data_3FA9
# 
_entry.id   3FA9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3FA9         
RCSB  RCSB050342   
WWPDB D_1000050342 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2FS6 'apo wild-type CRABPII'                                               unspecified 
PDB 2FS7 'apo wild-type CRABPII'                                               unspecified 
PDB 3CR6 'Another CRABPII mutant complexed with C15-aldehyde'                  unspecified 
PDB 3F8A 'Another CRABPII mutant complexed with C15-aldehyde'                  unspecified 
PDB 3F9D 'Another CRABPII R132K:R111L:T54E mutant complexed with C15-aldehyde' unspecified 
PDB 3FA6 'CRABPII R132K:Y134F:R111L:L121D:T54V MUTANT'                         unspecified 
PDB 3FA7 'CRABPII R132K:R111L:L121E:R59E MUTANT'                               unspecified 
PDB 3FA8 'CRABPII R132K:Y134F:R111L:L121E MUTANT'                              unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3FA9 
_pdbx_database_status.recvd_initial_deposition_date   2008-11-16 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Jia, X.'      1 
'Geiger, J.H.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structures of apo cellular retinoic acid-binding protein II mutants: 
Structural integrity investigated through multiple site mutations
;
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Jia, X.'       1 
primary 'Lee, K.S.'     2 
primary 'Vasileiou, C.' 3 
primary 'Borhan, B.'    4 
primary 'Geiger, J.H.'  5 
# 
_cell.entry_id           3FA9 
_cell.length_a           34.637 
_cell.length_b           37.173 
_cell.length_c           60.531 
_cell.angle_alpha        74.18 
_cell.angle_beta         73.24 
_cell.angle_gamma        90.51 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3FA9 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Cellular retinoic acid-binding protein 2' 15495.683 2   ? 'R132K, Y134F, R111L, L121D' ? ? 
2 non-polymer syn 'ACETATE ION'                              59.044    1   ? ?                            ? ? 
3 water       nat water                                      18.015    160 ? ?                            ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Cellular retinoic acid-binding protein II, CRABP-II' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP
CKSLVKWESENKMVCEQKLLKGEGPKTSWTLELTNDGELIDTMTADDVVCTKVFVRE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP
CKSLVKWESENKMVCEQKLLKGEGPKTSWTLELTNDGELIDTMTADDVVCTKVFVRE
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   ASN n 
1 3   PHE n 
1 4   SER n 
1 5   GLY n 
1 6   ASN n 
1 7   TRP n 
1 8   LYS n 
1 9   ILE n 
1 10  ILE n 
1 11  ARG n 
1 12  SER n 
1 13  GLU n 
1 14  ASN n 
1 15  PHE n 
1 16  GLU n 
1 17  GLU n 
1 18  LEU n 
1 19  LEU n 
1 20  LYS n 
1 21  VAL n 
1 22  LEU n 
1 23  GLY n 
1 24  VAL n 
1 25  ASN n 
1 26  VAL n 
1 27  MET n 
1 28  LEU n 
1 29  ARG n 
1 30  LYS n 
1 31  ILE n 
1 32  ALA n 
1 33  VAL n 
1 34  ALA n 
1 35  ALA n 
1 36  ALA n 
1 37  SER n 
1 38  LYS n 
1 39  PRO n 
1 40  ALA n 
1 41  VAL n 
1 42  GLU n 
1 43  ILE n 
1 44  LYS n 
1 45  GLN n 
1 46  GLU n 
1 47  GLY n 
1 48  ASP n 
1 49  THR n 
1 50  PHE n 
1 51  TYR n 
1 52  ILE n 
1 53  LYS n 
1 54  THR n 
1 55  SER n 
1 56  THR n 
1 57  THR n 
1 58  VAL n 
1 59  ARG n 
1 60  THR n 
1 61  THR n 
1 62  GLU n 
1 63  ILE n 
1 64  ASN n 
1 65  PHE n 
1 66  LYS n 
1 67  VAL n 
1 68  GLY n 
1 69  GLU n 
1 70  GLU n 
1 71  PHE n 
1 72  GLU n 
1 73  GLU n 
1 74  GLN n 
1 75  THR n 
1 76  VAL n 
1 77  ASP n 
1 78  GLY n 
1 79  ARG n 
1 80  PRO n 
1 81  CYS n 
1 82  LYS n 
1 83  SER n 
1 84  LEU n 
1 85  VAL n 
1 86  LYS n 
1 87  TRP n 
1 88  GLU n 
1 89  SER n 
1 90  GLU n 
1 91  ASN n 
1 92  LYS n 
1 93  MET n 
1 94  VAL n 
1 95  CYS n 
1 96  GLU n 
1 97  GLN n 
1 98  LYS n 
1 99  LEU n 
1 100 LEU n 
1 101 LYS n 
1 102 GLY n 
1 103 GLU n 
1 104 GLY n 
1 105 PRO n 
1 106 LYS n 
1 107 THR n 
1 108 SER n 
1 109 TRP n 
1 110 THR n 
1 111 LEU n 
1 112 GLU n 
1 113 LEU n 
1 114 THR n 
1 115 ASN n 
1 116 ASP n 
1 117 GLY n 
1 118 GLU n 
1 119 LEU n 
1 120 ILE n 
1 121 ASP n 
1 122 THR n 
1 123 MET n 
1 124 THR n 
1 125 ALA n 
1 126 ASP n 
1 127 ASP n 
1 128 VAL n 
1 129 VAL n 
1 130 CYS n 
1 131 THR n 
1 132 LYS n 
1 133 VAL n 
1 134 PHE n 
1 135 VAL n 
1 136 ARG n 
1 137 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 CRABP2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       CRABPII-pET17b-KFLD 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RABP2_HUMAN 
_struct_ref.pdbx_db_accession          P29373 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP
CKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
;
_struct_ref.pdbx_align_begin           2 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3FA9 A 1 ? 137 ? P29373 2 ? 138 ? 1 137 
2 1 3FA9 B 1 ? 137 ? P29373 2 ? 138 ? 1 137 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3FA9 LEU A 111 ? UNP P29373 ARG 112 ENGINEERED 111 1 
1 3FA9 ASP A 121 ? UNP P29373 LEU 122 ENGINEERED 121 2 
1 3FA9 LYS A 132 ? UNP P29373 ARG 133 ENGINEERED 132 3 
1 3FA9 PHE A 134 ? UNP P29373 TYR 135 ENGINEERED 134 4 
2 3FA9 LEU B 111 ? UNP P29373 ARG 112 ENGINEERED 111 5 
2 3FA9 ASP B 121 ? UNP P29373 LEU 122 ENGINEERED 121 6 
2 3FA9 LYS B 132 ? UNP P29373 ARG 133 ENGINEERED 132 7 
2 3FA9 PHE B 134 ? UNP P29373 TYR 135 ENGINEERED 134 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer         . 'ACETATE ION'   ? 'C2 H3 O2 -1'    59.044  
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3FA9 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.30 
_exptl_crystal.density_percent_sol   46.61 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.1 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1M BTP, 22% PEG4000, pH 8.1, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2006-03-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0332 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0332 
# 
_reflns.entry_id                     3FA9 
_reflns.observed_criterion_sigma_I   1 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             55.56 
_reflns.d_resolution_high            1.94 
_reflns.number_obs                   22554 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         87.9 
_reflns.pdbx_Rmerge_I_obs            0.055 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.3 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              1.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.94 
_reflns_shell.d_res_low              2.03 
_reflns_shell.percent_possible_all   88.4 
_reflns_shell.Rmerge_I_obs           0.299 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.2 
_reflns_shell.pdbx_redundancy        1.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3FA9 
_refine.ls_number_reflns_obs                     16634 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.36 
