  0.440   -13.078 1.00  29.15 ? 26  VAL A O   1 
ATOM   215  C CB  . VAL A 1 26  ? 27.325  -0.313  -11.703 1.00  30.61 ? 26  VAL A CB  1 
ATOM   216  C CG1 . VAL A 1 26  ? 28.385  0.555   -12.379 1.00  31.57 ? 26  VAL A CG1 1 
ATOM   217  C CG2 . VAL A 1 26  ? 26.514  0.508   -10.690 1.00  30.25 ? 26  VAL A CG2 1 
ATOM   218  N N   . MET A 1 27  ? 26.103  0.595   -14.616 1.00  30.99 ? 27  MET A N   1 
ATOM   219  C CA  . MET A 1 27  ? 25.381  1.628   -15.380 1.00  33.68 ? 27  MET A CA  1 
ATOM   220  C C   . MET A 1 27  ? 24.065  1.084   -15.914 1.00  31.10 ? 27  MET A C   1 
ATOM   221  O O   . MET A 1 27  ? 23.007  1.757   -15.871 1.00  31.94 ? 27  MET A O   1 
ATOM   222  C CB  . MET A 1 27  ? 26.226  2.158   -16.538 1.00  30.47 ? 27  MET A CB  1 
ATOM   223  C CG  . MET A 1 27  ? 27.477  2.879   -16.105 0.50  36.04 ? 27  MET A CG  1 
ATOM   224  S SD  . MET A 1 27  ? 28.182  3.800   -17.480 0.30  31.65 ? 27  MET A SD  1 
ATOM   225  C CE  . MET A 1 27  ? 29.572  4.603   -16.688 0.30  36.70 ? 27  MET A CE  1 
ATOM   226  N N   . LEU A 1 28  ? 24.116  -0.143  -16.414 1.00  29.31 ? 28  LEU A N   1 
ATOM   227  C CA  . LEU A 1 28  ? 22.947  -0.755  -16.975 1.00  28.87 ? 28  LEU A CA  1 
ATOM   228  C C   . LEU A 1 28  ? 22.007  -1.158  -15.846 1.00  27.14 ? 28  LEU A C   1 
ATOM   229  O O   . LEU A 1 28  ? 20.801  -1.127  -16.019 1.00  27.23 ? 28  LEU A O   1 
ATOM   230  C CB  . LEU A 1 28  ? 23.342  -1.960  -17.821 1.00  30.41 ? 28  LEU A CB  1 
ATOM   231  C CG  . LEU A 1 28  ? 24.141  -1.554  -19.065 1.00  32.25 ? 28  LEU A CG  1 
ATOM   232  C CD1 . LEU A 1 28  ? 24.685  -2.815  -19.674 1.00  33.39 ? 28  LEU A CD1 1 
ATOM   233  C CD2 . LEU A 1 28  ? 23.279  -0.803  -20.076 1.00  33.06 ? 28  LEU A CD2 1 
ATOM   234  N N   . ARG A 1 29  ? 22.564  -1.529  -14.693 1.00  24.87 ? 29  ARG A N   1 
ATOM   235  C CA  . ARG A 1 29  ? 21.710  -1.895  -13.546 1.00  23.98 ? 29  ARG A CA  1 
ATOM   236  C C   . ARG A 1 29  ? 20.894  -0.709  -13.076 1.00  25.39 ? 29  ARG A C   1 
ATOM   237  O O   . ARG A 1 29  ? 19.720  -0.829  -12.793 1.00  25.47 ? 29  ARG A O   1 
ATOM   238  C CB  . ARG A 1 29  ? 22.548  -2.392  -12.360 1.00  23.36 ? 29  ARG A CB  1 
ATOM   239  C CG  . ARG A 1 29  ? 23.187  -3.711  -12.642 1.00  22.40 ? 29  ARG A CG  1 
ATOM   240  C CD  . ARG A 1 29  ? 23.578  -4.420  -11.358 1.00  21.65 ? 29  ARG A CD  1 
ATOM   241  N NE  . ARG A 1 29  ? 24.267  -3.586  -10.393 1.00  22.32 ? 29  ARG A NE  1 
ATOM   242  C CZ  . ARG A 1 29  ? 25.586  -3.515  -10.234 1.00  22.63 ? 29  ARG A CZ  1 
ATOM   243  N NH1 . ARG A 1 29  ? 26.398  -4.139  -11.086 1.00  25.05 ? 29  ARG A NH1 1 
ATOM   244  N NH2 . ARG A 1 29  ? 26.081  -2.793  -9.234  1.00  24.74 ? 29  ARG A NH2 1 
ATOM   245  N N   . LYS A 1 30  ? 21.525  0.441   -12.986 1.00  26.38 ? 30  LYS A N   1 
ATOM   246  C CA  A LYS A 1 30  ? 20.844  1.661   -12.544 0.50  27.00 ? 30  LYS A CA  1 
ATOM   247  C CA  B LYS A 1 30  ? 20.802  1.605   -12.500 0.50  27.18 ? 30  LYS A CA  1 
ATOM   248  C C   . LYS A 1 30  ? 19.681  1.996   -13.462 1.00  27.95 ? 30  LYS A C   1 
ATOM   249  O O   . LYS A 1 30  ? 18.611  2.388   -13.017 1.00  27.89 ? 30  LYS A O   1 
ATOM   250  C CB  A LYS A 1 30  ? 21.819  2.835   -12.516 0.50  27.20 ? 30  LYS A CB  1 
ATOM   251  C CB  B LYS A 1 30  ? 21.749  2.766   -12.207 0.50  27.85 ? 30  LYS A CB  1 
ATOM   252  C CG  A LYS A 1 30  ? 22.420  3.122   -11.145 0.10  27.94 ? 30  LYS A CG  1 
ATOM   253  C CG  B LYS A 1 30  ? 22.671  2.516   -11.005 0.50  28.66 ? 30  LYS A CG  1 
ATOM   254  C CD  A LYS A 1 30  ? 22.968  1.866   -10.487 0.10  27.87 ? 30  LYS A CD  1 
ATOM   255  C CD  B LYS A 1 30  ? 21.898  1.988   -9.785  0.50  28.51 ? 30  LYS A CD  1 
ATOM   256  C CE  A LYS A 1 30  ? 23.517  2.171   -9.103  0.10  27.22 ? 30  LYS A CE  1 
ATOM   257  C CE  B LYS A 1 30  ? 22.778  1.854   -8.534  0.50  28.82 ? 30  LYS A CE  1 
ATOM   258  N NZ  A LYS A 1 30  ? 23.886  0.929   -8.376  0.10  28.00 ? 30  LYS A NZ  1 
ATOM   259  N NZ  B LYS A 1 30  ? 21.944  1.434   -7.369  0.50  27.74 ? 30  LYS A NZ  1 
ATOM   260  N N   . ILE A 1 31  ? 19.911  1.864   -14.760 1.00  27.37 ? 31  ILE A N   1 
ATOM   261  C CA  . ILE A 1 31  ? 18.855  2.133   -15.740 1.00  27.75 ? 31  ILE A CA  1 
ATOM   262  C C   . ILE A 1 31  ? 17.738  1.105   -15.574 1.00  26.93 ? 31  ILE A C   1 
ATOM   263  O O   . ILE A 1 31  ? 16.527  1.433   -15.563 1.00  27.95 ? 31  ILE A O   1 
ATOM   264  C CB  . ILE A 1 31  ? 19.426  2.040   -17.175 0.80  28.77 ? 31  ILE A CB  1 
ATOM   265  C CG1 . ILE A 1 31  ? 20.360  3.238   -17.453 0.50  29.16 ? 31  ILE A CG1 1 
ATOM   266  C CG2 . ILE A 1 31  ? 18.296  1.926   -18.197 0.50  29.10 ? 31  ILE A CG2 1 
ATOM   267  C CD1 . ILE A 1 31  ? 21.370  2.994   -18.571 0.50  29.69 ? 31  ILE A CD1 1 
ATOM   268  N N   . ALA A 1 32  ? 18.127  -0.156  -15.431 1.00  24.66 ? 32  ALA A N   1 
ATOM   269  C CA  . ALA A 1 32  ? 17.157  -1.230  -15.291 1.00  24.00 ? 32  ALA A CA  1 
ATOM   270  C C   . ALA A 1 32  ? 16.360  -1.096  -14.009 1.00  25.08 ? 32  ALA A C   1 
ATOM   271  O O   . ALA A 1 32  ? 15.138  -1.223  -14.002 1.00  26.39 ? 32  ALA A O   1 
ATOM   272  C CB  . ALA A 1 32  ? 17.855  -2.586  -15.325 1.00  24.84 ? 32  ALA A CB  1 
ATOM   273  N N   . VAL A 1 33  ? 17.045  -0.837  -12.907 1.00  25.51 ? 33  VAL A N   1 
ATOM   274  C CA  A VAL A 1 33  ? 16.333  -0.711  -11.649 0.50  27.82 ? 33  VAL A CA  1 
ATOM   275  C CA  B VAL A 1 33  ? 16.378  -0.648  -11.616 0.50  27.34 ? 33  VAL A CA  1 
ATOM   276  C C   . VAL A 1 33  ? 15.374  0.491   -11.674 1.00  28.26 ? 33  VAL A C   1 
ATOM   277  O O   . VAL A 1 33  ? 14.248  0.380   -11.172 1.00  31.46 ? 33  VAL A O   1 
ATOM   278  C CB  A VAL A 1 33  ? 17.305  -0.727  -10.438 0.50  27.81 ? 33  VAL A CB  1 
ATOM   279  C CB  B VAL A 1 33  ? 17.409  -0.392  -10.480 0.50  27.10 ? 33  VAL A CB  1 
ATOM   280  C CG1 A VAL A 1 33  ? 18.253  -1.895  -10.574 0.50  29.49 ? 33  VAL A CG1 1 
ATOM   281  C CG1 B VAL A 1 33  ? 16.795  0.426   -9.346  0.50  26.56 ? 33  VAL A CG1 1 
ATOM   282  C CG2 A VAL A 1 33  ? 18.068  0.567   -10.354 0.50  29.23 ? 33  VAL A CG2 1 
ATOM   283  C CG2 B VAL A 1 33  ? 17.904  -1.692  -9.959  0.50  28.32 ? 33  VAL A CG2 1 
ATOM   284  N N   . ALA A 1 34  ? 15.775  1.597   -12.298 0.90  28.34 ? 34  ALA A N   1 
ATOM   285  C CA  . ALA A 1 34  ? 14.893  2.771   -12.386 0.90  29.34 ? 34  ALA A CA  1 
ATOM   286  C C   . ALA A 1 34  ? 13.700  2.501   -13.300 0.90  29.41 ? 34  ALA A C   1 
ATOM   287  O O   . ALA A 1 34  ? 12.553  2.883   -12.997 0.70  31.03 ? 34  ALA A O   1 
ATOM   288  C CB  . ALA A 1 34  ? 15.645  3.935   -12.894 0.90  28.89 ? 34  ALA A CB  1 
ATOM   289  N N   . ALA A 1 35  ? 13.969  1.851   -14.430 1.00  28.87 ? 35  ALA A N   1 
ATOM   290  C CA  . ALA A 1 35  ? 12.904  1.601   -15.400 1.00  28.06 ? 35  ALA A CA  1 
ATOM   291  C C   . ALA A 1 35  ? 11.917  0.581   -14.909 1.00  28.96 ? 35  ALA A C   1 
ATOM   292  O O   . ALA A 1 35  ? 10.744  0.627   -15.277 1.00  29.56 ? 35  ALA A O   1 
ATOM   293  C CB  . ALA A 1 35  ? 13.495  1.121   -16.694 1.00  29.35 ? 35  ALA A CB  1 
ATOM   294  N N   . ALA A 1 36  ? 12.377  -0.362  -14.106 1.00  28.55 ? 36  ALA A N   1 
ATOM   295  C CA  . ALA A 1 36  ? 11.599  -1.547  -13.848 1.00  31.24 ? 36  ALA A CA  1 
ATOM   296  C C   . ALA A 1 36  ? 11.266  -1.814  -12.395 1.00  33.05 ? 36  ALA A C   1 
ATOM   297  O O   . ALA A 1 36  ? 11.042  -2.956  -12.025 1.00  34.60 ? 36  ALA A O   1 
ATOM   298  C CB  . ALA A 1 36  ? 12.275  -2.776  -14.485 1.00  32.01 ? 36  ALA A CB  1 
ATOM   299  N N   . SER A 1 37  ? 11.204  -0.758  -11.582 1.00  33.26 ? 37  SER A N   1 
ATOM   300  C CA  . SER A 1 37  ? 10.851  -0.872  -10.157 1.00  34.78 ? 37  SER A CA  1 
ATOM   301  C C   . SER A 1 37  ? 9.356   -0.646  -9.864  1.00  33.83 ? 37  SER A C   1 
ATOM   302  O O   . SER A 1 37  ? 8.875   -0.813  -8.736  1.00  34.24 ? 37  SER A O   1 
ATOM   303  C CB  . SER A 1 37  ? 11.695  0.110   -9.346  1.00  36.10 ? 37  SER A CB  1 
ATOM   304  O OG  . SER A 1 37  ? 13.078  -0.160  -9.556  1.00  39.16 ? 37  SER A OG  1 
ATOM   305  N N   . LYS A 1 38  ? 8.607   -0.244  -10.876 1.00  31.18 ? 38  LYS A N   1 
ATOM   306  C CA  . LYS A 1 38  ? 7.182   -0.207  -10.741 1.00  30.85 ? 38  LYS A CA  1 
ATOM   307  C C   . LYS A 1 38  ? 6.636   -0.836  -12.022 1.00  26.69 ? 38  LYS A C   1 
ATOM   308  O O   . LYS A 1 38  ? 5.951   -0.179  -12.779 1.00  29.13 ? 38  LYS A O   1 
ATOM   309  C CB  . LYS A 1 38  ? 6.680   1.218   -10.549 1.00  32.62 ? 38  LYS A CB  1 
ATOM   310  C CG  . LYS A 1 38  ? 6.740   1.659   -9.091  1.00  37.06 ? 38  LYS A CG  1 
ATOM   311  C CD  . LYS A 1 38  ? 6.942   3.151   -8.907  1.00  39.16 ? 38  LYS A CD  1 
ATOM   312  C CE  . LYS A 1 38  ? 5.985   3.966   -9.746  1.00  40.05 ? 38  LYS A CE  1 
ATOM   313  N NZ  . LYS A 1 38  ? 6.663   4.417   -10.991 1.00  42.75 ? 38  LYS A NZ  1 
ATOM   314  N N   . PRO A 1 39  ? 6.927   -2.136  -12.236 1.00  25.15 ? 39  PRO A N   1 
ATOM   315  C CA  . PRO A 1 39  ? 6.462   -2.795  -13.472 1.00  23.15 ? 39  PRO A CA  1 
ATOM   316  C C   . PRO A 1 39  ? 4.965   -2.969  -13.389 1.00  22.63 ? 39  PRO A C   1 
ATOM   317  O O   . PRO A 1 39  ? 4.460   -3.395  -12.333 1.00  24.31 ? 39  PRO A O   1 
ATOM   318  C CB  . PRO A 1 39  ? 7.154   -4.159  -13.430 1.00  23.67 ? 39  PRO A CB  1 
ATOM   319  C CG  . PRO A 1 39  ? 7.494   -4.409  -11.991 1.00  25.78 ? 39  PRO A CG  1 
ATOM   320  C CD  . PRO A 1 39  ? 7.644   -3.063  -11.337 1.00  26.14 ? 39  PRO A CD  1 
ATOM   321  N N   . ALA A 1 40  ? 4.252   -2.606  -14.464 1.00  21.63 ? 40  ALA A N   1 
ATOM   322  C CA  . ALA A 1 40  ? 2.828   -2.896  -14.605 1.00  21.04 ? 40  ALA A CA  1 
ATOM   323  C C   . ALA A 1 40  ? 2.717   -4.330  -15.087 1.00  20.22 ? 40  ALA A C   1 
ATOM   324  O O   . ALA A 1 40  ? 3.375   -4.668  -16.053 1.00  21.75 ? 40  ALA A O   1 
ATOM   325  C CB  . ALA A 1 40  ? 2.222   -1.967  -15.655 1.00  22.21 ? 40  ALA A CB  1 
ATOM   326  N N   . VAL A 1 41  ? 1.910   -5.147  -14.428 1.00  20.11 ? 41  VAL A N   1 
ATOM   327  C CA  . VAL A 1 41  ? 1.770   -6.573  -14.808 1.00  18.19 ? 41  VAL A CA  1 
ATOM   328  C C   . VAL A 1 41  ? 0.329   -6.861  -15.064 1.00  21.18 ? 41  VAL A C   1 
ATOM   329  O O   . VAL A 1 41  ? -0.489  -6.649  -14.182 1.00  19.41 ? 41  VAL A O   1 
ATOM   330  C CB  . VAL A 1 41  ? 2.270   -7.483  -13.652 1.00  20.49 ? 41  VAL A CB  1 
ATOM   331  C CG1 . VAL A 1 41  ? 2.071   -8.938  -13.987 1.00  20.66 ? 41  VAL A CG1 1 
ATOM   332  C CG2 . VAL A 1 41  ? 3.760   -7.226  -13.420 1.00  21.16 ? 41  VAL A CG2 1 
ATOM   333  N N   . GLU A 1 42  ? -0.004  -7.282  -16.272 1.00  15.31 ? 42  GLU A N   1 
ATOM   334  C CA  . GLU A 1 42  ? -1.377  -7.664  -16.603 1.00  21.49 ? 42  GLU A CA  1 
ATOM   335  C C   . GLU A 1 42  ? -1.332  -9.153  -16.907 1.00  17.66 ? 42  GLU A C   1 
ATOM   336  O O   . GLU A 1 42  ? -0.454  -9.638  -17.626 1.00  20.10 ? 42  GLU A O   1 
ATOM   337  C CB  . GLU A 1 42  ? -1.834  -6.953  -17.863 1.00  21.73 ? 42  GLU A CB  1 
ATOM   338  C CG  . GLU A 1 42  ? -3.237  -7.390  -18.253 1.00  27.33 ? 42  GLU A CG  1 
ATOM   339  C CD  . GLU A 1 42  ? -3.768  -6.782  -19.529 1.00  27.57 ? 42  GLU A CD  1 
ATOM   340  O OE1 . GLU A 1 42  ? -3.070  -5.981  -20.170 1.00  32.91 ? 42  GLU A OE1 1 
ATOM   341  O OE2 . GLU A 1 42  ? -4.923  -7.124  -19.889 0.60  33.36 ? 42  GLU A OE2 1 
ATOM   342  N N   . ILE A 1 43  ? -2.289  -9.888  -16.357 1.00  17.79 ? 43  ILE A N   1 
ATOM   343  C CA  . ILE A 1 43  ? -2.421  -11.305 -16.647 1.00  18.32 ? 43  ILE A CA  1 
ATOM   344  C C   . ILE A 1 43  ? -3.806  -11.594 -17.142 1.00  20.37 ? 43  ILE A C   1 
ATOM   345  O O   . ILE A 1 43  ? -4.778  -11.085 -16.572 1.00  19.99 ? 43  ILE A O   1 
ATOM   346  C CB  . ILE A 1 43  ? -2.133  -12.171 -15.391 1.00  17.81 ? 43  ILE A CB  1 
ATOM   347  C CG1 . ILE A 1 43  ? -0.705  -11.880 -14.873 1.00  16.92 ? 43  ILE A CG1 1 
ATOM   348  C CG2 . ILE A 1 43  ? -2.323  -13.675 -15.733 1.00  18.69 ? 43  ILE A CG2 1 
ATOM   349  C CD1 . ILE A 1 43  ? -0.344  -12.607 -13.542 1.00  19.05 ? 43  ILE A CD1 1 
ATOM   350  N N   . LYS A 1 44  ? -3.904  -12.378 -18.208 1.00  17.81 ? 44  LYS A N   1 
ATOM   351  C CA  A LYS A 1 44  ? -5.185  -12.953 -18.623 0.50  18.60 ? 44  LYS A CA  1 
ATOM   352  C CA  B LYS A 1 44  ? -5.175  -12.962 -18.605 0.50  19.42 ? 44  LYS A CA  1 
ATOM   353  C C   . LYS A 1 44  ? -5.036  -14.452 -18.570 1.00  20.11 ? 44  LYS A C   1 
ATOM   354  O O   . LYS A 1 44  ? -4.241  -15.018 -19.313 1.00  19.27 ? 44  LYS A O   1 
ATOM   355  C CB  A LYS A 1 44  ? -5.594  -12.516 -20.030 0.50  18.11 ? 44  LYS A CB  1 
ATOM   356  C CB  B LYS A 1 44  ? -5.573  -12.490 -19.986 0.50  20.72 ? 44  LYS A CB  1 
ATOM   357  C CG  A LYS A 1 44  ? -6.919  -13.136 -20.482 0.40  18.13 ? 44  LYS A CG  1 
ATOM   358  C CG  B LYS A 1 44  ? -5.915  -11.050 -19.949 0.50  22.80 ? 44  LYS A CG  1 
ATOM   359  C CD  A LYS A 1 44  ? -7.398  -12.324 -21.763 0.00  23.24 ? 44  LYS A CD  1 
ATOM   360  C CD  B LYS A 1 44  ? -6.128  -10.483 -21.325 0.50  24.41 ? 44  LYS A CD  1 
ATOM   361  C CE  A LYS A 1 44  ? -7.448  -10.827 -21.569 -0.10 23.98 ? 44  LYS A CE  1 
ATOM   362  C CE  B LYS A 1 44  ? -6.631  -9.070  -21.209 0.50  26.50 ? 44  LYS A CE  1 
ATOM   363  N NZ  A LYS A 1 44  ? -6.110  -10.220 -21.330 -0.10 23.87 ? 44  LYS A NZ  1 
ATOM   364  N NZ  B LYS A 1 44  ? -6.258  -8.236  -22.378 0.50  25.00 ? 44  LYS A NZ  1 
ATOM   365  N N   . GLN A 1 45  ? -5.765  -15.090 -17.666 1.00  18.38 ? 45  GLN A N   1 
ATOM   366  C CA  . GLN A 1 45  ? -5.680  -16.527 -17.544 1.00  19.15 ? 45  GLN A CA  1 
ATOM   367  C C   . GLN A 1 45  ? -6.992  -17.139 -18.037 1.00  18.35 ? 45  GLN A C   1 
ATOM   368  O O   . GLN A 1 45  ? -8.076  -16.718 -17.630 1.00  21.97 ? 45  GLN A O   1 
ATOM   369  C CB  . GLN A 1 45  ? -5.490  -16.941 -16.092 1.00  18.34 ? 45  GLN A CB  1 
ATOM   370  C CG  . GLN A 1 45  ? -5.510  -18.485 -15.914 1.00  19.32 ? 45  GLN A CG  1 
ATOM   371  C CD  . GLN A 1 45  ? -5.434  -18.941 -14.472 1.00  20.35 ? 45  GLN A CD  1 
ATOM   372  O OE1 . GLN A 1 45  ? -5.384  -18.116 -13.570 1.00  20.89 ? 45  GLN A OE1 1 
ATOM   373  N NE2 . GLN A 1 45  ? -5.486  -20.244 -14.242 1.00  20.91 ? 45  GLN A NE2 1 
ATOM   374  N N   . GLU A 1 46  ? -6.897  -18.175 -18.891 1.00  17.53 ? 46  GLU A N   1 
ATOM   375  C CA  . GLU A 1 46  ? -8.073  -18.914 -19.365 1.00  20.04 ? 46  GLU A CA  1 
ATOM   376  C C   . GLU A 1 46  ? -7.712  -20.370 -19.147 1.00  18.51 ? 46  GLU A C   1 
ATOM   377  O O   . GLU A 1 46  ? -7.107  -21.028 -20.013 1.00  20.22 ? 46  GLU A O   1 
ATOM   378  C CB  . GLU A 1 46  ? -8.340  -18.548 -20.830 1.00  18.86 ? 46  GLU A CB  1 
ATOM   379  C CG  . GLU A 1 46  ? -8.857  -17.093 -20.918 0.80  20.33 ? 46  GLU A CG  1 
ATOM   380  C CD  . GLU A 1 46  ? -9.323  -16.597 -22.323 0.70  20.59 ? 46  GLU A CD  1 
ATOM   381  O OE1 . GLU A 1 46  ? -10.034 -15.574 -22.380 0.60  23.99 ? 46  GLU A OE1 1 
ATOM   382  O OE2 . GLU A 1 46  ? -8.999  -17.204 -23.338 0.60  20.77 ? 46  GLU A OE2 1 
ATOM   383  N N   . GLY A 1 47  ? -8.021  -20.873 -17.954 1.00  20.59 ? 47  GLY A N   1 
ATOM   384  C CA  . GLY A 1 47  ? -7.570  -22.205 -17.607 1.00  20.05 ? 47  GLY A CA  1 
ATOM   385  C C   . GLY A 1 47  ? -6.050  -22.274 -17.578 1.00  19.21 ? 47  GLY A C   1 
ATOM   386  O O   . GLY A 1 47  ? -5.406  -21.537 -16.838 1.00  21.26 ? 47  GLY A O   1 
ATOM   387  N N   . ASP A 1 48  ? -5.491  -23.183 -18.379 1.00  19.18 ? 48  ASP A N   1 
ATOM   388  C CA  . ASP A 1 48  ? -4.037  -23.370 -18.413 1.00  20.02 ? 48  ASP A CA  1 
ATOM   389  C C   . ASP A 1 48  ? -3.371  -22.530 -19.467 1.00  19.34 ? 48  ASP A C   1 
ATOM   390  O O   . ASP A 1 48  ? -2.160  -22.649 -19.641 1.00  20.38 ? 48  ASP A O   1 
ATOM   391  C CB  . ASP A 1 48  ? -3.680  -24.824 -18.704 1.00  21.88 ? 48  ASP A CB  1 
ATOM   392  C CG  . ASP A 1 48  ? -3.730  -25.703 -17.472 1.00  24.09 ? 48  ASP A CG  1 
ATOM   393  O OD1 . ASP A 1 48  ? -3.736  -25.198 -16.326 1.00  24.74 ? 48  ASP A OD1 1 
ATOM   394  O OD2 . ASP A 1 48  ? -3.803  -26.935 -17.685 0.80  27.49 ? 48  ASP A OD2 1 
ATOM   395  N N   . THR A 1 49  ? -4.131  -21.679 -20.146 1.00  17.66 ? 49  THR A N   1 
ATOM   396  C CA  . THR A 1 49  ? -3.554  -20.765 -21.120 1.00  17.19 ? 49  THR A CA  1 
ATOM   397  C C   . THR A 1 49  ? -3.389  -19.367 -20.482 1.00  16.56 ? 49  THR A C   1 
ATOM   398  O O   . THR A 1 49  ? -4.351  -18.818 -19.913 1.00  19.67 ? 49  THR A O   1 
ATOM   399  C CB  . THR A 1 49  ? -4.446  -20.652 -22.341 1.00  18.67 ? 49  THR A CB  1 
ATOM   400  O OG1 . THR A 1 49  ? -4.519  -21.941 -22.971 1.00  20.05 ? 49  THR A OG1 1 
ATOM   401  C CG2 . THR A 1 49  ? -3.922  -19.583 -23.346 1.00  18.74 ? 49  THR A CG2 1 
ATOM   402  N N   . PHE A 1 50  ? -2.185  -18.797 -20.612 1.00  16.23 ? 50  PHE A N   1 
ATOM   403  C CA  . PHE A 1 50  ? -1.866  -17.517 -20.008 1.00  15.11 ? 50  PHE A CA  1 
ATOM   404  C C   . PHE A 1 50  ? -1.361  -16.516 -21.042 1.00  15.72 ? 50  PHE A C   1 
ATOM   405  O O   . PHE A 1 50  ? -0.650  -16.894 -21.988 1.00  16.18 ? 50  PHE A O   1 
ATOM   406  C CB  . PHE A 1 50  ? -0.761  -17.714 -18.963 1.00  16.60 ? 50  PHE A CB  1 
ATOM   407  C CG  . PHE A 1 50  ? -1.255  -18.284 -17.669 1.00  17.49 ? 50  PHE A CG  1 
ATOM   408  C CD1 . PHE A 1 50  ? -1.443  -19.647 -17.534 1.00  16.30 ? 50  PHE A CD1 1 
ATOM   409  C CD2 . PHE A 1 50  ? -1.509  -17.461 -16.588 1.00  16.25 ? 50  PHE A CD2 1 
ATOM   410  C CE1 . PHE A 1 50  ? -1.923  -20.186 -16.348 1.00  17.81 ? 50  PHE A CE1 1 
ATOM   411  C CE2 . PHE A 1 50  ? -1.954  -18.010 -15.388 1.00  18.54 ? 50  PHE A CE2 1 
ATOM   412  C CZ  . PHE A 1 50  ? -2.170  -19.355 -15.281 1.00  17.67 ? 50  PHE A CZ  1 
ATOM   413  N N   . TYR A 1 51  ? -1.722  -15.256 -20.813 1.00  14.82 ? 51  TYR A N   1 
ATOM   414  C CA  . TYR A 1 51  ? -1.080  -14.119 -21.465 1.00  15.12 ? 51  TYR A CA  1 
ATOM   415  C C   . TYR A 1 51  ? -0.612  -13.260 -20.332 1.00  16.00 ? 51  TYR A C   1 
ATOM   416  O O   . TYR A 1 51  ? -1.382  -12.988 -19.402 1.00  16.23 ? 51  TYR A O   1 
ATOM   417  C CB  . TYR A 1 51  ? -2.118  -13.351 -22.281 1.00  16.85 ? 51  TYR A CB  1 
ATOM   418  C CG  . TYR A 1 51  ? -1.694  -11.965 -22.665 1.00  16.70 ? 51  TYR A CG  1 
ATOM   419  C CD1 . TYR A 1 51  ? -0.750  -11.754 -23.670 1.00  16.43 ? 51  TYR A CD1 1 
ATOM   420  C CD2 . TYR A 1 51  ? -2.237  -10.844 -21.994 1.00  17.64 ? 51  TYR A CD2 1 
ATOM   421  C CE1 . TYR A 1 51  ? -0.389  -10.452 -24.050 1.00  15.32 ? 51  TYR A CE1 1 
ATOM   422  C CE2 . TYR A 1 51  ? -1.862  -9.551  -22.355 1.00  17.77 ? 51  TYR A CE2 1 
ATOM   423  C CZ  . TYR A 1 51  ? -0.950  -9.356  -23.379 1.00  18.16 ? 51  TYR A CZ  1 
ATOM   424  O OH  . TYR A 1 51  ? -0.620  -8.055  -23.791 1.00  20.45 ? 51  TYR A OH  1 
ATOM   425  N N   . ILE A 1 52  ? 0.649   -12.828 -20.383 1.00  13.53 ? 52  ILE A N   1 
ATOM   426  C CA  . ILE A 1 52  ? 1.196   -11.909 -19.350 1.00  15.01 ? 52  ILE A CA  1 
ATOM   427  C C   . ILE A 1 52  ? 1.833   -10.769 -20.076 1.00  15.25 ? 52  ILE A C   1 
ATOM   428  O O   . ILE A 1 52  ? 2.632   -10.990 -20.979 1.00  15.07 ? 52  ILE A O   1 
ATOM   429  C CB  . ILE A 1 52  ? 2.255   -12.639 -18.496 1.00  15.79 ? 52  ILE A CB  1 
ATOM   430  C CG1 . ILE A 1 52  ? 1.623   -13.880 -17.844 1.00  17.29 ? 52  ILE A CG1 1 
ATOM   431  C CG2 . ILE A 1 52  ? 2.773   -11.675 -17.421 1.00  18.00 ? 52  ILE A CG2 1 
ATOM   432  C CD1 . ILE A 1 52  ? 2.597   -14.607 -16.930 1.00  18.88 ? 52  ILE A CD1 1 
ATOM   433  N N   . LYS A 1 53  ? 1.514   -9.543  -19.684 1.00  13.94 ? 53  LYS A N   1 
ATOM   434  C CA  . LYS A 1 53  ? 2.212   -8.368  -20.237 1.00  14.36 ? 53  LYS A CA  1 
ATOM   435  C C   . LYS A 1 53  ? 2.865   -7.652  -19.092 1.00  15.97 ? 53  LYS A C   1 
ATOM   436  O O   . LYS A 1 53  ? 2.193   -7.283  -18.121 1.00  15.88 ? 53  LYS A O   1 
ATOM   437  C CB  . LYS A 1 53  ? 1.232   -7.402  -20.932 1.00  16.88 ? 53  LYS A CB  1 
ATOM   438  C CG  . LYS A 1 53  ? 1.977   -6.232  -21.519 1.00  18.19 ? 53  LYS A CG  1 
ATOM   439  C CD  . LYS A 1 53  ? 1.098   -5.357  -22.400 1.00  21.37 ? 53  LYS A CD  1 
ATOM   440  C CE  . LYS A 1 53  ? 0.019   -4.691  -21.575 1.00  23.86 ? 53  LYS A CE  1 
ATOM   441  N NZ  . LYS A 1 53  ? -0.738  -3.735  -22.481 0.70  23.71 ? 53  LYS A NZ  1 
ATOM   442  N N   . VAL A 1 54  ? 4.180   -7.450  -19.191 1.00  13.22 ? 54  VAL A N   1 
ATOM   443  C CA  . VAL A 1 54  ? 4.915   -6.672  -18.184 1.00  15.23 ? 54  VAL A CA  1 
ATOM   444  C C   . VAL A 1 54  ? 5.427   -5.436  -18.845 1.00  16.15 ? 54  VAL A C   1 
ATOM   445  O O   . VAL A 1 54  ? 6.130   -5.507  -19.854 1.00  16.48 ? 54  VAL A O   1 
ATOM   446  C CB  . VAL A 1 54  ? 6.073   -7.482  -17.630 1.00  15.57 ? 54  VAL A CB  1 
ATOM   447  C CG1 . VAL A 1 54  ? 6.759   -6.678  -16.538 1.00  16.77 ? 54  VAL A CG1 1 
ATOM   448  C CG2 . VAL A 1 54  ? 5.524   -8.793  -17.042 1.00  16.66 ? 54  VAL A CG2 1 
ATOM   449  N N   . SER A 1 55  ? 5.031   -4.285  -18.309 1.00  17.30 ? 55  SER A N   1 
ATOM   450  C CA  . SER A 1 55  ? 5.407   -2.988  -18.929 1.00  18.00 ? 55  SER A CA  1 
ATOM   451  C C   . SER A 1 55  ? 6.253   -2.168  -17.969 1.00  19.81 ? 55  SER A C   1 
ATOM   452  O O   . SER A 1 55  ? 5.843   -1.952  -16.826 1.00  20.51 ? 55  SER A O   1 
ATOM   453  C CB  . SER A 1 55  ? 4.142   -2.176  -19.299 1.00  20.99 ? 55  SER A CB  1 
ATOM   454  O OG  . SER A 1 55  ? 3.298   -2.900  -20.153 1.00  24.48 ? 55  SER A OG  1 
ATOM   455  N N   . THR A 1 56  ? 7.414   -1.714  -18.432 1.00  19.43 ? 56  THR A N   1 
ATOM   456  C CA  . THR A 1 56  ? 8.271   -0.791  -17.655 1.00  21.14 ? 56  THR A CA  1 
ATOM   457  C C   . THR A 1 56  ? 8.448   0.487   -18.472 1.00  21.04 ? 56  THR A C   1 
ATOM   458  O O   . THR A 1 56  ? 7.899   0.615   -19.556 1.00  23.18 ? 56  THR A O   1 
ATOM   459  C CB  . THR A 1 56  ? 9.657   -1.373  -17.412 1.00  23.01 ? 56  THR A CB  1 
ATOM   460  O OG1 . THR A 1 56  ? 10.363  -1.406  -18.655 1.00  23.09 ? 56  THR A OG1 1 
ATOM   461  C CG2 . THR A 1 56  ? 9.545   -2.788  -16.860 1.00  25.62 ? 56  THR A CG2 1 
ATOM   462  N N   . THR A 1 57  ? 9.221   1.446   -17.984 1.00  22.34 ? 57  THR A N   1 
ATOM   463  C CA  . THR A 1 57  ? 9.318   2.687   -18.742 1.00  23.37 ? 57  THR A CA  1 
ATOM   464  C C   . THR A 1 57  ? 9.953   2.504   -20.124 1.00  25.17 ? 57  THR A C   1 
ATOM   465  O O   . THR A 1 57  ? 9.799   3.366   -20.997 1.00  27.70 ? 57  THR A O   1 
ATOM   466  C CB  . THR A 1 57  ? 10.139  3.726   -17.982 1.00  24.20 ? 57  THR A CB  1 
ATOM   467  O OG1 . THR A 1 57  ? 11.448  3.193   -17.773 1.00  27.25 ? 57  THR A OG1 1 
ATOM   468  C CG2 . THR A 1 57  ? 9.495   3.974   -16.625 1.00  25.84 ? 57  THR A CG2 1 
ATOM   469  N N   . VAL A 1 58  ? 10.706  1.425   -20.313 1.00  23.47 ? 58  VAL A N   1 
ATOM   470  C CA  . VAL A 1 58  ? 11.478  1.235   -21.549 1.00  23.99 ? 58  VAL A CA  1 
ATOM   471  C C   . VAL A 1 58  ? 11.218  -0.097  -22.260 1.00  24.02 ? 58  VAL A C   1 
ATOM   472  O O   . VAL A 1 58  ? 11.875  -0.387  -23.258 1.00  22.39 ? 58  VAL A O   1 
ATOM   473  C CB  . VAL A 1 58  ? 13.009  1.315   -21.299 1.00  25.73 ? 58  VAL A CB  1 
ATOM   474  C CG1 . VAL A 1 58  ? 13.373  2.730   -20.834 0.70  25.61 ? 58  VAL A CG1 1 
ATOM   475  C CG2 . VAL A 1 58  ? 13.481  0.296   -20.282 0.70  25.97 ? 58  VAL A CG2 1 
ATOM   476  N N   . ARG A 1 59  ? 10.326  -0.939  -21.730 1.00  19.40 ? 59  ARG A N   1 
ATOM   477  C CA  . ARG A 1 59  ? 10.153  -2.279  -22.317 1.00  19.75 ? 59  ARG A CA  1 
ATOM   478  C C   . ARG A 1 59  ? 8.720   -2.751  -22.144 1.00  18.35 ? 59  ARG A C   1 
ATOM   479  O O   . ARG A 1 59  ? 8.105   -2.514  -21.103 1.00  18.73 ? 59  ARG A O   1 
ATOM   480  C CB  . ARG A 1 59  ? 11.102  -3.286  -21.645 1.00  20.04 ? 59  ARG A CB  1 
ATOM   481  C CG  . ARG A 1 59  ? 11.042  -4.710  -22.234 1.00  20.42 ? 59  ARG A CG  1 
ATOM   482  C CD  . ARG A 1 59  ? 12.026  -5.642  -21.565 1.00  22.32 ? 59  ARG A CD  1 
ATOM   483  N NE  . ARG A 1 59  ? 13.418  -5.287  -21.857 1.00  24.09 ? 59  ARG A NE  1 
ATOM   484  C CZ  . ARG A 1 59  ? 14.268  -6.048  -22.547 1.00  25.49 ? 59  ARG A CZ  1 
ATOM   485  N NH1 . ARG A 1 59  ? 13.884  -7.215  -23.057 1.00  24.39 ? 59  ARG A NH1 1 
ATOM   486  N NH2 . ARG A 1 59  ? 15.519  -5.629  -22.751 1.00  26.36 ? 59  ARG A NH2 1 
ATOM   487  N N   . THR A 1 60  ? 8.183   -3.409  -23.171 1.00  18.23 ? 60  THR A N   1 
ATOM   488  C CA  . THR A 1 60  ? 6.956   -4.164  -23.015 1.00  18.40 ? 60  THR A CA  1 
ATOM   489  C C   . THR A 1 60  ? 7.250   -5.631  -23.346 1.00  16.79 ? 60  THR A C   1 
ATOM   490  O O   . THR A 1 60  ? 7.773   -5.932  -24.447 1.00  19.20 ? 60  THR A O   1 
ATOM   491  C CB  . THR A 1 60  ? 5.883   -3.664  -23.939 1.00  19.52 ? 60  THR A CB  1 
ATOM   492  O OG1 . THR A 1 60  ? 5.578   -2.313  -23.617 1.00  22.38 ? 60  THR A OG1 1 
ATOM   493  C CG2 . THR A 1 60  ? 4.582   -4.496  -23.795 1.00  21.10 ? 60  THR A CG2 1 
ATOM   494  N N   . THR A 1 61  ? 6.971   -6.532  -22.388 1.00  17.29 ? 61  THR A N   1 
ATOM   495  C CA  . THR A 1 61  ? 7.198   -7.958  -22.600 1.00  15.73 ? 61  THR A CA  1 
ATOM   496  C C   . THR A 1 61  ? 5.861   -8.643  -22.583 1.00  15.85 ? 61  THR A C   1 
ATOM   497  O O   . THR A 1 61  ? 5.151   -8.547  -21.590 1.00  16.11 ? 61  THR A O   1 
ATOM   498  C CB  . THR A 1 61  ? 8.069   -8.498  -21.436 1.00  15.66 ? 61  THR A CB  1 
ATOM   499  O OG1 . THR A 1 61  ? 9.315   -7.794  -21.441 1.00  17.72 ? 61  THR A OG1 1 
ATOM   500  C CG2 . THR A 1 61  ? 8.313   -9.967  -21.555 1.00  17.39 ? 61  THR A CG2 1 
ATOM   501  N N   . GLU A 1 62  ? 5.523   -9.311  -23.673 1.00  15.32 ? 62  GLU A N   1 
ATOM   502  C CA  . GLU A 1 62  ? 4.266   -10.070 -23.707 1.00  14.24 ? 62  GLU A CA  1 
ATOM   503  C C   . GLU A 1 62  ? 4.617   -11.544 -23.852 1.00  16.77 ? 62  GLU A C   1 
ATOM   504  O O   . GLU A 1 62  ? 5.403   -11.949 -24.723 1.00  15.66 ? 62  GLU A O   1 
ATOM   505  C CB  . GLU A 1 62  ? 3.432   -9.639  -24.910 1.00  17.11 ? 62  GLU A CB  1 
ATOM   506  C CG  . GLU A 1 62  ? 2.791   -8.263  -24.688 1.00  19.13 ? 62  GLU A CG  1 
ATOM   507  C CD  . GLU A 1 62  ? 2.092   -7.766  -25.928 1.00  21.62 ? 62  GLU A CD  1 
ATOM   508  O OE1 . GLU A 1 62  ? 0.853   -7.730  -25.912 1.00  21.04 ? 62  GLU A OE1 1 
ATOM   509  O OE2 . GLU A 1 62  ? 2.792   -7.437  -26.908 1.00  24.10 ? 62  GLU A OE2 1 
ATOM   510  N N   . ILE A 1 63  ? 4.045   -12.368 -22.988 1.00  13.08 ? 63  ILE A N   1 
ATOM   511  C CA  . ILE A 1 63  ? 4.332   -13.790 -22.979 1.00  16.04 ? 63  ILE A CA  1 
ATOM   512  C C   . ILE A 1 63  ? 3.021   -14.536 -23.178 1.00  14.95 ? 63  ILE A C   1 
ATOM   513  O O   . ILE A 1 63  ? 1.996   -14.192 -22.567 1.00  15.47 ? 63  ILE A O   1 
ATOM   514  C CB  . ILE A 1 63  ? 4.920   -14.196 -21.597 1.00  17.19 ? 63  ILE A CB  1 
ATOM   515  C CG1 . ILE A 1 63  ? 6.172   -13.368 -21.260 1.00  20.87 ? 63  ILE A CG1 1 
ATOM   516  C CG2 . ILE A 1 63  ? 5.246   -15.680 -21.567 1.00  20.47 ? 63  ILE A CG2 1 
ATOM   517  C CD1 . ILE A 1 63  ? 6.600   -13.604 -19.784 1.00  20.54 ? 63  ILE A CD1 1 
ATOM   518  N N   . ASN A 1 64  ? 3.046   -15.580 -24.029 1.00  13.89 ? 64  ASN A N   1 
ATOM   519  C CA  . ASN A 1 64  ? 1.873   -16.415 -24.268 1.00  13.99 ? 64  ASN A CA  1 
ATOM   520  C C   . ASN A 1 64  ? 2.276   -17.864 -24.048 1.00  13.47 ? 64  ASN A C   1 
ATOM   521  O O   . ASN A 1 64  ? 3.186   -18.329 -24.737 1.00  15.32 ? 64  ASN A O   1 
ATOM   522  C CB  . ASN A 1 64  ? 1.437   -16.253 -25.712 1.00  14.38 ? 64  ASN A CB  1 
ATOM   523  C CG  . ASN A 1 64  ? 0.723   -14.921 -25.943 1.00  15.40 ? 64  ASN A CG  1 
ATOM   524  O OD1 . ASN A 1 64  ? -0.440  -14.739 -25.520 1.00  15.83 ? 64  ASN A OD1 1 
ATOM   525  N ND2 . ASN A 1 64  ? 1.432   -13.960 -26.601 1.00  14.95 ? 64  ASN A ND2 1 
ATOM   526  N N   . PHE A 1 65  ? 1.631   -18.561 -23.104 1.00  14.92 ? 65  PHE A N   1 
ATOM   527  C CA  . PHE A 1 65  ? 2.027   -19.935 -22.912 1.00  15.05 ? 65  PHE A CA  1 
ATOM   528  C C   . PHE A 1 65  ? 0.842   -20.753 -22.446 1.00  15.29 ? 65  PHE A C   1 
ATOM   529  O O   . PHE A 1 65  ? -0.159  -20.200 -21.953 1.00  16.05 ? 65  PHE A O   1 
ATOM   530  C CB  . PHE A 1 65  ? 3.166   -20.091 -21.912 1.00  15.53 ? 65  PHE A CB  1 
ATOM   531  C CG  . PHE A 1 65  ? 2.835   -19.668 -20.507 1.00  15.18 ? 65  PHE A CG  1 
ATOM   532  C CD1 . PHE A 1 65  ? 2.241   -20.557 -19.583 1.00  16.32 ? 65  PHE A CD1 1 
ATOM   533  C CD2 . PHE A 1 65  ? 3.158   -18.371 -20.083 1.00  15.09 ? 65  PHE A CD2 1 
ATOM   534  C CE1 . PHE A 1 65  ? 1.969   -20.144 -18.265 1.00  16.25 ? 65  PHE A CE1 1 
ATOM   535  C CE2 . PHE A 1 65  ? 2.885   -17.969 -18.782 1.00  15.81 ? 65  PHE A CE2 1 
ATOM   536  C CZ  . PHE A 1 65  ? 2.255   -18.870 -17.877 1.00  15.52 ? 65  PHE A CZ  1 
ATOM   537  N N   . LYS A 1 66  ? 0.977   -22.054 -22.643 1.00  17.08 ? 66  LYS A N   1 
ATOM   538  C CA  A LYS A 1 66  ? 0.052   -23.017 -22.059 0.50  16.69 ? 66  LYS A CA  1 
ATOM   539  C CA  B LYS A 1 66  ? 0.049   -22.977 -22.008 0.50  17.13 ? 66  LYS A CA  1 
ATOM   540  C C   . LYS A 1 66  ? 0.856   -23.841 -21.063 1.00  16.92 ? 66  LYS A C   1 
ATOM   541  O O   . LYS A 1 66  ? 1.983   -24.260 -21.376 1.00  15.93 ? 66  LYS A O   1 
ATOM   542  C CB  A LYS A 1 66  ? -0.544  -23.926 -23.174 0.50  17.32 ? 66  LYS A CB  1 
ATOM   543  C CB  B LYS A 1 66  ? -0.685  -23.862 -23.038 0.50  19.79 ? 66  LYS A CB  1 
ATOM   544  C CG  A LYS A 1 66  ? -1.293  -23.122 -24.224 0.50  17.33 ? 66  LYS A CG  1 
ATOM   545  C CG  B LYS A 1 66  ? -1.738  -24.755 -22.393 0.50  23.33 ? 66  LYS A CG  1 
ATOM   546  C CD  A LYS A 1 66  ? -1.954  -23.952 -25.315 0.50  19.87 ? 66  LYS A CD  1 
ATOM   547  C CD  B LYS A 1 66  ? -2.489  -25.561 -23.450 0.50  25.04 ? 66  LYS A CD  1 
ATOM   548  C CE  A LYS A 1 66  ? -2.698  -23.017 -26.276 0.50  20.63 ? 66  LYS A CE  1 
ATOM   549  C CE  B LYS A 1 66  ? -3.633  -26.386 -22.868 0.50  27.54 ? 66  LYS A CE  1 
ATOM   550  N NZ  A LYS A 1 66  ? -3.995  -22.456 -25.768 0.50  20.80 ? 66  LYS A NZ  1 
ATOM   551  N NZ  B LYS A 1 66  ? -4.247  -27.191 -23.977 0.50  28.59 ? 66  LYS A NZ  1 
ATOM   552  N N   . VAL A 1 67  ? 0.320   -24.071 -19.872 1.00  16.35 ? 67  VAL A N   1 
ATOM   553  C CA  . VAL A 1 67  ? 1.048   -24.846 -18.917 1.00  16.45 ? 67  VAL A CA  1 
ATOM   554  C C   . VAL A 1 67  ? 1.389   -26.203 -19.514 1.00  17.13 ? 67  VAL A C   1 
ATOM   555  O O   . VAL A 1 67  ? 0.527   -26.845 -20.142 1.00  19.22 ? 67  VAL A O   1 
ATOM   556  C CB  . VAL A 1 67  ? 0.215   -24.987 -17.628 1.00  18.15 ? 67  VAL A CB  1 
ATOM   557  C CG1 . VAL A 1 67  ? 0.943   -25.896 -16.664 1.00  19.52 ? 67  VAL A CG1 1 
ATOM   558  C CG2 . VAL A 1 67  ? -0.012  -23.598 -17.008 1.00  17.66 ? 67  VAL A CG2 1 
ATOM   559  N N   . GLY A 1 68  ? 2.645   -26.614 -19.377 1.00  16.36 ? 68  GLY A N   1 
ATOM   560  C CA  . GLY A 1 68  ? 3.077   -27.918 -19.863 1.00  18.34 ? 68  GLY A CA  1 
ATOM   561  C C   . GLY A 1 68  ? 3.582   -27.953 -21.295 1.00  19.04 ? 68  GLY A C   1 
ATOM   562  O O   . GLY A 1 68  ? 4.021   -29.015 -21.770 1.00  20.97 ? 68  GLY A O   1 
ATOM   563  N N   . GLU A 1 69  ? 3.553   -26.806 -21.979 1.00  18.13 ? 69  GLU A N   1 
ATOM   564  C CA  A GLU A 1 69  ? 3.994   -26.729 -23.375 0.50  19.02 ? 69  GLU A CA  1 
ATOM   565  C CA  B GLU A 1 69  ? 3.964   -26.712 -23.386 0.50  19.18 ? 69  GLU A CA  1 
ATOM   566  C C   . GLU A 1 69  ? 5.147   -25.739 -23.522 1.00  17.79 ? 69  GLU A C   1 
ATOM   567  O O   . GLU A 1 69  ? 5.077   -24.599 -23.052 1.00  17.36 ? 69  GLU A O   1 
ATOM   568  C CB  A GLU A 1 69  ? 2.834   -26.326 -24.281 0.50  18.40 ? 69  GLU A CB  1 
ATOM   569  C CB  B GLU A 1 69  ? 2.794   -26.207 -24.234 0.50  18.79 ? 69  GLU A CB  1 
ATOM   570  C CG  A GLU A 1 69  ? 1.716   -27.355 -24.214 0.50  21.44 ? 69  GLU A CG  1 
ATOM   571  C CG  B GLU A 1 69  ? 3.108   -26.022 -25.707 0.50  22.16 ? 69  GLU A CG  1 
ATOM   572  C CD  A GLU A 1 69  ? 0.573   -27.102 -25.147 0.50  25.61 ? 69  GLU A CD  1 
ATOM   573  C CD  B GLU A 1 69  ? 1.875   -25.822 -26.556 0.50  26.72 ? 69  GLU A CD  1 
ATOM   574  O OE1 A GLU A 1 69  ? 0.529   -26.045 -25.833 0.50  24.47 ? 69  GLU A OE1 1 
ATOM   575  O OE1 B GLU A 1 69  ? 0.968   -26.674 -26.472 0.50  25.60 ? 69  GLU A OE1 1 
ATOM   576  O OE2 A GLU A 1 69  ? -0.301  -28.007 -25.173 0.50  24.01 ? 69  GLU A OE2 1 
ATOM   577  O OE2 B GLU A 1 69  ? 1.835   -24.844 -27.338 0.50  24.27 ? 69  GLU A OE2 1 
ATOM   578  N N   . GLU A 1 70  ? 6.214   -26.183 -24.184 1.00  17.56 ? 70  GLU A N   1 
ATOM   579  C CA  . GLU A 1 70  ? 7.422   -25.398 -24.280 1.00  18.24 ? 70  GLU A CA  1 
ATOM   580  C C   . GLU A 1 70  ? 7.174   -24.141 -25.117 1.00  18.07 ? 70  GLU A C   1 
ATOM   581  O O   . GLU A 1 70  ? 6.404   -24.171 -26.099 1.00  18.84 ? 70  GLU A O   1 
ATOM   582  C CB  . GLU A 1 70  ? 8.513   -26.258 -24.967 1.00  20.66 ? 70  GLU A CB  1 
ATOM   583  C CG  . GLU A 1 70  ? 9.870   -25.613 -25.029 0.80  23.42 ? 70  GLU A CG  1 
ATOM   584  C CD  . GLU A 1 70  ? 10.825  -26.402 -25.922 0.70  24.66 ? 70  GLU A CD  1 
ATOM   585  O OE1 . GLU A 1 70  ? 11.305  -27.456 -25.470 0.50  25.42 ? 70  GLU A OE1 1 
ATOM   586  O OE2 . GLU A 1 70  ? 11.069  -25.967 -27.075 0.50  26.47 ? 70  GLU A OE2 1 
ATOM   587  N N   . PHE A 1 71  ? 7.820   -23.042 -24.724 1.00  15.59 ? 71  PHE A N   1 
ATOM   588  C CA  . PHE A 1 71  ? 7.754   -21.805 -25.512 1.00  15.56 ? 71  PHE A CA  1 
ATOM   589  C C   . PHE A 1 71  ? 9.091   -21.099 -25.475 1.00  16.25 ? 71  PHE A C   1 
ATOM   590  O O   . PHE A 1 71  ? 9.994   -21.506 -24.755 1.00  16.77 ? 71  PHE A O   1 
ATOM   591  C CB  . PHE A 1 71  ? 6.636   -20.902 -25.004 1.00  15.64 ? 71  PHE A CB  1 
ATOM   592  C CG  . PHE A 1 71  ? 6.799   -20.444 -23.579 1.00  13.86 ? 71  PHE A CG  1 
ATOM   593  C CD1 . PHE A 1 71  ? 6.496   -21.284 -22.487 1.00  15.07 ? 71  PHE A CD1 1 
ATOM   594  C CD2 . PHE A 1 71  ? 7.178   -19.133 -23.331 1.00  15.33 ? 71  PHE A CD2 1 
ATOM   595  C CE1 . PHE A 1 71  ? 6.623   -20.832 -21.191 1.00  15.53 ? 71  PHE A CE1 1 
ATOM   596  C CE2 . PHE A 1 71  ? 7.297   -18.679 -22.019 1.00  14.38 ? 71  PHE A CE2 1 
ATOM   597  C CZ  . PHE A 1 71  ? 7.008   -19.524 -20.954 1.00  16.02 ? 71  PHE A CZ  1 
ATOM   598  N N   . GLU A 1 72  ? 9.226   -20.089 -26.329 1.00  14.10 ? 72  GLU A N   1 
ATOM   599  C CA  . GLU A 1 72  ? 10.485  -19.330 -26.461 1.00  15.96 ? 72  GLU A CA  1 
ATOM   600  C C   . GLU A 1 72  ? 10.459  -18.062 -25.641 1.00  16.62 ? 72  GLU A C   1 
ATOM   601  O O   . GLU A 1 72  ? 9.452   -17.373 -25.636 1.00  17.07 ? 72  GLU A O   1 
ATOM   602  C CB  . GLU A 1 72  ? 10.734  -18.997 -27.932 1.00  16.79 ? 72  GLU A CB  1 
ATOM   603  C CG  . GLU A 1 72  ? 10.991  -20.262 -28.743 1.00  20.28 ? 72  GLU A CG  1 
ATOM   604  C CD  . GLU A 1 72  ? 12.332  -20.882 -28.340 1.00  23.75 ? 72  GLU A CD  1 
ATOM   605  O OE1 . GLU A 1 72  ? 13.351  -20.149 -28.268 1.00  25.40 ? 72  GLU A OE1 1 
ATOM   606  O OE2 . GLU A 1 72  ? 12.382  -22.105 -28.102 1.00  28.53 ? 72  GLU A OE2 1 
ATOM   607  N N   . GLU A 1 73  ? 11.585  -17.732 -24.993 1.00  16.82 ? 73  GLU A N   1 
ATOM   608  C CA  . GLU A 1 73  ? 11.645  -16.570 -24.122 1.00  17.37 ? 73  GLU A CA  1 
ATOM   609  C C   . GLU A 1 73  ? 13.107  -16.061 -24.173 1.00  17.08 ? 73  GLU A C   1 
ATOM   610  O O   . GLU A 1 73  ? 13.962  -16.692 -24.826 1.00  17.33 ? 73  GLU A O   1 
ATOM   611  C CB  . GLU A 1 73  ? 11.258  -17.000 -22.691 1.00  20.56 ? 73  GLU A CB  1 
ATOM   612  C CG  . GLU A 1 73  ? 10.725  -15.894 -21.831 1.00  22.16 ? 73  GLU A CG  1 
ATOM   613  C CD  . GLU A 1 73  ? 10.199  -16.359 -20.473 1.00  19.59 ? 73  GLU A CD  1 
ATOM   614  O OE1 . GLU A 1 73  ? 9.668   -15.494 -19.749 1.00  22.61 ? 73  GLU A OE1 1 
ATOM   615  O OE2 . GLU A 1 73  ? 10.402  -17.524 -20.053 1.00  18.70 ? 73  GLU A OE2 1 
ATOM   616  N N   . GLN A 1 74  ? 13.389  -14.941 -23.514 1.00  18.43 ? 74  GLN A N   1 
ATOM   617  C CA  . GLN A 1 74  ? 14.777  -14.640 -23.147 1.00  18.89 ? 74  GLN A CA  1 
ATOM   618  C C   . GLN A 1 74  ? 14.837  -14.543 -21.628 1.00  18.81 ? 74  GLN A C   1 
ATOM   619  O O   . GLN A 1 74  ? 13.831  -14.212 -20.981 1.00  20.43 ? 74  GLN A O   1 
ATOM   620  C CB  . GLN A 1 74  ? 15.292  -13.335 -23.785 1.00  19.29 ? 74  GLN A CB  1 
ATOM   621  C CG  . GLN A 1 74  ? 15.438  -13.517 -25.293 1.00  19.90 ? 74  GLN A CG  1 
ATOM   622  C CD  . GLN A 1 74  ? 16.195  -12.407 -25.968 1.00  19.45 ? 74  GLN A CD  1 
ATOM   623  O OE1 . GLN A 1 74  ? 16.389  -11.327 -25.384 1.00  22.22 ? 74  GLN A OE1 1 
ATOM   624  N NE2 . GLN A 1 74  ? 16.607  -12.651 -27.225 1.00  20.94 ? 74  GLN A NE2 1 
ATOM   625  N N   . THR A 1 75  ? 16.009  -14.828 -21.070 1.00  19.24 ? 75  THR A N   1 
ATOM   626  C CA  . THR A 1 75  ? 16.187  -14.736 -19.606 1.00  19.95 ? 75  THR A CA  1 
ATOM   627  C C   . THR A 1 75  ? 16.221  -13.255 -19.168 1.00  21.88 ? 75  THR A C   1 
ATOM   628  O O   . THR A 1 75  ? 16.242  -12.353 -20.001 1.00  22.53 ? 75  THR A O   1 
ATOM   629  C CB  . THR A 1 75  ? 17.516  -15.378 -19.185 1.00  21.89 ? 75  THR A CB  1 
ATOM   630  O OG1 . THR A 1 75  ? 18.606  -14.667 -19.786 1.00  22.96 ? 75  THR A OG1 1 
ATOM   631  C CG2 . THR A 1 75  ? 17.583  -16.787 -19.642 1.00  22.04 ? 75  THR A CG2 1 
ATOM   632  N N   . VAL A 1 76  ? 16.253  -12.991 -17.864 1.00  23.61 ? 76  VAL A N   1 
ATOM   633  C CA  . VAL A 1 76  ? 16.156  -11.593 -17.404 1.00  26.18 ? 76  VAL A CA  1 
ATOM   634  C C   . VAL A 1 76  ? 17.368  -10.757 -17.819 1.00  27.15 ? 76  VAL A C   1 
ATOM   635  O O   . VAL A 1 76  ? 17.270  -9.520  -17.965 1.00  28.49 ? 76  VAL A O   1 
ATOM   636  C CB  . VAL A 1 76  ? 15.931  -11.519 -15.887 1.00  28.04 ? 76  VAL A CB  1 
ATOM   637  C CG1 . VAL A 1 76  ? 17.115  -12.107 -15.160 1.00  28.05 ? 76  VAL A CG1 1 
ATOM   638  C CG2 . VAL A 1 76  ? 15.632  -10.053 -15.438 1.00  29.08 ? 76  VAL A CG2 1 
ATOM   639  N N   . ASP A 1 77  ? 18.493  -11.433 -18.056 1.00  25.25 ? 77  ASP A N   1 
ATOM   640  C CA  . ASP A 1 77  ? 19.677  -10.778 -18.580 1.00  26.99 ? 77  ASP A CA  1 
ATOM   641  C C   . ASP A 1 77  ? 19.821  -10.880 -20.118 0.90  26.51 ? 77  ASP A C   1 
ATOM   642  O O   . ASP A 1 77  ? 20.852  -10.480 -20.683 1.00  28.69 ? 77  ASP A O   1 
ATOM   643  C CB  . ASP A 1 77  ? 20.912  -11.345 -17.889 1.00  28.57 ? 77  ASP A CB  1 
ATOM   644  C CG  . ASP A 1 77  ? 21.108  -12.809 -18.160 1.00  30.22 ? 77  ASP A CG  1 
ATOM   645  O OD1 . ASP A 1 77  ? 20.136  -13.585 -17.986 1.00  30.08 ? 77  ASP A OD1 1 
ATOM   646  O OD2 . ASP A 1 77  ? 22.249  -13.189 -18.518 1.00  33.42 ? 77  ASP A OD2 1 
ATOM   647  N N   . GLY A 1 78  ? 18.805  -11.415 -20.804 1.00  24.55 ? 78  GLY A N   1 
ATOM   648  C CA  . GLY A 1 78  ? 18.745  -11.307 -22.275 1.00  23.95 ? 78  GLY A CA  1 
ATOM   649  C C   . GLY A 1 78  ? 19.188  -12.483 -23.136 1.00  22.46 ? 78  GLY A C   1 
ATOM   650  O O   . GLY A 1 78  ? 19.386  -12.326 -24.355 1.00  25.14 ? 78  GLY A O   1 
ATOM   651  N N   . ARG A 1 79  ? 19.327  -13.670 -22.543 1.00  22.72 ? 79  ARG A N   1 
ATOM   652  C CA  . ARG A 1 79  ? 19.805  -14.825 -23.286 1.00  21.74 ? 79  ARG A CA  1 
ATOM   653  C C   . ARG A 1 79  ? 18.638  -15.681 -23.795 1.00  20.70 ? 79  ARG A C   1 
ATOM   654  O O   . ARG A 1 79  ? 17.690  -15.944 -23.063 1.00  21.06 ? 79  ARG A O   1 
ATOM   655  C CB  . ARG A 1 79  ? 20.746  -15.668 -22.394 1.00  20.54 ? 79  ARG A CB  1 
ATOM   656  C CG  . ARG A 1 79  ? 21.907  -14.829 -21.842 1.00  23.63 ? 79  ARG A CG  1 
ATOM   657  C CD  . ARG A 1 79  ? 22.868  -15.714 -21.048 1.00  23.67 ? 79  ARG A CD  1 
ATOM   658  N NE  . ARG A 1 79  ? 23.529  -16.753 -21.840 0.80  25.24 ? 79  ARG A NE  1 
ATOM   659  C CZ  . ARG A 1 79  ? 24.404  -17.624 -21.316 0.80  24.44 ? 79  ARG A CZ  1 
ATOM   660  N NH1 . ARG A 1 79  ? 24.706  -17.549 -20.033 0.80  26.63 ? 79  ARG A NH1 1 
ATOM   661  N NH2 . ARG A 1 79  ? 24.974  -18.564 -22.052 0.80  26.03 ? 79  ARG A NH2 1 
ATOM   662  N N   . PRO A 1 80  ? 18.666  -16.062 -25.075 1.00  20.51 ? 80  PRO A N   1 
ATOM   663  C CA  . PRO A 1 80  ? 17.591  -16.926 -25.569 1.00  20.11 ? 80  PRO A CA  1 
ATOM   664  C C   . PRO A 1 80  ? 17.410  -18.223 -24.785 1.00  18.22 ? 80  PRO A C   1 
ATOM   665  O O   . PRO A 1 80  ? 18.405  -18.928 -24.511 1.00  21.51 ? 80  PRO A O   1 
ATOM   666  C CB  . PRO A 1 80  ? 18.026  -17.220 -27.001 1.00  20.64 ? 80  PRO A CB  1 
ATOM   667  C CG  . PRO A 1 80  ? 18.820  -15.983 -27.382 1.00  21.89 ? 80  PRO A CG  1 
ATOM   668  C CD  . PRO A 1 80  ? 19.597  -15.681 -26.146 1.00  20.15 ? 80  PRO A CD  1 
ATOM   669  N N   . CYS A 1 81  ? 16.158  -18.552 -24.446 1.00  17.85 ? 81  CYS A N   1 
ATOM   670  C CA  . CYS A 1 81  ? 15.942  -19.826 -23.774 1.00  16.33 ? 81  CYS A CA  1 
ATOM   671  C C   . CYS A 1 81  ? 14.640  -20.460 -24.207 1.00  17.67 ? 81  CYS A C   1 
ATOM   672  O O   . CYS A 1 81  ? 13.775  -19.795 -24.783 1.00  17.23 ? 81  CYS A O   1 
ATOM   673  C CB  . CYS A 1 81  ? 15.923  -19.607 -22.268 1.00  17.94 ? 81  CYS A CB  1 
ATOM   674  S SG  . CYS A 1 81  ? 14.613  -18.516 -21.645 1.00  18.14 ? 81  CYS A SG  1 
ATOM   675  N N   . LYS A 1 82  ? 14.557  -21.767 -23.975 1.00  17.47 ? 82  LYS A N   1 
ATOM   676  C CA  A LYS A 1 82  ? 13.288  -22.450 -24.106 0.50  18.60 ? 82  LYS A CA  1 
ATOM   677  C CA  B LYS A 1 82  ? 13.313  -22.527 -24.093 0.50  17.77 ? 82  LYS A CA  1 
ATOM   678  C C   . LYS A 1 82  ? 12.736  -22.631 -22.697 1.00  17.52 ? 82  LYS A C   1 
ATOM   679  O O   . LYS A 1 82  ? 13.456  -23.028 -21.757 1.00  19.03 ? 82  LYS A O   1 
ATOM   680  C CB  A LYS A 1 82  ? 13.455  -23.785 -24.833 0.50  20.09 ? 82  LYS A CB  1 
ATOM   681  C CB  B LYS A 1 82  ? 13.599  -23.957 -24.555 0.50  19.93 ? 82  LYS A CB  1 
ATOM   682  C CG  A LYS A 1 82  ? 14.640  -24.598 -24.388 0.50  22.95 ? 82  LYS A CG  1 
ATOM   683  C CG  B LYS A 1 82  ? 14.063  -24.107 -25.966 0.50  22.58 ? 82  LYS A CG  1 
ATOM   684  C CD  A LYS A 1 82  ? 14.768  -25.857 -25.243 0.40  21.96 ? 82  LYS A CD  1 
ATOM   685  C CD  B LYS A 1 82  ? 14.160  -25.580 -26.323 0.40  23.17 ? 82  LYS A CD  1 
ATOM   686  C CE  A LYS A 1 82  ? 15.501  -25.600 -26.563 0.40  24.24 ? 82  LYS A CE  1 
ATOM   687  C CE  B LYS A 1 82  ? 15.307  -26.272 -25.605 0.40  24.81 ? 82  LYS A CE  1 
ATOM   688  N NZ  A LYS A 1 82  ? 14.629  -24.962 -27.603 0.40  26.54 ? 82  LYS A NZ  1 
ATOM   689  N NZ  B LYS A 1 82  ? 15.536  -27.606 -26.235 0.40  25.04 ? 82  LYS A NZ  1 
ATOM   690  N N   . SER A 1 83  ? 11.468  -22.276 -22.560 1.00  15.46 ? 83  SER A N   1 
ATOM   691  C CA  . SER A 1 83  ? 10.821  -22.205 -21.259 1.00  13.99 ? 83  SER A CA  1 
ATOM   692  C C   . SER A 1 83  ? 9.674   -23.188 -21.151 1.00  14.53 ? 83  SER A C   1 
ATOM   693  O O   . SER A 1 83  ? 9.081   -23.575 -22.140 1.00  15.52 ? 83  SER A O   1 
ATOM   694  C CB  . SER A 1 83  ? 10.276  -20.795 -21.060 1.00  16.10 ? 83  SER A CB  1 
ATOM   695  O OG  . SER A 1 83  ? 11.386  -19.924 -20.938 1.00  16.07 ? 83  SER A OG  1 
ATOM   696  N N   . LEU A 1 84  ? 9.387   -23.595 -19.919 1.00  14.88 ? 84  LEU A N   1 
ATOM   697  C CA  . LEU A 1 84  ? 8.306   -24.528 -19.692 1.00  15.87 ? 84  LEU A CA  1 
ATOM   698  C C   . LEU A 1 84  ? 7.715   -24.276 -18.324 1.00  16.71 ? 84  LEU A C   1 
ATOM   699  O O   . LEU A 1 84  ? 8.419   -24.326 -17.331 1.00  15.87 ? 84  LEU A O   1 
ATOM   700  C CB  . LEU A 1 84  ? 8.848   -25.960 -19.758 1.00  18.28 ? 84  LEU A CB  1 
ATOM   701  C CG  . LEU A 1 84  ? 7.824   -27.086 -19.515 1.00  20.60 ? 84  LEU A CG  1 
ATOM   702  C CD1 . LEU A 1 84  ? 6.774   -27.101 -20.557 1.00  20.62 ? 84  LEU A CD1 1 
ATOM   703  C CD2 . LEU A 1 84  ? 8.577   -28.427 -19.518 1.00  19.86 ? 84  LEU A CD2 1 
ATOM   704  N N   . VAL A 1 85  ? 6.423   -23.970 -18.275 1.00  14.69 ? 85  VAL A N   1 
ATOM   705  C CA  . VAL A 1 85  ? 5.789   -23.642 -17.011 1.00  15.36 ? 85  VAL A CA  1 
ATOM   706  C C   . VAL A 1 85  ? 5.033   -24.925 -16.532 1.00  15.78 ? 85  VAL A C   1 
ATOM   707  O O   . VAL A 1 85  ? 4.316   -25.586 -17.337 1.00  18.29 ? 85  VAL A O   1 
ATOM   708  C CB  . VAL A 1 85  ? 4.774   -22.536 -17.172 1.00  15.44 ? 85  VAL A CB  1 
ATOM   709  C CG1 . VAL A 1 85  ? 3.939   -22.355 -15.881 1.00  16.65 ? 85  VAL A CG1 1 
ATOM   710  C CG2 . VAL A 1 85  ? 5.497   -21.218 -17.557 1.00  16.54 ? 85  VAL A CG2 1 
ATOM   711  N N   . LYS A 1 86  ? 5.167   -25.269 -15.252 1.00  18.47 ? 86  LYS A N   1 
ATOM   712  C CA  . LYS A 1 86  ? 4.348   -26.317 -14.663 1.00  19.58 ? 86  LYS A CA  1 
ATOM   713  C C   . LYS A 1 86  ? 3.681   -25.800 -13.397 1.00  16.63 ? 86  LYS A C   1 
ATOM   714  O O   . LYS A 1 86  ? 4.236   -24.905 -12.748 1.00  18.48 ? 86  LYS A O   1 
ATOM   715  C CB  . LYS A 1 86  ? 5.213   -27.516 -14.282 1.00  20.47 ? 86  LYS A CB  1 
ATOM   716  C CG  . LYS A 1 86  ? 5.932   -28.075 -15.484 1.00  25.57 ? 86  LYS A CG  1 
ATOM   717  C CD  . LYS A 1 86  ? 6.657   -29.359 -15.112 1.00  28.54 ? 86  LYS A CD  1 
ATOM   718  C CE  . LYS A 1 86  ? 7.417   -29.882 -16.305 1.00  30.63 ? 86  LYS A CE  1 
ATOM   719  N NZ  . LYS A 1 86  ? 7.725   -31.324 -16.081 1.00  34.78 ? 86  LYS A NZ  1 
ATOM   720  N N   . TRP A 1 87  ? 2.536   -26.357 -13.028 1.00  19.79 ? 87  TRP A N   1 
ATOM   721  C CA  . TRP A 1 87  ? 2.004   -26.060 -11.716 1.00  18.13 ? 87  TRP A CA  1 
ATOM   722  C C   . TRP A 1 87  ? 2.782   -26.793 -10.619 1.00  20.92 ? 87  TRP A C   1 
ATOM   723  O O   . TRP A 1 87  ? 2.933   -28.021 -10.654 1.00  21.15 ? 87  TRP A O   1 
ATOM   724  C CB  . TRP A 1 87  ? 0.533   -26.518 -11.629 1.00  19.53 ? 87  TRP A CB  1 
ATOM   725  C CG  . TRP A 1 87  ? -0.408  -25.743 -12.490 1.00  18.71 ? 87  TRP A CG  1 
ATOM   726  C CD1 . TRP A 1 87  ? -1.036  -26.177 -13.620 1.00  19.84 ? 87  TRP A CD1 1 
ATOM   727  C CD2 . TRP A 1 87  ? -0.831  -24.390 -12.288 1.00  18.17 ? 87  TRP A CD2 1 
ATOM   728  N NE1 . TRP A 1 87  ? -1.840  -25.183 -14.125 1.00  19.05 ? 87  TRP A NE1 1 
ATOM   729  C CE2 . TRP A 1 87  ? -1.733  -24.070 -13.323 1.00  18.62 ? 87  TRP A CE2 1 
ATOM   730  C CE3 . TRP A 1 87  ? -0.548  -23.428 -11.314 1.00  18.86 ? 87  TRP A CE3 1 
ATOM   731  C CZ2 . TRP A 1 87  ? -2.363  -22.822 -13.424 1.00  19.01 ? 87  TRP A CZ2 1 
ATOM   732  C CZ3 . TRP A 1 87  ? -1.180  -22.187 -11.405 1.00  19.61 ? 87  TRP A CZ3 1 
ATOM   733  C CH2 . TRP A 1 87  ? -2.075  -21.890 -12.460 1.00  19.59 ? 87  TRP A CH2 1 
ATOM   734  N N   . GLU A 1 88  ? 3.257   -26.040 -9.642  1.00  22.21 ? 88  GLU A N   1 
ATOM   735  C CA  . GLU A 1 88  ? 3.873   -26.665 -8.466  1.00  23.04 ? 88  GLU A CA  1 
ATOM   736  C C   . GLU A 1 88  ? 2.764   -27.105 -7.518  1.00  26.31 ? 88  GLU A C   1 
ATOM   737  O O   . GLU A 1 88  ? 2.871   -28.149 -6.838  1.00  26.09 ? 88  GLU A O   1 
ATOM   738  C CB  . GLU A 1 88  ? 4.810   -25.659 -7.777  1.00  24.42 ? 88  GLU A CB  1 
ATOM   739  C CG  . GLU A 1 88  ? 5.446   -26.196 -6.515  0.90  26.72 ? 88  GLU A CG  1 
ATOM   740  C CD  . GLU A 1 88  ? 6.423   -25.217 -5.915  0.70  27.58 ? 88  GLU A CD  1 
ATOM   741  O OE1 . GLU A 1 88  ? 7.581   -25.148 -6.393  0.60  27.32 ? 88  GLU A OE1 1 
ATOM   742  O OE2 . GLU A 1 88  ? 6.038   -24.551 -4.940  0.60  28.36 ? 88  GLU A OE2 1 
ATOM   743  N N   . SER A 1 89  ? 1.706   -26.308 -7.477  1.00  24.82 ? 89  SER A N   1 
ATOM   744  C CA  . SER A 1 89  ? 0.546   -26.542 -6.639  1.00  25.16 ? 89  SER A CA  1 
ATOM   745  C C   . SER A 1 89  ? -0.586  -25.816 -7.315  1.00  23.64 ? 89  SER A C   1 
ATOM   746  O O   . SER A 1 89  ? -0.392  -25.141 -8.352  1.00  26.28 ? 89  SER A O   1 
ATOM   747  C CB  . SER A 1 89  ? 0.778   -25.967 -5.249  1.00  26.25 ? 89  SER A CB  1 
ATOM   748  O OG  . SER A 1 89  ? 0.912   -24.539 -5.309  1.00  27.56 ? 89  SER A OG  1 
ATOM   749  N N   . GLU A 1 90  ? -1.785  -25.892 -6.743  1.00  28.01 ? 90  GLU A N   1 
ATOM   750  C CA  . GLU A 1 90  ? -2.921  -25.286 -7.399  1.00  26.95 ? 90  GLU A CA  1 
ATOM   751  C C   . GLU A 1 90  ? -2.755  -23.772 -7.528  1.00  27.54 ? 90  GLU A C   1 
ATOM   752  O O   . GLU A 1 90  ? -3.350  -23.151 -8.386  1.00  28.44 ? 90  GLU A O   1 
ATOM   753  C CB  . GLU A 1 90  ? -4.211  -25.585 -6.615  0.50  27.05 ? 90  GLU A CB  1 
ATOM   754  C CG  . GLU A 1 90  ? -5.435  -24.916 -7.198  0.30  27.66 ? 90  GLU A CG  1 
ATOM   755  C CD  . GLU A 1 90  ? -6.713  -25.275 -6.464  0.01  27.62 ? 90  GLU A CD  1 
ATOM   756  O OE1 . GLU A 1 90  ? -6.651  -25.539 -5.245  0.01  27.62 ? 90  GLU A OE1 1 
ATOM   757  O OE2 . GLU A 1 90  ? -7.784  -25.288 -7.107  0.01  27.63 ? 90  GLU A OE2 1 
ATOM   758  N N   . ASN A 1 91  ? -1.957  -23.172 -6.659  1.00  24.67 ? 91  ASN A N   1 
ATOM   759  C CA  . ASN A 1 91  ? -1.872  -21.725 -6.651  1.00  25.43 ? 91  ASN A CA  1 
ATOM   760  C C   . ASN A 1 91  ? -0.528  -21.170 -7.066  1.00  21.94 ? 91  ASN A C   1 
ATOM   761  O O   . ASN A 1 91  ? -0.309  -19.962 -6.949  1.00  21.00 ? 91  ASN A O   1 
ATOM   762  C CB  . ASN A 1 91  ? -2.218  -21.202 -5.263  0.70  26.14 ? 91  ASN A CB  1 
ATOM   763  C CG  . ASN A 1 91  ? -3.620  -21.569 -4.866  0.70  30.12 ? 91  ASN A CG  1 
ATOM   764  O OD1 . ASN A 1 91  ? -4.556  -21.460 -5.671  0.70  32.64 ? 91  ASN A OD1 1 
ATOM   765  N ND2 . ASN A 1 91  ? -3.775  -22.044 -3.649  0.70  30.93 ? 91  ASN A ND2 1 
ATOM   766  N N   . LYS A 1 92  ? 0.379   -22.035 -7.507  1.00  20.94 ? 92  LYS A N   1 
ATOM   767  C CA  . LYS A 1 92  ? 1.750   -21.580 -7.818  1.00  18.13 ? 92  LYS A CA  1 
ATOM   768  C C   . LYS A 1 92  ? 2.306   -22.304 -9.032  1.00  17.89 ? 92  LYS A C   1 
ATOM   769  O O   . LYS A 1 92  ? 2.227   -23.549 -9.098  1.00  19.31 ? 92  LYS A O   1 
ATOM   770  C CB  . LYS A 1 92  ? 2.703   -21.797 -6.632  1.00  20.11 ? 92  LYS A CB  1 
ATOM   771  C CG  . LYS A 1 92  ? 4.149   -21.329 -6.921  1.00  19.66 ? 92  LYS A CG  1 
ATOM   772  C CD  . LYS A 1 92  ? 4.971   -21.287 -5.662  1.00  21.49 ? 92  LYS A CD  1 
ATOM   773  C CE  . LYS A 1 92  ? 6.433   -20.988 -5.961  1.00  22.86 ? 92  LYS A CE  1 
ATOM   774  N NZ  . LYS A 1 92  ? 7.208   -20.610 -4.676  1.00  24.96 ? 92  LYS A NZ  1 
ATOM   775  N N   . MET A 1 93  ? 2.802   -21.512 -9.979  1.00  18.10 ? 93  MET A N   1 
ATOM   776  C CA  A MET A 1 93  ? 3.436   -22.068 -11.182 0.90  16.52 ? 93  MET A CA  1 
ATOM   777  C CA  B MET A 1 93  ? 3.420   -22.049 -11.190 0.10  15.02 ? 93  MET A CA  1 
ATOM   778  C C   . MET A 1 93  ? 4.907   -21.733 -11.207 1.00  16.30 ? 93  MET A C   1 
ATOM   779  O O   . MET A 1 93  ? 5.330   -20.715 -10.631 1.00  15.27 ? 93  MET A O   1 
ATOM   780  C CB  A MET A 1 93  ? 2.761   -21.499 -12.447 0.90  17.85 ? 93  MET A CB  1 
ATOM   781  C CB  B MET A 1 93  ? 2.766   -21.440 -12.428 0.10  16.82 ? 93  MET A CB  1 
ATOM   782  C CG  A MET A 1 93  ? 3.099   -20.042 -12.713 0.90  17.29 ? 93  MET A CG  1 
ATOM   783  C CG  B MET A 1 93  ? 3.004   -19.926 -12.563 0.10  15.01 ? 93  MET A CG  1 
ATOM   784  S SD  A MET A 1 93  ? 2.073   -19.269 -13.987 0.90  19.77 ? 93  MET A SD  1 
ATOM   785  S SD  B MET A 1 93  ? 2.449   -19.324 -14.171 0.10  16.97 ? 93  MET A SD  1 
ATOM   786  C CE  A MET A 1 93  ? 0.582   -19.016 -13.044 0.90  19.49 ? 93  MET A CE  1 
ATOM   787  C CE  B MET A 1 93  ? 0.883   -20.194 -14.318 0.10  14.83 ? 93  MET A CE  1 
ATOM   788  N N   . VAL A 1 94  ? 5.690   -22.591 -11.868 1.00  16.16 ? 94  VAL A N   1 
ATOM   789  C CA  . VAL A 1 94  ? 7.135   -22.393 -11.950 1.00  16.22 ? 94  VAL A CA  1 
ATOM   790  C C   . VAL A 1 94  ? 7.568   -22.516 -13.407 1.00  16.75 ? 94  VAL A C   1 
ATOM   791  O O   . VAL A 1 94  ? 7.182   -23.482 -14.084 1.00  17.13 ? 94  VAL A O   1 
ATOM   792  C CB  . VAL A 1 94  ? 7.888   -23.441 -11.091 1.00  18.15 ? 94  VAL A CB  1 
ATOM   793  C CG1 . VAL A 1 94  ? 9.418   -23.313 -11.250 1.00  19.28 ? 94  VAL A CG1 1 
ATOM   794  C CG2 . VAL A 1 94  ? 7.466   -23.335 -9.605  1.00  18.73 ? 94  VAL A CG2 1 
ATOM   795  N N   . CYS A 1 95  ? 8.353   -21.528 -13.871 1.00  16.78 ? 95  CYS A N   1 
ATOM   796  C CA  . CYS A 1 95  ? 8.837   -21.541 -15.243 1.00  16.20 ? 95  CYS A CA  1 
ATOM   797  C C   . CYS A 1 95  ? 10.299  -21.924 -15.190 1.00  16.76 ? 95  CYS A C   1 
ATOM   798  O O   . CYS A 1 95  ? 11.121  -21.146 -14.660 1.00  18.28 ? 95  CYS A O   1 
ATOM   799  C CB  . CYS A 1 95  ? 8.725   -20.149 -15.861 1.00  16.82 ? 95  CYS A CB  1 
ATOM   800  S SG  . CYS A 1 95  ? 9.195   -20.183 -17.592 1.00  19.30 ? 95  CYS A SG  1 
ATOM   801  N N   . GLU A 1 96  ? 10.628  -23.106 -15.729 1.00  17.56 ? 96  GLU A N   1 
ATOM   802  C CA  . GLU A 1 96  ? 12.005  -23.509 -15.928 1.00  18.10 ? 96  GLU A CA  1 
ATOM   803  C C   . GLU A 1 96  ? 12.516  -23.058 -17.291 1.00  17.88 ? 96  GLU A C   1 
ATOM   804  O O   . GLU A 1 96  ? 11.787  -23.074 -18.267 1.00  18.46 ? 96  GLU A O   1 
ATOM   805  C CB  . GLU A 1 96  ? 12.178  -25.031 -15.768 0.80  18.65 ? 96  GLU A CB  1 
ATOM   806  C CG  . GLU A 1 96  ? 11.758  -25.501 -14.364 0.70  19.39 ? 96  GLU A CG  1 
ATOM   807  C CD  . GLU A 1 96  ? 12.676  -25.046 -13.225 0.30  20.11 ? 96  GLU A CD  1 
ATOM   808  O OE1 . GLU A 1 96  ? 13.769  -24.506 -13.482 0.10  18.76 ? 96  GLU A OE1 1 
ATOM   809  O OE2 . GLU A 1 96  ? 12.292  -25.259 -12.054 0.10  19.07 ? 96  GLU A OE2 1 
ATOM   810  N N   . GLN A 1 97  ? 13.771  -22.646 -17.335 1.00  18.37 ? 97  GLN A N   1 
ATOM   811  C CA  . GLN A 1 97  ? 14.373  -22.103 -18.548 1.00  17.96 ? 97  GLN A CA  1 
ATOM   812  C C   . GLN A 1 97  ? 15.624  -22.889 -18.879 1.00  19.80 ? 97  GLN A C   1 
ATOM   813  O O   . GLN A 1 97  ? 16.438  -23.206 -17.989 1.00  20.90 ? 97  GLN A O   1 
ATOM   814  C CB  . GLN A 1 97  ? 14.742  -20.627 -18.334 1.00  18.29 ? 97  GLN A CB  1 
ATOM   815  C CG  . GLN A 1 97  ? 13.485  -19.774 -18.050 1.00  19.52 ? 97  GLN A CG  1 
ATOM   816  C CD  . GLN A 1 97  ? 13.765  -18.302 -17.781 1.00  19.09 ? 97  GLN A CD  1 
ATOM   817  O OE1 . GLN A 1 97  ? 14.840  -17.921 -17.268 1.00  20.83 ? 97  GLN A OE1 1 
ATOM   818  N NE2 . GLN A 1 97  ? 12.788  -17.459 -18.118 1.00  18.81 ? 97  GLN A NE2 1 
ATOM   819  N N   . LYS A 1 98  ? 15.777  -23.204 -20.159 1.00  17.85 ? 98  LYS A N   1 
ATOM   820  C CA  A LYS A 1 98  ? 16.981  -23.863 -20.668 0.50  18.02 ? 98  LYS A CA  1 
ATOM   821  C CA  B LYS A 1 98  ? 16.983  -23.850 -20.660 0.50  19.22 ? 98  LYS A CA  1 
ATOM   822  C C   . LYS A 1 98  ? 17.598  -22.998 -21.757 1.00  18.34 ? 98  LYS A C   1 
ATOM   823  O O   . LYS A 1 98  ? 16.924  -22.648 -22.711 1.00  19.12 ? 98  LYS A O   1 
ATOM   824  C CB  A LYS A 1 98  ? 16.630  -25.234 -21.250 0.50  18.46 ? 98  LYS A CB  1 
ATOM   825  C CB  B LYS A 1 98  ? 16.638  -25.222 -21.220 0.50  21.66 ? 98  LYS A CB  1 
ATOM   826  C CG  A LYS A 1 98  ? 17.818  -25.986 -21.858 0.30  17.33 ? 98  LYS A CG  1 
ATOM   827  C CG  B LYS A 1 98  ? 16.048  -26.153 -20.192 0.50  23.39 ? 98  LYS A CG  1 
ATOM   828  C CD  A LYS A 1 98  ? 17.412  -27.444 -22.079 -0.30 21.12 ? 98  LYS A CD  1 
ATOM   829  C CD  B LYS A 1 98  ? 15.897  -27.566 -20.763 0.50  25.48 ? 98  LYS A CD  1 
ATOM   830  C CE  A LYS A 1 98  ? 18.652  -28.315 -22.247 -0.30 21.11 ? 98  LYS A CE  1 
ATOM   831  C CE  B LYS A 1 98  ? 15.414  -28.538 -19.698 0.50  28.54 ? 98  LYS A CE  1 
ATOM   832  N NZ  A LYS A 1 98  ? 18.316  -29.766 -22.353 -0.40 21.20 ? 98  LYS A NZ  1 
ATOM   833  N NZ  B LYS A 1 98  ? 14.814  -29.763 -20.289 0.50  28.55 ? 98  LYS A NZ  1 
ATOM   834  N N   . LEU A 1 99  ? 18.896  -22.675 -21.631 1.00  19.16 ? 99  LEU A N   1 
ATOM   835  C CA  . LEU A 1 99  ? 19.553  -21.860 -22.663 1.00  20.55 ? 99  LEU A CA  1 
ATOM   836  C C   . LEU A 1 99  ? 19.560  -22.586 -23.997 1.00  22.30 ? 99  LEU A C   1 
ATOM   837  O O   . LEU A 1 99  ? 19.763  -23.792 -24.054 1.00  23.08 ? 99  LEU A O   1 
ATOM   838  C CB  . LEU A 1 99  ? 21.000  -21.590 -22.245 1.00  19.97 ? 99  LEU A CB  1 
ATOM   839  C CG  . LEU A 1 99  ? 21.059  -20.650 -21.052 1.00  20.30 ? 99  LEU A CG  1 
ATOM   840  C CD1 . LEU A 1 99  ? 22.440  -20.741 -20.415 1.00  20.93 ? 99  LEU A CD1 1 
ATOM   841  C CD2 . LEU A 1 99  ? 20.758  -19.201 -21.414 1.00  22.08 ? 99  LEU A CD2 1 
ATOM   842  N N   . LEU A 1 100 ? 19.364  -21.843 -25.082 1.00  22.16 ? 100 LEU A N   1 
ATOM   843  C CA  . LEU A 1 100 ? 19.410  -22.457 -26.401 1.00  23.98 ? 100 LEU A CA  1 
ATOM   844  C C   . LEU A 1 100 ? 20.831  -22.768 -26.770 1.00  26.49 ? 100 LEU A C   1 
ATOM   845  O O   . LEU A 1 100 ? 21.100  -23.722 -27.498 1.00  27.30 ? 100 LEU A O   1 
ATOM   846  C CB  . LEU A 1 100 ? 18.840  -21.525 -27.459 1.00  24.84 ? 100 LEU A CB  1 
ATOM   847  C CG  . LEU A 1 100 ? 17.361  -21.189 -27.298 1.00  26.79 ? 100 LEU A CG  1 
ATOM   848  C CD1 . LEU A 1 100 ? 16.811  -20.546 -28.556 1.00  26.37 ? 100 LEU A CD1 1 
ATOM   849  C CD2 . LEU A 1 100 ? 16.624  -22.439 -26.980 1.00  26.73 ? 100 LEU A CD2 1 
ATOM   850  N N   . LYS A 1 101 ? 21.736  -21.929 -26.296 1.00  25.34 ? 101 LYS A N   1 
ATOM   851  C CA  . LYS A 1 101 ? 23.147  -22.128 -26.623 0.80  26.41 ? 101 LYS A CA  1 
ATOM   852  C C   . LYS A 1 101 ? 24.017  -21.795 -25.431 1.00  25.49 ? 101 LYS A C   1 
ATOM   853  O O   . LYS A 1 101 ? 23.824  -20.781 -24.746 1.00  27.12 ? 101 LYS A O   1 
ATOM   854  C CB  . LYS A 1 101 ? 23.567  -21.267 -27.812 0.50  26.41 ? 101 LYS A CB  1 
ATOM   855  C CG  . LYS A 1 101 ? 22.936  -21.643 -29.143 0.20  26.84 ? 101 LYS A CG  1 
ATOM   856  C CD  . LYS A 1 101 ? 23.535  -20.829 -30.284 0.20  27.19 ? 101 LYS A CD  1 
ATOM   857  C CE  . LYS A 1 101 ? 22.733  -20.979 -31.571 0.20  27.55 ? 101 LYS A CE  1 
ATOM   858  N NZ  . LYS A 1 101 ? 23.309  -20.166 -32.695 0.20  27.73 ? 101 LYS A NZ  1 
ATOM   859  N N   . GLY A 1 102 ? 25.004  -22.648 -25.218 1.00  27.05 ? 102 GLY A N   1 
ATOM   860  C CA  . GLY A 1 102 ? 25.952  -22.402 -24.163 1.00  23.80 ? 102 GLY A CA  1 
ATOM   861  C C   . GLY A 1 102 ? 25.443  -22.768 -22.791 1.00  26.35 ? 102 GLY A C   1 
ATOM   862  O O   . GLY A 1 102 ? 24.379  -23.389 -22.641 1.00  24.00 ? 102 GLY A O   1 
ATOM   863  N N   . GLU A 1 103 ? 26.191  -22.344 -21.784 1.00  23.16 ? 103 GLU A N   1 
ATOM   864  C CA  . GLU A 1 103 ? 25.946  -22.696 -20.400 1.00  23.73 ? 103 GLU A CA  1 
ATOM   865  C C   . GLU A 1 103 ? 25.831  -21.408 -19.615 1.00  21.75 ? 103 GLU A C   1 
ATOM   866  O O   . GLU A 1 103 ? 26.236  -20.334 -20.084 1.00  23.02 ? 103 GLU A O   1 
ATOM   867  C CB  . GLU A 1 103 ? 27.144  -23.504 -19.836 1.00  24.15 ? 103 GLU A CB  1 
ATOM   868  C CG  . GLU A 1 103 ? 27.600  -24.748 -20.596 0.80  25.86 ? 103 GLU A CG  1 
ATOM   869  C CD  . GLU A 1 103 ? 28.883  -25.364 -19.982 0.70  24.76 ? 103 GLU A CD  1 
ATOM   870  O OE1 . GLU A 1 103 ? 30.000  -24.796 -20.132 0.40  22.56 ? 103 GLU A OE1 1 
ATOM   871  O OE2 . GLU A 1 103 ? 28.790  -26.440 -19.332 0.40  26.55 ? 103 GLU A OE2 1 
ATOM   872  N N   . GLY A 1 104 ? 25.271  -21.492 -18.417 1.00  22.26 ? 104 GLY A N   1 
ATOM   873  C CA  . GLY A 1 104 ? 25.113  -20.294 -17.593 1.00  22.28 ? 104 GLY A CA  1 
ATOM   874  C C   . GLY A 1 104 ? 24.374  -20.624 -16.323 1.00  23.36 ? 104 GLY A C   1 
ATOM   875  O O   . GLY A 1 104 ? 24.071  -21.785 -16.051 1.00  23.22 ? 104 GLY A O   1 
ATOM   876  N N   . PRO A 1 105 ? 24.106  -19.601 -15.506 1.00  22.72 ? 105 PRO A N   1 
ATOM   877  C CA  . PRO A 1 105 ? 23.389  -19.852 -14.267 1.00  23.09 ? 105 PRO A CA  1 