_refine.ls_d_res_high                            1.94 
_refine.ls_percent_reflns_obs                    90.47 
_refine.ls_R_factor_obs                          0.21573 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20873 
_refine.ls_R_factor_R_free                       0.27598 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.3 
_refine.ls_number_reflns_R_free                  1907 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.950 
_refine.correlation_coeff_Fo_to_Fc_free          0.917 
_refine.B_iso_mean                               30.293 
_refine.aniso_B[1][1]                            0.56 
_refine.aniso_B[2][2]                            -1.05 
_refine.aniso_B[3][3]                            1.24 
_refine.aniso_B[1][2]                            0.54 
_refine.aniso_B[1][3]                            -1.30 
_refine.aniso_B[2][3]                            0.03 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.247 
_refine.pdbx_overall_ESU_R_Free                  0.216 
_refine.overall_SU_ML                            0.144 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             4.914 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2170 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             160 
_refine_hist.number_atoms_total               2334 
_refine_hist.d_res_high                       1.94 
_refine_hist.d_res_low                        19.36 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.007  0.022  ? 2216 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.091  1.964  ? 2992 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.715  5.000  ? 276  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       32.416 25.876 ? 97   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.916 15.000 ? 430  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       20.782 15.000 ? 10   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.075  0.200  ? 349  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.020  ? 1610 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.213  0.300  ? 879  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.321  0.500  ? 1487 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.207  0.500  ? 241  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.243  0.300  ? 43   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.269  0.500  ? 13   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.977  2.000  ? 1415 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.537  3.000  ? 2235 'X-RAY DIFFRACTION' ? 
r_scbond_it                  0.807  2.000  ? 905  'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.259  3.000  ? 755  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.940 
_refine_ls_shell.d_res_low                        1.990 
_refine_ls_shell.number_reflns_R_work             1166 
_refine_ls_shell.R_factor_R_work                  0.235 
_refine_ls_shell.percent_reflns_obs               87.73 
_refine_ls_shell.R_factor_R_free                  0.299 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             143 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                  3FA9 
_struct.title                     
;Crystal structure of the apo R132K:Y134F:R111L:L121D mutant of cellular retinoic acid-binding protein II at 1.94 angstrom resolution
;
_struct.pdbx_descriptor           'Cellular retinoic acid-binding protein 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3FA9 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
_struct_keywords.text            
'CRABPII, retinoic acid, retinoid, Nucleus, Retinol-binding, Transport, Vitamin A, TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASN A 14 ? LEU A 22 ? ASN A 14 LEU A 22 1 ? 9  
HELX_P HELX_P2 2 ASN A 25 ? VAL A 33 ? ASN A 25 VAL A 33 1 ? 9  
HELX_P HELX_P3 3 ALA A 34 ? LYS A 38 ? ALA A 34 LYS A 38 5 ? 5  
HELX_P HELX_P4 4 ASN B 14 ? LEU B 22 ? ASN B 14 LEU B 22 1 ? 9  
HELX_P HELX_P5 5 ASN B 25 ? ALA B 36 ? ASN B 25 ALA B 36 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 10 ? 
B ? 10 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2  ? anti-parallel 
A 2 3  ? anti-parallel 
A 3 4  ? anti-parallel 
A 4 5  ? anti-parallel 
A 5 6  ? anti-parallel 
A 6 7  ? anti-parallel 
A 7 8  ? anti-parallel 
A 8 9  ? anti-parallel 
A 9 10 ? anti-parallel 
B 1 2  ? anti-parallel 
B 2 3  ? anti-parallel 
B 3 4  ? anti-parallel 
B 4 5  ? anti-parallel 
B 5 6  ? anti-parallel 
B 6 7  ? anti-parallel 
B 7 8  ? anti-parallel 
B 8 9  ? anti-parallel 
B 9 10 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  THR A 60  ? LYS A 66  ? THR A 60  LYS A 66  
A 2  THR A 49  ? SER A 55  ? THR A 49  SER A 55  
A 3  ALA A 40  ? GLU A 46  ? ALA A 40  GLU A 46  
A 4  GLY A 5   ? GLU A 13  ? GLY A 5   GLU A 13  
A 5  VAL A 128 ? ARG A 136 ? VAL A 128 ARG A 136 
A 6  GLU A 118 ? ALA A 125 ? GLU A 118 ALA A 125 
A 7  THR A 107 ? LEU A 113 ? THR A 107 LEU A 113 
A 8  LYS A 92  ? LEU A 99  ? LYS A 92  LEU A 99  
A 9  PRO A 80  ? SER A 89  ? PRO A 80  SER A 89  
A 10 PHE A 71  ? GLN A 74  ? PHE A 71  GLN A 74  
B 1  THR B 60  ? LYS B 66  ? THR B 60  LYS B 66  
B 2  THR B 49  ? SER B 55  ? THR B 49  SER B 55  
B 3  ALA B 40  ? GLU B 46  ? ALA B 40  GLU B 46  
B 4  GLY B 5   ? GLU B 13  ? GLY B 5   GLU B 13  
B 5  VAL B 128 ? ARG B 136 ? VAL B 128 ARG B 136 
B 6  GLU B 118 ? ALA B 125 ? GLU B 118 ALA B 125 
B 7  THR B 107 ? LEU B 113 ? THR B 107 LEU B 113 
B 8  LYS B 92  ? LEU B 99  ? LYS B 92  LEU B 99  
B 9  PRO B 80  ? TRP B 87  ? PRO B 80  TRP B 87  
B 10 PHE B 71  ? GLN B 74  ? PHE B 71  GLN B 74  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2  O PHE A 65  ? O PHE A 65  N PHE A 50  ? N PHE A 50  
A 2 3  O THR A 49  ? O THR A 49  N GLU A 46  ? N GLU A 46  
A 3 4  O VAL A 41  ? O VAL A 41  N TRP A 7   ? N TRP A 7   
A 4 5  N ILE A 10  ? N ILE A 10  O VAL A 133 ? O VAL A 133 
A 5 6  O LYS A 132 ? O LYS A 132 N ASP A 121 ? N ASP A 121 
A 6 7  O ILE A 120 ? O ILE A 120 N GLU A 112 ? N GLU A 112 
A 7 8  O TRP A 109 ? O TRP A 109 N CYS A 95  ? N CYS A 95  
A 8 9  O LYS A 92  ? O LYS A 92  N GLU A 88  ? N GLU A 88  
A 9 10 O SER A 83  ? O SER A 83  N PHE A 71  ? N PHE A 71  
B 1 2  O PHE B 65  ? O PHE B 65  N PHE B 50  ? N PHE B 50  
B 2 3  O LYS B 53  ? O LYS B 53  N GLU B 42  ? N GLU B 42  
B 3 4  O VAL B 41  ? O VAL B 41  N TRP B 7   ? N TRP B 7   
B 4 5  N ILE B 10  ? N ILE B 10  O VAL B 133 ? O VAL B 133 
B 5 6  O CYS B 130 ? O CYS B 130 N MET B 123 ? N MET B 123 
B 6 7  O ILE B 120 ? O ILE B 120 N GLU B 112 ? N GLU B 112 
B 7 8  O TRP B 109 ? O TRP B 109 N CYS B 95  ? N CYS B 95  
B 8 9  O LYS B 98  ? O LYS B 98  N LYS B 82  ? N LYS B 82  
B 9 10 O SER B 83  ? O SER B 83  N PHE B 71  ? N PHE B 71  
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE ACT B 138' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 SER B 12  ? SER B 12  . ? 1_555 ? 
2 AC1 4 PHE B 15  ? PHE B 15  . ? 1_555 ? 
3 AC1 4 ALA B 36  ? ALA B 36  . ? 1_555 ? 
4 AC1 4 LYS B 132 ? LYS B 132 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3FA9 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3FA9 
_atom_sites.fract_transf_matrix[1][1]   0.028871 
_atom_sites.fract_transf_matrix[1][2]   0.000257 
_atom_sites.fract_transf_matrix[1][3]   -0.009155 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.026902 
_atom_sites.fract_transf_matrix[2][3]   -0.008072 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018013 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A 1 1   ? 0.930   16.345  -7.781  1.00 36.85 ? 1   PRO A N   1 
ATOM   2    C CA  . PRO A 1 1   ? 1.592   15.082  -7.462  1.00 35.53 ? 1   PRO A CA  1 
ATOM   3    C C   . PRO A 1 1   ? 1.877   14.965  -5.966  1.00 33.86 ? 1   PRO A C   1 
ATOM   4    O O   . PRO A 1 1   ? 2.948   14.508  -5.584  1.00 34.88 ? 1   PRO A O   1 
ATOM   5    C CB  . PRO A 1 1   ? 2.910   15.181  -8.234  1.00 36.07 ? 1   PRO A CB  1 
ATOM   6    C CG  . PRO A 1 1   ? 2.608   16.069  -9.375  1.00 37.25 ? 1   PRO A CG  1 
ATOM   7    C CD  . PRO A 1 1   ? 1.647   17.094  -8.831  1.00 37.11 ? 1   PRO A CD  1 
ATOM   8    N N   . ASN A 1 2   ? 0.924   15.374  -5.134  1.00 31.08 ? 2   ASN A N   1 
ATOM   9    C CA  . ASN A 1 2   ? 1.103   15.348  -3.683  1.00 28.35 ? 2   ASN A CA  1 
ATOM   10   C C   . ASN A 1 2   ? 0.251   14.251  -3.005  1.00 26.12 ? 2   ASN A C   1 
ATOM   11   O O   . ASN A 1 2   ? -0.970  14.337  -2.979  1.00 25.08 ? 2   ASN A O   1 
ATOM   12   C CB  . ASN A 1 2   ? 0.783   16.729  -3.095  1.00 27.58 ? 2   ASN A CB  1 
ATOM   13   C CG  . ASN A 1 2   ? 1.319   16.899  -1.689  1.00 27.79 ? 2   ASN A CG  1 
ATOM   14   O OD1 . ASN A 1 2   ? 1.505   15.919  -0.968  1.00 26.95 ? 2   ASN A OD1 1 
ATOM   15   N ND2 . ASN A 1 2   ? 1.587   18.151  -1.295  1.00 27.16 ? 2   ASN A ND2 1 
ATOM   16   N N   . PHE A 1 3   ? 0.900   13.226  -2.464  1.00 23.72 ? 3   PHE A N   1 
ATOM   17   C CA  . PHE A 1 3   ? 0.179   12.089  -1.858  1.00 22.75 ? 3   PHE A CA  1 
ATOM   18   C C   . PHE A 1 3   ? -0.269  12.373  -0.411  1.00 22.46 ? 3   PHE A C   1 
ATOM   19   O O   . PHE A 1 3   ? -0.905  11.523  0.232   1.00 22.14 ? 3   PHE A O   1 
ATOM   20   C CB  . PHE A 1 3   ? 1.045   10.808  -1.873  1.00 22.13 ? 3   PHE A CB  1 
ATOM   21   C CG  . PHE A 1 3   ? 1.178   10.155  -3.237  1.00 22.90 ? 3   PHE A CG  1 
ATOM   22   C CD1 . PHE A 1 3   ? 1.932   10.752  -4.244  1.00 23.55 ? 3   PHE A CD1 1 
ATOM   23   C CD2 . PHE A 1 3   ? 0.565   8.939   -3.506  1.00 22.70 ? 3   PHE A CD2 1 
ATOM   24   C CE1 . PHE A 1 3   ? 2.068   10.143  -5.487  1.00 23.17 ? 3   PHE A CE1 1 
ATOM   25   C CE2 . PHE A 1 3   ? 0.693   8.338   -4.744  1.00 22.81 ? 3   PHE A CE2 1 
ATOM   26   C CZ  . PHE A 1 3   ? 1.438   8.945   -5.738  1.00 22.42 ? 3   PHE A CZ  1 
ATOM   27   N N   . SER A 1 4   ? 0.076   13.543  0.113   1.00 21.76 ? 4   SER A N   1 
ATOM   28   C CA  . SER A 1 4   ? -0.167  13.821  1.530   1.00 21.77 ? 4   SER A CA  1 
ATOM   29   C C   . SER A 1 4   ? -1.652  13.876  1.854   1.00 21.10 ? 4   SER A C   1 
ATOM   30   O O   . SER A 1 4   ? -2.467  14.249  1.010   1.00 21.48 ? 4   SER A O   1 
ATOM   31   C CB  . SER A 1 4   ? 0.508   15.120  1.982   1.00 22.10 ? 4   SER A CB  1 
ATOM   32   O OG  . SER A 1 4   ? 1.864   15.171  1.572   1.00 23.27 ? 4   SER A OG  1 
ATOM   33   N N   . GLY A 1 5   ? -1.992  13.503  3.087   1.00 21.55 ? 5   GLY A N   1 
ATOM   34   C CA  . GLY A 1 5   ? -3.365  13.579  3.556   1.00 21.58 ? 5   GLY A CA  1 
ATOM   35   C C   . GLY A 1 5   ? -3.743  12.434  4.473   1.00 21.95 ? 5   GLY A C   1 
ATOM   36   O O   . GLY A 1 5   ? -2.932  11.551  4.754   1.00 20.37 ? 5   GLY A O   1 
ATOM   37   N N   . ASN A 1 6   ? -4.989  12.470  4.929   1.00 22.46 ? 6   ASN A N   1 
ATOM   38   C CA  . ASN A 1 6   ? -5.571  11.427  5.755   1.00 23.09 ? 6   ASN A CA  1 
ATOM   39   C C   . ASN A 1 6   ? -6.584  10.686  4.910   1.00 21.48 ? 6   ASN A C   1 
ATOM   40   O O   . ASN A 1 6   ? -7.639  11.217  4.581   1.00 21.28 ? 6   ASN A O   1 