ATOM   878  C C   . PRO A 1 105 ? 22.040  -20.487 -14.547 1.00  22.52 ? 105 PRO A C   1 
ATOM   879  O O   . PRO A 1 105 ? 21.487  -20.341 -15.643 1.00  24.62 ? 105 PRO A O   1 
ATOM   880  C CB  . PRO A 1 105 ? 23.181  -18.451 -13.681 1.00  24.56 ? 105 PRO A CB  1 
ATOM   881  C CG  . PRO A 1 105 ? 24.069  -17.545 -14.440 1.00  26.63 ? 105 PRO A CG  1 
ATOM   882  C CD  . PRO A 1 105 ? 24.439  -18.180 -15.723 1.00  25.46 ? 105 PRO A CD  1 
ATOM   883  N N   . LYS A 1 106 ? 21.510  -21.202 -13.570 1.00  21.25 ? 106 LYS A N   1 
ATOM   884  C CA  . LYS A 1 106 ? 20.197  -21.761 -13.731 1.00  20.23 ? 106 LYS A CA  1 
ATOM   885  C C   . LYS A 1 106 ? 19.172  -20.665 -13.427 1.00  20.78 ? 106 LYS A C   1 
ATOM   886  O O   . LYS A 1 106 ? 19.194  -20.095 -12.326 1.00  21.52 ? 106 LYS A O   1 
ATOM   887  C CB  . LYS A 1 106 ? 20.040  -22.944 -12.779 1.00  22.66 ? 106 LYS A CB  1 
ATOM   888  C CG  . LYS A 1 106 ? 18.659  -23.562 -12.861 0.80  24.95 ? 106 LYS A CG  1 
ATOM   889  C CD  . LYS A 1 106 ? 18.476  -24.632 -11.808 0.60  26.53 ? 106 LYS A CD  1 
ATOM   890  C CE  . LYS A 1 106 ? 17.103  -25.248 -11.924 0.50  27.13 ? 106 LYS A CE  1 
ATOM   891  N NZ  . LYS A 1 106 ? 16.992  -26.485 -11.097 0.30  29.11 ? 106 LYS A NZ  1 
ATOM   892  N N   . THR A 1 107 ? 18.281  -20.363 -14.374 1.00  20.17 ? 107 THR A N   1 
ATOM   893  C CA  . THR A 1 107 ? 17.345  -19.276 -14.177 1.00  18.02 ? 107 THR A CA  1 
ATOM   894  C C   . THR A 1 107 ? 15.906  -19.781 -14.248 1.00  18.57 ? 107 THR A C   1 
ATOM   895  O O   . THR A 1 107 ? 15.615  -20.768 -14.940 1.00  19.18 ? 107 THR A O   1 
ATOM   896  C CB  . THR A 1 107 ? 17.514  -18.134 -15.239 1.00  20.19 ? 107 THR A CB  1 
ATOM   897  O OG1 . THR A 1 107 ? 17.388  -18.702 -16.559 1.00  22.42 ? 107 THR A OG1 1 
ATOM   898  C CG2 . THR A 1 107 ? 18.900  -17.501 -15.107 1.00  20.36 ? 107 THR A CG2 1 
ATOM   899  N N   . SER A 1 108 ? 15.016  -19.102 -13.518 1.00  16.48 ? 108 SER A N   1 
ATOM   900  C CA  . SER A 1 108 ? 13.618  -19.477 -13.481 1.00  16.25 ? 108 SER A CA  1 
ATOM   901  C C   . SER A 1 108 ? 12.811  -18.308 -12.978 1.00  15.81 ? 108 SER A C   1 
ATOM   902  O O   . SER A 1 108 ? 13.370  -17.311 -12.506 1.00  16.62 ? 108 SER A O   1 
ATOM   903  C CB  . SER A 1 108 ? 13.387  -20.639 -12.513 1.00  19.72 ? 108 SER A CB  1 
ATOM   904  O OG  . SER A 1 108 ? 13.772  -20.291 -11.186 1.00  23.62 ? 108 SER A OG  1 
ATOM   905  N N   . TRP A 1 109 ? 11.486  -18.431 -13.105 1.00  14.99 ? 109 TRP A N   1 
ATOM   906  C CA  . TRP A 1 109 ? 10.593  -17.479 -12.433 1.00  15.31 ? 109 TRP A CA  1 
ATOM   907  C C   . TRP A 1 109 ? 9.397   -18.257 -11.918 1.00  16.08 ? 109 TRP A C   1 
ATOM   908  O O   . TRP A 1 109 ? 9.100   -19.367 -12.396 1.00  16.68 ? 109 TRP A O   1 
ATOM   909  C CB  . TRP A 1 109 ? 10.175  -16.252 -13.316 1.00  16.23 ? 109 TRP A CB  1 
ATOM   910  C CG  . TRP A 1 109 ? 9.551   -16.530 -14.643 1.00  16.93 ? 109 TRP A CG  1 
ATOM   911  C CD1 . TRP A 1 109 ? 10.166  -16.459 -15.882 1.00  17.20 ? 109 TRP A CD1 1 
ATOM   912  C CD2 . TRP A 1 109 ? 8.172   -16.864 -14.903 1.00  17.35 ? 109 TRP A CD2 1 
ATOM   913  N NE1 . TRP A 1 109 ? 9.243   -16.722 -16.887 1.00  18.03 ? 109 TRP A NE1 1 
ATOM   914  C CE2 . TRP A 1 109 ? 8.021   -16.992 -16.302 1.00  17.60 ? 109 TRP A CE2 1 
ATOM   915  C CE3 . TRP A 1 109 ? 7.052   -17.086 -14.082 1.00  16.43 ? 109 TRP A CE3 1 
ATOM   916  C CZ2 . TRP A 1 109 ? 6.799   -17.334 -16.893 1.00  16.85 ? 109 TRP A CZ2 1 
ATOM   917  C CZ3 . TRP A 1 109 ? 5.838   -17.428 -14.682 1.00  16.13 ? 109 TRP A CZ3 1 
ATOM   918  C CH2 . TRP A 1 109 ? 5.719   -17.531 -16.065 1.00  16.92 ? 109 TRP A CH2 1 
ATOM   919  N N   . THR A 1 110 ? 8.730   -17.691 -10.914 1.00  15.66 ? 110 THR A N   1 
ATOM   920  C CA  . THR A 1 110 ? 7.520   -18.326 -10.370 1.00  15.95 ? 110 THR A CA  1 
ATOM   921  C C   . THR A 1 110 ? 6.443   -17.284 -10.189 1.00  16.73 ? 110 THR A C   1 
ATOM   922  O O   . THR A 1 110 ? 6.741   -16.111 -9.993  1.00  16.90 ? 110 THR A O   1 
ATOM   923  C CB  . THR A 1 110 ? 7.764   -19.029 -9.017  1.00  16.89 ? 110 THR A CB  1 
ATOM   924  O OG1 . THR A 1 110 ? 8.027   -18.066 -8.004  1.00  20.24 ? 110 THR A OG1 1 
ATOM   925  C CG2 . THR A 1 110 ? 8.933   -19.994 -9.094  1.00  17.70 ? 110 THR A CG2 1 
ATOM   926  N N   . LEU A 1 111 ? 5.186   -17.715 -10.205 1.00  15.37 ? 111 LEU A N   1 
ATOM   927  C CA  . LEU A 1 111 ? 4.048   -16.825 -9.881  1.00  15.89 ? 111 LEU A CA  1 
ATOM   928  C C   . LEU A 1 111 ? 3.106   -17.568 -8.952  1.00  17.44 ? 111 LEU A C   1 
ATOM   929  O O   . LEU A 1 111 ? 2.772   -18.708 -9.231  1.00  17.21 ? 111 LEU A O   1 
ATOM   930  C CB  . LEU A 1 111 ? 3.263   -16.385 -11.132 1.00  17.71 ? 111 LEU A CB  1 
ATOM   931  C CG  . LEU A 1 111 ? 3.907   -15.330 -12.026 1.00  19.00 ? 111 LEU A CG  1 
ATOM   932  C CD1 . LEU A 1 111 ? 3.035   -15.093 -13.263 1.00  19.66 ? 111 LEU A CD1 1 
ATOM   933  C CD2 . LEU A 1 111 ? 4.162   -14.014 -11.306 1.00  18.18 ? 111 LEU A CD2 1 
ATOM   934  N N   . GLU A 1 112 ? 2.683   -16.939 -7.859  1.00  17.44 ? 112 GLU A N   1 
ATOM   935  C CA  . GLU A 1 112 ? 1.817   -17.593 -6.863  1.00  20.60 ? 112 GLU A CA  1 
ATOM   936  C C   . GLU A 1 112 ? 0.720   -16.631 -6.504  1.00  20.20 ? 112 GLU A C   1 
ATOM   937  O O   . GLU A 1 112 ? 0.955   -15.438 -6.342  1.00  21.81 ? 112 GLU A O   1 
ATOM   938  C CB  . GLU A 1 112 ? 2.592   -17.950 -5.572  1.00  20.27 ? 112 GLU A CB  1 
ATOM   939  C CG  . GLU A 1 112 ? 1.694   -18.590 -4.477  1.00  24.48 ? 112 GLU A CG  1 
ATOM   940  C CD  . GLU A 1 112 ? 2.424   -18.871 -3.168  0.90  21.04 ? 112 GLU A CD  1 
ATOM   941  O OE1 . GLU A 1 112 ? 3.688   -18.775 -3.151  0.80  26.08 ? 112 GLU A OE1 1 
ATOM   942  O OE2 . GLU A 1 112 ? 1.727   -19.197 -2.154  0.50  27.30 ? 112 GLU A OE2 1 
ATOM   943  N N   . LEU A 1 113 ? -0.495  -17.137 -6.369  1.00  23.40 ? 113 LEU A N   1 
ATOM   944  C CA  . LEU A 1 113 ? -1.619  -16.282 -5.993  1.00  26.69 ? 113 LEU A CA  1 
ATOM   945  C C   . LEU A 1 113 ? -1.985  -16.713 -4.592  1.00  28.63 ? 113 LEU A C   1 
ATOM   946  O O   . LEU A 1 113 ? -2.313  -17.876 -4.375  1.00  29.93 ? 113 LEU A O   1 
ATOM   947  C CB  . LEU A 1 113 ? -2.788  -16.576 -6.931  1.00  28.81 ? 113 LEU A CB  1 
ATOM   948  C CG  . LEU A 1 113 ? -3.714  -15.461 -7.387  1.00  32.85 ? 113 LEU A CG  1 
ATOM   949  C CD1 . LEU A 1 113 ? -5.129  -16.056 -7.554  1.00  31.97 ? 113 LEU A CD1 1 
ATOM   950  C CD2 . LEU A 1 113 ? -3.724  -14.228 -6.509  1.00  31.38 ? 113 LEU A CD2 1 
ATOM   951  N N   . THR A 1 114 ? -1.895  -15.812 -3.621  1.00  29.14 ? 114 THR A N   1 
ATOM   952  C CA  . THR A 1 114 ? -2.181  -16.196 -2.226  1.00  30.63 ? 114 THR A CA  1 
ATOM   953  C C   . THR A 1 114 ? -3.690  -16.163 -1.968  1.00  31.11 ? 114 THR A C   1 
ATOM   954  O O   . THR A 1 114 ? -4.471  -15.610 -2.764  1.00  29.85 ? 114 THR A O   1 
ATOM   955  C CB  . THR A 1 114 ? -1.444  -15.306 -1.189  1.00  31.53 ? 114 THR A CB  1 
ATOM   956  O OG1 . THR A 1 114 ? -2.048  -14.007 -1.166  1.00  29.85 ? 114 THR A OG1 1 
ATOM   957  C CG2 . THR A 1 114 ? 0.044   -15.175 -1.501  1.00  31.32 ? 114 THR A CG2 1 
ATOM   958  N N   . ASN A 1 115 ? -4.109  -16.767 -0.863  0.60  32.45 ? 115 ASN A N   1 
ATOM   959  C CA  . ASN A 1 115 ? -5.525  -16.795 -0.497  0.50  33.53 ? 115 ASN A CA  1 
ATOM   960  C C   . ASN A 1 115 ? -6.072  -15.408 -0.242  0.50  33.59 ? 115 ASN A C   1 
ATOM   961  O O   . ASN A 1 115 ? -7.262  -15.136 -0.433  0.50  33.20 ? 115 ASN A O   1 
ATOM   962  C CB  . ASN A 1 115 ? -5.716  -17.644 0.754   0.40  34.73 ? 115 ASN A CB  1 
ATOM   963  C CG  . ASN A 1 115 ? -5.092  -19.006 0.622   0.40  36.14 ? 115 ASN A CG  1 
ATOM   964  O OD1 . ASN A 1 115 ? -4.324  -19.433 1.484   0.40  36.03 ? 115 ASN A OD1 1 
ATOM   965  N ND2 . ASN A 1 115 ? -5.400  -19.697 -0.475  0.40  36.15 ? 115 ASN A ND2 1 
ATOM   966  N N   . ASP A 1 116 ? -5.181  -14.536 0.203   0.80  32.30 ? 116 ASP A N   1 
ATOM   967  C CA  . ASP A 1 116 ? -5.519  -13.162 0.457   0.80  32.25 ? 116 ASP A CA  1 
ATOM   968  C C   . ASP A 1 116 ? -5.516  -12.338 -0.818  0.80  30.77 ? 116 ASP A C   1 
ATOM   969  O O   . ASP A 1 116 ? -5.826  -11.160 -0.788  0.80  30.50 ? 116 ASP A O   1 
ATOM   970  C CB  . ASP A 1 116 ? -4.556  -12.570 1.482   0.80  32.94 ? 116 ASP A CB  1 
ATOM   971  C CG  . ASP A 1 116 ? -4.912  -12.953 2.908   0.50  32.52 ? 116 ASP A CG  1 
ATOM   972  O OD1 . ASP A 1 116 ? -5.983  -13.576 3.123   0.40  33.72 ? 116 ASP A OD1 1 
ATOM   973  O OD2 . ASP A 1 116 ? -4.117  -12.630 3.808   0.40  32.94 ? 116 ASP A OD2 1 
ATOM   974  N N   . GLY A 1 117 ? -5.152  -12.952 -1.944  1.00  31.02 ? 117 GLY A N   1 
ATOM   975  C CA  . GLY A 1 117 ? -5.279  -12.269 -3.221  1.00  29.68 ? 117 GLY A CA  1 
ATOM   976  C C   . GLY A 1 117 ? -4.055  -11.467 -3.636  1.00  27.18 ? 117 GLY A C   1 
ATOM   977  O O   . GLY A 1 117 ? -4.170  -10.527 -4.439  1.00  28.99 ? 117 GLY A O   1 
ATOM   978  N N   . GLU A 1 118 ? -2.906  -11.778 -3.046  1.00  24.51 ? 118 GLU A N   1 
ATOM   979  C CA  . GLU A 1 118 ? -1.649  -11.157 -3.504  1.00  22.81 ? 118 GLU A CA  1 
ATOM   980  C C   . GLU A 1 118 ? -0.975  -12.056 -4.511  1.00  22.43 ? 118 GLU A C   1 
ATOM   981  O O   . GLU A 1 118 ? -1.045  -13.284 -4.430  1.00  23.02 ? 118 GLU A O   1 
ATOM   982  C CB  . GLU A 1 118 ? -0.697  -10.914 -2.345  1.00  23.61 ? 118 GLU A CB  1 
ATOM   983  C CG  . GLU A 1 118 ? -1.211  -9.848  -1.381  1.00  27.30 ? 118 GLU A CG  1 
ATOM   984  C CD  . GLU A 1 118 ? -0.234  -9.571  -0.264  1.00  29.06 ? 118 GLU A CD  1 
ATOM   985  O OE1 . GLU A 1 118 ? 0.512   -10.492 0.125   1.00  30.48 ? 118 GLU A OE1 1 
ATOM   986  O OE2 . GLU A 1 118 ? -0.227  -8.429  0.240   1.00  32.01 ? 118 GLU A OE2 1 
ATOM   987  N N   . LEU A 1 119 ? -0.278  -11.419 -5.436  1.00  18.47 ? 119 LEU A N   1 
ATOM   988  C CA  . LEU A 1 119 ? 0.477   -12.152 -6.448  1.00  17.36 ? 119 LEU A CA  1 
ATOM   989  C C   . LEU A 1 119 ? 1.934   -12.064 -6.049  1.00  18.14 ? 119 LEU A C   1 
ATOM   990  O O   . LEU A 1 119 ? 2.444   -10.957 -5.874  1.00  18.25 ? 119 LEU A O   1 
ATOM   991  C CB  . LEU A 1 119 ? 0.296   -11.468 -7.779  1.00  18.16 ? 119 LEU A CB  1 
ATOM   992  C CG  . LEU A 1 119 ? 1.035   -12.096 -8.965  1.00  18.11 ? 119 LEU A CG  1 
ATOM   993  C CD1 . LEU A 1 119 ? 0.436   -13.484 -9.380  1.00  20.72 ? 119 LEU A CD1 1 
ATOM   994  C CD2 . LEU A 1 119 ? 1.064   -11.079 -10.119 1.00  18.29 ? 119 LEU A CD2 1 
ATOM   995  N N   . ILE A 1 120 ? 2.610   -13.198 -5.871  1.00  18.62 ? 120 ILE A N   1 
ATOM   996  C CA  . ILE A 1 120 ? 4.032   -13.175 -5.550  1.00  18.29 ? 120 ILE A CA  1 
ATOM   997  C C   . ILE A 1 120 ? 4.807   -13.662 -6.775  1.00  16.17 ? 120 ILE A C   1 
ATOM   998  O O   . ILE A 1 120 ? 4.532   -14.747 -7.290  1.00  17.56 ? 120 ILE A O   1 
ATOM   999  C CB  . ILE A 1 120 ? 4.360   -14.126 -4.381  1.00  20.41 ? 120 ILE A CB  1 
ATOM   1000 C CG1 . ILE A 1 120 ? 3.621   -13.691 -3.109  1.00  21.94 ? 120 ILE A CG1 1 
ATOM   1001 C CG2 . ILE A 1 120 ? 5.831   -14.123 -4.091  1.00  20.44 ? 120 ILE A CG2 1 
ATOM   1002 C CD1 . ILE A 1 120 ? 3.743   -14.700 -2.022  1.00  24.80 ? 120 ILE A CD1 1 
ATOM   1003 N N   . ASP A 1 121 ? 5.742   -12.839 -7.236  1.00  18.38 ? 121 ASP A N   1 
ATOM   1004 C CA  . ASP A 1 121 ? 6.615   -13.221 -8.339  1.00  17.45 ? 121 ASP A CA  1 
ATOM   1005 C C   . ASP A 1 121 ? 7.994   -13.465 -7.779  1.00  19.34 ? 121 ASP A C   1 
ATOM   1006 O O   . ASP A 1 121 ? 8.492   -12.694 -6.961  1.00  17.68 ? 121 ASP A O   1 
ATOM   1007 C CB  . ASP A 1 121 ? 6.662   -12.033 -9.305  1.00  22.22 ? 121 ASP A CB  1 
ATOM   1008 C CG  . ASP A 1 121 ? 7.799   -12.081 -10.238 1.00  27.21 ? 121 ASP A CG  1 
ATOM   1009 O OD1 . ASP A 1 121 ? 8.032   -13.138 -10.855 1.00  29.55 ? 121 ASP A OD1 1 
ATOM   1010 O OD2 . ASP A 1 121 ? 8.432   -11.022 -10.375 1.00  29.45 ? 121 ASP A OD2 1 
ATOM   1011 N N   . THR A 1 122 ? 8.647   -14.561 -8.160  1.00  17.33 ? 122 THR A N   1 
ATOM   1012 C CA  . THR A 1 122 ? 10.076  -14.664 -7.882  1.00  19.28 ? 122 THR A CA  1 
ATOM   1013 C C   . THR A 1 122 ? 10.847  -14.888 -9.195  1.00  18.69 ? 122 THR A C   1 
ATOM   1014 O O   . THR A 1 122 ? 10.315  -15.441 -10.159 1.00  19.70 ? 122 THR A O   1 
ATOM   1015 C CB  . THR A 1 122 ? 10.424  -15.781 -6.873  1.00  21.21 ? 122 THR A CB  1 
ATOM   1016 O OG1 . THR A 1 122 ? 10.386  -17.079 -7.517  1.00  21.81 ? 122 THR A OG1 1 
ATOM   1017 C CG2 . THR A 1 122 ? 9.480   -15.779 -5.671  1.00  20.30 ? 122 THR A CG2 1 
ATOM   1018 N N   . MET A 1 123 ? 12.090  -14.409 -9.230  1.00  18.18 ? 123 MET A N   1 
ATOM   1019 C CA  . MET A 1 123 ? 13.007  -14.641 -10.344 1.00  19.73 ? 123 MET A CA  1 
ATOM   1020 C C   . MET A 1 123 ? 14.301  -15.075 -9.712  1.00  18.67 ? 123 MET A C   1 
ATOM   1021 O O   . MET A 1 123 ? 14.769  -14.453 -8.770  1.00  20.47 ? 123 MET A O   1 
ATOM   1022 C CB  . MET A 1 123 ? 13.233  -13.356 -11.138 1.00  22.07 ? 123 MET A CB  1 
ATOM   1023 C CG  . MET A 1 123 ? 12.044  -13.065 -12.041 0.90  25.58 ? 123 MET A CG  1 
ATOM   1024 S SD  . MET A 1 123 ? 12.302  -11.502 -12.871 0.70  28.77 ? 123 MET A SD  1 
ATOM   1025 C CE  . MET A 1 123 ? 12.025  -10.510 -11.437 0.70  26.62 ? 123 MET A CE  1 
ATOM   1026 N N   . THR A 1 124 ? 14.897  -16.131 -10.238 1.00  18.48 ? 124 THR A N   1 
ATOM   1027 C CA  A THR A 1 124 ? 16.065  -16.740 -9.601  0.50  15.98 ? 124 THR A CA  1 
ATOM   1028 C CA  B THR A 1 124 ? 16.085  -16.683 -9.591  0.50  17.69 ? 124 THR A CA  1 
ATOM   1029 C C   . THR A 1 124 ? 17.205  -16.854 -10.592 1.00  19.34 ? 124 THR A C   1 
ATOM   1030 O O   . THR A 1 124 ? 16.955  -17.107 -11.782 1.00  20.71 ? 124 THR A O   1 
ATOM   1031 C CB  A THR A 1 124 ? 15.655  -18.144 -9.102  0.50  16.63 ? 124 THR A CB  1 
ATOM   1032 C CB  B THR A 1 124 ? 15.783  -18.062 -9.016  0.50  20.48 ? 124 THR A CB  1 
ATOM   1033 O OG1 A THR A 1 124 ? 14.642  -17.994 -8.095  0.50  14.26 ? 124 THR A OG1 1 
ATOM   1034 O OG1 B THR A 1 124 ? 16.810  -18.463 -8.103  0.50  23.17 ? 124 THR A OG1 1 
ATOM   1035 C CG2 A THR A 1 124 ? 16.860  -19.034 -8.626  0.50  15.40 ? 124 THR A CG2 1 
ATOM   1036 C CG2 B THR A 1 124 ? 15.721  -19.052 -10.145 0.50  17.98 ? 124 THR A CG2 1 
ATOM   1037 N N   . ALA A 1 125 ? 18.431  -16.707 -10.107 1.00  18.62 ? 125 ALA A N   1 
ATOM   1038 C CA  . ALA A 1 125 ? 19.624  -17.105 -10.882 1.00  20.81 ? 125 ALA A CA  1 
ATOM   1039 C C   . ALA A 1 125 ? 20.483  -17.865 -9.891  1.00  21.42 ? 125 ALA A C   1 
ATOM   1040 O O   . ALA A 1 125 ? 20.928  -17.271 -8.899  1.00  22.16 ? 125 ALA A O   1 
ATOM   1041 C CB  . ALA A 1 125 ? 20.382  -15.916 -11.429 1.00  23.65 ? 125 ALA A CB  1 
ATOM   1042 N N   . ASP A 1 126 ? 20.657  -19.166 -10.122 1.00  21.72 ? 126 ASP A N   1 
ATOM   1043 C CA  . ASP A 1 126 ? 21.319  -20.055 -9.156  1.00  22.90 ? 126 ASP A CA  1 
ATOM   1044 C C   . ASP A 1 126 ? 20.711  -19.846 -7.764  1.00  24.55 ? 126 ASP A C   1 
ATOM   1045 O O   . ASP A 1 126 ? 19.548  -20.130 -7.599  1.00  26.85 ? 126 ASP A O   1 
ATOM   1046 C CB  . ASP A 1 126 ? 22.832  -19.909 -9.183  0.90  24.45 ? 126 ASP A CB  1 
ATOM   1047 C CG  . ASP A 1 126 ? 23.447  -20.397 -10.485 0.70  24.66 ? 126 ASP A CG  1 
ATOM   1048 O OD1 . ASP A 1 126 ? 22.947  -21.396 -11.065 0.70  23.66 ? 126 ASP A OD1 1 
ATOM   1049 O OD2 . ASP A 1 126 ? 24.440  -19.765 -10.924 0.60  25.85 ? 126 ASP A OD2 1 
ATOM   1050 N N   . ASP A 1 127 ? 21.471  -19.363 -6.778  1.00  25.30 ? 127 ASP A N   1 
ATOM   1051 C CA  . ASP A 1 127 ? 20.907  -19.271 -5.443  1.00  26.10 ? 127 ASP A CA  1 
ATOM   1052 C C   . ASP A 1 127 ? 20.490  -17.871 -5.065  1.00  26.42 ? 127 ASP A C   1 
ATOM   1053 O O   . ASP A 1 127 ? 20.246  -17.595 -3.884  1.00  27.79 ? 127 ASP A O   1 
ATOM   1054 C CB  . ASP A 1 127 ? 21.884  -19.811 -4.388  0.80  27.54 ? 127 ASP A CB  1 
ATOM   1055 C CG  . ASP A 1 127 ? 23.228  -19.117 -4.427  0.70  28.90 ? 127 ASP A CG  1 
ATOM   1056 O OD1 . ASP A 1 127 ? 23.547  -18.437 -5.421  0.70  29.46 ? 127 ASP A OD1 1 
ATOM   1057 O OD2 . ASP A 1 127 ? 24.010  -19.279 -3.463  0.60  32.18 ? 127 ASP A OD2 1 
ATOM   1058 N N   . VAL A 1 128 ? 20.392  -16.978 -6.039  1.00  22.75 ? 128 VAL A N   1 
ATOM   1059 C CA  . VAL A 1 128 ? 19.957  -15.609 -5.742  1.00  22.31 ? 128 VAL A CA  1 
ATOM   1060 C C   . VAL A 1 128 ? 18.503  -15.435 -6.167  1.00  21.49 ? 128 VAL A C   1 
ATOM   1061 O O   . VAL A 1 128 ? 18.168  -15.769 -7.288  1.00  22.26 ? 128 VAL A O   1 
ATOM   1062 C CB  . VAL A 1 128 ? 20.860  -14.593 -6.402  1.00  23.52 ? 128 VAL A CB  1 
ATOM   1063 C CG1 . VAL A 1 128 ? 20.318  -13.206 -6.223  1.00  25.18 ? 128 VAL A CG1 1 
ATOM   1064 C CG2 . VAL A 1 128 ? 22.270  -14.701 -5.764  1.00  25.53 ? 128 VAL A CG2 1 
ATOM   1065 N N   . VAL A 1 129 ? 17.671  -14.914 -5.266  1.00  21.19 ? 129 VAL A N   1 
ATOM   1066 C CA  . VAL A 1 129 ? 16.237  -14.799 -5.552  1.00  20.87 ? 129 VAL A CA  1 
ATOM   1067 C C   . VAL A 1 129 ? 15.743  -13.375 -5.394  1.00  22.17 ? 129 VAL A C   1 
ATOM   1068 O O   . VAL A 1 129 ? 15.931  -12.757 -4.340  1.00  21.23 ? 129 VAL A O   1 
ATOM   1069 C CB  . VAL A 1 129 ? 15.390  -15.681 -4.641  1.00  22.38 ? 129 VAL A CB  1 
ATOM   1070 C CG1 . VAL A 1 129 ? 13.901  -15.580 -5.086  1.00  23.90 ? 129 VAL A CG1 1 
ATOM   1071 C CG2 . VAL A 1 129 ? 15.895  -17.129 -4.690  1.00  23.45 ? 129 VAL A CG2 1 
ATOM   1072 N N   . CYS A 1 130 ? 15.086  -12.872 -6.429  1.00  18.91 ? 130 CYS A N   1 
ATOM   1073 C CA  . CYS A 1 130 ? 14.371  -11.596 -6.352  1.00  18.59 ? 130 CYS A CA  1 
ATOM   1074 C C   . CYS A 1 130 ? 12.908  -11.917 -6.107  1.00  19.56 ? 130 CYS A C   1 
ATOM   1075 O O   . CYS A 1 130 ? 12.350  -12.788 -6.731  1.00  20.12 ? 130 CYS A O   1 
ATOM   1076 C CB  . CYS A 1 130 ? 14.545  -10.852 -7.670  1.00  19.07 ? 130 CYS A CB  1 
ATOM   1077 S SG  . CYS A 1 130 ? 13.443  -9.426  -7.883  1.00  19.48 ? 130 CYS A SG  1 
ATOM   1078 N N   . THR A 1 131 ? 12.269  -11.199 -5.197  1.00  17.56 ? 131 THR A N   1 
ATOM   1079 C CA  . THR A 1 131 ? 10.850  -11.471 -4.887  1.00  19.12 ? 131 THR A CA  1 
ATOM   1080 C C   . THR A 1 131 ? 10.046  -10.172 -5.017  1.00  15.80 ? 131 THR A C   1 
ATOM   1081 O O   . THR A 1 131 ? 10.472  -9.143  -4.496  1.00  19.56 ? 131 THR A O   1 
ATOM   1082 C CB  . THR A 1 131 ? 10.681  -11.964 -3.437  1.00  20.58 ? 131 THR A CB  1 
ATOM   1083 O OG1 . THR A 1 131 ? 11.444  -13.154 -3.260  1.00  22.66 ? 131 THR A OG1 1 
ATOM   1084 C CG2 . THR A 1 131 ? 9.218   -12.274 -3.131  1.00  21.45 ? 131 THR A CG2 1 
ATOM   1085 N N   . LYS A 1 132 ? 8.915   -10.171 -5.756  1.00  18.06 ? 132 LYS A N   1 
ATOM   1086 C CA  . LYS A 1 132 ? 8.056   -8.999  -5.843  1.00  14.72 ? 132 LYS A CA  1 
ATOM   1087 C C   . LYS A 1 132 ? 6.670   -9.397  -5.508  1.00  19.70 ? 132 LYS A C   1 
ATOM   1088 O O   . LYS A 1 132 ? 6.258   -10.489 -5.783  1.00  15.26 ? 132 LYS A O   1 
ATOM   1089 C CB  . LYS A 1 132 ? 8.119   -8.374  -7.223  1.00  17.48 ? 132 LYS A CB  1 
ATOM   1090 C CG  . LYS A 1 132 ? 9.528   -7.992  -7.617  1.00  18.40 ? 132 LYS A CG  1 
ATOM   1091 C CD  . LYS A 1 132 ? 9.536   -7.223  -8.939  1.00  21.07 ? 132 LYS A CD  1 
ATOM   1092 C CE  . LYS A 1 132 ? 10.979  -7.097  -9.437  1.00  23.08 ? 132 LYS A CE  1 
ATOM   1093 N NZ  . LYS A 1 132 ? 11.057  -6.181  -10.594 1.00  25.91 ? 132 LYS A NZ  1 
ATOM   1094 N N   . VAL A 1 133 ? 5.944   -8.499  -4.829  1.00  14.98 ? 133 VAL A N   1 
ATOM   1095 C CA  . VAL A 1 133 ? 4.532   -8.811  -4.385  1.00  16.09 ? 133 VAL A CA  1 
ATOM   1096 C C   . VAL A 1 133 ? 3.631   -7.748  -4.988  1.00  14.44 ? 133 VAL A C   1 
ATOM   1097 O O   . VAL A 1 133 ? 4.009   -6.546  -4.979  1.00  16.93 ? 133 VAL A O   1 
ATOM   1098 C CB  . VAL A 1 133 ? 4.402   -8.830  -2.826  1.00  16.83 ? 133 VAL A CB  1 
ATOM   1099 C CG1 . VAL A 1 133 ? 2.982   -9.233  -2.444  1.00  19.22 ? 133 VAL A CG1 1 
ATOM   1100 C CG2 . VAL A 1 133 ? 5.427   -9.813  -2.248  1.00  18.44 ? 133 VAL A CG2 1 
ATOM   1101 N N   . PHE A 1 134 ? 2.454   -8.160  -5.484  1.00  16.83 ? 134 PHE A N   1 
ATOM   1102 C CA  . PHE A 1 134 ? 1.556   -7.233  -6.136  1.00  15.33 ? 134 PHE A CA  1 
ATOM   1103 C C   . PHE A 1 134 ? 0.153   -7.439  -5.598  1.00  16.44 ? 134 PHE A C   1 
ATOM   1104 O O   . PHE A 1 134 ? -0.155  -8.496  -5.057  1.00  16.85 ? 134 PHE A O   1 
ATOM   1105 C CB  . PHE A 1 134 ? 1.436   -7.506  -7.651  1.00  16.40 ? 134 PHE A CB  1 
ATOM   1106 C CG  . PHE A 1 134 ? 2.773   -7.457  -8.408  1.00  15.24 ? 134 PHE A CG  1 
ATOM   1107 C CD1 . PHE A 1 134 ? 3.694   -8.500  -8.303  1.00  16.09 ? 134 PHE A CD1 1 
ATOM   1108 C CD2 . PHE A 1 134 ? 3.052   -6.389  -9.279  1.00  15.77 ? 134 PHE A CD2 1 
ATOM   1109 C CE1 . PHE A 1 134 ? 4.898   -8.457  -9.042  1.00  14.83 ? 134 PHE A CE1 1 
ATOM   1110 C CE2 . PHE A 1 134 ? 4.274   -6.319  -9.988  1.00  16.66 ? 134 PHE A CE2 1 
ATOM   1111 C CZ  . PHE A 1 134 ? 5.182   -7.368  -9.862  1.00  16.04 ? 134 PHE A CZ  1 
ATOM   1112 N N   . VAL A 1 135 ? -0.690  -6.417  -5.778  1.00  19.16 ? 135 VAL A N   1 
ATOM   1113 C CA  . VAL A 1 135 ? -2.108  -6.568  -5.486  1.00  19.82 ? 135 VAL A CA  1 
ATOM   1114 C C   . VAL A 1 135 ? -2.943  -6.210  -6.700  1.00  17.97 ? 135 VAL A C   1 
ATOM   1115 O O   . VAL A 1 135 ? -2.468  -5.486  -7.577  1.00  19.72 ? 135 VAL A O   1 
ATOM   1116 C CB  . VAL A 1 135 ? -2.553  -5.666  -4.318  1.00  20.26 ? 135 VAL A CB  1 
ATOM   1117 C CG1 . VAL A 1 135 ? -1.873  -6.122  -3.040  1.00  20.91 ? 135 VAL A CG1 1 
ATOM   1118 C CG2 . VAL A 1 135 ? -2.304  -4.216  -4.673  1.00  21.23 ? 135 VAL A CG2 1 
ATOM   1119 N N   . ARG A 1 136 ? -4.191  -6.681  -6.743  1.00  23.32 ? 136 ARG A N   1 
ATOM   1120 C CA  . ARG A 1 136 ? -5.004  -6.455  -7.890  0.90  24.73 ? 136 ARG A CA  1 
ATOM   1121 C C   . ARG A 1 136 ? -5.603  -5.071  -7.870  1.00  26.61 ? 136 ARG A C   1 
ATOM   1122 O O   . ARG A 1 136 ? -6.185  -4.669  -6.854  0.80  26.78 ? 136 ARG A O   1 
ATOM   1123 C CB  . ARG A 1 136 ? -6.120  -7.483  -7.856  0.90  26.42 ? 136 ARG A CB  1 
ATOM   1124 C CG  . ARG A 1 136 ? -6.318  -8.151  -9.140  0.90  28.42 ? 136 ARG A CG  1 
ATOM   1125 C CD  . ARG A 1 136 ? -7.620  -8.874  -9.102  0.90  29.02 ? 136 ARG A CD  1 
ATOM   1126 N NE  . ARG A 1 136 ? -7.516  -10.165 -9.749  0.80  30.63 ? 136 ARG A NE  1 
ATOM   1127 C CZ  . ARG A 1 136 ? -7.382  -11.301 -9.098  0.80  30.31 ? 136 ARG A CZ  1 
ATOM   1128 N NH1 . ARG A 1 136 ? -7.340  -11.307 -7.776  0.80  30.43 ? 136 ARG A NH1 1 
ATOM   1129 N NH2 . ARG A 1 136 ? -7.268  -12.430 -9.775  0.80  30.20 ? 136 ARG A NH2 1 
ATOM   1130 N N   . GLU A 1 137 ? -5.481  -4.347  -8.972  1.00  28.74 ? 137 GLU A N   1 
ATOM   1131 C CA  . GLU A 1 137 ? -6.117  -3.040  -9.126  1.00  32.05 ? 137 GLU A CA  1 
ATOM   1132 C C   . GLU A 1 137 ? -7.617  -3.152  -9.354  1.00  33.01 ? 137 GLU A C   1 
ATOM   1133 O O   . GLU A 1 137 ? -8.393  -2.298  -8.891  1.00  31.00 ? 137 GLU A O   1 
ATOM   1134 C CB  . GLU A 1 137 ? -5.487  -2.345  -10.319 1.00  35.23 ? 137 GLU A CB  1 
ATOM   1135 C CG  . GLU A 1 137 ? -6.112  -1.053  -10.687 1.00  37.46 ? 137 GLU A CG  1 
ATOM   1136 C CD  . GLU A 1 137 ? -5.588  -0.523  -12.002 1.00  40.51 ? 137 GLU A CD  1 
ATOM   1137 O OE1 . GLU A 1 137 ? -5.708  -1.235  -13.034 1.00  40.95 ? 137 GLU A OE1 1 
ATOM   1138 O OE2 . GLU A 1 137 ? -5.072  0.616   -12.003 1.00  41.59 ? 137 GLU A OE2 1 
ATOM   1139 O OXT . GLU A 1 137 ? -8.071  -4.089  -10.020 1.00  32.13 ? 137 GLU A OXT 1 
ATOM   1140 N N   . PRO B 1 1   ? 12.133  -23.632 -44.061 0.50  32.63 ? 1   PRO B N   1 
ATOM   1141 C CA  . PRO B 1 1   ? 13.004  -22.473 -43.928 0.50  31.86 ? 1   PRO B CA  1 
ATOM   1142 C C   . PRO B 1 1   ? 13.028  -22.007 -42.485 0.50  30.03 ? 1   PRO B C   1 
ATOM   1143 O O   . PRO B 1 1   ? 12.215  -22.444 -41.682 0.50  32.52 ? 1   PRO B O   1 
ATOM   1144 C CB  . PRO B 1 1   ? 12.294  -21.423 -44.766 0.50  32.55 ? 1   PRO B CB  1 
ATOM   1145 C CG  . PRO B 1 1   ? 10.867  -21.712 -44.542 0.50  32.80 ? 1   PRO B CG  1 
ATOM   1146 C CD  . PRO B 1 1   ? 10.765  -23.232 -44.440 0.50  33.13 ? 1   PRO B CD  1 
ATOM   1147 N N   . ASN B 1 2   ? 13.938  -21.109 -42.153 1.00  29.30 ? 2   ASN B N   1 
ATOM   1148 C CA  A ASN B 1 2   ? 13.946  -20.649 -40.784 0.50  27.01 ? 2   ASN B CA  1 
ATOM   1149 C CA  B ASN B 1 2   ? 14.149  -20.676 -40.763 0.50  27.43 ? 2   ASN B CA  1 
ATOM   1150 C C   . ASN B 1 2   ? 14.129  -19.152 -40.655 1.00  26.43 ? 2   ASN B C   1 
ATOM   1151 O O   . ASN B 1 2   ? 15.007  -18.518 -41.234 1.00  26.80 ? 2   ASN B O   1 
ATOM   1152 C CB  A ASN B 1 2   ? 14.907  -21.464 -39.917 0.50  26.59 ? 2   ASN B CB  1 
ATOM   1153 C CB  B ASN B 1 2   ? 15.532  -21.154 -40.308 0.50  27.59 ? 2   ASN B CB  1 
ATOM   1154 C CG  A ASN B 1 2   ? 14.575  -21.372 -38.450 0.50  24.54 ? 2   ASN B CG  1 
ATOM   1155 C CG  B ASN B 1 2   ? 15.759  -20.972 -38.834 0.50  25.34 ? 2   ASN B CG  1 
ATOM   1156 O OD1 A ASN B 1 2   ? 14.872  -20.368 -37.808 0.50  25.79 ? 2   ASN B OD1 1 
ATOM   1157 O OD1 B ASN B 1 2   ? 15.044  -20.216 -38.181 0.50  27.44 ? 2   ASN B OD1 1 
ATOM   1158 N ND2 A ASN B 1 2   ? 13.974  -22.424 -37.902 0.10  25.94 ? 2   ASN B ND2 1 
ATOM   1159 N ND2 B ASN B 1 2   ? 16.760  -21.665 -38.292 0.50  28.35 ? 2   ASN B ND2 1 
ATOM   1160 N N   . PHE B 1 3   ? 13.185  -18.581 -39.910 1.00  22.18 ? 3   PHE B N   1 
ATOM   1161 C CA  . PHE B 1 3   ? 13.067  -17.130 -39.799 1.00  21.29 ? 3   PHE B CA  1 
ATOM   1162 C C   . PHE B 1 3   ? 14.015  -16.587 -38.755 1.00  20.85 ? 3   PHE B C   1 
ATOM   1163 O O   . PHE B 1 3   ? 14.143  -15.381 -38.615 1.00  20.67 ? 3   PHE B O   1 
ATOM   1164 C CB  . PHE B 1 3   ? 11.627  -16.782 -39.385 1.00  19.83 ? 3   PHE B CB  1 
ATOM   1165 C CG  . PHE B 1 3   ? 10.618  -16.849 -40.510 1.00  19.81 ? 3   PHE B CG  1 
ATOM   1166 C CD1 . PHE B 1 3   ? 10.164  -18.077 -40.996 1.00  20.81 ? 3   PHE B CD1 1 
ATOM   1167 C CD2 . PHE B 1 3   ? 10.132  -15.684 -41.091 1.00  20.10 ? 3   PHE B CD2 1 
ATOM   1168 C CE1 . PHE B 1 3   ? 9.261   -18.117 -42.043 1.00  21.80 ? 3   PHE B CE1 1 
ATOM   1169 C CE2 . PHE B 1 3   ? 9.200   -15.720 -42.119 1.00  19.25 ? 3   PHE B CE2 1 
ATOM   1170 C CZ  . PHE B 1 3   ? 8.763   -16.936 -42.606 1.00  20.82 ? 3   PHE B CZ  1 
ATOM   1171 N N   . SER B 1 4   ? 14.703  -17.462 -38.018 1.00  21.12 ? 4   SER B N   1 
ATOM   1172 C CA  . SER B 1 4   ? 15.593  -16.982 -36.967 1.00  19.24 ? 4   SER B CA  1 
ATOM   1173 C C   . SER B 1 4   ? 16.625  -16.042 -37.531 1.00  21.82 ? 4   SER B C   1 
ATOM   1174 O O   . SER B 1 4   ? 17.189  -16.294 -38.631 1.00  21.13 ? 4   SER B O   1 
ATOM   1175 C CB  . SER B 1 4   ? 16.314  -18.128 -36.255 1.00  20.92 ? 4   SER B CB  1 
ATOM   1176 O OG  . SER B 1 4   ? 15.396  -19.042 -35.704 1.00  21.29 ? 4   SER B OG  1 
ATOM   1177 N N   . GLY B 1 5   ? 16.941  -14.996 -36.796 1.00  20.90 ? 5   GLY B N   1 
ATOM   1178 C CA  . GLY B 1 5   ? 17.983  -14.088 -37.246 1.00  22.37 ? 5   GLY B CA  1 
ATOM   1179 C C   . GLY B 1 5   ? 17.977  -12.771 -36.523 1.00  21.38 ? 5   GLY B C   1 
ATOM   1180 O O   . GLY B 1 5   ? 17.026  -12.451 -35.787 1.00  19.94 ? 5   GLY B O   1 
ATOM   1181 N N   . ASN B 1 6   ? 19.026  -11.996 -36.744 1.00  21.26 ? 6   ASN B N   1 
ATOM   1182 C CA  . ASN B 1 6   ? 19.078  -10.640 -36.289 1.00  22.86 ? 6   ASN B CA  1 
ATOM   1183 C C   . ASN B 1 6   ? 18.869  -9.811  -37.548 1.00  19.25 ? 6   ASN B C   1 
ATOM   1184 O O   . ASN B 1 6   ? 19.752  -9.740  -38.437 1.00  26.35 ? 6   ASN B O   1 
ATOM   1185 C CB  . ASN B 1 6   ? 20.433  -10.320 -35.645 1.00  25.30 ? 6   ASN B CB  1 
ATOM   1186 C CG  . ASN B 1 6   ? 20.678  -11.147 -34.389 0.90  28.62 ? 6   ASN B CG  1 
ATOM   1187 O OD1 . ASN B 1 6   ? 19.912  -11.073 -33.439 0.80  29.90 ? 6   ASN B OD1 1 
ATOM   1188 N ND2 . ASN B 1 6   ? 21.721  -11.958 -34.406 0.80  30.29 ? 6   ASN B ND2 1 
ATOM   1189 N N   . TRP B 1 7   ? 17.704  -9.199  -37.626 1.00  19.40 ? 7   TRP B N   1 
ATOM   1190 C CA  . TRP B 1 7   ? 17.274  -8.547  -38.841 1.00  17.58 ? 7   TRP B CA  1 
ATOM   1191 C C   . TRP B 1 7   ? 17.403  -7.028  -38.758 1.00  18.92 ? 7   TRP B C   1 
ATOM   1192 O O   . TRP B 1 7   ? 17.045  -6.432  -37.751 1.00  18.56 ? 7   TRP B O   1 
ATOM   1193 C CB  . TRP B 1 7   ? 15.828  -8.952  -39.088 1.00  18.16 ? 7   TRP B CB  1 
ATOM   1194 C CG  . TRP B 1 7   ? 15.661  -10.418 -39.385 1.00  17.38 ? 7   TRP B CG  1 
ATOM   1195 C CD1 . TRP B 1 7   ? 15.281  -11.377 -38.503 1.00  18.11 ? 7   TRP B CD1 1 
ATOM   1196 C CD2 . TRP B 1 7   ? 15.859  -11.082 -40.643 1.00  18.20 ? 7   TRP B CD2 1 
ATOM   1197 N NE1 . TRP B 1 7   ? 15.180  -12.581 -39.137 1.00  18.40 ? 7   TRP B NE1 1 
ATOM   1198 C CE2 . TRP B 1 7   ? 15.553  -12.432 -40.453 1.00  18.81 ? 7   TRP B CE2 1 
ATOM   1199 C CE3 . TRP B 1 7   ? 16.248  -10.648 -41.923 1.00  19.37 ? 7   TRP B CE3 1 
ATOM   1200 C CZ2 . TRP B 1 7   ? 15.618  -13.373 -41.486 1.00  19.03 ? 7   TRP B CZ2 1 
ATOM   1201 C CZ3 . TRP B 1 7   ? 16.297  -11.572 -42.952 1.00  18.42 ? 7   TRP B CZ3 1 
ATOM   1202 C CH2 . TRP B 1 7   ? 15.967  -12.914 -42.736 1.00  18.83 ? 7   TRP B CH2 1 
ATOM   1203 N N   . LYS B 1 8   ? 17.938  -6.402  -39.813 1.00  19.08 ? 8   LYS B N   1 
ATOM   1204 C CA  A LYS B 1 8   ? 18.181  -4.953  -39.867 0.50  19.53 ? 8   LYS B CA  1 
ATOM   1205 C CA  B LYS B 1 8   ? 18.086  -4.944  -39.804 0.50  20.26 ? 8   LYS B CA  1 
ATOM   1206 C C   . LYS B 1 8   ? 17.328  -4.379  -40.995 1.00  19.68 ? 8   LYS B C   1 
ATOM   1207 O O   . LYS B 1 8   ? 17.264  -4.991  -42.062 1.00  18.57 ? 8   LYS B O   1 
ATOM   1208 C CB  A LYS B 1 8   ? 19.669  -4.691  -40.187 0.50  19.17 ? 8   LYS B CB  1 
ATOM   1209 C CB  B LYS B 1 8   ? 19.564  -4.512  -39.833 0.50  22.31 ? 8   LYS B CB  1 
ATOM   1210 C CG  A LYS B 1 8   ? 20.185  -5.455  -41.401 0.30  19.71 ? 8   LYS B CG  1 
ATOM   1211 C CG  B LYS B 1 8   ? 20.239  -4.704  -41.159 0.50  23.98 ? 8   LYS B CG  1 
ATOM   1212 C CD  A LYS B 1 8   ? 21.581  -5.002  -41.830 0.20  19.99 ? 8   LYS B CD  1 
ATOM   1213 C CD  B LYS B 1 8   ? 21.710  -4.304  -41.084 0.50  24.92 ? 8   LYS B CD  1 
ATOM   1214 C CE  A LYS B 1 8   ? 21.536  -3.643  -42.533 0.20  19.09 ? 8   LYS B CE  1 
ATOM   1215 C CE  B LYS B 1 8   ? 22.410  -4.664  -42.395 0.50  25.47 ? 8   LYS B CE  1 
ATOM   1216 N NZ  A LYS B 1 8   ? 22.885  -3.242  -43.015 0.10  21.00 ? 8   LYS B NZ  1 
ATOM   1217 N NZ  B LYS B 1 8   ? 23.895  -4.762  -42.286 0.50  27.03 ? 8   LYS B NZ  1 
ATOM   1218 N N   . ILE B 1 9   ? 16.689  -3.222  -40.795 1.00  18.75 ? 9   ILE B N   1 
ATOM   1219 C CA  . ILE B 1 9   ? 15.778  -2.746  -41.808 1.00  19.05 ? 9   ILE B CA  1 
ATOM   1220 C C   . ILE B 1 9   ? 16.534  -2.054  -42.946 1.00  19.32 ? 9   ILE B C   1 
ATOM   1221 O O   . ILE B 1 9   ? 17.469  -1.277  -42.686 1.00  21.84 ? 9   ILE B O   1 
ATOM   1222 C CB  . ILE B 1 9   ? 14.751  -1.781  -41.185 1.00  18.54 ? 9   ILE B CB  1 
ATOM   1223 C CG1 . ILE B 1 9   ? 13.609  -1.514  -42.157 1.00  19.06 ? 9   ILE B CG1 1 
ATOM   1224 C CG2 . ILE B 1 9   ? 15.423  -0.522  -40.656 1.00  19.95 ? 9   ILE B CG2 1 
ATOM   1225 C CD1 . ILE B 1 9   ? 12.379  -0.782  -41.478 1.00  18.55 ? 9   ILE B CD1 1 
ATOM   1226 N N   . ILE B 1 10  ? 16.103  -2.281  -44.197 1.00  18.33 ? 10  ILE B N   1 
ATOM   1227 C CA  . ILE B 1 10  ? 16.743  -1.623  -45.320 1.00  21.23 ? 10  ILE B CA  1 
ATOM   1228 C C   . ILE B 1 10  ? 15.750  -0.805  -46.120 1.00  16.37 ? 10  ILE B C   1 
ATOM   1229 O O   . ILE B 1 10  ? 16.199  0.039   -46.912 0.90  24.82 ? 10  ILE B O   1 
ATOM   1230 C CB  . ILE B 1 10  ? 17.493  -2.582  -46.252 1.00  20.53 ? 10  ILE B CB  1 
ATOM   1231 C CG1 . ILE B 1 10  ? 16.530  -3.570  -46.936 1.00  22.21 ? 10  ILE B CG1 1 
ATOM   1232 C CG2 . ILE B 1 10  ? 18.661  -3.264  -45.498 1.00  21.69 ? 10  ILE B CG2 1 
ATOM   1233 C CD1 . ILE B 1 10  ? 17.188  -4.414  -48.042 1.00  22.87 ? 10  ILE B CD1 1 
ATOM   1234 N N   . ARG B 1 11  ? 14.426  -1.052  -45.931 1.00  21.35 ? 11  ARG B N   1 
ATOM   1235 C CA  A ARG B 1 11  ? 13.410  -0.343  -46.729 0.50  19.78 ? 11  ARG B CA  1 
ATOM   1236 C CA  B ARG B 1 11  ? 13.435  -0.255  -46.664 0.50  19.44 ? 11  ARG B CA  1 
ATOM   1237 C C   . ARG B 1 11  ? 12.133  -0.231  -45.916 1.00  19.74 ? 11  ARG B C   1 
ATOM   1238 O O   . ARG B 1 11  ? 11.807  -1.190  -45.230 1.00  18.85 ? 11  ARG B O   1 
ATOM   1239 C CB  A ARG B 1 11  ? 13.143  -1.148  -48.018 0.50  21.81 ? 11  ARG B CB  1 
ATOM   1240 C CB  B ARG B 1 11  ? 13.214  -0.809  -48.083 0.50  20.31 ? 11  ARG B CB  1 
ATOM   1241 C CG  A ARG B 1 11  ? 12.524  -0.407  -49.187 0.50  24.60 ? 11  ARG B CG  1 
ATOM   1242 C CG  B ARG B 1 11  ? 12.234  -0.001  -48.949 0.50  22.32 ? 11  ARG B CG  1 
ATOM   1243 C CD  A ARG B 1 11  ? 13.068  -0.941  -50.524 0.50  23.75 ? 11  ARG B CD  1 
ATOM   1244 C CD  B ARG B 1 11  ? 12.281  -0.463  -50.408 0.50  20.96 ? 11  ARG B CD  1 
ATOM   1245 N NE  A ARG B 1 11  ? 12.665  -2.319  -50.811 0.40  24.67 ? 11  ARG B NE  1 
ATOM   1246 N NE  B ARG B 1 11  ? 11.697  -1.782  -50.613 0.50  21.54 ? 11  ARG B NE  1 
ATOM   1247 C CZ  A ARG B 1 11  ? 13.507  -3.347  -50.938 0.30  24.69 ? 11  ARG B CZ  1 
ATOM   1248 C CZ  B ARG B 1 11  ? 10.385  -1.995  -50.677 0.50  24.36 ? 11  ARG B CZ  1 
ATOM   1249 N NH1 A ARG B 1 11  ? 13.037  -4.551  -51.209 0.30  24.03 ? 11  ARG B NH1 1 
ATOM   1250 N NH1 B ARG B 1 11  ? 9.896   -3.222  -50.873 0.50  24.73 ? 11  ARG B NH1 1 
ATOM   1251 N NH2 A ARG B 1 11  ? 14.814  -3.174  -50.811 0.30  24.92 ? 11  ARG B NH2 1 
ATOM   1252 N NH2 B ARG B 1 11  ? 9.564   -0.973  -50.535 0.50  23.19 ? 11  ARG B NH2 1 
ATOM   1253 N N   . SER B 1 12  ? 11.413  0.890   -46.031 1.00  18.54 ? 12  SER B N   1 
ATOM   1254 C CA  . SER B 1 12  ? 10.112  1.017   -45.336 1.00  17.66 ? 12  SER B CA  1 
ATOM   1255 C C   . SER B 1 12  ? 9.162   1.713   -46.267 1.00  21.82 ? 12  SER B C   1 
ATOM   1256 O O   . SER B 1 12  ? 9.569   2.681   -46.882 1.00  18.98 ? 12  SER B O   1 
ATOM   1257 C CB  . SER B 1 12  ? 10.280  1.863   -44.066 1.00  22.07 ? 12  SER B CB  1 
ATOM   1258 O OG  . SER B 1 12  ? 9.079   1.952   -43.301 0.90  24.67 ? 12  SER B OG  1 
ATOM   1259 N N   . GLU B 1 13  ? 7.915   1.304   -46.339 1.00  16.93 ? 13  GLU B N   1 
ATOM   1260 C CA  . GLU B 1 13  ? 6.949   1.982   -47.187 1.00  18.49 ? 13  GLU B CA  1 
ATOM   1261 C C   . GLU B 1 13  ? 5.664   2.145   -46.378 1.00  16.81 ? 13  GLU B C   1 
ATOM   1262 O O   . GLU B 1 13  ? 5.130   1.158   -45.870 1.00  17.88 ? 13  GLU B O   1 
ATOM   1263 C CB  . GLU B 1 13  ? 6.675   1.134   -48.416 1.00  19.77 ? 13  GLU B CB  1 
ATOM   1264 C CG  . GLU B 1 13  ? 5.574   1.611   -49.346 1.00  23.05 ? 13  GLU B CG  1 
ATOM   1265 C CD  . GLU B 1 13  ? 5.500   0.754   -50.602 0.70  24.76 ? 13  GLU B CD  1 
ATOM   1266 O OE1 . GLU B 1 13  ? 6.451   0.797   -51.390 0.50  22.71 ? 13  GLU B OE1 1 
ATOM   1267 O OE2 . GLU B 1 13  ? 4.482   0.044   -50.796 0.50  23.77 ? 13  GLU B OE2 1 
ATOM   1268 N N   . ASN B 1 14  ? 5.199   3.398   -46.272 1.00  18.00 ? 14  ASN B N   1 
ATOM   1269 C CA  . ASN B 1 14  ? 3.888   3.720   -45.720 1.00  16.55 ? 14  ASN B CA  1 
ATOM   1270 C C   . ASN B 1 14  ? 3.752   3.473   -44.217 1.00  16.36 ? 14  ASN B C   1 
ATOM   1271 O O   . ASN B 1 14  ? 2.641   3.326   -43.712 1.00  19.33 ? 14  ASN B O   1 
ATOM   1272 C CB  . ASN B 1 14  ? 2.735   2.984   -46.452 1.00  17.33 ? 14  ASN B CB  1 
ATOM   1273 C CG  . ASN B 1 14  ? 2.636   3.382   -47.891 1.00  19.06 ? 14  ASN B CG  1 
ATOM   1274 O OD1 . ASN B 1 14  ? 3.191   4.414   -48.284 1.00  19.00 ? 14  ASN B OD1 1 
ATOM   1275 N ND2 . ASN B 1 14  ? 1.941   2.591   -48.682 1.00  18.94 ? 14  ASN B ND2 1 
ATOM   1276 N N   . PHE B 1 15  ? 4.868   3.423   -43.500 1.00  17.35 ? 15  PHE B N   1 
ATOM   1277 C CA  . PHE B 1 15  ? 4.769   3.289   -42.033 1.00  18.15 ? 15  PHE B CA  1 
ATOM   1278 C C   . PHE B 1 15  ? 4.055   4.482   -41.412 1.00  18.34 ? 15  PHE B C   1 
ATOM   1279 O O   . PHE B 1 15  ? 3.172   4.305   -40.551 1.00  17.85 ? 15  PHE B O   1 
ATOM   1280 C CB  . PHE B 1 15  ? 6.152   3.093   -41.418 1.00  18.70 ? 15  PHE B CB  1 
ATOM   1281 C CG  . PHE B 1 15  ? 6.118   2.819   -39.928 1.00  20.70 ? 15  PHE B CG  1 
ATOM   1282 C CD1 . PHE B 1 15  ? 5.310   1.810   -39.426 1.00  21.75 ? 15  PHE B CD1 1 
ATOM   1283 C CD2 . PHE B 1 15  ? 6.898   3.563   -39.062 1.00  21.15 ? 15  PHE B CD2 1 
ATOM   1284 C CE1 . PHE B 1 15  ? 5.260   1.549   -38.059 1.00  21.08 ? 15  PHE B CE1 1 
ATOM   1285 C CE2 . PHE B 1 15  ? 6.849   3.301   -37.692 1.00  21.20 ? 15  PHE B CE2 1 
ATOM   1286 C CZ  . PHE B 1 15  ? 6.027   2.313   -37.205 1.00  21.04 ? 15  PHE B CZ  1 
ATOM   1287 N N   . GLU B 1 16  ? 4.425   5.701   -41.812 1.00  18.40 ? 16  GLU B N   1 
ATOM   1288 C CA  . GLU B 1 16  ? 3.728   6.851   -41.231 1.00  19.51 ? 16  GLU B CA  1 
ATOM   1289 C C   . GLU B 1 16  ? 2.249   6.867   -41.597 1.00  19.24 ? 16  GLU B C   1 
ATOM   1290 O O   . GLU B 1 16  ? 1.381   7.215   -40.765 1.00  21.39 ? 16  GLU B O   1 
ATOM   1291 C CB  . GLU B 1 16  ? 4.384   8.193   -41.585 1.00  21.98 ? 16  GLU B CB  1 
ATOM   1292 C CG  . GLU B 1 16  ? 3.775   9.216   -40.608 0.80  25.19 ? 16  GLU B CG  1 
ATOM   1293 C CD  . GLU B 1 16  ? 4.151   10.626  -40.817 0.60  29.75 ? 16  GLU B CD  1 
ATOM   1294 O OE1 . GLU B 1 16  ? 5.272   10.871  -41.298 0.60  26.12 ? 16  GLU B OE1 1 
ATOM   1295 O OE2 . GLU B 1 16  ? 3.296   11.481  -40.457 0.50  26.75 ? 16  GLU B OE2 1 
ATOM   1296 N N   . GLU B 1 17  ? 1.967   6.504   -42.843 1.00  19.85 ? 17  GLU B N   1 
ATOM   1297 C CA  . GLU B 1 17  ? 0.598   6.435   -43.323 1.00  19.35 ? 17  GLU B CA  1 
ATOM   1298 C C   . GLU B 1 17  ? -0.227  5.453   -42.490 1.00  21.06 ? 17  GLU B C   1 
ATOM   1299 O O   . GLU B 1 17  ? -1.392  5.694   -42.133 1.00  20.70 ? 17  GLU B O   1 
ATOM   1300 C CB  . GLU B 1 17  ? 0.587   6.069   -44.810 1.00  22.41 ? 17  GLU B CB  1 
ATOM   1301 C CG  . GLU B 1 17  ? -0.798  6.108   -45.415 1.00  23.11 ? 17  GLU B CG  1 
ATOM   1302 C CD  . GLU B 1 17  ? -0.818  5.904   -46.905 0.90  24.67 ? 17  GLU B CD  1 
ATOM   1303 O OE1 . GLU B 1 17  ? 0.231   5.532   -47.459 0.70  24.21 ? 17  GLU B OE1 1 
ATOM   1304 O OE2 . GLU B 1 17  ? -1.892  6.157   -47.505 0.70  24.09 ? 17  GLU B OE2 1 
ATOM   1305 N N   . LEU B 1 18  ? 0.383   4.313   -42.213 1.00  17.85 ? 18  LEU B N   1 
ATOM   1306 C CA  . LEU B 1 18  ? -0.270  3.288   -41.358 1.00  18.29 ? 18  LEU B CA  1 
ATOM   1307 C C   . LEU B 1 18  ? -0.521  3.837   -39.962 1.00  21.46 ? 18  LEU B C   1 
ATOM   1308 O O   . LEU B 1 18  ? -1.611  3.677   -39.434 1.00  18.91 ? 18  LEU B O   1 
ATOM   1309 C CB  . LEU B 1 18  ? 0.660   2.063   -41.276 1.00  19.04 ? 18  LEU B CB  1 
ATOM   1310 C CG  . LEU B 1 18  ? 0.154   0.857   -40.438 1.00  18.69 ? 18  LEU B CG  1 
ATOM   1311 C CD1 . LEU B 1 18  ? -0.647  -0.026  -41.358 1.00  21.86 ? 18  LEU B CD1 1 
ATOM   1312 C CD2 . LEU B 1 18  ? 1.331   0.080   -39.822 1.00  21.40 ? 18  LEU B CD2 1 
ATOM   1313 N N   . LEU B 1 19  ? 0.466   4.486   -39.363 1.00  20.63 ? 19  LEU B N   1 
ATOM   1314 C CA  . LEU B 1 19  ? 0.266   5.065   -38.017 1.00  19.00 ? 19  LEU B CA  1 
ATOM   1315 C C   . LEU B 1 19  ? -0.893  6.079   -38.026 1.00  20.78 ? 19  LEU B C   1 
ATOM   1316 O O   . LEU B 1 19  ? -1.727  6.128   -37.097 1.00  23.76 ? 19  LEU B O   1 
ATOM   1317 C CB  . LEU B 1 19  ? 1.549   5.714   -37.476 1.00  19.69 ? 19  LEU B CB  1 
ATOM   1318 C CG  . LEU B 1 19  ? 2.736   4.748   -37.255 1.00  20.23 ? 19  LEU B CG  1 
ATOM   1319 C CD1 . LEU B 1 19  ? 3.957   5.507   -36.700 1.00  20.59 ? 19  LEU B CD1 1 
ATOM   1320 C CD2 . LEU B 1 19  ? 2.308   3.593   -36.343 1.00  21.20 ? 19  LEU B CD2 1 
ATOM   1321 N N   . LYS B 1 20  ? -0.948  6.890   -39.078 1.00  21.42 ? 20  LYS B N   1 
ATOM   1322 C CA  . LYS B 1 20  ? -2.006  7.915   -39.164 1.00  24.40 ? 20  LYS B CA  1 
ATOM   1323 C C   . LYS B 1 20  ? -3.393  7.255   -39.217 1.00  24.65 ? 20  LYS B C   1 
ATOM   1324 O O   . LYS B 1 20  ? -4.332  7.649   -38.476 1.00  29.46 ? 20  LYS B O   1 
ATOM   1325 C CB  . LYS B 1 20  ? -1.749  8.821   -40.376 1.00  25.24 ? 20  LYS B CB  1 
ATOM   1326 C CG  . LYS B 1 20  ? -2.795  9.962   -40.492 0.90  25.51 ? 20  LYS B CG  1 
ATOM   1327 C CD  . LYS B 1 20  ? -2.628  10.726  -41.794 0.70  27.24 ? 20  LYS B CD  1 
ATOM   1328 C CE  . LYS B 1 20  ? -3.475  11.996  -41.819 0.60  28.24 ? 20  LYS B CE  1 
ATOM   1329 N NZ  . LYS B 1 20  ? -3.343  12.646  -43.167 0.50  29.50 ? 20  LYS B NZ  1 
ATOM   1330 N N   . VAL B 1 21  ? -3.547  6.228   -40.045 1.00  27.64 ? 21  VAL B N   1 
ATOM   1331 C CA  . VAL B 1 21  ? -4.864  5.598   -40.138 1.00  29.61 ? 21  VAL B CA  1 
ATOM   1332 C C   . VAL B 1 21  ? -5.257  4.889   -38.852 1.00  29.63 ? 21  VAL B C   1 
ATOM   1333 O O   . VAL B 1 21  ? -6.455  4.732   -38.584 1.00  30.43 ? 21  VAL B O   1 
ATOM   1334 C CB  . VAL B 1 21  ? -5.070  4.657   -41.367 1.00  31.42 ? 21  VAL B CB  1 
ATOM   1335 C CG1 . VAL B 1 21  ? -4.766  5.376   -42.669 0.90  32.55 ? 21  VAL B CG1 1 
ATOM   1336 C CG2 . VAL B 1 21  ? -4.262  3.394   -41.243 0.90  31.24 ? 21  VAL B CG2 1 
ATOM   1337 N N   . LEU B 1 22  ? -4.273  4.478   -38.057 1.00  27.98 ? 22  LEU B N   1 
ATOM   1338 C CA  . LEU B 1 22  ? -4.540  3.867   -36.763 1.00  29.51 ? 22  LEU B CA  1 
ATOM   1339 C C   . LEU B 1 22  ? -4.831  4.918   -35.703 1.00  29.33 ? 22  LEU B C   1 
ATOM   1340 O O   . LEU B 1 22  ? -5.063  4.570   -34.549 1.00  33.30 ? 22  LEU B O   1 
ATOM   1341 C CB  . LEU B 1 22  ? -3.394  2.987   -36.304 1.00  28.47 ? 22  LEU B CB  1 
ATOM   1342 C CG  . LEU B 1 22  ? -3.206  1.738   -37.158 1.00  27.53 ? 22  LEU B CG  1 
ATOM   1343 C CD1 . LEU B 1 22  ? -1.891  1.149   -36.887 1.00  28.50 ? 22  LEU B CD1 1 
ATOM   1344 C CD2 . LEU B 1 22  ? -4.314  0.713   -36.850 1.00  29.40 ? 22  LEU B CD2 1 
ATOM   1345 N N   . GLY B 1 23  ? -4.788  6.191   -36.084 1.00  28.52 ? 23  GLY B N   1 
ATOM   1346 C CA  . GLY B 1 23  ? -5.061  7.309   -35.159 1.00  28.83 ? 23  GLY B CA  1 
ATOM   1347 C C   . GLY B 1 23  ? -3.930  7.750   -34.242 1.00  27.69 ? 23  GLY B C   1 
ATOM   1348 O O   . GLY B 1 23  ? -4.161  8.445   -33.245 1.00  29.83 ? 23  GLY B O   1 
ATOM   1349 N N   . VAL B 1 24  ? -2.692  7.369   -34.554 1.00  27.12 ? 24  VAL B N   1 
ATOM   1350 C CA  . VAL B 1 24  ? -1.545  7.770   -33.739 1.00  25.46 ? 24  VAL B CA  1 
ATOM   1351 C C   . VAL B 1 24  ? -1.313  9.281   -33.876 1.00  27.72 ? 24  VAL B C   1 
ATOM   1352 O O   . VAL B 1 24  ? -1.286  9.763   -34.992 1.00  28.03 ? 24  VAL B O   1 
ATOM   1353 C CB  . VAL B 1 24  ? -0.306  6.979   -34.160 1.00  26.33 ? 24  VAL B CB  1 
ATOM   1354 C CG1 . VAL B 1 24  ? 0.883   7.393   -33.354 1.00  25.05 ? 24  VAL B CG1 1 
ATOM   1355 C CG2 . VAL B 1 24  ? -0.610  5.468   -33.963 1.00  25.54 ? 24  VAL B CG2 1 
ATOM   1356 N N   . ASN B 1 25  ? -1.181  10.011  -32.758 1.00  26.44 ? 25  ASN B N   1 
ATOM   1357 C CA  . ASN B 1 25  ? -1.085  11.481  -32.822 1.00  27.59 ? 25  ASN B CA  1 
ATOM   1358 C C   . ASN B 1 25  ? 0.219   11.982  -33.440 1.00  27.48 ? 25  ASN B C   1 
ATOM   1359 O O   . ASN B 1 25  ? 1.211   11.246  -33.581 1.00  27.22 ? 25  ASN B O   1 
ATOM   1360 C CB  . ASN B 1 25  ? -1.414  12.137  -31.468 0.80  28.25 ? 25  ASN B CB  1 
ATOM   1361 C CG  . ASN B 1 25  ? -0.289  12.037  -30.455 0.80  27.83 ? 25  ASN B CG  1 
ATOM   1362 O OD1 . ASN B 1 25  ? 0.878   12.289  -30.753 0.70  28.38 ? 25  ASN B OD1 1 
ATOM   1363 N ND2 . ASN B 1 25  ? -0.652  11.701  -29.211 0.70  29.63 ? 25  ASN B ND2 1 
ATOM   1364 N N   . VAL B 1 26  ? 0.204   13.240  -33.843 1.00  28.03 ? 26  VAL B N   1 
ATOM   1365 C CA  . VAL B 1 26  ? 1.287   13.782  -34.646 1.00  27.39 ? 26  VAL B CA  1 
ATOM   1366 C C   . VAL B 1 26  ? 2.653   13.699  -33.983 1.00  27.68 ? 26  VAL B C   1 
ATOM   1367 O O   . VAL B 1 26  ? 3.618   13.309  -34.626 1.00  30.34 ? 26  VAL B O   1 
ATOM   1368 C CB  . VAL B 1 26  ? 0.951   15.238  -35.060 1.00  25.33 ? 26  VAL B CB  1 
ATOM   1369 C CG1 . VAL B 1 26  ? 2.146   15.943  -35.598 1.00  26.90 ? 26  VAL B CG1 1 
ATOM   1370 C CG2 . VAL B 1 26  ? -0.151  15.227  -36.092 1.00  25.03 ? 26  VAL B CG2 1 
ATOM   1371 N N   . MET B 1 27  ? 2.764   14.046  -32.699 0.90  29.96 ? 27  MET B N   1 
ATOM   1372 C CA  . MET B 1 27  ? 4.102   14.110  -32.133 0.90  29.90 ? 27  MET B CA  1 
ATOM   1373 C C   . MET B 1 27  ? 4.647   12.699  -31.796 0.70  29.09 ? 27  MET B C   1 
ATOM   1374 O O   . MET B 1 27  ? 5.858   12.474  -31.817 0.70  27.33 ? 27  MET B O   1 
ATOM   1375 C CB  . MET B 1 27  ? 4.198   15.103  -30.973 0.70  31.64 ? 27  MET B CB  1 
ATOM   1376 C CG  . MET B 1 27  ? 4.068   16.570  -31.414 0.70  32.34 ? 27  MET B CG  1 
ATOM   1377 S SD  . MET B 1 27  ? 5.263   17.146  -32.658 0.70  33.68 ? 27  MET B SD  1 
ATOM   1378 C CE  . MET B 1 27  ? 4.343   17.024  -34.172 0.80  32.48 ? 27  MET B CE  1 
ATOM   1379 N N   . LEU B 1 28  ? 3.736   11.768  -31.518 1.00  29.96 ? 28  LEU B N   1 
ATOM   1380 C CA  . LEU B 1 28  ? 4.094   10.324  -31.419 1.00  29.02 ? 28  LEU B CA  1 
ATOM   1381 C C   . LEU B 1 28  ? 4.540   9.760   -32.760 1.00  28.35 ? 28  LEU B C   1 
ATOM   1382 O O   . LEU B 1 28  ? 5.499   8.979   -32.830 0.80  26.74 ? 28  LEU B O   1 
ATOM   1383 C CB  . LEU B 1 28  ? 2.919   9.489   -30.907 1.00  31.43 ? 28  LEU B CB  1 
ATOM   1384 C CG  . LEU B 1 28  ? 2.523   9.630   -29.436 1.00  34.76 ? 28  LEU B CG  1 
ATOM   1385 C CD1 . LEU B 1 28  ? 1.424   8.624   -29.052 1.00  34.54 ? 28  LEU B CD1 1 
ATOM   1386 C CD2 . LEU B 1 28  ? 3.730   9.503   -28.533 1.00  34.49 ? 28  LEU B CD2 1 
ATOM   1387 N N   . ARG B 1 29  ? 3.845   10.126  -33.837 1.00  26.23 ? 29  ARG B N   1 
ATOM   1388 C CA  . ARG B 1 29  ? 4.282   9.677   -35.169 1.00  26.53 ? 29  ARG B CA  1 
ATOM   1389 C C   . ARG B 1 29  ? 5.679   10.208  -35.475 1.00  25.96 ? 29  ARG B C   1 
ATOM   1390 O O   . ARG B 1 29  ? 6.504   9.498   -36.056 1.00  24.21 ? 29  ARG B O   1 
ATOM   1391 C CB  . ARG B 1 29  ? 3.324   10.099  -36.310 1.00  26.95 ? 29  ARG B CB  1 
ATOM   1392 C CG  . ARG B 1 29  ? 1.928   9.502   -36.266 1.00  27.07 ? 29  ARG B CG  1 
ATOM   1393 C CD  . ARG B 1 29  ? 1.259   9.464   -37.649 1.00  26.40 ? 29  ARG B CD  1 
ATOM   1394 N NE  . ARG B 1 29  ? 1.056   10.758  -38.300 1.00  28.17 ? 29  ARG B NE  1 
ATOM   1395 C CZ  . ARG B 1 29  ? -0.023  11.535  -38.145 1.00  29.95 ? 29  ARG B CZ  1 
ATOM   1396 N NH1 . ARG B 1 29  ? -1.024  11.188  -37.333 1.00  27.85 ? 29  ARG B NH1 1 
ATOM   1397 N NH2 . ARG B 1 29  ? -0.108  12.660  -38.834 1.00  27.95 ? 29  ARG B NH2 1 
ATOM   1398 N N   . LYS B 1 30  ? 5.953   11.453  -35.097 1.00  28.67 ? 30  LYS B N   1 
ATOM   1399 C CA  . LYS B 1 30  ? 7.263   12.047  -35.373 1.00  30.07 ? 30  LYS B CA  1 
ATOM   1400 C C   . LYS B 1 30  ? 8.357   11.218  -34.715 1.00  30.19 ? 30  LYS B C   1 
ATOM   1401 O O   . LYS B 1 30  ? 9.377   10.889  -35.343 1.00  30.71 ? 30  LYS B O   1 
ATOM   1402 C CB  . LYS B 1 30  ? 7.321   13.492  -34.867 0.80  31.73 ? 30  LYS B CB  1 
ATOM   1403 C CG  . LYS B 1 30  ? 7.301   14.529  -35.980 0.50  33.95 ? 30  LYS B CG  1 
ATOM   1404 C CD  . LYS B 1 30  ? 8.502   14.332  -36.905 0.50  34.97 ? 30  LYS B CD  1 
ATOM   1405 C CE  . LYS B 1 30  ? 8.165   14.680  -38.347 0.50  35.71 ? 30  LYS B CE  1 
ATOM   1406 N NZ  . LYS B 1 30  ? 8.801   13.722  -39.285 0.50  36.18 ? 30  LYS B NZ  1 
ATOM   1407 N N   . ILE B 1 31  ? 8.137   10.874  -33.456 1.00  30.06 ? 31  ILE B N   1 
ATOM   1408 C CA  . ILE B 1 31  ? 9.067   10.039  -32.727 1.00  30.26 ? 31  ILE B CA  1 
ATOM   1409 C C   . ILE B 1 31  ? 9.204   8.679   -33.412 1.00  28.99 ? 31  ILE B C   1 
ATOM   1410 O O   . ILE B 1 31  ? 10.306  8.181   -33.586 1.00  30.26 ? 31  ILE B O   1 
ATOM   1411 C CB  . ILE B 1 31  ? 8.620   9.883   -31.251 0.80  30.35 ? 31  ILE B CB  1 
ATOM   1412 C CG1 . ILE B 1 31  ? 8.663   11.251  -30.542 0.70  31.24 ? 31  ILE B CG1 1 
ATOM   1413 C CG2 . ILE B 1 31  ? 9.475   8.839   -30.508 0.70  31.27 ? 31  ILE B CG2 1 
ATOM   1414 C CD1 . ILE B 1 31  ? 8.002   11.259  -29.176 0.70  31.38 ? 31  ILE B CD1 1 
ATOM   1415 N N   . ALA B 1 32  ? 8.093   8.087   -33.823 1.00  27.76 ? 32  ALA B N   1 
ATOM   1416 C CA  . ALA B 1 32  ? 8.137   6.712   -34.372 1.00  25.90 ? 32  ALA B CA  1 
ATOM   1417 C C   . ALA B 1 32  ? 8.904   6.614   -35.691 1.00  26.98 ? 32  ALA B C   1 
ATOM   1418 O O   . ALA B 1 32  ? 9.536   5.579   -35.996 1.00  26.44 ? 32  ALA B O   1 
ATOM   1419 C CB  . ALA B 1 32  ? 6.708   6.146   -34.532 1.00  27.04 ? 32  ALA B CB  1 
ATOM   1420 N N   . VAL B 1 33  ? 8.850   7.661   -36.500 1.00  29.48 ? 33  VAL B N   1 
ATOM   1421 C CA  . VAL B 1 33  ? 9.491   7.565   -37.807 1.00  30.82 ? 33  VAL B CA  1 
ATOM   1422 C C   . VAL B 1 33  ? 10.929  8.123   -37.846 1.00  32.59 ? 33  VAL B C   1 
ATOM   1423 O O   . VAL B 1 33  ? 11.600  8.052   -38.886 1.00  35.88 ? 33  VAL B O   1 
ATOM   1424 C CB  . VAL B 1 33  ? 8.582   8.176   -38.945 1.00  32.16 ? 33  VAL B CB  1 
ATOM   1425 C CG1 . VAL B 1 33  ? 7.177   7.628   -38.853 1.00  31.89 ? 33  VAL B CG1 1 
ATOM   1426 C CG2 . VAL B 1 33  ? 8.532   9.688   -38.853 1.00  32.12 ? 33  VAL B CG2 1 
ATOM   1427 N N   . ALA B 1 34  ? 11.391  8.663   -36.718 0.90  33.00 ? 34  ALA B N   1 
ATOM   1428 C CA  . ALA B 1 34  ? 12.734  9.261   -36.594 0.90  33.66 ? 34  ALA B CA  1 
ATOM   1429 C C   . ALA B 1 34  ? 13.818  8.169   -36.542 0.90  34.87 ? 34  ALA B C   1 
ATOM   1430 O O   . ALA B 1 34  ? 13.505  6.998   -36.572 0.90  34.84 ? 34  ALA B O   1 
ATOM   1431 C CB  . ALA B 1 34  ? 12.804  10.123  -35.359 0.90  33.84 ? 34  ALA B CB  1 
ATOM   1432 N N   . ALA B 1 35  ? 15.086  8.566   -36.452 1.00  35.96 ? 35  ALA B N   1 
ATOM   1433 C CA  . ALA B 1 35  ? 16.207  7.615   -36.528 1.00  36.19 ? 35  ALA B CA  1 
ATOM   1434 C C   . ALA B 1 35  ? 16.364  6.872   -35.205 1.00  36.26 ? 35  ALA B C   1 
ATOM   1435 O O   . ALA B 1 35  ? 16.715  5.698   -35.176 1.00  37.41 ? 35  ALA B O   1 
ATOM   1436 C CB  . ALA B 1 35  ? 17.487  8.346   -36.873 0.90  37.41 ? 35  ALA B CB  1 
ATOM   1437 N N   . ALA B 1 36  ? 16.075  7.564   -34.109 0.80  35.98 ? 36  ALA B N   1 
ATOM   1438 C CA  . ALA B 1 36  ? 16.231  6.977   -32.787 0.80  34.35 ? 36  ALA B CA  1 
ATOM   1439 C C   . ALA B 1 36  ? 15.245  5.838   -32.547 0.80  33.12 ? 36  ALA B C   1 
ATOM   1440 O O   . ALA B 1 36  ? 15.359  5.139   -31.525 0.80  32.34 ? 36  ALA B O   1 
ATOM   1441 C CB  . ALA B 1 36  ? 16.092  8.047   -31.699 0.80  35.14 ? 36  ALA B CB  1 
ATOM   1442 N N   . SER B 1 37  ? 14.300  5.658   -33.488 1.00  32.11 ? 37  SER B N   1 
ATOM   1443 C CA  . SER B 1 37  ? 13.302  4.593   -33.400 1.00  31.29 ? 37  SER B CA  1 
ATOM   1444 C C   . SER B 1 37  ? 13.464  3.547   -34.502 1.00  28.29 ? 37  SER B C   1 
ATOM   1445 O O   . SER B 1 37  ? 12.594  2.706   -34.673 1.00  27.65 ? 37  SER B O   1 
ATOM   1446 C CB  . SER B 1 37  ? 11.884  5.181   -33.435 1.00  33.11 ? 37  SER B CB  1 
ATOM   1447 O OG  . SER B 1 37  ? 11.581  5.846   -32.216 1.00  37.04 ? 37  SER B OG  1 
ATOM   1448 N N   . LYS B 1 38  ? 14.568  3.601   -35.256 1.00  26.65 ? 38  LYS B N   1 
ATOM   1449 C CA  . LYS B 1 38  ? 14.810  2.592   -36.283 1.00  25.55 ? 38  LYS B CA  1 
ATOM   1450 C C   . LYS B 1 38  ? 14.759  1.198   -35.633 1.00  23.44 ? 38  LYS B C   1 
ATOM   1451 O O   . LYS B 1 38  ? 15.469  0.968   -34.670 1.00  25.30 ? 38  LYS B O   1 
ATOM   1452 C CB  . LYS B 1 38  ? 16.209  2.812   -36.896 0.80  25.74 ? 38  LYS B CB  1 
ATOM   1453 C CG  . LYS B 1 38  ? 16.592  1.796   -37.955 0.80  25.97 ? 38  LYS B CG  1 
ATOM   1454 C CD  . LYS B 1 38  ? 17.996  2.084   -38.517 0.80  26.11 ? 38  LYS B CD  1 
ATOM   1455 C CE  . LYS B 1 38  ? 18.235  1.368   -39.820 0.70  28.20 ? 38  LYS B CE  1 
ATOM   1456 N NZ  . LYS B 1 38  ? 19.635  1.563   -40.308 0.50  28.97 ? 38  LYS B NZ  1 
ATOM   1457 N N   . PRO B 1 39  ? 13.918  0.272   -36.151 1.00  21.93 ? 39  PRO B N   1 
ATOM   1458 C CA  . PRO B 1 39  ? 13.795  -1.014  -35.415 1.00  20.22 ? 39  PRO B CA  1 
ATOM   1459 C C   . PRO B 1 39  ? 14.813  -2.057  -35.805 1.00  20.34 ? 39  PRO B C   1 
ATOM   1460 O O   . PRO B 1 39  ? 15.029  -2.295  -37.009 1.00  22.70 ? 39  PRO B O   1 
ATOM   1461 C CB  . PRO B 1 39  ? 12.415  -1.545  -35.851 1.00  20.05 ? 39  PRO B CB  1 
ATOM   1462 C CG  . PRO B 1 39  ? 12.217  -0.960  -37.234 1.00  20.97 ? 39  PRO B CG  1 
ATOM   1463 C CD  . PRO B 1 39  ? 12.967  0.350   -37.269 1.00  21.06 ? 39  PRO B CD  1 
ATOM   1464 N N   . ALA B 1 40  ? 15.412  -2.696  -34.808 1.00  18.04 ? 40  ALA B N   1 
ATOM   1465 C CA  . ALA B 1 40  ? 16.178  -3.902  -35.054 1.00  18.31 ? 40  ALA B CA  1 
ATOM   1466 C C   . ALA B 1 40  ? 15.334  -5.075  -34.564 1.00  19.98 ? 40  ALA B C   1 
ATOM   1467 O O   . ALA B 1 40  ? 14.773  -4.986  -33.469 1.00  19.86 ? 40  ALA B O   1 
ATOM   1468 C CB  . ALA B 1 40  ? 17.500  -3.837  -34.292 1.00  21.46 ? 40  ALA B CB  1 
ATOM   1469 N N   . VAL B 1 41  ? 15.225  -6.138  -35.358 1.00  17.32 ? 41  VAL B N   1 
ATOM   1470 C CA  . VAL B 1 41  ? 14.291  -7.227  -35.044 1.00  17.90 ? 41  VAL B CA  1 
ATOM   1471 C C   . VAL B 1 41  ? 15.065  -8.514  -34.876 1.00  18.46 ? 41  VAL B C   1 
ATOM   1472 O O   . VAL B 1 41  ? 15.773  -8.950  -35.789 1.00  21.32 ? 41  VAL B O   1 
ATOM   1473 C CB  . VAL B 1 41  ? 13.271  -7.380  -36.235 1.00  17.42 ? 41  VAL B CB  1 
ATOM   1474 C CG1 . VAL B 1 41  ? 12.380  -8.627  -36.072 1.00  20.01 ? 41  VAL B CG1 1 
ATOM   1475 C CG2 . VAL B 1 41  ? 12.411  -6.105  -36.394 1.00  18.54 ? 41  VAL B CG2 1 
ATOM   1476 N N   . GLU B 1 42  ? 14.927  -9.150  -33.714 1.00  17.06 ? 42  GLU B N   1 
ATOM   1477 C CA  A GLU B 1 42  ? 15.546  -10.464 -33.440 0.50  19.02 ? 42  GLU B CA  1 
ATOM   1478 C CA  B GLU B 1 42  ? 15.552  -10.461 -33.464 0.50  20.40 ? 42  GLU B CA  1 
ATOM   1479 C C   . GLU B 1 42  ? 14.433  -11.482 -33.406 1.00  17.79 ? 42  GLU B C   1 
ATOM   1480 O O   . GLU B 1 42  ? 13.468  -11.325 -32.649 1.00  18.94 ? 42  GLU B O   1 
ATOM   1481 C CB  A GLU B 1 42  ? 16.246  -10.457 -32.065 0.50  18.01 ? 42  GLU B CB  1 
ATOM   1482 C CB  B GLU B 1 42  ? 16.333  -10.436 -32.133 0.50  19.76 ? 42  GLU B CB  1 
ATOM   1483 C CG  A GLU B 1 42  ? 16.598  -11.867 -31.569 0.50  18.70 ? 42  GLU B CG  1 
ATOM   1484 C CG  B GLU B 1 42  ? 17.260  -11.640 -31.921 0.50  21.70 ? 42  GLU B CG  1 
ATOM   1485 C CD  A GLU B 1 42  ? 17.436  -11.899 -30.292 0.40  16.56 ? 42  GLU B CD  1 
ATOM   1486 C CD  B GLU B 1 42  ? 18.182  -11.496 -30.717 0.40  19.51 ? 42  GLU B CD  1 
ATOM   1487 O OE1 A GLU B 1 42  ? 17.525  -10.869 -29.603 0.30  16.35 ? 42  GLU B OE1 1 
ATOM   1488 O OE1 B GLU B 1 42  ? 18.677  -10.380 -30.477 0.30  22.75 ? 42  GLU B OE1 1 
ATOM   1489 O OE2 A GLU B 1 42  ? 18.007  -12.976 -29.988 0.30  19.99 ? 42  GLU B OE2 1 
ATOM   1490 O OE2 B GLU B 1 42  ? 18.450  -12.511 -30.028 0.30  24.81 ? 42  GLU B OE2 1 
ATOM   1491 N N   . ILE B 1 43  ? 14.533  -12.502 -34.240 1.00  17.36 ? 43  ILE B N   1 
ATOM   1492 C CA  . ILE B 1 43  ? 13.551  -13.592 -34.278 1.00  16.64 ? 43  ILE B CA  1 
ATOM   1493 C C   . ILE B 1 43  ? 14.269  -14.862 -33.912 1.00  17.04 ? 43  ILE B C   1 
ATOM   1494 O O   . ILE B 1 43  ? 15.417  -15.145 -34.364 1.00  18.48 ? 43  ILE B O   1 
ATOM   1495 C CB  . ILE B 1 43  ? 12.971  -13.760 -35.712 1.00  17.36 ? 43  ILE B CB  1 
ATOM   1496 C CG1 . ILE B 1 43  ? 12.253  -12.468 -36.093 1.00  16.81 ? 43  ILE B CG1 1 
ATOM   1497 C CG2 . ILE B 1 43  ? 12.036  -15.015 -35.796 1.00  18.34 ? 43  ILE B CG2 1 
ATOM   1498 C CD1 . ILE B 1 43  ? 11.595  -12.492 -37.474 1.00  19.08 ? 43  ILE B CD1 1 
ATOM   1499 N N   . LYS B 1 44  ? 13.597  -15.648 -33.066 1.00  16.70 ? 44  LYS B N   1 
ATOM   1500 C CA  . LYS B 1 44  ? 14.006  -17.030 -32.837 1.00  18.53 ? 44  LYS B CA  1 
ATOM   1501 C C   . LYS B 1 44  ? 12.827  -17.931 -33.168 1.00  18.11 ? 44  LYS B C   1 
ATOM   1502 O O   . LYS B 1 44  ? 11.764  -17.804 -32.569 1.00  19.00 ? 44  LYS B O   1 
ATOM   1503 C CB  . LYS B 1 44  ? 14.458  -17.276 -31.386 1.00  20.06 ? 44  LYS B CB  1 
ATOM   1504 C CG  . LYS B 1 44  ? 14.896  -18.717 -31.169 1.00  24.40 ? 44  LYS B CG  1 
ATOM   1505 C CD  . LYS B 1 44  ? 16.132  -19.025 -32.009 0.80  26.63 ? 44  LYS B CD  1 
ATOM   1506 C CE  . LYS B 1 44  ? 16.449  -20.504 -32.047 0.60  29.61 ? 44  LYS B CE  1 
ATOM   1507 N NZ  . LYS B 1 44  ? 17.784  -20.707 -32.661 0.50  30.34 ? 44  LYS B NZ  1 
ATOM   1508 N N   . GLN B 1 45  ? 13.024  -18.852 -34.114 1.00  19.59 ? 45  GLN B N   1 
ATOM   1509 C CA  . GLN B 1 45  ? 12.013  -19.813 -34.449 1.00  18.84 ? 45  GLN B CA  1 
ATOM   1510 C C   . GLN B 1 45  ? 12.543  -21.194 -34.101 1.00  20.43 ? 45  GLN B C   1 
ATOM   1511 O O   . GLN B 1 45  ? 13.651  -21.548 -34.496 1.00  21.89 ? 45  GLN B O   1 
ATOM   1512 C CB  . GLN B 1 45  ? 11.763  -19.801 -35.968 1.00  20.41 ? 45  GLN B CB  1 
ATOM   1513 C CG  . GLN B 1 45  ? 10.826  -20.917 -36.384 1.00  21.34 ? 45  GLN B CG  1 
ATOM   1514 C CD  . GLN B 1 45  ? 10.632  -20.967 -37.872 1.00  22.61 ? 45  GLN B CD  1 
ATOM   1515 O OE1 . GLN B 1 45  ? 11.241  -20.203 -38.613 1.00  23.21 ? 45  GLN B OE1 1 
ATOM   1516 N NE2 . GLN B 1 45  ? 9.763   -21.855 -38.320 1.00  24.83 ? 45  GLN B NE2 1 
ATOM   1517 N N   . GLU B 1 46  ? 11.731  -21.979 -33.404 1.00  21.69 ? 46  GLU B N   1 
ATOM   1518 C CA  . GLU B 1 46  ? 12.026  -23.389 -33.152 1.00  25.36 ? 46  GLU B CA  1 
ATOM   1519 C C   . GLU B 1 46  ? 10.760  -24.142 -33.495 1.00  24.30 ? 46  GLU B C   1 
ATOM   1520 O O   . GLU B 1 46  ? 9.762   -24.060 -32.793 1.00  26.12 ? 46  GLU B O   1 
ATOM   1521 C CB  . GLU B 1 46  ? 12.384  -23.554 -31.690 0.80  25.30 ? 46  GLU B CB  1 
ATOM   1522 C CG  . GLU B 1 46  ? 13.785  -23.142 -31.334 0.50  27.49 ? 46  GLU B CG  1 
ATOM   1523 C CD  . GLU B 1 46  ? 14.776  -24.283 -31.514 0.40  28.94 ? 46  GLU B CD  1 
ATOM   1524 O OE1 . GLU B 1 46  ? 14.524  -25.176 -32.363 0.40  29.01 ? 46  GLU B OE1 1 
ATOM   1525 O OE2 . GLU B 1 46  ? 15.787  -24.280 -30.793 0.40  29.25 ? 46  GLU B OE2 1 
ATOM   1526 N N   . GLY B 1 47  ? 10.754  -24.843 -34.614 1.00  26.62 ? 47  GLY B N   1 
ATOM   1527 C CA  . GLY B 1 47  ? 9.514   -25.459 -35.066 1.00  25.85 ? 47  GLY B CA  1 
ATOM   1528 C C   . GLY B 1 47  ? 8.486   -24.387 -35.372 1.00  25.42 ? 47  GLY B C   1 
ATOM   1529 O O   . GLY B 1 47  ? 8.770   -23.423 -36.094 1.00  25.55 ? 47  GLY B O   1 
ATOM   1530 N N   . ASP B 1 48  ? 7.293   -24.549 -34.814 1.00  23.37 ? 48  ASP B N   1 
ATOM   1531 C CA  . ASP B 1 48  ? 6.237   -23.577 -34.971 1.00  20.99 ? 48  ASP B CA  1 
ATOM   1532 C C   . ASP B 1 48  ? 6.251   -22.518 -33.857 1.00  19.99 ? 48  ASP B C   1 
ATOM   1533 O O   . ASP B 1 48  ? 5.398   -21.610 -33.873 1.00  21.25 ? 48  ASP B O   1 
ATOM   1534 C CB  . ASP B 1 48  ? 4.872   -24.275 -35.006 1.00  22.55 ? 48  ASP B CB  1 
ATOM   1535 C CG  . ASP B 1 48  ? 4.563   -24.857 -36.386 0.90  25.15 ? 48  ASP B CG  1 
ATOM   1536 O OD1 . ASP B 1 48  ? 5.171   -24.407 -37.376 0.80  24.55 ? 48  ASP B OD1 1 
ATOM   1537 O OD2 . ASP B 1 48  ? 3.715   -25.777 -36.453 0.60  24.67 ? 48  ASP B OD2 1 
ATOM   1538 N N   . THR B 1 49  ? 7.203   -22.611 -32.930 1.00  19.85 ? 49  THR B N   1 
ATOM   1539 C CA  . THR B 1 49  ? 7.259   -21.639 -31.841 1.00  18.19 ? 49  THR B CA  1 
ATOM   1540 C C   . THR B 1 49  ? 8.165   -20.473 -32.194 1.00  19.14 ? 49  THR B C   1 
ATOM   1541 O O   . THR B 1 49  ? 9.212   -20.668 -32.806 1.00  20.84 ? 49  THR B O   1 