ATOM   41   C CB  . ASN A 1 6   ? -6.246  12.058  6.976   1.00 25.13 ? 6   ASN A CB  1 
ATOM   42   C CG  . ASN A 1 6   ? -5.252  12.754  7.873   1.00 26.68 ? 6   ASN A CG  1 
ATOM   43   O OD1 . ASN A 1 6   ? -4.366  12.115  8.430   1.00 28.65 ? 6   ASN A OD1 1 
ATOM   44   N ND2 . ASN A 1 6   ? -5.371  14.059  7.992   1.00 27.30 ? 6   ASN A ND2 1 
ATOM   45   N N   . TRP A 1 7   ? -6.238  9.461   4.546   1.00 20.40 ? 7   TRP A N   1 
ATOM   46   C CA  . TRP A 1 7   ? -6.931  8.731   3.505   1.00 19.65 ? 7   TRP A CA  1 
ATOM   47   C C   . TRP A 1 7   ? -7.871  7.701   4.125   1.00 19.70 ? 7   TRP A C   1 
ATOM   48   O O   . TRP A 1 7   ? -7.465  6.958   5.024   1.00 19.80 ? 7   TRP A O   1 
ATOM   49   C CB  . TRP A 1 7   ? -5.901  8.039   2.597   1.00 18.59 ? 7   TRP A CB  1 
ATOM   50   C CG  . TRP A 1 7   ? -5.046  8.991   1.775   1.00 18.78 ? 7   TRP A CG  1 
ATOM   51   C CD1 . TRP A 1 7   ? -3.789  9.444   2.075   1.00 18.40 ? 7   TRP A CD1 1 
ATOM   52   C CD2 . TRP A 1 7   ? -5.393  9.588   0.517   1.00 18.07 ? 7   TRP A CD2 1 
ATOM   53   N NE1 . TRP A 1 7   ? -3.339  10.289  1.084   1.00 18.16 ? 7   TRP A NE1 1 
ATOM   54   C CE2 . TRP A 1 7   ? -4.310  10.395  0.122   1.00 18.36 ? 7   TRP A CE2 1 
ATOM   55   C CE3 . TRP A 1 7   ? -6.520  9.520   -0.313  1.00 18.97 ? 7   TRP A CE3 1 
ATOM   56   C CZ2 . TRP A 1 7   ? -4.317  11.123  -1.070  1.00 19.00 ? 7   TRP A CZ2 1 
ATOM   57   C CZ3 . TRP A 1 7   ? -6.531  10.259  -1.489  1.00 18.43 ? 7   TRP A CZ3 1 
ATOM   58   C CH2 . TRP A 1 7   ? -5.432  11.038  -1.861  1.00 18.38 ? 7   TRP A CH2 1 
ATOM   59   N N   . LYS A 1 8   ? -9.120  7.661   3.654   1.00 19.43 ? 8   LYS A N   1 
ATOM   60   C CA  . LYS A 1 8   ? -10.129 6.715   4.173   1.00 19.53 ? 8   LYS A CA  1 
ATOM   61   C C   . LYS A 1 8   ? -10.549 5.740   3.074   1.00 19.12 ? 8   LYS A C   1 
ATOM   62   O O   . LYS A 1 8   ? -10.775 6.152   1.943   1.00 19.62 ? 8   LYS A O   1 
ATOM   63   C CB  . LYS A 1 8   ? -11.366 7.464   4.680   1.00 19.94 ? 8   LYS A CB  1 
ATOM   64   C CG  . LYS A 1 8   ? -11.074 8.635   5.623   1.00 21.58 ? 8   LYS A CG  1 
ATOM   65   C CD  . LYS A 1 8   ? -10.234 8.211   6.825   1.00 22.52 ? 8   LYS A CD  1 
ATOM   66   C CE  . LYS A 1 8   ? -9.807  9.415   7.653   1.00 23.91 ? 8   LYS A CE  1 
ATOM   67   N NZ  . LYS A 1 8   ? -9.271  8.972   8.964   1.00 24.84 ? 8   LYS A NZ  1 
ATOM   68   N N   . ILE A 1 9   ? -10.658 4.459   3.404   1.00 18.64 ? 9   ILE A N   1 
ATOM   69   C CA  . ILE A 1 9   ? -10.853 3.449   2.392   1.00 18.27 ? 9   ILE A CA  1 
ATOM   70   C C   . ILE A 1 9   ? -12.299 3.464   1.892   1.00 19.15 ? 9   ILE A C   1 
ATOM   71   O O   . ILE A 1 9   ? -13.260 3.547   2.682   1.00 18.29 ? 9   ILE A O   1 
ATOM   72   C CB  . ILE A 1 9   ? -10.362 2.040   2.859   1.00 18.42 ? 9   ILE A CB  1 
ATOM   73   C CG1 . ILE A 1 9   ? -10.411 1.024   1.720   1.00 17.90 ? 9   ILE A CG1 1 
ATOM   74   C CG2 . ILE A 1 9   ? -11.091 1.559   4.134   1.00 18.91 ? 9   ILE A CG2 1 
ATOM   75   C CD1 . ILE A 1 9   ? -9.854  -0.380  2.118   1.00 18.28 ? 9   ILE A CD1 1 
ATOM   76   N N   . ILE A 1 10  ? -12.455 3.466   0.571   1.00 17.63 ? 10  ILE A N   1 
ATOM   77   C CA  . ILE A 1 10  ? -13.801 3.440   -0.002  1.00 17.42 ? 10  ILE A CA  1 
ATOM   78   C C   . ILE A 1 10  ? -14.045 2.221   -0.886  1.00 17.15 ? 10  ILE A C   1 
ATOM   79   O O   . ILE A 1 10  ? -15.189 1.924   -1.226  1.00 16.16 ? 10  ILE A O   1 
ATOM   80   C CB  . ILE A 1 10  ? -14.086 4.700   -0.820  1.00 17.25 ? 10  ILE A CB  1 
ATOM   81   C CG1 . ILE A 1 10  ? -13.173 4.748   -2.043  1.00 16.60 ? 10  ILE A CG1 1 
ATOM   82   C CG2 . ILE A 1 10  ? -13.900 5.944   0.054   1.00 17.34 ? 10  ILE A CG2 1 
ATOM   83   C CD1 . ILE A 1 10  ? -13.645 5.717   -3.154  1.00 16.49 ? 10  ILE A CD1 1 
ATOM   84   N N   . ARG A 1 11  ? -12.979 1.526   -1.273  1.00 17.28 ? 11  ARG A N   1 
ATOM   85   C CA  . ARG A 1 11  ? -13.120 0.294   -2.062  1.00 18.31 ? 11  ARG A CA  1 
ATOM   86   C C   . ARG A 1 11  ? -12.037 -0.709  -1.676  1.00 17.45 ? 11  ARG A C   1 
ATOM   87   O O   . ARG A 1 11  ? -10.898 -0.334  -1.393  1.00 17.48 ? 11  ARG A O   1 
ATOM   88   C CB  . ARG A 1 11  ? -13.006 0.552   -3.575  1.00 19.59 ? 11  ARG A CB  1 
ATOM   89   C CG  . ARG A 1 11  ? -14.041 1.457   -4.220  1.00 20.54 ? 11  ARG A CG  1 
ATOM   90   C CD  . ARG A 1 11  ? -15.462 0.853   -4.248  1.00 21.44 ? 11  ARG A CD  1 
ATOM   91   N NE  . ARG A 1 11  ? -15.524 -0.353  -5.077  1.00 22.43 ? 11  ARG A NE  1 
ATOM   92   C CZ  . ARG A 1 11  ? -15.839 -0.365  -6.372  1.00 21.94 ? 11  ARG A CZ  1 
ATOM   93   N NH1 . ARG A 1 11  ? -15.856 -1.516  -7.041  1.00 23.69 ? 11  ARG A NH1 1 
ATOM   94   N NH2 . ARG A 1 11  ? -16.145 0.756   -6.998  1.00 21.39 ? 11  ARG A NH2 1 
ATOM   95   N N   . SER A 1 12  ? -12.393 -1.985  -1.647  1.00 17.96 ? 12  SER A N   1 
ATOM   96   C CA  . SER A 1 12  ? -11.399 -3.041  -1.462  1.00 18.40 ? 12  SER A CA  1 
ATOM   97   C C   . SER A 1 12  ? -11.784 -4.237  -2.328  1.00 19.15 ? 12  SER A C   1 
ATOM   98   O O   . SER A 1 12  ? -12.940 -4.680  -2.306  1.00 19.43 ? 12  SER A O   1 
ATOM   99   C CB  . SER A 1 12  ? -11.322 -3.445  0.010   1.00 18.40 ? 12  SER A CB  1 
ATOM   100  O OG  . SER A 1 12  ? -10.367 -4.459  0.223   1.00 18.91 ? 12  SER A OG  1 
ATOM   101  N N   . GLU A 1 13  ? -10.823 -4.778  -3.072  1.00 18.98 ? 13  GLU A N   1 
ATOM   102  C CA  . GLU A 1 13  ? -11.139 -5.837  -4.005  1.00 20.44 ? 13  GLU A CA  1 
ATOM   103  C C   . GLU A 1 13  ? -10.110 -6.955  -3.969  1.00 20.22 ? 13  GLU A C   1 
ATOM   104  O O   . GLU A 1 13  ? -8.923  -6.700  -4.104  1.00 20.67 ? 13  GLU A O   1 
ATOM   105  C CB  . GLU A 1 13  ? -11.279 -5.267  -5.428  1.00 21.29 ? 13  GLU A CB  1 
ATOM   106  C CG  . GLU A 1 13  ? -11.778 -6.284  -6.459  1.00 22.87 ? 13  GLU A CG  1 
ATOM   107  C CD  . GLU A 1 13  ? -13.256 -6.616  -6.300  1.00 23.92 ? 13  GLU A CD  1 
ATOM   108  O OE1 . GLU A 1 13  ? -14.061 -5.718  -5.973  1.00 25.12 ? 13  GLU A OE1 1 
ATOM   109  O OE2 . GLU A 1 13  ? -13.619 -7.785  -6.499  1.00 25.63 ? 13  GLU A OE2 1 
ATOM   110  N N   . ASN A 1 14  ? -10.580 -8.178  -3.723  1.00 19.96 ? 14  ASN A N   1 
ATOM   111  C CA  . ASN A 1 14  ? -9.761  -9.386  -3.785  1.00 20.60 ? 14  ASN A CA  1 
ATOM   112  C C   . ASN A 1 14  ? -8.789  -9.562  -2.616  1.00 21.08 ? 14  ASN A C   1 
ATOM   113  O O   . ASN A 1 14  ? -7.830  -10.323 -2.717  1.00 21.20 ? 14  ASN A O   1 
ATOM   114  C CB  . ASN A 1 14  ? -8.995  -9.439  -5.105  1.00 20.51 ? 14  ASN A CB  1 
ATOM   115  C CG  . ASN A 1 14  ? -8.705  -10.837 -5.542  1.00 20.14 ? 14  ASN A CG  1 
ATOM   116  O OD1 . ASN A 1 14  ? -9.474  -11.749 -5.268  1.00 21.00 ? 14  ASN A OD1 1 
ATOM   117  N ND2 . ASN A 1 14  ? -7.595  -11.024 -6.232  1.00 20.67 ? 14  ASN A ND2 1 
ATOM   118  N N   . PHE A 1 15  ? -9.045  -8.879  -1.510  1.00 21.37 ? 15  PHE A N   1 
ATOM   119  C CA  . PHE A 1 15  ? -8.096  -8.890  -0.413  1.00 22.89 ? 15  PHE A CA  1 
ATOM   120  C C   . PHE A 1 15  ? -8.104  -10.213 0.339   1.00 23.93 ? 15  PHE A C   1 
ATOM   121  O O   . PHE A 1 15  ? -7.047  -10.819 0.517   1.00 23.25 ? 15  PHE A O   1 
ATOM   122  C CB  . PHE A 1 15  ? -8.307  -7.710  0.529   1.00 24.22 ? 15  PHE A CB  1 
ATOM   123  C CG  . PHE A 1 15  ? -7.342  -7.680  1.675   1.00 24.81 ? 15  PHE A CG  1 
ATOM   124  C CD1 . PHE A 1 15  ? -5.972  -7.625  1.445   1.00 25.11 ? 15  PHE A CD1 1 
ATOM   125  C CD2 . PHE A 1 15  ? -7.799  -7.702  2.980   1.00 25.14 ? 15  PHE A CD2 1 
ATOM   126  C CE1 . PHE A 1 15  ? -5.075  -7.606  2.504   1.00 25.95 ? 15  PHE A CE1 1 
ATOM   127  C CE2 . PHE A 1 15  ? -6.917  -7.681  4.034   1.00 25.45 ? 15  PHE A CE2 1 
ATOM   128  C CZ  . PHE A 1 15  ? -5.548  -7.632  3.801   1.00 25.20 ? 15  PHE A CZ  1 
ATOM   129  N N   . GLU A 1 16  ? -9.276  -10.681 0.772   1.00 25.25 ? 16  GLU A N   1 
ATOM   130  C CA  . GLU A 1 16  ? -9.315  -11.955 1.492   1.00 26.80 ? 16  GLU A CA  1 
ATOM   131  C C   . GLU A 1 16  ? -8.879  -13.101 0.590   1.00 27.28 ? 16  GLU A C   1 
ATOM   132  O O   . GLU A 1 16  ? -8.249  -14.069 1.034   1.00 26.78 ? 16  GLU A O   1 
ATOM   133  C CB  . GLU A 1 16  ? -10.703 -12.274 2.036   1.00 29.10 ? 16  GLU A CB  1 
ATOM   134  C CG  . GLU A 1 16  ? -10.784 -13.744 2.413   1.00 31.30 ? 16  GLU A CG  1 