ATOM   1542 C CB  . THR B 1 49  ? 7.700   -22.242 -30.491 1.00  22.04 ? 49  THR B CB  1 
ATOM   1543 O OG1 . THR B 1 49  ? 9.079   -22.632 -30.507 1.00  21.87 ? 49  THR B OG1 1 
ATOM   1544 C CG2 . THR B 1 49  ? 6.834   -23.414 -30.150 1.00  22.12 ? 49  THR B CG2 1 
ATOM   1545 N N   . PHE B 1 50  ? 7.720   -19.277 -31.832 1.00  17.17 ? 50  PHE B N   1 
ATOM   1546 C CA  . PHE B 1 50  ? 8.408   -18.048 -32.193 1.00  15.29 ? 50  PHE B CA  1 
ATOM   1547 C C   . PHE B 1 50  ? 8.594   -17.139 -31.002 1.00  15.60 ? 50  PHE B C   1 
ATOM   1548 O O   . PHE B 1 50  ? 7.741   -17.081 -30.115 1.00  16.05 ? 50  PHE B O   1 
ATOM   1549 C CB  . PHE B 1 50  ? 7.590   -17.242 -33.242 1.00  17.88 ? 50  PHE B CB  1 
ATOM   1550 C CG  . PHE B 1 50  ? 7.806   -17.726 -34.647 1.00  18.60 ? 50  PHE B CG  1 
ATOM   1551 C CD1 . PHE B 1 50  ? 7.151   -18.858 -35.121 1.00  18.96 ? 50  PHE B CD1 1 
ATOM   1552 C CD2 . PHE B 1 50  ? 8.711   -17.073 -35.497 1.00  18.39 ? 50  PHE B CD2 1 
ATOM   1553 C CE1 . PHE B 1 50  ? 7.376   -19.316 -36.452 1.00  19.46 ? 50  PHE B CE1 1 
ATOM   1554 C CE2 . PHE B 1 50  ? 8.932   -17.523 -36.805 1.00  21.15 ? 50  PHE B CE2 1 
ATOM   1555 C CZ  . PHE B 1 50  ? 8.274   -18.639 -37.253 1.00  19.20 ? 50  PHE B CZ  1 
ATOM   1556 N N   . TYR B 1 51  ? 9.703   -16.421 -31.056 1.00  14.87 ? 51  TYR B N   1 
ATOM   1557 C CA  . TYR B 1 51  ? 9.970   -15.281 -30.172 1.00  14.60 ? 51  TYR B CA  1 
ATOM   1558 C C   . TYR B 1 51  ? 10.461  -14.142 -31.055 1.00  15.85 ? 51  TYR B C   1 
ATOM   1559 O O   . TYR B 1 51  ? 11.344  -14.364 -31.912 1.00  15.91 ? 51  TYR B O   1 
ATOM   1560 C CB  . TYR B 1 51  ? 11.022  -15.661 -29.139 1.00  17.18 ? 51  TYR B CB  1 
ATOM   1561 C CG  . TYR B 1 51  ? 11.589  -14.467 -28.385 1.00  16.71 ? 51  TYR B CG  1 
ATOM   1562 C CD1 . TYR B 1 51  ? 11.007  -14.011 -27.217 1.00  16.82 ? 51  TYR B CD1 1 
ATOM   1563 C CD2 . TYR B 1 51  ? 12.695  -13.759 -28.872 1.00  17.37 ? 51  TYR B CD2 1 
ATOM   1564 C CE1 . TYR B 1 51  ? 11.550  -12.942 -26.494 1.00  17.50 ? 51  TYR B CE1 1 
ATOM   1565 C CE2 . TYR B 1 51  ? 13.225  -12.687 -28.178 1.00  17.24 ? 51  TYR B CE2 1 
ATOM   1566 C CZ  . TYR B 1 51  ? 12.656  -12.273 -26.995 1.00  17.65 ? 51  TYR B CZ  1 
ATOM   1567 O OH  . TYR B 1 51  ? 13.224  -11.194 -26.335 1.00  19.30 ? 51  TYR B OH  1 
ATOM   1568 N N   . ILE B 1 52  ? 9.922   -12.940 -30.827 1.00  13.94 ? 52  ILE B N   1 
ATOM   1569 C CA  . ILE B 1 52  ? 10.346  -11.782 -31.622 1.00  15.50 ? 52  ILE B CA  1 
ATOM   1570 C C   . ILE B 1 52  ? 10.599  -10.627 -30.688 1.00  14.53 ? 52  ILE B C   1 
ATOM   1571 O O   . ILE B 1 52  ? 9.723   -10.248 -29.885 1.00  16.67 ? 52  ILE B O   1 
ATOM   1572 C CB  . ILE B 1 52  ? 9.290   -11.391 -32.654 1.00  16.14 ? 52  ILE B CB  1 
ATOM   1573 C CG1 . ILE B 1 52  ? 8.971   -12.598 -33.542 1.00  16.48 ? 52  ILE B CG1 1 
ATOM   1574 C CG2 . ILE B 1 52  ? 9.824   -10.228 -33.491 1.00  17.62 ? 52  ILE B CG2 1 
ATOM   1575 C CD1 . ILE B 1 52  ? 7.975   -12.305 -34.710 1.00  18.04 ? 52  ILE B CD1 1 
ATOM   1576 N N   . LYS B 1 53  ? 11.778  -10.017 -30.825 1.00  15.76 ? 53  LYS B N   1 
ATOM   1577 C CA  . LYS B 1 53  ? 12.098  -8.852  -30.002 1.00  17.40 ? 53  LYS B CA  1 
ATOM   1578 C C   . LYS B 1 53  ? 12.393  -7.704  -30.974 1.00  16.13 ? 53  LYS B C   1 
ATOM   1579 O O   . LYS B 1 53  ? 13.180  -7.854  -31.933 1.00  19.29 ? 53  LYS B O   1 
ATOM   1580 C CB  . LYS B 1 53  ? 13.354  -9.092  -29.176 1.00  17.75 ? 53  LYS B CB  1 
ATOM   1581 C CG  . LYS B 1 53  ? 13.735  -7.912  -28.289 1.00  20.04 ? 53  LYS B CG  1 
ATOM   1582 C CD  . LYS B 1 53  ? 14.808  -8.276  -27.220 1.00  21.30 ? 53  LYS B CD  1 
ATOM   1583 C CE  . LYS B 1 53  ? 16.108  -8.637  -27.830 1.00  23.41 ? 53  LYS B CE  1 
ATOM   1584 N NZ  . LYS B 1 53  ? 17.203  -8.839  -26.765 1.00  22.62 ? 53  LYS B NZ  1 
ATOM   1585 N N   . VAL B 1 54  ? 11.786  -6.558  -30.708 1.00  17.55 ? 54  VAL B N   1 
ATOM   1586 C CA  . VAL B 1 54  ? 12.088  -5.363  -31.493 1.00  17.23 ? 54  VAL B CA  1 
ATOM   1587 C C   . VAL B 1 54  ? 12.743  -4.336  -30.601 1.00  20.10 ? 54  VAL B C   1 
ATOM   1588 O O   . VAL B 1 54  ? 12.219  -3.951  -29.540 1.00  18.89 ? 54  VAL B O   1 
ATOM   1589 C CB  . VAL B 1 54  ? 10.831  -4.736  -32.099 1.00  19.20 ? 54  VAL B CB  1 
ATOM   1590 C CG1 . VAL B 1 54  ? 11.176  -3.514  -32.971 1.00  20.59 ? 54  VAL B CG1 1 
ATOM   1591 C CG2 . VAL B 1 54  ? 10.065  -5.808  -32.885 1.00  19.21 ? 54  VAL B CG2 1 
ATOM   1592 N N   . SER B 1 55  ? 13.922  -3.892  -31.023 1.00  19.35 ? 55  SER B N   1 
ATOM   1593 C CA  . SER B 1 55  ? 14.735  -3.016  -30.206 1.00  22.99 ? 55  SER B CA  1 
ATOM   1594 C C   . SER B 1 55  ? 14.887  -1.692  -30.915 1.00  21.30 ? 55  SER B C   1 
ATOM   1595 O O   . SER B 1 55  ? 15.196  -1.622  -32.126 1.00  24.73 ? 55  SER B O   1 
ATOM   1596 C CB  . SER B 1 55  ? 16.130  -3.614  -29.961 1.00  21.58 ? 55  SER B CB  1 
ATOM   1597 O OG  . SER B 1 55  ? 16.008  -4.818  -29.221 1.00  24.01 ? 55  SER B OG  1 
ATOM   1598 N N   . THR B 1 56  ? 14.665  -0.628  -30.165 1.00  25.64 ? 56  THR B N   1 
ATOM   1599 C CA  . THR B 1 56  ? 15.069  0.680   -30.716 1.00  25.04 ? 56  THR B CA  1 
ATOM   1600 C C   . THR B 1 56  ? 15.847  1.457   -29.654 0.90  28.99 ? 56  THR B C   1 
ATOM   1601 O O   . THR B 1 56  ? 16.044  0.973   -28.534 0.90  30.31 ? 56  THR B O   1 
ATOM   1602 C CB  . THR B 1 56  ? 13.878  1.551   -31.134 1.00  26.91 ? 56  THR B CB  1 
ATOM   1603 O OG1 . THR B 1 56  ? 13.213  2.004   -29.956 1.00  28.38 ? 56  THR B OG1 1 
ATOM   1604 C CG2 . THR B 1 56  ? 12.885  0.789   -31.974 1.00  26.05 ? 56  THR B CG2 1 
ATOM   1605 N N   . THR B 1 57  ? 16.281  2.674   -29.971 0.90  30.24 ? 57  THR B N   1 
ATOM   1606 C CA  . THR B 1 57  ? 16.989  3.400   -28.926 0.80  31.28 ? 57  THR B CA  1 
ATOM   1607 C C   . THR B 1 57  ? 16.008  3.842   -27.841 0.80  32.12 ? 57  THR B C   1 
ATOM   1608 O O   . THR B 1 57  ? 16.443  4.145   -26.730 0.70  34.77 ? 57  THR B O   1 
ATOM   1609 C CB  . THR B 1 57  ? 17.785  4.622   -29.464 0.80  30.80 ? 57  THR B CB  1 
ATOM   1610 O OG1 . THR B 1 57  ? 16.866  5.627   -29.877 0.70  31.10 ? 57  THR B OG1 1 
ATOM   1611 C CG2 . THR B 1 57  ? 18.664  4.232   -30.623 0.70  31.18 ? 57  THR B CG2 1 
ATOM   1612 N N   . VAL B 1 58  ? 14.701  3.884   -28.149 0.90  32.11 ? 58  VAL B N   1 
ATOM   1613 C CA  . VAL B 1 58  ? 13.677  4.374   -27.184 0.90  32.15 ? 58  VAL B CA  1 
ATOM   1614 C C   . VAL B 1 58  ? 12.785  3.317   -26.486 0.80  31.08 ? 58  VAL B C   1 
ATOM   1615 O O   . VAL B 1 58  ? 12.165  3.601   -25.436 0.80  31.13 ? 58  VAL B O   1 
ATOM   1616 C CB  . VAL B 1 58  ? 12.751  5.465   -27.781 0.80  34.45 ? 58  VAL B CB  1 
ATOM   1617 C CG1 . VAL B 1 58  ? 13.458  6.252   -28.883 0.80  33.96 ? 58  VAL B CG1 1 
ATOM   1618 C CG2 . VAL B 1 58  ? 11.439  4.890   -28.294 0.80  34.99 ? 58  VAL B CG2 1 
ATOM   1619 N N   . ARG B 1 59  ? 12.691  2.111   -27.049 0.70  27.97 ? 59  ARG B N   1 
ATOM   1620 C CA  . ARG B 1 59  ? 11.908  1.056   -26.377 1.00  26.39 ? 59  ARG B CA  1 
ATOM   1621 C C   . ARG B 1 59  ? 12.334  -0.352  -26.854 0.80  23.09 ? 59  ARG B C   1 
ATOM   1622 O O   . ARG B 1 59  ? 12.905  -0.505  -27.944 0.80  23.90 ? 59  ARG B O   1 
ATOM   1623 C CB  . ARG B 1 59  ? 10.381  1.275   -26.559 1.00  25.57 ? 59  ARG B CB  1 
ATOM   1624 C CG  . ARG B 1 59  ? 9.511   0.527   -25.459 0.80  26.14 ? 59  ARG B CG  1 
ATOM   1625 C CD  . ARG B 1 59  ? 7.996   0.842   -25.449 0.70  25.74 ? 59  ARG B CD  1 
ATOM   1626 N NE  . ARG B 1 59  ? 7.324   0.168   -24.330 0.50  24.20 ? 59  ARG B NE  1 
ATOM   1627 C CZ  . ARG B 1 59  ? 7.322   0.616   -23.077 0.40  23.83 ? 59  ARG B CZ  1 
ATOM   1628 N NH1 . ARG B 1 59  ? 6.699   -0.063  -22.116 0.30  20.34 ? 59  ARG B NH1 1 
ATOM   1629 N NH2 . ARG B 1 59  ? 7.948   1.747   -22.780 0.30  20.90 ? 59  ARG B NH2 1 
ATOM   1630 N N   . THR B 1 60  ? 12.095  -1.374  -26.025 1.00  23.08 ? 60  THR B N   1 
ATOM   1631 C CA  . THR B 1 60  ? 12.219  -2.739  -26.485 1.00  21.39 ? 60  THR B CA  1 
ATOM   1632 C C   . THR B 1 60  ? 10.868  -3.406  -26.319 1.00  19.62 ? 60  THR B C   1 
ATOM   1633 O O   . THR B 1 60  ? 10.222  -3.200  -25.317 1.00  18.74 ? 60  THR B O   1 
ATOM   1634 C CB  . THR B 1 60  ? 13.275  -3.474  -25.674 1.00  21.96 ? 60  THR B CB  1 
ATOM   1635 O OG1 . THR B 1 60  ? 14.532  -2.788  -25.822 1.00  24.55 ? 60  THR B OG1 1 
ATOM   1636 C CG2 . THR B 1 60  ? 13.434  -4.917  -26.135 1.00  21.99 ? 60  THR B CG2 1 
ATOM   1637 N N   . THR B 1 61  ? 10.426  -4.165  -27.320 1.00  18.44 ? 61  THR B N   1 
ATOM   1638 C CA  A THR B 1 61  ? 9.235   -5.002  -27.166 0.50  16.92 ? 61  THR B CA  1 
ATOM   1639 C CA  B THR B 1 61  ? 9.215   -4.985  -27.197 0.50  19.01 ? 61  THR B CA  1 
ATOM   1640 C C   . THR B 1 61  ? 9.597   -6.443  -27.389 1.00  19.42 ? 61  THR B C   1 
ATOM   1641 O O   . THR B 1 61  ? 10.513  -6.777  -28.140 1.00  17.62 ? 61  THR B O   1 
ATOM   1642 C CB  A THR B 1 61  ? 8.151   -4.648  -28.163 0.50  16.70 ? 61  THR B CB  1 
ATOM   1643 C CB  B THR B 1 61  ? 8.154   -4.587  -28.249 0.50  21.82 ? 61  THR B CB  1 
ATOM   1644 O OG1 A THR B 1 61  ? 8.645   -4.883  -29.491 0.50  16.43 ? 61  THR B OG1 1 
ATOM   1645 O OG1 B THR B 1 61  ? 6.878   -5.175  -27.948 0.50  25.10 ? 61  THR B OG1 1 
ATOM   1646 C CG2 A THR B 1 61  ? 7.766   -3.174  -28.009 0.50  15.25 ? 61  THR B CG2 1 
ATOM   1647 C CG2 B THR B 1 61  ? 8.597   -5.025  -29.619 0.50  21.48 ? 61  THR B CG2 1 
ATOM   1648 N N   . GLU B 1 62  ? 8.883   -7.337  -26.707 1.00  15.75 ? 62  GLU B N   1 
ATOM   1649 C CA  . GLU B 1 62  ? 9.079   -8.787  -26.860 1.00  16.52 ? 62  GLU B CA  1 
ATOM   1650 C C   . GLU B 1 62  ? 7.727   -9.478  -26.941 1.00  15.15 ? 62  GLU B C   1 
ATOM   1651 O O   . GLU B 1 62  ? 6.796   -9.103  -26.228 1.00  16.05 ? 62  GLU B O   1 
ATOM   1652 C CB  . GLU B 1 62  ? 9.758   -9.382  -25.605 1.00  19.09 ? 62  GLU B CB  1 
ATOM   1653 C CG  . GLU B 1 62  ? 11.059  -8.750  -25.204 1.00  19.89 ? 62  GLU B CG  1 
ATOM   1654 C CD  . GLU B 1 62  ? 11.574  -9.426  -23.939 1.00  20.64 ? 62  GLU B CD  1 
ATOM   1655 O OE1 . GLU B 1 62  ? 12.139  -10.523 -24.064 1.00  19.42 ? 62  GLU B OE1 1 
ATOM   1656 O OE2 . GLU B 1 62  ? 11.397  -8.866  -22.821 1.00  20.48 ? 62  GLU B OE2 1 
ATOM   1657 N N   . ILE B 1 63  ? 7.628   -10.505 -27.787 1.00  15.03 ? 63  ILE B N   1 
ATOM   1658 C CA  . ILE B 1 63  ? 6.380   -11.310 -27.868 1.00  15.74 ? 63  ILE B CA  1 
ATOM   1659 C C   . ILE B 1 63  ? 6.787   -12.740 -28.186 1.00  15.33 ? 63  ILE B C   1 
ATOM   1660 O O   . ILE B 1 63  ? 7.830   -12.949 -28.870 1.00  15.61 ? 63  ILE B O   1 
ATOM   1661 C CB  . ILE B 1 63  ? 5.413   -10.763 -28.992 1.00  16.93 ? 63  ILE B CB  1 
ATOM   1662 C CG1 . ILE B 1 63  ? 4.066   -11.528 -29.110 1.00  18.83 ? 63  ILE B CG1 1 
ATOM   1663 C CG2 . ILE B 1 63  ? 6.048   -10.826 -30.329 1.00  17.38 ? 63  ILE B CG2 1 
ATOM   1664 C CD1 . ILE B 1 63  ? 3.000   -11.094 -28.194 1.00  21.53 ? 63  ILE B CD1 1 
ATOM   1665 N N   . ASN B 1 64  ? 5.992   -13.714 -27.724 1.00  14.97 ? 64  ASN B N   1 
ATOM   1666 C CA  . ASN B 1 64  ? 6.166   -15.063 -28.246 1.00  13.75 ? 64  ASN B CA  1 
ATOM   1667 C C   . ASN B 1 64  ? 4.808   -15.650 -28.559 1.00  14.13 ? 64  ASN B C   1 
ATOM   1668 O O   . ASN B 1 64  ? 3.772   -15.226 -28.033 1.00  14.23 ? 64  ASN B O   1 
ATOM   1669 C CB  . ASN B 1 64  ? 6.922   -15.977 -27.255 1.00  15.08 ? 64  ASN B CB  1 
ATOM   1670 C CG  . ASN B 1 64  ? 6.007   -16.516 -26.182 1.00  14.20 ? 64  ASN B CG  1 
ATOM   1671 O OD1 . ASN B 1 64  ? 5.554   -17.682 -26.236 1.00  17.32 ? 64  ASN B OD1 1 
ATOM   1672 N ND2 . ASN B 1 64  ? 5.696   -15.683 -25.218 1.00  13.45 ? 64  ASN B ND2 1 
ATOM   1673 N N   . PHE B 1 65  ? 4.848   -16.614 -29.473 1.00  14.02 ? 65  PHE B N   1 
ATOM   1674 C CA  . PHE B 1 65  ? 3.620   -17.250 -29.926 1.00  14.68 ? 65  PHE B CA  1 
ATOM   1675 C C   . PHE B 1 65  ? 3.981   -18.542 -30.633 1.00  17.27 ? 65  PHE B C   1 
ATOM   1676 O O   . PHE B 1 65  ? 5.148   -18.831 -30.903 1.00  16.94 ? 65  PHE B O   1 
ATOM   1677 C CB  . PHE B 1 65  ? 2.834   -16.348 -30.899 1.00  16.23 ? 65  PHE B CB  1 
ATOM   1678 C CG  . PHE B 1 65  ? 3.605   -15.982 -32.162 1.00  16.65 ? 65  PHE B CG  1 
ATOM   1679 C CD1 . PHE B 1 65  ? 3.542   -16.770 -33.284 1.00  17.61 ? 65  PHE B CD1 1 
ATOM   1680 C CD2 . PHE B 1 65  ? 4.353   -14.822 -32.205 1.00  17.87 ? 65  PHE B CD2 1 
ATOM   1681 C CE1 . PHE B 1 65  ? 4.244   -16.418 -34.432 1.00  17.52 ? 65  PHE B CE1 1 
ATOM   1682 C CE2 . PHE B 1 65  ? 5.039   -14.466 -33.362 1.00  17.96 ? 65  PHE B CE2 1 
ATOM   1683 C CZ  . PHE B 1 65  ? 4.992   -15.282 -34.471 1.00  18.68 ? 65  PHE B CZ  1 
ATOM   1684 N N   . LYS B 1 66  ? 2.952   -19.325 -30.931 1.00  17.25 ? 66  LYS B N   1 
ATOM   1685 C CA  . LYS B 1 66  ? 3.138   -20.561 -31.728 1.00  18.79 ? 66  LYS B CA  1 
ATOM   1686 C C   . LYS B 1 66  ? 2.192   -20.521 -32.916 1.00  20.16 ? 66  LYS B C   1 
ATOM   1687 O O   . LYS B 1 66  ? 1.021   -20.150 -32.776 1.00  18.83 ? 66  LYS B O   1 
ATOM   1688 C CB  . LYS B 1 66  ? 2.843   -21.785 -30.862 1.00  20.63 ? 66  LYS B CB  1 
ATOM   1689 C CG  . LYS B 1 66  ? 3.087   -23.105 -31.585 1.00  21.77 ? 66  LYS B CG  1 
ATOM   1690 C CD  . LYS B 1 66  ? 2.730   -24.273 -30.706 0.90  24.74 ? 66  LYS B CD  1 
ATOM   1691 C CE  . LYS B 1 66  ? 2.936   -25.521 -31.519 0.80  26.65 ? 66  LYS B CE  1 
ATOM   1692 N NZ  . LYS B 1 66  ? 4.389   -25.772 -31.589 0.60  28.76 ? 66  LYS B NZ  1 
ATOM   1693 N N   . VAL B 1 67  ? 2.704   -20.866 -34.095 1.00  19.98 ? 67  VAL B N   1 
ATOM   1694 C CA  . VAL B 1 67  ? 1.844   -20.854 -35.281 1.00  20.72 ? 67  VAL B CA  1 
ATOM   1695 C C   . VAL B 1 67  ? 0.681   -21.810 -35.035 1.00  21.44 ? 67  VAL B C   1 
ATOM   1696 O O   . VAL B 1 67  ? 0.870   -22.937 -34.550 1.00  23.26 ? 67  VAL B O   1 
ATOM   1697 C CB  . VAL B 1 67  ? 2.634   -21.257 -36.508 1.00  22.02 ? 67  VAL B CB  1 
ATOM   1698 C CG1 . VAL B 1 67  ? 1.704   -21.363 -37.721 1.00  21.66 ? 67  VAL B CG1 1 
ATOM   1699 C CG2 . VAL B 1 67  ? 3.726   -20.247 -36.751 1.00  21.43 ? 67  VAL B CG2 1 
ATOM   1700 N N   . GLY B 1 68  ? -0.525  -21.359 -35.335 1.00  20.70 ? 68  GLY B N   1 
ATOM   1701 C CA  . GLY B 1 68  ? -1.702  -22.245 -35.192 1.00  22.70 ? 68  GLY B CA  1 
ATOM   1702 C C   . GLY B 1 68  ? -2.459  -22.203 -33.869 1.00  24.91 ? 68  GLY B C   1 
ATOM   1703 O O   . GLY B 1 68  ? -3.538  -22.817 -33.723 1.00  24.02 ? 68  GLY B O   1 
ATOM   1704 N N   . GLU B 1 69  ? -1.886  -21.488 -32.893 1.00  22.34 ? 69  GLU B N   1 
ATOM   1705 C CA  . GLU B 1 69  ? -2.520  -21.339 -31.583 1.00  22.71 ? 69  GLU B CA  1 
ATOM   1706 C C   . GLU B 1 69  ? -2.857  -19.877 -31.313 1.00  21.77 ? 69  GLU B C   1 
ATOM   1707 O O   . GLU B 1 69  ? -1.986  -19.036 -31.421 1.00  19.94 ? 69  GLU B O   1 
ATOM   1708 C CB  . GLU B 1 69  ? -1.569  -21.832 -30.484 1.00  24.92 ? 69  GLU B CB  1 
ATOM   1709 C CG  . GLU B 1 69  ? -1.362  -23.303 -30.535 1.00  27.47 ? 69  GLU B CG  1 
ATOM   1710 C CD  . GLU B 1 69  ? -0.540  -23.853 -29.376 0.90  28.64 ? 69  GLU B CD  1 
ATOM   1711 O OE1 . GLU B 1 69  ? -0.079  -23.077 -28.502 0.90  28.87 ? 69  GLU B OE1 1 
ATOM   1712 O OE2 . GLU B 1 69  ? -0.347  -25.090 -29.355 0.80  32.57 ? 69  GLU B OE2 1 
ATOM   1713 N N   . GLU B 1 70  ? -4.099  -19.563 -30.964 1.00  19.71 ? 70  GLU B N   1 
ATOM   1714 C CA  . GLU B 1 70  ? -4.463  -18.191 -30.676 1.00  20.95 ? 70  GLU B CA  1 
ATOM   1715 C C   . GLU B 1 70  ? -3.640  -17.652 -29.526 1.00  19.00 ? 70  GLU B C   1 
ATOM   1716 O O   . GLU B 1 70  ? -3.317  -18.356 -28.565 1.00  19.33 ? 70  GLU B O   1 
ATOM   1717 C CB  . GLU B 1 70  ? -5.945  -18.076 -30.315 1.00  21.22 ? 70  GLU B CB  1 
ATOM   1718 C CG  . GLU B 1 70  ? -6.471  -16.668 -30.030 0.80  24.44 ? 70  GLU B CG  1 
ATOM   1719 C CD  . GLU B 1 70  ? -7.993  -16.639 -30.032 0.70  25.58 ? 70  GLU B CD  1 
ATOM   1720 O OE1 . GLU B 1 70  ? -8.585  -17.569 -30.615 0.50  27.02 ? 70  GLU B OE1 1 
ATOM   1721 O OE2 . GLU B 1 70  ? -8.582  -15.702 -29.465 0.50  27.35 ? 70  GLU B OE2 1 
ATOM   1722 N N   . PHE B 1 71  ? -3.286  -16.383 -29.638 1.00  17.61 ? 71  PHE B N   1 
ATOM   1723 C CA  . PHE B 1 71  ? -2.517  -15.731 -28.583 1.00  16.75 ? 71  PHE B CA  1 
ATOM   1724 C C   . PHE B 1 71  ? -2.973  -14.290 -28.474 1.00  17.46 ? 71  PHE B C   1 
ATOM   1725 O O   . PHE B 1 71  ? -3.824  -13.842 -29.238 1.00  17.27 ? 71  PHE B O   1 
ATOM   1726 C CB  . PHE B 1 71  ? -1.002  -15.827 -28.885 1.00  15.71 ? 71  PHE B CB  1 
ATOM   1727 C CG  . PHE B 1 71  ? -0.551  -15.109 -30.140 1.00  17.00 ? 71  PHE B CG  1 
ATOM   1728 C CD1 . PHE B 1 71  ? -0.698  -15.721 -31.377 1.00  18.08 ? 71  PHE B CD1 1 
ATOM   1729 C CD2 . PHE B 1 71  ? 0.112   -13.860 -30.060 1.00  16.00 ? 71  PHE B CD2 1 
ATOM   1730 C CE1 . PHE B 1 71  ? -0.237  -15.113 -32.525 1.00  17.26 ? 71  PHE B CE1 1 
ATOM   1731 C CE2 . PHE B 1 71  ? 0.592   -13.258 -31.219 1.00  15.83 ? 71  PHE B CE2 1 
ATOM   1732 C CZ  . PHE B 1 71  ? 0.410   -13.881 -32.457 1.00  17.27 ? 71  PHE B CZ  1 
ATOM   1733 N N   . GLU B 1 72  ? -2.423  -13.538 -27.537 1.00  15.71 ? 72  GLU B N   1 
ATOM   1734 C CA  . GLU B 1 72  ? -2.776  -12.123 -27.415 1.00  16.15 ? 72  GLU B CA  1 
ATOM   1735 C C   . GLU B 1 72  ? -1.528  -11.283 -27.636 1.00  15.32 ? 72  GLU B C   1 
ATOM   1736 O O   . GLU B 1 72  ? -0.413  -11.677 -27.255 1.00  14.81 ? 72  GLU B O   1 
ATOM   1737 C CB  . GLU B 1 72  ? -3.408  -11.818 -26.024 1.00  16.98 ? 72  GLU B CB  1 
ATOM   1738 C CG  . GLU B 1 72  ? -3.697  -10.326 -25.791 1.00  19.79 ? 72  GLU B CG  1 
ATOM   1739 C CD  . GLU B 1 72  ? -4.635  -10.051 -24.621 1.00  21.62 ? 72  GLU B CD  1 
ATOM   1740 O OE1 . GLU B 1 72  ? -5.313  -11.009 -24.203 1.00  25.02 ? 72  GLU B OE1 1 
ATOM   1741 O OE2 . GLU B 1 72  ? -4.697  -8.886  -24.172 1.00  23.78 ? 72  GLU B OE2 1 
ATOM   1742 N N   . GLU B 1 73  ? -1.713  -10.133 -28.297 1.00  15.49 ? 73  GLU B N   1 
ATOM   1743 C CA  . GLU B 1 73  ? -0.603  -9.192  -28.511 1.00  16.50 ? 73  GLU B CA  1 
ATOM   1744 C C   . GLU B 1 73  ? -1.203  -7.805  -28.643 1.00  18.02 ? 73  GLU B C   1 
ATOM   1745 O O   . GLU B 1 73  ? -2.349  -7.608  -28.239 1.00  20.65 ? 73  GLU B O   1 
ATOM   1746 C CB  . GLU B 1 73  ? 0.244   -9.584  -29.724 1.00  17.33 ? 73  GLU B CB  1 
ATOM   1747 C CG  . GLU B 1 73  ? -0.486  -9.537  -31.033 1.00  19.49 ? 73  GLU B CG  1 
ATOM   1748 C CD  . GLU B 1 73  ? 0.407   -9.843  -32.233 1.00  19.90 ? 73  GLU B CD  1 
ATOM   1749 O OE1 . GLU B 1 73  ? 1.649   -9.713  -32.167 1.00  21.77 ? 73  GLU B OE1 1 
ATOM   1750 O OE2 . GLU B 1 73  ? -0.157  -10.217 -33.264 1.00  21.05 ? 73  GLU B OE2 1 
ATOM   1751 N N   . GLN B 1 74  ? -0.440  -6.833  -29.111 1.00  18.00 ? 74  GLN B N   1 
ATOM   1752 C CA  . GLN B 1 74  ? -1.008  -5.487  -29.327 1.00  21.45 ? 74  GLN B CA  1 
ATOM   1753 C C   . GLN B 1 74  ? -0.926  -5.145  -30.772 1.00  20.92 ? 74  GLN B C   1 
ATOM   1754 O O   . GLN B 1 74  ? -0.057  -5.626  -31.461 1.00  21.90 ? 74  GLN B O   1 
ATOM   1755 C CB  . GLN B 1 74  ? -0.252  -4.455  -28.481 1.00  25.61 ? 74  GLN B CB  1 
ATOM   1756 C CG  . GLN B 1 74  ? -0.450  -4.728  -26.967 1.00  29.65 ? 74  GLN B CG  1 
ATOM   1757 C CD  . GLN B 1 74  ? 0.024   -3.606  -26.097 1.00  32.25 ? 74  GLN B CD  1 
ATOM   1758 O OE1 . GLN B 1 74  ? 1.061   -3.003  -26.361 0.70  33.87 ? 74  GLN B OE1 1 
ATOM   1759 N NE2 . GLN B 1 74  ? -0.723  -3.327  -25.031 0.90  34.34 ? 74  GLN B NE2 1 
ATOM   1760 N N   . THR B 1 75  ? -1.849  -4.319  -31.240 1.00  21.36 ? 75  THR B N   1 
ATOM   1761 C CA  . THR B 1 75  ? -1.732  -3.746  -32.581 1.00  21.77 ? 75  THR B CA  1 
ATOM   1762 C C   . THR B 1 75  ? -0.500  -2.858  -32.642 1.00  24.82 ? 75  THR B C   1 
ATOM   1763 O O   . THR B 1 75  ? 0.096   -2.543  -31.619 1.00  23.31 ? 75  THR B O   1 
ATOM   1764 C CB  . THR B 1 75  ? -2.986  -2.925  -32.943 1.00  21.70 ? 75  THR B CB  1 
ATOM   1765 O OG1 . THR B 1 75  ? -3.131  -1.837  -32.020 1.00  24.32 ? 75  THR B OG1 1 
ATOM   1766 C CG2 . THR B 1 75  ? -4.244  -3.802  -32.920 1.00  22.40 ? 75  THR B CG2 1 
ATOM   1767 N N   . VAL B 1 76  ? -0.126  -2.408  -33.837 1.00  26.21 ? 76  VAL B N   1 
ATOM   1768 C CA  A VAL B 1 76  ? 1.084   -1.602  -33.943 0.40  27.59 ? 76  VAL B CA  1 
ATOM   1769 C CA  B VAL B 1 76  ? 1.070   -1.578  -33.974 0.50  28.12 ? 76  VAL B CA  1 
ATOM   1770 C C   . VAL B 1 76  ? 0.966   -0.342  -33.080 0.80  28.68 ? 76  VAL B C   1 
ATOM   1771 O O   . VAL B 1 76  ? 1.936   0.096   -32.488 0.70  29.19 ? 76  VAL B O   1 
ATOM   1772 C CB  A VAL B 1 76  ? 1.447   -1.288  -35.418 0.30  27.40 ? 76  VAL B CB  1 
ATOM   1773 C CB  B VAL B 1 76  ? 1.320   -1.170  -35.452 0.50  28.70 ? 76  VAL B CB  1 
ATOM   1774 C CG1 A VAL B 1 76  ? 0.214   -0.970  -36.223 0.20  27.61 ? 76  VAL B CG1 1 
ATOM   1775 C CG1 B VAL B 1 76  ? 1.483   -2.401  -36.321 0.50  28.43 ? 76  VAL B CG1 1 
ATOM   1776 C CG2 A VAL B 1 76  ? 2.477   -0.172  -35.500 0.20  27.23 ? 76  VAL B CG2 1 
ATOM   1777 C CG2 B VAL B 1 76  ? 0.203   -0.320  -35.974 0.50  30.17 ? 76  VAL B CG2 1 
ATOM   1778 N N   . ASP B 1 77  ? -0.241  0.196   -32.970 1.00  29.39 ? 77  ASP B N   1 
ATOM   1779 C CA  . ASP B 1 77  ? -0.470  1.364   -32.127 1.00  31.59 ? 77  ASP B CA  1 
ATOM   1780 C C   . ASP B 1 77  ? -0.794  1.087   -30.650 1.00  31.94 ? 77  ASP B C   1 
ATOM   1781 O O   . ASP B 1 77  ? -1.100  2.000   -29.896 0.90  33.56 ? 77  ASP B O   1 
ATOM   1782 C CB  . ASP B 1 77  ? -1.566  2.228   -32.725 1.00  31.85 ? 77  ASP B CB  1 
ATOM   1783 C CG  . ASP B 1 77  ? -2.897  1.545   -32.716 1.00  33.86 ? 77  ASP B CG  1 
ATOM   1784 O OD1 . ASP B 1 77  ? -3.035  0.489   -33.393 1.00  31.58 ? 77  ASP B OD1 1 
ATOM   1785 O OD2 . ASP B 1 77  ? -3.799  2.053   -31.999 1.00  33.57 ? 77  ASP B OD2 1 
ATOM   1786 N N   . GLY B 1 78  ? -0.740  -0.169  -30.235 1.00  28.80 ? 78  GLY B N   1 
ATOM   1787 C CA  . GLY B 1 78  ? -0.798  -0.475  -28.807 1.00  28.22 ? 78  GLY B CA  1 
ATOM   1788 C C   . GLY B 1 78  ? -2.148  -0.885  -28.245 1.00  27.11 ? 78  GLY B C   1 
ATOM   1789 O O   . GLY B 1 78  ? -2.364  -0.788  -27.028 1.00  29.66 ? 78  GLY B O   1 
ATOM   1790 N N   . ARG B 1 79  ? -3.075  -1.314  -29.102 1.00  23.91 ? 79  ARG B N   1 
ATOM   1791 C CA  . ARG B 1 79  ? -4.373  -1.780  -28.617 1.00  23.80 ? 79  ARG B CA  1 
ATOM   1792 C C   . ARG B 1 79  ? -4.377  -3.302  -28.519 1.00  23.08 ? 79  ARG B C   1 
ATOM   1793 O O   . ARG B 1 79  ? -3.895  -3.987  -29.410 1.00  22.23 ? 79  ARG B O   1 
ATOM   1794 C CB  . ARG B 1 79  ? -5.505  -1.300  -29.532 1.00  26.05 ? 79  ARG B CB  1 
ATOM   1795 C CG  . ARG B 1 79  ? -5.827  0.196   -29.370 1.00  27.30 ? 79  ARG B CG  1 
ATOM   1796 C CD  . ARG B 1 79  ? -6.800  0.705   -30.482 1.00  27.28 ? 79  ARG B CD  1 
ATOM   1797 N NE  . ARG B 1 79  ? -6.097  0.594   -31.768 1.00  30.47 ? 79  ARG B NE  1 
ATOM   1798 C CZ  . ARG B 1 79  ? -6.575  -0.041  -32.826 1.00  30.76 ? 79  ARG B CZ  1 
ATOM   1799 N NH1 . ARG B 1 79  ? -7.794  -0.573  -32.784 1.00  31.50 ? 79  ARG B NH1 1 
ATOM   1800 N NH2 . ARG B 1 79  ? -5.839  -0.129  -33.932 1.00  31.12 ? 79  ARG B NH2 1 
ATOM   1801 N N   . PRO B 1 80  ? -4.899  -3.842  -27.412 1.00  20.90 ? 80  PRO B N   1 
ATOM   1802 C CA  . PRO B 1 80  ? -4.924  -5.291  -27.309 1.00  21.31 ? 80  PRO B CA  1 
ATOM   1803 C C   . PRO B 1 80  ? -5.712  -5.993  -28.400 1.00  19.70 ? 80  PRO B C   1 
ATOM   1804 O O   . PRO B 1 80  ? -6.857  -5.588  -28.712 1.00  21.01 ? 80  PRO B O   1 
ATOM   1805 C CB  . PRO B 1 80  ? -5.605  -5.517  -25.959 1.00  21.99 ? 80  PRO B CB  1 
ATOM   1806 C CG  . PRO B 1 80  ? -5.242  -4.258  -25.174 1.00  24.39 ? 80  PRO B CG  1 
ATOM   1807 C CD  . PRO B 1 80  ? -5.423  -3.177  -26.200 1.00  24.29 ? 80  PRO B CD  1 
ATOM   1808 N N   . CYS B 1 81  ? -5.161  -7.097  -28.908 1.00  19.24 ? 81  CYS B N   1 
ATOM   1809 C CA  . CYS B 1 81  ? -5.883  -7.925  -29.874 1.00  19.33 ? 81  CYS B CA  1 
ATOM   1810 C C   . CYS B 1 81  ? -5.637  -9.420  -29.642 1.00  18.42 ? 81  CYS B C   1 
ATOM   1811 O O   . CYS B 1 81  ? -4.647  -9.822  -28.995 1.00  19.90 ? 81  CYS B O   1 
ATOM   1812 C CB  . CYS B 1 81  ? -5.549  -7.532  -31.329 1.00  18.45 ? 81  CYS B CB  1 
ATOM   1813 S SG  . CYS B 1 81  ? -3.773  -7.731  -31.777 0.80  17.71 ? 81  CYS B SG  1 
ATOM   1814 N N   . LYS B 1 82  ? -6.580  -10.235 -30.134 1.00  19.93 ? 82  LYS B N   1 
ATOM   1815 C CA  . LYS B 1 82  ? -6.380  -11.654 -30.222 1.00  20.36 ? 82  LYS B CA  1 
ATOM   1816 C C   . LYS B 1 82  ? -5.846  -11.948 -31.626 1.00  18.99 ? 82  LYS B C   1 
ATOM   1817 O O   . LYS B 1 82  ? -6.394  -11.448 -32.636 1.00  24.16 ? 82  LYS B O   1 
ATOM   1818 C CB  . LYS B 1 82  ? -7.698  -12.396 -30.008 1.00  22.29 ? 82  LYS B CB  1 
ATOM   1819 C CG  . LYS B 1 82  ? -8.223  -12.287 -28.590 0.80  23.38 ? 82  LYS B CG  1 
ATOM   1820 C CD  . LYS B 1 82  ? -7.163  -12.677 -27.562 0.60  24.81 ? 82  LYS B CD  1 
ATOM   1821 C CE  . LYS B 1 82  ? -6.866  -14.158 -27.567 0.40  25.00 ? 82  LYS B CE  1 
ATOM   1822 N NZ  . LYS B 1 82  ? -6.282  -14.576 -26.239 0.30  25.45 ? 82  LYS B NZ  1 
ATOM   1823 N N   . SER B 1 83  ? -4.817  -12.796 -31.689 1.00  18.48 ? 83  SER B N   1 
ATOM   1824 C CA  . SER B 1 83  ? -4.115  -13.074 -32.928 1.00  17.79 ? 83  SER B CA  1 
ATOM   1825 C C   . SER B 1 83  ? -4.044  -14.553 -33.203 1.00  19.02 ? 83  SER B C   1 
ATOM   1826 O O   . SER B 1 83  ? -4.055  -15.391 -32.280 1.00  18.43 ? 83  SER B O   1 
ATOM   1827 C CB  . SER B 1 83  ? -2.676  -12.527 -32.855 1.00  20.07 ? 83  SER B CB  1 
ATOM   1828 O OG  . SER B 1 83  ? -2.688  -11.127 -32.872 1.00  19.99 ? 83  SER B OG  1 
ATOM   1829 N N   . LEU B 1 84  ? -3.954  -14.900 -34.485 1.00  17.85 ? 84  LEU B N   1 
ATOM   1830 C CA  . LEU B 1 84  ? -3.725  -16.272 -34.885 1.00  20.34 ? 84  LEU B CA  1 
ATOM   1831 C C   . LEU B 1 84  ? -2.916  -16.239 -36.144 1.00  20.52 ? 84  LEU B C   1 
ATOM   1832 O O   . LEU B 1 84  ? -3.322  -15.581 -37.126 1.00  21.47 ? 84  LEU B O   1 
ATOM   1833 C CB  . LEU B 1 84  ? -5.065  -16.987 -35.172 1.00  21.56 ? 84  LEU B CB  1 
ATOM   1834 C CG  . LEU B 1 84  ? -4.979  -18.435 -35.652 1.00  23.44 ? 84  LEU B CG  1 
ATOM   1835 C CD1 . LEU B 1 84  ? -4.297  -19.338 -34.658 1.00  23.46 ? 84  LEU B CD1 1 
ATOM   1836 C CD2 . LEU B 1 84  ? -6.398  -18.952 -35.919 1.00  22.14 ? 84  LEU B CD2 1 
ATOM   1837 N N   . VAL B 1 85  ? -1.748  -16.882 -36.094 1.00  18.64 ? 85  VAL B N   1 
ATOM   1838 C CA  . VAL B 1 85  ? -0.845  -16.966 -37.233 1.00  20.50 ? 85  VAL B CA  1 
ATOM   1839 C C   . VAL B 1 85  ? -1.033  -18.315 -37.921 1.00  21.70 ? 85  VAL B C   1 
ATOM   1840 O O   . VAL B 1 85  ? -1.162  -19.351 -37.252 1.00  23.70 ? 85  VAL B O   1 
ATOM   1841 C CB  . VAL B 1 85  ? 0.615   -16.830 -36.776 1.00  19.95 ? 85  VAL B CB  1 
ATOM   1842 C CG1 . VAL B 1 85  ? 1.554   -17.045 -37.948 1.00  20.84 ? 85  VAL B CG1 1 
ATOM   1843 C CG2 . VAL B 1 85  ? 0.853   -15.444 -36.124 1.00  20.40 ? 85  VAL B CG2 1 
ATOM   1844 N N   . LYS B 1 86  ? -1.054  -18.306 -39.254 1.00  22.17 ? 86  LYS B N   1 
ATOM   1845 C CA  . LYS B 1 86  ? -1.088  -19.547 -40.006 1.00  24.87 ? 86  LYS B CA  1 
ATOM   1846 C C   . LYS B 1 86  ? -0.029  -19.505 -41.071 1.00  25.16 ? 86  LYS B C   1 
ATOM   1847 O O   . LYS B 1 86  ? 0.324   -18.427 -41.538 1.00  22.51 ? 86  LYS B O   1 
ATOM   1848 C CB  . LYS B 1 86  ? -2.452  -19.717 -40.672 1.00  28.20 ? 86  LYS B CB  1 
ATOM   1849 C CG  . LYS B 1 86  ? -3.607  -19.657 -39.690 1.00  32.02 ? 86  LYS B CG  1 
ATOM   1850 C CD  . LYS B 1 86  ? -4.948  -19.820 -40.403 1.00  35.22 ? 86  LYS B CD  1 
ATOM   1851 C CE  . LYS B 1 86  ? -6.041  -20.165 -39.414 1.00  36.81 ? 86  LYS B CE  1 
ATOM   1852 N NZ  . LYS B 1 86  ? -7.363  -19.737 -39.958 1.00  40.18 ? 86  LYS B NZ  1 
ATOM   1853 N N   . TRP B 1 87  ? 0.486   -20.665 -41.456 1.00  24.90 ? 87  TRP B N   1 
ATOM   1854 C CA  . TRP B 1 87  ? 1.369   -20.734 -42.616 1.00  25.16 ? 87  TRP B CA  1 
ATOM   1855 C C   . TRP B 1 87  ? 0.526   -20.617 -43.894 1.00  26.69 ? 87  TRP B C   1 
ATOM   1856 O O   . TRP B 1 87  ? -0.371  -21.441 -44.123 1.00  27.07 ? 87  TRP B O   1 
ATOM   1857 C CB  . TRP B 1 87  ? 2.147   -22.044 -42.620 1.00  25.68 ? 87  TRP B CB  1 
ATOM   1858 C CG  . TRP B 1 87  ? 3.153   -22.220 -41.517 1.00  26.07 ? 87  TRP B CG  1 
ATOM   1859 C CD1 . TRP B 1 87  ? 3.110   -23.145 -40.500 1.00  25.46 ? 87  TRP B CD1 1 
ATOM   1860 C CD2 . TRP B 1 87  ? 4.366   -21.484 -41.333 1.00  24.83 ? 87  TRP B CD2 1 
ATOM   1861 N NE1 . TRP B 1 87  ? 4.212   -23.015 -39.695 1.00  25.38 ? 87  TRP B NE1 1 
ATOM   1862 C CE2 . TRP B 1 87  ? 4.994   -21.995 -40.179 1.00  26.35 ? 87  TRP B CE2 1 
ATOM   1863 C CE3 . TRP B 1 87  ? 4.969   -20.408 -42.019 1.00  25.27 ? 87  TRP B CE3 1 
ATOM   1864 C CZ2 . TRP B 1 87  ? 6.211   -21.480 -39.694 1.00  24.61 ? 87  TRP B CZ2 1 
ATOM   1865 C CZ3 . TRP B 1 87  ? 6.180   -19.891 -41.540 1.00  25.35 ? 87  TRP B CZ3 1 
ATOM   1866 C CH2 . TRP B 1 87  ? 6.797   -20.440 -40.405 1.00  25.68 ? 87  TRP B CH2 1 
ATOM   1867 N N   . GLU B 1 88  ? 0.793   -19.602 -44.714 1.00  26.56 ? 88  GLU B N   1 
ATOM   1868 C CA  . GLU B 1 88  ? 0.124   -19.494 -46.013 1.00  28.87 ? 88  GLU B CA  1 
ATOM   1869 C C   . GLU B 1 88  ? 0.931   -20.319 -46.995 0.90  30.55 ? 88  GLU B C   1 
ATOM   1870 O O   . GLU B 1 88  ? 0.404   -20.815 -48.017 0.80  32.56 ? 88  GLU B O   1 
ATOM   1871 C CB  . GLU B 1 88  ? 0.042   -18.036 -46.471 0.70  28.00 ? 88  GLU B CB  1 
ATOM   1872 C CG  . GLU B 1 88  ? -0.420  -17.877 -47.944 0.60  28.44 ? 88  GLU B CG  1 
ATOM   1873 C CD  . GLU B 1 88  ? -0.363  -16.446 -48.416 0.60  29.65 ? 88  GLU B CD  1 
ATOM   1874 O OE1 . GLU B 1 88  ? -1.116  -15.611 -47.875 0.50  31.06 ? 88  GLU B OE1 1 
ATOM   1875 O OE2 . GLU B 1 88  ? 0.431   -16.160 -49.334 0.50  30.87 ? 88  GLU B OE2 1 
ATOM   1876 N N   . SER B 1 89  ? 2.210   -20.462 -46.680 1.00  32.29 ? 89  SER B N   1 
ATOM   1877 C CA  . SER B 1 89  ? 3.123   -21.325 -47.391 1.00  34.07 ? 89  SER B CA  1 
ATOM   1878 C C   . SER B 1 89  ? 4.337   -21.587 -46.540 1.00  34.74 ? 89  SER B C   1 
ATOM   1879 O O   . SER B 1 89  ? 4.481   -21.051 -45.427 1.00  33.37 ? 89  SER B O   1 
ATOM   1880 C CB  . SER B 1 89  ? 3.579   -20.688 -48.710 1.00  35.13 ? 89  SER B CB  1 
ATOM   1881 O OG  . SER B 1 89  ? 4.617   -19.730 -48.477 1.00  34.45 ? 89  SER B OG  1 
ATOM   1882 N N   . GLU B 1 90  ? 5.243   -22.386 -47.080 1.00  35.71 ? 90  GLU B N   1 
ATOM   1883 C CA  . GLU B 1 90  ? 6.503   -22.694 -46.421 1.00  35.73 ? 90  GLU B CA  1 
ATOM   1884 C C   . GLU B 1 90  ? 7.267   -21.434 -45.946 1.00  34.20 ? 90  GLU B C   1 
ATOM   1885 O O   . GLU B 1 90  ? 7.868   -21.438 -44.862 1.00  33.50 ? 90  GLU B O   1 
ATOM   1886 C CB  . GLU B 1 90  ? 7.394   -23.522 -47.367 0.90  37.55 ? 90  GLU B CB  1 
ATOM   1887 C CG  . GLU B 1 90  ? 8.273   -24.532 -46.659 0.80  40.04 ? 90  GLU B CG  1 
ATOM   1888 C CD  . GLU B 1 90  ? 9.485   -24.927 -47.480 0.70  40.61 ? 90  GLU B CD  1 
ATOM   1889 O OE1 . GLU B 1 90  ? 9.515   -24.634 -48.699 0.60  41.08 ? 90  GLU B OE1 1 
ATOM   1890 O OE2 . GLU B 1 90  ? 10.421  -25.515 -46.898 0.60  41.67 ? 90  GLU B OE2 1 
ATOM   1891 N N   . ASN B 1 91  ? 7.243   -20.366 -46.744 1.00  33.21 ? 91  ASN B N   1 
ATOM   1892 C CA  . ASN B 1 91  ? 8.087   -19.209 -46.465 1.00  31.24 ? 91  ASN B CA  1 
ATOM   1893 C C   . ASN B 1 91  ? 7.303   -17.981 -46.021 1.00  28.35 ? 91  ASN B C   1 
ATOM   1894 O O   . ASN B 1 91  ? 7.860   -16.889 -45.974 1.00  25.73 ? 91  ASN B O   1 
ATOM   1895 C CB  . ASN B 1 91  ? 8.930   -18.843 -47.686 0.90  32.39 ? 91  ASN B CB  1 
ATOM   1896 C CG  . ASN B 1 91  ? 10.068  -19.819 -47.907 0.70  35.64 ? 91  ASN B CG  1 
ATOM   1897 O OD1 . ASN B 1 91  ? 11.020  -19.870 -47.129 0.60  35.32 ? 91  ASN B OD1 1 
ATOM   1898 N ND2 . ASN B 1 91  ? 9.964   -20.612 -48.958 0.60  35.26 ? 91  ASN B ND2 1 
ATOM   1899 N N   . LYS B 1 92  ? 6.025   -18.165 -45.705 1.00  25.36 ? 92  LYS B N   1 
ATOM   1900 C CA  . LYS B 1 92  ? 5.170   -17.022 -45.385 1.00  24.57 ? 92  LYS B CA  1 
ATOM   1901 C C   . LYS B 1 92  ? 4.123   -17.363 -44.349 1.00  24.40 ? 92  LYS B C   1 
ATOM   1902 O O   . LYS B 1 92  ? 3.355   -18.299 -44.510 1.00  24.07 ? 92  LYS B O   1 
ATOM   1903 C CB  . LYS B 1 92  ? 4.491   -16.472 -46.647 1.00  25.12 ? 92  LYS B CB  1 
ATOM   1904 C CG  . LYS B 1 92  ? 3.619   -15.267 -46.470 1.00  24.98 ? 92  LYS B CG  1 
ATOM   1905 C CD  . LYS B 1 92  ? 3.162   -14.828 -47.871 0.90  27.11 ? 92  LYS B CD  1 
ATOM   1906 C CE  . LYS B 1 92  ? 2.263   -13.637 -47.823 0.70  30.15 ? 92  LYS B CE  1 
ATOM   1907 N NZ  . LYS B 1 92  ? 1.628   -13.523 -49.188 0.60  29.69 ? 92  LYS B NZ  1 
ATOM   1908 N N   . MET B 1 93  ? 4.086   -16.561 -43.280 1.00  20.74 ? 93  MET B N   1 
ATOM   1909 C CA  . MET B 1 93  ? 3.076   -16.679 -42.261 1.00  22.23 ? 93  MET B CA  1 
ATOM   1910 C C   . MET B 1 93  ? 2.194   -15.447 -42.255 1.00  20.48 ? 93  MET B C   1 
ATOM   1911 O O   . MET B 1 93  ? 2.650   -14.324 -42.549 1.00  20.82 ? 93  MET B O   1 
ATOM   1912 C CB  . MET B 1 93  ? 3.738   -16.895 -40.907 1.00  23.17 ? 93  MET B CB  1 
ATOM   1913 C CG  . MET B 1 93  ? 4.359   -15.619 -40.331 1.00  23.91 ? 93  MET B CG  1 
ATOM   1914 S SD  . MET B 1 93  ? 5.263   -15.929 -38.792 1.00  25.86 ? 93  MET B SD  1 
ATOM   1915 C CE  . MET B 1 93  ? 6.801   -16.460 -39.457 1.00  22.00 ? 93  MET B CE  1 
ATOM   1916 N N   . VAL B 1 94  ? 0.921   -15.639 -41.951 1.00  20.73 ? 94  VAL B N   1 
ATOM   1917 C CA  . VAL B 1 94  ? -0.011  -14.540 -41.973 1.00  21.19 ? 94  VAL B CA  1 
ATOM   1918 C C   . VAL B 1 94  ? -0.795  -14.521 -40.676 1.00  21.03 ? 94  VAL B C   1 
ATOM   1919 O O   . VAL B 1 94  ? -1.295  -15.548 -40.226 1.00  21.74 ? 94  VAL B O   1 
ATOM   1920 C CB  . VAL B 1 94  ? -1.018  -14.676 -43.127 1.00  22.59 ? 94  VAL B CB  1 
ATOM   1921 C CG1 . VAL B 1 94  ? -2.079  -13.591 -43.022 1.00  26.04 ? 94  VAL B CG1 1 
ATOM   1922 C CG2 . VAL B 1 94  ? -0.285  -14.633 -44.470 1.00  24.72 ? 94  VAL B CG2 1 
ATOM   1923 N N   . CYS B 1 95  ? -0.899  -13.348 -40.063 1.00  20.59 ? 95  CYS B N   1 
ATOM   1924 C CA  . CYS B 1 95  ? -1.558  -13.201 -38.773 1.00  21.70 ? 95  CYS B CA  1 
ATOM   1925 C C   . CYS B 1 95  ? -2.823  -12.384 -38.903 1.00  23.70 ? 95  CYS B C   1 
ATOM   1926 O O   . CYS B 1 95  ? -2.790  -11.218 -39.310 1.00  22.96 ? 95  CYS B O   1 
ATOM   1927 C CB  . CYS B 1 95  ? -0.637  -12.470 -37.803 1.00  20.65 ? 95  CYS B CB  1 
ATOM   1928 S SG  . CYS B 1 95  ? -1.295  -12.373 -36.121 1.00  20.95 ? 95  CYS B SG  1 
ATOM   1929 N N   . GLU B 1 96  ? -3.948  -12.988 -38.513 1.00  24.01 ? 96  GLU B N   1 
ATOM   1930 C CA  . GLU B 1 96  ? -5.194  -12.247 -38.376 1.00  26.24 ? 96  GLU B CA  1 
ATOM   1931 C C   . GLU B 1 96  ? -5.369  -11.792 -36.932 1.00  23.65 ? 96  GLU B C   1 
ATOM   1932 O O   . GLU B 1 96  ? -5.004  -12.493 -35.979 1.00  23.63 ? 96  GLU B O   1 
ATOM   1933 C CB  . GLU B 1 96  ? -6.417  -13.069 -38.837 0.80  28.20 ? 96  GLU B CB  1 
ATOM   1934 C CG  . GLU B 1 96  ? -6.546  -14.481 -38.248 0.50  31.15 ? 96  GLU B CG  1 
ATOM   1935 C CD  . GLU B 1 96  ? -7.963  -15.082 -38.364 0.70  30.62 ? 96  GLU B CD  1 
ATOM   1936 O OE1 . GLU B 1 96  ? -8.426  -15.675 -37.373 0.60  34.06 ? 96  GLU B OE1 1 
ATOM   1937 O OE2 . GLU B 1 96  ? -8.612  -14.958 -39.432 0.60  34.39 ? 96  GLU B OE2 1 
ATOM   1938 N N   . GLN B 1 97  ? -5.913  -10.610 -36.785 1.00  21.98 ? 97  GLN B N   1 
ATOM   1939 C CA  . GLN B 1 97  ? -6.049  -9.961  -35.505 1.00  21.99 ? 97  GLN B CA  1 
ATOM   1940 C C   . GLN B 1 97  ? -7.479  -9.471  -35.316 1.00  24.14 ? 97  GLN B C   1 
ATOM   1941 O O   . GLN B 1 97  ? -8.123  -8.964  -36.248 1.00  22.59 ? 97  GLN B O   1 
ATOM   1942 C CB  . GLN B 1 97  ? -5.078  -8.767  -35.399 1.00  22.80 ? 97  GLN B CB  1 
ATOM   1943 C CG  . GLN B 1 97  ? -3.613  -9.129  -35.564 1.00  23.38 ? 97  GLN B CG  1 
ATOM   1944 C CD  . GLN B 1 97  ? -2.714  -7.935  -35.396 1.00  22.87 ? 97  GLN B CD  1 
ATOM   1945 O OE1 . GLN B 1 97  ? -2.994  -6.866  -35.938 1.00  25.96 ? 97  GLN B OE1 1 
ATOM   1946 N NE2 . GLN B 1 97  ? -1.625  -8.101  -34.655 1.00  25.46 ? 97  GLN B NE2 1 
ATOM   1947 N N   . LYS B 1 98  ? -7.979  -9.606  -34.088 1.00  21.19 ? 98  LYS B N   1 
ATOM   1948 C CA  . LYS B 1 98  ? -9.269  -9.054  -33.699 1.00  23.03 ? 98  LYS B CA  1 
ATOM   1949 C C   . LYS B 1 98  ? -9.138  -8.249  -32.418 1.00  21.49 ? 98  LYS B C   1 
ATOM   1950 O O   . LYS B 1 98  ? -8.615  -8.728  -31.422 1.00  23.07 ? 98  LYS B O   1 
ATOM   1951 C CB  . LYS B 1 98  ? -10.260 -10.191 -33.544 0.80  23.52 ? 98  LYS B CB  1 
ATOM   1952 C CG  . LYS B 1 98  ? -10.392 -11.015 -34.833 0.60  25.45 ? 98  LYS B CG  1 
ATOM   1953 C CD  . LYS B 1 98  ? -11.230 -12.272 -34.657 0.40  26.20 ? 98  LYS B CD  1 
ATOM   1954 C CE  . LYS B 1 98  ? -11.871 -12.693 -35.984 0.30  25.45 ? 98  LYS B CE  1 
ATOM   1955 N NZ  . LYS B 1 98  ? -12.931 -11.729 -36.424 0.20  26.59 ? 98  LYS B NZ  1 
ATOM   1956 N N   . LEU B 1 99  ? -9.571  -7.003  -32.434 1.00  24.09 ? 99  LEU B N   1 
ATOM   1957 C CA  . LEU B 1 99  ? -9.506  -6.153  -31.259 1.00  27.03 ? 99  LEU B CA  1 
ATOM   1958 C C   . LEU B 1 99  ? -10.297 -6.780  -30.163 1.00  27.93 ? 99  LEU B C   1 
ATOM   1959 O O   . LEU B 1 99  ? -11.395 -7.296  -30.395 1.00  29.06 ? 99  LEU B O   1 
ATOM   1960 C CB  . LEU B 1 99  ? -10.181 -4.819  -31.539 1.00  28.10 ? 99  LEU B CB  1 
ATOM   1961 C CG  . LEU B 1 99  ? -9.349  -3.864  -32.334 1.00  30.14 ? 99  LEU B CG  1 
ATOM   1962 C CD1 . LEU B 1 99  ? -10.207 -2.661  -32.729 1.00  31.58 ? 99  LEU B CD1 1 
ATOM   1963 C CD2 . LEU B 1 99  ? -8.153  -3.393  -31.506 1.00  29.55 ? 99  LEU B CD2 1 
ATOM   1964 N N   . LEU B 1 100 ? -9.779  -6.661  -28.952 1.00  29.25 ? 100 LEU B N   1 
ATOM   1965 C CA  . LEU B 1 100 ? -10.497 -7.150  -27.787 0.90  29.79 ? 100 LEU B CA  1 
ATOM   1966 C C   . LEU B 1 100 ? -11.612 -6.223  -27.354 0.80  30.34 ? 100 LEU B C   1 
ATOM   1967 O O   . LEU B 1 100 ? -12.642 -6.665  -26.822 0.80  31.38 ? 100 LEU B O   1 
ATOM   1968 C CB  . LEU B 1 100 ? -9.523  -7.366  -26.632 0.90  29.57 ? 100 LEU B CB  1 
ATOM   1969 C CG  . LEU B 1 100 ? -8.754  -8.664  -26.883 0.80  32.67 ? 100 LEU B CG  1 
ATOM   1970 C CD1 . LEU B 1 100 ? -7.700  -8.860  -25.818 0.80  32.14 ? 100 LEU B CD1 1 
ATOM   1971 C CD2 . LEU B 1 100 ? -9.714  -9.841  -26.927 0.80  32.46 ? 100 LEU B CD2 1 
ATOM   1972 N N   . LYS B 1 101 ? -11.400 -4.932  -27.535 0.70  30.21 ? 101 LYS B N   1 
ATOM   1973 C CA  . LYS B 1 101 ? -12.427 -3.986  -27.136 0.70  31.58 ? 101 LYS B CA  1 
ATOM   1974 C C   . LYS B 1 101 ? -12.583 -2.922  -28.186 0.70  30.94 ? 101 LYS B C   1 
ATOM   1975 O O   . LYS B 1 101 ? -11.600 -2.424  -28.728 0.60  31.16 ? 101 LYS B O   1 
ATOM   1976 C CB  . LYS B 1 101 ? -12.085 -3.367  -25.781 0.60  31.74 ? 101 LYS B CB  1 
ATOM   1977 C CG  . LYS B 1 101 ? -11.932 -4.402  -24.663 0.40  32.81 ? 101 LYS B CG  1 
ATOM   1978 C CD  . LYS B 1 101 ? -11.521 -3.788  -23.342 0.40  32.45 ? 101 LYS B CD  1 
ATOM   1979 C CE  . LYS B 1 101 ? -11.372 -4.859  -22.272 0.30  34.93 ? 101 LYS B CE  1 
ATOM   1980 N NZ  . LYS B 1 101 ? -12.634 -5.623  -22.078 0.30  31.09 ? 101 LYS B NZ  1 
ATOM   1981 N N   . GLY B 1 102 ? -13.836 -2.596  -28.493 0.70  31.75 ? 102 GLY B N   1 
ATOM   1982 C CA  . GLY B 1 102 ? -14.129 -1.483  -29.382 0.80  30.32 ? 102 GLY B CA  1 
ATOM   1983 C C   . GLY B 1 102 ? -13.925 -1.852  -30.839 0.80  29.38 ? 102 GLY B C   1 
ATOM   1984 O O   . GLY B 1 102 ? -13.826 -3.031  -31.204 0.80  29.80 ? 102 GLY B O   1 
ATOM   1985 N N   . GLU B 1 103 ? -13.837 -0.824  -31.658 0.70  29.37 ? 103 GLU B N   1 
ATOM   1986 C CA  . GLU B 1 103 ? -13.728 -0.983  -33.089 0.70  28.54 ? 103 GLU B CA  1 
ATOM   1987 C C   . GLU B 1 103 ? -12.520 -0.224  -33.603 0.80  28.18 ? 103 GLU B C   1 
ATOM   1988 O O   . GLU B 1 103 ? -11.952 0.645   -32.945 0.80  27.89 ? 103 GLU B O   1 
ATOM   1989 C CB  . GLU B 1 103 ? -14.995 -0.480  -33.794 0.60  28.27 ? 103 GLU B CB  1 
ATOM   1990 C CG  . GLU B 1 103 ? -16.296 -0.998  -33.178 0.40  27.86 ? 103 GLU B CG  1 
ATOM   1991 C CD  . GLU B 1 103 ? -16.527 -2.480  -33.447 0.30  26.49 ? 103 GLU B CD  1 
ATOM   1992 O OE1 . GLU B 1 103 ? -16.279 -2.928  -34.587 0.30  26.48 ? 103 GLU B OE1 1 
ATOM   1993 O OE2 . GLU B 1 103 ? -16.968 -3.202  -32.522 0.30  27.56 ? 103 GLU B OE2 1 
ATOM   1994 N N   . GLY B 1 104 ? -12.108 -0.590  -34.796 0.80  28.86 ? 104 GLY B N   1 
ATOM   1995 C CA  . GLY B 1 104 ? -10.942 0.034   -35.375 0.90  27.59 ? 104 GLY B CA  1 
ATOM   1996 C C   . GLY B 1 104 ? -10.737 -0.530  -36.746 0.90  29.01 ? 104 GLY B C   1 
ATOM   1997 O O   . GLY B 1 104 ? -11.498 -1.371  -37.209 0.90  29.04 ? 104 GLY B O   1 
ATOM   1998 N N   . PRO B 1 105 ? -9.676  -0.075  -37.414 1.00  30.44 ? 105 PRO B N   1 
ATOM   1999 C CA  . PRO B 1 105 ? -9.422  -0.574  -38.738 1.00  29.43 ? 105 PRO B CA  1 
ATOM   2000 C C   . PRO B 1 105 ? -9.078  -2.043  -38.594 1.00  27.72 ? 105 PRO B C   1 
ATOM   2001 O O   . PRO B 1 105 ? -8.605  -2.439  -37.529 1.00  29.34 ? 105 PRO B O   1 
ATOM   2002 C CB  . PRO B 1 105 ? -8.207  0.252   -39.196 1.00  31.13 ? 105 PRO B CB  1 
ATOM   2003 C CG  . PRO B 1 105 ? -7.542  0.666   -37.935 1.00  31.43 ? 105 PRO B CG  1 
ATOM   2004 C CD  . PRO B 1 105 ? -8.655  0.877   -36.947 1.00  30.90 ? 105 PRO B CD  1 
ATOM   2005 N N   . LYS B 1 106 ? -9.360  -2.834  -39.628 1.00  27.01 ? 106 LYS B N   1 
ATOM   2006 C CA  . LYS B 1 106 ? -9.000  -4.234  -39.672 1.00  26.26 ? 106 LYS B CA  1 
ATOM   2007 C C   . LYS B 1 106 ? -7.489  -4.252  -39.767 1.00  25.06 ? 106 LYS B C   1 
ATOM   2008 O O   . LYS B 1 106 ? -6.929  -3.644  -40.667 1.00  26.03 ? 106 LYS B O   1 
ATOM   2009 C CB  . LYS B 1 106 ? -9.595  -4.915  -40.909 0.90  26.78 ? 106 LYS B CB  1 
ATOM   2010 C CG  . LYS B 1 106 ? -9.284  -6.396  -41.018 0.90  27.90 ? 106 LYS B CG  1 
ATOM   2011 C CD  . LYS B 1 106 ? -9.991  -7.032  -42.242 0.80  29.08 ? 106 LYS B CD  1 
ATOM   2012 C CE  . LYS B 1 106 ? -9.735  -8.536  -42.296 0.70  29.22 ? 106 LYS B CE  1 
ATOM   2013 N NZ  . LYS B 1 106 ? -9.824  -9.159  -40.942 0.40  30.78 ? 106 LYS B NZ  1 
ATOM   2014 N N   . THR B 1 107 ? -6.825  -4.950  -38.850 1.00  23.08 ? 107 THR B N   1 
ATOM   2015 C CA  . THR B 1 107 ? -5.348  -5.019  -38.899 1.00  20.87 ? 107 THR B CA  1 
ATOM   2016 C C   . THR B 1 107 ? -4.884  -6.437  -39.099 1.00  23.16 ? 107 THR B C   1 
ATOM   2017 O O   . THR B 1 107 ? -5.570  -7.422  -38.728 1.00  19.68 ? 107 THR B O   1 
ATOM   2018 C CB  . THR B 1 107 ? -4.645  -4.459  -37.645 1.00  23.49 ? 107 THR B CB  1 
ATOM   2019 O OG1 . THR B 1 107 ? -5.082  -5.214  -36.486 1.00  23.86 ? 107 THR B OG1 1 
ATOM   2020 C CG2 . THR B 1 107 ? -5.020  -3.011  -37.423 1.00  23.38 ? 107 THR B CG2 1 
ATOM   2021 N N   . SER B 1 108 ? -3.722  -6.557  -39.735 1.00  19.59 ? 108 SER B N   1 
ATOM   2022 C CA  . SER B 1 108 ? -3.064  -7.839  -39.900 1.00  19.94 ? 108 SER B CA  1 
ATOM   2023 C C   . SER B 1 108 ? -1.567  -7.630  -40.076 1.00  19.02 ? 108 SER B C   1 
ATOM   2024 O O   . SER B 1 108 ? -1.109  -6.499  -40.224 1.00  18.85 ? 108 SER B O   1 
ATOM   2025 C CB  . SER B 1 108 ? -3.619  -8.586  -41.101 1.00  22.14 ? 108 SER B CB  1 
ATOM   2026 O OG  . SER B 1 108 ? -3.070  -8.023  -42.292 0.80  22.10 ? 108 SER B OG  1 
ATOM   2027 N N   . TRP B 1 109 ? -0.797  -8.716  -39.997 1.00  17.77 ? 109 TRP B N   1 
ATOM   2028 C CA  . TRP B 1 109 ? 0.612   -8.646  -40.392 1.00  17.96 ? 109 TRP B CA  1 
ATOM   2029 C C   . TRP B 1 109 ? 0.979   -9.942  -41.012 1.00  19.88 ? 109 TRP B C   1 
ATOM   2030 O O   . TRP B 1 109 ? 0.356   -10.972 -40.786 1.00  19.69 ? 109 TRP B O   1 
ATOM   2031 C CB  . TRP B 1 109 ? 1.560   -8.286  -39.244 1.00  19.06 ? 109 TRP B CB  1 
ATOM   2032 C CG  . TRP B 1 109 ? 1.569   -9.210  -38.026 1.00  18.50 ? 109 TRP B CG  1 
ATOM   2033 C CD1 . TRP B 1 109 ? 0.950   -8.973  -36.830 1.00  18.68 ? 109 TRP B CD1 1 
ATOM   2034 C CD2 . TRP B 1 109 ? 2.292   -10.459 -37.872 1.00  17.50 ? 109 TRP B CD2 1 
ATOM   2035 N NE1 . TRP B 1 109 ? 1.224   -10.004 -35.946 1.00  18.13 ? 109 TRP B NE1 1 
ATOM   2036 C CE2 . TRP B 1 109 ? 2.060   -10.913 -36.552 1.00  17.37 ? 109 TRP B CE2 1 
ATOM   2037 C CE3 . TRP B 1 109 ? 3.099   -11.241 -38.723 1.00  17.64 ? 109 TRP B CE3 1 
ATOM   2038 C CZ2 . TRP B 1 109 ? 2.589   -12.121 -36.074 1.00  18.72 ? 109 TRP B CZ2 1 
ATOM   2039 C CZ3 . TRP B 1 109 ? 3.633   -12.422 -38.254 1.00  18.34 ? 109 TRP B CZ3 1 
ATOM   2040 C CH2 . TRP B 1 109 ? 3.385   -12.855 -36.923 1.00  18.88 ? 109 TRP B CH2 1 
ATOM   2041 N N   . THR B 1 110 ? 2.009   -9.870  -41.847 1.00  17.66 ? 110 THR B N   1 
ATOM   2042 C CA  A THR B 1 110 ? 2.545   -11.045 -42.491 0.50  19.42 ? 110 THR B CA  1 
ATOM   2043 C CA  B THR B 1 110 ? 2.550   -11.029 -42.519 0.50  19.68 ? 110 THR B CA  1 
ATOM   2044 C C   . THR B 1 110 ? 4.065   -10.948 -42.484 1.00  17.77 ? 110 THR B C   1 
ATOM   2045 O O   . THR B 1 110 ? 4.641   -9.848  -42.531 1.00  17.90 ? 110 THR B O   1 
ATOM   2046 C CB  A THR B 1 110 ? 2.045   -11.171 -43.964 0.50  18.05 ? 110 THR B CB  1 
ATOM   2047 C CB  B THR B 1 110 ? 2.101   -11.053 -44.004 0.50  18.46 ? 110 THR B CB  1 
ATOM   2048 O OG1 A THR B 1 110 ? 2.815   -10.312 -44.804 0.50  20.37 ? 110 THR B OG1 1 
ATOM   2049 O OG1 B THR B 1 110 ? 0.688   -11.240 -44.081 0.50  21.59 ? 110 THR B OG1 1 
ATOM   2050 C CG2 A THR B 1 110 ? 0.585   -10.766 -44.091 0.50  20.89 ? 110 THR B CG2 1 
ATOM   2051 C CG2 B THR B 1 110 ? 2.773   -12.167 -44.753 0.50  21.29 ? 110 THR B CG2 1 
ATOM   2052 N N   . LEU B 1 111 ? 4.727   -12.102 -42.402 1.00  17.82 ? 111 LEU B N   1 
ATOM   2053 C CA  . LEU B 1 111 ? 6.185   -12.186 -42.516 1.00  18.33 ? 111 LEU B CA  1 
ATOM   2054 C C   . LEU B 1 111 ? 6.524   -13.221 -43.575 1.00  19.08 ? 111 LEU B C   1 
ATOM   2055 O O   . LEU B 1 111 ? 6.018   -14.363 -43.551 1.00  20.17 ? 111 LEU B O   1 
ATOM   2056 C CB  . LEU B 1 111 ? 6.849   -12.620 -41.200 1.00  19.01 ? 111 LEU B CB  1 
ATOM   2057 C CG  . LEU B 1 111 ? 6.862   -11.620 -40.063 1.00  19.48 ? 111 LEU B CG  1 
ATOM   2058 C CD1 . LEU B 1 111 ? 7.498   -12.307 -38.837 1.00  21.55 ? 111 LEU B CD1 1 
ATOM   2059 C CD2 . LEU B 1 111 ? 7.634   -10.373 -40.446 1.00  19.78 ? 111 LEU B CD2 1 
ATOM   2060 N N   . GLU B 1 112 ? 7.398   -12.833 -44.483 1.00  19.74 ? 112 GLU B N   1 
ATOM   2061 C CA  . GLU B 1 112 ? 7.782   -13.736 -45.603 1.00  20.46 ? 112 GLU B CA  1 
ATOM   2062 C C   . GLU B 1 112 ? 9.290   -13.734 -45.758 1.00  24.07 ? 112 GLU B C   1 
ATOM   2063 O O   . GLU B 1 112 ? 9.927   -12.691 -45.668 1.00  23.85 ? 112 GLU B O   1 
ATOM   2064 C CB  . GLU B 1 112 ? 7.181   -13.223 -46.932 1.00  24.13 ? 112 GLU B CB  1 
ATOM   2065 C CG  . GLU B 1 112 ? 7.540   -14.146 -48.086 1.00  26.23 ? 112 GLU B CG  1 
ATOM   2066 C CD  . GLU B 1 112 ? 6.864   -13.794 -49.395 1.00  27.82 ? 112 GLU B CD  1 
ATOM   2067 O OE1 . GLU B 1 112 ? 6.156   -12.783 -49.452 0.90  31.73 ? 112 GLU B OE1 1 
ATOM   2068 O OE2 . GLU B 1 112 ? 7.045   -14.551 -50.373 0.80  31.96 ? 112 GLU B OE2 1 
ATOM   2069 N N   . LEU B 1 113 ? 9.869   -14.904 -46.028 1.00  23.07 ? 113 LEU B N   1 
ATOM   2070 C CA  . LEU B 1 113 ? 11.293  -14.993 -46.350 1.00  25.94 ? 113 LEU B CA  1 
ATOM   2071 C C   . LEU B 1 113 ? 11.374  -15.163 -47.844 0.90  27.59 ? 113 LEU B C   1 
ATOM   2072 O O   . LEU B 1 113 ? 10.738  -16.058 -48.402 0.80  29.88 ? 113 LEU B O   1 
ATOM   2073 C CB  . LEU B 1 113 ? 11.903  -16.255 -45.750 0.90  27.12 ? 113 LEU B CB  1 
ATOM   2074 C CG  . LEU B 1 113 ? 12.286  -16.206 -44.297 0.90  27.12 ? 113 LEU B CG  1 
ATOM   2075 C CD1 . LEU B 1 113 ? 12.735  -17.618 -43.927 0.90  28.16 ? 113 LEU B CD1 1 
ATOM   2076 C CD2 . LEU B 1 113 ? 13.403  -15.195 -44.055 0.90  28.15 ? 113 LEU B CD2 1 
ATOM   2077 N N   . THR B 1 114 ? 12.141  -14.312 -48.496 1.00  29.12 ? 114 THR B N   1 
ATOM   2078 C CA  . THR B 1 114 ? 12.324  -14.457 -49.946 1.00  31.14 ? 114 THR B CA  1 
ATOM   2079 C C   . THR B 1 114 ? 13.552  -15.306 -50.260 1.00  33.09 ? 114 THR B C   1 
ATOM   2080 O O   . THR B 1 114 ? 14.321  -15.644 -49.379 1.00  33.08 ? 114 THR B O   1 
ATOM   2081 C CB  . THR B 1 114 ? 12.585  -13.120 -50.569 1.00  30.24 ? 114 THR B CB  1 
ATOM   2082 O OG1 . THR B 1 114 ? 13.886  -12.682 -50.164 1.00  30.50 ? 114 THR B OG1 1 
ATOM   2083 C CG2 . THR B 1 114 ? 11.535  -12.101 -50.089 1.00  30.37 ? 114 THR B CG2 1 
ATOM   2084 N N   . ASN B 1 115 ? 13.758  -15.619 -51.542 0.80  35.29 ? 115 ASN B N   1 
ATOM   2085 C CA  . ASN B 1 115 ? 14.926  -16.404 -51.939 0.70  35.69 ? 115 ASN B CA  1 
ATOM   2086 C C   . ASN B 1 115 ? 16.214  -15.578 -52.033 0.60  37.07 ? 115 ASN B C   1 
ATOM   2087 O O   . ASN B 1 115 ? 17.312  -16.125 -52.152 0.60  37.87 ? 115 ASN B O   1 
ATOM   2088 C CB  . ASN B 1 115 ? 14.658  -17.157 -53.250 0.50  36.71 ? 115 ASN B CB  1 
ATOM   2089 C CG  . ASN B 1 115 ? 15.367  -18.511 -53.304 0.40  37.41 ? 115 ASN B CG  1 
ATOM   2090 O OD1 . ASN B 1 115 ? 16.599  -18.592 -53.260 0.30  37.19 ? 115 ASN B OD1 1 
ATOM   2091 N ND2 . ASN B 1 115 ? 14.581  -19.584 -53.404 0.30  37.35 ? 115 ASN B ND2 1 
ATOM   2092 N N   . ASP B 1 116 ? 16.083  -14.260 -51.990 0.70  35.95 ? 116 ASP B N   1 
ATOM   2093 C CA  . ASP B 1 116 ? 17.252  -13.387 -51.979 0.70  35.73 ? 116 ASP B CA  1 
ATOM   2094 C C   . ASP B 1 116 ? 17.683  -13.008 -50.561 0.70  35.35 ? 116 ASP B C   1 
ATOM   2095 O O   . ASP B 1 116 ? 18.415  -12.045 -50.377 0.70  35.54 ? 116 ASP B O   1 
ATOM   2096 C CB  . ASP B 1 116 ? 16.987  -12.128 -52.818 0.50  35.98 ? 116 ASP B CB  1 
ATOM   2097 C CG  . ASP B 1 116 ? 16.579  -12.453 -54.243 0.30  35.90 ? 116 ASP B CG  1 
ATOM   2098 O OD1 . ASP B 1 116 ? 16.771  -13.622 -54.671 0.10  35.71 ? 116 ASP B OD1 1 
ATOM   2099 O OD2 . ASP B 1 116 ? 16.066  -11.543 -54.933 0.10  35.81 ? 116 ASP B OD2 1 
ATOM   2100 N N   . GLY B 1 117 ? 17.214  -13.764 -49.567 1.00  35.45 ? 117 GLY B N   1 
ATOM   2101 C CA  . GLY B 1 117 ? 17.602  -13.567 -48.156 1.00  32.67 ? 117 GLY B CA  1 
ATOM   2102 C C   . GLY B 1 117 ? 16.942  -12.387 -47.426 1.00  30.66 ? 117 GLY B C   1 
ATOM   2103 O O   . GLY B 1 117 ? 17.445  -11.916 -46.398 1.00  31.19 ? 117 GLY B O   1 
ATOM   2104 N N   . GLU B 1 118 ? 15.829  -11.899 -47.963 1.00  27.26 ? 118 GLU B N   1 
ATOM   2105 C CA  . GLU B 1 118 ? 15.129  -10.774 -47.315 1.00  26.01 ? 118 GLU B CA  1 
ATOM   2106 C C   . GLU B 1 118 ? 13.992  -11.292 -46.450 1.00  23.76 ? 118 GLU B C   1 
ATOM   2107 O O   . GLU B 1 118 ? 13.427  -12.351 -46.732 1.00  23.99 ? 118 GLU B O   1 
ATOM   2108 C CB  . GLU B 1 118 ? 14.590  -9.779  -48.359 1.00  27.07 ? 118 GLU B CB  1 
ATOM   2109 C CG  . GLU B 1 118 ? 15.714  -9.073  -49.133 1.00  28.58 ? 118 GLU B CG  1 
ATOM   2110 C CD  . GLU B 1 118 ? 15.234  -7.989  -50.098 0.90  29.29 ? 118 GLU B CD  1 
ATOM   2111 O OE1 . GLU B 1 118 ? 14.076  -8.024  -50.553 0.80  30.01 ? 118 GLU B OE1 1 
ATOM   2112 O OE2 . GLU B 1 118 ? 16.041  -7.081  -50.391 0.80  30.28 ? 118 GLU B OE2 1 
ATOM   2113 N N   . LEU B 1 119 ? 13.658  -10.512 -45.412 1.00  20.90 ? 119 LEU B N   1 
ATOM   2114 C CA  . LEU B 1 119 ? 12.467  -10.742 -44.595 1.00  19.96 ? 119 LEU B CA  1 
ATOM   2115 C C   . LEU B 1 119 ? 11.518  -9.573  -44.897 1.00  19.24 ? 119 LEU B C   1 
ATOM   2116 O O   . LEU B 1 119 ? 11.916  -8.427  -44.735 1.00  18.42 ? 119 LEU B O   1 
ATOM   2117 C CB  . LEU B 1 119 ? 12.847  -10.728 -43.115 1.00  19.83 ? 119 LEU B CB  1 
ATOM   2118 C CG  . LEU B 1 119 ? 11.621  -10.870 -42.199 1.00  18.82 ? 119 LEU B CG  1 
ATOM   2119 C CD1 . LEU B 1 119 ? 11.073  -12.333 -42.215 1.00  21.44 ? 119 LEU B CD1 1 
ATOM   2120 C CD2 . LEU B 1 119 ? 12.009  -10.492 -40.781 1.00  19.15 ? 119 LEU B CD2 1 
ATOM   2121 N N   . ILE B 1 120 ? 10.306  -9.876  -45.381 1.00  18.48 ? 120 ILE B N   1 
ATOM   2122 C CA  . ILE B 1 120 ? 9.350   -8.840  -45.718 1.00  18.97 ? 120 ILE B CA  1 
ATOM   2123 C C   . ILE B 1 120 ? 8.235   -8.894  -44.670 1.00  18.54 ? 120 ILE B C   1 
ATOM   2124 O O   . ILE B 1 120 ? 7.572   -9.914  -44.486 1.00  18.66 ? 120 ILE B O   1 
ATOM   2125 C CB  . ILE B 1 120 ? 8.701   -9.062  -47.106 1.00  20.75 ? 120 ILE B CB  1 
ATOM   2126 C CG1 . ILE B 1 120 ? 9.789   -9.243  -48.188 1.00  22.28 ? 120 ILE B CG1 1 
ATOM   2127 C CG2 . ILE B 1 120 ? 7.745   -7.903  -47.452 1.00  22.24 ? 120 ILE B CG2 1 
ATOM   2128 C CD1 . ILE B 1 120 ? 9.198   -9.658  -49.500 1.00  25.52 ? 120 ILE B CD1 1 
ATOM   2129 N N   . ASP B 1 121 ? 8.036   -7.778  -43.994 1.00  18.14 ? 121 ASP B N   1 
ATOM   2130 C CA  . ASP B 1 121 ? 7.007   -7.612  -42.956 1.00  17.68 ? 121 ASP B CA  1 
ATOM   2131 C C   . ASP B 1 121 ? 5.927   -6.711  -43.591 1.00  19.00 ? 121 ASP B C   1 
ATOM   2132 O O   . ASP B 1 121 ? 6.236   -5.584  -43.987 1.00  20.19 ? 121 ASP B O   1 
ATOM   2133 C CB  . ASP B 1 121 ? 7.704   -6.913  -41.786 1.00  20.88 ? 121 ASP B CB  1 
ATOM   2134 C CG  . ASP B 1 121 ? 6.787   -6.558  -40.673 1.00  22.89 ? 121 ASP B CG  1 
ATOM   2135 O OD1 . ASP B 1 121 ? 5.631   -7.013  -40.652 1.00  25.44 ? 121 ASP B OD1 1 
ATOM   2136 O OD2 . ASP B 1 121 ? 7.262   -5.812  -39.792 0.70  27.36 ? 121 ASP B OD2 1 
ATOM   2137 N N   . THR B 1 122 ? 4.703   -7.206  -43.721 1.00  18.09 ? 122 THR B N   1 
ATOM   2138 C CA  . THR B 1 122 ? 3.634   -6.380  -44.290 1.00  19.40 ? 122 THR B CA  1 
ATOM   2139 C C   . THR B 1 122 ? 2.647   -6.162  -43.158 1.00  20.81 ? 122 THR B C   1 
ATOM   2140 O O   . THR B 1 122 ? 2.294   -7.136  -42.462 1.00  22.80 ? 122 THR B O   1 
ATOM   2141 C CB  . THR B 1 122 ? 2.956   -7.085  -45.500 1.00  22.23 ? 122 THR B CB  1 
ATOM   2142 O OG1 . THR B 1 122 ? 3.962   -7.441  -46.469 1.00  23.20 ? 122 THR B OG1 1 
ATOM   2143 C CG2 . THR B 1 122 ? 1.974   -6.175  -46.185 1.00  24.50 ? 122 THR B CG2 1 
ATOM   2144 N N   . MET B 1 123 ? 2.264   -4.913  -42.916 1.00  17.25 ? 123 MET B N   1 
ATOM   2145 C CA  . MET B 1 123 ? 1.325   -4.593  -41.852 1.00  20.19 ? 123 MET B CA  1 
ATOM   2146 C C   . MET B 1 123 ? 0.195   -3.838  -42.513 1.00  18.58 ? 123 MET B C   1 
ATOM   2147 O O   . MET B 1 123 ? 0.439   -2.913  -43.291 1.00  20.46 ? 123 MET B O   1 
ATOM   2148 C CB  . MET B 1 123 ? 1.985   -3.728  -40.782 1.00  22.24 ? 123 MET B CB  1 
ATOM   2149 C CG  . MET B 1 123 ? 2.827   -4.567  -39.819 1.00  25.69 ? 123 MET B CG  1 
ATOM   2150 S SD  . MET B 1 123 ? 3.760   -3.597  -38.639 0.70  29.54 ? 123 MET B SD  1 
ATOM   2151 C CE  . MET B 1 123 ? 4.732   -2.855  -39.840 1.00  26.32 ? 123 MET B CE  1 
ATOM   2152 N N   . THR B 1 124 ? -1.040  -4.203  -42.184 1.00  19.39 ? 124 THR B N   1 
ATOM   2153 C CA  A THR B 1 124 ? -2.170  -3.562  -42.831 0.50  20.65 ? 124 THR B CA  1 
ATOM   2154 C CA  B THR B 1 124 ? -2.142  -3.542  -42.831 0.50  21.26 ? 124 THR B CA  1 
ATOM   2155 C C   . THR B 1 124 ? -3.073  -2.945  -41.817 1.00  21.61 ? 124 THR B C   1 
ATOM   2156 O O   . THR B 1 124 ? -3.154  -3.435  -40.694 1.00  21.89 ? 124 THR B O   1 
ATOM   2157 C CB  A THR B 1 124 ? -3.011  -4.542  -43.672 0.50  20.98 ? 124 THR B CB  1 
ATOM   2158 C CB  B THR B 1 124 ? -2.871  -4.504  -43.776 0.50  22.16 ? 124 THR B CB  1 
ATOM   2159 O OG1 A THR B 1 124 ? -3.752  -5.418  -42.807 0.50  21.48 ? 124 THR B OG1 1 
ATOM   2160 O OG1 B THR B 1 124 ? -1.915  -5.064  -44.683 0.50  23.94 ? 124 THR B OG1 1 
ATOM   2161 C CG2 A THR B 1 124 ? -2.136  -5.349  -44.599 0.50  22.09 ? 124 THR B CG2 1 
ATOM   2162 C CG2 B THR B 1 124 ? -3.953  -3.778  -44.566 0.50  24.38 ? 124 THR B CG2 1 
ATOM   2163 N N   . ALA B 1 125 ? -3.719  -1.861  -42.222 1.00  21.36 ? 125 ALA B N   1 
ATOM   2164 C CA  . ALA B 1 125 ? -4.765  -1.267  -41.396 1.00  22.03 ? 125 ALA B CA  1 
ATOM   2165 C C   . ALA B 1 125 ? -5.796  -0.755  -42.372 1.00  26.10 ? 125 ALA B C   1 
ATOM   2166 O O   . ALA B 1 125 ? -5.532  0.202   -43.127 1.00  23.34 ? 125 ALA B O   1 
ATOM   2167 C CB  . ALA B 1 125 ? -4.222  -0.162  -40.558 1.00  24.22 ? 125 ALA B CB  1 
ATOM   2168 N N   . ASP B 1 126 ? -6.953  -1.413  -42.385 1.00  25.28 ? 126 ASP B N   1 
ATOM   2169 C CA  . ASP B 1 126 ? -7.927  -1.225  -43.466 1.00  27.22 ? 126 ASP B CA  1 
ATOM   2170 C C   . ASP B 1 126 ? -7.262  -1.376  -44.840 1.00  27.20 ? 126 ASP B C   1 
ATOM   2171 O O   . ASP B 1 126 ? -6.779  -2.461  -45.174 1.00  27.51 ? 126 ASP B O   1 
ATOM   2172 C CB  . ASP B 1 126 ? -8.682  0.092   -43.292 1.00  28.74 ? 126 ASP B CB  1 
ATOM   2173 C CG  . ASP B 1 126 ? -9.762  -0.007  -42.217 0.90  29.59 ? 126 ASP B CG  1 
ATOM   2174 O OD1 . ASP B 1 126 ? -10.269 -1.140  -42.025 0.80  29.12 ? 126 ASP B OD1 1 
ATOM   2175 O OD2 . ASP B 1 126 ? -10.060 1.021   -41.554 0.70  30.73 ? 126 ASP B OD2 1 
ATOM   2176 N N   . ASP B 1 127 ? -7.235  -0.317  -45.648 0.90  26.79 ? 127 ASP B N   1 
ATOM   2177 C CA  . ASP B 1 127 ? -6.677  -0.455  -46.983 0.80  27.23 ? 127 ASP B CA  1 
ATOM   2178 C C   . ASP B 1 127 ? -5.233  0.014   -47.093 1.00  25.45 ? 127 ASP B C   1 
ATOM   2179 O O   . ASP B 1 127 ? -4.649  -0.105  -48.179 1.00  27.29 ? 127 ASP B O   1 
ATOM   2180 C CB  . ASP B 1 127 ? -7.541  0.287   -48.007 0.70  28.85 ? 127 ASP B CB  1 
ATOM   2181 C CG  . ASP B 1 127 ? -8.946  -0.262  -48.060 0.60  30.79 ? 127 ASP B CG  1 
ATOM   2182 O OD1 . ASP B 1 127 ? -9.088  -1.472  -48.332 0.60  31.39 ? 127 ASP B OD1 1 
ATOM   2183 O OD2 . ASP B 1 127 ? -9.897  0.505   -47.810 0.50  31.78 ? 127 ASP B OD2 1 
ATOM   2184 N N   . VAL B 1 128 ? -4.689  0.557   -45.999 1.00  24.44 ? 128 VAL B N   1 
ATOM   2185 C CA  . VAL B 1 128 ? -3.286  1.009   -45.978 1.00  22.31 ? 128 VAL B CA  1 
ATOM   2186 C C   . VAL B 1 128 ? -2.384  -0.198  -45.762 1.00  21.07 ? 128 VAL B C   1 
ATOM   2187 O O   . VAL B 1 128 ? -2.609  -0.981  -44.839 1.00  22.65 ? 128 VAL B O   1 
ATOM   2188 C CB  . VAL B 1 128 ? -3.020  2.078   -44.917 1.00  23.00 ? 128 VAL B CB  1 
ATOM   2189 C CG1 . VAL B 1 128 ? -1.510  2.376   -44.780 1.00  22.61 ? 128 VAL B CG1 1 
ATOM   2190 C CG2 . VAL B 1 128 ? -3.787  3.337   -45.248 1.00  25.29 ? 128 VAL B CG2 1 
ATOM   2191 N N   . VAL B 1 129 ? -1.376  -0.333  -46.618 1.00  21.28 ? 129 VAL B N   1 
ATOM   2192 C CA  . VAL B 1 129 ? -0.408  -1.415  -46.525 1.00  19.47 ? 129 VAL B CA  1 
ATOM   2193 C C   . VAL B 1 129 ? 0.964   -0.832  -46.304 1.00  21.25 ? 129 VAL B C   1 
ATOM   2194 O O   . VAL B 1 129 ? 1.466   -0.036  -47.104 1.00  18.68 ? 129 VAL B O   1 
ATOM   2195 C CB  . VAL B 1 129 ? -0.407  -2.254  -47.809 1.00  22.20 ? 129 VAL B CB  1 
ATOM   2196 C CG1 . VAL B 1 129 ? 0.608   -3.381  -47.699 1.00  23.00 ? 129 VAL B CG1 1 
ATOM   2197 C CG2 . VAL B 1 129 ? -1.838  -2.796  -48.089 1.00  23.40 ? 129 VAL B CG2 1 
ATOM   2198 N N   . CYS B 1 130 ? 1.573   -1.229  -45.193 1.00  17.40 ? 130 CYS B N   1 
ATOM   2199 C CA  . CYS B 1 130 ? 2.926   -0.830  -44.844 1.00  17.98 ? 130 CYS B CA  1 
ATOM   2200 C C   . CYS B 1 130 ? 3.831   -2.045  -45.105 1.00  15.58 ? 130 CYS B C   1 
ATOM   2201 O O   . CYS B 1 130 ? 3.508   -3.155  -44.712 1.00  18.52 ? 130 CYS B O   1 
ATOM   2202 C CB  . CYS B 1 130 ? 2.993   -0.356  -43.383 1.00  17.91 ? 130 CYS B CB  1 
ATOM   2203 S SG  . CYS B 1 130 ? 4.684   -0.278  -42.749 1.00  18.96 ? 130 CYS B SG  1 
ATOM   2204 N N   . THR B 1 131 ? 4.953   -1.838  -45.790 1.00  17.87 ? 131 THR B N   1 