ATOM   135  C CD  . GLU A 1 16  ? -11.915 -14.085 3.339   1.00 32.82 ? 16  GLU A CD  1 
ATOM   136  O OE1 . GLU A 1 16  ? -12.947 -13.382 3.316   1.00 33.73 ? 16  GLU A OE1 1 
ATOM   137  O OE2 . GLU A 1 16  ? -11.760 -15.086 4.074   1.00 33.61 ? 16  GLU A OE2 1 
ATOM   138  N N   . GLU A 1 17  ? -9.232  -12.980 -0.681  1.00 27.94 ? 17  GLU A N   1 
ATOM   139  C CA  . GLU A 1 17  ? -8.935  -13.993 -1.680  1.00 30.12 ? 17  GLU A CA  1 
ATOM   140  C C   . GLU A 1 17  ? -7.427  -14.109 -1.894  1.00 30.83 ? 17  GLU A C   1 
ATOM   141  O O   . GLU A 1 17  ? -6.892  -15.208 -2.068  1.00 32.40 ? 17  GLU A O   1 
ATOM   142  C CB  . GLU A 1 17  ? -9.662  -13.652 -2.988  1.00 30.53 ? 17  GLU A CB  1 
ATOM   143  C CG  . GLU A 1 17  ? -11.195 -13.748 -2.905  1.00 31.16 ? 17  GLU A CG  1 
ATOM   144  C CD  . GLU A 1 17  ? -11.883 -12.494 -2.361  1.00 31.93 ? 17  GLU A CD  1 
ATOM   145  O OE1 . GLU A 1 17  ? -11.203 -11.536 -1.944  1.00 31.50 ? 17  GLU A OE1 1 
ATOM   146  O OE2 . GLU A 1 17  ? -13.131 -12.465 -2.350  1.00 33.11 ? 17  GLU A OE2 1 
ATOM   147  N N   . LEU A 1 18  ? -6.750  -12.969 -1.861  1.00 31.10 ? 18  LEU A N   1 
ATOM   148  C CA  . LEU A 1 18  ? -5.294  -12.909 -1.902  1.00 31.16 ? 18  LEU A CA  1 
ATOM   149  C C   . LEU A 1 18  ? -4.707  -13.604 -0.682  1.00 31.44 ? 18  LEU A C   1 
ATOM   150  O O   . LEU A 1 18  ? -3.847  -14.475 -0.808  1.00 32.38 ? 18  LEU A O   1 
ATOM   151  C CB  . LEU A 1 18  ? -4.816  -11.454 -1.952  1.00 31.26 ? 18  LEU A CB  1 
ATOM   152  C CG  . LEU A 1 18  ? -3.334  -11.187 -1.642  1.00 31.64 ? 18  LEU A CG  1 
ATOM   153  C CD1 . LEU A 1 18  ? -2.439  -11.944 -2.616  1.00 32.43 ? 18  LEU A CD1 1 
ATOM   154  C CD2 . LEU A 1 18  ? -3.003  -9.707  -1.667  1.00 31.45 ? 18  LEU A CD2 1 
ATOM   155  N N   . LEU A 1 19  ? -5.177  -13.223 0.501   1.00 30.12 ? 19  LEU A N   1 
ATOM   156  C CA  . LEU A 1 19  ? -4.761  -13.902 1.722   1.00 28.85 ? 19  LEU A CA  1 
ATOM   157  C C   . LEU A 1 19  ? -5.025  -15.411 1.639   1.00 28.75 ? 19  LEU A C   1 
ATOM   158  O O   . LEU A 1 19  ? -4.199  -16.213 2.054   1.00 29.78 ? 19  LEU A O   1 
ATOM   159  C CB  . LEU A 1 19  ? -5.455  -13.289 2.942   1.00 28.46 ? 19  LEU A CB  1 
ATOM   160  C CG  . LEU A 1 19  ? -5.196  -11.801 3.215   1.00 27.71 ? 19  LEU A CG  1 
ATOM   161  C CD1 . LEU A 1 19  ? -6.001  -11.332 4.421   1.00 27.93 ? 19  LEU A CD1 1 
ATOM   162  C CD2 . LEU A 1 19  ? -3.715  -11.516 3.418   1.00 28.11 ? 19  LEU A CD2 1 
ATOM   163  N N   . LYS A 1 20  ? -6.168  -15.800 1.092   1.00 28.99 ? 20  LYS A N   1 
ATOM   164  C CA  . LYS A 1 20  ? -6.489  -17.221 0.960   1.00 30.04 ? 20  LYS A CA  1 
ATOM   165  C C   . LYS A 1 20  ? -5.466  -18.015 0.143   1.00 31.01 ? 20  LYS A C   1 
ATOM   166  O O   . LYS A 1 20  ? -4.960  -19.038 0.607   1.00 31.23 ? 20  LYS A O   1 
ATOM   167  C CB  . LYS A 1 20  ? -7.886  -17.429 0.378   1.00 29.68 ? 20  LYS A CB  1 
ATOM   168  C CG  . LYS A 1 20  ? -8.274  -18.898 0.340   1.00 30.18 ? 20  LYS A CG  1 
ATOM   169  C CD  . LYS A 1 20  ? -9.716  -19.096 -0.050  1.00 29.23 ? 20  LYS A CD  1 
ATOM   170  C CE  . LYS A 1 20  ? -10.127 -20.557 0.104   1.00 28.60 ? 20  LYS A CE  1 
ATOM   171  N NZ  . LYS A 1 20  ? -11.536 -20.753 -0.343  1.00 28.02 ? 20  LYS A NZ  1 
ATOM   172  N N   . VAL A 1 21  ? -5.165  -17.558 -1.071  1.00 31.00 ? 21  VAL A N   1 
ATOM   173  C CA  . VAL A 1 21  ? -4.220  -18.277 -1.929  1.00 32.18 ? 21  VAL A CA  1 
ATOM   174  C C   . VAL A 1 21  ? -2.805  -18.280 -1.368  1.00 33.16 ? 21  VAL A C   1 
ATOM   175  O O   . VAL A 1 21  ? -1.972  -19.084 -1.785  1.00 34.87 ? 21  VAL A O   1 
ATOM   176  C CB  . VAL A 1 21  ? -4.192  -17.722 -3.379  1.00 32.15 ? 21  VAL A CB  1 
ATOM   177  C CG1 . VAL A 1 21  ? -5.591  -17.612 -3.926  1.00 32.62 ? 21  VAL A CG1 1 
ATOM   178  C CG2 . VAL A 1 21  ? -3.492  -16.369 -3.425  1.00 32.46 ? 21  VAL A CG2 1 
ATOM   179  N N   . LEU A 1 22  ? -2.532  -17.381 -0.429  1.00 33.30 ? 22  LEU A N   1 
ATOM   180  C CA  . LEU A 1 22  ? -1.227  -17.317 0.216   1.00 33.30 ? 22  LEU A CA  1 
ATOM   181  C C   . LEU A 1 22  ? -1.141  -18.294 1.386   1.00 33.53 ? 22  LEU A C   1 