ATOM   2205 C CA  . THR B 1 131 ? 5.880   -2.922  -46.026 1.00  16.27 ? 131 THR B CA  1 
ATOM   2206 C C   . THR B 1 131 ? 7.221   -2.494  -45.474 1.00  18.57 ? 131 THR B C   1 
ATOM   2207 O O   . THR B 1 131 ? 7.742   -1.423  -45.814 1.00  19.61 ? 131 THR B O   1 
ATOM   2208 C CB  . THR B 1 131 ? 6.024   -3.157  -47.548 1.00  18.25 ? 131 THR B CB  1 
ATOM   2209 O OG1 . THR B 1 131 ? 4.723   -3.456  -48.104 1.00  20.85 ? 131 THR B OG1 1 
ATOM   2210 C CG2 . THR B 1 131 ? 6.986   -4.317  -47.802 1.00  19.34 ? 131 THR B CG2 1 
ATOM   2211 N N   . LYS B 1 132 ? 7.897   -3.394  -44.636 1.00  17.44 ? 132 LYS B N   1 
ATOM   2212 C CA  . LYS B 1 132 ? 9.272   -3.129  -44.215 1.00  17.61 ? 132 LYS B CA  1 
ATOM   2213 C C   . LYS B 1 132 ? 10.002  -4.339  -44.680 1.00  19.63 ? 132 LYS B C   1 
ATOM   2214 O O   . LYS B 1 132 ? 9.611   -5.491  -44.530 1.00  19.50 ? 132 LYS B O   1 
ATOM   2215 C CB  . LYS B 1 132 ? 9.306   -3.001  -42.683 1.00  18.16 ? 132 LYS B CB  1 
ATOM   2216 C CG  . LYS B 1 132 ? 8.572   -1.772  -42.193 1.00  18.65 ? 132 LYS B CG  1 
ATOM   2217 C CD  . LYS B 1 132 ? 8.702   -1.683  -40.682 1.00  21.75 ? 132 LYS B CD  1 
ATOM   2218 C CE  . LYS B 1 132 ? 7.817   -0.547  -40.184 1.00  25.68 ? 132 LYS B CE  1 
ATOM   2219 N NZ  . LYS B 1 132 ? 8.157   -0.289  -38.776 1.00  29.40 ? 132 LYS B NZ  1 
ATOM   2220 N N   . VAL B 1 133 ? 11.284  -4.035  -45.140 1.00  16.29 ? 133 VAL B N   1 
ATOM   2221 C CA  . VAL B 1 133 ? 12.173  -5.123  -45.669 1.00  17.70 ? 133 VAL B CA  1 
ATOM   2222 C C   . VAL B 1 133 ? 13.432  -5.137  -44.839 1.00  17.02 ? 133 VAL B C   1 
ATOM   2223 O O   . VAL B 1 133 ? 14.028  -4.078  -44.568 1.00  18.16 ? 133 VAL B O   1 
ATOM   2224 C CB  . VAL B 1 133 ? 12.525  -4.860  -47.146 1.00  17.13 ? 133 VAL B CB  1 
ATOM   2225 C CG1 . VAL B 1 133 ? 13.333  -6.046  -47.723 1.00  19.73 ? 133 VAL B CG1 1 
ATOM   2226 C CG2 . VAL B 1 133 ? 11.259  -4.690  -47.943 1.00  19.14 ? 133 VAL B CG2 1 
ATOM   2227 N N   . PHE B 1 134 ? 13.820  -6.346  -44.409 1.00  17.88 ? 134 PHE B N   1 
ATOM   2228 C CA  . PHE B 1 134 ? 14.978  -6.514  -43.555 1.00  17.90 ? 134 PHE B CA  1 
ATOM   2229 C C   . PHE B 1 134 ? 15.939  -7.497  -44.209 1.00  19.61 ? 134 PHE B C   1 
ATOM   2230 O O   . PHE B 1 134 ? 15.547  -8.354  -45.027 1.00  20.98 ? 134 PHE B O   1 
ATOM   2231 C CB  . PHE B 1 134 ? 14.591  -7.116  -42.174 1.00  17.91 ? 134 PHE B CB  1 
ATOM   2232 C CG  . PHE B 1 134 ? 13.602  -6.271  -41.385 1.00  16.01 ? 134 PHE B CG  1 
ATOM   2233 C CD1 . PHE B 1 134 ? 12.256  -6.285  -41.687 1.00  17.27 ? 134 PHE B CD1 1 
ATOM   2234 C CD2 . PHE B 1 134 ? 14.046  -5.504  -40.336 1.00  15.74 ? 134 PHE B CD2 1 
ATOM   2235 C CE1 . PHE B 1 134 ? 11.395  -5.509  -40.933 1.00  16.87 ? 134 PHE B CE1 1 
ATOM   2236 C CE2 . PHE B 1 134 ? 13.192  -4.715  -39.602 1.00  15.77 ? 134 PHE B CE2 1 
ATOM   2237 C CZ  . PHE B 1 134 ? 11.846  -4.725  -39.919 1.00  17.69 ? 134 PHE B CZ  1 
ATOM   2238 N N   . VAL B 1 135 ? 17.199  -7.393  -43.819 1.00  21.11 ? 135 VAL B N   1 
ATOM   2239 C CA  . VAL B 1 135 ? 18.155  -8.442  -44.172 1.00  22.45 ? 135 VAL B CA  1 
ATOM   2240 C C   . VAL B 1 135 ? 18.877  -8.886  -42.912 1.00  22.78 ? 135 VAL B C   1 
ATOM   2241 O O   . VAL B 1 135 ? 18.892  -8.191  -41.907 1.00  20.98 ? 135 VAL B O   1 
ATOM   2242 C CB  . VAL B 1 135 ? 19.180  -7.958  -45.239 1.00  23.01 ? 135 VAL B CB  1 
ATOM   2243 C CG1 . VAL B 1 135 ? 18.442  -7.543  -46.497 1.00  24.79 ? 135 VAL B CG1 1 
ATOM   2244 C CG2 . VAL B 1 135 ? 19.996  -6.848  -44.658 1.00  23.27 ? 135 VAL B CG2 1 
ATOM   2245 N N   . ARG B 1 136 ? 19.536  -10.041 -42.976 1.00  24.27 ? 136 ARG B N   1 
ATOM   2246 C CA  . ARG B 1 136 ? 20.291  -10.469 -41.806 0.90  25.05 ? 136 ARG B CA  1 
ATOM   2247 C C   . ARG B 1 136 ? 21.537  -9.630  -41.617 0.80  25.89 ? 136 ARG B C   1 
ATOM   2248 O O   . ARG B 1 136 ? 22.231  -9.287  -42.595 0.80  27.26 ? 136 ARG B O   1 
ATOM   2249 C CB  . ARG B 1 136 ? 20.660  -11.943 -41.899 0.90  26.16 ? 136 ARG B CB  1 
ATOM   2250 C CG  . ARG B 1 136 ? 19.459  -12.840 -41.584 0.90  25.87 ? 136 ARG B CG  1 
ATOM   2251 C CD  . ARG B 1 136 ? 19.861  -14.217 -41.034 0.90  27.80 ? 136 ARG B CD  1 
ATOM   2252 N NE  . ARG B 1 136 ? 18.710  -15.109 -40.929 0.90  27.66 ? 136 ARG B NE  1 
ATOM   2253 C CZ  . ARG B 1 136 ? 18.148  -15.667 -41.990 0.90  26.70 ? 136 ARG B CZ  1 
ATOM   2254 N NH1 . ARG B 1 136 ? 18.641  -15.393 -43.200 0.90  27.05 ? 136 ARG B NH1 1 
ATOM   2255 N NH2 . ARG B 1 136 ? 17.102  -16.460 -41.853 0.90  27.14 ? 136 ARG B NH2 1 
ATOM   2256 N N   . GLU B 1 137 ? 21.803  -9.317  -40.356 1.00  25.33 ? 137 GLU B N   1 
ATOM   2257 C CA  . GLU B 1 137 ? 22.943  -8.531  -39.922 0.90  27.63 ? 137 GLU B CA  1 
ATOM   2258 C C   . GLU B 1 137 ? 24.247  -9.246  -40.179 0.60  28.54 ? 137 GLU B C   1 
ATOM   2259 O O   . GLU B 1 137 ? 24.260  -10.353 -40.704 0.50  26.78 ? 137 GLU B O   1 
ATOM   2260 C CB  . GLU B 1 137 ? 22.818  -8.226  -38.436 0.60  27.50 ? 137 GLU B CB  1 
ATOM   2261 C CG  . GLU B 1 137 ? 21.670  -7.300  -38.096 0.50  28.18 ? 137 GLU B CG  1 
ATOM   2262 C CD  . GLU B 1 137 ? 21.666  -6.920  -36.627 0.50  27.42 ? 137 GLU B CD  1 
ATOM   2263 O OE1 . GLU B 1 137 ? 22.355  -7.603  -35.837 0.40  29.55 ? 137 GLU B OE1 1 
ATOM   2264 O OE2 . GLU B 1 137 ? 20.994  -5.939  -36.261 0.40  28.63 ? 137 GLU B OE2 1 
ATOM   2265 O OXT . GLU B 1 137 ? 25.313  -8.714  -39.843 0.40  28.01 ? 137 GLU B OXT 1 
HETATM 2266 C CAF . LSR C 2 .   ? 10.703  -6.493  -11.804 1.00  27.64 ? 138 LSR A CAF 1 
HETATM 2267 C CAE . LSR C 2 .   ? 10.147  -7.662  -12.207 1.00  28.17 ? 138 LSR A CAE 1 
HETATM 2268 C CAD . LSR C 2 .   ? 9.932   -8.008  -13.511 1.00  29.43 ? 138 LSR A CAD 1 
HETATM 2269 C CAA . LSR C 2 .   ? 10.357  -7.049  -14.597 1.00  30.26 ? 138 LSR A CAA 1 
HETATM 2270 C CAC . LSR C 2 .   ? 9.325   -9.213  -13.785 1.00  29.30 ? 138 LSR A CAC 1 
HETATM 2271 C CAB . LSR C 2 .   ? 8.895   -9.664  -14.980 1.00  32.16 ? 138 LSR A CAB 1 
HETATM 2272 C CAK . LSR C 2 .   ? 8.268   -10.856 -15.206 1.00  32.38 ? 138 LSR A CAK 1 
HETATM 2273 C CAJ . LSR C 2 .   ? 7.178   -11.251 -14.514 1.00  33.71 ? 138 LSR A CAJ 1 
HETATM 2274 C CAI . LSR C 2 .   ? 6.618   -10.377 -13.431 1.00  34.12 ? 138 LSR A CAI 1 
HETATM 2275 C CAN . LSR C 2 .   ? 6.447   -12.572 -14.734 1.00  34.75 ? 138 LSR A CAN 1 
HETATM 2276 C CAO . LSR C 2 .   ? 6.610   -13.053 -16.168 1.00  34.21 ? 138 LSR A CAO 1 
HETATM 2277 C CAP . LSR C 2 .   ? 8.081   -13.021 -16.522 1.00  33.78 ? 138 LSR A CAP 1 
HETATM 2278 C CAL . LSR C 2 .   ? 8.797   -11.695 -16.349 1.00  33.92 ? 138 LSR A CAL 1 
HETATM 2279 C CAH . LSR C 2 .   ? 8.651   -10.883 -17.630 1.00  34.17 ? 138 LSR A CAH 1 
HETATM 2280 C CAM . LSR C 2 .   ? 10.263  -12.007 -16.167 1.00  34.51 ? 138 LSR A CAM 1 
HETATM 2281 C CAF . LSR D 2 .   ? 7.987   -1.065  -37.774 1.00  32.81 ? 138 LSR B CAF 1 
HETATM 2282 C CAE . LSR D 2 .   ? 7.516   -2.324  -37.778 1.00  35.44 ? 138 LSR B CAE 1 
HETATM 2283 C CAD . LSR D 2 .   ? 7.250   -3.042  -36.645 1.00  36.64 ? 138 LSR B CAD 1 
HETATM 2284 C CAA . LSR D 2 .   ? 7.472   -2.413  -35.303 1.00  36.74 ? 138 LSR B CAA 1 
HETATM 2285 C CAC . LSR D 2 .   ? 6.815   -4.326  -36.765 1.00  38.15 ? 138 LSR B CAC 1 
HETATM 2286 C CAB . LSR D 2 .   ? 6.727   -5.258  -35.789 1.00  39.17 ? 138 LSR B CAB 1 
HETATM 2287 C CAK . LSR D 2 .   ? 6.320   -6.531  -36.086 1.00  40.14 ? 138 LSR B CAK 1 
HETATM 2288 C CAJ . LSR D 2 .   ? 7.280   -7.445  -36.264 1.00  40.59 ? 138 LSR B CAJ 1 
HETATM 2289 C CAI . LSR D 2 .   ? 8.709   -7.030  -36.112 1.00  40.79 ? 138 LSR B CAI 1 
HETATM 2290 C CAN . LSR D 2 .   ? 6.989   -8.883  -36.617 1.00  41.10 ? 138 LSR B CAN 1 
HETATM 2291 C CAO . LSR D 2 .   ? 5.753   -9.343  -35.864 1.00  40.82 ? 138 LSR B CAO 1 
HETATM 2292 C CAP . LSR D 2 .   ? 4.568   -8.411  -36.128 1.00  41.25 ? 138 LSR B CAP 1 
HETATM 2293 C CAL . LSR D 2 .   ? 4.858   -6.905  -36.239 0.30  40.52 ? 138 LSR B CAL 1 
HETATM 2294 C CAH . LSR D 2 .   ? 4.060   -6.185  -35.155 0.30  40.80 ? 138 LSR B CAH 1 
HETATM 2295 C CAM . LSR D 2 .   ? 4.389   -6.465  -37.621 0.30  40.73 ? 138 LSR B CAM 1 
HETATM 2296 O O   A HOH E 3 .   ? 6.627   0.960   -15.143 0.25  19.36 ? 139 HOH A O   1 
HETATM 2297 O O   B HOH E 3 .   ? 5.071   1.167   -15.888 0.25  23.56 ? 139 HOH A O   1 
HETATM 2298 O O   . HOH E 3 .   ? 15.373  -9.648  -23.442 1.00  29.98 ? 140 HOH A O   1 
HETATM 2299 O O   . HOH E 3 .   ? 8.499   -26.701 -7.813  1.00  48.15 ? 141 HOH A O   1 
HETATM 2300 O O   . HOH E 3 .   ? 4.684   -23.722 -20.525 1.00  16.49 ? 142 HOH A O   1 
HETATM 2301 O O   . HOH E 3 .   ? 21.130  -18.516 -28.318 1.00  39.05 ? 143 HOH A O   1 
HETATM 2302 O O   A HOH E 3 .   ? -7.822  0.118   -7.834  0.50  27.56 ? 144 HOH A O   1 
HETATM 2303 O O   B HOH E 3 .   ? -7.710  -0.901  -6.815  0.50  41.42 ? 144 HOH A O   1 
HETATM 2304 O O   . HOH E 3 .   ? 5.988   -17.073 -6.691  1.00  20.67 ? 145 HOH A O   1 
HETATM 2305 O O   A HOH E 3 .   ? -1.027  -29.007 -16.929 0.50  29.90 ? 146 HOH A O   1 
HETATM 2306 O O   B HOH E 3 .   ? -1.921  -28.473 -16.561 0.50  20.75 ? 146 HOH A O   1 
HETATM 2307 O O   . HOH E 3 .   ? 3.301   -22.715 -24.228 1.00  17.92 ? 147 HOH A O   1 
HETATM 2308 O O   . HOH E 3 .   ? 11.909  -27.950 -17.001 0.50  25.88 ? 148 HOH A O   1 
HETATM 2309 O O   . HOH E 3 .   ? 25.110  -2.738  -6.036  1.00  41.66 ? 149 HOH A O   1 
HETATM 2310 O O   . HOH E 3 .   ? -6.173  -24.749 -15.169 1.00  47.97 ? 150 HOH A O   1 
HETATM 2311 O O   . HOH E 3 .   ? 9.926   -20.949 -5.353  1.00  43.54 ? 151 HOH A O   1 
HETATM 2312 O O   . HOH E 3 .   ? 25.854  -6.404  -3.622  1.00  39.41 ? 152 HOH A O   1 
HETATM 2313 O O   . HOH E 3 .   ? 18.986  -19.786 -18.293 1.00  38.19 ? 153 HOH A O   1 
HETATM 2314 O O   . HOH E 3 .   ? 1.209   -7.992  2.183   1.00  43.16 ? 154 HOH A O   1 
HETATM 2315 O O   . HOH E 3 .   ? 24.981  -10.451 -18.109 1.00  44.07 ? 155 HOH A O   1 
HETATM 2316 O O   . HOH E 3 .   ? 5.046   -31.068 -20.200 1.00  42.90 ? 156 HOH A O   1 
HETATM 2317 O O   . HOH E 3 .   ? -1.908  -27.146 -20.774 1.00  51.11 ? 157 HOH A O   1 
HETATM 2318 O O   . HOH E 3 .   ? 14.298  -5.021  -5.341  1.00  17.31 ? 158 HOH A O   1 
HETATM 2319 O O   . HOH E 3 .   ? -1.818  -16.840 -24.512 1.00  19.56 ? 159 HOH A O   1 
HETATM 2320 O O   . HOH E 3 .   ? 2.030   -24.025 -26.799 0.50  21.42 ? 160 HOH A O   1 
HETATM 2321 O O   . HOH E 3 .   ? -10.768 -14.033 -20.375 1.00  38.56 ? 161 HOH A O   1 
HETATM 2322 O O   . HOH E 3 .   ? 10.882  -4.081  0.895   1.00  23.58 ? 162 HOH A O   1 
HETATM 2323 O O   . HOH E 3 .   ? 27.619  -7.252  -12.308 1.00  25.10 ? 163 HOH A O   1 
HETATM 2324 O O   . HOH E 3 .   ? 15.367  -23.513 -14.801 1.00  25.81 ? 164 HOH A O   1 
HETATM 2325 O O   . HOH E 3 .   ? 22.610  -8.376  -19.767 1.00  50.11 ? 165 HOH A O   1 
HETATM 2326 O O   . HOH E 3 .   ? 9.098   -8.550  -2.071  1.00  26.08 ? 166 HOH A O   1 
HETATM 2327 O O   . HOH E 3 .   ? 15.408  -15.357 -16.333 1.00  24.41 ? 167 HOH A O   1 
HETATM 2328 O O   . HOH E 3 .   ? 29.701  -26.682 -16.893 1.00  57.64 ? 168 HOH A O   1 
HETATM 2329 O O   . HOH E 3 .   ? 11.656  -3.909  -8.370  1.00  29.18 ? 169 HOH A O   1 
HETATM 2330 O O   A HOH E 3 .   ? -7.305  -5.673  -12.156 0.50  15.33 ? 170 HOH A O   1 
HETATM 2331 O O   B HOH E 3 .   ? -7.508  -6.609  -11.571 0.50  24.70 ? 170 HOH A O   1 
HETATM 2332 O O   . HOH E 3 .   ? 28.046  -4.103  -20.488 1.00  47.38 ? 171 HOH A O   1 
HETATM 2333 O O   . HOH E 3 .   ? 14.227  -17.458 -27.574 1.00  23.13 ? 172 HOH A O   1 
HETATM 2334 O O   . HOH E 3 .   ? 25.534  -17.780 -9.715  1.00  46.72 ? 173 HOH A O   1 
HETATM 2335 O O   . HOH E 3 .   ? 9.422   -23.162 -6.053  1.00  46.94 ? 174 HOH A O   1 
HETATM 2336 O O   . HOH E 3 .   ? -3.797  -28.114 -19.921 1.00  45.61 ? 175 HOH A O   1 
HETATM 2337 O O   . HOH E 3 .   ? -9.621  -14.226 -18.104 1.00  41.53 ? 176 HOH A O   1 
HETATM 2338 O O   A HOH E 3 .   ? 1.850   0.174   -4.214  0.50  17.68 ? 177 HOH A O   1 
HETATM 2339 O O   B HOH E 3 .   ? 1.556   1.936   -5.535  0.50  40.14 ? 177 HOH A O   1 
HETATM 2340 O O   . HOH E 3 .   ? 24.618  -16.375 -11.497 1.00  32.71 ? 178 HOH A O   1 
HETATM 2341 O O   . HOH E 3 .   ? 10.493  -26.771 -12.103 1.00  54.87 ? 179 HOH A O   1 
HETATM 2342 O O   . HOH E 3 .   ? 9.254   -12.610 -12.844 0.40  19.24 ? 180 HOH A O   1 
HETATM 2343 O O   A HOH E 3 .   ? 3.332   -1.651  -10.401 0.50  18.00 ? 181 HOH A O   1 
HETATM 2344 O O   B HOH E 3 .   ? 2.704   -2.646  -10.711 0.50  25.44 ? 181 HOH A O   1 
HETATM 2345 O O   . HOH E 3 .   ? 13.301  5.305   -17.948 1.00  59.11 ? 182 HOH A O   1 
HETATM 2346 O O   . HOH E 3 .   ? 18.658  -5.374  -4.868  1.00  20.59 ? 183 HOH A O   1 
HETATM 2347 O O   . HOH E 3 .   ? 12.905  4.493   -15.774 0.50  29.69 ? 184 HOH A O   1 
HETATM 2348 O O   . HOH E 3 .   ? -1.831  -27.919 -4.219  1.00  48.00 ? 185 HOH A O   1 
HETATM 2349 O O   . HOH E 3 .   ? 29.652  -2.888  -13.214 1.00  32.49 ? 186 HOH A O   1 
HETATM 2350 O O   . HOH E 3 .   ? 28.921  -21.657 -22.507 1.00  25.48 ? 187 HOH A O   1 
HETATM 2351 O O   . HOH E 3 .   ? 20.415  -23.928 -19.503 1.00  25.87 ? 188 HOH A O   1 
HETATM 2352 O O   . HOH E 3 .   ? 14.173  -3.375  -16.082 1.00  41.22 ? 189 HOH A O   1 
HETATM 2353 O O   . HOH E 3 .   ? -5.658  -1.893  -5.278  1.00  49.78 ? 190 HOH A O   1 
HETATM 2354 O O   . HOH E 3 .   ? -9.283  -19.011 -16.097 1.00  24.51 ? 191 HOH A O   1 
HETATM 2355 O O   . HOH E 3 .   ? 22.544  -24.701 -24.134 1.00  40.81 ? 192 HOH A O   1 
HETATM 2356 O O   . HOH E 3 .   ? -7.628  -13.787 -6.184  1.00  45.63 ? 193 HOH A O   1 
HETATM 2357 O O   A HOH E 3 .   ? 21.026  -18.791 -25.299 0.50  20.40 ? 194 HOH A O   1 
HETATM 2358 O O   B HOH E 3 .   ? 20.990  -19.461 -25.859 0.50  21.55 ? 194 HOH A O   1 
HETATM 2359 O O   . HOH E 3 .   ? 5.892   -26.217 -27.847 1.00  34.86 ? 195 HOH A O   1 
HETATM 2360 O O   A HOH E 3 .   ? 14.557  -3.042  -20.192 0.50  25.92 ? 196 HOH A O   1 
HETATM 2361 O O   B HOH E 3 .   ? 15.595  -2.988  -21.465 0.50  35.10 ? 196 HOH A O   1 
HETATM 2362 O O   . HOH E 3 .   ? 1.672   -28.790 -14.388 1.00  23.64 ? 197 HOH A O   1 
HETATM 2363 O O   . HOH E 3 .   ? -4.537  -5.555  -22.113 1.00  52.80 ? 198 HOH A O   1 
HETATM 2364 O O   A HOH E 3 .   ? 24.339  -23.182 -12.043 0.50  36.03 ? 199 HOH A O   1 
HETATM 2365 O O   B HOH E 3 .   ? 24.462  -23.478 -13.880 0.50  34.56 ? 199 HOH A O   1 
HETATM 2366 O O   . HOH E 3 .   ? 8.423   -12.723 -24.413 1.00  25.85 ? 200 HOH A O   1 
HETATM 2367 O O   . HOH E 3 .   ? 19.534  -9.909  -25.620 1.00  35.81 ? 201 HOH A O   1 
HETATM 2368 O O   . HOH E 3 .   ? 27.552  -27.175 -13.284 1.00  62.39 ? 202 HOH A O   1 
HETATM 2369 O O   . HOH E 3 .   ? 10.219  -23.520 -28.113 1.00  28.41 ? 203 HOH A O   1 
HETATM 2370 O O   . HOH E 3 .   ? 18.461  -22.074 -8.972  1.00  46.47 ? 204 HOH A O   1 
HETATM 2371 O O   . HOH E 3 .   ? 18.652  -14.281 -2.636  1.00  30.85 ? 205 HOH A O   1 
HETATM 2372 O O   . HOH E 3 .   ? -2.475  -5.936  -23.422 1.00  34.22 ? 206 HOH A O   1 
HETATM 2373 O O   . HOH E 3 .   ? 13.966  -12.259 -2.590  1.00  29.59 ? 207 HOH A O   1 
HETATM 2374 O O   . HOH E 3 .   ? 25.676  -14.447 -16.097 1.00  30.62 ? 208 HOH A O   1 
HETATM 2375 O O   . HOH E 3 .   ? 23.235  4.330   -15.380 1.00  48.09 ? 209 HOH A O   1 
HETATM 2376 O O   . HOH E 3 .   ? 23.032  -14.700 -25.782 1.00  39.80 ? 210 HOH A O   1 
HETATM 2377 O O   A HOH E 3 .   ? -9.170  -19.861 -13.785 0.50  29.43 ? 211 HOH A O   1 
HETATM 2378 O O   B HOH E 3 .   ? -9.562  -21.203 -14.768 0.50  31.07 ? 211 HOH A O   1 
HETATM 2379 O O   . HOH E 3 .   ? 27.671  -2.230  -5.816  1.00  48.06 ? 212 HOH A O   1 
HETATM 2380 O O   . HOH E 3 .   ? 7.613   -27.485 -11.067 1.00  56.66 ? 213 HOH A O   1 
HETATM 2381 O O   . HOH E 3 .   ? 20.147  -23.945 -8.825  1.00  50.99 ? 214 HOH A O   1 
HETATM 2382 O O   . HOH E 3 .   ? 24.259  -24.283 -18.019 1.00  29.63 ? 215 HOH A O   1 
HETATM 2383 O O   . HOH E 3 .   ? 5.305   -20.675 -2.048  1.00  48.90 ? 216 HOH A O   1 
HETATM 2384 O O   . HOH E 3 .   ? 3.855   -24.631 -3.998  1.00  44.18 ? 217 HOH A O   1 
HETATM 2385 O O   . HOH E 3 .   ? 22.908  -28.291 -17.685 1.00  64.85 ? 218 HOH A O   1 
HETATM 2386 O O   . HOH E 3 .   ? 27.295  -30.473 -18.093 1.00  60.88 ? 219 HOH A O   1 
HETATM 2387 O O   . HOH E 3 .   ? -9.045  -13.072 -2.129  1.00  74.99 ? 220 HOH A O   1 
HETATM 2388 O O   . HOH E 3 .   ? -5.715  -26.571 -3.551  1.00  67.42 ? 221 HOH A O   1 
HETATM 2389 O O   . HOH E 3 .   ? 22.284  -15.560 -1.752  1.00  62.40 ? 222 HOH A O   1 
HETATM 2390 O O   . HOH E 3 .   ? -10.823 -20.816 -12.111 1.00  37.56 ? 223 HOH A O   1 
HETATM 2391 O O   . HOH E 3 .   ? 1.484   -4.349  -18.549 1.00  21.80 ? 224 HOH A O   1 
HETATM 2392 O O   . HOH E 3 .   ? 2.241   0.198   -7.379  1.00  34.07 ? 225 HOH A O   1 
HETATM 2393 O O   . HOH E 3 .   ? -0.156  -1.540  -0.324  1.00  39.50 ? 226 HOH A O   1 
HETATM 2394 O O   . HOH E 3 .   ? 10.557  -8.046  2.339   1.00  37.21 ? 227 HOH A O   1 
HETATM 2395 O O   . HOH E 3 .   ? 14.443  -11.591 -0.057  1.00  34.82 ? 228 HOH A O   1 
HETATM 2396 O O   A HOH E 3 .   ? 9.252   -10.001 0.275   0.50  25.22 ? 229 HOH A O   1 
HETATM 2397 O O   B HOH E 3 .   ? 7.367   -10.480 0.763   0.50  35.13 ? 229 HOH A O   1 
HETATM 2398 O O   . HOH E 3 .   ? 7.883   -16.738 -2.221  1.00  35.72 ? 230 HOH A O   1 
HETATM 2399 O O   . HOH E 3 .   ? 21.186  -12.482 -2.506  1.00  33.13 ? 231 HOH A O   1 
HETATM 2400 O O   . HOH E 3 .   ? 7.953   -31.852 -20.471 1.00  57.94 ? 232 HOH A O   1 
HETATM 2401 O O   . HOH E 3 .   ? 25.612  -14.078 -4.654  1.00  41.59 ? 233 HOH A O   1 
HETATM 2402 O O   . HOH E 3 .   ? 23.830  -12.003 -3.570  1.00  37.01 ? 234 HOH A O   1 
HETATM 2403 O O   . HOH E 3 .   ? 21.753  2.008   -22.088 1.00  64.35 ? 235 HOH A O   1 
HETATM 2404 O O   . HOH E 3 .   ? 19.822  -1.433  -18.436 1.00  35.27 ? 236 HOH A O   1 
HETATM 2405 O O   . HOH E 3 .   ? 19.784  -4.644  -18.830 1.00  61.29 ? 237 HOH A O   1 
HETATM 2406 O O   . HOH E 3 .   ? 11.494  -18.064 -2.909  1.00  38.79 ? 238 HOH A O   1 
HETATM 2407 O O   . HOH E 3 .   ? 15.435  -5.742  -16.485 1.00  49.97 ? 239 HOH A O   1 
HETATM 2408 O O   . HOH E 3 .   ? 15.936  4.180   -16.761 1.00  36.26 ? 240 HOH A O   1 
HETATM 2409 O O   . HOH E 3 .   ? 16.630  4.264   -20.140 1.00  51.12 ? 241 HOH A O   1 
HETATM 2410 O O   A HOH E 3 .   ? 14.549  -2.505  -6.969  0.50  21.57 ? 242 HOH A O   1 
HETATM 2411 O O   B HOH E 3 .   ? 13.780  -2.228  -8.855  0.50  22.72 ? 242 HOH A O   1 
HETATM 2412 O O   . HOH E 3 .   ? -6.485  -8.746  -17.807 1.00  49.57 ? 243 HOH A O   1 
HETATM 2413 O O   . HOH E 3 .   ? 10.932  -15.098 0.394   1.00  55.00 ? 244 HOH A O   1 
HETATM 2414 O O   . HOH E 3 .   ? 6.055   -17.834 -4.156  1.00  26.51 ? 245 HOH A O   1 
HETATM 2415 O O   . HOH E 3 .   ? -5.307  -16.194 -21.771 1.00  33.23 ? 246 HOH A O   1 
HETATM 2416 O O   A HOH E 3 .   ? -1.941  -3.659  -15.359 0.50  29.27 ? 247 HOH A O   1 
HETATM 2417 O O   B HOH E 3 .   ? -0.684  -3.064  -17.815 0.50  26.06 ? 247 HOH A O   1 
HETATM 2418 O O   . HOH E 3 .   ? -7.970  -19.518 -24.328 1.00  37.17 ? 248 HOH A O   1 
HETATM 2419 O O   . HOH E 3 .   ? -6.355  -18.212 -26.315 1.00  39.82 ? 249 HOH A O   1 
HETATM 2420 O O   . HOH E 3 .   ? 2.392   -6.529  -29.290 1.00  24.72 ? 250 HOH A O   1 
HETATM 2421 O O   . HOH E 3 .   ? 5.335   -1.397  -26.464 1.00  46.57 ? 251 HOH A O   1 
HETATM 2422 O O   . HOH E 3 .   ? 10.270  -13.109 -20.286 1.00  27.02 ? 252 HOH A O   1 
HETATM 2423 O O   . HOH E 3 .   ? 15.403  -9.880  -20.998 1.00  34.15 ? 253 HOH A O   1 
HETATM 2424 O O   . HOH E 3 .   ? 9.101   -5.693  -19.608 1.00  25.82 ? 254 HOH A O   1 
HETATM 2425 O O   A HOH E 3 .   ? 8.934   -26.945 -15.975 0.50  19.50 ? 255 HOH A O   1 
HETATM 2426 O O   B HOH E 3 .   ? 8.499   -26.066 -14.096 0.50  25.00 ? 255 HOH A O   1 
HETATM 2427 O O   . HOH E 3 .   ? 2.371   -30.209 -12.053 0.50  17.12 ? 256 HOH A O   1 
HETATM 2428 O O   . HOH E 3 .   ? -0.956  -29.534 -14.480 1.00  31.34 ? 257 HOH A O   1 
HETATM 2429 O O   . HOH E 3 .   ? 2.433   -29.685 -16.709 1.00  28.97 ? 258 HOH A O   1 
HETATM 2430 O O   . HOH E 3 .   ? 6.295   -28.928 -25.143 1.00  29.64 ? 259 HOH A O   1 
HETATM 2431 O O   . HOH E 3 .   ? 4.928   -21.203 -28.107 1.00  24.21 ? 260 HOH A O   1 
HETATM 2432 O O   . HOH E 3 .   ? 2.772   -19.499 -27.306 1.00  26.15 ? 261 HOH A O   1 
HETATM 2433 O O   . HOH E 3 .   ? 4.028   -23.142 -26.904 1.00  35.28 ? 262 HOH A O   1 
HETATM 2434 O O   . HOH E 3 .   ? 18.452  3.450   -10.445 1.00  36.97 ? 263 HOH A O   1 
HETATM 2435 O O   . HOH E 3 .   ? 15.396  -15.440 -13.563 1.00  28.20 ? 264 HOH A O   1 
HETATM 2436 O O   A HOH E 3 .   ? 4.127   -11.676 1.195   0.50  35.11 ? 265 HOH A O   1 
HETATM 2437 O O   B HOH E 3 .   ? 2.731   -10.420 1.473   0.50  29.62 ? 265 HOH A O   1 
HETATM 2438 O O   . HOH E 3 .   ? 12.808  -25.532 -20.316 0.50  22.50 ? 266 HOH A O   1 
HETATM 2439 O O   . HOH E 3 .   ? -1.541  -24.813 -2.334  1.00  64.21 ? 267 HOH A O   1 
HETATM 2440 O O   . HOH E 3 .   ? 11.438  -18.953 -5.797  1.00  33.31 ? 268 HOH A O   1 
HETATM 2441 O O   . HOH E 3 .   ? 12.182  -18.127 -9.305  1.00  25.47 ? 269 HOH A O   1 
HETATM 2442 O O   . HOH E 3 .   ? 12.474  -20.977 -8.973  1.00  32.39 ? 270 HOH A O   1 
HETATM 2443 O O   . HOH E 3 .   ? 18.517  -22.001 -16.792 1.00  26.06 ? 271 HOH A O   1 
HETATM 2444 O O   . HOH E 3 .   ? 21.448  -22.921 -17.206 1.00  33.69 ? 272 HOH A O   1 
HETATM 2445 O O   . HOH E 3 .   ? 16.735  -21.195 -10.990 1.00  30.52 ? 273 HOH A O   1 
HETATM 2446 O O   . HOH E 3 .   ? -4.616  -7.801  -1.343  1.00  51.70 ? 274 HOH A O   1 
HETATM 2447 O O   . HOH E 3 .   ? -2.353  -18.019 0.505   1.00  54.59 ? 275 HOH A O   1 
HETATM 2448 O O   . HOH E 3 .   ? -6.906  -5.547  -4.621  1.00  34.98 ? 276 HOH A O   1 
HETATM 2449 O O   . HOH E 3 .   ? -1.118  -12.560 0.702   1.00  37.23 ? 277 HOH A O   1 
HETATM 2450 O O   . HOH E 3 .   ? 12.536  -12.434 -19.110 1.00  31.09 ? 278 HOH A O   1 
HETATM 2451 O O   . HOH E 3 .   ? 10.516  -15.376 -2.139  1.00  31.91 ? 279 HOH A O   1 
HETATM 2452 O O   . HOH E 3 .   ? 12.608  -2.779  -18.421 1.00  30.99 ? 280 HOH A O   1 
HETATM 2453 O O   . HOH E 3 .   ? -0.341  -3.004  -13.421 1.00  32.24 ? 281 HOH A O   1 
HETATM 2454 O O   . HOH E 3 .   ? -2.622  -7.091  0.329   1.00  41.89 ? 282 HOH A O   1 
HETATM 2455 O O   . HOH E 3 .   ? -5.319  -8.231  -4.748  1.00  33.90 ? 283 HOH A O   1 
HETATM 2456 O O   . HOH E 3 .   ? 23.383  -15.574 -17.724 0.50  21.96 ? 284 HOH A O   1 
HETATM 2457 O O   . HOH E 3 .   ? 23.113  -4.674  -5.515  1.00  31.44 ? 285 HOH A O   1 
HETATM 2458 O O   . HOH E 3 .   ? 16.361  -25.642 -16.096 1.00  48.24 ? 286 HOH A O   1 
HETATM 2459 O O   . HOH E 3 .   ? -7.115  -15.370 -4.584  1.00  44.17 ? 287 HOH A O   1 
HETATM 2460 O O   . HOH E 3 .   ? 23.003  -17.405 -24.565 1.00  35.30 ? 288 HOH A O   1 
HETATM 2461 O O   . HOH E 3 .   ? 1.522   -22.707 -3.200  1.00  44.35 ? 289 HOH A O   1 
HETATM 2462 O O   A HOH E 3 .   ? 21.539  -18.614 -17.803 0.50  23.17 ? 290 HOH A O   1 
HETATM 2463 O O   B HOH E 3 .   ? 21.274  -16.355 -17.490 0.50  26.77 ? 290 HOH A O   1 
HETATM 2464 O O   . HOH E 3 .   ? -8.100  -9.041  -5.847  1.00  36.43 ? 291 HOH A O   1 
HETATM 2465 O O   . HOH E 3 .   ? 23.355  1.984   -5.029  1.00  38.99 ? 292 HOH A O   1 
HETATM 2466 O O   . HOH E 3 .   ? 13.931  -19.960 -6.278  1.00  34.06 ? 293 HOH A O   1 
HETATM 2467 O O   . HOH E 3 .   ? 12.778  -14.545 -17.339 1.00  30.30 ? 294 HOH A O   1 
HETATM 2468 O O   . HOH E 3 .   ? 7.096   -23.064 -3.181  1.00  51.29 ? 295 HOH A O   1 
HETATM 2469 O O   . HOH E 3 .   ? -2.006  -11.787 3.238   1.00  47.44 ? 296 HOH A O   1 
HETATM 2470 O O   . HOH E 3 .   ? 27.049  -8.298  -4.413  1.00  54.09 ? 297 HOH A O   1 
HETATM 2471 O O   . HOH E 3 .   ? 15.745  -15.155 -28.661 1.00  25.77 ? 298 HOH A O   1 
HETATM 2472 O O   . HOH E 3 .   ? 26.238  -5.652  -18.746 1.00  34.98 ? 299 HOH A O   1 
HETATM 2473 O O   . HOH E 3 .   ? -12.025 -13.466 -23.895 1.00  61.56 ? 322 HOH A O   1 
HETATM 2474 O O   . HOH E 3 .   ? 22.885  -24.913 -20.588 1.00  33.61 ? 323 HOH A O   1 
HETATM 2475 O O   . HOH E 3 .   ? -5.896  0.424   -15.314 1.00  57.70 ? 329 HOH A O   1 
HETATM 2476 O O   . HOH E 3 .   ? 2.039   -18.010 0.278   1.00  52.65 ? 330 HOH A O   1 
HETATM 2477 O O   . HOH E 3 .   ? 19.229  -26.246 -27.534 1.00  53.21 ? 331 HOH A O   1 
HETATM 2478 O O   . HOH E 3 .   ? -0.597  -30.093 -23.642 1.00  62.94 ? 332 HOH A O   1 
HETATM 2479 O O   . HOH E 3 .   ? -8.691  -17.210 -7.626  1.00  49.58 ? 334 HOH A O   1 
HETATM 2480 O O   . HOH E 3 .   ? 0.498   -0.488  -12.778 1.00  54.11 ? 342 HOH A O   1 
HETATM 2481 O O   . HOH E 3 .   ? 24.543  -12.193 -19.912 1.00  53.07 ? 343 HOH A O   1 
HETATM 2482 O O   . HOH E 3 .   ? 9.522   -31.986 -18.109 1.00  62.91 ? 345 HOH A O   1 
HETATM 2483 O O   . HOH E 3 .   ? -5.119  -18.668 -4.125  1.00  51.51 ? 346 HOH A O   1 
HETATM 2484 O O   . HOH E 3 .   ? 28.131  -1.575  -21.235 1.00  59.01 ? 348 HOH A O   1 
HETATM 2485 O O   . HOH E 3 .   ? -0.697  -19.809 -1.915  1.00  47.79 ? 350 HOH A O   1 
HETATM 2486 O O   . HOH E 3 .   ? 10.812  -29.454 -13.051 1.00  52.42 ? 352 HOH A O   1 
HETATM 2487 O O   . HOH E 3 .   ? 25.514  -25.073 -26.801 1.00  50.13 ? 353 HOH A O   1 
HETATM 2488 O O   . HOH E 3 .   ? 2.723   -3.641  2.356   1.00  48.21 ? 359 HOH A O   1 
HETATM 2489 O O   . HOH E 3 .   ? 12.237  -29.755 -19.478 1.00  53.41 ? 361 HOH A O   1 
HETATM 2490 O O   . HOH E 3 .   ? 11.749  5.555   -12.997 1.00  58.05 ? 362 HOH A O   1 
HETATM 2491 O O   . HOH E 3 .   ? 24.779  -0.651  -7.097  1.00  38.72 ? 363 HOH A O   1 
HETATM 2492 O O   . HOH E 3 .   ? 4.633   5.759   -12.304 1.00  72.12 ? 364 HOH A O   1 
HETATM 2493 O O   . HOH E 3 .   ? 14.366  -31.837 -18.981 1.00  59.74 ? 365 HOH A O   1 
HETATM 2494 O O   . HOH E 3 .   ? 18.725  -26.106 -25.298 1.00  52.96 ? 368 HOH A O   1 
HETATM 2495 O O   . HOH E 3 .   ? 13.181  -28.945 -25.987 1.00  49.41 ? 373 HOH A O   1 
HETATM 2496 O O   A HOH E 3 .   ? 2.530   -1.478  -22.383 0.50  33.21 ? 374 HOH A O   1 
HETATM 2497 O O   . HOH E 3 .   ? -10.600 -19.511 -8.772  1.00  46.81 ? 378 HOH A O   1 
HETATM 2498 O O   . HOH E 3 .   ? -5.472  -24.201 -22.034 1.00  41.63 ? 380 HOH A O   1 
HETATM 2499 O O   . HOH E 3 .   ? -4.222  -25.091 -26.863 1.00  55.62 ? 381 HOH A O   1 
HETATM 2500 O O   . HOH E 3 .   ? 9.407   4.019   -12.905 0.50  44.36 ? 383 HOH A O   1 
HETATM 2501 O O   . HOH E 3 .   ? 15.206  -27.961 -14.039 1.00  62.96 ? 384 HOH A O   1 
HETATM 2502 O O   . HOH E 3 .   ? -7.378  -23.170 -13.341 1.00  50.36 ? 387 HOH A O   1 
HETATM 2503 O O   . HOH E 3 .   ? -7.513  -25.549 -9.855  1.00  47.66 ? 388 HOH A O   1 
HETATM 2504 O O   . HOH E 3 .   ? 24.102  2.762   -21.567 1.00  58.23 ? 390 HOH A O   1 
HETATM 2505 O O   . HOH F 3 .   ? 8.207   -7.664  -30.160 1.00  22.22 ? 139 HOH B O   1 
HETATM 2506 O O   A HOH F 3 .   ? -1.491  1.460   -48.979 0.50  16.09 ? 140 HOH B O   1 
HETATM 2507 O O   B HOH F 3 .   ? -2.845  3.008   -49.615 0.50  32.61 ? 140 HOH B O   1 
HETATM 2508 O O   . HOH F 3 .   ? 6.956   -19.403 -28.248 1.00  17.12 ? 141 HOH B O   1 
HETATM 2509 O O   . HOH F 3 .   ? -3.862  7.035   -46.290 1.00  45.22 ? 142 HOH B O   1 
HETATM 2510 O O   . HOH F 3 .   ? 15.883  -6.726  -31.027 1.00  22.06 ? 143 HOH B O   1 
HETATM 2511 O O   . HOH F 3 .   ? 0.381   -20.310 -27.574 1.00  24.77 ? 144 HOH B O   1 
HETATM 2512 O O   . HOH F 3 .   ? 20.959  -13.549 -38.461 0.50  23.28 ? 145 HOH B O   1 
HETATM 2513 O O   . HOH F 3 .   ? 0.521   -6.390  -34.027 1.00  29.29 ? 146 HOH B O   1 
HETATM 2514 O O   . HOH F 3 .   ? 4.192   -26.629 -29.410 1.00  50.61 ? 147 HOH B O   1 
HETATM 2515 O O   . HOH F 3 .   ? -4.845  -20.423 -27.535 1.00  28.03 ? 148 HOH B O   1 
HETATM 2516 O O   . HOH F 3 .   ? 0.460   -18.834 -29.790 1.00  19.07 ? 149 HOH B O   1 
HETATM 2517 O O   . HOH F 3 .   ? -0.766  -18.273 -33.729 1.00  19.45 ? 150 HOH B O   1 
HETATM 2518 O O   . HOH F 3 .   ? 1.646   3.351   -51.584 1.00  20.84 ? 151 HOH B O   1 
HETATM 2519 O O   . HOH F 3 .   ? 17.454  -2.200  -38.222 1.00  24.69 ? 152 HOH B O   1 
HETATM 2520 O O   . HOH F 3 .   ? -6.095  -21.683 -30.649 1.00  38.02 ? 153 HOH B O   1 
HETATM 2521 O O   . HOH F 3 .   ? -8.488  -6.298  -36.755 1.00  30.20 ? 154 HOH B O   1 
HETATM 2522 O O   . HOH F 3 .   ? -5.046  -16.755 -39.056 1.00  35.98 ? 155 HOH B O   1 
HETATM 2523 O O   . HOH F 3 .   ? -1.766  -18.925 -26.301 1.00  23.98 ? 156 HOH B O   1 
HETATM 2524 O O   . HOH F 3 .   ? 8.225   -15.353 -24.086 1.00  22.83 ? 157 HOH B O   1 
HETATM 2525 O O   . HOH F 3 .   ? 2.750   -27.068 -34.338 1.00  53.03 ? 158 HOH B O   1 
HETATM 2526 O O   . HOH F 3 .   ? -11.950 1.836   -39.494 1.00  50.00 ? 159 HOH B O   1 
HETATM 2527 O O   . HOH F 3 .   ? 0.426   -24.575 -38.103 1.00  46.75 ? 160 HOH B O   1 
HETATM 2528 O O   . HOH F 3 .   ? 5.267   -6.914  -27.211 1.00  27.32 ? 161 HOH B O   1 
HETATM 2529 O O   . HOH F 3 .   ? -7.122  -9.553  -39.397 1.00  28.23 ? 162 HOH B O   1 
HETATM 2530 O O   . HOH F 3 .   ? 7.081   10.166  -42.108 1.00  42.40 ? 163 HOH B O   1 
HETATM 2531 O O   . HOH F 3 .   ? -4.771  10.080  -37.459 1.00  52.31 ? 164 HOH B O   1 
HETATM 2532 O O   . HOH F 3 .   ? -1.619  14.720  -39.862 1.00  36.32 ? 165 HOH B O   1 
HETATM 2533 O O   . HOH F 3 .   ? 18.951  4.438   -34.644 1.00  51.93 ? 166 HOH B O   1 
HETATM 2534 O O   . HOH F 3 .   ? 3.684   -24.184 -49.277 1.00  49.26 ? 167 HOH B O   1 
HETATM 2535 O O   A HOH F 3 .   ? 12.203  -24.823 -37.672 0.50  37.15 ? 168 HOH B O   1 
HETATM 2536 O O   B HOH F 3 .   ? 12.998  -25.078 -36.211 0.50  28.19 ? 168 HOH B O   1 
HETATM 2537 O O   . HOH F 3 .   ? 15.381  -20.735 -44.069 1.00  45.17 ? 169 HOH B O   1 
HETATM 2538 O O   A HOH F 3 .   ? 4.431   -4.192  -27.294 0.50  23.49 ? 170 HOH B O   1 
HETATM 2539 O O   B HOH F 3 .   ? 3.494   -4.160  -29.662 0.50  31.81 ? 170 HOH B O   1 
HETATM 2540 O O   . HOH F 3 .   ? 11.137  -12.806 -22.803 1.00  27.98 ? 171 HOH B O   1 
HETATM 2541 O O   . HOH F 3 .   ? 10.709  12.107  -37.599 1.00  39.62 ? 172 HOH B O   1 
HETATM 2542 O O   . HOH F 3 .   ? 8.780   1.657   -51.898 1.00  33.69 ? 173 HOH B O   1 
HETATM 2543 O O   . HOH F 3 .   ? 20.143  -12.263 -28.575 1.00  35.44 ? 174 HOH B O   1 
HETATM 2544 O O   . HOH F 3 .   ? 16.756  2.634   -32.865 1.00  29.56 ? 175 HOH B O   1 
HETATM 2545 O O   . HOH F 3 .   ? -7.642  -2.011  -35.117 1.00  36.05 ? 176 HOH B O   1 
HETATM 2546 O O   . HOH F 3 .   ? 4.593   -27.974 -32.827 1.00  57.76 ? 177 HOH B O   1 
HETATM 2547 O O   . HOH F 3 .   ? 18.664  -7.198  -35.141 1.00  30.13 ? 178 HOH B O   1 
HETATM 2548 O O   . HOH F 3 .   ? 19.281  -7.290  -23.366 1.00  58.73 ? 179 HOH B O   1 
HETATM 2549 O O   . HOH F 3 .   ? 12.882  -7.395  -18.179 1.00  56.34 ? 180 HOH B O   1 
HETATM 2550 O O   . HOH F 3 .   ? 19.519  -6.402  -28.112 1.00  53.22 ? 181 HOH B O   1 
HETATM 2551 O O   . HOH F 3 .   ? 8.913   -27.370 -31.422 1.00  49.51 ? 182 HOH B O   1 
HETATM 2552 O O   . HOH F 3 .   ? 8.122   -26.935 -29.017 1.00  56.96 ? 183 HOH B O   1 
HETATM 2553 O O   A HOH F 3 .   ? 7.382   -27.805 -37.015 0.50  44.75 ? 184 HOH B O   1 
HETATM 2554 O O   . HOH F 3 .   ? 3.564   -24.930 -44.365 0.50  37.16 ? 185 HOH B O   1 
HETATM 2555 O O   . HOH F 3 .   ? 7.707   -23.042 -42.804 1.00  48.17 ? 186 HOH B O   1 
HETATM 2556 O O   . HOH F 3 .   ? 5.642   -26.715 -41.138 1.00  59.33 ? 187 HOH B O   1 
HETATM 2557 O O   . HOH F 3 .   ? 18.891  -18.697 -39.259 1.00  45.90 ? 188 HOH B O   1 
HETATM 2558 O O   . HOH F 3 .   ? 17.774  -8.069  -21.219 1.00  45.27 ? 189 HOH B O   1 
HETATM 2559 O O   . HOH F 3 .   ? -2.075  6.282   -30.222 1.00  44.45 ? 190 HOH B O   1 
HETATM 2560 O O   . HOH F 3 .   ? 16.174  10.676  -33.757 1.00  44.00 ? 191 HOH B O   1 
HETATM 2561 O O   A HOH F 3 .   ? 9.951   -7.439  -52.878 0.50  37.60 ? 192 HOH B O   1 
HETATM 2562 O O   B HOH F 3 .   ? 11.766  -6.203  -51.782 0.50  33.05 ? 192 HOH B O   1 
HETATM 2563 O O   . HOH F 3 .   ? 3.361   -13.496 -51.141 1.00  45.91 ? 193 HOH B O   1 
HETATM 2564 O O   . HOH F 3 .   ? -8.895  5.159   -39.642 1.00  36.90 ? 194 HOH B O   1 
HETATM 2565 O O   . HOH F 3 .   ? 5.976   7.060   -30.924 1.00  40.88 ? 195 HOH B O   1 
HETATM 2566 O O   . HOH F 3 .   ? -14.527 -4.575  -22.678 1.00  68.23 ? 196 HOH B O   1 
HETATM 2567 O O   . HOH F 3 .   ? -17.226 -5.497  -32.116 0.60  42.12 ? 197 HOH B O   1 
HETATM 2568 O O   . HOH F 3 .   ? -0.663  -23.054 -40.352 1.00  32.42 ? 198 HOH B O   1 
HETATM 2569 O O   . HOH F 3 .   ? -0.337  -25.360 -41.869 1.00  53.36 ? 199 HOH B O   1 
HETATM 2570 O O   . HOH F 3 .   ? 0.537   -25.394 -33.933 1.00  46.19 ? 201 HOH B O   1 
HETATM 2571 O O   . HOH F 3 .   ? 15.173  4.764   -23.154 1.00  50.97 ? 202 HOH B O   1 
HETATM 2572 O O   . HOH F 3 .   ? -6.318  -5.189  -43.003 1.00  42.65 ? 203 HOH B O   1 
HETATM 2573 O O   . HOH F 3 .   ? 14.316  12.055  -38.054 1.00  60.85 ? 204 HOH B O   1 
HETATM 2574 O O   . HOH F 3 .   ? 7.186   -25.685 -38.603 1.00  44.04 ? 205 HOH B O   1 
HETATM 2575 O O   . HOH F 3 .   ? -1.910  8.801   -30.129 1.00  35.28 ? 206 HOH B O   1 
HETATM 2576 O O   . HOH F 3 .   ? 11.219  -27.248 -30.512 1.00  60.54 ? 207 HOH B O   1 
HETATM 2577 O O   . HOH F 3 .   ? -7.122  8.701   -38.357 1.00  60.89 ? 208 HOH B O   1 
HETATM 2578 O O   . HOH F 3 .   ? -0.419  -8.239  -43.681 1.00  30.86 ? 209 HOH B O   1 
HETATM 2579 O O   . HOH F 3 .   ? 19.635  -11.653 -45.355 1.00  33.90 ? 210 HOH B O   1 
HETATM 2580 O O   . HOH F 3 .   ? -8.551  -3.841  -27.498 1.00  36.46 ? 211 HOH B O   1 
HETATM 2581 O O   . HOH F 3 .   ? -9.983  0.337   -31.059 1.00  50.81 ? 212 HOH B O   1 
HETATM 2582 O O   . HOH F 3 .   ? 22.863  -9.633  -45.104 1.00  47.62 ? 213 HOH B O   1 
HETATM 2583 O O   . HOH F 3 .   ? 15.453  -25.084 -35.208 1.00  61.37 ? 214 HOH B O   1 
HETATM 2584 O O   . HOH F 3 .   ? -2.229  10.007  -46.186 1.00  53.50 ? 215 HOH B O   1 
HETATM 2585 O O   . HOH F 3 .   ? 16.696  -4.390  -26.541 1.00  34.11 ? 216 HOH B O   1 
HETATM 2586 O O   . HOH F 3 .   ? 3.361   -7.869  -31.102 1.00  33.24 ? 217 HOH B O   1 
HETATM 2587 O O   . HOH F 3 .   ? 6.326   7.145   -28.084 1.00  52.85 ? 218 HOH B O   1 
HETATM 2588 O O   . HOH F 3 .   ? -17.500 0.368   -29.517 1.00  60.91 ? 219 HOH B O   1 
HETATM 2589 O O   A HOH F 3 .   ? 10.199  1.755   -39.249 0.70  38.63 ? 220 HOH B O   1 
HETATM 2590 O O   B HOH F 3 .   ? 9.926   2.635   -40.794 0.30  22.88 ? 220 HOH B O   1 
HETATM 2591 O O   . HOH F 3 .   ? -7.067  -4.803  -34.785 1.00  34.12 ? 221 HOH B O   1 
HETATM 2592 O O   . HOH F 3 .   ? 16.713  -16.253 -45.493 1.00  49.91 ? 222 HOH B O   1 
HETATM 2593 O O   . HOH F 3 .   ? 17.225  -6.666  -24.893 1.00  30.60 ? 223 HOH B O   1 
HETATM 2594 O O   . HOH F 3 .   ? -11.041 -6.011  -34.704 1.00  38.64 ? 224 HOH B O   1 
HETATM 2595 O O   . HOH F 3 .   ? 24.447  -5.318  -39.815 1.00  50.20 ? 225 HOH B O   1 
HETATM 2596 O O   . HOH F 3 .   ? 19.590  -0.847  -41.613 1.00  41.56 ? 226 HOH B O   1 
HETATM 2597 O O   . HOH F 3 .   ? 2.524   -26.336 -38.915 1.00  45.95 ? 227 HOH B O   1 
HETATM 2598 O O   . HOH F 3 .   ? -0.821  -5.476  -35.960 1.00  32.18 ? 228 HOH B O   1 
HETATM 2599 O O   A HOH F 3 .   ? 17.923  -15.864 -33.224 0.50  25.42 ? 229 HOH B O   1 
HETATM 2600 O O   B HOH F 3 .   ? 19.677  -14.880 -34.175 0.50  32.89 ? 229 HOH B O   1 
HETATM 2601 O O   . HOH F 3 .   ? 23.337  -12.236 -38.988 0.50  21.80 ? 230 HOH B O   1 
HETATM 2602 O O   . HOH F 3 .   ? 11.963  4.869   -37.322 1.00  40.93 ? 231 HOH B O   1 
HETATM 2603 O O   . HOH F 3 .   ? -3.451  12.635  -37.001 1.00  46.42 ? 232 HOH B O   1 
HETATM 2604 O O   A HOH F 3 .   ? -7.618  -13.851 -34.651 0.50  25.73 ? 233 HOH B O   1 
HETATM 2605 O O   B HOH F 3 .   ? -8.883  -15.115 -34.119 0.50  34.46 ? 233 HOH B O   1 
HETATM 2606 O O   . HOH F 3 .   ? 12.601  -9.651  -20.325 1.00  36.29 ? 234 HOH B O   1 
HETATM 2607 O O   . HOH F 3 .   ? 5.069   -9.987  -45.901 1.00  23.83 ? 235 HOH B O   1 
HETATM 2608 O O   . HOH F 3 .   ? 5.682   -7.255  -29.862 1.00  29.09 ? 236 HOH B O   1 
HETATM 2609 O O   . HOH F 3 .   ? 7.248   14.485  -30.954 1.00  48.27 ? 237 HOH B O   1 
HETATM 2610 O O   . HOH F 3 .   ? 14.705  -1.167  -23.630 1.00  35.78 ? 238 HOH B O   1 
HETATM 2611 O O   A HOH F 3 .   ? -4.323  -16.261 -25.507 0.50  22.62 ? 247 HOH B O   1 
HETATM 2612 O O   B HOH F 3 .   ? -4.698  -15.912 -24.091 0.50  29.19 ? 247 HOH B O   1 
HETATM 2613 O O   . HOH F 3 .   ? 11.025  -5.750  -17.926 1.00  36.46 ? 255 HOH B O   1 
HETATM 2614 O O   . HOH F 3 .   ? -0.608  -26.540 -31.438 1.00  58.17 ? 263 HOH B O   1 
HETATM 2615 O O   . HOH F 3 .   ? 6.713   -26.696 -32.916 1.00  30.55 ? 264 HOH B O   1 
HETATM 2616 O O   . HOH F 3 .   ? 19.148  -9.944  -28.311 1.00  39.98 ? 265 HOH B O   1 
HETATM 2617 O O   . HOH F 3 .   ? 16.316  -21.935 -35.083 1.00  41.86 ? 277 HOH B O   1 
HETATM 2618 O O   . HOH F 3 .   ? 18.839  -21.406 -36.128 1.00  69.81 ? 278 HOH B O   1 
HETATM 2619 O O   . HOH F 3 .   ? 21.407  -15.909 -37.035 1.00  56.65 ? 279 HOH B O   1 
HETATM 2620 O O   . HOH F 3 .   ? 23.745  -8.459  -34.836 0.50  32.87 ? 280 HOH B O   1 
HETATM 2621 O O   A HOH F 3 .   ? 18.323  -7.084  -32.215 0.50  26.48 ? 281 HOH B O   1 
HETATM 2622 O O   B HOH F 3 .   ? 18.466  -7.869  -30.704 0.50  36.36 ? 281 HOH B O   1 
HETATM 2623 O O   . HOH F 3 .   ? 18.061  -0.061  -34.880 1.00  38.43 ? 283 HOH B O   1 
HETATM 2624 O O   . HOH F 3 .   ? 16.941  1.403   -43.944 1.00  42.51 ? 284 HOH B O   1 
HETATM 2625 O O   . HOH F 3 .   ? 19.354  -0.473  -49.379 1.00  60.88 ? 285 HOH B O   1 
HETATM 2626 O O   . HOH F 3 .   ? 18.582  -7.305  -50.162 1.00  43.18 ? 286 HOH B O   1 
HETATM 2627 O O   . HOH F 3 .   ? 10.428  1.701   -49.772 0.50  21.94 ? 287 HOH B O   1 
HETATM 2628 O O   . HOH F 3 .   ? 13.646  3.251   -43.622 1.00  60.48 ? 288 HOH B O   1 
HETATM 2629 O O   . HOH F 3 .   ? 2.460   9.250   -44.901 0.70  21.58 ? 289 HOH B O   1 
HETATM 2630 O O   . HOH F 3 .   ? 7.143   11.692  -44.845 0.50  27.19 ? 290 HOH B O   1 
HETATM 2631 O O   . HOH F 3 .   ? 9.595   5.858   -41.436 1.00  49.27 ? 291 HOH B O   1 
HETATM 2632 O O   . HOH F 3 .   ? 3.657   4.168   -32.108 1.00  52.92 ? 292 HOH B O   1 
HETATM 2633 O O   . HOH F 3 .   ? 4.268   13.927  -37.235 1.00  43.43 ? 294 HOH B O   1 
HETATM 2634 O O   . HOH F 3 .   ? -4.677  12.991  -32.908 1.00  40.36 ? 295 HOH B O   1 
HETATM 2635 O O   . HOH F 3 .   ? -4.872  12.179  -30.296 1.00  54.83 ? 296 HOH B O   1 
HETATM 2636 O O   . HOH F 3 .   ? 10.823  8.968   -27.206 1.00  47.77 ? 297 HOH B O   1 
HETATM 2637 O O   . HOH F 3 .   ? 9.199   -0.704  -31.271 1.00  53.62 ? 299 HOH B O   1 
HETATM 2638 O O   . HOH F 3 .   ? 10.973  -1.456  -29.755 1.00  34.45 ? 300 HOH B O   1 
HETATM 2639 O O   . HOH F 3 .   ? 7.406   -3.640  -31.641 1.00  34.93 ? 301 HOH B O   1 
HETATM 2640 O O   . HOH F 3 .   ? -6.643  -10.728 -41.624 1.00  39.47 ? 302 HOH B O   1 
HETATM 2641 O O   . HOH F 3 .   ? -9.885  -9.528  -38.661 1.00  46.41 ? 303 HOH B O   1 
HETATM 2642 O O   . HOH F 3 .   ? -8.532  -0.828  -27.600 1.00  43.64 ? 304 HOH B O   1 
HETATM 2643 O O   . HOH F 3 .   ? -8.601  -4.074  -24.874 1.00  36.49 ? 305 HOH B O   1 
HETATM 2644 O O   A HOH F 3 .   ? -6.735  0.087   -25.868 0.50  29.55 ? 306 HOH B O   1 
HETATM 2645 O O   B HOH F 3 .   ? -5.127  0.591   -25.682 0.50  37.26 ? 306 HOH B O   1 
HETATM 2646 O O   . HOH F 3 .   ? -1.728  -3.213  -36.042 1.00  32.43 ? 307 HOH B O   1 
HETATM 2647 O O   . HOH F 3 .   ? -1.279  -2.833  -38.621 1.00  29.96 ? 308 HOH B O   1 
HETATM 2648 O O   . HOH F 3 .   ? 0.120   -5.008  -38.305 1.00  30.19 ? 309 HOH B O   1 
HETATM 2649 O O   . HOH F 3 .   ? 5.040   -10.863 -48.386 1.00  30.53 ? 310 HOH B O   1 
HETATM 2650 O O   . HOH F 3 .   ? 1.757   -10.133 -48.850 1.00  55.58 ? 311 HOH B O   1 
HETATM 2651 O O   . HOH F 3 .   ? -1.033  -8.381  -46.233 1.00  45.99 ? 312 HOH B O   1 
HETATM 2652 O O   . HOH F 3 .   ? -0.698  -6.543  -50.138 1.00  54.20 ? 313 HOH B O   1 
HETATM 2653 O O   . HOH F 3 .   ? 4.157   -6.036  -48.903 1.00  30.56 ? 314 HOH B O   1 
HETATM 2654 O O   . HOH F 3 .   ? 5.903   -6.708  -50.693 1.00  37.34 ? 315 HOH B O   1 
HETATM 2655 O O   . HOH F 3 .   ? 1.891   -5.853  -50.278 1.00  41.46 ? 316 HOH B O   1 
HETATM 2656 O O   . HOH F 3 .   ? 3.358   -1.218  -48.877 1.00  24.17 ? 317 HOH B O   1 
HETATM 2657 O O   . HOH F 3 .   ? 15.229  -14.592 -46.808 1.00  40.37 ? 318 HOH B O   1 
HETATM 2658 O O   . HOH F 3 .   ? -0.155  1.143   -51.359 0.50  15.55 ? 319 HOH B O   1 
HETATM 2659 O O   A HOH F 3 .   ? 1.668   -1.155  -50.858 0.50  25.29 ? 320 HOH B O   1 
HETATM 2660 O O   B HOH F 3 .   ? 1.614   -3.587  -51.506 0.50  34.72 ? 320 HOH B O   1 
HETATM 2661 O O   A HOH F 3 .   ? 9.536   1.132   -35.266 0.50  26.57 ? 324 HOH B O   1 
HETATM 2662 O O   B HOH F 3 .   ? 9.997   2.797   -35.634 0.50  31.75 ? 324 HOH B O   1 
HETATM 2663 O O   . HOH F 3 .   ? 20.714  -13.986 -44.301 1.00  36.49 ? 325 HOH B O   1 
HETATM 2664 O O   . HOH F 3 .   ? -7.805  2.526   -45.673 1.00  40.78 ? 326 HOH B O   1 
HETATM 2665 O O   . HOH F 3 .   ? 17.812  -15.701 -30.631 1.00  38.38 ? 327 HOH B O   1 
HETATM 2666 O O   . HOH F 3 .   ? -17.651 -1.436  -36.529 1.00  36.26 ? 328 HOH B O   1 
HETATM 2667 O O   . HOH F 3 .   ? 9.749   -22.700 -41.203 1.00  48.86 ? 333 HOH B O   1 
HETATM 2668 O O   A HOH F 3 .   ? 19.480  -22.848 -31.083 0.50  45.43 ? 335 HOH B O   1 
HETATM 2669 O O   B HOH F 3 .   ? 19.978  -21.013 -31.198 0.50  34.72 ? 335 HOH B O   1 
HETATM 2670 O O   . HOH F 3 .   ? 2.280   0.795   -29.326 1.00  57.45 ? 336 HOH B O   1 
HETATM 2671 O O   . HOH F 3 .   ? -7.194  -22.145 -41.441 1.00  63.76 ? 337 HOH B O   1 
HETATM 2672 O O   . HOH F 3 .   ? -13.524 -1.909  -38.713 1.00  55.10 ? 338 HOH B O   1 
HETATM 2673 O O   . HOH F 3 .   ? -0.587  0.278   -25.232 1.00  60.94 ? 339 HOH B O   1 
HETATM 2674 O O   . HOH F 3 .   ? -9.430  -15.684 -41.600 1.00  59.29 ? 341 HOH B O   1 
HETATM 2675 O O   . HOH F 3 .   ? -3.539  2.029   -27.104 1.00  67.67 ? 344 HOH B O   1 
HETATM 2676 O O   . HOH F 3 .   ? 16.550  -25.292 -39.331 1.00  60.95 ? 347 HOH B O   1 
HETATM 2677 O O   . HOH F 3 .   ? 13.103  6.186   -23.512 1.00  60.90 ? 349 HOH B O   1 
HETATM 2678 O O   . HOH F 3 .   ? 16.564  -1.370  -27.175 1.00  47.02 ? 351 HOH B O   1 
HETATM 2679 O O   . HOH F 3 .   ? -4.108  4.960   -31.468 1.00  62.45 ? 356 HOH B O   1 
HETATM 2680 O O   . HOH F 3 .   ? -9.595  3.804   -41.936 1.00  48.03 ? 357 HOH B O   1 
HETATM 2681 O O   . HOH F 3 .   ? -1.419  13.711  -26.625 1.00  54.76 ? 358 HOH B O   1 
HETATM 2682 O O   . HOH F 3 .   ? -13.697 -5.076  -33.324 1.00  43.22 ? 360 HOH B O   1 
HETATM 2683 O O   . HOH F 3 .   ? 10.590  2.500   -30.366 1.00  54.39 ? 371 HOH B O   1 
HETATM 2684 O O   . HOH F 3 .   ? -2.631  -1.895  -24.423 1.00  47.43 ? 375 HOH B O   1 
HETATM 2685 O O   . HOH F 3 .   ? -3.866  -16.304 -40.963 1.00  38.61 ? 376 HOH B O   1 
HETATM 2686 O O   . HOH F 3 .   ? -5.321  -23.805 -35.330 1.00  56.94 ? 377 HOH B O   1 
HETATM 2687 O O   . HOH F 3 .   ? -5.039  -12.511 -42.415 1.00  50.83 ? 386 HOH B O   1 
HETATM 2688 O O   . HOH F 3 .   ? -3.283  -20.830 -44.260 1.00  56.79 ? 389 HOH B O   1 
HETATM 2689 O O   . HOH F 3 .   ? -9.142  -11.787 -42.650 1.00  54.98 ? 391 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . PRO A 1   ? 0.4338 0.4322 0.4423 -0.0061 0.0017  0.0011  1   PRO A N   
2    C CA  . PRO A 1   ? 0.4150 0.4245 0.4309 -0.0109 0.0024  0.0058  1   PRO A CA  
3    C C   . PRO A 1   ? 0.3966 0.4197 0.4165 -0.0063 0.0007  0.0007  1   PRO A C   
4    O O   . PRO A 1   ? 0.4110 0.4391 0.4287 -0.0178 -0.0029 0.0050  1   PRO A O   
5    C CB  . PRO A 1   ? 0.4330 0.4236 0.4459 -0.0014 0.0003  0.0008  1   PRO A CB  
6    C CG  . PRO A 1   ? 0.4396 0.4344 0.4476 -0.0064 -0.0010 0.0016  1   PRO A CG  
7    C CD  . PRO A 1   ? 0.4364 0.4340 0.4459 -0.0018 0.0011  0.0014  1   PRO A CD  
8    N N   . ASN A 2   ? 0.3627 0.3896 0.3829 -0.0309 0.0087  0.0067  2   ASN A N   
9    C CA  . ASN A 2   ? 0.3105 0.3646 0.3476 -0.0243 0.0234  -0.0032 2   ASN A CA  
10   C C   . ASN A 2   ? 0.2764 0.3451 0.3153 -0.0270 0.0351  -0.0189 2   ASN A C   
11   O O   . ASN A 2   ? 0.2794 0.3617 0.3201 -0.0416 0.0537  -0.0135 2   ASN A O   
12   C CB  . ASN A 2   ? 0.3127 0.3796 0.3465 -0.0235 0.0145  0.0072  2   ASN A CB  
13   C CG  . ASN A 2   ? 0.3228 0.3866 0.3528 -0.0090 0.0069  0.0000  2   ASN A CG  
14   O OD1 . ASN A 2   ? 0.2478 0.3840 0.3426 -0.0406 0.0160  0.0051  2   ASN A OD1 
15   N ND2 . ASN A 2   ? 0.2459 0.3521 0.3300 -0.0189 0.0197  -0.0182 2   ASN A ND2 
16   N N   . PHE A 3   ? 0.2327 0.3251 0.2791 -0.0414 0.0308  -0.0211 3   PHE A N   
17   C CA  . PHE A 3   ? 0.1903 0.2961 0.2638 -0.0267 0.0257  -0.0293 3   PHE A CA  
18   C C   . PHE A 3   ? 0.1758 0.2790 0.2478 -0.0267 0.0188  -0.0501 3   PHE A C   
19   O O   . PHE A 3   ? 0.2174 0.3047 0.2844 -0.0194 0.0277  -0.0544 3   PHE A O   
20   C CB  . PHE A 3   ? 0.2144 0.2784 0.2433 -0.0200 0.0353  -0.0154 3   PHE A CB  
21   C CG  . PHE A 3   ? 0.2095 0.2787 0.2191 -0.0160 0.0376  -0.0138 3   PHE A CG  
22   C CD1 . PHE A 3   ? 0.2172 0.2509 0.2259 -0.0251 0.0166  -0.0144 3   PHE A CD1 
23   C CD2 . PHE A 3   ? 0.2041 0.2580 0.2226 -0.0286 0.0274  -0.0158 3   PHE A CD2 
24   C CE1 . PHE A 3   ? 0.2053 0.2737 0.2418 -0.0225 0.0215  -0.0121 3   PHE A CE1 
25   C CE2 . PHE A 3   ? 0.2166 0.2381 0.2310 -0.0259 0.0460  -0.0116 3   PHE A CE2 
26   C CZ  . PHE A 3   ? 0.2173 0.2460 0.2413 -0.0329 0.0328  -0.0094 3   PHE A CZ  
27   N N   . SER A 4   ? 0.2146 0.2967 0.2579 -0.0018 0.0340  -0.0428 4   SER A N   
28   C CA  . SER A 4   ? 0.1729 0.2628 0.2653 -0.0180 -0.0092 -0.0474 4   SER A CA  
29   C C   . SER A 4   ? 0.2193 0.2777 0.2828 -0.0056 0.0256  -0.0444 4   SER A C   
30   O O   . SER A 4   ? 0.2582 0.3175 0.3089 -0.0323 0.0260  -0.0601 4   SER A O   
31   C CB  . SER A 4   ? 0.2151 0.3034 0.3018 0.0002  0.0026  -0.0283 4   SER A CB  
32   O OG  . SER A 4   ? 0.1920 0.3136 0.2574 -0.0227 0.0145  -0.0648 4   SER A OG  
33   N N   . GLY A 5   ? 0.2135 0.2594 0.2924 -0.0241 0.0162  -0.0590 5   GLY A N   
34   C CA  . GLY A 5   ? 0.2408 0.2598 0.3319 -0.0160 0.0109  -0.0476 5   GLY A CA  
35   C C   . GLY A 5   ? 0.1391 0.2331 0.2426 -0.0013 0.0502  -0.0635 5   GLY A C   
36   O O   . GLY A 5   ? 0.2338 0.3009 0.3007 -0.0230 -0.0143 -0.0541 5   GLY A O   
37   N N   . ASN A 6   ? 0.2299 0.2948 0.2971 -0.0176 -0.0209 -0.0165 6   ASN A N   
38   C CA  . ASN A 6   ? 0.2301 0.2829 0.2635 -0.0037 -0.0108 -0.0322 6   ASN A CA  
39   C C   . ASN A 6   ? 0.1579 0.2989 0.2561 0.0222  -0.0066 -0.0360 6   ASN A C   
40   O O   . ASN A 6   ? 0.2701 0.3951 0.3031 0.0068  -0.0413 -0.0160 6   ASN A O   
41   C CB  . ASN A 6   ? 0.2878 0.3262 0.3047 0.0019  -0.0104 -0.0188 6   ASN A CB  
42   C CG  . ASN A 6   ? 0.3284 0.3817 0.3356 -0.0027 -0.0088 -0.0110 6   ASN A CG  
43   O OD1 . ASN A 6   ? 0.3823 0.4144 0.3697 0.0059  0.0086  -0.0151 6   ASN A OD1 
44   N ND2 . ASN A 6   ? 0.3496 0.4005 0.3784 0.0034  -0.0025 -0.0144 6   ASN A ND2 
45   N N   . TRP A 7   ? 0.2071 0.2791 0.2663 -0.0020 -0.0207 -0.0259 7   TRP A N   
46   C CA  . TRP A 7   ? 0.1766 0.2453 0.2449 -0.0043 -0.0039 -0.0264 7   TRP A CA  
47   C C   . TRP A 7   ? 0.1961 0.2483 0.2314 -0.0002 -0.0024 -0.0379 7   TRP A C   
48   O O   . TRP A 7   ? 0.1885 0.2401 0.2676 -0.0213 0.0057  -0.0239 7   TRP A O   
49   C CB  . TRP A 7   ? 0.1969 0.2573 0.2501 -0.0122 -0.0037 -0.0334 7   TRP A CB  
50   C CG  . TRP A 7   ? 0.1983 0.2531 0.2482 -0.0157 0.0112  -0.0300 7   TRP A CG  
51   C CD1 . TRP A 7   ? 0.2003 0.2706 0.2429 -0.0152 0.0142  -0.0352 7   TRP A CD1 
52   C CD2 . TRP A 7   ? 0.1804 0.2505 0.2348 -0.0180 0.0079  -0.0377 7   TRP A CD2 
53   N NE1 . TRP A 7   ? 0.2214 0.2629 0.2486 -0.0307 0.0227  -0.0375 7   TRP A NE1 
54   C CE2 . TRP A 7   ? 0.1977 0.2563 0.2402 -0.0141 0.0192  -0.0325 7   TRP A CE2 
55   C CE3 . TRP A 7   ? 0.1809 0.2617 0.2303 -0.0173 0.0198  -0.0296 7   TRP A CE3 
56   C CZ2 . TRP A 7   ? 0.2243 0.2638 0.2494 -0.0135 0.0108  -0.0403 7   TRP A CZ2 
57   C CZ3 . TRP A 7   ? 0.2157 0.2699 0.2609 -0.0212 0.0158  -0.0406 7   TRP A CZ3 
58   C CH2 . TRP A 7   ? 0.2066 0.2649 0.2466 -0.0284 0.0158  -0.0330 7   TRP A CH2 
59   N N   . LYS A 8   ? 0.1897 0.2449 0.2492 0.0005  -0.0168 -0.0463 8   LYS A N   
60   C CA  . LYS A 8   ? 0.2183 0.2332 0.2540 0.0087  -0.0339 -0.0357 8   LYS A CA  
61   C C   . LYS A 8   ? 0.1924 0.2225 0.2275 0.0015  -0.0242 -0.0340 8   LYS A C   
62   O O   . LYS A 8   ? 0.1853 0.2421 0.2437 0.0123  -0.0220 -0.0383 8   LYS A O   
63   C CB  . LYS A 8   ? 0.2796 0.2530 0.2991 0.0060  -0.0196 -0.0394 8   LYS A CB  
64   C CG  . LYS A 8   ? 0.2665 0.2661 0.2925 0.0064  -0.0040 -0.0205 8   LYS A CG  
65   C CD  . LYS A 8   ? 0.2800 0.2611 0.2970 0.0080  0.0014  -0.0167 8   LYS A CD  
66   C CE  . LYS A 8   ? 0.2911 0.3034 0.3250 0.0040  -0.0030 0.0058  8   LYS A CE  
67   N NZ  . LYS A 8   ? 0.2885 0.2620 0.2924 0.0095  0.0030  -0.0217 8   LYS A NZ  
68   N N   . ILE A 9   ? 0.2050 0.2252 0.2318 0.0141  0.0044  -0.0585 9   ILE A N   
69   C CA  . ILE A 9   ? 0.1995 0.2278 0.1881 -0.0047 -0.0017 -0.0452 9   ILE A CA  
70   C C   . ILE A 9   ? 0.2085 0.2463 0.2173 0.0073  0.0018  -0.0370 9   ILE A C   
71   O O   . ILE A 9   ? 0.2001 0.2359 0.1967 0.0113  -0.0200 -0.0446 9   ILE A O   
72   C CB  . ILE A 9   ? 0.1905 0.2148 0.2261 0.0007  0.0007  -0.0231 9   ILE A CB  
73   C CG1 . ILE A 9   ? 0.1843 0.2444 0.2330 0.0021  -0.0009 -0.0177 9   ILE A CG1 
74   C CG2 . ILE A 9   ? 0.2603 0.2461 0.2669 -0.0093 0.0112  -0.0154 9   ILE A CG2 
75   C CD1 . ILE A 9   ? 0.1941 0.2537 0.2262 -0.0169 -0.0047 -0.0228 9   ILE A CD1 
76   N N   . ILE A 10  ? 0.1561 0.2382 0.1844 0.0082  -0.0040 -0.0564 10  ILE A N   
77   C CA  . ILE A 10  ? 0.1975 0.2715 0.2037 0.0038  0.0067  -0.0368 10  ILE A CA  
78   C C   . ILE A 10  ? 0.1603 0.2294 0.1759 0.0143  0.0098  -0.0587 10  ILE A C   
79   O O   . ILE A 10  ? 0.1914 0.2700 0.2262 -0.0103 -0.0151 -0.0461 10  ILE A O   
80   C CB  . ILE A 10  ? 0.2008 0.2509 0.2009 0.0137  0.0128  -0.0392 10  ILE A CB  
81   C CG1 . ILE A 10  ? 0.2402 0.2708 0.2237 -0.0076 0.0241  -0.0190 10  ILE A CG1 
82   C CG2 . ILE A 10  ? 0.1915 0.2897 0.2307 0.0106  0.0070  -0.0417 10  ILE A CG2 
83   C CD1 . ILE A 10  ? 0.2529 0.2853 0.2299 -0.0154 0.0338  -0.0190 10  ILE A CD1 
84   N N   . ARG A 11  ? 0.1971 0.2579 0.2311 0.0179  0.0075  -0.0342 11  ARG A N   
85   C CA  . ARG A 11  ? 0.2078 0.2668 0.2337 0.0118  -0.0056 -0.0280 11  ARG A CA  
86   C C   . ARG A 11  ? 0.1282 0.2022 0.1756 -0.0011 -0.0317 -0.0708 11  ARG A C   
87   O O   . ARG A 11  ? 0.2082 0.2461 0.2474 0.0080  0.0146  -0.0200 11  ARG A O   
88   C CB  . ARG A 11  ? 0.2433 0.2797 0.2704 0.0035  -0.0092 -0.0214 11  ARG A CB  
89   C CG  . ARG A 11  ? 0.3000 0.3240 0.2785 -0.0027 -0.0213 -0.0107 11  ARG A CG  
90   C CD  . ARG A 11  ? 0.3139 0.3342 0.2923 0.0065  -0.0041 -0.0026 11  ARG A CD  
91   N NE  . ARG A 11  ? 0.3271 0.3693 0.3055 0.0048  0.0105  -0.0084 11  ARG A NE  
92   C CZ  . ARG A 11  ? 0.3438 0.3768 0.3235 0.0003  0.0060  -0.0034 11  ARG A CZ  
93   N NH1 . ARG A 11  ? 0.3411 0.3847 0.3431 0.0174  0.0124  0.0032  11  ARG A NH1 
94   N NH2 . ARG A 11  ? 0.3443 0.3682 0.3089 -0.0008 0.0039  0.0033  11  ARG A NH2 
95   N N   . SER A 12  ? 0.2119 0.2529 0.2413 0.0320  0.0253  -0.0326 12  SER A N   
96   C CA  . SER A 12  ? 0.1698 0.2428 0.1928 0.0132  -0.0153 -0.0299 12  SER A CA  
97   C C   . SER A 12  ? 0.1991 0.2579 0.2404 0.0385  -0.0144 -0.0036 12  SER A C   
98   O O   . SER A 12  ? 0.1784 0.2148 0.1997 0.0136  -0.0165 -0.0545 12  SER A O   
99   C CB  . SER A 12  ? 0.2306 0.2502 0.2237 0.0245  -0.0046 -0.0221 12  SER A CB  
100  O OG  . SER A 12  ? 0.2068 0.2748 0.2142 0.0300  -0.0220 -0.0439 12  SER A OG  
101  N N   . GLU A 13  ? 0.1751 0.2221 0.1660 0.0220  -0.0211 -0.0463 13  GLU A N   
102  C CA  . GLU A 13  ? 0.1757 0.2312 0.1784 0.0138  -0.0159 -0.0253 13  GLU A CA  
103  C C   . GLU A 13  ? 0.1628 0.2225 0.1642 0.0065  -0.0192 -0.0416 13  GLU A C   
104  O O   . GLU A 13  ? 0.2024 0.2377 0.1828 0.0197  -0.0049 -0.0382 13  GLU A O   
105  C CB  . GLU A 13  ? 0.2251 0.2527 0.1949 0.0042  -0.0019 -0.0081 13  GLU A CB  
106  C CG  . GLU A 13  ? 0.2441 0.2616 0.2036 -0.0004 0.0138  -0.0354 13  GLU A CG  
107  C CD  . GLU A 13  ? 0.2347 0.2529 0.1788 0.0096  0.0037  -0.0423 13  GLU A CD  
108  O OE1 . GLU A 13  ? 0.3031 0.3078 0.2667 0.0169  -0.0055 -0.0243 13  GLU A OE1 
109  O OE2 . GLU A 13  ? 0.2853 0.2648 0.1945 -0.0044 -0.0027 -0.0288 13  GLU A OE2 
110  N N   . ASN A 14  ? 0.1962 0.2703 0.1891 0.0047  -0.0026 -0.0164 14  ASN A N   
111  C CA  A ASN A 14  ? 0.2044 0.2398 0.1851 0.0182  -0.0023 -0.0183 14  ASN A CA  
112  C CA  B ASN A 14  ? 0.2086 0.2452 0.1910 0.0173  -0.0023 -0.0173 14  ASN A CA  
113  C C   . ASN A 14  ? 0.1854 0.2349 0.1808 0.0215  -0.0010 -0.0231 14  ASN A C   
114  O O   . ASN A 14  ? 0.2103 0.2545 0.2242 0.0141  0.0077  -0.0217 14  ASN A O   
115  C CB  A ASN A 14  ? 0.2273 0.2574 0.2098 0.0225  -0.0014 -0.0025 14  ASN A CB  
116  C CB  B ASN A 14  ? 0.2423 0.2682 0.2302 0.0166  -0.0007 0.0012  14  ASN A CB  
117  C CG  A ASN A 14  ? 0.2358 0.2572 0.2156 0.0149  -0.0123 -0.0068 14  ASN A CG  
118  C CG  B ASN A 14  ? 0.2516 0.2627 0.2379 0.0022  -0.0190 -0.0053 14  ASN A CG  
119  O OD1 A ASN A 14  ? 0.2426 0.2581 0.1927 0.0226  -0.0041 -0.0263 14  ASN A OD1 
120  O OD1 B ASN A 14  ? 0.2786 0.2972 0.2718 0.0012  -0.0010 0.0067  14  ASN A OD1 
121  N ND2 A ASN A 14  ? 0.2635 0.2703 0.2463 0.0124  0.0021  -0.0130 14  ASN A ND2 
122  N ND2 B ASN A 14  ? 0.2828 0.2951 0.2742 0.0085  -0.0077 -0.0004 14  ASN A ND2 
123  N N   . PHE A 15  ? 0.1896 0.2240 0.1691 -0.0052 -0.0069 -0.0192 15  PHE A N   
124  C CA  . PHE A 15  ? 0.1876 0.2465 0.1886 0.0184  -0.0041 -0.0180 15  PHE A CA  
125  C C   . PHE A 15  ? 0.2259 0.2557 0.2325 -0.0125 0.0056  -0.0154 15  PHE A C   
126  O O   . PHE A 15  ? 0.2308 0.2142 0.1791 0.0052  0.0145  -0.0407 15  PHE A O   
127  C CB  . PHE A 15  ? 0.2375 0.2660 0.2115 0.0131  -0.0115 0.0016  15  PHE A CB  
128  C CG  . PHE A 15  ? 0.2665 0.2975 0.2293 0.0083  -0.0045 -0.0052 15  PHE A CG  
129  C CD1 . PHE A 15  ? 0.3016 0.3240 0.2388 0.0085  -0.0046 -0.0042 15  PHE A CD1 
130  C CD2 . PHE A 15  ? 0.3189 0.3327 0.2295 0.0011  -0.0061 -0.0048 15  PHE A CD2 
131  C CE1 . PHE A 15  ? 0.3176 0.3414 0.2596 0.0086  -0.0014 -0.0039 15  PHE A CE1 
132  C CE2 . PHE A 15  ? 0.3396 0.3468 0.2382 -0.0019 -0.0041 0.0033  15  PHE A CE2 
133  C CZ  . PHE A 15  ? 0.3123 0.3333 0.2475 0.0005  -0.0083 0.0063  15  PHE A CZ  
134  N N   . GLU A 16  ? 0.1803 0.2261 0.2274 0.0098  0.0090  -0.0343 16  GLU A N   
135  C CA  . GLU A 16  ? 0.2129 0.2492 0.2391 -0.0027 0.0088  -0.0211 16  GLU A CA  
136  C C   . GLU A 16  ? 0.2401 0.2542 0.2311 0.0085  0.0057  -0.0062 16  GLU A C   
137  O O   . GLU A 16  ? 0.2216 0.2640 0.1958 0.0286  0.0252  -0.0141 16  GLU A O   
138  C CB  . GLU A 16  ? 0.2169 0.2545 0.2232 -0.0012 0.0105  -0.0133 16  GLU A CB  
139  C CG  . GLU A 16  ? 0.2149 0.2868 0.2640 -0.0226 0.0085  -0.0257 16  GLU A CG  
140  C CD  . GLU A 16  ? 0.2546 0.3046 0.3016 -0.0098 0.0088  -0.0177 16  GLU A CD  
141  O OE1 . GLU A 16  ? 0.2293 0.2921 0.2629 -0.0091 0.0426  -0.0607 16  GLU A OE1 
142  O OE2 . GLU A 16  ? 0.2269 0.3131 0.2897 -0.0056 0.0348  -0.0332 16  GLU A OE2 
143  N N   . GLU A 17  ? 0.2179 0.2613 0.2105 0.0127  0.0122  -0.0080 17  GLU A N   
144  C CA  . GLU A 17  ? 0.2521 0.2826 0.2366 0.0263  0.0089  -0.0002 17  GLU A CA  
145  C C   . GLU A 17  ? 0.2646 0.2844 0.2601 0.0251  -0.0110 0.0002  17  GLU A C   
146  O O   . GLU A 17  ? 0.2502 0.3109 0.2453 0.0599  0.0109  -0.0048 17  GLU A O   
147  C CB  . GLU A 17  ? 0.2735 0.3201 0.2509 0.0264  0.0147  0.0116  17  GLU A CB  
148  C CG  . GLU A 17  ? 0.3035 0.3369 0.3002 0.0221  0.0091  0.0114  17  GLU A CG  
149  C CD  . GLU A 17  ? 0.3159 0.3500 0.3050 0.0216  -0.0064 0.0051  17  GLU A CD  
150  O OE1 . GLU A 17  ? 0.3412 0.3898 0.3399 0.0150  -0.0129 -0.0139 17  GLU A OE1 
151  O OE2 . GLU A 17  ? 0.3189 0.4135 0.3432 0.0360  0.0082  -0.0069 17  GLU A OE2 
152  N N   . LEU A 18  ? 0.2657 0.2558 0.2232 0.0108  -0.0004 -0.0091 18  LEU A N   
153  C CA  . LEU A 18  ? 0.2782 0.2390 0.2144 0.0296  0.0078  -0.0062 18  LEU A CA  
154  C C   . LEU A 18  ? 0.2925 0.2778 0.2607 0.0140  -0.0045 0.0104  18  LEU A C   
155  O O   . LEU A 18  ? 0.2800 0.2553 0.2325 0.0594  0.0450  -0.0204 18  LEU A O   
156  C CB  . LEU A 18  ? 0.3052 0.2653 0.2461 -0.0066 0.0067  -0.0211 18  LEU A CB  
157  C CG  . LEU A 18  ? 0.3442 0.2708 0.2681 0.0151  -0.0009 -0.0207 18  LEU A CG  
158  C CD1 . LEU A 18  ? 0.3968 0.3032 0.3208 0.0084  -0.0114 -0.0087 18  LEU A CD1 
159  C CD2 . LEU A 18  ? 0.3371 0.3065 0.2711 -0.0170 0.0065  -0.0206 18  LEU A CD2 
160  N N   . LEU A 19  ? 0.2366 0.2383 0.1941 0.0361  0.0291  -0.0044 19  LEU A N   
161  C CA  . LEU A 19  ? 0.2246 0.2583 0.2174 0.0180  0.0063  0.0081  19  LEU A CA  
162  C C   . LEU A 19  ? 0.1912 0.2902 0.1659 0.0354  0.0452  -0.0152 19  LEU A C   
163  O O   . LEU A 19  ? 0.3087 0.3493 0.2561 0.0270  -0.0111 0.0062  19  LEU A O   
164  C CB  . LEU A 19  ? 0.2102 0.2449 0.2338 0.0185  0.0065  -0.0094 19  LEU A CB  
165  C CG  . LEU A 19  ? 0.2074 0.2362 0.2449 0.0268  0.0026  -0.0118 19  LEU A CG  
166  C CD1 . LEU A 19  ? 0.2750 0.2558 0.2542 0.0059  -0.0153 0.0037  19  LEU A CD1 
167  C CD2 . LEU A 19  ? 0.2488 0.2946 0.2621 0.0272  0.0036  -0.0200 19  LEU A CD2 
168  N N   . LYS A 20  ? 0.2091 0.3039 0.2476 0.0160  -0.0054 0.0146  20  LYS A N   
169  C CA  . LYS A 20  ? 0.2218 0.3217 0.2422 0.0279  -0.0078 -0.0042 20  LYS A CA  
170  C C   . LYS A 20  ? 0.2315 0.3093 0.2578 0.0429  0.0129  0.0099  20  LYS A C   
171  O O   . LYS A 20  ? 0.2630 0.3538 0.2753 0.0593  0.0334  0.0252  20  LYS A O   
172  C CB  . LYS A 20  ? 0.2077 0.3341 0.2422 0.0183  -0.0243 -0.0219 20  LYS A CB  
173  C CG  . LYS A 20  ? 0.2016 0.3623 0.2580 0.0209  -0.0200 -0.0037 20  LYS A CG  
174  C CD  . LYS A 20  ? 0.2486 0.3864 0.2734 0.0205  -0.0212 -0.0065 20  LYS A CD  
175  C CE  . LYS A 20  ? 0.2757 0.4161 0.3028 0.0099  -0.0152 -0.0189 20  LYS A CE  
176  N NZ  . LYS A 20  ? 0.3080 0.4446 0.2818 0.0064  -0.0095 -0.0230 20  LYS A NZ  
177  N N   . VAL A 21  ? 0.2898 0.3003 0.2940 0.0537  0.0114  0.0006  21  VAL A N   
178  C CA  . VAL A 21  ? 0.3397 0.3242 0.3399 0.0430  0.0198  0.0038  21  VAL A CA  
179  C C   . VAL A 21  ? 0.3469 0.3323 0.3250 0.0490  0.0267  -0.0077 21  VAL A C   
180  O O   . VAL A 21  ? 0.3359 0.3497 0.3634 0.0636  0.0346  0.0039  21  VAL A O   
181  C CB  . VAL A 21  ? 0.3654 0.3299 0.3434 0.0330  0.0121  0.0105  21  VAL A CB  
182  C CG1 . VAL A 21  ? 0.4132 0.3563 0.3807 0.0329  0.0068  -0.0028 21  VAL A CG1 
183  C CG2 . VAL A 21  ? 0.3788 0.3427 0.3791 0.0190  0.0164  0.0010  21  VAL A CG2 
184  N N   . LEU A 22  ? 0.3327 0.3298 0.2862 0.0489  0.0296  -0.0151 22  LEU A N   
185  C CA  . LEU A 22  ? 0.3607 0.3338 0.3021 0.0144  0.0331  -0.0070 22  LEU A CA  
186  C C   . LEU A 22  ? 0.3798 0.3488 0.3212 0.0151  0.0316  0.0019  22  LEU A C   
187  O O   . LEU A 22  ? 0.4229 0.3757 0.3148 0.0185  0.0675  -0.0216 22  LEU A O   
188  C CB  . LEU A 22  ? 0.3732 0.3337 0.2993 0.0193  0.0241  -0.0001 22  LEU A CB  
189  C CG  . LEU A 22  ? 0.3630 0.3248 0.3098 0.0103  0.0278  -0.0068 22  LEU A CG  
190  C CD1 . LEU A 22  ? 0.3682 0.3596 0.3008 0.0046  0.0241  -0.0067 22  LEU A CD1 
191  C CD2 . LEU A 22  ? 0.3860 0.3366 0.3238 0.0052  0.0249  0.0051  22  LEU A CD2 
192  N N   . GLY A 23  ? 0.3463 0.3304 0.3080 0.0344  0.0335  -0.0044 23  GLY A N   
193  C CA  . GLY A 23  ? 0.3337 0.3360 0.3019 0.0408  0.0312  0.0058  23  GLY A CA  
194  C C   . GLY A 23  ? 0.3416 0.3570 0.3163 0.0260  0.0149  0.0108  23  GLY A C   
195  O O   . GLY A 23  ? 0.2900 0.3809 0.3045 0.0417  0.0504  0.0089  23  GLY A O   
196  N N   . VAL A 24  ? 0.2918 0.3414 0.2344 0.0496  0.0316  -0.0125 24  VAL A N   
197  C CA  . VAL A 24  ? 0.3148 0.3396 0.2727 0.0309  0.0277  -0.0076 24  VAL A CA  
198  C C   . VAL A 24  ? 0.2837 0.3575 0.3111 0.0242  0.0293  0.0025  24  VAL A C   
199  O O   . VAL A 24  ? 0.2565 0.3638 0.2904 0.0444  0.0373  -0.0169 24  VAL A O   
200  C CB  . VAL A 24  ? 0.3009 0.3333 0.2745 0.0226  0.0291  -0.0080 24  VAL A CB  
201  C CG1 . VAL A 24  ? 0.3281 0.3496 0.2676 0.0175  0.0217  0.0151  24  VAL A CG1 
202  C CG2 . VAL A 24  ? 0.3109 0.3459 0.2495 0.0167  0.0271  -0.0013 24  VAL A CG2 
203  N N   . ASN A 25  ? 0.3239 0.3630 0.3333 0.0376  0.0354  0.0037  25  ASN A N   
204  C CA  . ASN A 25  ? 0.3563 0.3846 0.3653 0.0272  0.0365  -0.0002 25  ASN A CA  
205  C C   . ASN A 25  ? 0.3561 0.3784 0.3779 0.0183  0.0193  0.0011  25  ASN A C   
206  O O   . ASN A 25  ? 0.3354 0.3720 0.3728 0.0214  0.0293  -0.0072 25  ASN A O   
207  C CB  . ASN A 25  ? 0.4163 0.4253 0.4018 0.0211  0.0329  0.0090  25  ASN A CB  
208  C CG  . ASN A 25  ? 0.4712 0.4607 0.4094 0.0251  0.0246  0.0098  25  ASN A CG  
209  O OD1 . ASN A 25  ? 0.4997 0.4833 0.4387 0.0287  0.0243  0.0134  25  ASN A OD1 
210  N ND2 . ASN A 25  ? 0.5108 0.4952 0.4512 0.0192  0.0178  -0.0038 25  ASN A ND2 
211  N N   . VAL A 26  ? 0.3460 0.3744 0.3573 0.0225  0.0320  -0.0010 26  VAL A N   
212  C CA  . VAL A 26  ? 0.3666 0.3798 0.3808 0.0141  0.0176  -0.0027 26  VAL A CA  
213  C C   . VAL A 26  ? 0.3618 0.3852 0.3898 0.0138  0.0134  -0.0002 26  VAL A C   
214  O O   . VAL A 26  ? 0.3348 0.3806 0.3920 0.0197  0.0059  -0.0072 26  VAL A O   
215  C CB  . VAL A 26  ? 0.3788 0.3938 0.3902 0.0105  0.0167  -0.0107 26  VAL A CB  
216  C CG1 . VAL A 26  ? 0.3778 0.4042 0.4174 0.0013  0.0188  0.0016  26  VAL A CG1 
217  C CG2 . VAL A 26  ? 0.3760 0.3862 0.3868 0.0101  0.0199  -0.0115 26  VAL A CG2 
218  N N   . MET A 27  ? 0.3814 0.3916 0.4042 0.0093  0.0025  0.0105  27  MET A N   
219  C CA  . MET A 27  ? 0.4337 0.4143 0.4318 0.0273  -0.0089 0.0037  27  MET A CA  
220  C C   . MET A 27  ? 0.3974 0.3922 0.3920 0.0112  0.0034  0.0101  27  MET A C   
221  O O   . MET A 27  ? 0.4158 0.3900 0.4078 0.0228  0.0111  0.0003  27  MET A O   
222  C CB  . MET A 27  ? 0.3566 0.3864 0.4145 -0.0350 0.0043  0.0152  27  MET A CB  
223  C CG  . MET A 27  ? 0.4623 0.4495 0.4575 0.0284  0.0027  -0.0002 27  MET A CG  
224  S SD  . MET A 27  ? 0.3865 0.4064 0.4096 -0.0321 0.0061  0.0121  27  MET A SD  
225  C CE  . MET A 27  ? 0.4870 0.4639 0.4434 0.0394  0.0099  0.0087  27  MET A CE  
226  N N   . LEU A 28  ? 0.3757 0.3801 0.3575 0.0128  0.0114  0.0128  28  LEU A N   
227  C CA  . LEU A 28  ? 0.3835 0.3692 0.3441 0.0130  0.0216  0.0119  28  LEU A CA  
228  C C   . LEU A 28  ? 0.3577 0.3550 0.3183 0.0155  0.0176  0.0006  28  LEU A C   
229  O O   . LEU A 28  ? 0.3581 0.3654 0.3111 0.0270  -0.0007 -0.0178 28  LEU A O   
230  C CB  . LEU A 28  ? 0.4075 0.3885 0.3592 0.0113  0.0183  0.0039  28  LEU A CB  
231  C CG  . LEU A 28  ? 0.4238 0.4109 0.3905 0.0094  0.0201  0.0069  28  LEU A CG  
232  C CD1 . LEU A 28  ? 0.4407 0.4264 0.4013 0.0204  0.0198  0.0000  28  LEU A CD1 
233  C CD2 . LEU A 28  ? 0.4316 0.4199 0.4046 0.0007  0.0111  0.0071  28  LEU A CD2 
234  N N   . ARG A 29  ? 0.3174 0.3380 0.2895 0.0194  -0.0010 -0.0016 29  ARG A N   
235  C CA  . ARG A 29  ? 0.3028 0.3187 0.2894 0.0285  0.0068  0.0005  29  ARG A CA  
236  C C   . ARG A 29  ? 0.3239 0.3260 0.3148 0.0220  -0.0048 0.0005  29  ARG A C   
237  O O   . ARG A 29  ? 0.3165 0.3343 0.3168 0.0180  -0.0096 0.0000  29  ARG A O   
238  C CB  . ARG A 29  ? 0.3080 0.3194 0.2598 0.0317  0.0053  -0.0094 29  ARG A CB  
239  C CG  . ARG A 29  ? 0.2908 0.2991 0.2610 0.0220  -0.0081 0.0064  29  ARG A CG  
240  C CD  . ARG A 29  ? 0.2730 0.3135 0.2360 0.0243  0.0037  -0.0206 29  ARG A CD  
241  N NE  . ARG A 29  ? 0.2556 0.3134 0.2788 0.0091  0.0049  -0.0180 29  ARG A NE  
242  C CZ  . ARG A 29  ? 0.2568 0.3268 0.2761 0.0159  0.0072  -0.0382 29  ARG A CZ  
243  N NH1 . ARG A 29  ? 0.2766 0.3795 0.2955 0.0199  0.0246  -0.0348 29  ARG A NH1 
244  N NH2 . ARG A 29  ? 0.2875 0.3488 0.3035 0.0263  0.0002  -0.0189 29  ARG A NH2 
245  N N   . LYS A 30  ? 0.3326 0.3278 0.3418 0.0132  -0.0068 -0.0051 30  LYS A N   
246  C CA  A LYS A 30  ? 0.3332 0.3385 0.3541 0.0217  -0.0034 -0.0047 30  LYS A CA  
247  C CA  B LYS A 30  ? 0.3350 0.3414 0.3563 0.0204  -0.0033 -0.0049 30  LYS A CA  
248  C C   . LYS A 30  ? 0.3473 0.3540 0.3607 0.0148  -0.0055 -0.0036 30  LYS A C   
249  O O   . LYS A 30  ? 0.3335 0.3546 0.3716 0.0352  -0.0034 -0.0133 30  LYS A O   
250  C CB  A LYS A 30  ? 0.3464 0.3409 0.3460 0.0078  -0.0055 -0.0065 30  LYS A CB  
251  C CB  B LYS A 30  ? 0.3545 0.3508 0.3528 0.0046  -0.0070 -0.0025 30  LYS A CB  
252  C CG  A LYS A 30  ? 0.3501 0.3500 0.3615 0.0044  0.0008  -0.0008 30  LYS A CG  
253  C CG  B LYS A 30  ? 0.3573 0.3627 0.3689 -0.0012 -0.0053 -0.0041 30  LYS A CG  
254  C CD  A LYS A 30  ? 0.3494 0.3519 0.3576 0.0010  0.0000  -0.0011 30  LYS A CD  
255  C CD  B LYS A 30  ? 0.3622 0.3648 0.3559 -0.0020 -0.0118 -0.0034 30  LYS A CD  
256  C CE  A LYS A 30  ? 0.3475 0.3407 0.3458 0.0032  -0.0044 0.0035  30  LYS A CE  
257  C CE  B LYS A 30  ? 0.3688 0.3593 0.3667 -0.0066 -0.0046 -0.0085 30  LYS A CE  
258  N NZ  A LYS A 30  ? 0.3470 0.3610 0.3556 -0.0037 0.0013  -0.0087 30  LYS A NZ  
259  N NZ  B LYS A 30  ? 0.3658 0.3388 0.3491 -0.0070 -0.0069 -0.0122 30  LYS A NZ  
260  N N   . ILE A 31  ? 0.3468 0.3529 0.3401 0.0255  -0.0032 -0.0072 31  ILE A N   
261  C CA  . ILE A 31  ? 0.3519 0.3578 0.3446 0.0199  -0.0036 -0.0019 31  ILE A CA  
262  C C   . ILE A 31  ? 0.3390 0.3549 0.3291 0.0228  -0.0061 -0.0149 31  ILE A C   
263  O O   . ILE A 31  ? 0.3607 0.3471 0.3540 0.0418  -0.0136 -0.0188 31  ILE A O   
264  C CB  . ILE A 31  ? 0.3648 0.3728 0.3554 0.0024  -0.0042 -0.0005 31  ILE A CB  
265  C CG1 . ILE A 31  ? 0.3692 0.3722 0.3662 0.0060  0.0000  0.0049  31  ILE A CG1 
266  C CG2 . ILE A 31  ? 0.3690 0.3787 0.3580 0.0094  -0.0067 0.0018  31  ILE A CG2 
267  C CD1 . ILE A 31  ? 0.3774 0.3751 0.3752 0.0050  -0.0001 0.0061  31  ILE A CD1 
268  N N   . ALA A 32  ? 0.3238 0.3400 0.2732 0.0267  -0.0060 -0.0018 32  ALA A N   
269  C CA  . ALA A 32  ? 0.3162 0.3243 0.2712 0.0264  -0.0047 -0.0102 32  ALA A CA  
270  C C   . ALA A 32  ? 0.3101 0.3578 0.2849 0.0128  -0.0038 0.0053  32  ALA A C   
271  O O   . ALA A 32  ? 0.3043 0.4006 0.2977 0.0149  -0.0355 0.0206  32  ALA A O   
272  C CB  . ALA A 32  ? 0.3251 0.3382 0.2803 0.0365  -0.0110 -0.0021 32  ALA A CB  
273  N N   . VAL A 33  ? 0.2928 0.3745 0.3019 0.0121  -0.0140 -0.0141 33  VAL A N   
274  C CA  A VAL A 33  ? 0.3355 0.4011 0.3204 0.0067  -0.0097 -0.0132 33  VAL A CA  
275  C CA  B VAL A 33  ? 0.3247 0.3992 0.3148 0.0069  -0.0112 -0.0155 33  VAL A CA  
276  C C   . VAL A 33  ? 0.3342 0.4149 0.3244 0.0040  -0.0094 -0.0293 33  VAL A C   
277  O O   . VAL A 33  ? 0.3505 0.4877 0.3571 0.0043  -0.0104 -0.0515 33  VAL A O   
278  C CB  A VAL A 33  ? 0.3376 0.3909 0.3280 0.0084  -0.0103 -0.0109 33  VAL A CB  
279  C CB  B VAL A 33  ? 0.3157 0.3922 0.3216 0.0000  -0.0082 -0.0149 33  VAL A CB  
280  C CG1 A VAL A 33  ? 0.3665 0.4144 0.3396 -0.0054 -0.0144 -0.0052 33  VAL A CG1 
281  C CG1 B VAL A 33  ? 0.3114 0.3819 0.3156 0.0048  -0.0083 -0.0204 33  VAL A CG1 
282  C CG2 A VAL A 33  ? 0.3725 0.3921 0.3459 0.0001  -0.0043 -0.0101 33  VAL A CG2 
283  C CG2 B VAL A 33  ? 0.3362 0.4001 0.3397 0.0053  -0.0062 -0.0120 33  VAL A CG2 
284  N N   . ALA A 34  ? 0.3370 0.4026 0.3371 0.0208  -0.0260 -0.0307 34  ALA A N   
285  C CA  . ALA A 34  ? 0.3557 0.4111 0.3478 0.0252  -0.0225 -0.0399 34  ALA A CA  
286  C C   . ALA A 34  ? 0.3515 0.4175 0.3482 0.0217  -0.0172 -0.0509 34  ALA A C   
287  O O   . ALA A 34  ? 0.3742 0.4326 0.3722 0.0296  -0.0194 -0.0561 34  ALA A O   
288  C CB  . ALA A 34  ? 0.3575 0.3919 0.3483 0.0184  -0.0099 -0.0364 34  ALA A CB  
289  N N   . ALA A 35  ? 0.3548 0.4049 0.3373 0.0214  -0.0200 -0.0506 35  ALA A N   
290  C CA  . ALA A 35  ? 0.3495 0.3800 0.3365 0.0152  -0.0137 -0.0408 35  ALA A CA  
291  C C   . ALA A 35  ? 0.3609 0.3890 0.3504 0.0107  -0.0160 -0.0409 35  ALA A C   
292  O O   . ALA A 35  ? 0.3664 0.4015 0.3552 0.0170  -0.0178 -0.0602 35  ALA A O   
293  C CB  . ALA A 35  ? 0.3747 0.3958 0.3446 0.0146  -0.0007 -0.0377 35  ALA A CB  
294  N N   . ALA A 36  ? 0.3600 0.3840 0.3406 -0.0004 -0.0281 -0.0409 36  ALA A N   
295  C CA  . ALA A 36  ? 0.3946 0.4077 0.3846 -0.0057 -0.0165 -0.0222 36  ALA A CA  
296  C C   . ALA A 36  ? 0.4171 0.4317 0.4067 -0.0125 -0.0314 -0.0006 36  ALA A C   
297  O O   . ALA A 36  ? 0.4326 0.4251 0.4566 -0.0071 -0.0612 0.0027  36  ALA A O   
298  C CB  . ALA A 36  ? 0.4094 0.4119 0.3949 -0.0041 -0.0213 -0.0231 36  ALA A CB  
299  N N   . SER A 37  ? 0.4329 0.4339 0.3968 -0.0134 -0.0120 -0.0192 37  SER A N   
300  C CA  . SER A 37  ? 0.4453 0.4669 0.4091 -0.0165 -0.0162 -0.0062 37  SER A CA  
301  C C   . SER A 37  ? 0.4379 0.4624 0.3850 -0.0261 -0.0145 -0.0026 37  SER A C   
302  O O   . SER A 37  ? 0.4489 0.4924 0.3596 -0.0375 -0.0215 -0.0059 37  SER A O   
303  C CB  . SER A 37  ? 0.4514 0.4893 0.4308 -0.0166 -0.0143 -0.0136 37  SER A CB  
304  O OG  . SER A 37  ? 0.4790 0.5392 0.4695 -0.0129 -0.0159 -0.0083 37  SER A OG  
305  N N   . LYS A 38  ? 0.4053 0.4237 0.3556 -0.0265 -0.0217 -0.0084 38  LYS A N   
306  C CA  . LYS A 38  ? 0.4140 0.4060 0.3520 -0.0170 -0.0178 -0.0115 38  LYS A CA  
307  C C   . LYS A 38  ? 0.3635 0.3559 0.2945 -0.0117 -0.0168 -0.0081 38  LYS A C   
308  O O   . LYS A 38  ? 0.3867 0.3645 0.3552 -0.0012 0.0070  -0.0173 38  LYS A O   
309  C CB  . LYS A 38  ? 0.4389 0.4185 0.3819 -0.0111 -0.0100 -0.0082 38  LYS A CB  
310  C CG  . LYS A 38  ? 0.4976 0.4706 0.4398 -0.0049 -0.0036 -0.0095 38  LYS A CG  
311  C CD  . LYS A 38  ? 0.5169 0.4881 0.4828 -0.0067 -0.0015 -0.0053 38  LYS A CD  
312  C CE  . LYS A 38  ? 0.5225 0.5129 0.4863 0.0021  -0.0015 0.0012  38  LYS A CE  
313  N NZ  . LYS A 38  ? 0.5489 0.5409 0.5345 -0.0027 -0.0006 -0.0047 38  LYS A NZ  
314  N N   . PRO A 39  ? 0.3395 0.3428 0.2730 -0.0075 -0.0240 -0.0170 39  PRO A N   
315  C CA  . PRO A 39  ? 0.3134 0.3132 0.2531 -0.0117 -0.0149 -0.0149 39  PRO A CA  
316  C C   . PRO A 39  ? 0.3107 0.3040 0.2448 -0.0050 -0.0119 -0.0141 39  PRO A C   
317  O O   . PRO A 39  ? 0.3165 0.3259 0.2810 0.0062  0.0021  0.0059  39  PRO A O   
318  C CB  . PRO A 39  ? 0.3216 0.3227 0.2550 -0.0196 -0.0231 -0.0130 39  PRO A CB  
319  C CG  . PRO A 39  ? 0.3567 0.3356 0.2871 -0.0118 -0.0099 0.0084  39  PRO A CG  
320  C CD  . PRO A 39  ? 0.3561 0.3410 0.2958 -0.0134 -0.0209 -0.0024 39  PRO A CD  
321  N N   . ALA A 40  ? 0.2831 0.2902 0.2486 0.0070  -0.0089 -0.0171 40  ALA A N   
322  C CA  . ALA A 40  ? 0.2906 0.2543 0.2543 -0.0087 -0.0031 -0.0325 40  ALA A CA  
323  C C   . ALA A 40  ? 0.2683 0.2605 0.2395 -0.0103 0.0076  -0.0308 40  ALA A C   
324  O O   . ALA A 40  ? 0.3076 0.2784 0.2403 -0.0091 0.0352  -0.0404 40  ALA A O   
325  C CB  . ALA A 40  ? 0.2917 0.2717 0.2805 0.0001  -0.0106 -0.0280 40  ALA A CB  
326  N N   . VAL A 41  ? 0.2484 0.2689 0.2468 -0.0041 -0.0090 -0.0423 41  VAL A N   
327  C CA  . VAL A 41  ? 0.1888 0.2643 0.2381 -0.0103 -0.0075 -0.0272 41  VAL A CA  
328  C C   . VAL A 41  ? 0.2316 0.2970 0.2759 -0.0160 0.0027  -0.0054 41  VAL A C   
329  O O   . VAL A 41  ? 0.1720 0.3423 0.2229 -0.0046 0.0212  -0.0751 41  VAL A O   
330  C CB  . VAL A 41  ? 0.2357 0.2844 0.2581 -0.0138 0.0067  -0.0081 41  VAL A CB  
331  C CG1 . VAL A 41  ? 0.2421 0.2814 0.2615 -0.0054 -0.0089 0.0034  41  VAL A CG1 
332  C CG2 . VAL A 41  ? 0.2108 0.3276 0.2655 -0.0044 -0.0153 -0.0045 41  VAL A CG2 
333  N N   . GLU A 42  ? 0.1531 0.2227 0.2057 -0.0221 0.0025  -0.0506 42  GLU A N   
334  C CA  . GLU A 42  ? 0.2455 0.2691 0.3017 -0.0117 0.0020  -0.0255 42  GLU A CA  
335  C C   . GLU A 42  ? 0.2124 0.2323 0.2262 0.0017  0.0164  -0.0452 42  GLU A C   
336  O O   . GLU A 42  ? 0.2318 0.2672 0.2646 -0.0139 0.0080  -0.0251 42  GLU A O   
337  C CB  . GLU A 42  ? 0.2321 0.2920 0.3012 0.0111  -0.0124 -0.0219 42  GLU A CB  
338  C CG  . GLU A 42  ? 0.2912 0.3608 0.3864 -0.0082 -0.0157 -0.0090 42  GLU A CG  
339  C CD  . GLU A 42  ? 0.3073 0.3738 0.3663 -0.0092 -0.0234 0.0031  42  GLU A CD  
340  O OE1 . GLU A 42  ? 0.3821 0.4389 0.4291 0.0048  -0.0114 0.0354  42  GLU A OE1 
341  O OE2 . GLU A 42  ? 0.3782 0.4501 0.4390 -0.0065 -0.0182 0.0016  42  GLU A OE2 
342  N N   . ILE A 43  ? 0.2164 0.2247 0.2348 -0.0132 -0.0058 -0.0343 43  ILE A N   
343  C CA  . ILE A 43  ? 0.2045 0.2477 0.2437 -0.0024 0.0054  -0.0360 43  ILE A CA  
344  C C   . ILE A 43  ? 0.2323 0.2609 0.2804 -0.0164 0.0031  -0.0453 43  ILE A C   
345  O O   . ILE A 43  ? 0.1788 0.2956 0.2850 -0.0216 0.0351  -0.0601 43  ILE A O   
346  C CB  . ILE A 43  ? 0.1953 0.2284 0.2530 -0.0151 0.0015  -0.0379 43  ILE A CB  
347  C CG1 . ILE A 43  ? 0.1789 0.2650 0.1991 -0.0132 0.0054  -0.0253 43  ILE A CG1 
348  C CG2 . ILE A 43  ? 0.2250 0.2261 0.2591 -0.0088 0.0177  -0.0471 43  ILE A CG2 
349  C CD1 . ILE A 43  ? 0.2299 0.2638 0.2300 -0.0074 0.0099  -0.0179 43  ILE A CD1 
350  N N   . LYS A 44  ? 0.1776 0.2662 0.2328 -0.0247 0.0010  -0.0396 44  LYS A N   
351  C CA  A LYS A 44  ? 0.1860 0.2521 0.2687 -0.0229 0.0013  -0.0247 44  LYS A CA  
352  C CA  B LYS A 44  ? 0.1997 0.2608 0.2772 -0.0191 0.0010  -0.0231 44  LYS A CA  
353  C C   . LYS A 44  ? 0.2058 0.2746 0.2836 -0.0245 -0.0112 -0.0304 44  LYS A C   
354  O O   . LYS A 44  ? 0.1638 0.2844 0.2839 -0.0246 0.0307  -0.0389 44  LYS A O   
355  C CB  A LYS A 44  ? 0.1646 0.2555 0.2679 -0.0313 0.0041  -0.0164 44  LYS A CB  
356  C CB  B LYS A 44  ? 0.2145 0.2873 0.2851 -0.0188 0.0031  -0.0091 44  LYS A CB  
357  C CG  A LYS A 44  ? 0.1916 0.2469 0.2500 -0.0371 0.0039  -0.0115 44  LYS A CG  
358  C CG  B LYS A 44  ? 0.2691 0.3061 0.2911 -0.0029 0.0082  -0.0038 44  LYS A CG  
359  C CD  A LYS A 44  ? 0.2944 0.2944 0.2944 0.0000  0.0000  0.0000  44  LYS A CD  
360  C CD  B LYS A 44  ? 0.3056 0.3282 0.2935 0.0022  -0.0002 0.0126  44  LYS A CD  
361  C CE  A LYS A 44  ? 0.3037 0.3037 0.3037 0.0000  0.0000  0.0000  44  LYS A CE  
362  C CE  B LYS A 44  ? 0.3449 0.3409 0.3209 0.0045  0.0036  0.0000  44  LYS A CE  
363  N NZ  A LYS A 44  ? 0.3023 0.3023 0.3023 0.0000  0.0000  0.0000  44  LYS A NZ  
364  N NZ  B LYS A 44  ? 0.3356 0.3427 0.2714 0.0224  0.0087  0.0086  44  LYS A NZ  
365  N N   . GLN A 45  ? 0.1848 0.2603 0.2531 -0.0380 -0.0046 -0.0318 45  GLN A N   
366  C CA  . GLN A 45  ? 0.1882 0.2719 0.2672 -0.0217 -0.0016 -0.0164 45  GLN A CA  
367  C C   . GLN A 45  ? 0.1797 0.2640 0.2535 -0.0246 -0.0079 -0.0375 45  GLN A C   
368  O O   . GLN A 45  ? 0.2217 0.3213 0.2916 -0.0288 -0.0076 -0.0569 45  GLN A O   
369  C CB  . GLN A 45  ? 0.1829 0.2631 0.2508 -0.0210 0.0160  -0.0199 45  GLN A CB  
370  C CG  . GLN A 45  ? 0.2225 0.2568 0.2546 -0.0288 0.0128  -0.0137 45  GLN A CG  
371  C CD  . GLN A 45  ? 0.2278 0.2794 0.2658 -0.0255 0.0179  -0.0143 45  GLN A CD  
372  O OE1 . GLN A 45  ? 0.2410 0.2941 0.2586 -0.0460 0.0225  -0.0569 45  GLN A OE1 
373  N NE2 . GLN A 45  ? 0.2621 0.2679 0.2646 -0.0238 0.0066  -0.0252 45  GLN A NE2 
374  N N   . GLU A 46  ? 0.1757 0.2625 0.2276 -0.0552 0.0000  -0.0475 46  GLU A N   
375  C CA  . GLU A 46  ? 0.2151 0.2914 0.2546 -0.0216 -0.0040 -0.0078 46  GLU A CA  
376  C C   . GLU A 46  ? 0.1925 0.2720 0.2386 -0.0423 0.0146  -0.0094 46  GLU A C   
377  O O   . GLU A 46  ? 0.2157 0.2746 0.2777 -0.0399 0.0025  -0.0330 46  GLU A O   
378  C CB  . GLU A 46  ? 0.2126 0.2809 0.2230 -0.0252 -0.0214 -0.0274 46  GLU A CB  
379  C CG  . GLU A 46  ? 0.2521 0.2764 0.2440 -0.0160 -0.0251 0.0170  46  GLU A CG  
380  C CD  . GLU A 46  ? 0.2443 0.2931 0.2450 -0.0186 -0.0234 -0.0127 46  GLU A CD  
381  O OE1 . GLU A 46  ? 0.2987 0.3150 0.2977 -0.0169 -0.0236 0.0072  46  GLU A OE1 
382  O OE2 . GLU A 46  ? 0.2442 0.3184 0.2265 -0.0082 0.0036  0.0026  46  GLU A OE2 
383  N N   . GLY A 47  ? 0.2119 0.3140 0.2564 -0.0312 0.0175  -0.0035 47  GLY A N   
384  C CA  . GLY A 47  ? 0.1986 0.3084 0.2545 -0.0102 0.0198  0.0014  47  GLY A CA  
385  C C   . GLY A 47  ? 0.1993 0.2748 0.2557 -0.0375 0.0079  -0.0108 47  GLY A C   
386  O O   . GLY A 47  ? 0.2235 0.3072 0.2769 -0.0116 0.0060  -0.0347 47  GLY A O   
387  N N   . ASP A 48  ? 0.1972 0.2583 0.2732 -0.0088 0.0146  -0.0010 48  ASP A N   
388  C CA  . ASP A 48  ? 0.2294 0.2499 0.2812 -0.0177 0.0123  0.0036  48  ASP A CA  
389  C C   . ASP A 48  ? 0.2305 0.2535 0.2507 -0.0201 0.0174  -0.0143 48  ASP A C   
390  O O   . ASP A 48  ? 0.2286 0.2685 0.2772 -0.0184 0.0262  -0.0212 48  ASP A O   
391  C CB  . ASP A 48  ? 0.2865 0.2511 0.2936 -0.0265 0.0027  -0.0016 48  ASP A CB  
392  C CG  . ASP A 48  ? 0.3221 0.2616 0.3316 -0.0213 0.0027  0.0050  48  ASP A CG  
393  O OD1 . ASP A 48  ? 0.3188 0.2721 0.3490 -0.0496 -0.0057 0.0258  48  ASP A OD1 
394  O OD2 . ASP A 48  ? 0.3899 0.2787 0.3758 -0.0269 -0.0097 0.0205  48  ASP A OD2 
395  N N   . THR A 49  ? 0.2221 0.2142 0.2346 -0.0401 0.0123  -0.0301 49  THR A N   
396  C CA  . THR A 49  ? 0.2212 0.2153 0.2164 -0.0315 0.0114  -0.0257 49  THR A CA  
397  C C   . THR A 49  ? 0.1990 0.2060 0.2241 -0.0230 0.0195  -0.0271 49  THR A C   
398  O O   . THR A 49  ? 0.2161 0.2407 0.2903 -0.0451 0.0211  -0.0440 49  THR A O   
399  C CB  . THR A 49  ? 0.2423 0.2335 0.2333 -0.0272 0.0117  -0.0143 49  THR A CB  
400  O OG1 . THR A 49  ? 0.2393 0.2550 0.2675 -0.0341 0.0150  -0.0351 49  THR A OG1 
401  C CG2 . THR A 49  ? 0.2162 0.2470 0.2488 -0.0409 0.0110  -0.0134 49  THR A CG2 
402  N N   . PHE A 50  ? 0.2114 0.1988 0.2062 -0.0271 0.0020  -0.0181 50  PHE A N   
403  C CA  . PHE A 50  ? 0.1893 0.2042 0.1804 -0.0256 0.0021  -0.0071 50  PHE A CA  
404  C C   . PHE A 50  ? 0.1888 0.2075 0.2006 -0.0146 -0.0124 -0.0032 50  PHE A C   
405  O O   . PHE A 50  ? 0.2046 0.1900 0.2202 -0.0192 0.0025  -0.0234 50  PHE A O   
406  C CB  . PHE A 50  ? 0.2037 0.2288 0.1980 -0.0139 0.0022  0.0044  50  PHE A CB  
407  C CG  . PHE A 50  ? 0.2098 0.2384 0.2164 -0.0022 0.0017  -0.0034 50  PHE A CG  
408  C CD1 . PHE A 50  ? 0.1743 0.2414 0.2035 -0.0257 0.0133  0.0347  50  PHE A CD1 
409  C CD2 . PHE A 50  ? 0.1784 0.2528 0.1860 -0.0105 0.0012  0.0087  50  PHE A CD2 
410  C CE1 . PHE A 50  ? 0.2070 0.2730 0.1966 -0.0176 -0.0101 -0.0017 50  PHE A CE1 
411  C CE2 . PHE A 50  ? 0.2163 0.2670 0.2210 -0.0054 -0.0069 -0.0023 50  PHE A CE2 
412  C CZ  . PHE A 50  ? 0.2141 0.2576 0.1994 -0.0042 0.0097  0.0101  50  PHE A CZ  
413  N N   . TYR A 51  ? 0.1875 0.1823 0.1933 -0.0358 0.0066  -0.0059 51  TYR A N   
414  C CA  . TYR A 51  ? 0.2021 0.1742 0.1981 -0.0169 -0.0171 -0.0016 51  TYR A CA  
415  C C   . TYR A 51  ? 0.1901 0.2017 0.2161 -0.0123 -0.0020 -0.0138 51  TYR A C   
416  O O   . TYR A 51  ? 0.1827 0.2374 0.1966 -0.0334 0.0043  -0.0334 51  TYR A O   
417  C CB  . TYR A 51  ? 0.2043 0.2106 0.2254 -0.0120 -0.0207 -0.0028 51  TYR A CB  
418  C CG  . TYR A 51  ? 0.2239 0.2051 0.2054 0.0004  -0.0310 -0.0135 51  TYR A CG  
419  C CD1 . TYR A 51  ? 0.1909 0.2213 0.2121 -0.0155 -0.0421 0.0015  51  TYR A CD1 
420  C CD2 . TYR A 51  ? 0.2267 0.2115 0.2318 0.0023  -0.0336 -0.0097 51  TYR A CD2 
421  C CE1 . TYR A 51  ? 0.2106 0.1936 0.1779 -0.0041 -0.0398 -0.0170 51  TYR A CE1 
422  C CE2 . TYR A 51  ? 0.2436 0.2023 0.2291 0.0021  -0.0295 -0.0068 51  TYR A CE2 
423  C CZ  . TYR A 51  ? 0.2336 0.2157 0.2404 -0.0095 -0.0334 0.0032  51  TYR A CZ  
424  O OH  . TYR A 51  ? 0.2732 0.2318 0.2720 -0.0133 -0.0373 0.0049  51  TYR A OH  
425  N N   . ILE A 52  ? 0.1638 0.1741 0.1760 -0.0360 -0.0135 -0.0456 52  ILE A N   
426  C CA  . ILE A 52  ? 0.2049 0.1854 0.1797 -0.0181 -0.0145 -0.0122 52  ILE A CA  
427  C C   . ILE A 52  ? 0.1974 0.1979 0.1840 -0.0110 -0.0142 -0.0156 52  ILE A C   
428  O O   . ILE A 52  ? 0.2003 0.2103 0.1618 -0.0280 0.0296  -0.0093 52  ILE A O   
429  C CB  . ILE A 52  ? 0.2300 0.1901 0.1797 -0.0055 0.0009  -0.0184 52  ILE A CB  
430  C CG1 . ILE A 52  ? 0.2328 0.2047 0.2193 -0.0118 -0.0057 0.0030  52  ILE A CG1 
431  C CG2 . ILE A 52  ? 0.2607 0.2346 0.1883 -0.0136 -0.0282 -0.0326 52  ILE A CG2 
432  C CD1 . ILE A 52  ? 0.2692 0.2295 0.2186 -0.0015 -0.0279 0.0103  52  ILE A CD1 
433  N N   . LYS A 53  ? 0.1937 0.1735 0.1624 -0.0045 -0.0007 -0.0076 53  LYS A N   
434  C CA  . LYS A 53  ? 0.1783 0.1898 0.1772 -0.0016 0.0024  -0.0013 53  LYS A CA  
435  C C   . LYS A 53  ? 0.2010 0.2036 0.2020 -0.0053 0.0017  -0.0036 53  LYS A C   
436  O O   . LYS A 53  ? 0.1814 0.2386 0.1832 -0.0069 0.0050  -0.0303 53  LYS A O   
437  C CB  . LYS A 53  ? 0.2238 0.2324 0.1852 0.0084  -0.0087 0.0042  53  LYS A CB  
438  C CG  . LYS A 53  ? 0.2424 0.2234 0.2251 0.0045  -0.0275 0.0052  53  LYS A CG  
439  C CD  . LYS A 53  ? 0.3005 0.2857 0.2257 0.0216  -0.0222 0.0144  53  LYS A CD  
440  C CE  . LYS A 53  ? 0.3023 0.3313 0.2727 0.0289  -0.0236 0.0262  53  LYS A CE  
441  N NZ  . LYS A 53  ? 0.3114 0.3306 0.2587 0.0450  -0.0301 0.0275  53  LYS A NZ  
442  N N   . VAL A 54  ? 0.1605 0.1755 0.1663 -0.0224 -0.0074 -0.0166 54  VAL A N   
443  C CA  . VAL A 54  ? 0.1966 0.1939 0.1882 -0.0170 -0.0119 -0.0174 54  VAL A CA  
444  C C   . VAL A 54  ? 0.2182 0.2052 0.1900 -0.0124 -0.0078 -0.0173 54  VAL A C   
445  O O   . VAL A 54  ? 0.2385 0.2016 0.1861 -0.0297 0.0217  -0.0017 54  VAL A O   
446  C CB  . VAL A 54  ? 0.1808 0.1968 0.2141 -0.0260 -0.0022 -0.0154 54  VAL A CB  
447  C CG1 . VAL A 54  ? 0.2003 0.2246 0.2122 -0.0181 -0.0145 -0.0351 54  VAL A CG1 
448  C CG2 . VAL A 54  ? 0.2157 0.2019 0.2152 -0.0143 0.0191  0.0080  54  VAL A CG2 
449  N N   . SER A 55  ? 0.2550 0.1775 0.2244 -0.0083 -0.0125 -0.0104 55  SER A N   
450  C CA  . SER A 55  ? 0.2651 0.1874 0.2313 -0.0161 -0.0206 -0.0129 55  SER A CA  
451  C C   . SER A 55  ? 0.2820 0.2279 0.2428 -0.0191 -0.0129 -0.0232 55  SER A C   
452  O O   . SER A 55  ? 0.2814 0.2567 0.2410 -0.0152 -0.0038 -0.0385 55  SER A O   
453  C CB  . SER A 55  ? 0.2751 0.2446 0.2777 -0.0152 -0.0380 -0.0210 55  SER A CB  
454  O OG  . SER A 55  ? 0.3310 0.3014 0.2975 0.0041  -0.0362 -0.0161 55  SER A OG  
455  N N   . THR A 56  ? 0.2745 0.2182 0.2456 -0.0287 -0.0231 -0.0368 56  THR A N   
456  C CA  . THR A 56  ? 0.2932 0.2420 0.2677 -0.0289 -0.0233 -0.0269 56  THR A CA  
457  C C   . THR A 56  ? 0.3050 0.2328 0.2616 -0.0300 -0.0283 -0.0249 56  THR A C   
458  O O   . THR A 56  ? 0.3318 0.2403 0.3086 -0.0191 -0.0389 -0.0137 56  THR A O   
459  C CB  . THR A 56  ? 0.3128 0.2635 0.2978 -0.0255 -0.0183 -0.0198 56  THR A CB  
460  O OG1 . THR A 56  ? 0.2986 0.2853 0.2935 -0.0313 -0.0202 -0.0242 56  THR A OG1 
461  C CG2 . THR A 56  ? 0.3409 0.2880 0.3443 -0.0277 -0.0203 0.0051  56  THR A CG2 
462  N N   . THR A 57  ? 0.3140 0.2529 0.2819 -0.0168 -0.0140 -0.0238 57  THR A N   
463  C CA  . THR A 57  ? 0.3316 0.2556 0.3005 -0.0132 -0.0163 -0.0192 57  THR A CA  
464  C C   . THR A 57  ? 0.3560 0.2849 0.3151 -0.0143 -0.0151 -0.0177 57  THR A C   
465  O O   . THR A 57  ? 0.4166 0.2956 0.3400 0.0029  -0.0300 -0.0117 57  THR A O   
466  C CB  . THR A 57  ? 0.3199 0.2812 0.3182 -0.0147 -0.0141 -0.0319 57  THR A CB  
467  O OG1 . THR A 57  ? 0.3580 0.3228 0.3544 -0.0119 -0.0236 -0.0290 57  THR A OG1 
468  C CG2 . THR A 57  ? 0.3437 0.2988 0.3393 -0.0088 -0.0076 -0.0316 57  THR A CG2 
469  N N   . VAL A 58  ? 0.3414 0.2503 0.3001 -0.0259 -0.0106 -0.0369 58  VAL A N   
470  C CA  . VAL A 58  ? 0.3389 0.2585 0.3141 -0.0362 0.0036  -0.0318 58  VAL A CA  
471  C C   . VAL A 58  ? 0.3384 0.2595 0.3145 -0.0413 0.0041  -0.0197 58  VAL A C   
472  O O   . VAL A 58  ? 0.3507 0.2455 0.2543 -0.0812 0.0318  -0.0164 58  VAL A O   
473  C CB  . VAL A 58  ? 0.3558 0.2772 0.3443 -0.0388 0.0115  -0.0233 58  VAL A CB  
474  C CG1 . VAL A 58  ? 0.3493 0.2701 0.3537 -0.0419 -0.0102 -0.0433 58  VAL A CG1 
475  C CG2 . VAL A 58  ? 0.3363 0.3013 0.3489 -0.0126 -0.0089 -0.0310 58  VAL A CG2 
476  N N   . ARG A 59  ? 0.2789 0.2188 0.2392 -0.0448 -0.0013 -0.0019 59  ARG A N   
477  C CA  . ARG A 59  ? 0.2695 0.2452 0.2357 -0.0231 -0.0063 -0.0080 59  ARG A CA  
478  C C   . ARG A 59  ? 0.2566 0.2298 0.2107 -0.0372 -0.0063 -0.0158 59  ARG A C   
479  O O   . ARG A 59  ? 0.2721 0.2189 0.2207 -0.0491 -0.0068 -0.0374 59  ARG A O   
480  C CB  . ARG A 59  ? 0.2765 0.2274 0.2576 -0.0204 -0.0112 -0.0023 59  ARG A CB  
481  C CG  . ARG A 59  ? 0.2603 0.2298 0.2856 -0.0190 -0.0150 -0.0088 59  ARG A CG  
482  C CD  . ARG A 59  ? 0.2709 0.2794 0.2974 -0.0228 -0.0110 0.0073  59  ARG A CD  
483  N NE  . ARG A 59  ? 0.2897 0.3062 0.3191 -0.0171 0.0179  0.0248  59  ARG A NE  
484  C CZ  . ARG A 59  ? 0.3123 0.3309 0.3250 -0.0122 0.0053  0.0125  59  ARG A CZ  
485  N NH1 . ARG A 59  ? 0.3218 0.3245 0.2803 -0.0134 -0.0092 0.0227  59  ARG A NH1 
486  N NH2 . ARG A 59  ? 0.3200 0.3412 0.3402 -0.0331 0.0058  0.0302  59  ARG A NH2 
487  N N   . THR A 60  ? 0.2571 0.2089 0.2265 -0.0226 -0.0155 -0.0125 60  THR A N   
488  C CA  . THR A 60  ? 0.2526 0.2120 0.2344 -0.0191 -0.0018 0.0026  60  THR A CA  
489  C C   . THR A 60  ? 0.2578 0.1911 0.1888 -0.0380 0.0225  -0.0023 60  THR A C   
490  O O   . THR A 60  ? 0.2749 0.2208 0.2335 -0.0468 0.0327  -0.0068 60  THR A O   
491  C CB  . THR A 60  ? 0.2680 0.2215 0.2520 -0.0217 -0.0204 0.0084  60  THR A CB  
492  O OG1 . THR A 60  ? 0.3358 0.2504 0.2639 -0.0007 -0.0241 -0.0031 60  THR A OG1 
493  C CG2 . THR A 60  ? 0.2858 0.2400 0.2759 -0.0217 -0.0146 0.0118  60  THR A CG2 
494  N N   . THR A 61  ? 0.2410 0.1928 0.2231 -0.0243 0.0162  -0.0062 61  THR A N   
495  C CA  . THR A 61  ? 0.1931 0.2019 0.2026 -0.0291 0.0014  -0.0035 61  THR A CA  
496  C C   . THR A 61  ? 0.2065 0.2090 0.1864 -0.0263 0.0095  -0.0158 61  THR A C   
497  O O   . THR A 61  ? 0.2022 0.2350 0.1746 -0.0387 0.0213  -0.0180 61  THR A O   
498  C CB  . THR A 61  ? 0.1824 0.2043 0.2080 -0.0059 0.0057  -0.0007 61  THR A CB  
499  O OG1 . THR A 61  ? 0.2045 0.2281 0.2404 -0.0264 0.0306  -0.0101 61  THR A OG1 
500  C CG2 . THR A 61  ? 0.2170 0.2067 0.2370 -0.0143 -0.0018 -0.0070 61  THR A CG2 
501  N N   . GLU A 62  ? 0.2066 0.1984 0.1771 -0.0438 0.0096  0.0008  62  GLU A N   
502  C CA  . GLU A 62  ? 0.2009 0.1681 0.1718 -0.0216 -0.0232 0.0064  62  GLU A CA  
503  C C   . GLU A 62  ? 0.2425 0.1973 0.1972 -0.0029 0.0046  -0.0079 62  GLU A C   
504  O O   . GLU A 62  ? 0.2574 0.1774 0.1602 -0.0292 0.0683  0.0079  62  GLU A O   
505  C CB  . GLU A 62  ? 0.2562 0.2041 0.1898 0.0127  -0.0190 -0.0075 62  GLU A CB  
506  C CG  . GLU A 62  ? 0.2900 0.2022 0.2344 0.0128  -0.0184 0.0106  62  GLU A CG  
507  C CD  . GLU A 62  ? 0.3063 0.2486 0.2663 0.0110  -0.0210 0.0145  62  GLU A CD  
508  O OE1 . GLU A 62  ? 0.3100 0.2321 0.2572 -0.0198 -0.0503 0.0184  62  GLU A OE1 
509  O OE2 . GLU A 62  ? 0.3583 0.2874 0.2699 0.0031  -0.0167 0.0229  62  GLU A OE2 
510  N N   . ILE A 63  ? 0.1804 0.1677 0.1490 -0.0442 -0.0095 0.0023  63  ILE A N   
511  C CA  . ILE A 63  ? 0.2110 0.2120 0.1864 -0.0185 -0.0133 0.0054  63  ILE A CA  
512  C C   . ILE A 63  ? 0.1982 0.2012 0.1685 -0.0261 -0.0077 0.0063  63  ILE A C   
513  O O   . ILE A 63  ? 0.2142 0.1934 0.1802 -0.0232 -0.0011 -0.0031 63  ILE A O   
514  C CB  . ILE A 63  ? 0.2124 0.2227 0.2181 -0.0348 -0.0416 0.0028  63  ILE A CB  
515  C CG1 . ILE A 63  ? 0.2608 0.2834 0.2486 -0.0367 -0.0525 0.0067  63  ILE A CG1 
516  C CG2 . ILE A 63  ? 0.2838 0.2505 0.2434 -0.0204 -0.0137 0.0122  63  ILE A CG2 
517  C CD1 . ILE A 63  ? 0.2627 0.2919 0.2255 -0.0319 -0.0358 0.0088  63  ILE A CD1 
518  N N   . ASN A 64  ? 0.1820 0.1866 0.1591 -0.0291 -0.0128 0.0030  64  ASN A N   
519  C CA  . ASN A 64  ? 0.1883 0.1891 0.1541 -0.0223 -0.0069 0.0075  64  ASN A CA  
520  C C   . ASN A 64  ? 0.1755 0.1795 0.1566 -0.0175 0.0084  0.0138  64  ASN A C   
521  O O   . ASN A 64  ? 0.1991 0.1933 0.1897 0.0032  0.0084  0.0098  64  ASN A O   
522  C CB  . ASN A 64  ? 0.2073 0.1998 0.1392 -0.0103 -0.0242 0.0073  64  ASN A CB  
523  C CG  . ASN A 64  ? 0.2005 0.2176 0.1666 -0.0119 -0.0032 0.0070  64  ASN A CG  
524  O OD1 . ASN A 64  ? 0.2073 0.2123 0.1816 -0.0239 -0.0105 0.0009  64  ASN A OD1 
525  N ND2 . ASN A 64  ? 0.2193 0.2022 0.1466 -0.0309 -0.0140 0.0035  64  ASN A ND2 
526  N N   . PHE A 65  ? 0.1974 0.1734 0.1958 -0.0126 0.0075  -0.0045 65  PHE A N   
527  C CA  . PHE A 65  ? 0.1867 0.1808 0.2043 -0.0369 0.0181  0.0314  65  PHE A CA  
528  C C   . PHE A 65  ? 0.1905 0.1950 0.1955 -0.0454 0.0093  0.0066  65  PHE A C   
529  O O   . PHE A 65  ? 0.1950 0.2149 0.1997 -0.0368 0.0168  0.0082  65  PHE A O   
530  C CB  . PHE A 65  ? 0.2058 0.1906 0.1934 -0.0106 0.0060  -0.0056 65  PHE A CB  
531  C CG  . PHE A 65  ? 0.1904 0.1997 0.1865 -0.0120 0.0120  0.0207  65  PHE A CG  
532  C CD1 . PHE A 65  ? 0.2028 0.2252 0.1920 -0.0252 0.0103  0.0109  65  PHE A CD1 
533  C CD2 . PHE A 65  ? 0.1793 0.1938 0.2002 -0.0125 -0.0008 0.0066  65  PHE A CD2 
534  C CE1 . PHE A 65  ? 0.2099 0.2169 0.1905 -0.0179 0.0092  0.0045  65  PHE A CE1 
535  C CE2 . PHE A 65  ? 0.1852 0.2254 0.1900 -0.0122 0.0088  0.0223  65  PHE A CE2 
536  C CZ  . PHE A 65  ? 0.2091 0.1978 0.1826 -0.0194 0.0107  0.0220  65  PHE A CZ  
537  N N   . LYS A 66  ? 0.2256 0.2176 0.2056 -0.0197 0.0069  0.0035  66  LYS A N   
538  C CA  A LYS A 66  ? 0.2249 0.1996 0.2095 -0.0322 0.0087  -0.0052 66  LYS A CA  
539  C CA  B LYS A 66  ? 0.2308 0.1976 0.2222 -0.0342 0.0107  0.0007  66  LYS A CA  
540  C C   . LYS A 66  ? 0.2252 0.2013 0.2163 -0.0344 0.0112  -0.0121 66  LYS A C   
541  O O   . LYS A 66  ? 0.2114 0.1743 0.2192 -0.0287 0.0056  -0.0133 66  LYS A O   
542  C CB  A LYS A 66  ? 0.2384 0.2104 0.2091 -0.0298 -0.0037 -0.0098 66  LYS A CB  
543  C CB  B LYS A 66  ? 0.2634 0.2346 0.2537 -0.0307 -0.0090 -0.0066 66  LYS A CB  
544  C CG  A LYS A 66  ? 0.2144 0.2377 0.2063 -0.0202 -0.0038 -0.0201 66  LYS A CG  
545  C CG  B LYS A 66  ? 0.3016 0.2919 0.2928 -0.0106 -0.0029 -0.0068 66  LYS A CG  
546  C CD  A LYS A 66  ? 0.2628 0.2623 0.2297 -0.0025 0.0029  -0.0227 66  LYS A CD  
547  C CD  B LYS A 66  ? 0.3242 0.3169 0.3102 -0.0214 -0.0127 -0.0137 66  LYS A CD  
548  C CE  A LYS A 66  ? 0.2659 0.2790 0.2389 -0.0034 -0.0018 -0.0092 66  LYS A CE  
549  C CE  B LYS A 66  ? 0.3449 0.3494 0.3518 -0.0097 -0.0033 0.0010  66  LYS A CE  
550  N NZ  A LYS A 66  ? 0.2910 0.2685 0.2305 0.0079  -0.0037 -0.0129 66  LYS A NZ  
551  N NZ  B LYS A 66  ? 0.3699 0.3612 0.3548 -0.0167 -0.0128 -0.0145 66  LYS A NZ  
552  N N   . VAL A 67  ? 0.2210 0.1963 0.2038 -0.0338 0.0129  -0.0008 67  VAL A N   
553  C CA  . VAL A 67  ? 0.2284 0.2057 0.1908 -0.0303 0.0282  -0.0015 67  VAL A CA  
554  C C   . VAL A 67  ? 0.2201 0.1987 0.2321 -0.0319 0.0154  0.0094  67  VAL A C   
555  O O   . VAL A 67  ? 0.2525 0.2323 0.2452 -0.0491 -0.0028 -0.0022 67  VAL A O   
556  C CB  . VAL A 67  ? 0.2405 0.2419 0.2071 -0.0260 0.0348  0.0036  67  VAL A CB  
557  C CG1 . VAL A 67  ? 0.2720 0.2545 0.2150 -0.0046 0.0156  -0.0024 67  VAL A CG1 
558  C CG2 . VAL A 67  ? 0.2342 0.2424 0.1944 -0.0312 0.0244  -0.0059 67  VAL A CG2 
559  N N   . GLY A 68  ? 0.2421 0.1649 0.2145 -0.0128 0.0222  -0.0045 68  GLY A N   
560  C CA  . GLY A 68  ? 0.2652 0.1765 0.2548 -0.0179 0.0220  -0.0002 68  GLY A CA  
561  C C   . GLY A 68  ? 0.2723 0.2048 0.2462 -0.0179 0.0154  -0.0118 68  GLY A C   
562  O O   . GLY A 68  ? 0.3101 0.2008 0.2856 -0.0190 0.0469  -0.0107 68  GLY A O   
563  N N   . GLU A 69  ? 0.2571 0.2011 0.2306 -0.0195 0.0173  -0.0051 69  GLU A N   
564  C CA  A GLU A 69  ? 0.2519 0.2213 0.2494 -0.0223 0.0161  -0.0002 69  GLU A CA  
565  C CA  B GLU A 69  ? 0.2541 0.2226 0.2518 -0.0223 0.0161  -0.0010 69  GLU A CA  
566  C C   . GLU A 69  ? 0.2249 0.2061 0.2447 -0.0301 0.0153  -0.0063 69  GLU A C   
567  O O   . GLU A 69  ? 0.2278 0.1991 0.2326 -0.0218 0.0227  -0.0019 69  GLU A O   
568  C CB  A GLU A 69  ? 0.2348 0.2227 0.2416 -0.0274 0.0031  0.0046  69  GLU A CB  
569  C CB  B GLU A 69  ? 0.2392 0.2253 0.2491 -0.0217 0.0011  0.0061  69  GLU A CB  
570  C CG  A GLU A 69  ? 0.2669 0.2677 0.2798 -0.0280 -0.0068 0.0015  69  GLU A CG  
571  C CG  B GLU A 69  ? 0.2819 0.2733 0.2867 -0.0212 -0.0041 0.0007  69  GLU A CG  
572  C CD  A GLU A 69  ? 0.3248 0.3302 0.3179 -0.0054 0.0009  -0.0053 69  GLU A CD  
573  C CD  B GLU A 69  ? 0.3352 0.3398 0.3402 -0.0014 -0.0002 -0.0039 69  GLU A CD  
574  O OE1 A GLU A 69  ? 0.3234 0.3067 0.2995 -0.0123 0.0065  0.0013  69  GLU A OE1 
575  O OE1 B GLU A 69  ? 0.3213 0.3205 0.3308 -0.0285 0.0030  0.0032  69  GLU A OE1 
576  O OE2 A GLU A 69  ? 0.2782 0.3073 0.3266 -0.0449 -0.0161 -0.0045 69  GLU A OE2 
577  O OE2 B GLU A 69  ? 0.3276 0.2898 0.3045 -0.0047 -0.0163 0.0192  69  GLU A OE2 
578  N N   . GLU A 70  ? 0.2319 0.2181 0.2171 -0.0156 0.0053  -0.0110 70  GLU A N   
579  C CA  . GLU A 70  ? 0.2467 0.2134 0.2328 -0.0137 0.0108  -0.0016 70  GLU A CA  
580  C C   . GLU A 70  ? 0.2359 0.2248 0.2259 -0.0126 -0.0036 -0.0046 70  GLU A C   
581  O O   . GLU A 70  ? 0.2437 0.2557 0.2162 -0.0475 -0.0113 -0.0116 70  GLU A O   
582  C CB  . GLU A 70  ? 0.2533 0.2575 0.2741 -0.0089 0.0176  -0.0138 70  GLU A CB  
583  C CG  . GLU A 70  ? 0.2927 0.2890 0.3081 -0.0072 0.0243  -0.0023 70  GLU A CG  
584  C CD  . GLU A 70  ? 0.3154 0.3022 0.3192 0.0013  0.0201  -0.0051 70  GLU A CD  
585  O OE1 . GLU A 70  ? 0.3289 0.2930 0.3438 0.0217  0.0175  -0.0022 70  GLU A OE1 
586  O OE2 . GLU A 70  ? 0.3511 0.3138 0.3407 0.0105  0.0270  -0.0020 70  GLU A OE2 
587  N N   . PHE A 71  ? 0.2146 0.1861 0.1914 -0.0180 0.0079  0.0100  71  PHE A N   
588  C CA  . PHE A 71  ? 0.1983 0.1862 0.2064 -0.0197 0.0070  0.0112  71  PHE A CA  
589  C C   . PHE A 71  ? 0.2029 0.2054 0.2090 -0.0108 0.0045  -0.0008 71  PHE A C   
590  O O   . PHE A 71  ? 0.2195 0.1988 0.2188 -0.0247 0.0145  0.0393  71  PHE A O   
591  C CB  . PHE A 71  ? 0.2000 0.2001 0.1940 -0.0036 0.0001  -0.0003 71  PHE A CB  
592  C CG  . PHE A 71  ? 0.1898 0.1644 0.1722 -0.0199 -0.0070 0.0155  71  PHE A CG  
593  C CD1 . PHE A 71  ? 0.2084 0.1935 0.1707 0.0018  -0.0045 0.0000  71  PHE A CD1 
594  C CD2 . PHE A 71  ? 0.2017 0.1865 0.1944 -0.0163 -0.0120 -0.0008 71  PHE A CD2 
595  C CE1 . PHE A 71  ? 0.2131 0.1904 0.1863 -0.0045 -0.0076 -0.0071 71  PHE A CE1 
596  C CE2 . PHE A 71  ? 0.2059 0.1651 0.1751 -0.0160 -0.0088 -0.0051 71  PHE A CE2 
597  C CZ  . PHE A 71  ? 0.2179 0.1840 0.2068 -0.0146 0.0082  0.0032  71  PHE A CZ  
598  N N   . GLU A 72  ? 0.1840 0.1679 0.1838 -0.0317 0.0205  0.0051  72  GLU A N   
599  C CA  . GLU A 72  ? 0.1974 0.2121 0.1966 -0.0260 0.0221  -0.0031 72  GLU A CA  
600  C C   . GLU A 72  ? 0.2078 0.2241 0.1994 -0.0191 0.0122  -0.0077 72  GLU A C   
601  O O   . GLU A 72  ? 0.2316 0.2087 0.2082 -0.0161 0.0135  0.0002  72  GLU A O   
602  C CB  . GLU A 72  ? 0.2258 0.2097 0.2022 0.0011  0.0088  0.0036  72  GLU A CB  
603  C CG  . GLU A 72  ? 0.2660 0.2427 0.2618 0.0194  0.0184  -0.0051 72  GLU A CG  
604  C CD  . GLU A 72  ? 0.2935 0.2931 0.3156 0.0121  0.0135  0.0025  72  GLU A CD  
605  O OE1 . GLU A 72  ? 0.3007 0.3181 0.3462 0.0213  0.0208  -0.0035 72  GLU A OE1 
606  O OE2 . GLU A 72  ? 0.3467 0.3426 0.3946 0.0095  0.0162  0.0127  72  GLU A OE2 
607  N N   . GLU A 73  ? 0.2188 0.2204 0.1999 -0.0130 0.0090  0.0014  73  GLU A N   
608  C CA  . GLU A 73  ? 0.2309 0.2296 0.1994 -0.0175 0.0010  0.0091  73  GLU A CA  
609  C C   . GLU A 73  ? 0.2291 0.2257 0.1939 -0.0242 0.0015  0.0058  73  GLU A C   
610  O O   . GLU A 73  ? 0.2190 0.2278 0.2114 -0.0344 0.0033  0.0090  73  GLU A O   
611  C CB  . GLU A 73  ? 0.3009 0.2607 0.2193 0.0059  0.0171  -0.0006 73  GLU A CB  
612  C CG  . GLU A 73  ? 0.2942 0.2958 0.2517 0.0082  0.0156  0.0074  73  GLU A CG  
613  C CD  . GLU A 73  ? 0.2571 0.2524 0.2346 -0.0041 0.0310  -0.0038 73  GLU A CD  
614  O OE1 . GLU A 73  ? 0.2680 0.2890 0.3019 -0.0057 0.0546  0.0020  73  GLU A OE1 
615  O OE2 . GLU A 73  ? 0.2433 0.2424 0.2246 -0.0327 0.0207  0.0078  73  GLU A OE2 
616  N N   . GLN A 74  ? 0.2576 0.2350 0.2077 -0.0189 -0.0107 0.0276  74  GLN A N   
617  C CA  . GLN A 74  ? 0.2570 0.2480 0.2126 -0.0394 -0.0039 0.0035  74  GLN A CA  
618  C C   . GLN A 74  ? 0.2535 0.2495 0.2114 -0.0366 -0.0041 0.0145  74  GLN A C   
619  O O   . GLN A 74  ? 0.2815 0.2674 0.2272 -0.0384 -0.0088 -0.0065 74  GLN A O   
620  C CB  . GLN A 74  ? 0.2615 0.2635 0.2079 -0.0278 -0.0064 0.0150  74  GLN A CB  
621  C CG  . GLN A 74  ? 0.2788 0.2650 0.2120 -0.0340 0.0050  0.0060  74  GLN A CG  
622  C CD  . GLN A 74  ? 0.2441 0.2564 0.2385 -0.0143 -0.0103 0.0111  74  GLN A CD  
623  O OE1 . GLN A 74  ? 0.2790 0.2793 0.2858 -0.0302 -0.0187 0.0270  74  GLN A OE1 
624  N NE2 . GLN A 74  ? 0.2715 0.2623 0.2617 -0.0096 -0.0125 0.0129  74  GLN A NE2 
625  N N   . THR A 75  ? 0.2766 0.2492 0.2051 -0.0451 -0.0181 0.0239  75  THR A N   
626  C CA  . THR A 75  ? 0.2790 0.2639 0.2151 -0.0406 -0.0277 0.0088  75  THR A CA  
627  C C   . THR A 75  ? 0.3190 0.2747 0.2376 -0.0343 -0.0153 0.0069  75  THR A C   
628  O O   . THR A 75  ? 0.3375 0.2836 0.2349 -0.0376 -0.0324 -0.0068 75  THR A O   
629  C CB  . THR A 75  ? 0.2903 0.2836 0.2576 -0.0299 -0.0074 0.0234  75  THR A CB  
630  O OG1 . THR A 75  ? 0.2920 0.3183 0.2620 -0.0607 -0.0169 0.0242  75  THR A OG1 
631  C CG2 . THR A 75  ? 0.2899 0.2771 0.2702 -0.0130 -0.0042 0.0099  75  THR A CG2 
632  N N   . VAL A 76  ? 0.3378 0.3006 0.2584 -0.0234 -0.0122 -0.0093 76  VAL A N   
633  C CA  . VAL A 76  ? 0.3563 0.3369 0.3015 -0.0140 -0.0042 -0.0056 76  VAL A CA  
634  C C   . VAL A 76  ? 0.3654 0.3432 0.3227 -0.0108 -0.0019 -0.0035 76  VAL A C   
635  O O   . VAL A 76  ? 0.3724 0.3555 0.3543 -0.0121 -0.0001 -0.0166 76  VAL A O   
636  C CB  . VAL A 76  ? 0.3827 0.3597 0.3227 -0.0010 -0.0030 -0.0092 76  VAL A CB  
637  C CG1 . VAL A 76  ? 0.3602 0.3709 0.3343 -0.0015 0.0009  0.0052  76  VAL A CG1 
638  C CG2 . VAL A 76  ? 0.4094 0.3529 0.3425 0.0000  -0.0124 -0.0148 76  VAL A CG2 
639  N N   . ASP A 77  ? 0.3249 0.3410 0.2933 -0.0074 -0.0133 0.0028  77  ASP A N   
640  C CA  . ASP A 77  ? 0.3499 0.3499 0.3255 -0.0187 -0.0138 0.0014  77  ASP A CA  
641  C C   . ASP A 77  ? 0.3462 0.3440 0.3170 -0.0257 -0.0109 0.0050  77  ASP A C   
642  O O   . ASP A 77  ? 0.3661 0.3935 0.3302 -0.0364 -0.0013 0.0041  77  ASP A O   
643  C CB  . ASP A 77  ? 0.3485 0.3752 0.3619 -0.0254 -0.0087 -0.0051 77  ASP A CB  
644  C CG  . ASP A 77  ? 0.3677 0.3985 0.3820 -0.0145 0.0068  -0.0074 77  ASP A CG  
645  O OD1 . ASP A 77  ? 0.3690 0.4049 0.3686 -0.0350 0.0001  -0.0163 77  ASP A OD1 
646  O OD2 . ASP A 77  ? 0.3893 0.4456 0.4346 -0.0107 0.0157  -0.0036 77  ASP A OD2 
647  N N   . GLY A 78  ? 0.3145 0.3222 0.2959 -0.0442 -0.0142 0.0311  78  GLY A N   
648  C CA  . GLY A 78  ? 0.3158 0.3109 0.2832 -0.0338 -0.0112 0.0312  78  GLY A CA  
649  C C   . GLY A 78  ? 0.2800 0.3146 0.2585 -0.0181 -0.0108 0.0327  78  GLY A C   
650  O O   . GLY A 78  ? 0.3089 0.3542 0.2921 -0.0244 -0.0151 0.0357  78  GLY A O   
651  N N   . ARG A 79  ? 0.2706 0.3073 0.2851 -0.0351 -0.0168 0.0139  79  ARG A N   
652  C CA  . ARG A 79  ? 0.2416 0.2945 0.2896 -0.0213 -0.0186 0.0283  79  ARG A CA  
653  C C   . ARG A 79  ? 0.2332 0.3043 0.2489 -0.0279 -0.0027 0.0326  79  ARG A C   
654  O O   . ARG A 79  ? 0.2354 0.3230 0.2416 -0.0268 0.0070  0.0373  79  ARG A O   
655  C CB  . ARG A 79  ? 0.1998 0.2766 0.3040 -0.0269 -0.0279 0.0299  79  ARG A CB  
656  C CG  . ARG A 79  ? 0.2561 0.2951 0.3466 -0.0184 -0.0287 0.0229  79  ARG A CG  
657  C CD  . ARG A 79  ? 0.2358 0.3165 0.3470 -0.0179 -0.0317 0.0249  79  ARG A CD  
658  N NE  . ARG A 79  ? 0.2615 0.3290 0.3682 -0.0409 -0.0086 0.0271  79  ARG A NE  
659  C CZ  . ARG A 79  ? 0.2545 0.3268 0.3472 -0.0164 -0.0056 0.0218  79  ARG A CZ  
660  N NH1 . ARG A 79  ? 0.2730 0.3639 0.3747 -0.0212 -0.0053 0.0476  79  ARG A NH1 
661  N NH2 . ARG A 79  ? 0.2578 0.3554 0.3758 -0.0294 -0.0018 0.0400  79  ARG A NH2 
662  N N   . PRO A 80  ? 0.2356 0.2995 0.2441 -0.0294 0.0152  0.0232  80  PRO A N   
663  C CA  . PRO A 80  ? 0.2387 0.2849 0.2405 -0.0195 0.0113  0.0266  80  PRO A CA  
664  C C   . PRO A 80  ? 0.1873 0.2722 0.2327 -0.0037 0.0344  0.0205  80  PRO A C   
665  O O   . PRO A 80  ? 0.2398 0.3163 0.2611 -0.0025 0.0025  0.0447  80  PRO A O   
666  C CB  . PRO A 80  ? 0.2311 0.2888 0.2642 -0.0230 0.0320  0.0163  80  PRO A CB  
667  C CG  . PRO A 80  ? 0.2522 0.3111 0.2682 -0.0177 0.0265  0.0268  80  PRO A CG  
668  C CD  . PRO A 80  ? 0.2168 0.3011 0.2474 -0.0242 0.0184  0.0408  80  PRO A CD  
669  N N   . CYS A 81  ? 0.2087 0.2551 0.2142 -0.0079 0.0051  0.0251  81  CYS A N   
670  C CA  . CYS A 81  ? 0.1910 0.2427 0.1868 -0.0200 0.0227  0.0051  81  CYS A CA  
671  C C   . CYS A 81  ? 0.1970 0.2538 0.2204 -0.0083 0.0167  0.0065  81  CYS A C   
672  O O   . CYS A 81  ? 0.2183 0.2310 0.2052 -0.0066 0.0052  0.0090  81  CYS A O   
673  C CB  . CYS A 81  ? 0.2066 0.2715 0.2035 0.0000  -0.0007 0.0004  81  CYS A CB  
674  S SG  . CYS A 81  ? 0.2266 0.2641 0.1983 0.0014  0.0094  0.0129  81  CYS A SG  
675  N N   . LYS A 82  ? 0.2048 0.2306 0.2282 -0.0136 0.0114  0.0017  82  LYS A N   
676  C CA  A LYS A 82  ? 0.2185 0.2568 0.2315 -0.0063 0.0137  0.0001  82  LYS A CA  
677  C CA  B LYS A 82  ? 0.2063 0.2439 0.2248 -0.0048 0.0166  -0.0011 82  LYS A CA  
678  C C   . LYS A 82  ? 0.2065 0.2458 0.2132 0.0040  0.0071  0.0099  82  LYS A C   
679  O O   . LYS A 82  ? 0.2066 0.2813 0.2348 0.0047  0.0138  0.0202  82  LYS A O   
680  C CB  A LYS A 82  ? 0.2568 0.2616 0.2449 0.0019  0.0043  -0.0098 82  LYS A CB  
681  C CB  B LYS A 82  ? 0.2461 0.2535 0.2577 0.0088  0.0042  -0.0054 82  LYS A CB  
682  C CG  A LYS A 82  ? 0.2901 0.2900 0.2919 -0.0026 0.0049  -0.0047 82  LYS A CG  
683  C CG  B LYS A 82  ? 0.2859 0.2862 0.2858 -0.0023 0.0112  -0.0006 82  LYS A CG  
684  C CD  A LYS A 82  ? 0.2858 0.2728 0.2756 0.0044  0.0080  -0.0152 82  LYS A CD  
685  C CD  B LYS A 82  ? 0.2928 0.2914 0.2961 0.0013  0.0084  -0.0038 82  LYS A CD  
686  C CE  A LYS A 82  ? 0.3130 0.3032 0.3047 -0.0017 -0.0026 0.0046  82  LYS A CE  
687  C CE  B LYS A 82  ? 0.3195 0.3083 0.3148 -0.0001 0.0022  -0.0080 82  LYS A CE  
688  N NZ  A LYS A 82  ? 0.3414 0.3354 0.3313 -0.0005 -0.0044 0.0022  82  LYS A NZ  
689  N NZ  B LYS A 82  ? 0.3228 0.3108 0.3178 0.0009  -0.0023 -0.0074 82  LYS A NZ  
690  N N   . SER A 83  ? 0.1927 0.2080 0.1864 0.0021  0.0298  0.0013  83  SER A N   
691  C CA  . SER A 83  ? 0.1774 0.1693 0.1845 0.0034  0.0267  -0.0037 83  SER A CA  
692  C C   . SER A 83  ? 0.1930 0.1742 0.1846 -0.0001 0.0184  -0.0053 83  SER A C   
693  O O   . SER A 83  ? 0.1914 0.1930 0.2050 -0.0116 0.0010  0.0030  83  SER A O   
694  C CB  . SER A 83  ? 0.2131 0.1759 0.2226 -0.0055 -0.0075 -0.0011 83  SER A CB  
695  O OG  . SER A 83  ? 0.1968 0.2039 0.2097 -0.0481 -0.0114 0.0003  83  SER A OG  
696  N N   . LEU A 84  ? 0.2046 0.1734 0.1872 -0.0022 0.0291  0.0131  84  LEU A N   
697  C CA  . LEU A 84  ? 0.2158 0.1684 0.2185 -0.0141 0.0304  -0.0004 84  LEU A CA  
698  C C   . LEU A 84  ? 0.2439 0.1931 0.1978 -0.0087 0.0146  -0.0014 84  LEU A C   
699  O O   . LEU A 84  ? 0.2130 0.1961 0.1938 -0.0123 0.0075  -0.0016 84  LEU A O   
700  C CB  . LEU A 84  ? 0.2374 0.1846 0.2725 0.0003  0.0170  -0.0028 84  LEU A CB  
701  C CG  . LEU A 84  ? 0.2711 0.2110 0.3003 0.0012  -0.0067 -0.0021 84  LEU A CG  
702  C CD1 . LEU A 84  ? 0.2818 0.2174 0.2843 -0.0031 -0.0128 -0.0143 84  LEU A CD1 
703  C CD2 . LEU A 84  ? 0.2699 0.1897 0.2948 0.0074  -0.0012 0.0081  84  LEU A CD2 
704  N N   . VAL A 85  ? 0.2277 0.1636 0.1666 -0.0158 0.0175  0.0025  85  VAL A N   
705  C CA  . VAL A 85  ? 0.2364 0.1628 0.1842 -0.0233 0.0226  0.0038  85  VAL A CA  
706  C C   . VAL A 85  ? 0.2468 0.1640 0.1885 -0.0452 0.0175  0.0042  85  VAL A C   
707  O O   . VAL A 85  ? 0.2559 0.2339 0.2051 -0.0540 0.0158  -0.0023 85  VAL A O   
708  C CB  . VAL A 85  ? 0.2394 0.1726 0.1743 -0.0161 0.0177  0.0090  85  VAL A CB  
709  C CG1 . VAL A 85  ? 0.2290 0.2005 0.2029 -0.0121 0.0263  -0.0152 85  VAL A CG1 
710  C CG2 . VAL A 85  ? 0.2466 0.1712 0.2107 -0.0366 0.0152  -0.0090 85  VAL A CG2 
711  N N   . LYS A 86  ? 0.2702 0.1990 0.2326 -0.0457 0.0157  0.0097  86  LYS A N   
712  C CA  . LYS A 86  ? 0.2828 0.2131 0.2478 -0.0310 0.0336  -0.0013 86  LYS A CA  
713  C C   . LYS A 86  ? 0.2338 0.1965 0.2013 -0.0536 0.0511  0.0118  86  LYS A C   
714  O O   . LYS A 86  ? 0.2865 0.2228 0.1926 -0.0252 0.0389  -0.0020 86  LYS A O   
715  C CB  . LYS A 86  ? 0.2978 0.2199 0.2600 -0.0124 0.0454  0.0077  86  LYS A CB  
716  C CG  . LYS A 86  ? 0.3468 0.2897 0.3348 0.0117  0.0388  0.0004  86  LYS A CG  
717  C CD  . LYS A 86  ? 0.3877 0.3206 0.3760 0.0249  0.0230  0.0099  86  LYS A CD  
718  C CE  . LYS A 86  ? 0.4101 0.3609 0.3926 0.0200  0.0199  -0.0004 86  LYS A CE  
719  N NZ  . LYS A 86  ? 0.4610 0.3990 0.4615 0.0183  0.0161  0.0087  86  LYS A NZ  
720  N N   . TRP A 87  ? 0.2883 0.2266 0.2367 -0.0243 0.0185  -0.0280 87  TRP A N   
721  C CA  . TRP A 87  ? 0.2459 0.2490 0.1938 -0.0438 0.0368  0.0153  87  TRP A CA  
722  C C   . TRP A 87  ? 0.2838 0.2576 0.2532 -0.0144 0.0045  -0.0098 87  TRP A C   
723  O O   . TRP A 87  ? 0.3115 0.2464 0.2457 -0.0205 0.0060  0.0170  87  TRP A O   
724  C CB  . TRP A 87  ? 0.2436 0.2589 0.2395 -0.0422 0.0297  0.0087  87  TRP A CB  
725  C CG  . TRP A 87  ? 0.2400 0.2486 0.2223 -0.0386 0.0277  0.0140  87  TRP A CG  
726  C CD1 . TRP A 87  ? 0.2631 0.2517 0.2390 -0.0363 0.0248  0.0038  87  TRP A CD1 
727  C CD2 . TRP A 87  ? 0.2448 0.2354 0.2102 -0.0356 0.0317  0.0062  87  TRP A CD2 
728  N NE1 . TRP A 87  ? 0.2646 0.2249 0.2342 -0.0411 0.0284  -0.0049 87  TRP A NE1 
729  C CE2 . TRP A 87  ? 0.2446 0.2369 0.2259 -0.0439 0.0426  0.0015  87  TRP A CE2 
730  C CE3 . TRP A 87  ? 0.2528 0.2338 0.2297 -0.0393 0.0344  0.0073  87  TRP A CE3 
731  C CZ2 . TRP A 87  ? 0.2447 0.2523 0.2250 -0.0352 0.0203  0.0111  87  TRP A CZ2 
732  C CZ3 . TRP A 87  ? 0.2691 0.2410 0.2349 -0.0312 0.0236  0.0048  87  TRP A CZ3 
733  C CH2 . TRP A 87  ? 0.2569 0.2515 0.2358 -0.0255 0.0286  0.0068  87  TRP A CH2 
734  N N   . GLU A 88  ? 0.3329 0.2654 0.2453 -0.0223 0.0017  0.0052  88  GLU A N   
735  C CA  . GLU A 88  ? 0.3357 0.2705 0.2690 -0.0214 -0.0164 0.0068  88  GLU A CA  
736  C C   . GLU A 88  ? 0.3786 0.3030 0.3178 -0.0166 -0.0090 -0.0007 88  GLU A C   
737  O O   . GLU A 88  ? 0.4103 0.2700 0.3110 -0.0345 0.0065  0.0311  88  GLU A O   
738  C CB  . GLU A 88  ? 0.3489 0.2887 0.2903 -0.0179 -0.0177 0.0023  88  GLU A CB  
739  C CG  . GLU A 88  ? 0.3675 0.3247 0.3229 -0.0120 -0.0197 0.0047  88  GLU A CG  
740  C CD  . GLU A 88  ? 0.3685 0.3433 0.3358 -0.0073 -0.0201 0.0030  88  GLU A CD  
741  O OE1 . GLU A 88  ? 0.3623 0.3535 0.3220 -0.0186 -0.0103 0.0139  88  GLU A OE1 
742  O OE2 . GLU A 88  ? 0.3752 0.3397 0.3626 0.0035  -0.0084 -0.0031 88  GLU A OE2 
743  N N   . SER A 89  ? 0.3600 0.2808 0.3022 -0.0350 0.0148  0.0033  89  SER A N   
744  C CA  . SER A 89  ? 0.3693 0.2829 0.3037 -0.0508 0.0296  -0.0110 89  SER A CA  
745  C C   . SER A 89  ? 0.3424 0.2636 0.2923 -0.0495 0.0437  0.0037  89  SER A C   
746  O O   . SER A 89  ? 0.3778 0.3013 0.3195 -0.0434 0.0526  -0.0239 89  SER A O   
747  C CB  . SER A 89  ? 0.4081 0.2876 0.3015 -0.0501 0.0349  -0.0032 89  SER A CB  
748  O OG  . SER A 89  ? 0.4320 0.2989 0.3161 -0.0787 0.0524  -0.0285 89  SER A OG  
749  N N   . GLU A 90  ? 0.3788 0.3198 0.3654 -0.0353 0.0272  -0.0128 90  GLU A N   
750  C CA  . GLU A 90  ? 0.3440 0.3266 0.3532 -0.0298 0.0254  0.0000  90  GLU A CA  
751  C C   . GLU A 90  ? 0.3483 0.3460 0.3521 -0.0220 0.0289  0.0059  90  GLU A C   
752  O O   . GLU A 90  ? 0.3349 0.3842 0.3615 -0.0405 0.0152  0.0184  90  GLU A O   
753  C CB  . GLU A 90  ? 0.3457 0.3337 0.3484 -0.0207 0.0212  0.0016  90  GLU A CB  
754  C CG  . GLU A 90  ? 0.3503 0.3410 0.3597 -0.0149 0.0142  -0.0020 90  GLU A CG  
755  C CD  . GLU A 90  ? 0.3516 0.3414 0.3565 -0.0117 0.0109  -0.0007 90  GLU A CD  
756  O OE1 . GLU A 90  ? 0.3499 0.3449 0.3545 -0.0066 0.0063  0.0000  90  GLU A OE1 
757  O OE2 . GLU A 90  ? 0.3499 0.3454 0.3542 -0.0067 0.0060  -0.0001 90  GLU A OE2 
758  N N   . ASN A 91  ? 0.3189 0.3138 0.3044 -0.0396 0.0413  0.0002  91  ASN A N   
759  C CA  . ASN A 91  ? 0.3258 0.3301 0.3103 -0.0199 0.0304  -0.0165 91  ASN A CA  
760  C C   . ASN A 91  ? 0.2810 0.2784 0.2740 -0.0191 0.0451  -0.0083 91  ASN A C   
761  O O   . ASN A 91  ? 0.2657 0.2579 0.2740 -0.0282 0.0523  -0.0149 91  ASN A O   
762  C CB  . ASN A 91  ? 0.3394 0.3268 0.3268 -0.0153 0.0355  -0.0102 91  ASN A CB  
763  C CG  . ASN A 91  ? 0.3678 0.3898 0.3868 -0.0076 0.0157  -0.0058 91  ASN A CG  
764  O OD1 . ASN A 91  ? 0.3914 0.4187 0.4299 -0.0144 0.0089  0.0005  91  ASN A OD1 
765  N ND2 . ASN A 91  ? 0.3946 0.3885 0.3920 -0.0021 0.0200  0.0012  91  ASN A ND2 
766  N N   . LYS A 92  ? 0.2743 0.2521 0.2692 -0.0237 0.0264  -0.0090 92  LYS A N   
767  C CA  . LYS A 92  ? 0.2390 0.2557 0.1942 -0.0253 0.0321  -0.0037 92  LYS A CA  
768  C C   . LYS A 92  ? 0.2555 0.2133 0.2108 -0.0165 0.0252  0.0014  92  LYS A C   
769  O O   . LYS A 92  ? 0.2934 0.2131 0.2270 -0.0216 0.0238  0.0022  92  LYS A O   
770  C CB  . LYS A 92  ? 0.2479 0.2735 0.2426 -0.0282 0.0132  0.0136  92  LYS A CB  
771  C CG  . LYS A 92  ? 0.2232 0.2999 0.2237 -0.0172 0.0018  -0.0045 92  LYS A CG  
772  C CD  . LYS A 92  ? 0.2685 0.3123 0.2357 -0.0182 -0.0108 0.0103  92  LYS A CD  
773  C CE  . LYS A 92  ? 0.2829 0.3299 0.2557 -0.0253 -0.0154 0.0032  92  LYS A CE  
774  N NZ  . LYS A 92  ? 0.3341 0.3445 0.2698 -0.0327 -0.0333 0.0064  92  LYS A NZ  
775  N N   . MET A 93  ? 0.2616 0.2308 0.1952 -0.0200 0.0271  -0.0132 93  MET A N   
776  C CA  A MET A 93  ? 0.2265 0.2257 0.1754 -0.0168 0.0299  -0.0042 93  MET A CA  
777  C CA  B MET A 93  ? 0.2135 0.1922 0.1650 -0.0133 0.0223  0.0031  93  MET A CA  
778  C C   . MET A 93  ? 0.2421 0.1958 0.1814 -0.0229 0.0310  0.0074  93  MET A C   
779  O O   . MET A 93  ? 0.2449 0.1837 0.1513 -0.0415 0.0349  -0.0141 93  MET A O   
780  C CB  A MET A 93  ? 0.2514 0.2307 0.1960 -0.0123 0.0148  -0.0009 93  MET A CB  
781  C CB  B MET A 93  ? 0.2225 0.2156 0.2009 -0.0126 0.0167  -0.0062 93  MET A CB  
782  C CG  A MET A 93  ? 0.2272 0.2258 0.2037 -0.0146 0.0097  0.0054  93  MET A CG  
783  C CG  B MET A 93  ? 0.2013 0.1990 0.1699 -0.0086 0.0061  0.0090  93  MET A CG  
784  S SD  A MET A 93  ? 0.2750 0.2752 0.2009 -0.0042 0.0069  0.0066  93  MET A SD  
785  S SD  B MET A 93  ? 0.2149 0.2232 0.2066 -0.0087 0.0122  -0.0072 93  MET A SD  
786  C CE  A MET A 93  ? 0.2233 0.2642 0.2529 -0.0133 -0.0103 0.0107  93  MET A CE  
787  C CE  B MET A 93  ? 0.1794 0.1927 0.1915 -0.0112 -0.0001 0.0020  93  MET A CE  
788  N N   . VAL A 94  ? 0.2410 0.1889 0.1839 -0.0134 0.0307  0.0067  94  VAL A N   
789  C CA  . VAL A 94  ? 0.2382 0.2053 0.1727 -0.0124 0.0188  -0.0002 94  VAL A CA  
790  C C   . VAL A 94  ? 0.2582 0.1933 0.1849 -0.0296 0.0171  -0.0123 94  VAL A C   
791  O O   . VAL A 94  ? 0.2640 0.2061 0.1805 -0.0242 0.0048  -0.0012 94  VAL A O   
792  C CB  . VAL A 94  ? 0.2639 0.2238 0.2016 -0.0151 0.0086  0.0188  94  VAL A CB  
793  C CG1 . VAL A 94  ? 0.2496 0.2560 0.2269 0.0289  -0.0115 0.0111  94  VAL A CG1 
794  C CG2 . VAL A 94  ? 0.2844 0.2397 0.1876 -0.0163 -0.0009 0.0177  94  VAL A CG2 
795  N N   . CYS A 95  ? 0.2413 0.2284 0.1677 -0.0318 0.0267  0.0100  95  CYS A N   
796  C CA  . CYS A 95  ? 0.2276 0.1989 0.1890 -0.0183 0.0149  0.0048  95  CYS A CA  
797  C C   . CYS A 95  ? 0.2227 0.2222 0.1918 -0.0291 0.0211  0.0041  95  CYS A C   
798  O O   . CYS A 95  ? 0.2382 0.2291 0.2271 -0.0188 0.0038  -0.0207 95  CYS A O   
799  C CB  . CYS A 95  ? 0.2412 0.2179 0.1798 -0.0275 0.0248  0.0061  95  CYS A CB  
800  S SG  . CYS A 95  ? 0.2906 0.2502 0.1923 -0.0203 0.0238  -0.0097 95  CYS A SG  
801  N N   . GLU A 96  ? 0.2286 0.2227 0.2159 -0.0021 0.0039  0.0178  96  GLU A N   
802  C CA  . GLU A 96  ? 0.2308 0.2385 0.2182 -0.0054 0.0145  0.0246  96  GLU A CA  
803  C C   . GLU A 96  ? 0.2275 0.2486 0.2031 -0.0019 0.0037  0.0151  96  GLU A C   
804  O O   . GLU A 96  ? 0.2349 0.2519 0.2144 -0.0204 -0.0048 0.0050  96  GLU A O   
805  C CB  . GLU A 96  ? 0.2387 0.2430 0.2267 0.0012  0.0167  0.0149  96  GLU A CB  
806  C CG  . GLU A 96  ? 0.2465 0.2554 0.2344 -0.0111 0.0021  0.0234  96  GLU A CG  
807  C CD  . GLU A 96  ? 0.2650 0.2507 0.2483 0.0042  0.0008  0.0099  96  GLU A CD  
808  O OE1 . GLU A 96  ? 0.2373 0.2337 0.2416 -0.0042 0.0051  0.0077  96  GLU A OE1 
809  O OE2 . GLU A 96  ? 0.2407 0.2475 0.2363 -0.0021 0.0054  0.0102  96  GLU A OE2 
810  N N   . GLN A 97  ? 0.2312 0.2573 0.2095 -0.0071 0.0064  0.0126  97  GLN A N   
811  C CA  . GLN A 97  ? 0.2272 0.2441 0.2110 -0.0042 0.0039  0.0079  97  GLN A CA  
812  C C   . GLN A 97  ? 0.2291 0.2861 0.2370 0.0057  -0.0010 0.0052  97  GLN A C   
813  O O   . GLN A 97  ? 0.2280 0.3167 0.2491 0.0243  -0.0124 0.0023  97  GLN A O   
814  C CB  . GLN A 97  ? 0.2342 0.2390 0.2216 0.0047  0.0071  0.0081  97  GLN A CB  
815  C CG  . GLN A 97  ? 0.2500 0.2455 0.2459 0.0051  -0.0010 0.0169  97  GLN A CG  
816  C CD  . GLN A 97  ? 0.2395 0.2462 0.2396 -0.0214 -0.0151 0.0204  97  GLN A CD  
817  O OE1 . GLN A 97  ? 0.2525 0.2696 0.2693 -0.0197 -0.0241 0.0561  97  GLN A OE1 
818  N NE2 . GLN A 97  ? 0.2358 0.2633 0.2155 -0.0161 0.0031  0.0357  97  GLN A NE2 
819  N N   . LYS A 98  ? 0.2073 0.2573 0.2137 0.0093  0.0004  -0.0045 98  LYS A N   
820  C CA  A LYS A 98  ? 0.1997 0.2501 0.2347 0.0075  0.0085  -0.0024 98  LYS A CA  
821  C CA  B LYS A 98  ? 0.2175 0.2655 0.2469 0.0079  0.0082  0.0007  98  LYS A CA  
822  C C   . LYS A 98  ? 0.1998 0.2626 0.2344 0.0074  0.0004  0.0049  98  LYS A C   
823  O O   . LYS A 98  ? 0.1951 0.2703 0.2608 0.0006  0.0021  0.0014  98  LYS A O   
824  C CB  A LYS A 98  ? 0.2100 0.2446 0.2466 0.0073  0.0119  -0.0062 98  LYS A CB  
825  C CB  B LYS A 98  ? 0.2611 0.2785 0.2834 0.0047  0.0050  -0.0062 98  LYS A CB  
826  C CG  A LYS A 98  ? 0.1977 0.2273 0.2332 0.0040  0.0221  -0.0120 98  LYS A CG  
827  C CG  B LYS A 98  ? 0.2925 0.2995 0.2967 0.0008  0.0046  0.0081  98  LYS A CG  
828  C CD  A LYS A 98  ? 0.2675 0.2675 0.2675 0.0000  0.0000  0.0000  98  LYS A CD  
829  C CD  B LYS A 98  ? 0.3284 0.3120 0.3278 -0.0049 0.0053  -0.0080 98  LYS A CD  
830  C CE  A LYS A 98  ? 0.2673 0.2673 0.2673 0.0000  0.0000  0.0000  98  LYS A CE  
831  C CE  B LYS A 98  ? 0.3625 0.3643 0.3575 0.0004  0.0066  0.0012  98  LYS A CE  
832  N NZ  A LYS A 98  ? 0.2685 0.2685 0.2685 0.0000  0.0000  0.0000  98  LYS A NZ  
833  N NZ  B LYS A 98  ? 0.3736 0.3440 0.3668 -0.0066 0.0010  -0.0046 98  LYS A NZ  
834  N N   . LEU A 99  ? 0.2036 0.2928 0.2314 0.0020  0.0086  0.0023  99  LEU A N   
835  C CA  . LEU A 99  ? 0.2148 0.3181 0.2479 -0.0111 -0.0055 0.0000  99  LEU A CA  
836  C C   . LEU A 99  ? 0.2492 0.3199 0.2780 -0.0051 -0.0065 0.0001  99  LEU A C   
837  O O   . LEU A 99  ? 0.2699 0.3300 0.2770 0.0057  -0.0119 -0.0057 99  LEU A O   
838  C CB  . LEU A 99  ? 0.1865 0.3105 0.2616 -0.0044 -0.0116 -0.0020 99  LEU A CB  
839  C CG  . LEU A 99  ? 0.2055 0.3063 0.2595 0.0063  -0.0161 -0.0015 99  LEU A CG  
840  C CD1 . LEU A 99  ? 0.1921 0.3276 0.2755 -0.0063 -0.0092 0.0070  99  LEU A CD1 
841  C CD2 . LEU A 99  ? 0.2393 0.3142 0.2854 -0.0112 0.0088  0.0060  99  LEU A CD2 
842  N N   . LEU A 100 ? 0.2478 0.3324 0.2618 -0.0011 -0.0029 0.0078  100 LEU A N   
843  C CA  . LEU A 100 ? 0.2654 0.3551 0.2907 0.0105  0.0075  -0.0075 100 LEU A CA  
844  C C   . LEU A 100 ? 0.2990 0.3780 0.3294 0.0112  0.0006  -0.0022 100 LEU A C   
845  O O   . LEU A 100 ? 0.3289 0.3942 0.3141 0.0106  -0.0079 -0.0173 100 LEU A O   
846  C CB  . LEU A 100 ? 0.2896 0.3520 0.3021 0.0116  0.0106  0.0066  100 LEU A CB  
847  C CG  . LEU A 100 ? 0.3211 0.3723 0.3242 0.0212  0.0151  -0.0012 100 LEU A CG  
848  C CD1 . LEU A 100 ? 0.3243 0.3588 0.3186 0.0083  -0.0055 -0.0075 100 LEU A CD1 
849  C CD2 . LEU A 100 ? 0.3249 0.3683 0.3222 -0.0107 0.0112  -0.0204 100 LEU A CD2 
850  N N   . LYS A 101 ? 0.2743 0.3818 0.3065 0.0000  -0.0038 -0.0074 101 LYS A N   
851  C CA  . LYS A 101 ? 0.2922 0.3843 0.3270 0.0084  -0.0017 -0.0061 101 LYS A CA  
852  C C   . LYS A 101 ? 0.2750 0.3766 0.3168 0.0140  -0.0020 -0.0178 101 LYS A C   
853  O O   . LYS A 101 ? 0.2801 0.4091 0.3410 0.0030  0.0024  -0.0135 101 LYS A O   
854  C CB  . LYS A 101 ? 0.3059 0.3684 0.3290 0.0041  0.0045  0.0004  101 LYS A CB  
855  C CG  . LYS A 101 ? 0.3180 0.3633 0.3384 -0.0014 0.0012  -0.0006 101 LYS A CG  
856  C CD  . LYS A 101 ? 0.3277 0.3652 0.3401 0.0013  0.0034  -0.0004 101 LYS A CD  
857  C CE  . LYS A 101 ? 0.3408 0.3608 0.3451 -0.0007 0.0009  0.0014  101 LYS A CE  
858  N NZ  . LYS A 101 ? 0.3481 0.3555 0.3497 -0.0010 0.0048  -0.0004 101 LYS A NZ  
859  N N   . GLY A 102 ? 0.3018 0.4087 0.3172 0.0094  0.0029  -0.0111 102 GLY A N   
860  C CA  . GLY A 102 ? 0.2354 0.3856 0.2832 0.0040  -0.0118 -0.0218 102 GLY A CA  
861  C C   . GLY A 102 ? 0.2899 0.3760 0.3352 -0.0049 0.0046  -0.0004 102 GLY A C   
862  O O   . GLY A 102 ? 0.2146 0.3877 0.3093 -0.0273 0.0101  -0.0230 102 GLY A O   
863  N N   . GLU A 103 ? 0.2523 0.3393 0.2883 -0.0118 -0.0152 -0.0144 103 GLU A N   
864  C CA  . GLU A 103 ? 0.2706 0.3230 0.3077 0.0000  -0.0148 0.0033  103 GLU A CA  
865  C C   . GLU A 103 ? 0.2288 0.3142 0.2832 -0.0055 -0.0147 0.0054  103 GLU A C   
866  O O   . GLU A 103 ? 0.2535 0.3401 0.2810 0.0101  -0.0191 0.0132  103 GLU A O   
867  C CB  . GLU A 103 ? 0.2904 0.3122 0.3149 0.0191  -0.0206 -0.0063 103 GLU A CB  
868  C CG  . GLU A 103 ? 0.3189 0.3071 0.3563 -0.0066 0.0041  -0.0053 103 GLU A CG  
869  C CD  . GLU A 103 ? 0.3073 0.2909 0.3424 -0.0017 0.0022  0.0011  103 GLU A CD  
870  O OE1 . GLU A 103 ? 0.2860 0.2449 0.3263 -0.0080 -0.0021 -0.0297 103 GLU A OE1 
871  O OE2 . GLU A 103 ? 0.3343 0.3089 0.3654 -0.0079 0.0002  0.0056  103 GLU A OE2 
872  N N   . GLY A 104 ? 0.2376 0.3163 0.2915 0.0001  -0.0129 -0.0187 104 GLY A N   
873  C CA  . GLY A 104 ? 0.2569 0.2991 0.2905 0.0050  0.0022  -0.0178 104 GLY A CA  
874  C C   . GLY A 104 ? 0.2707 0.3057 0.3109 -0.0049 -0.0060 -0.0076 104 GLY A C   
875  O O   . GLY A 104 ? 0.2848 0.3064 0.2909 -0.0212 0.0051  -0.0096 104 GLY A O   
876  N N   . PRO A 105 ? 0.2639 0.2848 0.3143 0.0087  0.0132  -0.0085 105 PRO A N   
877  C CA  . PRO A 105 ? 0.2676 0.3036 0.3058 -0.0032 0.0037  -0.0137 105 PRO A CA  
878  C C   . PRO A 105 ? 0.2626 0.3028 0.2901 0.0111  0.0022  -0.0012 105 PRO A C   
879  O O   . PRO A 105 ? 0.2754 0.3611 0.2988 0.0123  -0.0068 0.0078  105 PRO A O   
880  C CB  . PRO A 105 ? 0.2923 0.3018 0.3388 0.0063  0.0249  -0.0170 105 PRO A CB  
881  C CG  . PRO A 105 ? 0.3249 0.3225 0.3644 0.0033  0.0237  -0.0105 105 PRO A CG  
882  C CD  . PRO A 105 ? 0.3019 0.3135 0.3517 0.0037  0.0066  -0.0064 105 PRO A CD  