ATOM   182  O O   . LEU A 1 22  ? -0.075  -18.478 1.964   1.00 33.28 ? 22  LEU A O   1 
ATOM   183  C CB  . LEU A 1 22  ? -0.934  -15.901 0.723   1.00 33.41 ? 22  LEU A CB  1 
ATOM   184  C CG  . LEU A 1 22  ? -0.741  -14.771 -0.287  1.00 33.96 ? 22  LEU A CG  1 
ATOM   185  C CD1 . LEU A 1 22  ? -0.588  -13.445 0.441   1.00 33.98 ? 22  LEU A CD1 1 
ATOM   186  C CD2 . LEU A 1 22  ? 0.475   -15.045 -1.155  1.00 34.25 ? 22  LEU A CD2 1 
ATOM   187  N N   . GLY A 1 23  ? -2.274  -18.891 1.751   1.00 33.74 ? 23  GLY A N   1 
ATOM   188  C CA  . GLY A 1 23  ? -2.304  -19.887 2.826   1.00 33.19 ? 23  GLY A CA  1 
ATOM   189  C C   . GLY A 1 23  ? -2.605  -19.335 4.207   1.00 33.69 ? 23  GLY A C   1 
ATOM   190  O O   . GLY A 1 23  ? -2.387  -20.011 5.219   1.00 33.70 ? 23  GLY A O   1 
ATOM   191  N N   . VAL A 1 24  ? -3.117  -18.108 4.260   1.00 32.99 ? 24  VAL A N   1 
ATOM   192  C CA  . VAL A 1 24  ? -3.486  -17.496 5.535   1.00 32.19 ? 24  VAL A CA  1 
ATOM   193  C C   . VAL A 1 24  ? -4.742  -18.180 6.074   1.00 32.19 ? 24  VAL A C   1 
ATOM   194  O O   . VAL A 1 24  ? -5.736  -18.306 5.361   1.00 30.84 ? 24  VAL A O   1 
ATOM   195  C CB  . VAL A 1 24  ? -3.720  -15.982 5.375   1.00 31.61 ? 24  VAL A CB  1 
ATOM   196  C CG1 . VAL A 1 24  ? -4.313  -15.403 6.630   1.00 31.86 ? 24  VAL A CG1 1 
ATOM   197  C CG2 . VAL A 1 24  ? -2.411  -15.278 5.016   1.00 31.50 ? 24  VAL A CG2 1 
ATOM   198  N N   . ASN A 1 25  ? -4.690  -18.634 7.328   1.00 32.56 ? 25  ASN A N   1 
ATOM   199  C CA  . ASN A 1 25  ? -5.783  -19.421 7.896   1.00 32.75 ? 25  ASN A CA  1 
ATOM   200  C C   . ASN A 1 25  ? -7.070  -18.611 7.982   1.00 32.52 ? 25  ASN A C   1 
ATOM   201  O O   . ASN A 1 25  ? -7.033  -17.386 8.047   1.00 32.17 ? 25  ASN A O   1 
ATOM   202  C CB  . ASN A 1 25  ? -5.391  -20.032 9.255   1.00 33.72 ? 25  ASN A CB  1 
ATOM   203  C CG  . ASN A 1 25  ? -5.434  -19.033 10.388  1.00 34.79 ? 25  ASN A CG  1 
ATOM   204  O OD1 . ASN A 1 25  ? -6.460  -18.405 10.638  1.00 35.09 ? 25  ASN A OD1 1 
ATOM   205  N ND2 . ASN A 1 25  ? -4.320  -18.901 11.105  1.00 35.74 ? 25  ASN A ND2 1 
ATOM   206  N N   . VAL A 1 26  ? -8.207  -19.296 7.968   1.00 32.40 ? 26  VAL A N   1 
ATOM   207  C CA  . VAL A 1 26  ? -9.499  -18.628 7.812   1.00 33.00 ? 26  VAL A CA  1 
ATOM   208  C C   . VAL A 1 26  ? -9.828  -17.643 8.941   1.00 33.67 ? 26  VAL A C   1 
ATOM   209  O O   . VAL A 1 26  ? -10.549 -16.668 8.722   1.00 33.12 ? 26  VAL A O   1 
ATOM   210  C CB  . VAL A 1 26  ? -10.652 -19.646 7.586   1.00 32.86 ? 26  VAL A CB  1 
ATOM   211  C CG1 . VAL A 1 26  ? -10.764 -20.622 8.759   1.00 33.38 ? 26  VAL A CG1 1 
ATOM   212  C CG2 . VAL A 1 26  ? -11.978 -18.930 7.324   1.00 32.82 ? 26  VAL A CG2 1 
ATOM   213  N N   . MET A 1 27  ? -9.287  -17.903 10.131  1.00 34.38 ? 27  MET A N   1 
ATOM   214  C CA  . MET A 1 27  ? -9.489  -17.053 11.300  1.00 34.99 ? 27  MET A CA  1 
ATOM   215  C C   . MET A 1 27  ? -8.914  -15.657 11.069  1.00 35.16 ? 27  MET A C   1 
ATOM   216  O O   . MET A 1 27  ? -9.601  -14.644 11.244  1.00 35.12 ? 27  MET A O   1 
ATOM   217  C CB  . MET A 1 27  ? -8.826  -17.682 12.529  0.80 35.04 ? 27  MET A CB  1 
ATOM   218  C CG  . MET A 1 27  ? -9.392  -19.032 12.934  0.60 35.56 ? 27  MET A CG  1 
ATOM   219  S SD  . MET A 1 27  ? -10.995 -18.914 13.751  0.30 36.09 ? 27  MET A SD  1 
ATOM   220  C CE  . MET A 1 27  ? -10.585 -17.886 15.165  0.50 36.22 ? 27  MET A CE  1 
ATOM   221  N N   . LEU A 1 28  ? -7.652  -15.613 10.662  1.00 35.21 ? 28  LEU A N   1 
ATOM   222  C CA  . LEU A 1 28  ? -6.985  -14.349 10.387  1.00 35.30 ? 28  LEU A CA  1 
ATOM   223  C C   . LEU A 1 28  ? -7.611  -13.629 9.193   1.00 35.21 ? 28  LEU A C   1 
ATOM   224  O O   . LEU A 1 28  ? -7.786  -12.416 9.222   1.00 34.76 ? 28  LEU A O   1 
ATOM   225  C CB  . LEU A 1 28  ? -5.486  -14.570 10.166  1.00 35.77 ? 28  LEU A CB  1 
ATOM   226  C CG  . LEU A 1 28  ? -4.783  -15.407 11.240  1.00 36.44 ? 28  LEU A CG  1 
ATOM   227  C CD1 . LEU A 1 28  ? -3.280  -15.415 11.020  1.00 36.46 ? 28  LEU A CD1 1 
ATOM   228  C CD2 . LEU A 1 28  ? -5.117  -14.905 12.633  1.00 36.14 ? 28  LEU A CD2 1 