883  N N   . LYS A 106 ? 0.2471 0.2859 0.2744 0.0118  0.0008  -0.0060 106 LYS A N   
884  C CA  . LYS A 106 ? 0.2404 0.2759 0.2521 0.0123  0.0031  0.0033  106 LYS A CA  
885  C C   . LYS A 106 ? 0.2507 0.2852 0.2535 0.0195  -0.0177 0.0017  106 LYS A C   
886  O O   . LYS A 106 ? 0.2649 0.3006 0.2522 0.0474  -0.0238 -0.0035 106 LYS A O   
887  C CB  . LYS A 106 ? 0.2791 0.2913 0.2904 -0.0017 0.0068  0.0118  106 LYS A CB  
888  C CG  . LYS A 106 ? 0.2958 0.3325 0.3196 -0.0072 0.0052  0.0119  106 LYS A CG  
889  C CD  . LYS A 106 ? 0.3382 0.3320 0.3376 0.0009  0.0046  0.0169  106 LYS A CD  
890  C CE  . LYS A 106 ? 0.3567 0.3318 0.3421 -0.0068 0.0005  0.0209  106 LYS A CE  
891  N NZ  . LYS A 106 ? 0.3718 0.3665 0.3676 -0.0002 0.0022  0.0105  106 LYS A NZ  
892  N N   . THR A 107 ? 0.2317 0.2880 0.2466 -0.0002 -0.0064 -0.0013 107 THR A N   
893  C CA  . THR A 107 ? 0.2042 0.2528 0.2277 0.0026  -0.0048 0.0204  107 THR A CA  
894  C C   . THR A 107 ? 0.2219 0.2544 0.2292 0.0018  -0.0040 0.0022  107 THR A C   
895  O O   . THR A 107 ? 0.2341 0.2909 0.2035 0.0093  0.0026  -0.0098 107 THR A O   
896  C CB  . THR A 107 ? 0.2405 0.2657 0.2609 -0.0103 -0.0069 0.0229  107 THR A CB  
897  O OG1 . THR A 107 ? 0.2857 0.3041 0.2620 0.0000  -0.0154 0.0382  107 THR A OG1 
898  C CG2 . THR A 107 ? 0.2366 0.2640 0.2728 -0.0191 -0.0200 0.0144  107 THR A CG2 
899  N N   . SER A 108 ? 0.1954 0.2251 0.2054 0.0053  -0.0021 0.0126  108 SER A N   
900  C CA  . SER A 108 ? 0.1928 0.2277 0.1967 0.0015  -0.0073 0.0017  108 SER A CA  
901  C C   . SER A 108 ? 0.1965 0.2184 0.1859 -0.0106 -0.0072 -0.0050 108 SER A C   
902  O O   . SER A 108 ? 0.1728 0.2395 0.2192 -0.0118 -0.0249 -0.0187 108 SER A O   
903  C CB  . SER A 108 ? 0.2680 0.2613 0.2199 -0.0131 -0.0189 0.0064  108 SER A CB  
904  O OG  . SER A 108 ? 0.3275 0.3082 0.2616 -0.0574 -0.0172 0.0244  108 SER A OG  
905  N N   . TRP A 109 ? 0.1716 0.2179 0.1800 -0.0047 0.0027  -0.0119 109 TRP A N   
906  C CA  . TRP A 109 ? 0.1808 0.1984 0.2024 -0.0027 0.0090  0.0120  109 TRP A CA  
907  C C   . TRP A 109 ? 0.1850 0.2160 0.2096 -0.0133 0.0064  -0.0041 109 TRP A C   
908  O O   . TRP A 109 ? 0.1928 0.2128 0.2280 -0.0187 0.0266  -0.0174 109 TRP A O   
909  C CB  . TRP A 109 ? 0.2016 0.2070 0.2080 -0.0135 -0.0041 -0.0073 109 TRP A CB  
910  C CG  . TRP A 109 ? 0.2067 0.2313 0.2052 -0.0139 0.0067  -0.0004 109 TRP A CG  
911  C CD1 . TRP A 109 ? 0.2166 0.2257 0.2110 -0.0269 -0.0041 0.0009  109 TRP A CD1 
912  C CD2 . TRP A 109 ? 0.2085 0.2351 0.2155 -0.0159 -0.0017 -0.0052 109 TRP A CD2 
913  N NE1 . TRP A 109 ? 0.2263 0.2512 0.2076 -0.0133 -0.0011 -0.0073 109 TRP A NE1 
914  C CE2 . TRP A 109 ? 0.2085 0.2482 0.2119 -0.0179 0.0033  -0.0074 109 TRP A CE2 
915  C CE3 . TRP A 109 ? 0.2035 0.2045 0.2160 -0.0055 0.0079  -0.0079 109 TRP A CE3 
916  C CZ2 . TRP A 109 ? 0.2124 0.2155 0.2121 -0.0108 -0.0015 0.0030  109 TRP A CZ2 
917  C CZ3 . TRP A 109 ? 0.2153 0.1957 0.2019 -0.0104 -0.0060 -0.0137 109 TRP A CZ3 
918  C CH2 . TRP A 109 ? 0.2153 0.2160 0.2114 -0.0065 -0.0070 0.0015  109 TRP A CH2 
919  N N   . THR A 110 ? 0.1863 0.2208 0.1877 -0.0143 0.0230  -0.0089 110 THR A N   
920  C CA  . THR A 110 ? 0.2064 0.2068 0.1927 -0.0125 0.0266  0.0000  110 THR A CA  
921  C C   . THR A 110 ? 0.2259 0.2098 0.1998 -0.0135 0.0244  -0.0057 110 THR A C   
922  O O   . THR A 110 ? 0.2256 0.1936 0.2226 -0.0325 0.0220  -0.0191 110 THR A O   
923  C CB  . THR A 110 ? 0.2379 0.2036 0.2002 0.0047  0.0029  -0.0093 110 THR A CB  
924  O OG1 . THR A 110 ? 0.2834 0.2617 0.2237 -0.0097 -0.0055 -0.0073 110 THR A OG1 
925  C CG2 . THR A 110 ? 0.2422 0.2205 0.2098 0.0183  0.0021  0.0002  110 THR A CG2 
926  N N   . LEU A 111 ? 0.1900 0.2239 0.1698 -0.0123 0.0200  0.0045  111 LEU A N   
927  C CA  . LEU A 111 ? 0.1960 0.2141 0.1935 -0.0196 0.0223  0.0086  111 LEU A CA  
928  C C   . LEU A 111 ? 0.2383 0.2151 0.2092 -0.0192 0.0259  0.0051  111 LEU A C   
929  O O   . LEU A 111 ? 0.2373 0.2015 0.2150 -0.0492 0.0368  -0.0051 111 LEU A O   
930  C CB  . LEU A 111 ? 0.2167 0.2477 0.2082 -0.0261 -0.0043 0.0044  111 LEU A CB  
931  C CG  . LEU A 111 ? 0.2643 0.2517 0.2056 -0.0004 -0.0054 0.0094  111 LEU A CG  
932  C CD1 . LEU A 111 ? 0.2819 0.2692 0.1960 -0.0011 -0.0232 0.0032  111 LEU A CD1 
933  C CD2 . LEU A 111 ? 0.2582 0.2109 0.2215 -0.0152 0.0019  0.0095  111 LEU A CD2 
934  N N   . GLU A 112 ? 0.2329 0.2296 0.2000 -0.0291 0.0450  0.0042  112 GLU A N   
935  C CA  . GLU A 112 ? 0.2484 0.2632 0.2709 -0.0265 0.0236  -0.0083 112 GLU A CA  
936  C C   . GLU A 112 ? 0.2528 0.2612 0.2533 -0.0252 0.0555  -0.0093 112 GLU A C   
937  O O   . GLU A 112 ? 0.2521 0.2736 0.3026 -0.0400 0.0661  -0.0327 112 GLU A O   
938  C CB  . GLU A 112 ? 0.2708 0.2698 0.2294 -0.0356 0.0500  0.0359  112 GLU A CB  
939  C CG  . GLU A 112 ? 0.3049 0.3369 0.2882 -0.0252 0.0189  0.0060  112 GLU A CG  
940  C CD  . GLU A 112 ? 0.2467 0.3219 0.2306 -0.0326 0.0489  0.0400  112 GLU A CD  
941  O OE1 . GLU A 112 ? 0.3337 0.3715 0.2857 -0.0202 0.0046  0.0123  112 GLU A OE1 
942  O OE2 . GLU A 112 ? 0.3530 0.3713 0.3130 -0.0111 -0.0068 0.0170  112 GLU A OE2 
943  N N   . LEU A 113 ? 0.2813 0.2921 0.3155 -0.0240 0.0437  -0.0280 113 LEU A N   
944  C CA  . LEU A 113 ? 0.3354 0.3398 0.3388 -0.0013 0.0344  -0.0173 113 LEU A CA  
945  C C   . LEU A 113 ? 0.3725 0.3614 0.3538 -0.0098 0.0471  -0.0169 113 LEU A C   
946  O O   . LEU A 113 ? 0.4076 0.3718 0.3577 -0.0117 0.0709  -0.0313 113 LEU A O   
947  C CB  . LEU A 113 ? 0.3369 0.3692 0.3883 -0.0127 0.0242  -0.0169 113 LEU A CB  
948  C CG  . LEU A 113 ? 0.3975 0.4304 0.4202 -0.0141 -0.0002 -0.0052 113 LEU A CG  
949  C CD1 . LEU A 113 ? 0.3774 0.4208 0.4162 -0.0180 0.0199  -0.0090 113 LEU A CD1 
950  C CD2 . LEU A 113 ? 0.3752 0.4123 0.4047 -0.0026 0.0211  -0.0118 113 LEU A CD2 
951  N N   . THR A 114 ? 0.3886 0.3590 0.3593 -0.0229 0.0558  -0.0195 114 THR A N   
952  C CA  . THR A 114 ? 0.4081 0.3906 0.3650 -0.0113 0.0292  -0.0071 114 THR A CA  
953  C C   . THR A 114 ? 0.4073 0.3953 0.3794 -0.0109 0.0312  -0.0073 114 THR A C   
954  O O   . THR A 114 ? 0.3569 0.4089 0.3681 -0.0118 0.0536  -0.0076 114 THR A O   
955  C CB  . THR A 114 ? 0.4186 0.4101 0.3691 -0.0108 0.0340  -0.0006 114 THR A CB  
956  O OG1 . THR A 114 ? 0.4067 0.3990 0.3284 -0.0076 0.0586  0.0007  114 THR A OG1 
957  C CG2 . THR A 114 ? 0.4137 0.4015 0.3747 -0.0046 0.0343  -0.0007 114 THR A CG2 
958  N N   . ASN A 115 ? 0.4252 0.4122 0.3954 -0.0086 0.0214  -0.0033 115 ASN A N   
959  C CA  . ASN A 115 ? 0.4255 0.4289 0.4196 -0.0062 0.0136  -0.0011 115 ASN A CA  
960  C C   . ASN A 115 ? 0.4264 0.4334 0.4165 -0.0053 0.0166  -0.0021 115 ASN A C   
961  O O   . ASN A 115 ? 0.4100 0.4315 0.4200 -0.0051 0.0138  -0.0043 115 ASN A O   
962  C CB  . ASN A 115 ? 0.4459 0.4454 0.4280 -0.0041 0.0083  0.0017  115 ASN A CB  
963  C CG  . ASN A 115 ? 0.4611 0.4597 0.4521 -0.0016 0.0088  0.0017  115 ASN A CG  
964  O OD1 . ASN A 115 ? 0.4574 0.4712 0.4401 0.0018  -0.0034 0.0025  115 ASN A OD1 
965  N ND2 . ASN A 115 ? 0.4678 0.4594 0.4462 -0.0062 0.0021  -0.0002 115 ASN A ND2 
966  N N   . ASP A 116 ? 0.4091 0.4226 0.3952 -0.0076 0.0326  -0.0066 116 ASP A N   
967  C CA  . ASP A 116 ? 0.4101 0.4185 0.3965 -0.0044 0.0209  0.0020  116 ASP A CA  
968  C C   . ASP A 116 ? 0.3902 0.4094 0.3694 -0.0071 0.0322  -0.0075 116 ASP A C   
969  O O   . ASP A 116 ? 0.3791 0.4262 0.3533 0.0031  0.0394  -0.0022 116 ASP A O   
970  C CB  . ASP A 116 ? 0.4227 0.4232 0.4054 -0.0012 0.0134  -0.0036 116 ASP A CB  
971  C CG  . ASP A 116 ? 0.4106 0.4232 0.4017 -0.0093 0.0089  -0.0023 116 ASP A CG  
972  O OD1 . ASP A 116 ? 0.4381 0.4352 0.4078 0.0011  0.0102  -0.0020 116 ASP A OD1 
973  O OD2 . ASP A 116 ? 0.4203 0.4166 0.4145 0.0056  0.0108  0.0040  116 ASP A OD2 
974  N N   . GLY A 117 ? 0.3836 0.4169 0.3779 -0.0091 0.0264  -0.0016 117 GLY A N   
975  C CA  . GLY A 117 ? 0.3564 0.4079 0.3634 -0.0135 0.0268  0.0075  117 GLY A CA  
976  C C   . GLY A 117 ? 0.3344 0.3789 0.3194 -0.0136 0.0346  0.0070  117 GLY A C   
977  O O   . GLY A 117 ? 0.3275 0.4309 0.3431 -0.0096 0.0432  0.0145  117 GLY A O   
978  N N   . GLU A 118 ? 0.2914 0.3574 0.2824 -0.0198 0.0538  -0.0093 118 GLU A N   
979  C CA  . GLU A 118 ? 0.2807 0.3253 0.2607 -0.0093 0.0354  -0.0257 118 GLU A CA  
980  C C   . GLU A 118 ? 0.2943 0.2958 0.2618 -0.0107 0.0279  -0.0205 118 GLU A C   
981  O O   . GLU A 118 ? 0.3093 0.3061 0.2590 -0.0299 0.0493  -0.0274 118 GLU A O   
982  C CB  . GLU A 118 ? 0.2970 0.3158 0.2843 -0.0093 0.0194  -0.0187 118 GLU A CB  
983  C CG  . GLU A 118 ? 0.3606 0.3642 0.3123 0.0066  0.0213  -0.0205 118 GLU A CG  
984  C CD  . GLU A 118 ? 0.3778 0.3812 0.3450 -0.0049 0.0104  -0.0168 118 GLU A CD  
985  O OE1 . GLU A 118 ? 0.4049 0.4019 0.3510 -0.0063 0.0026  -0.0143 118 GLU A OE1 
986  O OE2 . GLU A 118 ? 0.4391 0.3939 0.3830 -0.0138 0.0131  -0.0165 118 GLU A OE2 
987  N N   . LEU A 119 ? 0.2201 0.2499 0.2316 -0.0260 0.0515  -0.0392 119 LEU A N   
988  C CA  . LEU A 119 ? 0.1730 0.2578 0.2286 -0.0072 0.0359  -0.0342 119 LEU A CA  
989  C C   . LEU A 119 ? 0.1963 0.2513 0.2416 -0.0096 0.0218  -0.0199 119 LEU A C   
990  O O   . LEU A 119 ? 0.2285 0.2151 0.2499 -0.0315 0.0247  -0.0385 119 LEU A O   
991  C CB  . LEU A 119 ? 0.1948 0.2548 0.2403 -0.0068 0.0235  -0.0288 119 LEU A CB  
992  C CG  . LEU A 119 ? 0.2198 0.2563 0.2119 -0.0227 0.0265  -0.0284 119 LEU A CG  
993  C CD1 . LEU A 119 ? 0.2551 0.2731 0.2588 -0.0264 0.0308  -0.0353 119 LEU A CD1 
994  C CD2 . LEU A 119 ? 0.2388 0.2412 0.2147 -0.0014 0.0152  -0.0243 119 LEU A CD2 
995  N N   . ILE A 120 ? 0.1953 0.2607 0.2514 -0.0075 0.0253  -0.0144 120 ILE A N   
996  C CA  . ILE A 120 ? 0.2148 0.2511 0.2287 0.0000  0.0171  -0.0290 120 ILE A CA  
997  C C   . ILE A 120 ? 0.1982 0.2161 0.1999 -0.0215 0.0227  -0.0305 120 ILE A C   
998  O O   . ILE A 120 ? 0.2291 0.2245 0.2134 -0.0062 0.0291  -0.0337 120 ILE A O   
999  C CB  . ILE A 120 ? 0.2554 0.2802 0.2398 0.0045  0.0166  -0.0170 120 ILE A CB  
1000 C CG1 . ILE A 120 ? 0.2858 0.2993 0.2483 0.0021  0.0129  -0.0098 120 ILE A CG1 
1001 C CG2 . ILE A 120 ? 0.2633 0.2863 0.2268 0.0102  0.0182  -0.0218 120 ILE A CG2 
1002 C CD1 . ILE A 120 ? 0.3433 0.3293 0.2697 -0.0059 0.0061  0.0013  120 ILE A CD1 
1003 N N   . ASP A 121 ? 0.2192 0.2509 0.2280 0.0041  0.0292  -0.0327 121 ASP A N   
1004 C CA  . ASP A 121 ? 0.1950 0.2364 0.2317 0.0027  0.0227  -0.0225 121 ASP A CA  
1005 C C   . ASP A 121 ? 0.2341 0.2538 0.2467 0.0000  -0.0103 -0.0241 121 ASP A C   
1006 O O   . ASP A 121 ? 0.2095 0.2285 0.2334 -0.0162 -0.0195 -0.0674 121 ASP A O   
1007 C CB  . ASP A 121 ? 0.2686 0.2957 0.2799 0.0036  -0.0028 0.0035  121 ASP A CB  
1008 C CG  . ASP A 121 ? 0.3607 0.3600 0.3129 -0.0041 -0.0034 0.0020  121 ASP A CG  
1009 O OD1 . ASP A 121 ? 0.3854 0.3681 0.3690 0.0044  -0.0002 0.0004  121 ASP A OD1 
1010 O OD2 . ASP A 121 ? 0.3933 0.3940 0.3314 -0.0360 -0.0093 0.0046  121 ASP A OD2 
1011 N N   . THR A 122 ? 0.2040 0.2192 0.2350 0.0045  0.0111  -0.0408 122 THR A N   
1012 C CA  . THR A 122 ? 0.2359 0.2460 0.2503 0.0051  0.0098  -0.0290 122 THR A CA  
1013 C C   . THR A 122 ? 0.2388 0.2283 0.2429 0.0110  0.0065  -0.0394 122 THR A C   
1014 O O   . THR A 122 ? 0.2369 0.2442 0.2671 -0.0160 -0.0071 -0.0349 122 THR A O   
1015 C CB  . THR A 122 ? 0.2801 0.2658 0.2600 0.0067  0.0056  -0.0245 122 THR A CB  
1016 O OG1 . THR A 122 ? 0.3087 0.2496 0.2701 0.0191  -0.0012 -0.0346 122 THR A OG1 
1017 C CG2 . THR A 122 ? 0.2748 0.2687 0.2276 0.0020  0.0018  -0.0251 122 THR A CG2 
1018 N N   . MET A 123 ? 0.2220 0.2172 0.2516 0.0099  -0.0009 -0.0236 123 MET A N   
1019 C CA  . MET A 123 ? 0.2278 0.2511 0.2707 0.0108  -0.0129 -0.0174 123 MET A CA  
1020 C C   . MET A 123 ? 0.2205 0.2439 0.2447 0.0190  -0.0251 -0.0196 123 MET A C   
1021 O O   . MET A 123 ? 0.2441 0.2713 0.2622 0.0216  -0.0332 -0.0316 123 MET A O   
1022 C CB  . MET A 123 ? 0.2715 0.2805 0.2866 0.0002  -0.0197 -0.0064 123 MET A CB  
1023 C CG  . MET A 123 ? 0.3281 0.3013 0.3422 0.0196  -0.0256 0.0043  123 MET A CG  
1024 S SD  . MET A 123 ? 0.3689 0.3404 0.3835 0.0127  -0.0373 0.0266  123 MET A SD  
1025 C CE  . MET A 123 ? 0.3514 0.3165 0.3433 0.0355  -0.0362 0.0250  123 MET A CE  
1026 N N   . THR A 124 ? 0.2112 0.2484 0.2423 0.0080  -0.0198 -0.0141 124 THR A N   
1027 C CA  A THR A 124 ? 0.1899 0.2127 0.2044 0.0102  -0.0111 -0.0142 124 THR A CA  
1028 C CA  B THR A 124 ? 0.2098 0.2360 0.2262 0.0157  -0.0122 -0.0122 124 THR A CA  
1029 C C   . THR A 124 ? 0.2298 0.2604 0.2444 0.0198  -0.0035 -0.0094 124 THR A C   
1030 O O   . THR A 124 ? 0.2330 0.3183 0.2353 0.0281  -0.0210 -0.0263 124 THR A O   
1031 C CB  A THR A 124 ? 0.2027 0.2226 0.2063 0.0102  -0.0139 -0.0086 124 THR A CB  
1032 C CB  B THR A 124 ? 0.2522 0.2647 0.2612 0.0159  -0.0138 -0.0055 124 THR A CB  
1033 O OG1 A THR A 124 ? 0.1804 0.2002 0.1610 0.0083  0.0056  -0.0136 124 THR A OG1 
1034 O OG1 B THR A 124 ? 0.2813 0.3175 0.2812 0.0159  -0.0204 -0.0069 124 THR A OG1 
1035 C CG2 A THR A 124 ? 0.1807 0.2107 0.1936 -0.0057 -0.0104 -0.0290 124 THR A CG2 
1036 C CG2 B THR A 124 ? 0.2386 0.2302 0.2141 0.0214  0.0005  -0.0159 124 THR A CG2 
1037 N N   . ALA A 125 ? 0.2131 0.2468 0.2475 0.0209  -0.0194 -0.0135 125 ALA A N   
1038 C CA  . ALA A 125 ? 0.2549 0.2812 0.2544 0.0152  -0.0114 0.0014  125 ALA A CA  
1039 C C   . ALA A 125 ? 0.2478 0.3030 0.2630 0.0204  -0.0335 -0.0081 125 ALA A C   
1040 O O   . ALA A 125 ? 0.2329 0.3624 0.2465 0.0145  -0.0359 -0.0162 125 ALA A O   
1041 C CB  . ALA A 125 ? 0.2833 0.3055 0.3096 -0.0115 -0.0122 0.0137  125 ALA A CB  
1042 N N   . ASP A 126 ? 0.2681 0.3094 0.2475 0.0280  -0.0369 0.0047  126 ASP A N   
1043 C CA  . ASP A 126 ? 0.2842 0.3240 0.2619 0.0250  -0.0204 0.0102  126 ASP A CA  
1044 C C   . ASP A 126 ? 0.3017 0.3455 0.2854 0.0330  -0.0218 -0.0011 126 ASP A C   
1045 O O   . ASP A 126 ? 0.3513 0.3552 0.3135 0.0334  -0.0076 0.0138  126 ASP A O   
1046 C CB  . ASP A 126 ? 0.2921 0.3459 0.2910 0.0108  -0.0223 -0.0068 126 ASP A CB  
1047 C CG  . ASP A 126 ? 0.3032 0.3354 0.2982 0.0033  -0.0195 -0.0080 126 ASP A CG  
1048 O OD1 . ASP A 126 ? 0.2953 0.3200 0.2835 0.0294  -0.0370 -0.0069 126 ASP A OD1 
1049 O OD2 . ASP A 126 ? 0.3135 0.3602 0.3085 0.0019  -0.0116 -0.0211 126 ASP A OD2 
1050 N N   . ASP A 127 ? 0.3166 0.3522 0.2923 0.0541  -0.0160 -0.0067 127 ASP A N   
1051 C CA  . ASP A 127 ? 0.3460 0.3534 0.2921 0.0416  -0.0226 0.0071  127 ASP A CA  
1052 C C   . ASP A 127 ? 0.3565 0.3516 0.2955 0.0300  -0.0110 0.0059  127 ASP A C   
1053 O O   . ASP A 127 ? 0.4206 0.3742 0.2609 0.0509  0.0052  0.0037  127 ASP A O   
1054 C CB  . ASP A 127 ? 0.3615 0.3824 0.3022 0.0310  -0.0342 0.0093  127 ASP A CB  
1055 C CG  . ASP A 127 ? 0.3608 0.4052 0.3320 0.0208  -0.0334 0.0131  127 ASP A CG  
1056 O OD1 . ASP A 127 ? 0.3484 0.4153 0.3553 0.0295  -0.0514 0.0191  127 ASP A OD1 
1057 O OD2 . ASP A 127 ? 0.4134 0.4396 0.3694 0.0242  -0.0309 0.0179  127 ASP A OD2 
1058 N N   . VAL A 128 ? 0.2788 0.3171 0.2684 0.0418  -0.0140 0.0107  128 VAL A N   
1059 C CA  . VAL A 128 ? 0.2642 0.3044 0.2788 0.0114  -0.0300 0.0006  128 VAL A CA  
1060 C C   . VAL A 128 ? 0.2600 0.2937 0.2626 0.0110  -0.0243 0.0055  128 VAL A C   
1061 O O   . VAL A 128 ? 0.2775 0.2900 0.2781 0.0144  -0.0291 -0.0248 128 VAL A O   
1062 C CB  . VAL A 128 ? 0.2729 0.3282 0.2924 0.0088  -0.0340 0.0068  128 VAL A CB  
1063 C CG1 . VAL A 128 ? 0.2947 0.3413 0.3204 -0.0023 -0.0243 -0.0015 128 VAL A CG1 
1064 C CG2 . VAL A 128 ? 0.2911 0.3594 0.3195 -0.0016 -0.0270 -0.0059 128 VAL A CG2 
1065 N N   . VAL A 129 ? 0.2403 0.2690 0.2959 0.0273  -0.0425 0.0034  129 VAL A N   
1066 C CA  . VAL A 129 ? 0.2434 0.2632 0.2863 0.0172  -0.0130 -0.0087 129 VAL A CA  
1067 C C   . VAL A 129 ? 0.2715 0.2743 0.2965 0.0248  -0.0234 -0.0076 129 VAL A C   
1068 O O   . VAL A 129 ? 0.2812 0.2783 0.2470 0.0383  -0.0443 -0.0271 129 VAL A O   
1069 C CB  . VAL A 129 ? 0.2582 0.2707 0.3213 0.0209  -0.0188 0.0046  129 VAL A CB  
1070 C CG1 . VAL A 129 ? 0.2585 0.3108 0.3385 0.0033  -0.0088 0.0067  129 VAL A CG1 
1071 C CG2 . VAL A 129 ? 0.2750 0.2859 0.3299 0.0147  -0.0030 0.0045  129 VAL A CG2 
1072 N N   . CYS A 130 ? 0.2230 0.2468 0.2487 0.0173  -0.0320 -0.0180 130 CYS A N   
1073 C CA  . CYS A 130 ? 0.1928 0.2530 0.2605 0.0060  -0.0120 -0.0316 130 CYS A CA  
1074 C C   . CYS A 130 ? 0.2093 0.2646 0.2692 0.0166  -0.0205 -0.0217 130 CYS A C   
1075 O O   . CYS A 130 ? 0.2317 0.2652 0.2673 0.0257  -0.0009 -0.0732 130 CYS A O   
1076 C CB  . CYS A 130 ? 0.2182 0.2367 0.2695 0.0052  -0.0221 -0.0342 130 CYS A CB  
1077 S SG  . CYS A 130 ? 0.2223 0.2725 0.2453 0.0354  -0.0285 -0.0479 130 CYS A SG  
1078 N N   . THR A 131 ? 0.1960 0.2341 0.2371 0.0236  -0.0061 -0.0224 131 THR A N   
1079 C CA  . THR A 131 ? 0.2264 0.2361 0.2638 0.0121  -0.0004 -0.0052 131 THR A CA  
1080 C C   . THR A 131 ? 0.1875 0.1954 0.2173 0.0004  0.0003  -0.0514 131 THR A C   
1081 O O   . THR A 131 ? 0.2118 0.2565 0.2747 0.0211  0.0009  -0.0266 131 THR A O   
1082 C CB  . THR A 131 ? 0.2569 0.2534 0.2715 0.0029  0.0043  -0.0017 131 THR A CB  
1083 O OG1 . THR A 131 ? 0.2995 0.2654 0.2959 0.0096  0.0052  -0.0077 131 THR A OG1 
1084 C CG2 . THR A 131 ? 0.2600 0.2809 0.2740 0.0005  0.0114  -0.0171 131 THR A CG2 
1085 N N   . LYS A 132 ? 0.2112 0.2316 0.2433 0.0222  0.0039  -0.0347 132 LYS A N   
1086 C CA  . LYS A 132 ? 0.1332 0.1984 0.2275 0.0046  0.0072  -0.0234 132 LYS A CA  
1087 C C   . LYS A 132 ? 0.2126 0.2573 0.2784 -0.0033 0.0325  0.0058  132 LYS A C   
1088 O O   . LYS A 132 ? 0.1494 0.1784 0.2520 -0.0131 0.0498  -0.0869 132 LYS A O   
1089 C CB  . LYS A 132 ? 0.1941 0.2289 0.2411 -0.0053 0.0097  -0.0188 132 LYS A CB  
1090 C CG  . LYS A 132 ? 0.1966 0.2401 0.2623 0.0074  0.0019  -0.0112 132 LYS A CG  
1091 C CD  . LYS A 132 ? 0.2465 0.2809 0.2730 -0.0038 0.0069  -0.0036 132 LYS A CD  
1092 C CE  . LYS A 132 ? 0.2710 0.3138 0.2921 -0.0088 0.0057  0.0033  132 LYS A CE  
1093 N NZ  . LYS A 132 ? 0.3309 0.3225 0.3309 0.0110  -0.0015 0.0086  132 LYS A NZ  
1094 N N   . VAL A 133 ? 0.1668 0.2122 0.1901 0.0119  0.0148  -0.0370 133 VAL A N   
1095 C CA  . VAL A 133 ? 0.1932 0.2374 0.1804 -0.0093 0.0035  -0.0132 133 VAL A CA  
1096 C C   . VAL A 133 ? 0.1640 0.1947 0.1896 -0.0122 0.0020  -0.0261 133 VAL A C   
1097 O O   . VAL A 133 ? 0.1975 0.2334 0.2121 0.0051  0.0109  -0.0353 133 VAL A O   
1098 C CB  . VAL A 133 ? 0.2095 0.2233 0.2065 -0.0075 0.0136  0.0034  133 VAL A CB  
1099 C CG1 . VAL A 133 ? 0.2130 0.2619 0.2552 -0.0040 0.0267  0.0017  133 VAL A CG1 
1100 C CG2 . VAL A 133 ? 0.2352 0.2425 0.2230 0.0077  -0.0039 0.0001  133 VAL A CG2 
1101 N N   . PHE A 134 ? 0.1983 0.2487 0.1924 -0.0022 0.0096  -0.0201 134 PHE A N   
1102 C CA  . PHE A 134 ? 0.1664 0.2316 0.1843 -0.0014 -0.0013 -0.0419 134 PHE A CA  
1103 C C   . PHE A 134 ? 0.1826 0.2448 0.1972 0.0056  0.0074  -0.0406 134 PHE A C   
1104 O O   . PHE A 134 ? 0.1702 0.2623 0.2075 -0.0119 0.0295  -0.0698 134 PHE A O   
1105 C CB  . PHE A 134 ? 0.2039 0.2512 0.1678 -0.0070 0.0121  -0.0183 134 PHE A CB  
1106 C CG  . PHE A 134 ? 0.1714 0.2256 0.1817 0.0036  0.0069  -0.0343 134 PHE A CG  
1107 C CD1 . PHE A 134 ? 0.1884 0.2422 0.1804 -0.0130 -0.0153 -0.0489 134 PHE A CD1 
1108 C CD2 . PHE A 134 ? 0.1711 0.2385 0.1896 -0.0040 -0.0001 -0.0290 134 PHE A CD2 
1109 C CE1 . PHE A 134 ? 0.1741 0.2190 0.1701 -0.0083 0.0011  -0.0417 134 PHE A CE1 
1110 C CE2 . PHE A 134 ? 0.1868 0.2410 0.2051 -0.0074 -0.0058 -0.0437 134 PHE A CE2 
1111 C CZ  . PHE A 134 ? 0.1883 0.2383 0.1829 0.0085  -0.0009 -0.0226 134 PHE A CZ  
1112 N N   . VAL A 135 ? 0.2095 0.2645 0.2539 -0.0066 -0.0026 -0.0508 135 VAL A N   
1113 C CA  . VAL A 135 ? 0.2272 0.2807 0.2452 0.0054  0.0351  -0.0508 135 VAL A CA  
1114 C C   . VAL A 135 ? 0.1589 0.2712 0.2525 -0.0135 0.0229  -0.0439 135 VAL A C   
1115 O O   . VAL A 135 ? 0.1978 0.3150 0.2362 0.0037  -0.0066 -0.0635 135 VAL A O   
1116 C CB  . VAL A 135 ? 0.2476 0.2854 0.2365 0.0173  0.0341  -0.0488 135 VAL A CB  
1117 C CG1 . VAL A 135 ? 0.2364 0.2963 0.2618 0.0251  0.0231  -0.0353 135 VAL A CG1 
1118 C CG2 . VAL A 135 ? 0.2704 0.2839 0.2524 0.0036  0.0107  -0.0655 135 VAL A CG2 
1119 N N   . ARG A 136 ? 0.2503 0.3350 0.3008 0.0041  0.0334  -0.0511 136 ARG A N   
1120 C CA  . ARG A 136 ? 0.2641 0.3643 0.3110 -0.0025 0.0112  -0.0416 136 ARG A CA  
1121 C C   . ARG A 136 ? 0.3004 0.3908 0.3199 0.0162  0.0175  -0.0332 136 ARG A C   
1122 O O   . ARG A 136 ? 0.2984 0.4136 0.3056 0.0552  -0.0012 -0.0338 136 ARG A O   
1123 C CB  . ARG A 136 ? 0.2835 0.3885 0.3315 -0.0134 0.0200  -0.0314 136 ARG A CB  
1124 C CG  . ARG A 136 ? 0.3365 0.3887 0.3544 -0.0009 0.0229  -0.0278 136 ARG A CG  
1125 C CD  . ARG A 136 ? 0.3235 0.3956 0.3836 -0.0064 0.0113  -0.0240 136 ARG A CD  
1126 N NE  . ARG A 136 ? 0.3603 0.4076 0.3956 0.0035  0.0174  -0.0166 136 ARG A NE  
1127 C CZ  . ARG A 136 ? 0.3579 0.3992 0.3943 -0.0090 0.0209  -0.0113 136 ARG A CZ  
1128 N NH1 . ARG A 136 ? 0.3739 0.3990 0.3832 0.0008  0.0235  -0.0200 136 ARG A NH1 
1129 N NH2 . ARG A 136 ? 0.3600 0.4081 0.3792 -0.0163 0.0399  -0.0283 136 ARG A NH2 
1130 N N   . GLU A 137 ? 0.3324 0.3988 0.3605 0.0191  0.0007  -0.0358 137 GLU A N   
1131 C CA  . GLU A 137 ? 0.3733 0.4230 0.4213 0.0135  -0.0102 -0.0305 137 GLU A CA  
1132 C C   . GLU A 137 ? 0.3820 0.4311 0.4411 0.0265  0.0043  -0.0346 137 GLU A C   
1133 O O   . GLU A 137 ? 0.3311 0.4282 0.4186 0.0501  0.0050  -0.0471 137 GLU A O   
1134 C CB  . GLU A 137 ? 0.4363 0.4536 0.4483 -0.0009 -0.0059 -0.0224 137 GLU A CB  
1135 C CG  . GLU A 137 ? 0.4657 0.4707 0.4866 0.0093  -0.0024 -0.0128 137 GLU A CG  
1136 C CD  . GLU A 137 ? 0.5077 0.5134 0.5179 0.0053  0.0050  -0.0114 137 GLU A CD  
1137 O OE1 . GLU A 137 ? 0.5232 0.5142 0.5183 0.0068  -0.0006 -0.0256 137 GLU A OE1 
1138 O OE2 . GLU A 137 ? 0.5186 0.5260 0.5354 -0.0151 0.0095  -0.0103 137 GLU A OE2 
1139 O OXT . GLU A 137 ? 0.3386 0.4420 0.4401 0.0435  -0.0034 -0.0538 137 GLU A OXT 
1140 N N   . PRO B 1   ? 0.4190 0.4094 0.4111 -0.0001 0.0007  -0.0069 1   PRO B N   
1141 C CA  . PRO B 1   ? 0.4172 0.4007 0.3925 0.0006  0.0024  -0.0107 1   PRO B CA  
1142 C C   . PRO B 1   ? 0.3929 0.3732 0.3746 0.0044  0.0053  -0.0091 1   PRO B C   
1143 O O   . PRO B 1   ? 0.4176 0.4038 0.4138 0.0142  0.0028  -0.0152 1   PRO B O   
1144 C CB  . PRO B 1   ? 0.4238 0.4044 0.4084 0.0001  0.0014  -0.0102 1   PRO B CB  
1145 C CG  . PRO B 1   ? 0.4207 0.4084 0.4169 -0.0006 0.0067  -0.0058 1   PRO B CG  
1146 C CD  . PRO B 1   ? 0.4254 0.4156 0.4176 0.0007  0.0041  -0.0038 1   PRO B CD  
1147 N N   . ASN B 2   ? 0.3928 0.3695 0.3509 0.0223  0.0102  -0.0176 2   ASN B N   
1148 C CA  A ASN B 2   ? 0.3596 0.3362 0.3304 0.0182  0.0141  -0.0169 2   ASN B CA  
1149 C CA  B ASN B 2   ? 0.3638 0.3386 0.3395 0.0162  0.0122  -0.0160 2   ASN B CA  
1150 C C   . ASN B 2   ? 0.3457 0.3197 0.3387 0.0175  0.0257  -0.0088 2   ASN B C   
1151 O O   . ASN B 2   ? 0.3510 0.3402 0.3268 0.0169  0.0438  -0.0255 2   ASN B O   
1152 C CB  A ASN B 2   ? 0.3547 0.3265 0.3290 0.0209  0.0194  -0.0113 2   ASN B CB  
1153 C CB  B ASN B 2   ? 0.3596 0.3311 0.3575 0.0189  0.0133  -0.0114 2   ASN B CB  
1154 C CG  A ASN B 2   ? 0.3412 0.2846 0.3063 0.0046  0.0127  -0.0151 2   ASN B CG  
1155 C CG  B ASN B 2   ? 0.3270 0.3041 0.3315 0.0334  0.0161  -0.0153 2   ASN B CG  
1156 O OD1 A ASN B 2   ? 0.3488 0.2920 0.3391 0.0397  0.0288  -0.0033 2   ASN B OD1 
1157 O OD1 B ASN B 2   ? 0.3728 0.3174 0.3521 0.0160  0.0178  0.0008  2   ASN B OD1 
1158 N ND2 A ASN B 2   ? 0.3371 0.3233 0.3251 0.0209  0.0074  -0.0110 2   ASN B ND2 
1159 N ND2 B ASN B 2   ? 0.3825 0.3347 0.3599 0.0097  0.0087  -0.0051 2   ASN B ND2 
1160 N N   . PHE B 3   ? 0.3200 0.2650 0.2575 0.0291  0.0349  -0.0150 3   PHE B N   
1161 C CA  . PHE B 3   ? 0.2877 0.2543 0.2666 0.0085  0.0176  0.0000  3   PHE B CA  
1162 C C   . PHE B 3   ? 0.2850 0.2508 0.2561 0.0097  0.0217  0.0016  3   PHE B C   
1163 O O   . PHE B 3   ? 0.2811 0.2408 0.2631 0.0247  0.0237  0.0119  3   PHE B O   
1164 C CB  . PHE B 3   ? 0.2670 0.2475 0.2389 0.0146  0.0229  -0.0002 3   PHE B CB  
1165 C CG  . PHE B 3   ? 0.2729 0.2429 0.2368 0.0115  0.0207  -0.0250 3   PHE B CG  
1166 C CD1 . PHE B 3   ? 0.2836 0.2566 0.2502 0.0041  0.0036  -0.0243 3   PHE B CD1 
1167 C CD2 . PHE B 3   ? 0.2719 0.2633 0.2283 0.0059  0.0061  -0.0102 3   PHE B CD2 
1168 C CE1 . PHE B 3   ? 0.3027 0.2651 0.2604 0.0229  0.0021  -0.0184 3   PHE B CE1 
1169 C CE2 . PHE B 3   ? 0.2698 0.2491 0.2122 0.0092  0.0121  -0.0113 3   PHE B CE2 
1170 C CZ  . PHE B 3   ? 0.2914 0.2536 0.2461 0.0125  0.0108  -0.0114 3   PHE B CZ  
1171 N N   . SER B 4   ? 0.2746 0.2597 0.2680 0.0299  0.0290  -0.0046 4   SER B N   
1172 C CA  . SER B 4   ? 0.2532 0.2446 0.2330 0.0246  0.0299  0.0167  4   SER B CA  
1173 C C   . SER B 4   ? 0.2795 0.2742 0.2752 0.0178  0.0174  0.0099  4   SER B C   
1174 O O   . SER B 4   ? 0.2544 0.2877 0.2606 0.0345  0.0834  0.0023  4   SER B O   
1175 C CB  . SER B 4   ? 0.2778 0.2556 0.2613 0.0332  0.0203  0.0075  4   SER B CB  
1176 O OG  . SER B 4   ? 0.2866 0.2835 0.2387 0.0434  0.0388  0.0142  4   SER B OG  
1177 N N   . GLY B 5   ? 0.2607 0.2667 0.2666 0.0200  0.0426  -0.0085 5   GLY B N   
1178 C CA  . GLY B 5   ? 0.2779 0.2854 0.2866 0.0050  0.0207  0.0023  5   GLY B CA  
1179 C C   . GLY B 5   ? 0.2552 0.2834 0.2736 0.0231  0.0031  0.0036  5   GLY B C   
1180 O O   . GLY B 5   ? 0.2314 0.2810 0.2449 0.0172  0.0050  0.0239  5   GLY B O   
1181 N N   . ASN B 6   ? 0.2445 0.2874 0.2760 0.0297  -0.0143 0.0386  6   ASN B N   
1182 C CA  . ASN B 6   ? 0.2622 0.3126 0.2937 0.0177  -0.0099 0.0356  6   ASN B CA  
1183 C C   . ASN B 6   ? 0.1914 0.2822 0.2577 0.0492  0.0225  0.0525  6   ASN B C   
1184 O O   . ASN B 6   ? 0.2810 0.3714 0.3487 0.0427  -0.0044 0.0705  6   ASN B O   
1185 C CB  . ASN B 6   ? 0.2812 0.3536 0.3264 0.0062  -0.0090 0.0458  6   ASN B CB  
1186 C CG  . ASN B 6   ? 0.3405 0.4004 0.3464 0.0122  -0.0179 0.0291  6   ASN B CG  
1187 O OD1 . ASN B 6   ? 0.3559 0.4310 0.3489 -0.0034 -0.0051 0.0361  6   ASN B OD1 
1188 N ND2 . ASN B 6   ? 0.3679 0.3990 0.3837 0.0123  -0.0138 0.0209  6   ASN B ND2 
1189 N N   . TRP B 7   ? 0.2186 0.2718 0.2467 0.0120  -0.0091 0.0428  7   TRP B N   
1190 C CA  . TRP B 7   ? 0.1948 0.2426 0.2304 0.0155  -0.0107 0.0318  7   TRP B CA  
1191 C C   . TRP B 7   ? 0.2020 0.2600 0.2566 0.0051  0.0063  0.0291  7   TRP B C   
1192 O O   . TRP B 7   ? 0.1986 0.2569 0.2495 0.0026  0.0081  0.0374  7   TRP B O   
1193 C CB  . TRP B 7   ? 0.2172 0.2368 0.2358 0.0113  0.0068  0.0251  7   TRP B CB  
1194 C CG  . TRP B 7   ? 0.2097 0.2413 0.2092 0.0026  0.0061  0.0222  7   TRP B CG  
1195 C CD1 . TRP B 7   ? 0.2246 0.2447 0.2186 0.0158  0.0064  0.0292  7   TRP B CD1 
1196 C CD2 . TRP B 7   ? 0.2247 0.2458 0.2209 0.0088  0.0058  0.0201  7   TRP B CD2 
1197 N NE1 . TRP B 7   ? 0.2568 0.2427 0.1994 0.0087  0.0102  0.0226  7   TRP B NE1 
1198 C CE2 . TRP B 7   ? 0.2332 0.2572 0.2242 0.0140  0.0137  0.0160  7   TRP B CE2 
1199 C CE3 . TRP B 7   ? 0.2403 0.2724 0.2231 0.0100  0.0133  0.0113  7   TRP B CE3 
1200 C CZ2 . TRP B 7   ? 0.2428 0.2589 0.2212 0.0003  0.0222  0.0197  7   TRP B CZ2 
1201 C CZ3 . TRP B 7   ? 0.2282 0.2489 0.2226 0.0217  0.0082  0.0203  7   TRP B CZ3 
1202 C CH2 . TRP B 7   ? 0.2397 0.2569 0.2186 0.0132  0.0183  0.0190  7   TRP B CH2 
1203 N N   . LYS B 8   ? 0.1979 0.2726 0.2542 0.0072  0.0090  0.0349  8   LYS B N   
1204 C CA  A LYS B 8   ? 0.2072 0.2709 0.2638 -0.0003 0.0068  0.0198  8   LYS B CA  
1205 C CA  B LYS B 8   ? 0.2161 0.2812 0.2724 0.0029  0.0093  0.0205  8   LYS B CA  
1206 C C   . LYS B 8   ? 0.2243 0.2579 0.2653 0.0030  0.0084  0.0225  8   LYS B C   
1207 O O   . LYS B 8   ? 0.2180 0.2509 0.2365 0.0250  0.0237  0.0266  8   LYS B O   
1208 C CB  A LYS B 8   ? 0.2086 0.2707 0.2487 0.0071  0.0085  0.0197  8   LYS B CB  
1209 C CB  B LYS B 8   ? 0.2454 0.3024 0.2999 0.0011  -0.0004 0.0149  8   LYS B CB  
1210 C CG  A LYS B 8   ? 0.2269 0.2587 0.2633 -0.0027 -0.0018 0.0066  8   LYS B CG  
1211 C CG  B LYS B 8   ? 0.2714 0.3177 0.3220 0.0042  0.0045  0.0080  8   LYS B CG  
1212 C CD  A LYS B 8   ? 0.2335 0.2630 0.2629 0.0016  0.0012  0.0047  8   LYS B CD  
1213 C CD  B LYS B 8   ? 0.2831 0.3325 0.3312 -0.0007 -0.0023 0.0078  8   LYS B CD  
1214 C CE  A LYS B 8   ? 0.2170 0.2480 0.2600 -0.0106 0.0070  0.0075  8   LYS B CE  
1215 C CE  B LYS B 8   ? 0.2854 0.3382 0.3441 0.0064  0.0059  0.0061  8   LYS B CE  
1216 N NZ  A LYS B 8   ? 0.2746 0.2537 0.2693 0.0029  -0.0124 -0.0046 8   LYS B NZ  
1217 N NZ  B LYS B 8   ? 0.3142 0.3482 0.3644 -0.0056 -0.0030 0.0074  8   LYS B NZ  
1218 N N   . ILE B 9   ? 0.1917 0.2673 0.2534 0.0071  0.0123  0.0308  9   ILE B N   
1219 C CA  . ILE B 9   ? 0.2206 0.2631 0.2399 0.0139  0.0345  0.0377  9   ILE B CA  
1220 C C   . ILE B 9   ? 0.2189 0.2569 0.2580 -0.0048 0.0214  0.0361  9   ILE B C   
1221 O O   . ILE B 9   ? 0.2551 0.2999 0.2748 -0.0187 0.0062  0.0573  9   ILE B O   
1222 C CB  . ILE B 9   ? 0.2082 0.2582 0.2380 0.0160  0.0158  0.0245  9   ILE B CB  
1223 C CG1 . ILE B 9   ? 0.2185 0.2578 0.2478 0.0274  0.0178  0.0300  9   ILE B CG1 
1224 C CG2 . ILE B 9   ? 0.2398 0.2724 0.2456 0.0157  0.0077  0.0144  9   ILE B CG2 
1225 C CD1 . ILE B 9   ? 0.2140 0.2702 0.2206 0.0180  0.0495  0.0490  9   ILE B CD1 
1226 N N   . ILE B 10  ? 0.2227 0.2387 0.2351 0.0021  0.0484  0.0499  10  ILE B N   
1227 C CA  . ILE B 10  ? 0.2480 0.2851 0.2735 0.0279  0.0260  0.0226  10  ILE B CA  
1228 C C   . ILE B 10  ? 0.1821 0.2212 0.2187 0.0004  0.0515  0.0844  10  ILE B C   
1229 O O   . ILE B 10  ? 0.2740 0.3160 0.3530 0.0400  0.0107  0.0200  10  ILE B O   
1230 C CB  . ILE B 10  ? 0.2606 0.2846 0.2349 0.0103  0.0324  0.0336  10  ILE B CB  
1231 C CG1 . ILE B 10  ? 0.2851 0.3114 0.2472 0.0234  0.0161  0.0165  10  ILE B CG1 
1232 C CG2 . ILE B 10  ? 0.2596 0.3074 0.2567 0.0254  0.0180  0.0448  10  ILE B CG2 
1233 C CD1 . ILE B 10  ? 0.2933 0.3237 0.2518 0.0180  0.0354  0.0136  10  ILE B CD1 
1234 N N   . ARG B 11  ? 0.2411 0.2768 0.2932 0.0391  0.0084  0.0366  11  ARG B N   
1235 C CA  A ARG B 11  ? 0.2218 0.2700 0.2595 0.0179  0.0162  0.0374  11  ARG B CA  
1236 C CA  B ARG B 11  ? 0.2220 0.2688 0.2476 0.0192  0.0130  0.0356  11  ARG B CA  
1237 C C   . ARG B 11  ? 0.2266 0.2630 0.2602 0.0265  0.0120  0.0309  11  ARG B C   
1238 O O   . ARG B 11  ? 0.2122 0.2493 0.2544 0.0120  0.0339  0.0477  11  ARG B O   
1239 C CB  A ARG B 11  ? 0.2715 0.2815 0.2756 0.0131  0.0096  0.0248  11  ARG B CB  
1240 C CB  B ARG B 11  ? 0.2520 0.2702 0.2494 0.0184  0.0033  0.0268  11  ARG B CB  
1241 C CG  A ARG B 11  ? 0.3125 0.3198 0.3022 0.0074  0.0033  0.0086  11  ARG B CG  
1242 C CG  B ARG B 11  ? 0.2773 0.3002 0.2703 0.0133  0.0074  0.0103  11  ARG B CG  
1243 C CD  A ARG B 11  ? 0.3215 0.3052 0.2756 0.0028  -0.0047 0.0052  11  ARG B CD  
1244 C CD  B ARG B 11  ? 0.2608 0.2901 0.2452 0.0096  0.0056  0.0200  11  ARG B CD  
1245 N NE  A ARG B 11  ? 0.3364 0.3154 0.2853 0.0072  -0.0022 0.0102  11  ARG B NE  
1246 N NE  B ARG B 11  ? 0.2672 0.3039 0.2471 -0.0003 0.0013  0.0182  11  ARG B NE  
1247 C CZ  A ARG B 11  ? 0.3327 0.3227 0.2825 0.0010  0.0024  0.0024  11  ARG B CZ  
1248 C CZ  B ARG B 11  ? 0.3103 0.3395 0.2754 -0.0036 0.0051  0.0168  11  ARG B CZ  
1249 N NH1 A ARG B 11  ? 0.3279 0.3081 0.2768 0.0050  0.0110  0.0101  11  ARG B NH1 
1250 N NH1 B ARG B 11  ? 0.3154 0.3283 0.2957 -0.0130 -0.0042 0.0190  11  ARG B NH1 
1251 N NH2 A ARG B 11  ? 0.3309 0.3253 0.2906 0.0072  0.0014  -0.0003 11  ARG B NH2 
1252 N NH2 B ARG B 11  ? 0.3044 0.3117 0.2647 0.0073  0.0021  0.0230  11  ARG B NH2 
1253 N N   . SER B 12  ? 0.1939 0.2705 0.2401 0.0088  0.0204  0.0480  12  SER B N   
1254 C CA  . SER B 12  ? 0.1720 0.2535 0.2454 0.0211  -0.0002 0.0448  12  SER B CA  
1255 C C   . SER B 12  ? 0.2358 0.3041 0.2890 0.0184  -0.0239 0.0168  12  SER B C   
1256 O O   . SER B 12  ? 0.1786 0.2635 0.2788 -0.0145 -0.0029 0.1075  12  SER B O   
1257 C CB  . SER B 12  ? 0.2317 0.3329 0.2738 0.0110  0.0150  0.0135  12  SER B CB  
1258 O OG  . SER B 12  ? 0.2819 0.3504 0.3049 -0.0002 0.0212  0.0120  12  SER B OG  
1259 N N   . GLU B 13  ? 0.1689 0.2607 0.2135 0.0154  0.0177  0.0393  13  GLU B N   
1260 C CA  . GLU B 13  ? 0.2150 0.2584 0.2290 0.0074  0.0263  0.0330  13  GLU B CA  
1261 C C   . GLU B 13  ? 0.1876 0.2311 0.2197 0.0114  0.0214  0.0209  13  GLU B C   
1262 O O   . GLU B 13  ? 0.2271 0.2379 0.2143 0.0158  0.0136  0.0298  13  GLU B O   
1263 C CB  . GLU B 13  ? 0.2554 0.2688 0.2269 0.0052  0.0070  0.0316  13  GLU B CB  
1264 C CG  . GLU B 13  ? 0.2944 0.3165 0.2646 -0.0012 0.0009  0.0003  13  GLU B CG  
1265 C CD  . GLU B 13  ? 0.3191 0.3244 0.2972 0.0020  0.0040  -0.0019 13  GLU B CD  
1266 O OE1 . GLU B 13  ? 0.3020 0.3085 0.2522 -0.0141 0.0168  -0.0157 13  GLU B OE1 
1267 O OE2 . GLU B 13  ? 0.2959 0.3076 0.2996 -0.0200 -0.0032 -0.0192 13  GLU B OE2 
1268 N N   . ASN B 14  ? 0.2015 0.2480 0.2344 0.0321  0.0195  0.0206  14  ASN B N   
1269 C CA  . ASN B 14  ? 0.1838 0.2442 0.2007 0.0138  0.0122  0.0291  14  ASN B CA  
1270 C C   . ASN B 14  ? 0.1890 0.2279 0.2046 0.0219  0.0265  0.0449  14  ASN B C   
1271 O O   . ASN B 14  ? 0.2270 0.2502 0.2573 0.0231  -0.0014 0.0563  14  ASN B O   
1272 C CB  . ASN B 14  ? 0.2049 0.2575 0.1961 0.0041  0.0141  0.0226  14  ASN B CB  
1273 C CG  . ASN B 14  ? 0.2323 0.2607 0.2312 0.0034  -0.0040 0.0141  14  ASN B CG  
1274 O OD1 . ASN B 14  ? 0.2483 0.2578 0.2157 0.0175  0.0049  0.0539  14  ASN B OD1 
1275 N ND2 . ASN B 14  ? 0.2417 0.2731 0.2046 0.0039  -0.0128 0.0056  14  ASN B ND2 
1276 N N   . PHE B 15  ? 0.2328 0.2307 0.1957 0.0187  0.0030  0.0411  15  PHE B N   
1277 C CA  . PHE B 15  ? 0.2376 0.2347 0.2173 0.0232  0.0152  0.0251  15  PHE B CA  
1278 C C   . PHE B 15  ? 0.2381 0.2325 0.2260 0.0106  0.0295  0.0150  15  PHE B C   
1279 O O   . PHE B 15  ? 0.2516 0.2226 0.2039 0.0331  0.0350  0.0242  15  PHE B O   
1280 C CB  . PHE B 15  ? 0.2413 0.2543 0.2147 0.0345  -0.0028 0.0255  15  PHE B CB  
1281 C CG  . PHE B 15  ? 0.2629 0.2770 0.2466 0.0310  0.0002  0.0121  15  PHE B CG  
1282 C CD1 . PHE B 15  ? 0.2763 0.2922 0.2577 0.0422  0.0140  0.0151  15  PHE B CD1 
1283 C CD2 . PHE B 15  ? 0.2709 0.2938 0.2387 0.0387  -0.0044 0.0062  15  PHE B CD2 
1284 C CE1 . PHE B 15  ? 0.2789 0.2787 0.2431 0.0434  0.0017  0.0105  15  PHE B CE1 
1285 C CE2 . PHE B 15  ? 0.2761 0.2886 0.2407 0.0351  -0.0128 0.0148  15  PHE B CE2 
1286 C CZ  . PHE B 15  ? 0.2570 0.2886 0.2538 0.0503  -0.0105 0.0166  15  PHE B CZ  
1287 N N   . GLU B 16  ? 0.2535 0.2214 0.2242 0.0244  0.0285  0.0121  16  GLU B N   
1288 C CA  . GLU B 16  ? 0.2664 0.2333 0.2417 0.0174  0.0115  0.0131  16  GLU B CA  
1289 C C   . GLU B 16  ? 0.2567 0.2427 0.2316 0.0228  0.0293  0.0085  16  GLU B C   
1290 O O   . GLU B 16  ? 0.2651 0.2974 0.2501 0.0226  0.0279  0.0337  16  GLU B O   
1291 C CB  . GLU B 16  ? 0.3060 0.2472 0.2819 0.0121  0.0230  0.0070  16  GLU B CB  
1292 C CG  . GLU B 16  ? 0.3391 0.2891 0.3286 0.0130  0.0151  -0.0054 16  GLU B CG  
1293 C CD  . GLU B 16  ? 0.3995 0.3507 0.3801 -0.0010 0.0000  0.0017  16  GLU B CD  
1294 O OE1 . GLU B 16  ? 0.3199 0.3236 0.3489 -0.0154 0.0238  0.0256  16  GLU B OE1 
1295 O OE2 . GLU B 16  ? 0.3568 0.2769 0.3825 0.0211  0.0291  -0.0128 16  GLU B OE2 
1296 N N   . GLU B 17  ? 0.2645 0.2435 0.2460 0.0223  0.0187  0.0272  17  GLU B N   
1297 C CA  . GLU B 17  ? 0.2505 0.2478 0.2369 0.0140  0.0218  0.0295  17  GLU B CA  
1298 C C   . GLU B 17  ? 0.2615 0.2795 0.2592 0.0116  0.0219  0.0284  17  GLU B C   
1299 O O   . GLU B 17  ? 0.2573 0.2767 0.2524 0.0488  0.0163  0.0192  17  GLU B O   
1300 C CB  . GLU B 17  ? 0.2876 0.2883 0.2752 0.0177  -0.0060 -0.0025 17  GLU B CB  
1301 C CG  . GLU B 17  ? 0.2853 0.3303 0.2625 0.0284  -0.0068 0.0128  17  GLU B CG  
1302 C CD  . GLU B 17  ? 0.2938 0.3584 0.2852 0.0244  -0.0074 -0.0023 17  GLU B CD  
1303 O OE1 . GLU B 17  ? 0.3135 0.3642 0.2421 0.0322  -0.0151 0.0045  17  GLU B OE1 
1304 O OE2 . GLU B 17  ? 0.2748 0.3788 0.2615 0.0317  -0.0095 0.0166  17  GLU B OE2 
1305 N N   . LEU B 18  ? 0.2287 0.2153 0.2340 0.0234  0.0329  0.0533  18  LEU B N   
1306 C CA  . LEU B 18  ? 0.2394 0.2272 0.2281 0.0173  0.0386  0.0367  18  LEU B CA  
1307 C C   . LEU B 18  ? 0.2754 0.2638 0.2760 0.0316  0.0005  0.0315  18  LEU B C   
1308 O O   . LEU B 18  ? 0.2225 0.2487 0.2472 0.0480  0.0530  0.0410  18  LEU B O   
1309 C CB  . LEU B 18  ? 0.2449 0.2154 0.2628 0.0160  0.0311  0.0379  18  LEU B CB  
1310 C CG  . LEU B 18  ? 0.2554 0.2257 0.2291 0.0113  0.0296  0.0350  18  LEU B CG  
1311 C CD1 . LEU B 18  ? 0.2767 0.2647 0.2889 -0.0055 0.0218  0.0276  18  LEU B CD1 
1312 C CD2 . LEU B 18  ? 0.2773 0.2769 0.2589 0.0055  0.0050  0.0257  18  LEU B CD2 
1313 N N   . LEU B 19  ? 0.2698 0.2510 0.2629 0.0219  0.0124  0.0249  19  LEU B N   
1314 C CA  . LEU B 19  ? 0.2455 0.2266 0.2497 0.0402  0.0359  0.0173  19  LEU B CA  
1315 C C   . LEU B 19  ? 0.2711 0.2600 0.2581 0.0512  0.0533  0.0198  19  LEU B C   
1316 O O   . LEU B 19  ? 0.2944 0.3045 0.3038 0.0637  0.0494  0.0231  19  LEU B O   
1317 C CB  . LEU B 19  ? 0.2470 0.2473 0.2537 0.0414  0.0291  0.0187  19  LEU B CB  
1318 C CG  . LEU B 19  ? 0.2638 0.2455 0.2590 0.0349  0.0142  0.0271  19  LEU B CG  
1319 C CD1 . LEU B 19  ? 0.2722 0.2561 0.2538 0.0269  0.0229  0.0142  19  LEU B CD1 
1320 C CD2 . LEU B 19  ? 0.2781 0.2476 0.2798 0.0172  0.0089  0.0384  19  LEU B CD2 
1321 N N   . LYS B 20  ? 0.2754 0.2478 0.2904 0.0593  0.0405  0.0164  20  LYS B N   
1322 C CA  . LYS B 20  ? 0.2933 0.3003 0.3334 0.0507  0.0235  0.0195  20  LYS B CA  
1323 C C   . LYS B 20  ? 0.2778 0.3184 0.3401 0.0553  0.0489  -0.0082 20  LYS B C   
1324 O O   . LYS B 20  ? 0.3391 0.3738 0.4062 0.0234  0.0394  0.0057  20  LYS B O   
1325 C CB  . LYS B 20  ? 0.3041 0.3104 0.3443 0.0537  0.0096  0.0222  20  LYS B CB  
1326 C CG  . LYS B 20  ? 0.3098 0.3082 0.3512 0.0555  0.0047  0.0285  20  LYS B CG  
1327 C CD  . LYS B 20  ? 0.3357 0.3367 0.3623 0.0367  -0.0018 0.0218  20  LYS B CD  
1328 C CE  . LYS B 20  ? 0.3649 0.3488 0.3594 0.0275  -0.0023 0.0178  20  LYS B CE  
1329 N NZ  . LYS B 20  ? 0.3762 0.3726 0.3721 0.0201  -0.0047 0.0064  20  LYS B NZ  
1330 N N   . VAL B 21  ? 0.3120 0.3647 0.3734 0.0262  0.0220  0.0165  21  VAL B N   
1331 C CA  . VAL B 21  ? 0.3459 0.3836 0.3954 0.0131  0.0185  0.0106  21  VAL B CA  
1332 C C   . VAL B 21  ? 0.3457 0.3921 0.3877 0.0047  0.0237  0.0060  21  VAL B C   
1333 O O   . VAL B 21  ? 0.3337 0.4129 0.4095 0.0214  0.0432  0.0072  21  VAL B O   
1334 C CB  . VAL B 21  ? 0.3739 0.4058 0.4140 0.0045  0.0131  0.0048  21  VAL B CB  
1335 C CG1 . VAL B 21  ? 0.3985 0.4117 0.4265 -0.0003 0.0047  0.0102  21  VAL B CG1 
1336 C CG2 . VAL B 21  ? 0.3835 0.3914 0.4119 0.0050  0.0117  0.0113  21  VAL B CG2 
1337 N N   . LEU B 22  ? 0.3406 0.3652 0.3572 0.0009  0.0343  0.0050  22  LEU B N   
1338 C CA  . LEU B 22  ? 0.3645 0.3912 0.3656 -0.0033 0.0377  0.0055  22  LEU B CA  
1339 C C   . LEU B 22  ? 0.3795 0.3764 0.3582 0.0072  0.0420  0.0011  22  LEU B C   
1340 O O   . LEU B 22  ? 0.4381 0.4334 0.3936 0.0127  0.0475  0.0086  22  LEU B O   
1341 C CB  . LEU B 22  ? 0.3808 0.3636 0.3372 -0.0172 0.0303  0.0169  22  LEU B CB  
1342 C CG  . LEU B 22  ? 0.3551 0.3558 0.3350 -0.0213 0.0435  0.0114  22  LEU B CG  
1343 C CD1 . LEU B 22  ? 0.3973 0.3581 0.3274 -0.0142 0.0330  0.0218  22  LEU B CD1 
1344 C CD2 . LEU B 22  ? 0.3987 0.3586 0.3595 -0.0207 0.0433  0.0132  22  LEU B CD2 
1345 N N   . GLY B 23  ? 0.3651 0.3643 0.3543 0.0176  0.0533  -0.0034 23  GLY B N   
1346 C CA  . GLY B 23  ? 0.3653 0.3603 0.3696 0.0144  0.0459  -0.0075 23  GLY B CA  
1347 C C   . GLY B 23  ? 0.3570 0.3410 0.3540 0.0196  0.0354  -0.0145 23  GLY B C   
1348 O O   . GLY B 23  ? 0.3755 0.3605 0.3972 0.0294  0.0482  -0.0182 23  GLY B O   
1349 N N   . VAL B 24  ? 0.3627 0.3074 0.3600 0.0242  0.0417  0.0014  24  VAL B N   
1350 C CA  . VAL B 24  ? 0.3439 0.2711 0.3521 0.0179  0.0402  0.0070  24  VAL B CA  
1351 C C   . VAL B 24  ? 0.3734 0.3124 0.3672 0.0154  0.0303  0.0083  24  VAL B C   
1352 O O   . VAL B 24  ? 0.3695 0.3131 0.3823 0.0249  0.0230  0.0368  24  VAL B O   
1353 C CB  . VAL B 24  ? 0.3555 0.2848 0.3601 0.0118  0.0316  0.0083  24  VAL B CB  
1354 C CG1 . VAL B 24  ? 0.3450 0.2695 0.3370 0.0165  0.0324  0.0178  24  VAL B CG1 
1355 C CG2 . VAL B 24  ? 0.3382 0.2845 0.3476 0.0019  0.0488  0.0049  24  VAL B CG2 
1356 N N   . ASN B 25  ? 0.3752 0.2722 0.3568 0.0242  0.0305  0.0127  25  ASN B N   
1357 C CA  . ASN B 25  ? 0.3834 0.3079 0.3570 0.0075  0.0255  0.0057  25  ASN B CA  
1358 C C   . ASN B 25  ? 0.3751 0.2911 0.3779 0.0211  0.0232  0.0142  25  ASN B C   
1359 O O   . ASN B 25  ? 0.3650 0.2934 0.3756 0.0377  0.0124  0.0209  25  ASN B O   
1360 C CB  . ASN B 25  ? 0.4006 0.3068 0.3656 0.0175  0.0212  -0.0066 25  ASN B CB  
1361 C CG  . ASN B 25  ? 0.3933 0.3159 0.3482 0.0138  0.0236  -0.0015 25  ASN B CG  
1362 O OD1 . ASN B 25  ? 0.4249 0.3072 0.3459 0.0126  0.0331  0.0055  25  ASN B OD1 
1363 N ND2 . ASN B 25  ? 0.4279 0.3443 0.3534 0.0154  0.0152  0.0062  25  ASN B ND2 
1364 N N   . VAL B 26  ? 0.3838 0.3052 0.3757 0.0254  0.0211  0.0141  26  VAL B N   
1365 C CA  . VAL B 26  ? 0.3759 0.2913 0.3733 0.0148  0.0150  0.0065  26  VAL B CA  
1366 C C   . VAL B 26  ? 0.3871 0.2950 0.3697 0.0212  0.0112  0.0041  26  VAL B C   
1367 O O   . VAL B 26  ? 0.3924 0.3427 0.4176 0.0174  0.0116  0.0083  26  VAL B O   
1368 C CB  . VAL B 26  ? 0.3507 0.2736 0.3380 0.0302  0.0190  -0.0109 26  VAL B CB  
1369 C CG1 . VAL B 26  ? 0.3657 0.2898 0.3663 0.0167  0.0103  0.0077  26  VAL B CG1 
1370 C CG2 . VAL B 26  ? 0.3455 0.2775 0.3278 0.0382  0.0126  -0.0152 26  VAL B CG2 
1371 N N   . MET B 27  ? 0.4128 0.3185 0.4067 0.0273  0.0022  -0.0085 27  MET B N   
1372 C CA  . MET B 27  ? 0.4172 0.3180 0.4008 0.0247  -0.0065 -0.0115 27  MET B CA  
1373 C C   . MET B 27  ? 0.4008 0.3150 0.3894 0.0247  -0.0032 -0.0076 27  MET B C   
1374 O O   . MET B 27  ? 0.3973 0.2780 0.3628 0.0305  -0.0065 -0.0173 27  MET B O   
1375 C CB  . MET B 27  ? 0.4330 0.3558 0.4133 0.0229  0.0045  -0.0080 27  MET B CB  
1376 C CG  . MET B 27  ? 0.4273 0.3678 0.4336 0.0233  0.0121  -0.0027 27  MET B CG  
1377 S SD  . MET B 27  ? 0.4418 0.3769 0.4610 0.0329  0.0243  -0.0038 27  MET B SD  
1378 C CE  . MET B 27  ? 0.4203 0.3725 0.4411 0.0289  0.0178  -0.0063 27  MET B CE  
1379 N N   . LEU B 28  ? 0.4253 0.3107 0.4023 0.0322  0.0023  -0.0107 28  LEU B N   
1380 C CA  . LEU B 28  ? 0.4069 0.3113 0.3843 0.0301  0.0012  0.0012  28  LEU B CA  
1381 C C   . LEU B 28  ? 0.3899 0.3223 0.3650 0.0295  0.0024  0.0047  28  LEU B C   
1382 O O   . LEU B 28  ? 0.3934 0.2648 0.3575 0.0394  -0.0033 0.0174  28  LEU B O   
1383 C CB  . LEU B 28  ? 0.4192 0.3679 0.4069 0.0156  0.0091  -0.0028 28  LEU B CB  
1384 C CG  . LEU B 28  ? 0.4681 0.4167 0.4359 0.0136  0.0088  -0.0085 28  LEU B CG  
1385 C CD1 . LEU B 28  ? 0.4577 0.4222 0.4326 0.0024  0.0070  -0.0036 28  LEU B CD1 
1386 C CD2 . LEU B 28  ? 0.4434 0.4286 0.4385 0.0173  0.0034  -0.0067 28  LEU B CD2 
1387 N N   . ARG B 29  ? 0.3593 0.2821 0.3552 0.0326  -0.0068 0.0192  29  ARG B N   
1388 C CA  . ARG B 29  ? 0.3495 0.3047 0.3538 0.0184  0.0016  0.0103  29  ARG B CA  
1389 C C   . ARG B 29  ? 0.3355 0.2990 0.3518 0.0138  -0.0096 0.0157  29  ARG B C   
1390 O O   . ARG B 29  ? 0.3279 0.2679 0.3241 0.0371  -0.0039 0.0347  29  ARG B O   
1391 C CB  . ARG B 29  ? 0.3346 0.3189 0.3705 0.0155  0.0000  0.0193  29  ARG B CB  
1392 C CG  . ARG B 29  ? 0.3500 0.3096 0.3688 0.0144  -0.0108 0.0041  29  ARG B CG  
1393 C CD  . ARG B 29  ? 0.3401 0.3048 0.3579 0.0063  0.0035  0.0168  29  ARG B CD  
1394 N NE  . ARG B 29  ? 0.3608 0.3077 0.4017 0.0201  0.0092  0.0025  29  ARG B NE  
1395 C CZ  . ARG B 29  ? 0.3864 0.3374 0.4139 0.0124  0.0119  0.0114  29  ARG B CZ  
1396 N NH1 . ARG B 29  ? 0.3579 0.3017 0.3984 0.0164  0.0351  0.0099  29  ARG B NH1 
1397 N NH2 . ARG B 29  ? 0.3905 0.2793 0.3921 0.0062  0.0192  0.0133  29  ARG B NH2 
1398 N N   . LYS B 30  ? 0.3661 0.3413 0.3818 0.0073  0.0001  0.0088  30  LYS B N   
1399 C CA  . LYS B 30  ? 0.3758 0.3541 0.4123 -0.0012 -0.0086 0.0002  30  LYS B CA  
1400 C C   . LYS B 30  ? 0.3869 0.3551 0.4047 -0.0006 -0.0118 0.0016  30  LYS B C   
1401 O O   . LYS B 30  ? 0.3928 0.3506 0.4233 0.0021  -0.0105 0.0098  30  LYS B O   
1402 C CB  . LYS B 30  ? 0.4085 0.3726 0.4244 0.0030  -0.0068 0.0015  30  LYS B CB  
1403 C CG  . LYS B 30  ? 0.4362 0.4176 0.4358 0.0022  -0.0006 0.0013  30  LYS B CG  
1404 C CD  . LYS B 30  ? 0.4401 0.4336 0.4550 0.0017  0.0022  0.0013  30  LYS B CD  
1405 C CE  . LYS B 30  ? 0.4504 0.4515 0.4549 0.0034  0.0014  -0.0028 30  LYS B CE  
1406 N NZ  . LYS B 30  ? 0.4631 0.4498 0.4615 0.0029  0.0004  0.0023  30  LYS B NZ  
1407 N N   . ILE B 31  ? 0.3804 0.3527 0.4088 -0.0027 -0.0137 -0.0077 31  ILE B N   
1408 C CA  . ILE B 31  ? 0.3906 0.3465 0.4123 0.0115  -0.0115 -0.0054 31  ILE B CA  
1409 C C   . ILE B 31  ? 0.3714 0.3360 0.3941 0.0042  -0.0064 -0.0036 31  ILE B C   
1410 O O   . ILE B 31  ? 0.3814 0.3475 0.4207 0.0206  -0.0078 0.0058  31  ILE B O   
1411 C CB  . ILE B 31  ? 0.3893 0.3608 0.4030 0.0152  -0.0138 -0.0041 31  ILE B CB  
1412 C CG1 . ILE B 31  ? 0.4053 0.3743 0.4071 0.0100  -0.0100 -0.0057 31  ILE B CG1 
1413 C CG2 . ILE B 31  ? 0.4132 0.3768 0.3980 0.0115  -0.0177 -0.0023 31  ILE B CG2 
1414 C CD1 . ILE B 31  ? 0.4059 0.3761 0.4102 0.0044  -0.0073 -0.0099 31  ILE B CD1 
1415 N N   . ALA B 32  ? 0.3652 0.3124 0.3772 0.0204  -0.0081 -0.0088 32  ALA B N   
1416 C CA  . ALA B 32  ? 0.3539 0.2839 0.3463 0.0247  -0.0091 -0.0027 32  ALA B CA  
1417 C C   . ALA B 32  ? 0.3625 0.3102 0.3523 0.0214  -0.0036 0.0103  32  ALA B C   
1418 O O   . ALA B 32  ? 0.3751 0.3032 0.3263 0.0213  -0.0030 0.0096  32  ALA B O   
1419 C CB  . ALA B 32  ? 0.3665 0.2881 0.3726 0.0172  -0.0059 -0.0035 32  ALA B CB  
1420 N N   . VAL B 33  ? 0.3916 0.3504 0.3779 0.0082  -0.0128 0.0096  33  VAL B N   
1421 C CA  . VAL B 33  ? 0.4097 0.3751 0.3860 0.0170  -0.0037 0.0107  33  VAL B CA  
1422 C C   . VAL B 33  ? 0.4227 0.3965 0.4189 0.0218  0.0055  0.0151  33  VAL B C   
1423 O O   . VAL B 33  ? 0.4506 0.4392 0.4731 0.0309  0.0146  0.0269  33  VAL B O   
1424 C CB  . VAL B 33  ? 0.4358 0.3987 0.3872 0.0095  -0.0080 0.0101  33  VAL B CB  
1425 C CG1 . VAL B 33  ? 0.4307 0.3882 0.3926 0.0138  -0.0061 0.0094  33  VAL B CG1 
1426 C CG2 . VAL B 33  ? 0.4471 0.3855 0.3877 0.0167  -0.0035 0.0251  33  VAL B CG2 
1427 N N   . ALA B 34  ? 0.4084 0.4013 0.4439 0.0186  -0.0035 0.0172  34  ALA B N   
1428 C CA  . ALA B 34  ? 0.4129 0.4064 0.4596 0.0151  -0.0015 0.0114  34  ALA B CA  
1429 C C   . ALA B 34  ? 0.4203 0.4253 0.4792 0.0142  -0.0017 0.0084  34  ALA B C   
1430 O O   . ALA B 34  ? 0.4168 0.4169 0.4900 0.0141  -0.0042 0.0022  34  ALA B O   
1431 C CB  . ALA B 34  ? 0.4124 0.4065 0.4665 0.0177  -0.0004 0.0148  34  ALA B CB  
1432 N N   . ALA B 35  ? 0.4350 0.4373 0.4940 0.0055  -0.0055 0.0064  35  ALA B N   
1433 C CA  . ALA B 35  ? 0.4387 0.4515 0.4849 -0.0011 0.0018  0.0061  35  ALA B CA  
1434 C C   . ALA B 35  ? 0.4468 0.4504 0.4803 0.0086  -0.0067 0.0007  35  ALA B C   
1435 O O   . ALA B 35  ? 0.4414 0.4615 0.5182 0.0052  -0.0003 0.0089  35  ALA B O   
1436 C CB  . ALA B 35  ? 0.4552 0.4670 0.4991 0.0071  -0.0008 0.0003  35  ALA B CB  
1437 N N   . ALA B 36  ? 0.4395 0.4580 0.4692 0.0002  -0.0021 0.0101  36  ALA B N   
1438 C CA  . ALA B 36  ? 0.4313 0.4380 0.4357 0.0009  -0.0033 0.0074  36  ALA B CA  
1439 C C   . ALA B 36  ? 0.4213 0.4232 0.4137 0.0020  -0.0046 0.0160  36  ALA B C   
1440 O O   . ALA B 36  ? 0.4009 0.4056 0.4222 0.0139  0.0162  0.0275  36  ALA B O   
1441 C CB  . ALA B 36  ? 0.4467 0.4380 0.4502 0.0060  0.0003  0.0034  36  ALA B CB  
1442 N N   . SER B 37  ? 0.3984 0.4029 0.4186 0.0049  0.0028  0.0137  37  SER B N   
1443 C CA  . SER B 37  ? 0.3833 0.4105 0.3950 0.0134  -0.0080 -0.0022 37  SER B CA  
1444 C C   . SER B 37  ? 0.3533 0.3613 0.3600 0.0111  -0.0035 0.0114  37  SER B C   
1445 O O   . SER B 37  ? 0.3366 0.3854 0.3283 0.0237  0.0046  0.0279  37  SER B O   
1446 C CB  . SER B 37  ? 0.4061 0.4332 0.4185 0.0154  -0.0030 -0.0045 37  SER B CB  
1447 O OG  . SER B 37  ? 0.4577 0.4904 0.4591 0.0096  0.0029  -0.0110 37  SER B OG  
1448 N N   . LYS B 38  ? 0.3281 0.3377 0.3468 0.0071  0.0002  0.0070  38  LYS B N   
1449 C CA  . LYS B 38  ? 0.3140 0.3257 0.3310 -0.0028 0.0136  0.0170  38  LYS B CA  
1450 C C   . LYS B 38  ? 0.2818 0.3094 0.2993 -0.0052 -0.0017 0.0249  38  LYS B C   
1451 O O   . LYS B 38  ? 0.3167 0.3445 0.2998 -0.0057 0.0222  0.0158  38  LYS B O   
1452 C CB  . LYS B 38  ? 0.3136 0.3409 0.3235 -0.0050 0.0228  0.0221  38  LYS B CB  
1453 C CG  . LYS B 38  ? 0.3245 0.3298 0.3322 -0.0191 0.0194  0.0151  38  LYS B CG  
1454 C CD  . LYS B 38  ? 0.3178 0.3444 0.3296 -0.0212 0.0291  0.0052  38  LYS B CD  
1455 C CE  . LYS B 38  ? 0.3423 0.3711 0.3580 -0.0300 0.0176  -0.0015 38  LYS B CE  
1456 N NZ  . LYS B 38  ? 0.3570 0.3835 0.3600 -0.0102 0.0143  -0.0038 38  LYS B NZ  
1457 N N   . PRO B 39  ? 0.2664 0.2968 0.2700 -0.0023 0.0028  0.0329  39  PRO B N   
1458 C CA  . PRO B 39  ? 0.2369 0.2669 0.2642 0.0004  -0.0072 0.0405  39  PRO B CA  
1459 C C   . PRO B 39  ? 0.2458 0.2865 0.2404 0.0034  -0.0018 0.0187  39  PRO B C   
1460 O O   . PRO B 39  ? 0.2667 0.3414 0.2541 0.0443  -0.0061 0.0074  39  PRO B O   
1461 C CB  . PRO B 39  ? 0.2527 0.2784 0.2306 -0.0035 -0.0115 0.0289  39  PRO B CB  
1462 C CG  . PRO B 39  ? 0.2419 0.2979 0.2567 0.0086  -0.0080 0.0398  39  PRO B CG  
1463 C CD  . PRO B 39  ? 0.2535 0.2874 0.2591 -0.0006 -0.0205 0.0309  39  PRO B CD  
1464 N N   . ALA B 40  ? 0.1936 0.2443 0.2472 -0.0127 0.0103  0.0256  40  ALA B N   
1465 C CA  . ALA B 40  ? 0.2142 0.2236 0.2575 -0.0215 0.0115  0.0264  40  ALA B CA  
1466 C C   . ALA B 40  ? 0.2425 0.2462 0.2704 -0.0105 0.0192  0.0095  40  ALA B C   
1467 O O   . ALA B 40  ? 0.2562 0.2569 0.2413 -0.0433 0.0580  0.0353  40  ALA B O   
1468 C CB  . ALA B 40  ? 0.2327 0.2823 0.3003 -0.0191 0.0025  0.0336  40  ALA B CB  
1469 N N   . VAL B 41  ? 0.2149 0.2129 0.2302 -0.0152 0.0275  0.0299  41  VAL B N   
1470 C CA  . VAL B 41  ? 0.2315 0.2066 0.2418 -0.0113 -0.0061 0.0174  41  VAL B CA  
1471 C C   . VAL B 41  ? 0.2447 0.2236 0.2329 -0.0007 0.0120  0.0005  41  VAL B C   
1472 O O   . VAL B 41  ? 0.3077 0.2550 0.2473 0.0135  0.0437  0.0296  41  VAL B O   
1473 C CB  . VAL B 41  ? 0.2352 0.1978 0.2286 -0.0149 0.0028  0.0039  41  VAL B CB  
1474 C CG1 . VAL B 41  ? 0.2634 0.2212 0.2754 -0.0325 0.0079  0.0217  41  VAL B CG1 
1475 C CG2 . VAL B 41  ? 0.2493 0.2048 0.2504 -0.0097 0.0128  0.0127  41  VAL B CG2 
1476 N N   . GLU B 42  ? 0.2228 0.1973 0.2279 0.0176  -0.0061 0.0354  42  GLU B N   
1477 C CA  A GLU B 42  ? 0.2521 0.2296 0.2407 -0.0013 -0.0036 0.0051  42  GLU B CA  
1478 C CA  B GLU B 42  ? 0.2738 0.2430 0.2584 -0.0021 -0.0003 0.0047  42  GLU B CA  
1479 C C   . GLU B 42  ? 0.2323 0.2197 0.2239 0.0044  0.0063  0.0163  42  GLU B C   
1480 O O   . GLU B 42  ? 0.2506 0.2355 0.2334 -0.0002 0.0153  0.0047  42  GLU B O   
1481 C CB  A GLU B 42  ? 0.2390 0.2212 0.2238 0.0004  -0.0210 0.0151  42  GLU B CB  
1482 C CB  B GLU B 42  ? 0.2630 0.2430 0.2445 0.0033  -0.0257 0.0141  42  GLU B CB  
1483 C CG  A GLU B 42  ? 0.2469 0.2388 0.2245 -0.0013 -0.0079 0.0079  42  GLU B CG  
1484 C CG  B GLU B 42  ? 0.2821 0.2745 0.2677 0.0003  -0.0049 0.0112  42  GLU B CG  
1485 C CD  A GLU B 42  ? 0.2064 0.2079 0.2146 0.0200  -0.0157 0.0147  42  GLU B CD  
1486 C CD  B GLU B 42  ? 0.2655 0.2322 0.2433 0.0030  -0.0282 0.0284  42  GLU B CD  
1487 O OE1 A GLU B 42  ? 0.2062 0.2085 0.2064 -0.0060 -0.0081 0.0091  42  GLU B OE1 
1488 O OE1 B GLU B 42  ? 0.2981 0.3021 0.2641 0.0008  -0.0170 0.0050  42  GLU B OE1 
1489 O OE2 A GLU B 42  ? 0.2707 0.2408 0.2478 -0.0211 -0.0026 0.0154  42  GLU B OE2 
1490 O OE2 B GLU B 42  ? 0.3171 0.3254 0.3001 -0.0119 -0.0064 0.0058  42  GLU B OE2 
1491 N N   . ILE B 43  ? 0.2292 0.2115 0.2186 -0.0064 0.0025  0.0209  43  ILE B N   
1492 C CA  . ILE B 43  ? 0.2202 0.2134 0.1986 0.0081  -0.0015 0.0096  43  ILE B CA  
1493 C C   . ILE B 43  ? 0.2086 0.2288 0.2097 0.0065  0.0022  0.0195  43  ILE B C   
1494 O O   . ILE B 43  ? 0.2496 0.2397 0.2127 0.0178  0.0218  0.0192  43  ILE B O   
1495 C CB  . ILE B 43  ? 0.2227 0.2258 0.2112 0.0152  0.0033  0.0030  43  ILE B CB  
1496 C CG1 . ILE B 43  ? 0.2069 0.2256 0.2061 0.0281  0.0087  0.0099  43  ILE B CG1 
1497 C CG2 . ILE B 43  ? 0.2442 0.2383 0.2142 0.0055  0.0151  0.0104  43  ILE B CG2 
1498 C CD1 . ILE B 43  ? 0.2489 0.2734 0.2025 0.0061  0.0033  0.0110  43  ILE B CD1 
1499 N N   . LYS B 44  ? 0.2321 0.2107 0.1915 -0.0019 0.0229  0.0257  44  LYS B N   
1500 C CA  . LYS B 44  ? 0.2559 0.2260 0.2221 0.0115  0.0129  0.0046  44  LYS B CA  
1501 C C   . LYS B 44  ? 0.2594 0.2036 0.2251 0.0139  0.0198  -0.0093 44  LYS B C   
1502 O O   . LYS B 44  ? 0.2683 0.2125 0.2411 0.0017  0.0173  -0.0009 44  LYS B O   
1503 C CB  . LYS B 44  ? 0.2735 0.2552 0.2332 0.0147  0.0088  0.0091  44  LYS B CB  
1504 C CG  . LYS B 44  ? 0.3395 0.3069 0.2804 0.0216  0.0029  0.0127  44  LYS B CG  
1505 C CD  . LYS B 44  ? 0.3392 0.3440 0.3283 0.0238  0.0030  0.0162  44  LYS B CD  
1506 C CE  . LYS B 44  ? 0.3810 0.3692 0.3747 0.0169  0.0040  -0.0003 44  LYS B CE  
1507 N NZ  . LYS B 44  ? 0.3790 0.3801 0.3934 0.0157  0.0020  0.0019  44  LYS B NZ  
1508 N N   . GLN B 45  ? 0.2903 0.2152 0.2387 0.0167  0.0055  -0.0049 45  GLN B N   
1509 C CA  . GLN B 45  ? 0.2895 0.1924 0.2339 0.0194  0.0041  -0.0020 45  GLN B CA  
1510 C C   . GLN B 45  ? 0.2927 0.2140 0.2696 0.0239  0.0113  0.0049  45  GLN B C   
1511 O O   . GLN B 45  ? 0.3132 0.2289 0.2896 0.0246  0.0212  0.0137  45  GLN B O   
1512 C CB  . GLN B 45  ? 0.3089 0.2235 0.2430 0.0071  0.0070  -0.0167 45  GLN B CB  
1513 C CG  . GLN B 45  ? 0.3304 0.2307 0.2496 0.0005  0.0051  -0.0260 45  GLN B CG  
1514 C CD  . GLN B 45  ? 0.3316 0.2531 0.2742 -0.0084 0.0010  -0.0121 45  GLN B CD  
1515 O OE1 . GLN B 45  ? 0.3611 0.2613 0.2593 0.0059  0.0209  -0.0254 45  GLN B OE1 
1516 N NE2 . GLN B 45  ? 0.3622 0.2774 0.3039 -0.0154 -0.0015 -0.0183 45  GLN B NE2 
1517 N N   . GLU B 46  ? 0.3226 0.1957 0.3056 0.0240  0.0218  0.0060  46  GLU B N   
1518 C CA  . GLU B 46  ? 0.3591 0.2597 0.3447 0.0254  0.0165  0.0094  46  GLU B CA  
1519 C C   . GLU B 46  ? 0.3596 0.2424 0.3210 0.0150  0.0176  -0.0012 46  GLU B C   
1520 O O   . GLU B 46  ? 0.3938 0.2589 0.3393 -0.0037 0.0265  0.0172  46  GLU B O   
1521 C CB  . GLU B 46  ? 0.3574 0.2658 0.3378 0.0144  0.0038  0.0176  46  GLU B CB  
1522 C CG  . GLU B 46  ? 0.3693 0.3107 0.3645 0.0203  0.0080  0.0083  46  GLU B CG  
1523 C CD  . GLU B 46  ? 0.3754 0.3459 0.3782 0.0177  0.0105  0.0039  46  GLU B CD  
1524 O OE1 . GLU B 46  ? 0.3720 0.3450 0.3852 0.0188  0.0071  0.0023  46  GLU B OE1 
1525 O OE2 . GLU B 46  ? 0.3646 0.3626 0.3841 0.0107  0.0066  -0.0026 46  GLU B OE2 
1526 N N   . GLY B 47  ? 0.3695 0.3011 0.3406 0.0233  0.0203  -0.0118 47  GLY B N   
1527 C CA  . GLY B 47  ? 0.3605 0.2951 0.3264 0.0119  0.0232  -0.0268 47  GLY B CA  
1528 C C   . GLY B 47  ? 0.3632 0.2849 0.3176 -0.0022 0.0235  -0.0265 47  GLY B C   
1529 O O   . GLY B 47  ? 0.3832 0.2826 0.3048 0.0028  0.0504  -0.0298 47  GLY B O   
1530 N N   . ASP B 48  ? 0.3285 0.2644 0.2949 0.0007  0.0277  -0.0302 48  ASP B N   
1531 C CA  . ASP B 48  ? 0.3061 0.2397 0.2515 -0.0117 0.0132  -0.0344 48  ASP B CA  
1532 C C   . ASP B 48  ? 0.3010 0.2242 0.2340 -0.0079 -0.0005 -0.0271 48  ASP B C   
1533 O O   . ASP B 48  ? 0.3154 0.2463 0.2457 0.0002  -0.0004 -0.0416 48  ASP B O   
1534 C CB  . ASP B 48  ? 0.3192 0.2601 0.2773 -0.0178 0.0000  -0.0362 48  ASP B CB  
1535 C CG  . ASP B 48  ? 0.3571 0.2907 0.3076 -0.0215 0.0070  -0.0299 48  ASP B CG  
1536 O OD1 . ASP B 48  ? 0.3730 0.2705 0.2894 -0.0180 0.0050  -0.0485 48  ASP B OD1 
1537 O OD2 . ASP B 48  ? 0.3536 0.2717 0.3118 -0.0413 -0.0101 -0.0517 48  ASP B OD2 
1538 N N   . THR B 49  ? 0.3011 0.2162 0.2369 -0.0194 0.0300  -0.0026 49  THR B N   
1539 C CA  . THR B 49  ? 0.2833 0.1957 0.2121 -0.0195 0.0243  -0.0047 49  THR B CA  
1540 C C   . THR B 49  ? 0.2764 0.2034 0.2471 -0.0082 0.0230  -0.0065 49  THR B C   
1541 O O   . THR B 49  ? 0.3028 0.2075 0.2813 -0.0012 0.0417  -0.0109 49  THR B O   
1542 C CB  . THR B 49  ? 0.3122 0.2534 0.2719 -0.0066 0.0068  0.0088  49  THR B CB  
1543 O OG1 . THR B 49  ? 0.3276 0.2246 0.2786 -0.0001 0.0265  0.0093  49  THR B OG1 
1544 C CG2 . THR B 49  ? 0.3199 0.2400 0.2806 -0.0118 0.0109  0.0176  49  THR B CG2 
1545 N N   . PHE B 50  ? 0.2631 0.1775 0.2116 -0.0094 0.0092  -0.0174 50  PHE B N   
1546 C CA  . PHE B 50  ? 0.2373 0.1719 0.1714 -0.0225 -0.0072 -0.0137 50  PHE B CA  
1547 C C   . PHE B 50  ? 0.2275 0.1813 0.1837 0.0000  0.0170  -0.0175 50  PHE B C   
1548 O O   . PHE B 50  ? 0.2428 0.1919 0.1748 -0.0133 0.0132  -0.0182 50  PHE B O   
1549 C CB  . PHE B 50  ? 0.2690 0.2154 0.1949 -0.0012 0.0055  0.0002  50  PHE B CB  
1550 C CG  . PHE B 50  ? 0.2531 0.2387 0.2146 -0.0030 0.0153  -0.0116 50  PHE B CG  
1551 C CD1 . PHE B 50  ? 0.2886 0.2469 0.1846 -0.0015 0.0108  -0.0298 50  PHE B CD1 
1552 C CD2 . PHE B 50  ? 0.2852 0.2392 0.1742 0.0071  0.0199  -0.0063 50  PHE B CD2 
1553 C CE1 . PHE B 50  ? 0.2954 0.2349 0.2091 -0.0061 0.0121  -0.0216 50  PHE B CE1 
1554 C CE2 . PHE B 50  ? 0.2946 0.2680 0.2409 0.0167  0.0089  0.0008  50  PHE B CE2 
1555 C CZ  . PHE B 50  ? 0.2954 0.2561 0.1778 -0.0031 0.0030  -0.0198 50  PHE B CZ  
1556 N N   . TYR B 51  ? 0.2275 0.1570 0.1805 -0.0187 0.0083  -0.0131 51  TYR B N   
1557 C CA  . TYR B 51  ? 0.2189 0.1750 0.1606 -0.0296 0.0069  0.0116  51  TYR B CA  
1558 C C   . TYR B 51  ? 0.2236 0.1949 0.1834 -0.0107 0.0211  0.0081  51  TYR B C   
1559 O O   . TYR B 51  ? 0.2189 0.2027 0.1828 0.0114  0.0198  0.0302  51  TYR B O   
1560 C CB  . TYR B 51  ? 0.2415 0.2181 0.1929 -0.0254 -0.0005 0.0171  51  TYR B CB  
1561 C CG  . TYR B 51  ? 0.2374 0.1923 0.2051 -0.0263 -0.0011 0.0257  51  TYR B CG  
1562 C CD1 . TYR B 51  ? 0.2382 0.1959 0.2049 -0.0130 -0.0075 0.0256  51  TYR B CD1 
1563 C CD2 . TYR B 51  ? 0.2238 0.2177 0.2183 -0.0213 -0.0115 0.0213  51  TYR B CD2 
1564 C CE1 . TYR B 51  ? 0.2289 0.2288 0.2072 -0.0157 -0.0081 0.0186  51  TYR B CE1 
1565 C CE2 . TYR B 51  ? 0.2460 0.2204 0.1885 -0.0074 -0.0073 0.0144  51  TYR B CE2 
1566 C CZ  . TYR B 51  ? 0.2372 0.2137 0.2196 -0.0150 -0.0074 0.0022  51  TYR B CZ  
1567 O OH  . TYR B 51  ? 0.2588 0.2457 0.2288 -0.0391 -0.0013 0.0129  51  TYR B OH  
1568 N N   . ILE B 52  ? 0.2254 0.1651 0.1388 -0.0227 0.0084  0.0194  52  ILE B N   
1569 C CA  . ILE B 52  ? 0.2350 0.1680 0.1856 -0.0149 -0.0086 0.0125  52  ILE B CA  
1570 C C   . ILE B 52  ? 0.2095 0.1747 0.1676 -0.0110 -0.0044 0.0139  52  ILE B C   
1571 O O   . ILE B 52  ? 0.2487 0.2008 0.1837 -0.0259 0.0178  -0.0035 52  ILE B O   
1572 C CB  . ILE B 52  ? 0.2495 0.1857 0.1779 -0.0212 -0.0029 0.0198  52  ILE B CB  
1573 C CG1 . ILE B 52  ? 0.2414 0.2005 0.1840 -0.0175 -0.0157 0.0199  52  ILE B CG1 
1574 C CG2 . ILE B 52  ? 0.2788 0.1958 0.1949 -0.0262 -0.0035 0.0394  52  ILE B CG2 
1575 C CD1 . ILE B 52  ? 0.2596 0.2306 0.1953 -0.0228 -0.0275 0.0128  52  ILE B CD1 
1576 N N   . LYS B 53  ? 0.2259 0.1796 0.1931 -0.0119 0.0038  0.0100  53  LYS B N   
1577 C CA  . LYS B 53  ? 0.2601 0.1920 0.2090 -0.0175 0.0009  0.0142  53  LYS B CA  
1578 C C   . LYS B 53  ? 0.2362 0.1833 0.1932 -0.0216 0.0302  0.0236  53  LYS B C   
1579 O O   . LYS B 53  ? 0.2830 0.2171 0.2328 -0.0159 0.0252  0.0154  53  LYS B O   
1580 C CB  . LYS B 53  ? 0.2486 0.2244 0.2011 -0.0190 0.0167  0.0098  53  LYS B CB  
1581 C CG  . LYS B 53  ? 0.2666 0.2476 0.2471 -0.0257 -0.0072 0.0238  53  LYS B CG  
1582 C CD  . LYS B 53  ? 0.2739 0.2771 0.2582 -0.0102 -0.0137 0.0175  53  LYS B CD  
1583 C CE  . LYS B 53  ? 0.2752 0.3006 0.3136 -0.0055 -0.0325 0.0267  53  LYS B CE  
1584 N NZ  . LYS B 53  ? 0.2596 0.2944 0.3052 -0.0182 -0.0452 0.0363  53  LYS B NZ  
1585 N N   . VAL B 54  ? 0.2564 0.1926 0.2176 -0.0265 -0.0019 0.0110  54  VAL B N   
1586 C CA  . VAL B 54  ? 0.2523 0.1826 0.2195 -0.0213 0.0229  0.0277  54  VAL B CA  
1587 C C   . VAL B 54  ? 0.2995 0.2127 0.2514 -0.0075 -0.0050 -0.0041 54  VAL B C   
1588 O O   . VAL B 54  ? 0.3009 0.1882 0.2286 -0.0569 0.0565  0.0246  54  VAL B O   
1589 C CB  . VAL B 54  ? 0.2745 0.2129 0.2422 -0.0209 -0.0015 0.0102  54  VAL B CB  
1590 C CG1 . VAL B 54  ? 0.2873 0.2514 0.2435 -0.0109 0.0027  0.0266  54  VAL B CG1 
1591 C CG2 . VAL B 54  ? 0.2700 0.2416 0.2183 -0.0187 -0.0033 -0.0041 54  VAL B CG2 
1592 N N   . SER B 55  ? 0.2791 0.2253 0.2307 -0.0332 0.0248  0.0237  55  SER B N   
1593 C CA  . SER B 55  ? 0.3357 0.2510 0.2869 -0.0199 0.0036  0.0053  55  SER B CA  
1594 C C   . SER B 55  ? 0.3188 0.2250 0.2654 -0.0390 0.0184  0.0324  55  SER B C   
1595 O O   . SER B 55  ? 0.3499 0.2848 0.3048 -0.0322 -0.0053 0.0093  55  SER B O   
1596 C CB  . SER B 55  ? 0.3146 0.2512 0.2538 -0.0352 -0.0110 0.0253  55  SER B CB  
1597 O OG  . SER B 55  ? 0.3520 0.2767 0.2834 -0.0103 -0.0166 0.0173  55  SER B OG  
1598 N N   . THR B 56  ? 0.3736 0.2835 0.3172 -0.0338 0.0146  0.0180  56  THR B N   
1599 C CA  . THR B 56  ? 0.3860 0.2443 0.3209 -0.0471 0.0164  0.0248  56  THR B CA  
1600 C C   . THR B 56  ? 0.4226 0.3250 0.3538 -0.0326 -0.0004 0.0119  56  THR B C   
1601 O O   . THR B 56  ? 0.4353 0.3298 0.3864 -0.0439 -0.0084 0.0125  56  THR B O   
1602 C CB  . THR B 56  ? 0.3968 0.3132 0.3122 -0.0185 0.0277  0.0118  56  THR B CB  
1603 O OG1 . THR B 56  ? 0.4409 0.2993 0.3380 -0.0039 0.0355  0.0020  56  THR B OG1 
1604 C CG2 . THR B 56  ? 0.3889 0.2903 0.3105 -0.0190 0.0300  0.0237  56  THR B CG2 
1605 N N   . THR B 57  ? 0.4273 0.3287 0.3928 -0.0397 -0.0010 0.0129  57  THR B N   
1606 C CA  . THR B 57  ? 0.4317 0.3549 0.4018 -0.0303 0.0018  0.0029  57  THR B CA  
1607 C C   . THR B 57  ? 0.4435 0.3667 0.4100 -0.0177 0.0062  0.0056  57  THR B C   
1608 O O   . THR B 57  ? 0.4859 0.3984 0.4366 -0.0124 0.0019  0.0029  57  THR B O   
1609 C CB  . THR B 57  ? 0.4178 0.3514 0.4008 -0.0296 0.0045  0.0066  57  THR B CB  
1610 O OG1 . THR B 57  ? 0.4101 0.3614 0.4100 -0.0239 0.0028  0.0077  57  THR B OG1 
1611 C CG2 . THR B 57  ? 0.4062 0.3645 0.4136 -0.0281 -0.0013 0.0052  57  THR B CG2 
1612 N N   . VAL B 58  ? 0.4473 0.3665 0.4059 -0.0331 0.0116  -0.0042 58  VAL B N   
1613 C CA  . VAL B 58  ? 0.4473 0.3692 0.4050 -0.0235 0.0171  0.0002  58  VAL B CA  
1614 C C   . VAL B 58  ? 0.4419 0.3515 0.3875 -0.0264 0.0173  -0.0080 58  VAL B C   
1615 O O   . VAL B 58  ? 0.4516 0.3580 0.3731 -0.0311 0.0285  -0.0185 58  VAL B O   
1616 C CB  . VAL B 58  ? 0.4537 0.4192 0.4358 -0.0183 0.0047  0.0018  58  VAL B CB  
1617 C CG1 . VAL B 58  ? 0.4527 0.4126 0.4248 -0.0179 0.0064  0.0111  58  VAL B CG1 
1618 C CG2 . VAL B 58  ? 0.4623 0.4263 0.4407 -0.0180 0.0054  0.0076  58  VAL B CG2 
1619 N N   . ARG B 59  ? 0.4127 0.3115 0.3384 -0.0284 0.0207  -0.0018 59  ARG B N   
1620 C CA  . ARG B 59  ? 0.3806 0.2937 0.3283 -0.0320 0.0286  0.0024  59  ARG B CA  
1621 C C   . ARG B 59  ? 0.3554 0.2441 0.2776 -0.0503 0.0392  0.0113  59  ARG B C   
1622 O O   . ARG B 59  ? 0.3804 0.2312 0.2963 -0.0800 0.0356  0.0122  59  ARG B O   
1623 C CB  . ARG B 59  ? 0.3693 0.2875 0.3145 -0.0157 0.0145  0.0120  59  ARG B CB  
1624 C CG  . ARG B 59  ? 0.3480 0.3164 0.3285 -0.0135 0.0191  0.0072  59  ARG B CG  
1625 C CD  . ARG B 59  ? 0.3545 0.2984 0.3251 -0.0134 0.0122  0.0088  59  ARG B CD  
1626 N NE  . ARG B 59  ? 0.3284 0.2903 0.3005 -0.0047 0.0037  0.0017  59  ARG B NE  
1627 C CZ  . ARG B 59  ? 0.3054 0.2922 0.3078 0.0070  -0.0043 0.0030  59  ARG B CZ  
1628 N NH1 . ARG B 59  ? 0.2687 0.2292 0.2747 -0.0021 -0.0136 0.0057  59  ARG B NH1 
1629 N NH2 . ARG B 59  ? 0.2671 0.2405 0.2865 -0.0020 -0.0050 0.0031  59  ARG B NH2 
1630 N N   . THR B 60  ? 0.3485 0.2413 0.2869 -0.0353 0.0202  0.0050  60  THR B N   
1631 C CA  . THR B 60  ? 0.2953 0.2502 0.2669 -0.0396 0.0183  -0.0058 60  THR B CA  
1632 C C   . THR B 60  ? 0.2772 0.2323 0.2358 -0.0213 0.0202  -0.0009 60  THR B C   
1633 O O   . THR B 60  ? 0.2735 0.2245 0.2138 -0.0445 0.0328  -0.0029 60  THR B O   
1634 C CB  . THR B 60  ? 0.2870 0.2721 0.2752 -0.0385 0.0242  0.0017  60  THR B CB  
1635 O OG1 . THR B 60  ? 0.2963 0.3021 0.3343 -0.0578 -0.0036 -0.0094 60  THR B OG1 
1636 C CG2 . THR B 60  ? 0.2873 0.2718 0.2763 -0.0336 0.0107  -0.0034 60  THR B CG2 
1637 N N   . THR B 61  ? 0.2743 0.2056 0.2205 -0.0298 0.0098  0.0070  61  THR B N   
1638 C CA  A THR B 61  ? 0.2491 0.1901 0.2035 -0.0222 0.0134  0.0025  61  THR B CA  
1639 C CA  B THR B 61  ? 0.2678 0.2183 0.2362 -0.0226 0.0157  0.0030  61  THR B CA  
1640 C C   . THR B 61  ? 0.2707 0.2220 0.2448 -0.0139 -0.0083 -0.0248 61  THR B C   
1641 O O   . THR B 61  ? 0.2683 0.1880 0.2131 -0.0596 0.0536  0.0017  61  THR B O   
1642 C CB  A THR B 61  ? 0.2473 0.1776 0.2095 -0.0170 0.0143  -0.0042 61  THR B CB  
1643 C CB  B THR B 61  ? 0.2967 0.2593 0.2729 -0.0124 0.0101  0.0003  61  THR B CB  
1644 O OG1 A THR B 61  ? 0.2520 0.1825 0.1897 -0.0110 0.0044  -0.0039 61  THR B OG1 
1645 O OG1 B THR B 61  ? 0.3301 0.2998 0.3236 -0.0011 0.0052  -0.0038 61  THR B OG1 
1646 C CG2 A THR B 61  ? 0.2478 0.1490 0.1824 0.0023  -0.0016 -0.0192 61  THR B CG2 
1647 C CG2 B THR B 61  ? 0.2903 0.2621 0.2637 -0.0101 0.0087  0.0051  61  THR B CG2 
1648 N N   . GLU B 62  ? 0.2410 0.1779 0.1794 -0.0361 0.0164  0.0208  62  GLU B N   
1649 C CA  . GLU B 62  ? 0.2309 0.1932 0.2033 -0.0097 -0.0017 -0.0068 62  GLU B CA  
1650 C C   . GLU B 62  ? 0.2054 0.1775 0.1925 -0.0078 0.0147  0.0023  62  GLU B C   
1651 O O   . GLU B 62  ? 0.2319 0.1931 0.1846 -0.0090 0.0243  -0.0129 62  GLU B O   
1652 C CB  . GLU B 62  ? 0.2584 0.2162 0.2508 -0.0061 -0.0186 0.0025  62  GLU B CB  
1653 C CG  . GLU B 62  ? 0.2430 0.2477 0.2651 -0.0068 -0.0144 0.0096  62  GLU B CG  
1654 C CD  . GLU B 62  ? 0.2714 0.2730 0.2397 -0.0162 -0.0061 0.0011  62  GLU B CD  
1655 O OE1 . GLU B 62  ? 0.2587 0.2543 0.2248 -0.0224 0.0032  0.0124  62  GLU B OE1 
1656 O OE2 . GLU B 62  ? 0.2729 0.2567 0.2482 -0.0264 0.0106  -0.0175 62  GLU B OE2 
1657 N N   . ILE B 63  ? 0.2104 0.1770 0.1833 -0.0380 0.0111  -0.0049 63  ILE B N   
1658 C CA  . ILE B 63  ? 0.1995 0.1840 0.2146 -0.0321 0.0040  -0.0105 63  ILE B CA  
1659 C C   . ILE B 63  ? 0.2081 0.1904 0.1840 -0.0262 0.0213  -0.0026 63  ILE B C   
1660 O O   . ILE B 63  ? 0.2111 0.1795 0.2024 -0.0142 0.0173  -0.0112 63  ILE B O   
1661 C CB  . ILE B 63  ? 0.1855 0.2105 0.2472 -0.0291 0.0064  -0.0037 63  ILE B CB  
1662 C CG1 . ILE B 63  ? 0.1882 0.2450 0.2820 -0.0314 0.0022  -0.0342 63  ILE B CG1 
1663 C CG2 . ILE B 63  ? 0.2209 0.2229 0.2164 -0.0040 -0.0035 -0.0071 63  ILE B CG2 
1664 C CD1 . ILE B 63  ? 0.2382 0.2805 0.2993 -0.0115 0.0038  -0.0359 63  ILE B CD1 
1665 N N   . ASN B 64  ? 0.2138 0.1704 0.1845 -0.0213 -0.0048 -0.0183 64  ASN B N   
1666 C CA  . ASN B 64  ? 0.1927 0.1628 0.1666 -0.0232 -0.0160 -0.0044 64  ASN B CA  
1667 C C   . ASN B 64  ? 0.1931 0.1764 0.1671 -0.0162 0.0124  -0.0041 64  ASN B C   
1668 O O   . ASN B 64  ? 0.2026 0.1741 0.1638 -0.0191 -0.0035 0.0081  64  ASN B O   
1669 C CB  . ASN B 64  ? 0.2069 0.1938 0.1724 -0.0065 0.0062  0.0187  64  ASN B CB  
1670 C CG  . ASN B 64  ? 0.1766 0.1716 0.1911 -0.0184 -0.0039 -0.0095 64  ASN B CG  
1671 O OD1 . ASN B 64  ? 0.2407 0.1933 0.2240 -0.0252 0.0127  0.0131  64  ASN B OD1 
1672 N ND2 . ASN B 64  ? 0.1652 0.1978 0.1480 -0.0070 0.0123  -0.0012 64  ASN B ND2 
1673 N N   . PHE B 65  ? 0.2051 0.1792 0.1482 -0.0354 0.0011  -0.0138 65  PHE B N   
1674 C CA  . PHE B 65  ? 0.2052 0.1812 0.1714 -0.0278 -0.0218 -0.0261 65  PHE B CA  
1675 C C   . PHE B 65  ? 0.2390 0.2142 0.2029 -0.0077 0.0090  -0.0119 65  PHE B C   
1676 O O   . PHE B 65  ? 0.2524 0.2027 0.1883 -0.0152 0.0039  -0.0136 65  PHE B O   
1677 C CB  . PHE B 65  ? 0.2219 0.2069 0.1879 -0.0253 0.0086  0.0066  65  PHE B CB  
1678 C CG  . PHE B 65  ? 0.2174 0.2166 0.1984 -0.0161 0.0070  0.0047  65  PHE B CG  
1679 C CD1 . PHE B 65  ? 0.2308 0.2438 0.1945 -0.0141 0.0015  0.0171  65  PHE B CD1 
1680 C CD2 . PHE B 65  ? 0.2332 0.2087 0.2368 0.0049  -0.0148 0.0105  65  PHE B CD2 
1681 C CE1 . PHE B 65  ? 0.2274 0.2403 0.1978 -0.0107 -0.0003 0.0080  65  PHE B CE1 
1682 C CE2 . PHE B 65  ? 0.2424 0.2147 0.2253 -0.0047 -0.0035 0.0088  65  PHE B CE2 
1683 C CZ  . PHE B 65  ? 0.2472 0.2346 0.2277 -0.0051 -0.0060 0.0066  65  PHE B CZ  
1684 N N   . LYS B 66  ? 0.2611 0.2030 0.1911 -0.0425 -0.0025 -0.0353 66  LYS B N   
1685 C CA  . LYS B 66  ? 0.2881 0.2177 0.2079 -0.0110 0.0045  -0.0143 66  LYS B CA  
1686 C C   . LYS B 66  ? 0.2905 0.2331 0.2424 -0.0246 0.0064  0.0017  66  LYS B C   
1687 O O   . LYS B 66  ? 0.2763 0.2234 0.2155 -0.0250 -0.0054 -0.0041 66  LYS B O   
1688 C CB  . LYS B 66  ? 0.3278 0.2198 0.2363 -0.0076 0.0086  -0.0155 66  LYS B CB  
1689 C CG  . LYS B 66  ? 0.3473 0.2183 0.2615 -0.0204 0.0005  -0.0063 66  LYS B CG  
1690 C CD  . LYS B 66  ? 0.3773 0.2657 0.2969 -0.0177 0.0113  0.0112  66  LYS B CD  
1691 C CE  . LYS B 66  ? 0.3841 0.3121 0.3163 -0.0043 0.0129  -0.0021 66  LYS B CE  
1692 N NZ  . LYS B 66  ? 0.3866 0.3477 0.3583 -0.0026 0.0089  0.0049  66  LYS B NZ  
1693 N N   . VAL B 67  ? 0.3002 0.2346 0.2240 -0.0396 -0.0134 -0.0175 67  VAL B N   
1694 C CA  . VAL B 67  ? 0.2997 0.2613 0.2260 -0.0335 -0.0029 -0.0140 67  VAL B CA  
1695 C C   . VAL B 67  ? 0.3180 0.2524 0.2440 -0.0374 -0.0067 -0.0226 67  VAL B C   
1696 O O   . VAL B 67  ? 0.3655 0.2658 0.2523 -0.0258 -0.0332 -0.0265 67  VAL B O   
1697 C CB  . VAL B 67  ? 0.3216 0.2817 0.2332 -0.0248 -0.0078 -0.0172 67  VAL B CB  
1698 C CG1 . VAL B 67  ? 0.3116 0.2888 0.2223 -0.0252 -0.0043 -0.0182 67  VAL B CG1 
1699 C CG2 . VAL B 67  ? 0.3141 0.2841 0.2159 -0.0298 -0.0067 -0.0236 67  VAL B CG2 
1700 N N   . GLY B 68  ? 0.3037 0.2491 0.2337 -0.0482 -0.0109 -0.0144 68  GLY B N   
1701 C CA  . GLY B 68  ? 0.3041 0.2891 0.2691 -0.0529 -0.0117 -0.0217 68  GLY B CA  
1702 C C   . GLY B 68  ? 0.3310 0.3194 0.2957 -0.0475 -0.0052 -0.0024 68  GLY B C   
1703 O O   . GLY B 68  ? 0.3235 0.3163 0.2728 -0.0707 0.0039  -0.0183 68  GLY B O   
1704 N N   . GLU B 69  ? 0.3148 0.2770 0.2569 -0.0551 -0.0210 -0.0184 69  GLU B N   
1705 C CA  . GLU B 69  ? 0.3024 0.2786 0.2818 -0.0390 0.0015  0.0007  69  GLU B CA  
1706 C C   . GLU B 69  ? 0.2836 0.2838 0.2596 -0.0235 -0.0028 0.0048  69  GLU B C   
1707 O O   . GLU B 69  ? 0.2609 0.2720 0.2248 -0.0691 -0.0192 -0.0026 69  GLU B O   
1708 C CB  . GLU B 69  ? 0.3256 0.2992 0.3218 -0.0288 -0.0084 -0.0001 69  GLU B CB  
1709 C CG  . GLU B 69  ? 0.3618 0.3209 0.3610 -0.0148 0.0005  0.0020  69  GLU B CG  
1710 C CD  . GLU B 69  ? 0.4037 0.3266 0.3577 -0.0178 -0.0133 0.0039  69  GLU B CD  
1711 O OE1 . GLU B 69  ? 0.4158 0.3229 0.3583 -0.0288 0.0089  0.0266  69  GLU B OE1 
1712 O OE2 . GLU B 69  ? 0.4328 0.3793 0.4252 -0.0122 -0.0108 0.0065  69  GLU B OE2 
1713 N N   . GLU B 70  ? 0.2530 0.2783 0.2176 -0.0303 -0.0008 0.0215  70  GLU B N   
1714 C CA  . GLU B 70  ? 0.2455 0.2917 0.2588 -0.0285 -0.0056 0.0024  70  GLU B CA  
1715 C C   . GLU B 70  ? 0.2343 0.2582 0.2294 -0.0328 -0.0090 0.0025  70  GLU B C   
1716 O O   . GLU B 70  ? 0.2462 0.2560 0.2322 -0.0269 -0.0056 0.0132  70  GLU B O   
1717 C CB  . GLU B 70  ? 0.2365 0.2981 0.2714 -0.0198 0.0098  0.0069  70  GLU B CB  
1718 C CG  . GLU B 70  ? 0.2773 0.3276 0.3236 -0.0159 -0.0054 0.0000  70  GLU B CG  
1719 C CD  . GLU B 70  ? 0.2953 0.3334 0.3430 -0.0135 -0.0049 -0.0004 70  GLU B CD  
1720 O OE1 . GLU B 70  ? 0.2927 0.3487 0.3850 -0.0282 -0.0212 -0.0025 70  GLU B OE1 
1721 O OE2 . GLU B 70  ? 0.3171 0.3458 0.3761 -0.0090 0.0019  0.0016  70  GLU B OE2 
1722 N N   . PHE B 71  ? 0.2337 0.2417 0.1936 -0.0423 -0.0076 -0.0009 71  PHE B N   
1723 C CA  . PHE B 71  ? 0.1936 0.2478 0.1949 -0.0262 -0.0298 -0.0011 71  PHE B CA  
1724 C C   . PHE B 71  ? 0.2114 0.2508 0.2011 -0.0153 0.0041  0.0045  71  PHE B C   
1725 O O   . PHE B 71  ? 0.2175 0.2631 0.1755 -0.0213 -0.0339 0.0195  71  PHE B O   
1726 C CB  . PHE B 71  ? 0.1949 0.2322 0.1695 -0.0256 -0.0041 0.0092  71  PHE B CB  
1727 C CG  . PHE B 71  ? 0.2316 0.2387 0.1756 -0.0208 -0.0225 -0.0076 71  PHE B CG  
1728 C CD1 . PHE B 71  ? 0.2402 0.2565 0.1899 -0.0148 -0.0160 -0.0110 71  PHE B CD1 
1729 C CD2 . PHE B 71  ? 0.2001 0.2210 0.1866 -0.0148 -0.0060 0.0133  71  PHE B CD2 
1730 C CE1 . PHE B 71  ? 0.2373 0.2302 0.1882 -0.0234 -0.0251 0.0050  71  PHE B CE1 
1731 C CE2 . PHE B 71  ? 0.2139 0.2145 0.1729 -0.0137 -0.0171 0.0009  71  PHE B CE2 
1732 C CZ  . PHE B 71  ? 0.2358 0.2311 0.1893 -0.0267 -0.0176 0.0078  71  PHE B CZ  
1733 N N   . GLU B 72  ? 0.2075 0.2239 0.1655 -0.0299 -0.0059 0.0009  72  GLU B N   
1734 C CA  . GLU B 72  ? 0.2071 0.2334 0.1729 -0.0124 0.0048  0.0068  72  GLU B CA  
1735 C C   . GLU B 72  ? 0.1993 0.2045 0.1780 -0.0021 -0.0140 0.0061  72  GLU B C   
1736 O O   . GLU B 72  ? 0.1696 0.2131 0.1800 -0.0026 -0.0030 -0.0034 72  GLU B O   
1737 C CB  . GLU B 72  ? 0.2251 0.2513 0.1685 -0.0302 0.0195  0.0029  72  GLU B CB  
1738 C CG  . GLU B 72  ? 0.2385 0.2883 0.2249 -0.0118 0.0191  -0.0074 72  GLU B CG  
1739 C CD  . GLU B 72  ? 0.2774 0.3017 0.2421 -0.0111 0.0017  -0.0003 72  GLU B CD  
1740 O OE1 . GLU B 72  ? 0.3137 0.3706 0.2663 -0.0232 0.0200  0.0310  72  GLU B OE1 
1741 O OE2 . GLU B 72  ? 0.2959 0.3433 0.2642 0.0229  -0.0085 -0.0159 72  GLU B OE2 
1742 N N   . GLU B 73  ? 0.2237 0.2014 0.1631 -0.0073 -0.0011 0.0223  73  GLU B N   
1743 C CA  . GLU B 73  ? 0.2125 0.2211 0.1934 0.0092  0.0011  0.0134  73  GLU B CA  
1744 C C   . GLU B 73  ? 0.2341 0.2289 0.2214 0.0149  -0.0040 0.0030  73  GLU B C   
1745 O O   . GLU B 73  ? 0.2354 0.2484 0.3008 0.0076  0.0031  0.0047  73  GLU B O   
1746 C CB  . GLU B 73  ? 0.2190 0.2478 0.1916 -0.0075 -0.0005 0.0011  73  GLU B CB  
1747 C CG  . GLU B 73  ? 0.2535 0.2752 0.2116 0.0003  0.0038  0.0074  73  GLU B CG  
1748 C CD  . GLU B 73  ? 0.2552 0.2784 0.2226 -0.0009 0.0075  0.0122  73  GLU B CD  
1749 O OE1 . GLU B 73  ? 0.2587 0.3388 0.2293 0.0111  0.0198  0.0010  73  GLU B OE1 
1750 O OE2 . GLU B 73  ? 0.2833 0.3098 0.2066 -0.0193 0.0039  0.0279  73  GLU B OE2 
1751 N N   . GLN B 74  ? 0.2475 0.2011 0.2353 0.0189  -0.0118 0.0237  74  GLN B N   
1752 C CA  . GLN B 74  ? 0.3163 0.2448 0.2535 0.0144  0.0078  0.0173  74  GLN B CA  
1753 C C   . GLN B 74  ? 0.3005 0.2451 0.2492 0.0056  0.0038  0.0146  74  GLN B C   
1754 O O   . GLN B 74  ? 0.3058 0.2476 0.2785 -0.0056 0.0306  0.0196  74  GLN B O   
1755 C CB  . GLN B 74  ? 0.3688 0.2847 0.3194 0.0063  0.0030  0.0036  74  GLN B CB  
1756 C CG  . GLN B 74  ? 0.4248 0.3493 0.3522 0.0184  -0.0214 0.0084  74  GLN B CG  
1757 C CD  . GLN B 74  ? 0.4416 0.3930 0.3906 0.0007  -0.0062 -0.0030 74  GLN B CD  
1758 O OE1 . GLN B 74  ? 0.4602 0.4180 0.4084 0.0016  -0.0091 -0.0045 74  GLN B OE1 
1759 N NE2 . GLN B 74  ? 0.4554 0.4229 0.4262 0.0105  -0.0040 -0.0050 74  GLN B NE2 
1760 N N   . THR B 75  ? 0.3137 0.2672 0.2306 0.0211  0.0232  0.0344  75  THR B N   
1761 C CA  . THR B 75  ? 0.3184 0.2601 0.2484 -0.0027 0.0170  0.0273  75  THR B CA  
1762 C C   . THR B 75  ? 0.3336 0.3080 0.3013 0.0021  0.0151  0.0112  75  THR B C   
1763 O O   . THR B 75  ? 0.3113 0.2679 0.3063 -0.0136 0.0137  0.0136  75  THR B O   
1764 C CB  . THR B 75  ? 0.3002 0.2739 0.2501 0.0073  0.0143  0.0246  75  THR B CB  
1765 O OG1 . THR B 75  ? 0.3431 0.2999 0.2810 0.0000  0.0138  0.0214  75  THR B OG1 
1766 C CG2 . THR B 75  ? 0.3042 0.2821 0.2645 0.0036  0.0002  0.0156  75  THR B CG2 
1767 N N   . VAL B 76  ? 0.3554 0.3199 0.3202 -0.0003 0.0224  0.0198  76  VAL B N   
1768 C CA  A VAL B 76  ? 0.3649 0.3401 0.3430 -0.0059 0.0124  0.0067  76  VAL B CA  
1769 C CA  B VAL B 76  ? 0.3711 0.3478 0.3493 -0.0075 0.0120  0.0049  76  VAL B CA  
1770 C C   . VAL B 76  ? 0.3846 0.3541 0.3507 -0.0081 0.0108  0.0064  76  VAL B C   
1771 O O   . VAL B 76  ? 0.3851 0.3553 0.3686 -0.0139 0.0162  0.0061  76  VAL B O   
1772 C CB  A VAL B 76  ? 0.3554 0.3422 0.3432 -0.0063 0.0119  0.0076  76  VAL B CB  
1773 C CB  B VAL B 76  ? 0.3723 0.3631 0.3551 -0.0058 0.0133  0.0072  76  VAL B CB  
1774 C CG1 A VAL B 76  ? 0.3641 0.3419 0.3427 -0.0051 0.0117  0.0028  76  VAL B CG1 
1775 C CG1 B VAL B 76  ? 0.3687 0.3572 0.3541 -0.0154 0.0064  0.0040  76  VAL B CG1 
1776 C CG2 A VAL B 76  ? 0.3577 0.3348 0.3420 -0.0054 0.0078  0.0054  76  VAL B CG2 
1777 C CG2 B VAL B 76  ? 0.3924 0.3847 0.3692 -0.0067 0.0036  -0.0003 76  VAL B CG2 
1778 N N   . ASP B 77  ? 0.4061 0.3491 0.3611 0.0026  0.0161  0.0067  77  ASP B N   
1779 C CA  . ASP B 77  ? 0.4375 0.3738 0.3890 -0.0052 0.0120  0.0051  77  ASP B CA  
1780 C C   . ASP B 77  ? 0.4341 0.3768 0.4026 -0.0013 0.0072  0.0090  77  ASP B C   
1781 O O   . ASP B 77  ? 0.4752 0.3709 0.4289 -0.0034 0.0132  0.0043  77  ASP B O   
1782 C CB  . ASP B 77  ? 0.4322 0.3807 0.3973 0.0055  0.0060  0.0059  77  ASP B CB  
1783 C CG  . ASP B 77  ? 0.4627 0.4088 0.4151 0.0015  0.0058  0.0101  77  ASP B CG  
1784 O OD1 . ASP B 77  ? 0.4544 0.3775 0.3677 0.0146  0.0139  0.0079  77  ASP B OD1 
1785 O OD2 . ASP B 77  ? 0.4449 0.3925 0.4381 0.0214  0.0097  -0.0031 77  ASP B OD2 
1786 N N   . GLY B 78  ? 0.3882 0.3259 0.3801 -0.0177 0.0074  0.0172  78  GLY B N   
1787 C CA  . GLY B 78  ? 0.3665 0.3375 0.3681 -0.0054 -0.0050 0.0044  78  GLY B CA  
1788 C C   . GLY B 78  ? 0.3530 0.3343 0.3427 0.0161  0.0003  0.0067  78  GLY B C   
1789 O O   . GLY B 78  ? 0.3670 0.4059 0.3540 0.0151  -0.0092 0.0159  78  GLY B O   
1790 N N   . ARG B 79  ? 0.3284 0.2830 0.2968 0.0211  0.0034  0.0093  79  ARG B N   
1791 C CA  . ARG B 79  ? 0.3284 0.2854 0.2903 0.0181  -0.0156 0.0151  79  ARG B CA  
1792 C C   . ARG B 79  ? 0.3184 0.2825 0.2758 0.0190  0.0007  0.0089  79  ARG B C   
1793 O O   . ARG B 79  ? 0.3484 0.2575 0.2387 0.0241  0.0071  0.0284  79  ARG B O   
1794 C CB  . ARG B 79  ? 0.3389 0.3213 0.3295 0.0107  -0.0176 0.0107  79  ARG B CB  
1795 C CG  . ARG B 79  ? 0.3624 0.3407 0.3338 0.0138  -0.0033 0.0065  79  ARG B CG  
1796 C CD  . ARG B 79  ? 0.3722 0.3553 0.3090 0.0237  0.0003  0.0143  79  ARG B CD  
1797 N NE  . ARG B 79  ? 0.3932 0.4026 0.3617 0.0221  0.0105  0.0035  79  ARG B NE  
1798 C CZ  . ARG B 79  ? 0.3921 0.4089 0.3678 0.0013  0.0122  -0.0018 79  ARG B CZ  
1799 N NH1 . ARG B 79  ? 0.3900 0.4210 0.3856 0.0026  0.0281  0.0073  79  ARG B NH1 
1800 N NH2 . ARG B 79  ? 0.3911 0.4093 0.3817 0.0005  0.0260  0.0133  79  ARG B NH2 
1801 N N   . PRO B 80  ? 0.2996 0.2573 0.2371 0.0338  0.0063  0.0133  80  PRO B N   
1802 C CA  . PRO B 80  ? 0.2921 0.2746 0.2428 0.0141  -0.0017 0.0165  80  PRO B CA  
1803 C C   . PRO B 80  ? 0.2468 0.2770 0.2246 0.0231  0.0034  0.0179  80  PRO B C   
1804 O O   . PRO B 80  ? 0.2389 0.3035 0.2556 0.0397  -0.0256 0.0195  80  PRO B O   
1805 C CB  . PRO B 80  ? 0.3033 0.2957 0.2365 0.0179  0.0124  0.0148  80  PRO B CB  
1806 C CG  . PRO B 80  ? 0.3575 0.2995 0.2696 0.0215  0.0082  0.0192  80  PRO B CG  
1807 C CD  . PRO B 80  ? 0.3573 0.2950 0.2704 0.0178  0.0175  0.0154  80  PRO B CD  
1808 N N   . CYS B 81  ? 0.2304 0.2784 0.2223 0.0093  -0.0065 0.0032  81  CYS B N   
1809 C CA  . CYS B 81  ? 0.2236 0.2853 0.2252 -0.0067 -0.0043 0.0082  81  CYS B CA  
1810 C C   . CYS B 81  ? 0.2009 0.2856 0.2134 -0.0034 -0.0089 0.0168  81  CYS B C   
1811 O O   . CYS B 81  ? 0.2193 0.3010 0.2357 -0.0131 -0.0141 0.0269  81  CYS B O   
1812 C CB  . CYS B 81  ? 0.1802 0.3065 0.2143 -0.0076 -0.0201 0.0045  81  CYS B CB  
1813 S SG  . CYS B 81  ? 0.1980 0.2774 0.1972 -0.0108 -0.0090 0.0190  81  CYS B SG  
1814 N N   . LYS B 82  ? 0.2299 0.2945 0.2328 -0.0215 -0.0029 0.0142  82  LYS B N   
1815 C CA  . LYS B 82  ? 0.2236 0.2946 0.2551 -0.0194 -0.0134 0.0115  82  LYS B CA  
1816 C C   . LYS B 82  ? 0.2213 0.2863 0.2139 -0.0072 -0.0237 0.0357  82  LYS B C   
1817 O O   . LYS B 82  ? 0.2985 0.3539 0.2652 -0.0174 -0.0138 0.0242  82  LYS B O   
1818 C CB  . LYS B 82  ? 0.2632 0.3076 0.2759 -0.0241 -0.0045 0.0213  82  LYS B CB  
1819 C CG  . LYS B 82  ? 0.2883 0.3177 0.2823 -0.0123 0.0052  0.0003  82  LYS B CG  
1820 C CD  . LYS B 82  ? 0.2936 0.3423 0.3066 -0.0181 0.0073  0.0062  82  LYS B CD  
1821 C CE  . LYS B 82  ? 0.3107 0.3386 0.3003 0.0003  0.0001  0.0063  82  LYS B CE  
1822 N NZ  . LYS B 82  ? 0.3238 0.3500 0.2930 -0.0055 -0.0079 0.0087  82  LYS B NZ  
1823 N N   . SER B 83  ? 0.2172 0.2636 0.2213 -0.0264 -0.0035 0.0121  83  SER B N   
1824 C CA  . SER B 83  ? 0.2072 0.2560 0.2124 -0.0330 -0.0114 0.0159  83  SER B CA  
1825 C C   . SER B 83  ? 0.2245 0.2678 0.2304 -0.0329 -0.0168 0.0043  83  SER B C   
1826 O O   . SER B 83  ? 0.2326 0.2451 0.2226 -0.0594 -0.0208 0.0213  83  SER B O   
1827 C CB  . SER B 83  ? 0.2376 0.2783 0.2463 -0.0265 -0.0315 0.0131  83  SER B CB  
1828 O OG  . SER B 83  ? 0.2585 0.2727 0.2283 -0.0275 -0.0337 0.0160  83  SER B OG  
1829 N N   . LEU B 84  ? 0.2119 0.2716 0.1946 -0.0415 -0.0002 0.0165  84  LEU B N   
1830 C CA  . LEU B 84  ? 0.2425 0.2807 0.2496 -0.0401 -0.0017 0.0109  84  LEU B CA  
1831 C C   . LEU B 84  ? 0.2553 0.2772 0.2471 -0.0373 -0.0048 0.0105  84  LEU B C   
1832 O O   . LEU B 84  ? 0.2744 0.2949 0.2464 -0.0476 -0.0144 0.0114  84  LEU B O   
1833 C CB  . LEU B 84  ? 0.2467 0.2953 0.2769 -0.0479 -0.0116 0.0126  84  LEU B CB  
1834 C CG  . LEU B 84  ? 0.2688 0.3182 0.3034 -0.0349 -0.0139 -0.0011 84  LEU B CG  
1835 C CD1 . LEU B 84  ? 0.2781 0.3163 0.2969 -0.0382 -0.0222 0.0050  84  LEU B CD1 
1836 C CD2 . LEU B 84  ? 0.2683 0.2939 0.2789 -0.0557 -0.0189 0.0049  84  LEU B CD2 
1837 N N   . VAL B 85  ? 0.2436 0.2483 0.2161 -0.0437 -0.0094 -0.0025 85  VAL B N   
1838 C CA  . VAL B 85  ? 0.2777 0.2652 0.2360 -0.0253 -0.0072 -0.0170 85  VAL B CA  
1839 C C   . VAL B 85  ? 0.3013 0.2780 0.2450 -0.0347 -0.0094 -0.0039 85  VAL B C   
1840 O O   . VAL B 85  ? 0.3485 0.3033 0.2486 -0.0473 -0.0055 -0.0079 85  VAL B O   
1841 C CB  . VAL B 85  ? 0.2651 0.2460 0.2465 -0.0166 0.0014  -0.0136 85  VAL B CB  
1842 C CG1 . VAL B 85  ? 0.2802 0.2844 0.2272 -0.0038 -0.0053 -0.0233 85  VAL B CG1 
1843 C CG2 . VAL B 85  ? 0.2712 0.2581 0.2456 -0.0152 -0.0056 -0.0151 85  VAL B CG2 
1844 N N   . LYS B 86  ? 0.3092 0.2950 0.2378 -0.0397 -0.0053 0.0024  86  LYS B N   
1845 C CA  . LYS B 86  ? 0.3365 0.3328 0.2754 -0.0300 0.0049  -0.0046 86  LYS B CA  
1846 C C   . LYS B 86  ? 0.3461 0.3227 0.2871 -0.0262 -0.0017 0.0004  86  LYS B C   
1847 O O   . LYS B 86  ? 0.3684 0.2718 0.2150 -0.0438 0.0042  0.0119  86  LYS B O   
1848 C CB  . LYS B 86  ? 0.3583 0.3834 0.3297 -0.0227 -0.0096 -0.0098 86  LYS B CB  
1849 C CG  . LYS B 86  ? 0.3878 0.4453 0.3833 -0.0186 -0.0004 -0.0017 86  LYS B CG  
1850 C CD  . LYS B 86  ? 0.4209 0.4901 0.4270 -0.0233 -0.0126 -0.0087 86  LYS B CD  
1851 C CE  . LYS B 86  ? 0.4389 0.5047 0.4549 -0.0140 -0.0003 -0.0059 86  LYS B CE  
1852 N NZ  . LYS B 86  ? 0.4851 0.5393 0.5019 -0.0195 -0.0009 -0.0089 86  LYS B NZ  
1853 N N   . TRP B 87  ? 0.3538 0.3054 0.2868 -0.0268 0.0061  -0.0085 87  TRP B N   
1854 C CA  . TRP B 87  ? 0.3551 0.3230 0.2776 -0.0271 -0.0100 -0.0082 87  TRP B CA  
1855 C C   . TRP B 87  ? 0.3782 0.3349 0.3007 -0.0414 -0.0218 -0.0141 87  TRP B C   
1856 O O   . TRP B 87  ? 0.3820 0.3419 0.3043 -0.0718 -0.0255 -0.0199 87  TRP B O   
1857 C CB  . TRP B 87  ? 0.3641 0.3157 0.2958 -0.0243 -0.0072 -0.0207 87  TRP B CB  
1858 C CG  . TRP B 87  ? 0.3728 0.3200 0.2976 -0.0174 0.0008  -0.0130 87  TRP B CG  
1859 C CD1 . TRP B 87  ? 0.3663 0.3053 0.2958 -0.0155 -0.0047 -0.0114 87  TRP B CD1 
1860 C CD2 . TRP B 87  ? 0.3558 0.3077 0.2798 -0.0226 -0.0021 -0.0287 87  TRP B CD2 
1861 N NE1 . TRP B 87  ? 0.3606 0.3135 0.2901 -0.0207 0.0041  -0.0280 87  TRP B NE1 
1862 C CE2 . TRP B 87  ? 0.3671 0.3193 0.3145 -0.0152 0.0049  -0.0127 87  TRP B CE2 
1863 C CE3 . TRP B 87  ? 0.3609 0.3041 0.2949 -0.0141 -0.0040 -0.0240 87  TRP B CE3 
1864 C CZ2 . TRP B 87  ? 0.3508 0.2999 0.2842 -0.0234 0.0012  -0.0267 87  TRP B CZ2 
1865 C CZ3 . TRP B 87  ? 0.3609 0.3051 0.2972 -0.0078 -0.0063 -0.0195 87  TRP B CZ3 
1866 C CH2 . TRP B 87  ? 0.3692 0.3149 0.2913 -0.0090 -0.0038 -0.0175 87  TRP B CH2 
1867 N N   . GLU B 88  ? 0.3998 0.3340 0.2751 -0.0448 -0.0259 -0.0180 88  GLU B N   
1868 C CA  . GLU B 88  ? 0.4118 0.3707 0.3145 -0.0281 -0.0230 -0.0046 88  GLU B CA  
1869 C C   . GLU B 88  ? 0.4395 0.3809 0.3403 -0.0272 -0.0166 -0.0192 88  GLU B C   
1870 O O   . GLU B 88  ? 0.4616 0.4163 0.3592 -0.0390 -0.0200 -0.0068 88  GLU B O   
1871 C CB  . GLU B 88  ? 0.4065 0.3618 0.2955 -0.0223 -0.0250 -0.0045 88  GLU B CB  
1872 C CG  . GLU B 88  ? 0.4044 0.3725 0.3035 -0.0175 -0.0248 -0.0018 88  GLU B CG  
1873 C CD  . GLU B 88  ? 0.4069 0.3824 0.3371 -0.0132 -0.0177 0.0015  88  GLU B CD  
1874 O OE1 . GLU B 88  ? 0.4283 0.3954 0.3563 -0.0050 -0.0132 -0.0022 88  GLU B OE1 
1875 O OE2 . GLU B 88  ? 0.4275 0.3914 0.3537 -0.0129 -0.0105 0.0070  88  GLU B OE2 
1876 N N   . SER B 89  ? 0.4617 0.3925 0.3727 -0.0277 -0.0040 -0.0163 89  SER B N   
1877 C CA  . SER B 89  ? 0.4796 0.4044 0.4104 -0.0178 0.0098  -0.0039 89  SER B CA  
1878 C C   . SER B 89  ? 0.4870 0.4137 0.4192 -0.0177 0.0090  -0.0101 89  SER B C   
1879 O O   . SER B 89  ? 0.5009 0.3657 0.4013 -0.0133 0.0257  -0.0249 89  SER B O   
1880 C CB  . SER B 89  ? 0.4910 0.4400 0.4037 -0.0157 0.0172  -0.0058 89  SER B CB  
1881 O OG  . SER B 89  ? 0.4941 0.4220 0.3925 -0.0385 0.0125  -0.0179 89  SER B OG  
1882 N N   . GLU B 90  ? 0.4949 0.4113 0.4504 -0.0079 0.0064  -0.0205 90  GLU B N   
1883 C CA  . GLU B 90  ? 0.4882 0.4248 0.4442 -0.0034 0.0035  -0.0195 90  GLU B CA  
1884 C C   . GLU B 90  ? 0.4745 0.3930 0.4318 0.0020  0.0082  -0.0045 90  GLU B C   
1885 O O   . GLU B 90  ? 0.4930 0.3512 0.4287 0.0067  0.0103  -0.0374 90  GLU B O   
1886 C CB  . GLU B 90  ? 0.4963 0.4553 0.4750 0.0020  0.0084  -0.0125 90  GLU B CB  
1887 C CG  . GLU B 90  ? 0.5195 0.4940 0.5079 0.0062  -0.0004 -0.0027 90  GLU B CG  
1888 C CD  . GLU B 90  ? 0.5196 0.5073 0.5158 0.0116  0.0028  -0.0016 90  GLU B CD  
1889 O OE1 . GLU B 90  ? 0.5278 0.5138 0.5191 0.0102  0.0034  -0.0067 90  GLU B OE1 
1890 O OE2 . GLU B 90  ? 0.5287 0.5227 0.5318 0.0074  -0.0036 0.0021  90  GLU B OE2 
1891 N N   . ASN B 91  ? 0.4563 0.3920 0.4135 0.0057  0.0213  -0.0172 91  ASN B N   
1892 C CA  . ASN B 91  ? 0.4276 0.3768 0.3825 0.0113  0.0216  -0.0161 91  ASN B CA  
1893 C C   . ASN B 91  ? 0.3936 0.3443 0.3393 0.0052  0.0161  -0.0181 91  ASN B C   
1894 O O   . ASN B 91  ? 0.3732 0.3165 0.2878 0.0020  0.0301  -0.0240 91  ASN B O   
1895 C CB  . ASN B 91  ? 0.4310 0.3890 0.4104 0.0066  0.0241  -0.0132 91  ASN B CB  
1896 C CG  . ASN B 91  ? 0.4542 0.4418 0.4579 0.0093  0.0145  0.0002  91  ASN B CG  
1897 O OD1 . ASN B 91  ? 0.4515 0.4443 0.4459 0.0111  0.0000  -0.0117 91  ASN B OD1 
1898 N ND2 . ASN B 91  ? 0.4622 0.4323 0.4451 -0.0011 0.0045  -0.0201 91  ASN B ND2 
1899 N N   . LYS B 92  ? 0.3789 0.3168 0.2677 -0.0118 0.0172  -0.0300 92  LYS B N   
1900 C CA  . LYS B 92  ? 0.3575 0.3165 0.2594 -0.0031 0.0114  -0.0055 92  LYS B CA  
1901 C C   . LYS B 92  ? 0.3482 0.3054 0.2734 -0.0246 0.0095  -0.0067 92  LYS B C   
1902 O O   . LYS B 92  ? 0.3780 0.2954 0.2409 -0.0471 0.0137  -0.0342 92  LYS B O   
1903 C CB  . LYS B 92  ? 0.3612 0.3248 0.2683 -0.0039 -0.0041 -0.0078 92  LYS B CB  
1904 C CG  . LYS B 92  ? 0.3538 0.3542 0.2408 0.0044  -0.0144 0.0152  92  LYS B CG  
1905 C CD  . LYS B 92  ? 0.3737 0.3693 0.2867 0.0022  -0.0265 0.0235  92  LYS B CD  
1906 C CE  . LYS B 92  ? 0.3921 0.3923 0.3611 0.0026  -0.0009 0.0058  92  LYS B CE  
1907 N NZ  . LYS B 92  ? 0.3873 0.4000 0.3407 0.0023  -0.0252 0.0198  92  LYS B NZ  
1908 N N   . MET B 93  ? 0.3179 0.2477 0.2221 -0.0316 0.0038  -0.0165 93  MET B N   
1909 C CA  . MET B 93  ? 0.3092 0.2868 0.2485 -0.0245 -0.0003 -0.0151 93  MET B CA  
1910 C C   . MET B 93  ? 0.3027 0.2628 0.2125 -0.0353 0.0060  -0.0116 93  MET B C   
1911 O O   . MET B 93  ? 0.3106 0.2596 0.2208 -0.0224 0.0360  -0.0010 93  MET B O   
1912 C CB  . MET B 93  ? 0.3394 0.2921 0.2488 -0.0316 0.0007  -0.0207 93  MET B CB  
1913 C CG  . MET B 93  ? 0.3407 0.2923 0.2752 -0.0258 -0.0254 -0.0140 93  MET B CG  
1914 S SD  . MET B 93  ? 0.3722 0.3560 0.2542 -0.0298 -0.0149 -0.0139 93  MET B SD  
1915 C CE  . MET B 93  ? 0.3116 0.2704 0.2537 -0.0252 -0.0082 0.0051  93  MET B CE  
1916 N N   . VAL B 94  ? 0.2957 0.2830 0.2089 -0.0266 0.0121  -0.0161 94  VAL B N   
1917 C CA  . VAL B 94  ? 0.2916 0.2974 0.2160 -0.0268 0.0130  -0.0056 94  VAL B CA  
1918 C C   . VAL B 94  ? 0.2889 0.2900 0.2201 -0.0262 0.0204  0.0053  94  VAL B C   
1919 O O   . VAL B 94  ? 0.3069 0.2694 0.2494 -0.0484 0.0152  -0.0101 94  VAL B O   
1920 C CB  . VAL B 94  ? 0.3044 0.3329 0.2210 -0.0216 0.0130  0.0004  94  VAL B CB  
1921 C CG1 . VAL B 94  ? 0.3369 0.3632 0.2890 -0.0278 -0.0038 0.0071  94  VAL B CG1 
1922 C CG2 . VAL B 94  ? 0.3385 0.3484 0.2522 -0.0314 0.0225  -0.0049 94  VAL B CG2 
1923 N N   . CYS B 95  ? 0.2764 0.2787 0.2272 -0.0367 0.0158  -0.0039 95  CYS B N   
1924 C CA  . CYS B 95  ? 0.2727 0.3019 0.2498 -0.0296 0.0178  0.0162  95  CYS B CA  
1925 C C   . CYS B 95  ? 0.2950 0.3252 0.2799 -0.0093 0.0080  0.0101  95  CYS B C   
1926 O O   . CYS B 95  ? 0.2634 0.3124 0.2964 -0.0178 0.0307  0.0316  95  CYS B O   
1927 C CB  . CYS B 95  ? 0.2681 0.2991 0.2171 -0.0320 0.0236  0.0059  95  CYS B CB  
1928 S SG  . CYS B 95  ? 0.2838 0.2951 0.2170 -0.0609 0.0235  0.0144  95  CYS B SG  
1929 N N   . GLU B 96  ? 0.2830 0.3484 0.2806 -0.0309 0.0007  0.0121  96  GLU B N   
1930 C CA  . GLU B 96  ? 0.3247 0.3683 0.3040 -0.0056 -0.0076 -0.0016 96  GLU B CA  
1931 C C   . GLU B 96  ? 0.2754 0.3448 0.2784 -0.0052 -0.0027 0.0087  96  GLU B C   
1932 O O   . GLU B 96  ? 0.2805 0.3390 0.2781 0.0008  -0.0057 0.0083  96  GLU B O   
1933 C CB  . GLU B 96  ? 0.3502 0.3859 0.3351 -0.0237 -0.0183 0.0017  96  GLU B CB  
1934 C CG  . GLU B 96  ? 0.3875 0.4085 0.3875 -0.0100 -0.0111 0.0003  96  GLU B CG  
1935 C CD  . GLU B 96  ? 0.3752 0.4085 0.3795 -0.0244 -0.0119 0.0035  96  GLU B CD  
1936 O OE1 . GLU B 96  ? 0.4168 0.4392 0.4379 -0.0158 -0.0093 -0.0005 96  GLU B OE1 
1937 O OE2 . GLU B 96  ? 0.4288 0.4427 0.4350 -0.0146 -0.0125 0.0027  96  GLU B OE2 
1938 N N   . GLN B 97  ? 0.2487 0.3333 0.2532 -0.0091 -0.0056 0.0234  97  GLN B N   
1939 C CA  . GLN B 97  ? 0.2460 0.3341 0.2551 -0.0028 0.0031  0.0080  97  GLN B CA  
1940 C C   . GLN B 97  ? 0.2577 0.3671 0.2922 -0.0057 -0.0001 0.0181  97  GLN B C   
1941 O O   . GLN B 97  ? 0.2539 0.3611 0.2432 0.0098  0.0194  0.0706  97  GLN B O   
1942 C CB  . GLN B 97  ? 0.2618 0.3431 0.2611 0.0064  -0.0062 0.0234  97  GLN B CB  
1943 C CG  . GLN B 97  ? 0.2687 0.3521 0.2676 0.0143  0.0132  0.0092  97  GLN B CG  
1944 C CD  . GLN B 97  ? 0.2414 0.3534 0.2741 0.0194  -0.0080 0.0168  97  GLN B CD  
1945 O OE1 . GLN B 97  ? 0.2808 0.3793 0.3260 -0.0038 0.0052  0.0298  97  GLN B OE1 
1946 N NE2 . GLN B 97  ? 0.2878 0.3900 0.2893 0.0126  0.0073  -0.0118 97  GLN B NE2 
1947 N N   . LYS B 98  ? 0.2404 0.3374 0.2271 0.0032  0.0050  0.0324  98  LYS B N   
1948 C CA  . LYS B 98  ? 0.2515 0.3428 0.2804 0.0028  -0.0129 0.0355  98  LYS B CA  
1949 C C   . LYS B 98  ? 0.2258 0.3228 0.2678 -0.0099 -0.0048 0.0383  98  LYS B C   
1950 O O   . LYS B 98  ? 0.2487 0.3530 0.2745 0.0104  -0.0011 0.0536  98  LYS B O   
1951 C CB  . LYS B 98  ? 0.2790 0.3353 0.2793 -0.0066 -0.0104 0.0223  98  LYS B CB  
1952 C CG  . LYS B 98  ? 0.3113 0.3414 0.3140 -0.0043 -0.0026 0.0084  98  LYS B CG  
1953 C CD  . LYS B 98  ? 0.3281 0.3412 0.3259 -0.0048 0.0010  0.0036  98  LYS B CD  
1954 C CE  . LYS B 98  ? 0.3111 0.3294 0.3265 0.0081  -0.0094 0.0114  98  LYS B CE  
1955 N NZ  . LYS B 98  ? 0.3408 0.3494 0.3201 -0.0144 0.0072  -0.0031 98  LYS B NZ  
1956 N N   . LEU B 99  ? 0.2441 0.3596 0.3116 0.0093  0.0033  0.0157  99  LEU B N   
1957 C CA  . LEU B 99  ? 0.3053 0.3796 0.3421 0.0122  -0.0112 0.0142  99  LEU B CA  
1958 C C   . LEU B 99  ? 0.3107 0.4036 0.3469 -0.0039 0.0025  0.0062  99  LEU B C   
1959 O O   . LEU B 99  ? 0.3020 0.4588 0.3432 0.0073  -0.0026 0.0153  99  LEU B O   
1960 C CB  . LEU B 99  ? 0.3053 0.3821 0.3802 0.0202  -0.0223 0.0110  99  LEU B CB  
1961 C CG  . LEU B 99  ? 0.3573 0.3941 0.3935 0.0114  -0.0172 0.0263  99  LEU B CG  
1962 C CD1 . LEU B 99  ? 0.3678 0.4075 0.4245 0.0274  -0.0221 0.0267  99  LEU B CD1 
1963 C CD2 . LEU B 99  ? 0.3366 0.3816 0.4044 0.0067  -0.0227 0.0156  99  LEU B CD2 
1964 N N   . LEU B 100 ? 0.3282 0.4231 0.3597 0.0221  -0.0048 0.0153  100 LEU B N   
1965 C CA  . LEU B 100 ? 0.3536 0.4124 0.3659 0.0076  0.0008  0.0120  100 LEU B CA  
1966 C C   . LEU B 100 ? 0.3659 0.4119 0.3748 0.0109  -0.0064 0.0159  100 LEU B C   
1967 O O   . LEU B 100 ? 0.3731 0.4330 0.3859 0.0179  -0.0053 0.0176  100 LEU B O   
1968 C CB  . LEU B 100 ? 0.3615 0.3987 0.3631 0.0025  -0.0078 0.0166  100 LEU B CB  
1969 C CG  . LEU B 100 ? 0.4017 0.4247 0.4149 0.0000  -0.0030 0.0069  100 LEU B CG  
1970 C CD1 . LEU B 100 ? 0.3933 0.4222 0.4057 0.0044  -0.0170 0.0142  100 LEU B CD1 
1971 C CD2 . LEU B 100 ? 0.3978 0.4217 0.4137 -0.0050 -0.0139 0.0066  100 LEU B CD2 
1972 N N   . LYS B 101 ? 0.3694 0.4087 0.3698 0.0171  0.0098  0.0091  101 LYS B N   
1973 C CA  . LYS B 101 ? 0.3806 0.4119 0.4074 0.0208  0.0038  0.0085  101 LYS B CA  
1974 C C   . LYS B 101 ? 0.3672 0.4188 0.3893 0.0130  0.0074  0.0129  101 LYS B C   
1975 O O   . LYS B 101 ? 0.3609 0.4192 0.4036 0.0245  -0.0102 0.0089  101 LYS B O   
1976 C CB  . LYS B 101 ? 0.3968 0.4142 0.3946 0.0158  0.0065  0.0056  101 LYS B CB  
1977 C CG  . LYS B 101 ? 0.4037 0.4216 0.4213 0.0089  0.0049  0.0043  101 LYS B CG  
1978 C CD  . LYS B 101 ? 0.4136 0.4122 0.4069 0.0038  0.0054  0.0024  101 LYS B CD  
1979 C CE  . LYS B 101 ? 0.4748 0.4374 0.4148 0.0316  -0.0045 -0.0050 101 LYS B CE  
1980 N NZ  . LYS B 101 ? 0.3696 0.3948 0.4168 -0.0194 0.0131  0.0058  101 LYS B NZ  
1981 N N   . GLY B 102 ? 0.3794 0.4304 0.3962 0.0176  0.0014  0.0100  102 GLY B N   
1982 C CA  . GLY B 102 ? 0.3559 0.4147 0.3814 0.0254  0.0029  0.0039  102 GLY B CA  
1983 C C   . GLY B 102 ? 0.3366 0.4036 0.3758 0.0202  0.0020  0.0069  102 GLY B C   
1984 O O   . GLY B 102 ? 0.3386 0.4261 0.3675 0.0131  0.0021  0.0053  102 GLY B O   
1985 N N   . GLU B 103 ? 0.3398 0.4036 0.3723 0.0275  0.0085  0.0102  103 GLU B N   
1986 C CA  . GLU B 103 ? 0.3342 0.3864 0.3634 0.0214  -0.0036 0.0120  103 GLU B CA  
1987 C C   . GLU B 103 ? 0.3381 0.3745 0.3581 0.0202  -0.0025 0.0148  103 GLU B C   
1988 O O   . GLU B 103 ? 0.3485 0.3630 0.3479 0.0229  0.0033  0.0257  103 GLU B O   
1989 C CB  . GLU B 103 ? 0.3354 0.3762 0.3623 0.0126  -0.0057 0.0162  103 GLU B CB  
1990 C CG  . GLU B 103 ? 0.3302 0.3702 0.3582 0.0092  -0.0014 0.0085  103 GLU B CG  
1991 C CD  . GLU B 103 ? 0.3216 0.3500 0.3349 0.0016  0.0002  0.0101  103 GLU B CD  
1992 O OE1 . GLU B 103 ? 0.3205 0.3357 0.3498 -0.0049 -0.0053 0.0111  103 GLU B OE1 
1993 O OE2 . GLU B 103 ? 0.3270 0.3711 0.3490 0.0107  -0.0020 0.0002  103 GLU B OE2 
1994 N N   . GLY B 104 ? 0.3461 0.3923 0.3581 0.0146  -0.0047 0.0230  104 GLY B N   
1995 C CA  . GLY B 104 ? 0.3162 0.3685 0.3635 0.0140  0.0052  0.0277  104 GLY B CA  
1996 C C   . GLY B 104 ? 0.3392 0.3866 0.3763 -0.0005 0.0052  0.0237  104 GLY B C   
1997 O O   . GLY B 104 ? 0.3377 0.3944 0.3713 0.0061  0.0046  0.0261  104 GLY B O   
1998 N N   . PRO B 105 ? 0.3524 0.4088 0.3954 -0.0057 0.0135  0.0166  105 PRO B N   
1999 C CA  . PRO B 105 ? 0.3322 0.4023 0.3836 -0.0101 0.0179  0.0130  105 PRO B CA  
2000 C C   . PRO B 105 ? 0.2967 0.4004 0.3561 -0.0096 0.0166  0.0214  105 PRO B C   
2001 O O   . PRO B 105 ? 0.2873 0.4376 0.3896 -0.0159 0.0316  0.0307  105 PRO B O   
2002 C CB  . PRO B 105 ? 0.3539 0.4266 0.4020 -0.0167 0.0173  0.0108  105 PRO B CB  
2003 C CG  . PRO B 105 ? 0.3638 0.4284 0.4017 -0.0154 0.0067  -0.0011 105 PRO B CG  
2004 C CD  . PRO B 105 ? 0.3586 0.4150 0.4003 -0.0099 0.0084  0.0014  105 PRO B CD  
2005 N N   . LYS B 106 ? 0.2670 0.3921 0.3669 -0.0050 0.0222  0.0181  106 LYS B N   
2006 C CA  . LYS B 106 ? 0.2791 0.3796 0.3387 -0.0064 0.0141  0.0244  106 LYS B CA  
2007 C C   . LYS B 106 ? 0.2539 0.3752 0.3228 0.0046  0.0207  0.0313  106 LYS B C   
2008 O O   . LYS B 106 ? 0.2573 0.3904 0.3411 0.0107  -0.0124 0.0655  106 LYS B O   
2009 C CB  . LYS B 106 ? 0.2974 0.3778 0.3420 -0.0016 0.0243  0.0113  106 LYS B CB  
2010 C CG  . LYS B 106 ? 0.3237 0.3890 0.3474 -0.0003 0.0016  0.0040  106 LYS B CG  
2011 C CD  . LYS B 106 ? 0.3535 0.3892 0.3622 0.0020  0.0053  -0.0011 106 LYS B CD  
2012 C CE  . LYS B 106 ? 0.3663 0.3802 0.3634 0.0028  0.0079  0.0078  106 LYS B CE  
2013 N NZ  . LYS B 106 ? 0.3821 0.3897 0.3977 0.0015  -0.0034 0.0022  106 LYS B NZ  
2014 N N   . THR B 107 ? 0.2206 0.3530 0.3032 0.0018  0.0146  0.0502  107 THR B N   
2015 C CA  . THR B 107 ? 0.2083 0.3112 0.2733 -0.0062 0.0308  0.0420  107 THR B CA  
2016 C C   . THR B 107 ? 0.2639 0.3298 0.2860 0.0021  -0.0047 0.0317  107 THR B C   
2017 O O   . THR B 107 ? 0.2076 0.3100 0.2302 -0.0051 -0.0101 0.0591  107 THR B O   
2018 C CB  . THR B 107 ? 0.2658 0.3177 0.3089 -0.0078 0.0308  0.0259  107 THR B CB  
2019 O OG1 . THR B 107 ? 0.2801 0.3410 0.2853 -0.0241 0.0390  0.0686  107 THR B OG1 
2020 C CG2 . THR B 107 ? 0.2720 0.2953 0.3207 -0.0111 0.0281  0.0350  107 THR B CG2 
2021 N N   . SER B 108 ? 0.2086 0.2978 0.2378 -0.0096 0.0197  0.0340  108 SER B N   
2022 C CA  . SER B 108 ? 0.2349 0.2927 0.2299 -0.0061 0.0097  0.0219  108 SER B CA  
2023 C C   . SER B 108 ? 0.2308 0.2708 0.2209 0.0027  0.0016  0.0320  108 SER B C   
2024 O O   . SER B 108 ? 0.2202 0.2786 0.2173 -0.0027 0.0070  0.0340  108 SER B O   
2025 C CB  . SER B 108 ? 0.2737 0.3314 0.2361 -0.0028 0.0064  0.0235  108 SER B CB  
2026 O OG  . SER B 108 ? 0.3193 0.3069 0.2136 -0.0103 -0.0118 0.0366  108 SER B OG  
2027 N N   . TRP B 109 ? 0.2227 0.2396 0.2126 0.0037  0.0238  0.0302  109 TRP B N   
2028 C CA  . TRP B 109 ? 0.2245 0.2522 0.2055 0.0127  0.0102  0.0139  109 TRP B CA  
2029 C C   . TRP B 109 ? 0.2541 0.2586 0.2423 0.0025  0.0035  0.0145  109 TRP B C   
2030 O O   . TRP B 109 ? 0.2435 0.2707 0.2338 -0.0224 0.0219  0.0273  109 TRP B O   
2031 C CB  . TRP B 109 ? 0.2429 0.2534 0.2275 -0.0036 0.0175  0.0294  109 TRP B CB  
2032 C CG  . TRP B 109 ? 0.2443 0.2403 0.2183 0.0008  0.0187  0.0320  109 TRP B CG  
2033 C CD1 . TRP B 109 ? 0.2529 0.2398 0.2168 -0.0023 0.0173  0.0202  109 TRP B CD1 
2034 C CD2 . TRP B 109 ? 0.2191 0.2388 0.2070 0.0015  0.0225  0.0224  109 TRP B CD2 
2035 N NE1 . TRP B 109 ? 0.2473 0.2342 0.2074 -0.0013 0.0100  0.0305  109 TRP B NE1 
2036 C CE2 . TRP B 109 ? 0.2231 0.2420 0.1947 -0.0062 0.0165  0.0245  109 TRP B CE2 
2037 C CE3 . TRP B 109 ? 0.2214 0.2421 0.2068 -0.0034 0.0071  0.0157  109 TRP B CE3 
2038 C CZ2 . TRP B 109 ? 0.2351 0.2500 0.2260 0.0006  0.0249  0.0127  109 TRP B CZ2 
2039 C CZ3 . TRP B 109 ? 0.2460 0.2357 0.2150 -0.0092 0.0232  0.0242  109 TRP B CZ3 
2040 C CH2 . TRP B 109 ? 0.2557 0.2498 0.2118 0.0052  0.0241  0.0241  109 TRP B CH2 
2041 N N   . THR B 110 ? 0.2411 0.2396 0.1900 0.0018  0.0248  0.0248  110 THR B N   
2042 C CA  A THR B 110 ? 0.2618 0.2508 0.2252 -0.0037 0.0002  0.0157  110 THR B CA  
2043 C CA  B THR B 110 ? 0.2620 0.2542 0.2315 -0.0022 0.0010  0.0115  110 THR B CA  
2044 C C   . THR B 110 ? 0.2403 0.2302 0.2046 -0.0066 -0.0034 0.0035  110 THR B C   
2045 O O   . THR B 110 ? 0.2364 0.2254 0.2180 -0.0009 0.0301  0.0357  110 THR B O   
2046 C CB  A THR B 110 ? 0.2358 0.2493 0.2007 -0.0077 0.0043  0.0132  110 THR B CB  
2047 C CB  B THR B 110 ? 0.2372 0.2561 0.2079 0.0013  0.0053  -0.0026 110 THR B CB  
2048 O OG1 A THR B 110 ? 0.2862 0.2589 0.2288 -0.0108 -0.0114 0.0220  110 THR B OG1 
2049 O OG1 B THR B 110 ? 0.2826 0.2831 0.2543 -0.0036 -0.0074 -0.0063 110 THR B OG1 
2050 C CG2 A THR B 110 ? 0.2771 0.2723 0.2441 -0.0184 -0.0057 0.0064  110 THR B CG2 
2051 C CG2 B THR B 110 ? 0.2788 0.2772 0.2526 -0.0045 -0.0135 0.0030  110 THR B CG2 
2052 N N   . LEU B 111 ? 0.2586 0.2197 0.1988 -0.0054 0.0033  -0.0018 111 LEU B N   
2053 C CA  . LEU B 111 ? 0.2605 0.2425 0.1934 0.0113  0.0053  0.0001  111 LEU B CA  
2054 C C   . LEU B 111 ? 0.2729 0.2349 0.2170 -0.0012 0.0032  -0.0113 111 LEU B C   
2055 O O   . LEU B 111 ? 0.2812 0.2564 0.2287 0.0032  0.0239  -0.0195 111 LEU B O   
2056 C CB  . LEU B 111 ? 0.2860 0.2225 0.2138 0.0041  -0.0184 0.0144  111 LEU B CB  
2057 C CG  . LEU B 111 ? 0.2863 0.2380 0.2157 -0.0108 -0.0058 0.0236  111 LEU B CG  
2058 C CD1 . LEU B 111 ? 0.3125 0.2685 0.2376 -0.0096 -0.0219 0.0238  111 LEU B CD1 
2059 C CD2 . LEU B 111 ? 0.2922 0.2118 0.2476 -0.0167 -0.0092 0.0086  111 LEU B CD2 
2060 N N   . GLU B 112 ? 0.2948 0.2532 0.2021 0.0140  0.0284  -0.0133 112 GLU B N   
2061 C CA  . GLU B 112 ? 0.3148 0.2487 0.2138 0.0202  0.0199  -0.0311 112 GLU B CA  
2062 C C   . GLU B 112 ? 0.3484 0.2980 0.2678 0.0083  0.0165  -0.0169 112 GLU B C   
2063 O O   . GLU B 112 ? 0.3487 0.2721 0.2853 0.0078  0.0427  -0.0416 112 GLU B O   
2064 C CB  . GLU B 112 ? 0.3530 0.3070 0.2568 0.0193  0.0085  -0.0290 112 GLU B CB  
2065 C CG  . GLU B 112 ? 0.3859 0.3321 0.2784 0.0186  0.0137  -0.0342 112 GLU B CG  
2066 C CD  . GLU B 112 ? 0.4190 0.3481 0.2896 0.0302  0.0066  -0.0449 112 GLU B CD  
2067 O OE1 . GLU B 112 ? 0.4519 0.4128 0.3407 0.0202  -0.0081 -0.0154 112 GLU B OE1 
2068 O OE2 . GLU B 112 ? 0.4547 0.4188 0.3406 0.0056  0.0092  -0.0316 112 GLU B OE2 
2069 N N   . LEU B 113 ? 0.3286 0.2711 0.2765 0.0403  0.0189  -0.0164 113 LEU B N   
2070 C CA  . LEU B 113 ? 0.3597 0.3174 0.3083 0.0051  0.0104  0.0046  113 LEU B CA  
2071 C C   . LEU B 113 ? 0.3712 0.3585 0.3185 0.0124  0.0275  -0.0172 113 LEU B C   
2072 O O   . LEU B 113 ? 0.4102 0.3786 0.3464 -0.0093 0.0259  -0.0160 113 LEU B O   
2073 C CB  . LEU B 113 ? 0.3674 0.3265 0.3365 0.0147  0.0071  0.0058  113 LEU B CB  
2074 C CG  . LEU B 113 ? 0.3779 0.3243 0.3282 0.0088  -0.0004 0.0085  113 LEU B CG  
2075 C CD1 . LEU B 113 ? 0.3995 0.3225 0.3476 0.0189  0.0088  0.0097  113 LEU B CD1 
2076 C CD2 . LEU B 113 ? 0.3889 0.3316 0.3490 0.0149  -0.0123 0.0101  113 LEU B CD2 
2077 N N   . THR B 114 ? 0.4049 0.3656 0.3359 0.0170  0.0237  -0.0129 114 THR B N   
2078 C CA  . THR B 114 ? 0.4262 0.4111 0.3457 0.0185  0.0199  -0.0212 114 THR B CA  
2079 C C   . THR B 114 ? 0.4445 0.4217 0.3910 0.0181  0.0120  -0.0190 114 THR B C   
2080 O O   . THR B 114 ? 0.4579 0.4162 0.3826 0.0303  0.0106  -0.0278 114 THR B O   
2081 C CB  . THR B 114 ? 0.4155 0.4024 0.3308 0.0196  0.0205  -0.0261 114 THR B CB  
2082 O OG1 . THR B 114 ? 0.4164 0.4193 0.3232 0.0337  0.0425  -0.0294 114 THR B OG1 
2083 C CG2 . THR B 114 ? 0.3964 0.3953 0.3621 0.0286  0.0149  -0.0122 114 THR B CG2 
2084 N N   . ASN B 115 ? 0.4684 0.4584 0.4138 0.0041  0.0031  -0.0144 115 ASN B N   
2085 C CA  . ASN B 115 ? 0.4607 0.4547 0.4404 0.0078  0.0061  -0.0101 115 ASN B CA  
2086 C C   . ASN B 115 ? 0.4786 0.4739 0.4559 0.0068  0.0064  -0.0054 115 ASN B C   
2087 O O   . ASN B 115 ? 0.4717 0.4846 0.4823 0.0127  0.0034  -0.0062 115 ASN B O   
2088 C CB  . ASN B 115 ? 0.4757 0.4663 0.4526 0.0047  0.0021  -0.0090 115 ASN B CB  
2089 C CG  . ASN B 115 ? 0.4819 0.4728 0.4667 -0.0003 -0.0002 -0.0049 115 ASN B CG  
2090 O OD1 . ASN B 115 ? 0.4749 0.4728 0.4650 -0.0024 -0.0023 -0.0027 115 ASN B OD1 
2091 N ND2 . ASN B 115 ? 0.4771 0.4724 0.4695 -0.0025 -0.0011 -0.0023 115 ASN B ND2 
2092 N N   . ASP B 116 ? 0.4659 0.4550 0.4448 0.0046  0.0116  -0.0077 116 ASP B N   
2093 C CA  . ASP B 116 ? 0.4554 0.4578 0.4441 0.0073  0.0085  -0.0016 116 ASP B CA  
2094 C C   . ASP B 116 ? 0.4445 0.4562 0.4423 0.0064  0.0159  -0.0046 116 ASP B C   
2095 O O   . ASP B 116 ? 0.4477 0.4656 0.4368 -0.0004 0.0223  -0.0091 116 ASP B O   
2096 C CB  . ASP B 116 ? 0.4581 0.4541 0.4545 0.0028  0.0049  -0.0019 116 ASP B CB  
2097 C CG  . ASP B 116 ? 0.4547 0.4560 0.4531 0.0002  0.0033  0.0003  116 ASP B CG  
2098 O OD1 . ASP B 116 ? 0.4521 0.4540 0.4506 0.0001  0.0021  -0.0015 116 ASP B OD1 
2099 O OD2 . ASP B 116 ? 0.4526 0.4550 0.4529 0.0000  0.0014  0.0007  116 ASP B OD2 
2100 N N   . GLY B 117 ? 0.4456 0.4549 0.4462 0.0213  0.0132  -0.0069 117 GLY B N   
2101 C CA  . GLY B 117 ? 0.3980 0.4367 0.4063 0.0331  0.0295  -0.0191 117 GLY B CA  
2102 C C   . GLY B 117 ? 0.3870 0.4050 0.3728 0.0300  0.0323  -0.0230 117 GLY B C   
2103 O O   . GLY B 117 ? 0.3789 0.4329 0.3732 0.0502  0.0421  -0.0209 117 GLY B O   
2104 N N   . GLU B 118 ? 0.3570 0.3734 0.3054 0.0263  0.0512  -0.0192 118 GLU B N   
2105 C CA  . GLU B 118 ? 0.3329 0.3439 0.3113 0.0184  0.0459  -0.0020 118 GLU B CA  
2106 C C   . GLU B 118 ? 0.3189 0.3135 0.2702 0.0136  0.0315  -0.0109 118 GLU B C   
2107 O O   . GLU B 118 ? 0.3354 0.3168 0.2591 0.0140  0.0550  0.0106  118 GLU B O   
2108 C CB  . GLU B 118 ? 0.3415 0.3620 0.3248 0.0119  0.0369  0.0042  118 GLU B CB  
2109 C CG  . GLU B 118 ? 0.3702 0.3701 0.3456 0.0043  0.0331  0.0113  118 GLU B CG  
2110 C CD  . GLU B 118 ? 0.3823 0.3890 0.3415 0.0029  0.0201  0.0104  118 GLU B CD  
2111 O OE1 . GLU B 118 ? 0.3964 0.4000 0.3436 -0.0110 0.0201  0.0094  118 GLU B OE1 
2112 O OE2 . GLU B 118 ? 0.4010 0.4062 0.3430 -0.0055 0.0315  0.0179  118 GLU B OE2 
2113 N N   . LEU B 119 ? 0.2782 0.2821 0.2336 0.0121  0.0418  0.0050  119 LEU B N   
2114 C CA  . LEU B 119 ? 0.2474 0.2635 0.2473 0.0263  0.0264  0.0027  119 LEU B CA  
2115 C C   . LEU B 119 ? 0.2473 0.2618 0.2218 0.0228  0.0245  -0.0016 119 LEU B C   
2116 O O   . LEU B 119 ? 0.2439 0.2439 0.2120 0.0285  0.0280  0.0118  119 LEU B O   
2117 C CB  . LEU B 119 ? 0.2500 0.2606 0.2427 0.0100  0.0345  0.0208  119 LEU B CB  
2118 C CG  . LEU B 119 ? 0.2392 0.2535 0.2222 -0.0022 0.0351  0.0140  119 LEU B CG  
2119 C CD1 . LEU B 119 ? 0.2724 0.2793 0.2630 -0.0039 0.0223  0.0037  119 LEU B CD1 
2120 C CD2 . LEU B 119 ? 0.2244 0.2752 0.2276 0.0026  -0.0092 0.0156  119 LEU B CD2 
2121 N N   . ILE B 120 ? 0.2416 0.2487 0.2118 0.0196  0.0359  0.0008  120 ILE B N   
2122 C CA  . ILE B 120 ? 0.2405 0.2557 0.2243 0.0264  0.0278  -0.0052 120 ILE B CA  
2123 C C   . ILE B 120 ? 0.2492 0.2333 0.2220 0.0014  0.0415  0.0096  120 ILE B C   
2124 O O   . ILE B 120 ? 0.2728 0.2105 0.2254 0.0123  0.0328  -0.0092 120 ILE B O   
2125 C CB  . ILE B 120 ? 0.2779 0.2751 0.2351 0.0271  0.0195  0.0079  120 ILE B CB  
2126 C CG1 . ILE B 120 ? 0.3034 0.3218 0.2214 0.0288  0.0066  -0.0061 120 ILE B CG1 
2127 C CG2 . ILE B 120 ? 0.2906 0.3024 0.2521 0.0286  0.0100  0.0158  120 ILE B CG2 
2128 C CD1 . ILE B 120 ? 0.3347 0.3665 0.2683 0.0163  -0.0084 0.0018  120 ILE B CD1 
2129 N N   . ASP B 121 ? 0.2406 0.2322 0.2163 0.0115  0.0276  0.0053  121 ASP B N   
2130 C CA  . ASP B 121 ? 0.2145 0.2298 0.2272 0.0138  0.0046  0.0067  121 ASP B CA  
2131 C C   . ASP B 121 ? 0.2358 0.2330 0.2531 0.0103  -0.0012 0.0144  121 ASP B C   
2132 O O   . ASP B 121 ? 0.2334 0.2562 0.2774 -0.0010 0.0092  0.0366  121 ASP B O   
2133 C CB  . ASP B 121 ? 0.2805 0.2678 0.2448 0.0069  0.0187  -0.0122 121 ASP B CB  
2134 C CG  . ASP B 121 ? 0.2944 0.3055 0.2697 -0.0109 0.0061  -0.0454 121 ASP B CG  
2135 O OD1 . ASP B 121 ? 0.3368 0.3358 0.2939 0.0007  0.0168  -0.0225 121 ASP B OD1 
2136 O OD2 . ASP B 121 ? 0.3359 0.3789 0.3247 -0.0180 0.0052  -0.0392 121 ASP B OD2 
2137 N N   . THR B 122 ? 0.2307 0.2300 0.2263 0.0201  0.0201  0.0348  122 THR B N   
2138 C CA  . THR B 122 ? 0.2348 0.2536 0.2487 0.0157  0.0205  0.0235  122 THR B CA  
2139 C C   . THR B 122 ? 0.2497 0.2582 0.2826 0.0093  0.0359  0.0268  122 THR B C   
2140 O O   . THR B 122 ? 0.2726 0.2622 0.3313 0.0255  0.0881  0.0549  122 THR B O   
2141 C CB  . THR B 122 ? 0.2720 0.2854 0.2870 0.0286  0.0004  0.0134  122 THR B CB  
2142 O OG1 . THR B 122 ? 0.3058 0.3048 0.2709 -0.0002 0.0132  0.0143  122 THR B OG1 
2143 C CG2 . THR B 122 ? 0.2994 0.3074 0.3238 0.0288  -0.0034 0.0216  122 THR B CG2 
2144 N N   . MET B 123 ? 0.1896 0.2355 0.2303 0.0235  0.0257  0.0412  123 MET B N   
2145 C CA  . MET B 123 ? 0.2212 0.2665 0.2792 0.0235  0.0024  0.0291  123 MET B CA  
2146 C C   . MET B 123 ? 0.1971 0.2547 0.2542 0.0168  0.0191  0.0449  123 MET B C   
2147 O O   . MET B 123 ? 0.2105 0.2784 0.2882 0.0406  0.0220  0.0398  123 MET B O   
2148 C CB  . MET B 123 ? 0.2585 0.3012 0.2852 0.0203  0.0039  0.0135  123 MET B CB  
2149 C CG  . MET B 123 ? 0.3127 0.3377 0.3257 0.0045  -0.0344 0.0170  123 MET B CG  
2150 S SD  . MET B 123 ? 0.3647 0.3926 0.3650 -0.0024 -0.0484 0.0131  123 MET B SD  
2151 C CE  . MET B 123 ? 0.3273 0.3718 0.3008 0.0153  -0.0316 0.0209  123 MET B CE  
2152 N N   . THR B 124 ? 0.2036 0.2713 0.2616 0.0203  0.0031  0.0381  124 THR B N   
2153 C CA  A THR B 124 ? 0.2254 0.2945 0.2647 0.0117  0.0121  0.0288  124 THR B CA  
2154 C CA  B THR B 124 ? 0.2319 0.2989 0.2767 0.0138  0.0110  0.0255  124 THR B CA  
2155 C C   . THR B 124 ? 0.2185 0.3158 0.2866 0.0226  0.0051  0.0224  124 THR B C   
2156 O O   . THR B 124 ? 0.1941 0.3467 0.2907 0.0288  0.0222  0.0639  124 THR B O   
2157 C CB  A THR B 124 ? 0.2468 0.2843 0.2660 -0.0014 -0.0047 0.0301  124 THR B CB  
2158 C CB  B THR B 124 ? 0.2603 0.2916 0.2898 0.0020  -0.0060 0.0215  124 THR B CB  
2159 O OG1 A THR B 124 ? 0.2545 0.3003 0.2612 -0.0183 -0.0032 0.0268  124 THR B OG1 
2160 O OG1 B THR B 124 ? 0.3084 0.3003 0.3008 -0.0010 -0.0029 0.0161  124 THR B OG1 
2161 C CG2 A THR B 124 ? 0.2807 0.2855 0.2728 -0.0041 0.0055  0.0231  124 THR B CG2 
2162 C CG2 B THR B 124 ? 0.2939 0.3111 0.3211 -0.0020 -0.0100 0.0078  124 THR B CG2 
2163 N N   . ALA B 125 ? 0.2167 0.3117 0.2830 0.0233  0.0084  0.0327  125 ALA B N   
2164 C CA  . ALA B 125 ? 0.2164 0.3297 0.2906 0.0222  0.0209  0.0353  125 ALA B CA  
2165 C C   . ALA B 125 ? 0.2845 0.3624 0.3444 0.0203  -0.0009 0.0374  125 ALA B C   
2166 O O   . ALA B 125 ? 0.2357 0.3378 0.3132 0.0017  0.0315  0.0689  125 ALA B O   
2167 C CB  . ALA B 125 ? 0.2638 0.3530 0.3031 0.0190  0.0224  0.0305  125 ALA B CB  
2168 N N   . ASP B 126 ? 0.2682 0.3663 0.3259 -0.0055 0.0032  0.0457  126 ASP B N   
2169 C CA  . ASP B 126 ? 0.3056 0.3815 0.3469 0.0033  0.0010  0.0363  126 ASP B CA  
2170 C C   . ASP B 126 ? 0.2926 0.3784 0.3623 0.0070  -0.0052 0.0305  126 ASP B C   
2171 O O   . ASP B 126 ? 0.3002 0.3919 0.3528 -0.0029 0.0004  0.0317  126 ASP B O   
2172 C CB  . ASP B 126 ? 0.3215 0.3974 0.3728 0.0088  0.0210  0.0311  126 ASP B CB  
2173 C CG  . ASP B 126 ? 0.3274 0.3992 0.3975 0.0041  0.0228  0.0182  126 ASP B CG  
2174 O OD1 . ASP B 126 ? 0.3059 0.4130 0.3872 0.0141  0.0091  0.0180  126 ASP B OD1 
2175 O OD2 . ASP B 126 ? 0.3392 0.4137 0.4145 0.0040  0.0364  0.0140  126 ASP B OD2 
2176 N N   . ASP B 127 ? 0.2781 0.3837 0.3559 0.0065  -0.0045 0.0378  127 ASP B N   
2177 C CA  . ASP B 127 ? 0.2903 0.3843 0.3597 0.0064  -0.0128 0.0308  127 ASP B CA  
2178 C C   . ASP B 127 ? 0.2713 0.3686 0.3268 0.0027  0.0033  0.0256  127 ASP B C   
2179 O O   . ASP B 127 ? 0.2925 0.4110 0.3334 0.0122  -0.0102 0.0314  127 ASP B O   
2180 C CB  . ASP B 127 ? 0.3308 0.3972 0.3681 -0.0005 -0.0125 0.0319  127 ASP B CB  
2181 C CG  . ASP B 127 ? 0.3550 0.4113 0.4035 -0.0033 -0.0099 0.0161  127 ASP B CG  
2182 O OD1 . ASP B 127 ? 0.3587 0.4197 0.4142 -0.0114 -0.0097 0.0064  127 ASP B OD1 
2183 O OD2 . ASP B 127 ? 0.3743 0.4199 0.4133 0.0032  -0.0054 0.0090  127 ASP B OD2 
2184 N N   . VAL B 128 ? 0.2639 0.3334 0.3310 0.0050  -0.0020 0.0331  128 VAL B N   
2185 C CA  . VAL B 128 ? 0.2486 0.3068 0.2920 0.0149  0.0032  0.0282  128 VAL B CA  
2186 C C   . VAL B 128 ? 0.2414 0.2981 0.2611 0.0122  0.0067  0.0570  128 VAL B C   
2187 O O   . VAL B 128 ? 0.2462 0.3101 0.3042 0.0176  0.0141  0.0657  128 VAL B O   
2188 C CB  . VAL B 128 ? 0.2724 0.2988 0.3024 0.0180  0.0009  0.0314  128 VAL B CB  
2189 C CG1 . VAL B 128 ? 0.2724 0.3031 0.2834 0.0079  0.0033  0.0164  128 VAL B CG1 
2190 C CG2 . VAL B 128 ? 0.3090 0.3101 0.3416 0.0257  -0.0032 0.0153  128 VAL B CG2 
2191 N N   . VAL B 129 ? 0.2485 0.2953 0.2645 0.0181  -0.0136 0.0305  129 VAL B N   
2192 C CA  . VAL B 129 ? 0.2147 0.2626 0.2624 -0.0004 0.0097  0.0246  129 VAL B CA  
2193 C C   . VAL B 129 ? 0.2446 0.2816 0.2811 0.0033  0.0044  0.0137  129 VAL B C   
2194 O O   . VAL B 129 ? 0.2407 0.2529 0.2158 0.0177  0.0057  0.0746  129 VAL B O   
2195 C CB  . VAL B 129 ? 0.2523 0.2980 0.2929 -0.0119 -0.0048 0.0090  129 VAL B CB  
2196 C CG1 . VAL B 129 ? 0.2507 0.3079 0.3151 -0.0075 -0.0057 0.0097  129 VAL B CG1 
2197 C CG2 . VAL B 129 ? 0.2687 0.3135 0.3065 -0.0052 -0.0083 0.0081  129 VAL B CG2 
2198 N N   . CYS B 130 ? 0.1859 0.2513 0.2237 0.0124  0.0026  0.0487  130 CYS B N   
2199 C CA  . CYS B 130 ? 0.2102 0.2471 0.2257 0.0083  0.0109  0.0085  130 CYS B CA  
2200 C C   . CYS B 130 ? 0.1797 0.2189 0.1931 0.0105  0.0211  0.0412  130 CYS B C   
2201 O O   . CYS B 130 ? 0.2279 0.2511 0.2243 0.0202  0.0190  0.0185  130 CYS B O   
2202 C CB  . CYS B 130 ? 0.2096 0.2677 0.2032 0.0041  0.0111  0.0261  130 CYS B CB  
2203 S SG  . CYS B 130 ? 0.2346 0.2701 0.2154 0.0133  0.0296  0.0438  130 CYS B SG  
2204 N N   . THR B 131 ? 0.2077 0.2404 0.2307 0.0098  0.0189  0.0149  131 THR B N   
2205 C CA  . THR B 131 ? 0.1873 0.2415 0.1892 0.0131  0.0299  0.0255  131 THR B CA  
2206 C C   . THR B 131 ? 0.2196 0.2438 0.2421 0.0111  0.0225  0.0168  131 THR B C   
2207 O O   . THR B 131 ? 0.2161 0.2596 0.2692 0.0243  0.0092  0.0575  131 THR B O   
2208 C CB  . THR B 131 ? 0.2212 0.2624 0.2098 0.0116  0.0116  0.0089  131 THR B CB  
2209 O OG1 . THR B 131 ? 0.2549 0.3068 0.2302 0.0006  0.0008  0.0357  131 THR B OG1 
2210 C CG2 . THR B 131 ? 0.2510 0.2683 0.2153 0.0038  0.0217  0.0131  131 THR B CG2 
2211 N N   . LYS B 132 ? 0.1719 0.2616 0.2292 0.0212  0.0032  0.0052  132 LYS B N   
2212 C CA  . LYS B 132 ? 0.2088 0.2453 0.2150 0.0055  0.0145  -0.0003 132 LYS B CA  
2213 C C   . LYS B 132 ? 0.2233 0.2531 0.2693 0.0214  0.0045  0.0116  132 LYS B C   
2214 O O   . LYS B 132 ? 0.2092 0.2547 0.2768 -0.0021 0.0296  0.0031  132 LYS B O   
2215 C CB  . LYS B 132 ? 0.2407 0.2388 0.2101 0.0135  0.0157  0.0096  132 LYS B CB  
2216 C CG  . LYS B 132 ? 0.2340 0.2481 0.2264 0.0056  0.0210  0.0053  132 LYS B CG  
2217 C CD  . LYS B 132 ? 0.2850 0.2913 0.2499 0.0256  0.0180  -0.0028 132 LYS B CD  
2218 C CE  . LYS B 132 ? 0.3342 0.3187 0.3227 0.0344  0.0130  0.0006  132 LYS B CE  
2219 N NZ  . LYS B 132 ? 0.3841 0.3830 0.3498 0.0338  -0.0001 -0.0029 132 LYS B NZ  
2220 N N   . VAL B 133 ? 0.1849 0.2349 0.1991 0.0180  0.0407  0.0238  133 VAL B N   
2221 C CA  . VAL B 133 ? 0.2360 0.2369 0.1994 0.0316  0.0230  0.0292  133 VAL B CA  
2222 C C   . VAL B 133 ? 0.2164 0.2258 0.2042 0.0092  0.0328  0.0255  133 VAL B C   
2223 O O   . VAL B 133 ? 0.2095 0.2449 0.2355 0.0255  0.0262  0.0433  133 VAL B O   
2224 C CB  . VAL B 133 ? 0.2246 0.2340 0.1922 0.0349  0.0312  0.0302  133 VAL B CB  
2225 C CG1 . VAL B 133 ? 0.2741 0.2518 0.2237 0.0329  0.0442  0.0159  133 VAL B CG1 
2226 C CG2 . VAL B 133 ? 0.2610 0.2712 0.1948 0.0261  0.0216  0.0260  133 VAL B CG2 
2227 N N   . PHE B 134 ? 0.2249 0.2325 0.2216 0.0195  0.0374  0.0258  134 PHE B N   
2228 C CA  . PHE B 134 ? 0.2255 0.2402 0.2143 0.0276  0.0339  0.0358  134 PHE B CA  
2229 C C   . PHE B 134 ? 0.2554 0.2523 0.2374 0.0162  0.0391  0.0277  134 PHE B C   
2230 O O   . PHE B 134 ? 0.2814 0.2685 0.2471 0.0215  0.0542  0.0380  134 PHE B O   
2231 C CB  . PHE B 134 ? 0.2302 0.2371 0.2129 0.0347  0.0309  0.0221  134 PHE B CB  
2232 C CG  . PHE B 134 ? 0.1944 0.2182 0.1955 0.0281  0.0283  0.0226  134 PHE B CG  
2233 C CD1 . PHE B 134 ? 0.2256 0.2298 0.2006 0.0249  0.0173  0.0385  134 PHE B CD1 
2234 C CD2 . PHE B 134 ? 0.2042 0.2101 0.1836 0.0335  0.0165  0.0415  134 PHE B CD2 
2235 C CE1 . PHE B 134 ? 0.2004 0.2271 0.2134 0.0278  0.0198  0.0258  134 PHE B CE1 
2236 C CE2 . PHE B 134 ? 0.1954 0.2207 0.1830 0.0347  0.0325  0.0354  134 PHE B CE2 
2237 C CZ  . PHE B 134 ? 0.2160 0.2332 0.2226 0.0144  0.0131  0.0319  134 PHE B CZ  
2238 N N   . VAL B 135 ? 0.2530 0.2778 0.2713 0.0365  0.0448  0.0462  135 VAL B N   
2239 C CA  . VAL B 135 ? 0.2487 0.3101 0.2941 0.0382  0.0557  0.0308  135 VAL B CA  
2240 C C   . VAL B 135 ? 0.2533 0.3052 0.3070 0.0290  0.0405  0.0203  135 VAL B C   
2241 O O   . VAL B 135 ? 0.2142 0.2900 0.2926 0.0381  0.0614  0.0361  135 VAL B O   
2242 C CB  . VAL B 135 ? 0.2574 0.3206 0.2962 0.0315  0.0521  0.0226  135 VAL B CB  
2243 C CG1 . VAL B 135 ? 0.3009 0.3354 0.3056 0.0238  0.0521  0.0286  135 VAL B CG1 
2244 C CG2 . VAL B 135 ? 0.2464 0.3229 0.3147 0.0205  0.0681  0.0229  135 VAL B CG2 
2245 N N   . ARG B 136 ? 0.2718 0.3208 0.3292 0.0382  0.0444  0.0177  136 ARG B N   
2246 C CA  . ARG B 136 ? 0.2793 0.3324 0.3398 0.0163  0.0265  0.0109  136 ARG B CA  
2247 C C   . ARG B 136 ? 0.2960 0.3426 0.3450 0.0093  0.0379  0.0123  136 ARG B C   
2248 O O   . ARG B 136 ? 0.3077 0.3867 0.3413 0.0109  0.0534  0.0184  136 ARG B O   
2249 C CB  . ARG B 136 ? 0.2986 0.3230 0.3722 0.0214  0.0193  0.0161  136 ARG B CB  
2250 C CG  . ARG B 136 ? 0.2973 0.3105 0.3751 0.0154  0.0018  0.0184  136 ARG B CG  
2251 C CD  . ARG B 136 ? 0.3409 0.3276 0.3877 0.0183  -0.0009 0.0225  136 ARG B CD  
2252 N NE  . ARG B 136 ? 0.3393 0.3377 0.3739 0.0216  0.0013  0.0065  136 ARG B NE  
2253 C CZ  . ARG B 136 ? 0.3433 0.3185 0.3524 0.0351  0.0163  -0.0046 136 ARG B CZ  
2254 N NH1 . ARG B 136 ? 0.3603 0.3232 0.3440 0.0454  0.0314  -0.0117 136 ARG B NH1 
2255 N NH2 . ARG B 136 ? 0.3634 0.3037 0.3637 0.0423  0.0229  -0.0131 136 ARG B NH2 
2256 N N   . GLU B 137 ? 0.2738 0.3370 0.3513 0.0155  0.0384  -0.0029 137 GLU B N   
2257 C CA  . GLU B 137 ? 0.3226 0.3573 0.3698 0.0093  0.0131  -0.0064 137 GLU B CA  
2258 C C   . GLU B 137 ? 0.3254 0.3739 0.3850 0.0101  0.0057  -0.0043 137 GLU B C   
2259 O O   . GLU B 137 ? 0.3086 0.3557 0.3529 0.0036  0.0010  -0.0208 137 GLU B O   
2260 C CB  . GLU B 137 ? 0.3284 0.3533 0.3630 -0.0031 0.0062  -0.0086 137 GLU B CB  
2261 C CG  . GLU B 137 ? 0.3350 0.3530 0.3827 -0.0043 -0.0002 -0.0023 137 GLU B CG  
2262 C CD  . GLU B 137 ? 0.3296 0.3418 0.3705 0.0098  -0.0125 -0.0038 137 GLU B CD  
2263 O OE1 . GLU B 137 ? 0.3730 0.3654 0.3842 -0.0167 -0.0054 -0.0098 137 GLU B OE1 
2264 O OE2 . GLU B 137 ? 0.3275 0.3702 0.3899 -0.0134 -0.0112 -0.0111 137 GLU B OE2 
2265 O OXT . GLU B 137 ? 0.3080 0.3660 0.3900 -0.0128 0.0119  -0.0194 137 GLU B OXT 
2266 C CAF . LSR C .   ? 0.3531 0.3560 0.3408 0.0096  -0.0054 0.0034  138 LSR A CAF 
2267 C CAE . LSR C .   ? 0.3562 0.3560 0.3580 0.0105  -0.0011 -0.0030 138 LSR A CAE 
2268 C CAD . LSR C .   ? 0.3604 0.3753 0.3826 0.0148  -0.0038 0.0076  138 LSR A CAD 
2269 C CAA . LSR C .   ? 0.3728 0.3915 0.3853 0.0097  -0.0097 0.0032  138 LSR A CAA 
2270 C CAC . LSR C .   ? 0.3637 0.3803 0.3689 0.0179  -0.0137 -0.0050 138 LSR A CAC 
2271 C CAB . LSR C .   ? 0.3982 0.4129 0.4105 0.0260  -0.0116 0.0034  138 LSR A CAB 
2272 C CAK . LSR C .   ? 0.4209 0.4047 0.4046 0.0172  -0.0031 0.0012  138 LSR A CAK 
2273 C CAJ . LSR C .   ? 0.4442 0.4185 0.4178 0.0103  -0.0055 -0.0028 138 LSR A CAJ 
2274 C CAI . LSR C .   ? 0.4552 0.4314 0.4095 0.0143  0.0012  0.0001  138 LSR A CAI 
2275 C CAN . LSR C .   ? 0.4549 0.4444 0.4210 0.0031  -0.0019 0.0019  138 LSR A CAN 
2276 C CAO . LSR C .   ? 0.4459 0.4310 0.4228 0.0145  -0.0003 -0.0144 138 LSR A CAO 
2277 C CAP . LSR C .   ? 0.4389 0.4261 0.4184 0.0087  -0.0036 0.0000  138 LSR A CAP 
2278 C CAL . LSR C .   ? 0.4437 0.4300 0.4149 0.0112  -0.0021 -0.0001 138 LSR A CAL 
2279 C CAH . LSR C .   ? 0.4448 0.4287 0.4247 0.0143  -0.0004 0.0008  138 LSR A CAH 
2280 C CAM . LSR C .   ? 0.4367 0.4418 0.4326 0.0173  0.0003  0.0045  138 LSR A CAM 
2281 C CAF . LSR D .   ? 0.4228 0.4161 0.4077 0.0109  0.0110  0.0009  138 LSR B CAF 
2282 C CAE . LSR D .   ? 0.4698 0.4355 0.4412 -0.0029 0.0025  0.0018  138 LSR B CAE 
2283 C CAD . LSR D .   ? 0.4749 0.4635 0.4535 -0.0010 0.0057  -0.0013 138 LSR B CAD 
2284 C CAA . LSR D .   ? 0.4817 0.4628 0.4513 -0.0065 0.0018  0.0041  138 LSR B CAA 
2285 C CAC . LSR D .   ? 0.4944 0.4705 0.4843 -0.0021 0.0067  0.0025  138 LSR B CAC 
2286 C CAB . LSR D .   ? 0.5008 0.4911 0.4963 0.0009  0.0039  0.0015  138 LSR B CAB 
2287 C CAK . LSR D .   ? 0.5085 0.5026 0.5139 0.0012  0.0018  0.0001  138 LSR B CAK 
2288 C CAJ . LSR D .   ? 0.5118 0.5109 0.5194 0.0003  0.0019  -0.0013 138 LSR B CAJ 
2289 C CAI . LSR D .   ? 0.5102 0.5186 0.5208 -0.0002 0.0013  -0.0064 138 LSR B CAI 
2290 C CAN . LSR D .   ? 0.5146 0.5193 0.5275 -0.0003 0.0066  -0.0003 138 LSR B CAN 
2291 C CAO . LSR D .   ? 0.5149 0.5071 0.5289 0.0005  0.0020  0.0028  138 LSR B CAO 
2292 C CAP . LSR D .   ? 0.5160 0.5142 0.5368 0.0016  0.0031  0.0011  138 LSR B CAP 
2293 C CAL . LSR D .   ? 0.5095 0.5079 0.5220 0.0000  0.0026  -0.0002 138 LSR B CAL 
2294 C CAH . LSR D .   ? 0.5120 0.5129 0.5253 -0.0003 0.0021  -0.0010 138 LSR B CAH 
2295 C CAM . LSR D .   ? 0.5114 0.5110 0.5251 -0.0006 -0.0005 0.0002  138 LSR B CAM 
2296 O O   A HOH E .   ? 0.2382 0.2704 0.2269 0.0072  -0.0001 0.0050  139 HOH A O   
2297 O O   B HOH E .   ? 0.2979 0.2916 0.3054 0.0080  0.0127  -0.0034 139 HOH A O   
2298 O O   . HOH E .   ? 0.4377 0.3600 0.3413 0.0362  -0.0188 0.0166  140 HOH A O   
2299 O O   . HOH E .   ? 0.6225 0.6122 0.5947 0.0017  -0.0037 0.0184  141 HOH A O   
2300 O O   . HOH E .   ? 0.2217 0.1993 0.2054 -0.0257 0.0119  -0.0035 142 HOH A O   
2301 O O   . HOH E .   ? 0.4787 0.5495 0.4552 0.0290  0.0416  0.0213  143 HOH A O   
2302 O O   A HOH E .   ? 0.3279 0.3862 0.3327 0.0000  -0.0114 -0.0052 144 HOH A O   
2303 O O   B HOH E .   ? 0.5169 0.5265 0.5301 -0.0059 -0.0041 -0.0054 144 HOH A O   
2304 O O   . HOH E .   ? 0.2801 0.2476 0.2576 0.0121  0.0602  -0.0035 145 HOH A O   
2305 O O   A HOH E .   ? 0.3958 0.3688 0.3713 -0.0030 0.0033  0.0133  146 HOH A O   
2306 O O   B HOH E .   ? 0.2704 0.2146 0.3031 -0.0007 0.0182  0.0147  146 HOH A O   
2307 O O   . HOH E .   ? 0.2069 0.2306 0.2433 -0.0186 0.0505  0.0123  147 HOH A O   
2308 O O   . HOH E .   ? 0.3615 0.2746 0.3472 -0.0020 -0.0185 0.0152  148 HOH A O   
2309 O O   . HOH E .   ? 0.5266 0.5559 0.5003 -0.0007 0.0285  -0.0026 149 HOH A O   
2310 O O   . HOH E .   ? 0.5807 0.6308 0.6109 0.0139  0.0131  0.0010  150 HOH A O   
2311 O O   . HOH E .   ? 0.5497 0.5593 0.5453 0.0038  -0.0026 0.0159  151 HOH A O   
2312 O O   . HOH E .   ? 0.4899 0.5422 0.4652 -0.0117 -0.0020 -0.0012 152 HOH A O   
2313 O O   . HOH E .   ? 0.4927 0.4949 0.4635 0.0438  0.0212  -0.0027 153 HOH A O   
2314 O O   . HOH E .   ? 0.5528 0.5572 0.5298 -0.0272 -0.0168 -0.0153 154 HOH A O   
2315 O O   . HOH E .   ? 0.5992 0.5547 0.5204 0.0153  0.0114  -0.0210 155 HOH A O   
2316 O O   . HOH E .   ? 0.5689 0.5018 0.5590 -0.0043 0.0040  0.0040  156 HOH A O   
2317 O O   . HOH E .   ? 0.6088 0.6459 0.6870 -0.0102 -0.0148 -0.0242 157 HOH A O   
2318 O O   . HOH E .   ? 0.1829 0.2642 0.2103 0.0181  0.0100  -0.0335 158 HOH A O   
2319 O O   . HOH E .   ? 0.2435 0.2774 0.2221 -0.0615 -0.0207 0.0203  159 HOH A O   
2320 O O   . HOH E .   ? 0.2778 0.2758 0.2599 0.0178  -0.0124 0.0273  160 HOH A O   
2321 O O   . HOH E .   ? 0.4782 0.4922 0.4947 0.0064  0.0010  0.0105  161 HOH A O   
2322 O O   . HOH E .   ? 0.2907 0.2862 0.3188 0.0128  -0.0331 0.0022  162 HOH A O   
2323 O O   . HOH E .   ? 0.2131 0.3653 0.3750 0.0455  0.0148  -0.0170 163 HOH A O   
2324 O O   . HOH E .   ? 0.3665 0.2721 0.3421 -0.0104 -0.0693 0.0197  164 HOH A O   
2325 O O   . HOH E .   ? 0.6499 0.6462 0.6077 -0.0200 -0.0028 -0.0057 165 HOH A O   
2326 O O   . HOH E .   ? 0.2781 0.3724 0.3402 -0.0167 -0.0311 -0.0271 166 HOH A O   
2327 O O   . HOH E .   ? 0.3498 0.3056 0.2717 -0.0199 -0.0269 0.0396  167 HOH A O   
2328 O O   . HOH E .   ? 0.7209 0.7393 0.7296 -0.0151 -0.0021 0.0033  168 HOH A O   
2329 O O   . HOH E .   ? 0.4069 0.3810 0.3205 0.0205  -0.0051 -0.0102 169 HOH A O   
2330 O O   A HOH E .   ? 0.1576 0.2057 0.2191 0.0091  0.0661  0.0211  170 HOH A O   
2331 O O   B HOH E .   ? 0.2986 0.3020 0.3378 0.0160  0.0250  -0.0289 170 HOH A O   
2332 O O   . HOH E .   ? 0.6192 0.6048 0.5762 0.0204  0.0162  -0.0072 171 HOH A O   
2333 O O   . HOH E .   ? 0.2508 0.3497 0.2782 0.0355  0.0180  -0.0105 172 HOH A O   
2334 O O   . HOH E .   ? 0.5988 0.5891 0.5870 -0.0065 0.0244  -0.0052 173 HOH A O   
2335 O O   . HOH E .   ? 0.5923 0.5718 0.6192 -0.0009 -0.0099 -0.0099 174 HOH A O   
2336 O O   . HOH E .   ? 0.5829 0.5717 0.5781 -0.0125 -0.0113 -0.0017 175 HOH A O   
2337 O O   . HOH E .   ? 0.5109 0.5736 0.4933 0.0369  -0.0022 0.0005  176 HOH A O   
2338 O O   A HOH E .   ? 0.2736 0.2144 0.1838 -0.0051 -0.0238 -0.0571 177 HOH A O   
2339 O O   B HOH E .   ? 0.5219 0.5069 0.4963 0.0146  -0.0143 -0.0110 177 HOH A O   
2340 O O   . HOH E .   ? 0.3400 0.4953 0.4072 -0.0010 0.0055  -0.0430 178 HOH A O   
2341 O O   . HOH E .   ? 0.7073 0.6953 0.6821 0.0151  -0.0082 -0.0020 179 HOH A O   
2342 O O   . HOH E .   ? 0.2319 0.2370 0.2619 0.0078  0.0076  0.0121  180 HOH A O   
2343 O O   A HOH E .   ? 0.2569 0.2243 0.2024 -0.0293 0.0197  -0.0275 181 HOH A O   
2344 O O   B HOH E .   ? 0.3299 0.3578 0.2790 -0.0023 0.0258  0.0020  181 HOH A O   
2345 O O   . HOH E .   ? 0.7595 0.7331 0.7530 -0.0063 0.0036  -0.0065 182 HOH A O   
2346 O O   . HOH E .   ? 0.2762 0.2575 0.2485 0.0001  0.0199  -0.0582 183 HOH A O   
2347 O O   . HOH E .   ? 0.3616 0.3597 0.4068 0.0174  -0.0117 -0.0087 184 HOH A O   
2348 O O   . HOH E .   ? 0.5969 0.6061 0.6206 -0.0319 0.0180  0.0087  185 HOH A O   
2349 O O   . HOH E .   ? 0.3524 0.4570 0.4247 0.0331  0.0044  -0.0141 186 HOH A O   
2350 O O   . HOH E .   ? 0.2995 0.3910 0.2774 -0.0147 0.0174  -0.0514 187 HOH A O   
2351 O O   . HOH E .   ? 0.2976 0.3409 0.3442 0.0174  -0.0351 0.0189  188 HOH A O   
2352 O O   . HOH E .   ? 0.5287 0.5670 0.4704 -0.0083 -0.0292 -0.0035 189 HOH A O   
2353 O O   . HOH E .   ? 0.6594 0.6226 0.6094 -0.0092 -0.0011 -0.0269 190 HOH A O   
2354 O O   . HOH E .   ? 0.2206 0.3603 0.3502 -0.0380 0.0340  0.0017  191 HOH A O   
2355 O O   . HOH E .   ? 0.5044 0.5291 0.5169 0.0058  -0.0105 -0.0158 192 HOH A O   
2356 O O   . HOH E .   ? 0.5568 0.5751 0.6015 0.0070  0.0163  -0.0067 193 HOH A O   
2357 O O   A HOH E .   ? 0.1948 0.2878 0.2923 -0.0203 0.0292  -0.0013 194 HOH A O   
2358 O O   B HOH E .   ? 0.2254 0.2852 0.3079 0.0002  -0.0002 -0.0028 194 HOH A O   
2359 O O   . HOH E .   ? 0.4553 0.4146 0.4545 -0.0386 -0.0197 -0.0264 195 HOH A O   
2360 O O   A HOH E .   ? 0.3475 0.3210 0.3161 -0.0011 -0.0037 -0.0024 196 HOH A O   
2361 O O   B HOH E .   ? 0.4464 0.4300 0.4573 -0.0096 -0.0002 -0.0162 196 HOH A O   
2362 O O   . HOH E .   ? 0.3938 0.2104 0.2940 -0.0534 0.0350  -0.0235 197 HOH A O   
2363 O O   . HOH E .   ? 0.6733 0.6909 0.6418 0.0069  -0.0061 0.0027  198 HOH A O   
2364 O O   A HOH E .   ? 0.4653 0.4588 0.4446 0.0130  -0.0038 -0.0053 199 HOH A O   
2365 O O   B HOH E .   ? 0.4626 0.4417 0.4088 0.0230  0.0052  0.0109  199 HOH A O   
2366 O O   . HOH E .   ? 0.3892 0.3288 0.2639 0.0093  0.0105  0.0062  200 HOH A O   
2367 O O   . HOH E .   ? 0.4503 0.4378 0.4724 -0.0113 0.0111  0.0485  201 HOH A O   
2368 O O   . HOH E .   ? 0.7916 0.7791 0.7999 0.0063  0.0012  0.0068  202 HOH A O   
2369 O O   . HOH E .   ? 0.4075 0.3446 0.3270 0.0021  0.0176  0.0035  203 HOH A O   
2370 O O   . HOH E .   ? 0.6043 0.5759 0.5854 0.0116  -0.0184 0.0121  204 HOH A O   
2371 O O   . HOH E .   ? 0.3855 0.4245 0.3620 0.0310  -0.0292 -0.0401 205 HOH A O   
2372 O O   . HOH E .   ? 0.3940 0.4630 0.4431 0.0337  -0.0070 0.0211  206 HOH A O   
2373 O O   . HOH E .   ? 0.3782 0.4219 0.3239 -0.0098 -0.0144 -0.0655 207 HOH A O   
2374 O O   . HOH E .   ? 0.3513 0.4381 0.3740 0.0175  -0.0097 -0.0041 208 HOH A O   
2375 O O   . HOH E .   ? 0.6141 0.5871 0.6257 0.0065  0.0037  0.0145  209 HOH A O   
2376 O O   . HOH E .   ? 0.4566 0.5350 0.5205 -0.0151 0.0215  0.0378  210 HOH A O   
2377 O O   A HOH E .   ? 0.3379 0.3890 0.3912 0.0058  0.0124  -0.0196 211 HOH A O   
2378 O O   B HOH E .   ? 0.3634 0.3948 0.4222 0.0163  -0.0182 0.0065  211 HOH A O   
2379 O O   . HOH E .   ? 0.6122 0.6330 0.5808 0.0105  -0.0106 -0.0212 212 HOH A O   
2380 O O   . HOH E .   ? 0.7265 0.7003 0.7261 0.0032  -0.0013 0.0032  213 HOH A O   
2381 O O   . HOH E .   ? 0.6626 0.6343 0.6404 0.0079  -0.0028 0.0058  214 HOH A O   
2382 O O   . HOH E .   ? 0.3888 0.3553 0.3816 -0.0063 0.0418  -0.0043 215 HOH A O   
2383 O O   . HOH E .   ? 0.6492 0.6263 0.5824 -0.0016 -0.0168 0.0126  216 HOH A O   
2384 O O   . HOH E .   ? 0.6144 0.5420 0.5221 -0.0262 -0.0205 0.0098  217 HOH A O   
2385 O O   . HOH E .   ? 0.8266 0.8176 0.8195 0.0015  0.0028  -0.0007 218 HOH A O   
2386 O O   . HOH E .   ? 0.7580 0.7810 0.7740 -0.0067 -0.0098 -0.0066 219 HOH A O   
2387 O O   . HOH E .   ? 0.9459 0.9483 0.9550 -0.0019 0.0000  0.0013  220 HOH A O   
2388 O O   . HOH E .   ? 0.8475 0.8650 0.8491 0.0018  0.0056  0.0022  221 HOH A O   
2389 O O   . HOH E .   ? 0.8083 0.8003 0.7621 0.0007  0.0059  -0.0008 222 HOH A O   
2390 O O   . HOH E .   ? 0.4575 0.4901 0.4795 0.0507  -0.0422 0.0161  223 HOH A O   
2391 O O   . HOH E .   ? 0.3476 0.2523 0.2283 0.0418  -0.0590 -0.0500 224 HOH A O   
2392 O O   . HOH E .   ? 0.4666 0.3939 0.4339 0.0174  -0.0491 0.0010  225 HOH A O   
2393 O O   . HOH E .   ? 0.5321 0.4871 0.4813 -0.0074 -0.0071 -0.0270 226 HOH A O   
2394 O O   . HOH E .   ? 0.4512 0.5340 0.4283 -0.0155 0.0047  -0.0140 227 HOH A O   
2395 O O   . HOH E .   ? 0.5144 0.4251 0.3835 0.0140  -0.0066 -0.0144 228 HOH A O   
2396 O O   A HOH E .   ? 0.3573 0.3139 0.2868 -0.0197 -0.0080 0.0161  229 HOH A O   
2397 O O   B HOH E .   ? 0.4525 0.4489 0.4332 0.0117  -0.0276 0.0037  229 HOH A O   
2398 O O   . HOH E .   ? 0.5082 0.4622 0.3865 0.0203  -0.0397 0.0171  230 HOH A O   
2399 O O   . HOH E .   ? 0.4193 0.4478 0.3914 0.0164  -0.0429 -0.0083 231 HOH A O   
2400 O O   . HOH E .   ? 0.7419 0.7160 0.7434 -0.0026 -0.0030 -0.0037 232 HOH A O   
2401 O O   . HOH E .   ? 0.5042 0.5189 0.5570 -0.0120 -0.0030 -0.0043 233 HOH A O   
2402 O O   . HOH E .   ? 0.4977 0.4496 0.4586 0.0078  -0.0131 0.0044  234 HOH A O   
2403 O O   . HOH E .   ? 0.8134 0.8208 0.8108 0.0033  0.0012  -0.0013 235 HOH A O   
2404 O O   . HOH E .   ? 0.4643 0.4586 0.4170 0.0317  -0.0015 0.0019  236 HOH A O   
2405 O O   . HOH E .   ? 0.7800 0.7915 0.7572 -0.0006 -0.0071 -0.0056 237 HOH A O   
2406 O O   . HOH E .   ? 0.5259 0.4921 0.4556 0.0045  0.0161  -0.0084 238 HOH A O   
2407 O O   . HOH E .   ? 0.6596 0.6331 0.6057 -0.0010 0.0037  -0.0069 239 HOH A O   
2408 O O   . HOH E .   ? 0.4861 0.4228 0.4688 0.0147  -0.0194 0.0144  240 HOH A O   
2409 O O   . HOH E .   ? 0.6285 0.6446 0.6690 -0.0095 -0.0175 0.0054  241 HOH A O   
2410 O O   A HOH E .   ? 0.2107 0.2640 0.3445 -0.0016 -0.0116 0.0135  242 HOH A O   
2411 O O   B HOH E .   ? 0.2194 0.3312 0.3126 0.0016  0.0419  -0.0112 242 HOH A O   
2412 O O   . HOH E .   ? 0.6141 0.6293 0.6400 -0.0053 -0.0153 -0.0148 243 HOH A O   
2413 O O   . HOH E .   ? 0.6839 0.7233 0.6824 -0.0080 -0.0125 -0.0009 244 HOH A O   
2414 O O   . HOH E .   ? 0.3839 0.3310 0.2922 0.0047  0.0165  0.0108  245 HOH A O   
2415 O O   . HOH E .   ? 0.4417 0.3813 0.4393 -0.0176 -0.0258 -0.0317 246 HOH A O   
2416 O O   A HOH E .   ? 0.3704 0.3495 0.3922 0.0066  -0.0262 -0.0214 247 HOH A O   
2417 O O   B HOH E .   ? 0.2471 0.3333 0.4097 0.0265  -0.0134 -0.0368 247 HOH A O   
2418 O O   . HOH E .   ? 0.4817 0.4961 0.4345 0.0029  -0.0026 -0.0197 248 HOH A O   
2419 O O   . HOH E .   ? 0.4785 0.5482 0.4862 -0.0121 0.0060  0.0115  249 HOH A O   
2420 O O   . HOH E .   ? 0.3243 0.3365 0.2785 -0.0137 0.0079  0.0165  250 HOH A O   
2421 O O   . HOH E .   ? 0.6007 0.5716 0.5971 0.0116  -0.0030 0.0077  251 HOH A O   
2422 O O   . HOH E .   ? 0.3493 0.3516 0.3254 -0.0222 0.0220  -0.0031 252 HOH A O   
2423 O O   . HOH E .   ? 0.4892 0.4302 0.3782 0.0302  -0.0232 0.0488  253 HOH A O   
2424 O O   . HOH E .   ? 0.3227 0.3187 0.3396 -0.0218 0.0098  -0.0241 254 HOH A O   
2425 O O   A HOH E .   ? 0.2852 0.2076 0.2478 -0.0356 -0.0314 0.0073  255 HOH A O   
2426 O O   B HOH E .   ? 0.3396 0.2205 0.3898 0.0215  -0.0317 -0.0041 255 HOH A O   
2427 O O   . HOH E .   ? 0.2882 0.1550 0.2071 -0.0513 0.0149  0.0057  256 HOH A O   
2428 O O   . HOH E .   ? 0.4041 0.3394 0.4471 -0.0531 0.0311  0.0059  257 HOH A O   
2429 O O   . HOH E .   ? 0.4373 0.3071 0.3561 -0.0517 0.0290  -0.0081 258 HOH A O   
2430 O O   . HOH E .   ? 0.3410 0.3184 0.4665 0.0005  0.0272  -0.0640 259 HOH A O   
2431 O O   . HOH E .   ? 0.2860 0.3770 0.2569 -0.0448 0.0174  -0.0621 260 HOH A O   
2432 O O   . HOH E .   ? 0.3258 0.3551 0.3126 -0.0517 0.0304  -0.0210 261 HOH A O   
2433 O O   . HOH E .   ? 0.4309 0.4435 0.4659 -0.0278 -0.0315 0.0260  262 HOH A O   
2434 O O   . HOH E .   ? 0.4412 0.5049 0.4586 0.0201  -0.0167 -0.0667 263 HOH A O   
2435 O O   . HOH E .   ? 0.3580 0.3457 0.3674 -0.0237 -0.0211 0.0034  264 HOH A O   
2436 O O   A HOH E .   ? 0.4713 0.4452 0.4174 -0.0024 -0.0045 -0.0042 265 HOH A O   
2437 O O   B HOH E .   ? 0.3561 0.4049 0.3645 -0.0207 -0.0036 0.0062  265 HOH A O   
2438 O O   . HOH E .   ? 0.3216 0.2588 0.2746 -0.0030 0.0219  -0.0215 266 HOH A O   
2439 O O   . HOH E .   ? 0.8052 0.8202 0.8143 0.0027  0.0054  -0.0032 267 HOH A O   
2440 O O   . HOH E .   ? 0.4077 0.4353 0.4223 0.0200  -0.0330 0.0124  268 HOH A O   
2441 O O   . HOH E .   ? 0.3296 0.3639 0.2740 0.0344  -0.0219 -0.0071 269 HOH A O   
2442 O O   . HOH E .   ? 0.4143 0.4381 0.3781 -0.0003 0.0026  -0.0201 270 HOH A O   
2443 O O   . HOH E .   ? 0.2863 0.4009 0.3029 0.0177  -0.0419 -0.0146 271 HOH A O   
2444 O O   . HOH E .   ? 0.3963 0.4510 0.4327 -0.0073 0.0121  0.0118  272 HOH A O   
2445 O O   . HOH E .   ? 0.3901 0.3778 0.3916 0.0176  0.0205  0.0230  273 HOH A O   
2446 O O   . HOH E .   ? 0.6516 0.6495 0.6632 0.0100  0.0127  0.0000  274 HOH A O   
2447 O O   . HOH E .   ? 0.7138 0.6724 0.6879 -0.0049 0.0099  0.0138  275 HOH A O   
2448 O O   . HOH E .   ? 0.3820 0.5455 0.4015 0.0174  0.0000  -0.0164 276 HOH A O   
2449 O O   . HOH E .   ? 0.5112 0.5088 0.3946 0.0143  0.0125  -0.0304 277 HOH A O   
2450 O O   . HOH E .   ? 0.4320 0.3680 0.3812 -0.0036 0.0113  -0.0207 278 HOH A O   
2451 O O   . HOH E .   ? 0.4679 0.3562 0.3881 0.0221  0.0115  0.0427  279 HOH A O   
2452 O O   . HOH E .   ? 0.4500 0.4031 0.3244 0.0106  -0.0199 -0.0237 280 HOH A O   
2453 O O   . HOH E .   ? 0.4358 0.3984 0.3908 0.0133  0.0268  -0.0013 281 HOH A O   
2454 O O   . HOH E .   ? 0.5560 0.5444 0.4913 0.0093  0.0176  0.0065  282 HOH A O   
2455 O O   . HOH E .   ? 0.4323 0.4531 0.4026 -0.0097 0.0940  -0.0073 283 HOH A O   
2456 O O   . HOH E .   ? 0.2755 0.2821 0.2765 -0.0243 -0.0048 -0.0270 284 HOH A O   
2457 O O   . HOH E .   ? 0.4012 0.4332 0.3599 -0.0028 -0.0081 -0.0208 285 HOH A O   
2458 O O   . HOH E .   ? 0.5888 0.6091 0.6349 0.0280  0.0099  0.0013  286 HOH A O   
2459 O O   . HOH E .   ? 0.5121 0.5857 0.5805 -0.0148 0.0117  -0.0003 287 HOH A O   
2460 O O   . HOH E .   ? 0.3654 0.4616 0.5139 -0.0211 -0.0207 0.0121  288 HOH A O   
2461 O O   . HOH E .   ? 0.5778 0.5836 0.5237 -0.0083 0.0050  0.0274  289 HOH A O   
2462 O O   A HOH E .   ? 0.3376 0.3211 0.2215 0.0209  0.0007  0.0374  290 HOH A O   
2463 O O   B HOH E .   ? 0.2986 0.3777 0.3406 -0.0194 -0.0050 0.0019  290 HOH A O   
2464 O O   . HOH E .   ? 0.4416 0.4843 0.4583 -0.0045 0.0336  -0.0069 291 HOH A O   
2465 O O   . HOH E .   ? 0.5115 0.5078 0.4620 0.0238  0.0259  -0.0203 292 HOH A O   
2466 O O   . HOH E .   ? 0.4247 0.4042 0.4650 0.0049  0.0215  0.0252  293 HOH A O   
2467 O O   . HOH E .   ? 0.3109 0.3617 0.4786 -0.0406 0.0290  0.0190  294 HOH A O   
2468 O O   . HOH E .   ? 0.6652 0.6249 0.6584 -0.0110 -0.0174 -0.0028 295 HOH A O   
2469 O O   . HOH E .   ? 0.5846 0.6289 0.5889 -0.0045 0.0019  -0.0052 296 HOH A O   
2470 O O   . HOH E .   ? 0.6797 0.7073 0.6678 0.0082  -0.0062 -0.0024 297 HOH A O   
2471 O O   . HOH E .   ? 0.3447 0.2904 0.3438 -0.0069 -0.0481 -0.0071 298 HOH A O   
2472 O O   . HOH E .   ? 0.4626 0.4809 0.3855 0.0054  0.0730  0.0129  299 HOH A O   
2473 O O   . HOH E .   ? 0.7691 0.7823 0.7874 -0.0040 0.0036  0.0112  322 HOH A O   
2474 O O   . HOH E .   ? 0.4245 0.4564 0.3960 0.0153  -0.0096 -0.0135 323 HOH A O   
2475 O O   . HOH E .   ? 0.7343 0.7261 0.7316 -0.0029 -0.0004 0.0029  329 HOH A O   
2476 O O   . HOH E .   ? 0.6756 0.6806 0.6439 -0.0007 -0.0103 0.0117  330 HOH A O   
2477 O O   . HOH E .   ? 0.6632 0.6721 0.6862 0.0136  0.0098  -0.0124 331 HOH A O   
2478 O O   . HOH E .   ? 0.7927 0.7994 0.7990 0.0010  -0.0040 0.0048  332 HOH A O   
2479 O O   . HOH E .   ? 0.6185 0.6695 0.5956 -0.0022 0.0245  0.0052  334 HOH A O   
2480 O O   . HOH E .   ? 0.6830 0.6871 0.6857 0.0112  0.0102  -0.0097 342 HOH A O   
2481 O O   . HOH E .   ? 0.6761 0.6688 0.6714 -0.0049 -0.0131 -0.0080 343 HOH A O   
2482 O O   . HOH E .   ? 0.8045 0.7907 0.7948 0.0010  -0.0019 -0.0030 345 HOH A O   
2483 O O   . HOH E .   ? 0.6245 0.6609 0.6718 -0.0094 -0.0017 0.0103  346 HOH A O   
2484 O O   . HOH E .   ? 0.7624 0.7450 0.7347 0.0024  0.0118  0.0003  348 HOH A O   
2485 O O   . HOH E .   ? 0.6206 0.6030 0.5922 -0.0175 0.0092  0.0127  350 HOH A O   
2486 O O   . HOH E .   ? 0.6716 0.6453 0.6749 0.0040  0.0026  0.0041  352 HOH A O   
2487 O O   . HOH E .   ? 0.6389 0.6328 0.6331 -0.0012 0.0001  -0.0123 353 HOH A O   
2488 O O   . HOH E .   ? 0.6281 0.6093 0.5944 -0.0002 0.0101  -0.0095 359 HOH A O   
2489 O O   . HOH E .   ? 0.6785 0.6437 0.7069 0.0069  -0.0112 -0.0056 361 HOH A O   
2490 O O   . HOH E .   ? 0.7233 0.7363 0.7457 0.0041  0.0085  -0.0060 362 HOH A O   
2491 O O   . HOH E .   ? 0.4267 0.5174 0.5270 -0.0442 0.0149  -0.0190 363 HOH A O   
2492 O O   . HOH E .   ? 0.9071 0.9138 0.9190 0.0018  0.0009  0.0013  364 HOH A O   
2493 O O   . HOH E .   ? 0.7663 0.7566 0.7466 0.0079  0.0010  0.0016  365 HOH A O   
2494 O O   . HOH E .   ? 0.6606 0.6803 0.6714 -0.0124 -0.0181 -0.0015 368 HOH A O   
2495 O O   . HOH E .   ? 0.6252 0.6012 0.6508 0.0043  0.0060  -0.0213 373 HOH A O   
2496 O O   A HOH E .   ? 0.4698 0.4103 0.3816 0.0032  -0.0219 0.0117  374 HOH A O   
2497 O O   . HOH E .   ? 0.5651 0.6150 0.5985 -0.0183 -0.0005 0.0014  378 HOH A O   
2498 O O   . HOH E .   ? 0.5565 0.4936 0.5314 -0.0563 -0.0100 0.0110  380 HOH A O   
2499 O O   . HOH E .   ? 0.7194 0.6885 0.7052 0.0126  -0.0018 0.0025  381 HOH A O   
2500 O O   . HOH E .   ? 0.5629 0.5529 0.5694 0.0003  0.0004  -0.0029 383 HOH A O   
2501 O O   . HOH E .   ? 0.7946 0.7981 0.7993 0.0055  0.0024  0.0016  384 HOH A O   
2502 O O   . HOH E .   ? 0.6427 0.6510 0.6195 0.0094  0.0110  0.0001  387 HOH A O   
2503 O O   . HOH E .   ? 0.5797 0.6053 0.6258 -0.0100 -0.0003 -0.0004 388 HOH A O   
2504 O O   . HOH E .   ? 0.7292 0.7329 0.7501 -0.0025 -0.0034 -0.0003 390 HOH A O   
2505 O O   . HOH F .   ? 0.3282 0.2454 0.2704 -0.0198 0.0062  0.0294  139 HOH B O   
2506 O O   A HOH F .   ? 0.2439 0.2440 0.1231 -0.0308 0.0089  0.0802  140 HOH B O   
2507 O O   B HOH F .   ? 0.4708 0.3885 0.3796 0.0054  0.0089  -0.0004 140 HOH B O   
2508 O O   . HOH F .   ? 0.2858 0.1816 0.1830 0.0053  -0.0215 -0.0129 141 HOH B O   
2509 O O   . HOH F .   ? 0.5652 0.5851 0.5677 0.0183  -0.0052 0.0049  142 HOH B O   
2510 O O   . HOH F .   ? 0.2653 0.3097 0.2631 -0.0318 0.0111  0.0506  143 HOH B O   
2511 O O   . HOH F .   ? 0.3006 0.3283 0.3121 -0.0213 0.0123  -0.0215 144 HOH B O   
2512 O O   . HOH F .   ? 0.2456 0.3376 0.3011 0.0324  0.0602  -0.0070 145 HOH B O   
2513 O O   . HOH F .   ? 0.3961 0.3959 0.3206 -0.0045 0.0084  -0.0325 146 HOH B O   
2514 O O   . HOH F .   ? 0.6593 0.5995 0.6639 -0.0049 -0.0012 0.0021  147 HOH B O   
2515 O O   . HOH F .   ? 0.3716 0.3634 0.3299 -0.0465 0.0027  0.0395  148 HOH B O   
2516 O O   . HOH F .   ? 0.2587 0.2164 0.2491 -0.0311 0.0218  -0.0226 149 HOH B O   
2517 O O   . HOH F .   ? 0.2959 0.2404 0.2025 -0.0352 -0.0174 0.0140  150 HOH B O   
2518 O O   . HOH F .   ? 0.2746 0.3124 0.2048 0.0185  -0.0244 0.0289  151 HOH B O   
2519 O O   . HOH F .   ? 0.3247 0.3151 0.2982 0.0199  -0.0187 0.0314  152 HOH B O   
2520 O O   . HOH F .   ? 0.4067 0.4821 0.5558 -0.0334 0.0012  -0.0094 153 HOH B O   
2521 O O   . HOH F .   ? 0.3435 0.4280 0.3758 0.0035  0.0535  0.0587  154 HOH B O   
2522 O O   . HOH F .   ? 0.4586 0.5302 0.3780 0.0003  -0.0437 -0.0096 155 HOH B O   
2523 O O   . HOH F .   ? 0.2945 0.3247 0.2920 -0.0579 -0.0084 0.0028  156 HOH B O   
2524 O O   . HOH F .   ? 0.2549 0.3633 0.2492 0.0021  -0.0187 0.0136  157 HOH B O   
2525 O O   . HOH F .   ? 0.6821 0.6583 0.6745 -0.0107 0.0090  0.0055  158 HOH B O   
2526 O O   . HOH F .   ? 0.6199 0.6341 0.6455 0.0066  -0.0040 0.0088  159 HOH B O   
2527 O O   . HOH F .   ? 0.6106 0.5588 0.6066 -0.0333 0.0049  -0.0077 160 HOH B O   
2528 O O   . HOH F .   ? 0.3562 0.2794 0.4023 0.0271  0.0046  0.0473  161 HOH B O   
2529 O O   . HOH F .   ? 0.3395 0.4027 0.3303 -0.0015 -0.0123 0.0687  162 HOH B O   
2530 O O   . HOH F .   ? 0.5670 0.5154 0.5284 -0.0020 -0.0182 0.0117  163 HOH B O   
2531 O O   . HOH F .   ? 0.6779 0.6523 0.6573 0.0067  0.0218  -0.0055 164 HOH B O   
2532 O O   . HOH F .   ? 0.5343 0.3953 0.4501 0.0381  -0.0137 -0.0202 165 HOH B O   
2533 O O   . HOH F .   ? 0.6402 0.6676 0.6649 0.0131  -0.0072 -0.0047 166 HOH B O   
2534 O O   . HOH F .   ? 0.6486 0.5941 0.6286 0.0086  -0.0048 -0.0123 167 HOH B O   
2535 O O   A HOH F .   ? 0.4630 0.4543 0.4943 0.0097  -0.0044 0.0053  168 HOH B O   
2536 O O   B HOH F .   ? 0.3801 0.3578 0.3329 0.0234  0.0290  -0.0195 168 HOH B O   
2537 O O   . HOH F .   ? 0.5855 0.5727 0.5579 -0.0009 0.0235  -0.0327 169 HOH B O   
2538 O O   A HOH F .   ? 0.3222 0.2588 0.3115 0.0009  -0.0119 -0.0094 170 HOH B O   
2539 O O   B HOH F .   ? 0.4237 0.3773 0.4075 -0.0135 0.0203  0.0066  170 HOH B O   
2540 O O   . HOH F .   ? 0.4845 0.3258 0.2526 -0.0022 0.0466  0.0010  171 HOH B O   
2541 O O   . HOH F .   ? 0.4959 0.4837 0.5257 0.0130  -0.0045 0.0305  172 HOH B O   
2542 O O   . HOH F .   ? 0.4104 0.4431 0.4265 0.0055  0.0363  -0.0253 173 HOH B O   
2543 O O   . HOH F .   ? 0.4033 0.4815 0.4617 -0.0061 0.0106  0.0408  174 HOH B O   
2544 O O   . HOH F .   ? 0.3873 0.3639 0.3718 -0.0522 -0.0145 0.0187  175 HOH B O   
2545 O O   . HOH F .   ? 0.4272 0.4872 0.4552 0.0051  0.0359  -0.0159 176 HOH B O   
2546 O O   . HOH F .   ? 0.7327 0.7218 0.7401 -0.0061 0.0013  -0.0039 177 HOH B O   
2547 O O   . HOH F .   ? 0.3144 0.4090 0.4212 0.0157  0.0038  -0.0215 178 HOH B O   
2548 O O   . HOH F .   ? 0.7320 0.7471 0.7523 0.0058  0.0031  0.0021  179 HOH B O   
2549 O O   . HOH F .   ? 0.7136 0.7028 0.7241 0.0112  0.0038  0.0092  180 HOH B O   
2550 O O   . HOH F .   ? 0.6609 0.6983 0.6628 -0.0009 -0.0013 -0.0137 181 HOH B O   
2551 O O   . HOH F .   ? 0.6293 0.6360 0.6159 -0.0009 -0.0012 0.0008  182 HOH B O   
2552 O O   . HOH F .   ? 0.7471 0.7060 0.7111 0.0068  0.0047  -0.0013 183 HOH B O   
2553 O O   A HOH F .   ? 0.5621 0.5567 0.5815 -0.0006 0.0056  -0.0086 184 HOH B O   
2554 O O   . HOH F .   ? 0.4986 0.4582 0.4550 -0.0045 0.0047  -0.0054 185 HOH B O   
2555 O O   . HOH F .   ? 0.6213 0.6213 0.5875 -0.0104 -0.0009 -0.0005 186 HOH B O   
2556 O O   . HOH F .   ? 0.7480 0.7522 0.7539 -0.0038 -0.0005 -0.0054 187 HOH B O   
2557 O O   . HOH F .   ? 0.6126 0.5931 0.5380 0.0121  0.0300  0.0047  188 HOH B O   
2558 O O   . HOH F .   ? 0.6016 0.5409 0.5776 0.0196  -0.0041 0.0144  189 HOH B O   
2559 O O   . HOH F .   ? 0.5843 0.5378 0.5666 0.0048  0.0139  -0.0026 190 HOH B O   
2560 O O   . HOH F .   ? 0.5468 0.5200 0.6048 -0.0153 -0.0001 0.0154  191 HOH B O   
2561 O O   A HOH F .   ? 0.4777 0.4758 0.4750 0.0004  0.0014  -0.0060 192 HOH B O   
2562 O O   B HOH F .   ? 0.4486 0.4381 0.3689 0.0093  -0.0183 -0.0012 192 HOH B O   
2563 O O   . HOH F .   ? 0.6032 0.5974 0.5436 0.0213  -0.0167 0.0015  193 HOH B O   
2564 O O   . HOH F .   ? 0.3865 0.4999 0.5157 0.0401  0.0208  -0.0287 194 HOH B O   
2565 O O   . HOH F .   ? 0.5361 0.4945 0.5224 0.0288  -0.0017 0.0188  195 HOH B O   
2566 O O   . HOH F .   ? 0.8695 0.8558 0.8669 -0.0061 0.0005  -0.0039 196 HOH B O   
2567 O O   . HOH F .   ? 0.5393 0.5545 0.5063 -0.0102 -0.0185 0.0149  197 HOH B O   
2568 O O   . HOH F .   ? 0.4616 0.3378 0.4324 -0.0489 0.0215  -0.0022 198 HOH B O   
2569 O O   . HOH F .   ? 0.6855 0.6658 0.6758 -0.0103 -0.0113 -0.0039 199 HOH B O   
2570 O O   . HOH F .   ? 0.6130 0.5219 0.6200 -0.0202 -0.0035 -0.0013 201 HOH B O   
2571 O O   . HOH F .   ? 0.6362 0.6718 0.6285 -0.0118 -0.0003 0.0099  202 HOH B O   
2572 O O   . HOH F .   ? 0.4464 0.6288 0.5453 -0.0269 0.0210  -0.0171 203 HOH B O   
2573 O O   . HOH F .   ? 0.7731 0.7648 0.7739 -0.0034 0.0052  -0.0009 204 HOH B O   
2574 O O   . HOH F .   ? 0.5549 0.5616 0.5568 0.0215  0.0085  -0.0284 205 HOH B O   
2575 O O   . HOH F .   ? 0.5295 0.4046 0.4062 0.0119  0.0157  -0.0385 206 HOH B O   
2576 O O   . HOH F .   ? 0.7673 0.7504 0.7826 -0.0083 -0.0065 0.0095  207 HOH B O   
2577 O O   . HOH F .   ? 0.7691 0.7589 0.7851 0.0052  0.0022  -0.0014 208 HOH B O   
2578 O O   . HOH F .   ? 0.3259 0.5042 0.3424 -0.0243 -0.0100 0.0099  209 HOH B O   
2579 O O   . HOH F .   ? 0.3889 0.4463 0.4528 0.0429  0.0495  -0.0048 210 HOH B O   
2580 O O   . HOH F .   ? 0.4245 0.4912 0.4694 0.0338  0.0045  0.0256  211 HOH B O   
2581 O O   . HOH F .   ? 0.6363 0.6552 0.6390 0.0081  -0.0045 -0.0079 212 HOH B O   
2582 O O   . HOH F .   ? 0.5953 0.6313 0.5824 0.0068  0.0223  0.0190  213 HOH B O   
2583 O O   . HOH F .   ? 0.7737 0.7693 0.7887 0.0030  0.0045  -0.0042 214 HOH B O   
2584 O O   . HOH F .   ? 0.6840 0.6840 0.6648 -0.0118 -0.0036 0.0029  215 HOH B O   
2585 O O   . HOH F .   ? 0.4391 0.4156 0.4413 -0.0013 0.0006  0.0480  216 HOH B O   
2586 O O   . HOH F .   ? 0.4376 0.4196 0.4057 -0.0444 -0.0279 0.0144  217 HOH B O   
2587 O O   . HOH F .   ? 0.6807 0.6675 0.6597 0.0062  0.0023  0.0080  218 HOH B O   
2588 O O   . HOH F .   ? 0.7655 0.7706 0.7780 0.0063  0.0043  0.0021  219 HOH B O   
2589 O O   A HOH F .   ? 0.4732 0.4695 0.5248 0.0067  -0.0162 0.0058  220 HOH B O   
2590 O O   B HOH F .   ? 0.2731 0.3350 0.2609 0.0009  -0.0250 -0.0325 220 HOH B O   
2591 O O   . HOH F .   ? 0.3789 0.4958 0.4217 0.0006  0.0141  0.0280  221 HOH B O   
2592 O O   . HOH F .   ? 0.6204 0.6459 0.6299 0.0065  0.0030  -0.0094 222 HOH B O   
2593 O O   . HOH F .   ? 0.3639 0.4108 0.3878 -0.0040 0.0096  -0.0179 223 HOH B O   
2594 O O   . HOH F .   ? 0.4999 0.5136 0.4543 0.0309  -0.0384 0.0405  224 HOH B O   
2595 O O   . HOH F .   ? 0.6076 0.6542 0.6453 -0.0198 0.0097  0.0042  225 HOH B O   
2596 O O   . HOH F .   ? 0.4872 0.5493 0.5424 -0.0314 0.0022  0.0044  226 HOH B O   
2597 O O   . HOH F .   ? 0.6133 0.5730 0.5594 -0.0278 -0.0073 0.0044  227 HOH B O   
2598 O O   . HOH F .   ? 0.3758 0.4388 0.4078 -0.0081 0.0203  0.0165  228 HOH B O   
2599 O O   A HOH F .   ? 0.2886 0.3847 0.2925 0.0146  -0.0110 0.0093  229 HOH B O   
2600 O O   B HOH F .   ? 0.3748 0.4401 0.4347 -0.0013 -0.0137 -0.0040 229 HOH B O   
2601 O O   . HOH F .   ? 0.2370 0.3073 0.2840 0.0142  0.0233  0.0358  230 HOH B O   
2602 O O   . HOH F .   ? 0.5523 0.4843 0.5184 0.0307  0.0117  0.0071  231 HOH B O   
2603 O O   . HOH F .   ? 0.5854 0.6024 0.5757 0.0182  -0.0090 0.0015  232 HOH B O   
2604 O O   A HOH F .   ? 0.2589 0.3620 0.3566 -0.0230 0.0058  0.0088  233 HOH B O   
2605 O O   B HOH F .   ? 0.4377 0.4334 0.4380 -0.0216 0.0283  0.0161  233 HOH B O   
2606 O O   . HOH F .   ? 0.4283 0.4737 0.4767 0.0263  0.0093  0.0200  234 HOH B O   
2607 O O   . HOH F .   ? 0.3036 0.3629 0.2386 -0.0256 -0.0012 -0.0225 235 HOH B O   
2608 O O   . HOH F .   ? 0.4093 0.3467 0.3492 -0.0300 -0.0182 0.0156  236 HOH B O   
2609 O O   . HOH F .   ? 0.6243 0.5776 0.6322 -0.0019 -0.0189 -0.0128 237 HOH B O   
2610 O O   . HOH F .   ? 0.4169 0.4547 0.4876 -0.0247 -0.0047 -0.0442 238 HOH B O   
2611 O O   A HOH F .   ? 0.2838 0.2911 0.2844 -0.0170 -0.0150 0.0015  247 HOH B O   
2612 O O   B HOH F .   ? 0.3493 0.3725 0.3873 -0.0066 0.0157  -0.0122 247 HOH B O   
2613 O O   . HOH F .   ? 0.5016 0.5022 0.3814 -0.0003 -0.0119 -0.0026 255 HOH B O   
2614 O O   . HOH F .   ? 0.7403 0.7229 0.7470 -0.0018 0.0037  -0.0039 263 HOH B O   
2615 O O   . HOH F .   ? 0.4445 0.3049 0.4112 -0.0306 0.0055  0.0290  264 HOH B O   
2616 O O   . HOH F .   ? 0.5129 0.5174 0.4884 0.0159  0.0147  0.0138  265 HOH B O   
2617 O O   . HOH F .   ? 0.5252 0.5417 0.5232 0.0446  0.0211  -0.0106 277 HOH B O   
2618 O O   . HOH F .   ? 0.8862 0.8937 0.8725 0.0031  0.0015  0.0004  278 HOH B O   
2619 O O   . HOH F .   ? 0.6973 0.7027 0.7524 0.0097  -0.0004 0.0067  279 HOH B O   
2620 O O   . HOH F .   ? 0.4299 0.3994 0.4193 -0.0034 -0.0032 0.0268  280 HOH B O   
2621 O O   A HOH F .   ? 0.2615 0.3345 0.4100 -0.0079 -0.0193 0.0247  281 HOH B O   
2622 O O   B HOH F .   ? 0.4569 0.4862 0.4383 -0.0181 -0.0151 -0.0154 281 HOH B O   
2623 O O   . HOH F .   ? 0.4248 0.5153 0.5198 0.0077  -0.0354 0.0110  283 HOH B O   
2624 O O   . HOH F .   ? 0.5303 0.5385 0.5463 -0.0075 0.0064  0.0069  284 HOH B O   
2625 O O   . HOH F .   ? 0.7602 0.7729 0.7799 -0.0003 0.0043  -0.0052 285 HOH B O   
2626 O O   . HOH F .   ? 0.5577 0.5742 0.5086 -0.0189 0.0172  0.0270  286 HOH B O   
2627 O O   . HOH F .   ? 0.2614 0.3472 0.2249 0.0276  0.0240  0.0087  287 HOH B O   
2628 O O   . HOH F .   ? 0.7479 0.7786 0.7712 -0.0120 -0.0063 -0.0030 288 HOH B O   
2629 O O   . HOH F .   ? 0.2776 0.2954 0.2468 0.0383  -0.0007 0.0205  289 HOH B O   
2630 O O   . HOH F .   ? 0.3651 0.3285 0.3395 0.0195  0.0006  -0.0036 290 HOH B O   
2631 O O   . HOH F .   ? 0.6105 0.6534 0.6079 0.0042  0.0154  0.0075  291 HOH B O   
2632 O O   . HOH F .   ? 0.6764 0.6777 0.6564 -0.0099 -0.0009 0.0053  292 HOH B O   
2633 O O   . HOH F .   ? 0.5364 0.5418 0.5717 0.0063  -0.0066 -0.0031 294 HOH B O   
2634 O O   . HOH F .   ? 0.5229 0.4835 0.5268 -0.0197 -0.0019 0.0000  295 HOH B O   
2635 O O   . HOH F .   ? 0.6925 0.6849 0.7057 0.0060  0.0056  0.0021  296 HOH B O   
2636 O O   . HOH F .   ? 0.6209 0.5984 0.5955 -0.0013 -0.0136 0.0107  297 HOH B O   
2637 O O   . HOH F .   ? 0.6780 0.7000 0.6592 0.0037  0.0061  0.0043  299 HOH B O   
2638 O O   . HOH F .   ? 0.5019 0.3551 0.4516 -0.0212 0.0146  0.0221  300 HOH B O   
2639 O O   . HOH F .   ? 0.4786 0.4762 0.3722 0.0115  -0.0206 0.0179  301 HOH B O   
2640 O O   . HOH F .   ? 0.4762 0.5087 0.5146 -0.0236 0.0146  -0.0117 302 HOH B O   
2641 O O   . HOH F .   ? 0.5524 0.6218 0.5891 -0.0218 -0.0121 0.0060  303 HOH B O   
2642 O O   . HOH F .   ? 0.5445 0.5529 0.5607 0.0178  0.0221  0.0152  304 HOH B O   
2643 O O   . HOH F .   ? 0.4856 0.4758 0.4248 0.0146  0.0014  0.0024  305 HOH B O   
2644 O O   A HOH F .   ? 0.3971 0.3625 0.3630 0.0227  0.0044  -0.0303 306 HOH B O   
2645 O O   B HOH F .   ? 0.4793 0.4477 0.4884 0.0118  0.0069  0.0017  306 HOH B O   
2646 O O   . HOH F .   ? 0.3862 0.5062 0.3397 -0.0116 0.0027  0.0070  307 HOH B O   
2647 O O   . HOH F .   ? 0.3091 0.4862 0.3429 -0.0228 0.0068  0.0562  308 HOH B O   
2648 O O   . HOH F .   ? 0.3829 0.3679 0.3962 -0.0012 0.0004  0.0039  309 HOH B O   
2649 O O   . HOH F .   ? 0.4520 0.4442 0.2637 0.0172  0.0151  -0.0173 310 HOH B O   
2650 O O   . HOH F .   ? 0.7044 0.7039 0.7032 0.0023  -0.0146 -0.0168 311 HOH B O   
2651 O O   . HOH F .   ? 0.5796 0.5994 0.5682 0.0161  0.0144  0.0035  312 HOH B O   
2652 O O   . HOH F .   ? 0.7076 0.6621 0.6895 0.0005  -0.0038 -0.0073 313 HOH B O   
2653 O O   . HOH F .   ? 0.4391 0.4117 0.3101 0.0137  -0.0325 -0.0027 314 HOH B O   
2654 O O   . HOH F .   ? 0.5141 0.4609 0.4435 -0.0047 0.0089  -0.0160 315 HOH B O   
2655 O O   . HOH F .   ? 0.5510 0.5275 0.4965 0.0124  -0.0161 -0.0248 316 HOH B O   
2656 O O   . HOH F .   ? 0.3223 0.2880 0.3077 0.0257  0.0258  0.0650  317 HOH B O   
2657 O O   . HOH F .   ? 0.5288 0.5204 0.4846 0.0312  0.0183  0.0008  318 HOH B O   
2658 O O   . HOH F .   ? 0.1755 0.2278 0.1875 -0.0001 -0.0233 0.0382  319 HOH B O   
2659 O O   A HOH F .   ? 0.3702 0.3075 0.2833 0.0168  -0.0165 -0.0009 320 HOH B O   
2660 O O   B HOH F .   ? 0.4450 0.4460 0.4281 0.0124  0.0122  0.0111  320 HOH B O   
2661 O O   A HOH F .   ? 0.3812 0.3097 0.3184 0.0176  -0.0080 -0.0089 324 HOH B O   
2662 O O   B HOH F .   ? 0.3814 0.3963 0.4285 -0.0006 0.0105  0.0178  324 HOH B O   
2663 O O   . HOH F .   ? 0.4424 0.4266 0.5173 0.0519  0.0046  -0.0040 325 HOH B O   
2664 O O   . HOH F .   ? 0.4993 0.5400 0.5101 0.0156  -0.0019 0.0395  326 HOH B O   
2665 O O   . HOH F .   ? 0.4719 0.5014 0.4848 -0.0175 -0.0155 0.0035  327 HOH B O   
2666 O O   . HOH F .   ? 0.4633 0.4653 0.4491 0.0129  0.0051  0.0432  328 HOH B O   
2667 O O   . HOH F .   ? 0.6360 0.6288 0.5915 0.0095  0.0108  -0.0216 333 HOH B O   
2668 O O   A HOH F .   ? 0.5881 0.5803 0.5575 0.0087  0.0093  -0.0025 335 HOH B O   
2669 O O   B HOH F .   ? 0.4287 0.4574 0.4330 0.0044  0.0238  0.0017  335 HOH B O   
2670 O O   . HOH F .   ? 0.7197 0.7359 0.7269 -0.0089 -0.0021 0.0001  336 HOH B O   
2671 O O   . HOH F .   ? 0.8141 0.7950 0.8134 -0.0048 0.0000  -0.0030 337 HOH B O   
2672 O O   . HOH F .   ? 0.6880 0.7120 0.6936 -0.0056 -0.0054 -0.0010 338 HOH B O   
2673 O O   . HOH F .   ? 0.7733 0.7875 0.7544 0.0021  -0.0032 -0.0094 339 HOH B O   
2674 O O   . HOH F .   ? 0.7571 0.7414 0.7542 0.0124  -0.0019 0.0050  341 HOH B O   
2675 O O   . HOH F .   ? 0.8587 0.8565 0.8559 0.0031  -0.0068 -0.0038 344 HOH B O   
2676 O O   . HOH F .   ? 0.7806 0.7763 0.7588 0.0031  0.0109  -0.0086 347 HOH B O   
2677 O O   . HOH F .   ? 0.7738 0.7738 0.7663 -0.0118 0.0080  0.0076  349 HOH B O   
2678 O O   . HOH F .   ? 0.5967 0.5973 0.5923 -0.0292 0.0011  0.0192  351 HOH B O   
2679 O O   . HOH F .   ? 0.7916 0.7903 0.7910 0.0028  0.0107  -0.0024 356 HOH B O   
2680 O O   . HOH F .   ? 0.5944 0.6340 0.5965 -0.0027 -0.0016 0.0138  357 HOH B O   
2681 O O   . HOH F .   ? 0.7058 0.6891 0.6857 0.0176  -0.0003 -0.0070 358 HOH B O   
2682 O O   . HOH F .   ? 0.5149 0.5688 0.5584 0.0023  -0.0061 -0.0057 360 HOH B O   
2683 O O   . HOH F .   ? 0.7139 0.6774 0.6752 0.0067  0.0043  -0.0003 371 HOH B O   
2684 O O   . HOH F .   ? 0.6146 0.6169 0.5703 0.0142  -0.0099 0.0027  375 HOH B O   
2685 O O   . HOH F .   ? 0.4260 0.5180 0.5230 -0.0447 -0.0361 0.0220  376 HOH B O   
2686 O O   . HOH F .   ? 0.7313 0.7064 0.7257 -0.0161 -0.0088 -0.0086 377 HOH B O   
2687 O O   . HOH F .   ? 0.6690 0.6487 0.6135 0.0116  0.0000  0.0090  386 HOH B O   
2688 O O   . HOH F .   ? 0.7321 0.7270 0.6984 -0.0024 -0.0036 -0.0051 389 HOH B O   
2689 O O   . HOH F .   ? 0.6708 0.7186 0.6996 0.0029  0.0031  -0.0019 391 HOH B O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PRO 1   1   1   PRO PRO A . n 
A 1 2   ASN 2   2   2   ASN ASN A . n 
A 1 3   PHE 3   3   3   PHE PHE A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLY 5   5   5   GLY GLY A . n 
A 1 6   ASN 6   6   6   ASN ASN A . n 
A 1 7   TRP 7   7   7   TRP TRP A . n 
A 1 8   LYS 8   8   8   LYS LYS A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  ILE 10  10  10  ILE ILE A . n 
A 1 11  ARG 11  11  11  ARG ARG A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLU 13  13  13  GLU GLU A . n 
A 1 14  ASN 14  14  14  ASN ASN A . n 
A 1 15  PHE 15  15  15  PHE PHE A . n 
A 1 16  GLU 16  16  16  GLU GLU A . n 
A 1 17  GLU 17  17  17  GLU GLU A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  VAL 24  24  24  VAL VAL A . n 
A 1 25  ASN 25  25  25  ASN ASN A . n 
A 1 26  VAL 26  26  26  VAL VAL A . n 
A 1 27  MET 27  27  27  MET MET A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  ARG 29  29  29  ARG ARG A . n 
A 1 30  LYS 30  30  30  LYS LYS A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  ALA 32  32  32  ALA ALA A . n 
A 1 33  VAL 33  33  33  VAL VAL A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  ALA 35  35  35  ALA ALA A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  SER 37  37  37  SER SER A . n 
A 1 38  LYS 38  38  38  LYS LYS A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  VAL 41  41  41  VAL VAL A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  ILE 43  43  43  ILE ILE A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  GLN 45  45  45  GLN GLN A . n 
A 1 46  GLU 46  46  46  GLU GLU A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  ASP 48  48  48  ASP ASP A . n 
A 1 49  THR 49  49  49  THR THR A . n 
A 1 50  PHE 50  50  50  PHE PHE A . n 
A 1 51  TYR 51  51  51  TYR TYR A . n 
A 1 52  ILE 52  52  52  ILE ILE A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  VAL 54  54  54  VAL VAL A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  THR 56  56  56  THR THR A . n 
A 1 57  THR 57  57  57  THR THR A . n 
A 1 58  VAL 58  58  58  VAL VAL A . n 
A 1 59  ARG 59  59  59  ARG ARG A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  THR 61  61  61  THR THR A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  ILE 63  63  63  ILE ILE A . n 
A 1 64  ASN 64  64  64  ASN ASN A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  LYS 66  66  66  LYS LYS A . n 
A 1 67  VAL 67  67  67  VAL VAL A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  GLU 69  69  69  GLU GLU A . n 
A 1 70  GLU 70  70  70  GLU GLU A . n 
A 1 71  PHE 71  71  71  PHE PHE A . n 
A 1 72  GLU 72  72  72  GLU GLU A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  VAL 76  76  76  VAL VAL A . n 
A 1 77  ASP 77  77  77  ASP ASP A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  ARG 79  79  79  ARG ARG A . n 
A 1 80  PRO 80  80  80  PRO PRO A . n 
A 1 81  CYS 81  81  81  CYS CYS A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  LEU 84  84  84  LEU LEU A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  LYS 86  86  86  LYS LYS A . n 
A 1 87  TRP 87  87  87  TRP TRP A . n 
A 1 88  GLU 88  88  88  GLU GLU A . n 
A 1 89  SER 89  89  89  SER SER A . n 
A 1 90  GLU 90  90  90  GLU GLU A . n 
A 1 91  ASN 91  91  91  ASN ASN A . n 
A 1 92  LYS 92  92  92  LYS LYS A . n 
A 1 93  MET 93  93  93  MET MET A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  CYS 95  95  95  CYS CYS A . n 
A 1 96  GLU 96  96  96  GLU GLU A . n 
A 1 97  GLN 97  97  97  GLN GLN A . n 
A 1 98  LYS 98  98  98  LYS LYS A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 GLU 103 103 103 GLU GLU A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 PRO 105 105 105 PRO PRO A . n 
A 1 106 LYS 106 106 106 LYS LYS A . n 
A 1 107 THR 107 107 107 THR THR A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 TRP 109 109 109 TRP TRP A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 THR 114 114 114 THR THR A . n 
A 1 115 ASN 115 115 115 ASN ASN A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLU 118 118 118 GLU GLU A . n 
A 1 119 LEU 119 119 119 LEU LEU A . n 
A 1 120 ILE 120 120 120 ILE ILE A . n 
A 1 121 ASP 121 121 121 ASP ASP A . n 
A 1 122 THR 122 122 122 THR THR A . n 
A 1 123 MET 123 123 123 MET MET A . n 
A 1 124 THR 124 124 124 THR THR A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 ASP 126 126 126 ASP ASP A . n 
A 1 127 ASP 127 127 127 ASP ASP A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 CYS 130 130 130 CYS CYS A . n 
A 1 131 THR 131 131 131 THR THR A . n 
A 1 132 LYS 132 132 132 LYS LYS A . n 
A 1 133 VAL 133 133 133 VAL VAL A . n 
A 1 134 PHE 134 134 134 PHE PHE A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 GLU 137 137 137 GLU GLU A . n 
B 1 1   PRO 1   1   1   PRO PRO B . n 
B 1 2   ASN 2   2   2   ASN ASN B . n 
B 1 3   PHE 3   3   3   PHE PHE B . n 
B 1 4   SER 4   4   4   SER SER B . n 
B 1 5   GLY 5   5   5   GLY GLY B . n 
B 1 6   ASN 6   6   6   ASN ASN B . n 
B 1 7   TRP 7   7   7   TRP TRP B . n 
B 1 8   LYS 8   8   8   LYS LYS B . n 
B 1 9   ILE 9   9   9   ILE ILE B . n 
B 1 10  ILE 10  10  10  ILE ILE B . n 
B 1 11  ARG 11  11  11  ARG ARG B . n 
B 1 12  SER 12  12  12  SER SER B . n 
B 1 13  GLU 13  13  13  GLU GLU B . n 
B 1 14  ASN 14  14  14  ASN ASN B . n 
B 1 15  PHE 15  15  15  PHE PHE B . n 
B 1 16  GLU 16  16  16  GLU GLU B . n 
B 1 17  GLU 17  17  17  GLU GLU B . n 
B 1 18  LEU 18  18  18  LEU LEU B . n 
B 1 19  LEU 19  19  19  LEU LEU B . n 
B 1 20  LYS 20  20  20  LYS LYS B . n 
B 1 21  VAL 21  21  21  VAL VAL B . n 
B 1 22  LEU 22  22  22  LEU LEU B . n 
B 1 23  GLY 23  23  23  GLY GLY B . n 
B 1 24  VAL 24  24  24  VAL VAL B . n 
B 1 25  ASN 25  25  25  ASN ASN B . n 
B 1 26  VAL 26  26  26  VAL VAL B . n 
B 1 27  MET 27  27  27  MET MET B . n 
B 1 28  LEU 28  28  28  LEU LEU B . n 
B 1 29  ARG 29  29  29  ARG ARG B . n 
B 1 30  LYS 30  30  30  LYS LYS B . n 
B 1 31  ILE 31  31  31  ILE ILE B . n 
B 1 32  ALA 32  32  32  ALA ALA B . n 
B 1 33  VAL 33  33  33  VAL VAL B . n 
B 1 34  ALA 34  34  34  ALA ALA B . n 
B 1 35  ALA 35  35  35  ALA ALA B . n 
B 1 36  ALA 36  36  36  ALA ALA B . n 
B 1 37  SER 37  37  37  SER SER B . n 
B 1 38  LYS 38  38  38  LYS LYS B . n 
B 1 39  PRO 39  39  39  PRO PRO B . n 
B 1 40  ALA 40  40  40  ALA ALA B . n 
B 1 41  VAL 41  41  41  VAL VAL B . n 
B 1 42  GLU 42  42  42  GLU GLU B . n 
B 1 43  ILE 43  43  43  ILE ILE B . n 
B 1 44  LYS 44  44  44  LYS LYS B . n 
B 1 45  GLN 45  45  45  GLN GLN B . n 
B 1 46  GLU 46  46  46  GLU GLU B . n 
B 1 47  GLY 47  47  47  GLY GLY B . n 
B 1 48  ASP 48  48  48  ASP ASP B . n 
B 1 49  THR 49  49  49  THR THR B . n 
B 1 50  PHE 50  50  50  PHE PHE B . n 
B 1 51  TYR 51  51  51  TYR TYR B . n 
B 1 52  ILE 52  52  52  ILE ILE B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  VAL 54  54  54  VAL VAL B . n 
B 1 55  SER 55  55  55  SER SER B . n 
B 1 56  THR 56  56  56  THR THR B . n 
B 1 57  THR 57  57  57  THR THR B . n 
B 1 58  VAL 58  58  58  VAL VAL B . n 
B 1 59  ARG 59  59  59  ARG ARG B . n 
B 1 60  THR 60  60  60  THR THR B . n 
B 1 61  THR 61  61  61  THR THR B . n 
B 1 62  GLU 62  62  62  GLU GLU B . n 
B 1 63  ILE 63  63  63  ILE ILE B . n 
B 1 64  ASN 64  64  64  ASN ASN B . n 
B 1 65  PHE 65  65  65  PHE PHE B . n 
B 1 66  LYS 66  66  66  LYS LYS B . n 
B 1 67  VAL 67  67  67  VAL VAL B . n 
B 1 68  GLY 68  68  68  GLY GLY B . n 
B 1 69  GLU 69  69  69  GLU GLU B . n 
B 1 70  GLU 70  70  70  GLU GLU B . n 
B 1 71  PHE 71  71  71  PHE PHE B . n 
B 1 72  GLU 72  72  72  GLU GLU B . n 
B 1 73  GLU 73  73  73  GLU GLU B . n 
B 1 74  GLN 74  74  74  GLN GLN B . n 
B 1 75  THR 75  75  75  THR THR B . n 
B 1 76  VAL 76  76  76  VAL VAL B . n 
B 1 77  ASP 77  77  77  ASP ASP B . n 
B 1 78  GLY 78  78  78  GLY GLY B . n 
B 1 79  ARG 79  79  79  ARG ARG B . n 
B 1 80  PRO 80  80  80  PRO PRO B . n 
B 1 81  CYS 81  81  81  CYS CYS B . n 
B 1 82  LYS 82  82  82  LYS LYS B . n 
B 1 83  SER 83  83  83  SER SER B . n 
B 1 84  LEU 84  84  84  LEU LEU B . n 
B 1 85  VAL 85  85  85  VAL VAL B . n 
B 1 86  LYS 86  86  86  LYS LYS B . n 
B 1 87  TRP 87  87  87  TRP TRP B . n 
B 1 88  GLU 88  88  88  GLU GLU B . n 
B 1 89  SER 89  89  89  SER SER B . n 
B 1 90  GLU 90  90  90  GLU GLU B . n 
B 1 91  ASN 91  91  91  ASN ASN B . n 
B 1 92  LYS 92  92  92  LYS LYS B . n 
B 1 93  MET 93  93  93  MET MET B . n 
B 1 94  VAL 94  94  94  VAL VAL B . n 
B 1 95  CYS 95  95  95  CYS CYS B . n 
B 1 96  GLU 96  96  96  GLU GLU B . n 
B 1 97  GLN 97  97  97  GLN GLN B . n 
B 1 98  LYS 98  98  98  LYS LYS B . n 
B 1 99  LEU 99  99  99  LEU LEU B . n 
B 1 100 LEU 100 100 100 LEU LEU B . n 
B 1 101 LYS 101 101 101 LYS LYS B . n 
B 1 102 GLY 102 102 102 GLY GLY B . n 
B 1 103 GLU 103 103 103 GLU GLU B . n 
B 1 104 GLY 104 104 104 GLY GLY B . n 
B 1 105 PRO 105 105 105 PRO PRO B . n 
B 1 106 LYS 106 106 106 LYS LYS B . n 
B 1 107 THR 107 107 107 THR THR B . n 
B 1 108 SER 108 108 108 SER SER B . n 
B 1 109 TRP 109 109 109 TRP TRP B . n 
B 1 110 THR 110 110 110 THR THR B . n 
B 1 111 LEU 111 111 111 LEU LEU B . n 
B 1 112 GLU 112 112 112 GLU GLU B . n 
B 1 113 LEU 113 113 113 LEU LEU B . n 
B 1 114 THR 114 114 114 THR THR B . n 
B 1 115 ASN 115 115 115 ASN ASN B . n 
B 1 116 ASP 116 116 116 ASP ASP B . n 
B 1 117 GLY 117 117 117 GLY GLY B . n 
B 1 118 GLU 118 118 118 GLU GLU B . n 
B 1 119 LEU 119 119 119 LEU LEU B . n 
B 1 120 ILE 120 120 120 ILE ILE B . n 
B 1 121 ASP 121 121 121 ASP ASP B . n 
B 1 122 THR 122 122 122 THR THR B . n 
B 1 123 MET 123 123 123 MET MET B . n 
B 1 124 THR 124 124 124 THR THR B . n 
B 1 125 ALA 125 125 125 ALA ALA B . n 
B 1 126 ASP 126 126 126 ASP ASP B . n 
B 1 127 ASP 127 127 127 ASP ASP B . n 
B 1 128 VAL 128 128 128 VAL VAL B . n 
B 1 129 VAL 129 129 129 VAL VAL B . n 
B 1 130 CYS 130 130 130 CYS CYS B . n 
B 1 131 THR 131 131 131 THR THR B . n 
B 1 132 LYS 132 132 132 LYS LYS B . n 
B 1 133 VAL 133 133 133 VAL VAL B . n 
B 1 134 PHE 134 134 134 PHE PHE B . n 
B 1 135 VAL 135 135 135 VAL VAL B . n 
B 1 136 ARG 136 136 136 ARG ARG B . n 
B 1 137 GLU 137 137 137 GLU GLU B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E 
2 1 B,D,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-10-27 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .        ? 1 
PHASER   phasing           .        ? 2 
REFMAC   refinement        5.2.0005 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A VAL 33 ? ? OG A SER 37  ? ? 2.07 
2 1 OE1 B GLU 16 ? ? O  B HOH 163 ? ? 2.10 
3 1 OE1 A GLU 90 ? ? O  A HOH 221 ? ? 2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 126 ? ? 49.03 -115.84 
2 1 ASP B 126 ? ? 50.49 -116.36 
# 
_pdbx_unobs_or_zero_occ_atoms.id               1 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag   0 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id     LYS 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id      44 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id     CD 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id     A 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id    A 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id    LYS 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id     44 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id    CD 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '1,3,3-trimethyl-2-[(1E,3E)-3-methylpenta-1,3-dien-1-yl]cyclohexene' LSR 
3 water                                                                HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 LSR 1   138 138 LSR LSR A . 
D 2 LSR 1   138 138 LSR LSR B . 
E 3 HOH 1   139 139 HOH HOH A . 
E 3 HOH 2   140 140 HOH HOH A . 
E 3 HOH 3   141 141 HOH HOH A . 
E 3 HOH 4   142 142 HOH HOH A . 
E 3 HOH 5   143 143 HOH HOH A . 
E 3 HOH 6   144 144 HOH HOH A . 
E 3 HOH 7   145 145 HOH HOH A . 
E 3 HOH 8   146 146 HOH HOH A . 
E 3 HOH 9   147 147 HOH HOH A . 
E 3 HOH 10  148 148 HOH HOH A . 
E 3 HOH 11  149 149 HOH HOH A . 
E 3 HOH 12  150 150 HOH HOH A . 
E 3 HOH 13  151 151 HOH HOH A . 
E 3 HOH 14  152 152 HOH HOH A . 
E 3 HOH 15  153 153 HOH HOH A . 
E 3 HOH 16  154 154 HOH HOH A . 
E 3 HOH 17  155 155 HOH HOH A . 
E 3 HOH 18  156 156 HOH HOH A . 
E 3 HOH 19  157 157 HOH HOH A . 
E 3 HOH 20  158 158 HOH HOH A . 
E 3 HOH 21  159 159 HOH HOH A . 
E 3 HOH 22  160 160 HOH HOH A . 
E 3 HOH 23  161 161 HOH HOH A . 
E 3 HOH 24  162 162 HOH HOH A . 
E 3 HOH 25  163 163 HOH HOH A . 
E 3 HOH 26  164 164 HOH HOH A . 
E 3 HOH 27  165 165 HOH HOH A . 
E 3 HOH 28  166 166 HOH HOH A . 
E 3 HOH 29  167 167 HOH HOH A . 
E 3 HOH 30  168 168 HOH HOH A . 
E 3 HOH 31  169 169 HOH HOH A . 
E 3 HOH 32  170 170 HOH HOH A . 
E 3 HOH 33  171 171 HOH HOH A . 
E 3 HOH 34  172 172 HOH HOH A . 
E 3 HOH 35  173 173 HOH HOH A . 
E 3 HOH 36  174 174 HOH HOH A . 
E 3 HOH 37  175 175 HOH HOH A . 
E 3 HOH 38  176 176 HOH HOH A . 
E 3 HOH 39  177 177 HOH HOH A . 
E 3 HOH 40  178 178 HOH HOH A . 
E 3 HOH 41  179 179 HOH HOH A . 
E 3 HOH 42  180 180 HOH HOH A . 
E 3 HOH 43  181 181 HOH HOH A . 
E 3 HOH 44  182 182 HOH HOH A . 
E 3 HOH 45  183 183 HOH HOH A . 
E 3 HOH 46  184 184 HOH HOH A . 
E 3 HOH 47  185 185 HOH HOH A . 
E 3 HOH 48  186 186 HOH HOH A . 
E 3 HOH 49  187 187 HOH HOH A . 
E 3 HOH 50  188 188 HOH HOH A . 
E 3 HOH 51  189 189 HOH HOH A . 
E 3 HOH 52  190 190 HOH HOH A . 
E 3 HOH 53  191 191 HOH HOH A . 
E 3 HOH 54  192 192 HOH HOH A . 
E 3 HOH 55  193 193 HOH HOH A . 
E 3 HOH 56  194 194 HOH HOH A . 
E 3 HOH 57  195 195 HOH HOH A . 
E 3 HOH 58  196 196 HOH HOH A . 
E 3 HOH 59  197 197 HOH HOH A . 
E 3 HOH 60  198 198 HOH HOH A . 
E 3 HOH 61  199 199 HOH HOH A . 
E 3 HOH 62  200 200 HOH HOH A . 
E 3 HOH 63  201 201 HOH HOH A . 
E 3 HOH 64  202 202 HOH HOH A . 
E 3 HOH 65  203 203 HOH HOH A . 
E 3 HOH 66  204 204 HOH HOH A . 
E 3 HOH 67  205 205 HOH HOH A . 
E 3 HOH 68  206 206 HOH HOH A . 
E 3 HOH 69  207 207 HOH HOH A . 
E 3 HOH 70  208 208 HOH HOH A . 
E 3 HOH 71  209 209 HOH HOH A . 
E 3 HOH 72  210 210 HOH HOH A . 
E 3 HOH 73  211 211 HOH HOH A . 
E 3 HOH 74  212 212 HOH HOH A . 
E 3 HOH 75  213 213 HOH HOH A . 
E 3 HOH 76  214 214 HOH HOH A . 
E 3 HOH 77  215 215 HOH HOH A . 
E 3 HOH 78  216 216 HOH HOH A . 
E 3 HOH 79  217 217 HOH HOH A . 
E 3 HOH 80  218 218 HOH HOH A . 
E 3 HOH 81  219 219 HOH HOH A . 
E 3 HOH 82  220 220 HOH HOH A . 
E 3 HOH 83  221 221 HOH HOH A . 
E 3 HOH 84  222 222 HOH HOH A . 
E 3 HOH 85  223 223 HOH HOH A . 
E 3 HOH 86  224 224 HOH HOH A . 
E 3 HOH 87  225 225 HOH HOH A . 
E 3 HOH 88  226 226 HOH HOH A . 
E 3 HOH 89  227 227 HOH HOH A . 
E 3 HOH 90  228 228 HOH HOH A . 
E 3 HOH 91  229 229 HOH HOH A . 
E 3 HOH 92  230 230 HOH HOH A . 
E 3 HOH 93  231 231 HOH HOH A . 
E 3 HOH 94  232 232 HOH HOH A . 
E 3 HOH 95  233 233 HOH HOH A . 
E 3 HOH 96  234 234 HOH HOH A . 
E 3 HOH 97  235 235 HOH HOH A . 
E 3 HOH 98  236 236 HOH HOH A . 
E 3 HOH 99  237 237 HOH HOH A . 
E 3 HOH 100 238 238 HOH HOH A . 
E 3 HOH 101 239 239 HOH HOH A . 
E 3 HOH 102 240 240 HOH HOH A . 
E 3 HOH 103 241 241 HOH HOH A . 
E 3 HOH 104 242 242 HOH HOH A . 
E 3 HOH 105 243 243 HOH HOH A . 
E 3 HOH 106 244 244 HOH HOH A . 
E 3 HOH 107 245 245 HOH HOH A . 
E 3 HOH 108 246 246 HOH HOH A . 
E 3 HOH 109 247 247 HOH HOH A . 
E 3 HOH 110 248 248 HOH HOH A . 
E 3 HOH 111 249 249 HOH HOH A . 
E 3 HOH 112 250 250 HOH HOH A . 
E 3 HOH 113 251 251 HOH HOH A . 
E 3 HOH 114 252 252 HOH HOH A . 
E 3 HOH 115 253 253 HOH HOH A . 
E 3 HOH 116 254 254 HOH HOH A . 
E 3 HOH 117 255 255 HOH HOH A . 
E 3 HOH 118 256 256 HOH HOH A . 
E 3 HOH 119 257 257 HOH HOH A . 
E 3 HOH 120 258 258 HOH HOH A . 
E 3 HOH 121 259 259 HOH HOH A . 
E 3 HOH 122 260 260 HOH HOH A . 
E 3 HOH 123 261 261 HOH HOH A . 
E 3 HOH 124 262 262 HOH HOH A . 
E 3 HOH 125 263 263 HOH HOH A . 
E 3 HOH 126 264 264 HOH HOH A . 
E 3 HOH 127 265 265 HOH HOH A . 
E 3 HOH 128 266 266 HOH HOH A . 
E 3 HOH 129 267 267 HOH HOH A . 
E 3 HOH 130 268 268 HOH HOH A . 
E 3 HOH 131 269 269 HOH HOH A . 
E 3 HOH 132 270 270 HOH HOH A . 
E 3 HOH 133 271 271 HOH HOH A . 
E 3 HOH 134 272 272 HOH HOH A . 
E 3 HOH 135 273 273 HOH HOH A . 
E 3 HOH 136 274 274 HOH HOH A . 
E 3 HOH 137 275 275 HOH HOH A . 
E 3 HOH 138 276 276 HOH HOH A . 
E 3 HOH 139 277 277 HOH HOH A . 
E 3 HOH 140 278 278 HOH HOH A . 
E 3 HOH 141 279 279 HOH HOH A . 
E 3 HOH 142 280 280 HOH HOH A . 
E 3 HOH 143 281 281 HOH HOH A . 
E 3 HOH 144 282 282 HOH HOH A . 
E 3 HOH 145 283 283 HOH HOH A . 
E 3 HOH 146 284 284 HOH HOH A . 
E 3 HOH 147 285 285 HOH HOH A . 
E 3 HOH 148 286 286 HOH HOH A . 
E 3 HOH 149 287 287 HOH HOH A . 
E 3 HOH 150 288 288 HOH HOH A . 
E 3 HOH 151 289 289 HOH HOH A . 
E 3 HOH 152 290 290 HOH HOH A . 
E 3 HOH 153 291 291 HOH HOH A . 
E 3 HOH 154 292 292 HOH HOH A . 
E 3 HOH 155 293 293 HOH HOH A . 
E 3 HOH 156 294 294 HOH HOH A . 
E 3 HOH 157 295 295 HOH HOH A . 
E 3 HOH 158 296 296 HOH HOH A . 
E 3 HOH 159 297 297 HOH HOH A . 
E 3 HOH 160 298 298 HOH HOH A . 
E 3 HOH 161 299 299 HOH HOH A . 
E 3 HOH 162 322 322 HOH HOH A . 
E 3 HOH 163 323 323 HOH HOH A . 
E 3 HOH 164 329 329 HOH HOH A . 
E 3 HOH 165 330 330 HOH HOH A . 
E 3 HOH 166 331 331 HOH HOH A . 
E 3 HOH 167 332 332 HOH HOH A . 
E 3 HOH 168 334 334 HOH HOH A . 
E 3 HOH 169 342 342 HOH HOH A . 
E 3 HOH 170 343 343 HOH HOH A . 
E 3 HOH 171 345 345 HOH HOH A . 
E 3 HOH 172 346 346 HOH HOH A . 
E 3 HOH 173 348 348 HOH HOH A . 
E 3 HOH 174 350 350 HOH HOH A . 
E 3 HOH 175 352 352 HOH HOH A . 
E 3 HOH 176 353 353 HOH HOH A . 
E 3 HOH 177 359 359 HOH HOH A . 
E 3 HOH 178 361 361 HOH HOH A . 
E 3 HOH 179 362 362 HOH HOH A . 
E 3 HOH 180 363 363 HOH HOH A . 
E 3 HOH 181 364 364 HOH HOH A . 
E 3 HOH 182 365 365 HOH HOH A . 
E 3 HOH 183 368 368 HOH HOH A . 
E 3 HOH 184 373 373 HOH HOH A . 
E 3 HOH 185 374 374 HOH HOH A . 
E 3 HOH 186 378 378 HOH HOH A . 
E 3 HOH 187 380 380 HOH HOH A . 
E 3 HOH 188 381 381 HOH HOH A . 
E 3 HOH 189 383 383 HOH HOH A . 
E 3 HOH 190 384 384 HOH HOH A . 
E 3 HOH 191 387 387 HOH HOH A . 
E 3 HOH 192 388 388 HOH HOH A . 
E 3 HOH 193 390 390 HOH HOH A . 
F 3 HOH 1   139 139 HOH HOH B . 
F 3 HOH 2   140 140 HOH HOH B . 
F 3 HOH 3   141 141 HOH HOH B . 
F 3 HOH 4   142 142 HOH HOH B . 
F 3 HOH 5   143 143 HOH HOH B . 
F 3 HOH 6   144 144 HOH HOH B . 
F 3 HOH 7   145 145 HOH HOH B . 
F 3 HOH 8   146 146 HOH HOH B . 
F 3 HOH 9   147 147 HOH HOH B . 
F 3 HOH 10  148 148 HOH HOH B . 
F 3 HOH 11  149 149 HOH HOH B . 
F 3 HOH 12  150 150 HOH HOH B . 
F 3 HOH 13  151 151 HOH HOH B . 
F 3 HOH 14  152 152 HOH HOH B . 
F 3 HOH 15  153 153 HOH HOH B . 
F 3 HOH 16  154 154 HOH HOH B . 
F 3 HOH 17  155 155 HOH HOH B . 
F 3 HOH 18  156 156 HOH HOH B . 
F 3 HOH 19  157 157 HOH HOH B . 
F 3 HOH 20  158 158 HOH HOH B . 
F 3 HOH 21  159 159 HOH HOH B . 
F 3 HOH 22  160 160 HOH HOH B . 
F 3 HOH 23  161 161 HOH HOH B . 
F 3 HOH 24  162 162 HOH HOH B . 
F 3 HOH 25  163 163 HOH HOH B . 
F 3 HOH 26  164 164 HOH HOH B . 
F 3 HOH 27  165 165 HOH HOH B . 
F 3 HOH 28  166 166 HOH HOH B . 
F 3 HOH 29  167 167 HOH HOH B . 
F 3 HOH 30  168 168 HOH HOH B . 
F 3 HOH 31  169 169 HOH HOH B . 
F 3 HOH 32  170 170 HOH HOH B . 
F 3 HOH 33  171 171 HOH HOH B . 
F 3 HOH 34  172 172 HOH HOH B . 
F 3 HOH 35  173 173 HOH HOH B . 
F 3 HOH 36  174 174 HOH HOH B . 
F 3 HOH 37  175 175 HOH HOH B . 
F 3 HOH 38  176 176 HOH HOH B . 
F 3 HOH 39  177 177 HOH HOH B . 
F 3 HOH 40  178 178 HOH HOH B . 
F 3 HOH 41  179 179 HOH HOH B . 
F 3 HOH 42  180 180 HOH HOH B . 
F 3 HOH 43  181 181 HOH HOH B . 
F 3 HOH 44  182 182 HOH HOH B . 
F 3 HOH 45  183 183 HOH HOH B . 
F 3 HOH 46  184 184 HOH HOH B . 
F 3 HOH 47  185 185 HOH HOH B . 
F 3 HOH 48  186 186 HOH HOH B . 
F 3 HOH 49  187 187 HOH HOH B . 
F 3 HOH 50  188 188 HOH HOH B . 
F 3 HOH 51  189 189 HOH HOH B . 
F 3 HOH 52  190 190 HOH HOH B . 
F 3 HOH 53  191 191 HOH HOH B . 
F 3 HOH 54  192 192 HOH HOH B . 
F 3 HOH 55  193 193 HOH HOH B . 
F 3 HOH 56  194 194 HOH HOH B . 
F 3 HOH 57  195 195 HOH HOH B . 
F 3 HOH 58  196 196 HOH HOH B . 
F 3 HOH 59  197 197 HOH HOH B . 
F 3 HOH 60  198 198 HOH HOH B . 
F 3 HOH 61  199 199 HOH HOH B . 
F 3 HOH 62  201 201 HOH HOH B . 
F 3 HOH 63  202 202 HOH HOH B . 
F 3 HOH 64  203 203 HOH HOH B . 
F 3 HOH 65  204 204 HOH HOH B . 
F 3 HOH 66  205 205 HOH HOH B . 
F 3 HOH 67  206 206 HOH HOH B . 
F 3 HOH 68  207 207 HOH HOH B . 
F 3 HOH 69  208 208 HOH HOH B . 
F 3 HOH 70  209 209 HOH HOH B . 
F 3 HOH 71  210 210 HOH HOH B . 
F 3 HOH 72  211 211 HOH HOH B . 
F 3 HOH 73  212 212 HOH HOH B . 
F 3 HOH 74  213 213 HOH HOH B . 
F 3 HOH 75  214 214 HOH HOH B . 
F 3 HOH 76  215 215 HOH HOH B . 
F 3 HOH 77  216 216 HOH HOH B . 
F 3 HOH 78  217 217 HOH HOH B . 
F 3 HOH 79  218 218 HOH HOH B . 
F 3 HOH 80  219 219 HOH HOH B . 
F 3 HOH 81  220 220 HOH HOH B . 
F 3 HOH 82  221 221 HOH HOH B . 
F 3 HOH 83  222 222 HOH HOH B . 
F 3 HOH 84  223 223 HOH HOH B . 
F 3 HOH 85  224 224 HOH HOH B . 
F 3 HOH 86  225 225 HOH HOH B . 
F 3 HOH 87  226 226 HOH HOH B . 
F 3 HOH 88  227 227 HOH HOH B . 
F 3 HOH 89  228 228 HOH HOH B . 
F 3 HOH 90  229 229 HOH HOH B . 
F 3 HOH 91  230 230 HOH HOH B . 
F 3 HOH 92  231 231 HOH HOH B . 
F 3 HOH 93  232 232 HOH HOH B . 
F 3 HOH 94  233 233 HOH HOH B . 
F 3 HOH 95  234 234 HOH HOH B . 
F 3 HOH 96  235 235 HOH HOH B . 
F 3 HOH 97  236 236 HOH HOH B . 
F 3 HOH 98  237 237 HOH HOH B . 
F 3 HOH 99  238 238 HOH HOH B . 
F 3 HOH 100 247 247 HOH HOH B . 
F 3 HOH 101 255 255 HOH HOH B . 
F 3 HOH 102 263 263 HOH HOH B . 
F 3 HOH 103 264 264 HOH HOH B . 
F 3 HOH 104 265 265 HOH HOH B . 
F 3 HOH 105 277 277 HOH HOH B . 
F 3 HOH 106 278 278 HOH HOH B . 
F 3 HOH 107 279 279 HOH HOH B . 
F 3 HOH 108 280 280 HOH HOH B . 
F 3 HOH 109 281 281 HOH HOH B . 
F 3 HOH 110 283 283 HOH HOH B . 
F 3 HOH 111 284 284 HOH HOH B . 
F 3 HOH 112 285 285 HOH HOH B . 
F 3 HOH 113 286 286 HOH HOH B . 
F 3 HOH 114 287 287 HOH HOH B . 
F 3 HOH 115 288 288 HOH HOH B . 
F 3 HOH 116 289 289 HOH HOH B . 
F 3 HOH 117 290 290 HOH HOH B . 
F 3 HOH 118 291 291 HOH HOH B . 
F 3 HOH 119 292 292 HOH HOH B . 
F 3 HOH 120 294 294 HOH HOH B . 
F 3 HOH 121 295 295 HOH HOH B . 
F 3 HOH 122 296 296 HOH HOH B . 
F 3 HOH 123 297 297 HOH HOH B . 
F 3 HOH 124 299 299 HOH HOH B . 
F 3 HOH 125 300 300 HOH HOH B . 
F 3 HOH 126 301 301 HOH HOH B . 
F 3 HOH 127 302 302 HOH HOH B . 
F 3 HOH 128 303 303 HOH HOH B . 
F 3 HOH 129 304 304 HOH HOH B . 
F 3 HOH 130 305 305 HOH HOH B . 
F 3 HOH 131 306 306 HOH HOH B . 
F 3 HOH 132 307 307 HOH HOH B . 
F 3 HOH 133 308 308 HOH HOH B . 
F 3 HOH 134 309 309 HOH HOH B . 
F 3 HOH 135 310 310 HOH HOH B . 
F 3 HOH 136 311 311 HOH HOH B . 
F 3 HOH 137 312 312 HOH HOH B . 
F 3 HOH 138 313 313 HOH HOH B . 
F 3 HOH 139 314 314 HOH HOH B . 
F 3 HOH 140 315 315 HOH HOH B . 
F 3 HOH 141 316 316 HOH HOH B . 
F 3 HOH 142 317 317 HOH HOH B . 
F 3 HOH 143 318 318 HOH HOH B . 
F 3 HOH 144 319 319 HOH HOH B . 
F 3 HOH 145 320 320 HOH HOH B . 
F 3 HOH 146 324 324 HOH HOH B . 
F 3 HOH 147 325 325 HOH HOH B . 
F 3 HOH 148 326 326 HOH HOH B . 
F 3 HOH 149 327 327 HOH HOH B . 
F 3 HOH 150 328 328 HOH HOH B . 
F 3 HOH 151 333 333 HOH HOH B . 
F 3 HOH 152 335 335 HOH HOH B . 
F 3 HOH 153 336 336 HOH HOH B . 
F 3 HOH 154 337 337 HOH HOH B . 
F 3 HOH 155 338 338 HOH HOH B . 
F 3 HOH 156 339 339 HOH HOH B . 
F 3 HOH 157 341 341 HOH HOH B . 
F 3 HOH 158 344 344 HOH HOH B . 
F 3 HOH 159 347 347 HOH HOH B . 
F 3 HOH 160 349 349 HOH HOH B . 
F 3 HOH 161 351 351 HOH HOH B . 
F 3 HOH 162 356 356 HOH HOH B . 
F 3 HOH 163 357 357 HOH HOH B . 
F 3 HOH 164 358 358 HOH HOH B . 
F 3 HOH 165 360 360 HOH HOH B . 
F 3 HOH 166 371 371 HOH HOH B . 
F 3 HOH 167 375 375 HOH HOH B . 
F 3 HOH 168 376 376 HOH HOH B . 
F 3 HOH 169 377 377 HOH HOH B . 
F 3 HOH 170 386 386 HOH HOH B . 
F 3 HOH 171 389 389 HOH HOH B . 
F 3 HOH 172 391 391 HOH HOH B . 
#