ATOM   229  N N   . ARG A 1 29  ? -7.954  -14.378 8.149   1.00 34.87 ? 29  ARG A N   1 
ATOM   230  C CA  . ARG A 1 29  ? -8.594  -13.794 6.978   1.00 34.79 ? 29  ARG A CA  1 
ATOM   231  C C   . ARG A 1 29  ? -9.840  -13.037 7.408   1.00 36.29 ? 29  ARG A C   1 
ATOM   232  O O   . ARG A 1 29  ? -10.093 -11.915 6.959   1.00 35.88 ? 29  ARG A O   1 
ATOM   233  C CB  . ARG A 1 29  ? -8.992  -14.879 5.970   1.00 33.56 ? 29  ARG A CB  1 
ATOM   234  C CG  . ARG A 1 29  ? -7.836  -15.682 5.413   1.00 32.38 ? 29  ARG A CG  1 
ATOM   235  C CD  . ARG A 1 29  ? -8.138  -16.224 4.020   1.00 31.30 ? 29  ARG A CD  1 
ATOM   236  N NE  . ARG A 1 29  ? -9.369  -17.016 3.921   1.00 30.50 ? 29  ARG A NE  1 
ATOM   237  C CZ  . ARG A 1 29  ? -9.441  -18.335 4.104   1.00 30.10 ? 29  ARG A CZ  1 
ATOM   238  N NH1 . ARG A 1 29  ? -8.351  -19.020 4.431   1.00 28.98 ? 29  ARG A NH1 1 
ATOM   239  N NH2 . ARG A 1 29  ? -10.603 -18.971 3.972   1.00 28.93 ? 29  ARG A NH2 1 
ATOM   240  N N   . LYS A 1 30  ? -10.617 -13.668 8.284   1.00 36.83 ? 30  LYS A N   1 
ATOM   241  C CA  . LYS A 1 30  ? -11.861 -13.094 8.761   1.00 38.06 ? 30  LYS A CA  1 
ATOM   242  C C   . LYS A 1 30  ? -11.603 -11.902 9.675   1.00 38.07 ? 30  LYS A C   1 
ATOM   243  O O   . LYS A 1 30  ? -12.389 -10.956 9.719   1.00 39.26 ? 30  LYS A O   1 
ATOM   244  C CB  . LYS A 1 30  ? -12.694 -14.158 9.465   1.00 38.71 ? 30  LYS A CB  1 
ATOM   245  C CG  . LYS A 1 30  ? -13.272 -15.193 8.502   1.00 39.64 ? 30  LYS A CG  1 
ATOM   246  C CD  . LYS A 1 30  ? -14.026 -14.533 7.355   1.00 40.26 ? 30  LYS A CD  1 
ATOM   247  C CE  . LYS A 1 30  ? -14.366 -15.547 6.266   1.00 40.78 ? 30  LYS A CE  1 
ATOM   248  N NZ  . LYS A 1 30  ? -15.109 -14.927 5.142   1.00 41.06 ? 30  LYS A NZ  1 
ATOM   249  N N   . ILE A 1 31  ? -10.491 -11.948 10.393  1.00 38.07 ? 31  ILE A N   1 
ATOM   250  C CA  . ILE A 1 31  ? -10.056 -10.804 11.178  1.00 37.62 ? 31  ILE A CA  1 
ATOM   251  C C   . ILE A 1 31  ? -9.668  -9.655  10.252  1.00 37.21 ? 31  ILE A C   1 
ATOM   252  O O   . ILE A 1 31  ? -10.181 -8.541  10.385  1.00 37.28 ? 31  ILE A O   1 
ATOM   253  C CB  . ILE A 1 31  ? -8.875  -11.173 12.088  1.00 37.73 ? 31  ILE A CB  1 
ATOM   254  C CG1 . ILE A 1 31  ? -9.381  -11.961 13.302  1.00 37.75 ? 31  ILE A CG1 1 
ATOM   255  C CG2 . ILE A 1 31  ? -8.117  -9.918  12.535  1.00 38.23 ? 31  ILE A CG2 1 
ATOM   256  C CD1 . ILE A 1 31  ? -8.287  -12.682 14.071  1.00 37.71 ? 31  ILE A CD1 1 
ATOM   257  N N   . ALA A 1 32  ? -8.781  -9.937  9.302   1.00 35.95 ? 32  ALA A N   1 
ATOM   258  C CA  . ALA A 1 32  ? -8.265  -8.908  8.400   1.00 36.06 ? 32  ALA A CA  1 
ATOM   259  C C   . ALA A 1 32  ? -9.346  -8.169  7.610   1.00 35.79 ? 32  ALA A C   1 
ATOM   260  O O   . ALA A 1 32  ? -9.141  -7.028  7.199   1.00 34.79 ? 32  ALA A O   1 
ATOM   261  C CB  . ALA A 1 32  ? -7.225  -9.498  7.457   1.00 35.82 ? 32  ALA A CB  1 
ATOM   262  N N   . VAL A 1 33  ? -10.493 -8.811  7.390   1.00 36.16 ? 33  VAL A N   1 
ATOM   263  C CA  . VAL A 1 33  ? -11.557 -8.186  6.593   1.00 36.20 ? 33  VAL A CA  1 
ATOM   264  C C   . VAL A 1 33  ? -12.750 -7.668  7.404   1.00 36.76 ? 33  VAL A C   1 
ATOM   265  O O   . VAL A 1 33  ? -13.739 -7.210  6.830   1.00 36.19 ? 33  VAL A O   1 
ATOM   266  C CB  . VAL A 1 33  ? -12.080 -9.117  5.471   1.00 36.78 ? 33  VAL A CB  1 
ATOM   267  C CG1 . VAL A 1 33  ? -11.069 -9.218  4.327   1.00 35.87 ? 33  VAL A CG1 1 
ATOM   268  C CG2 . VAL A 1 33  ? -12.438 -10.498 6.022   1.00 36.47 ? 33  VAL A CG2 1 
ATOM   269  N N   . ALA A 1 34  ? -12.669 -7.745  8.728   1.00 36.47 ? 34  ALA A N   1 
ATOM   270  C CA  . ALA A 1 34  ? -13.739 -7.218  9.562   1.00 36.77 ? 34  ALA A CA  1 
ATOM   271  C C   . ALA A 1 34  ? -13.746 -5.694  9.489   1.00 37.25 ? 34  ALA A C   1 
ATOM   272  O O   . ALA A 1 34  ? -12.707 -5.070  9.235   1.00 36.84 ? 34  ALA A O   1 
ATOM   273  C CB  . ALA A 1 34  ? -13.575 -7.690  11.004  1.00 36.74 ? 34  ALA A CB  1 
ATOM   274  N N   . ALA A 1 35  ? -14.917 -5.096  9.706   1.00 37.62 ? 35  ALA A N   1 
ATOM   275  C CA  . ALA A 1 35  ? -15.040 -3.641  9.740   1.00 37.60 ? 35  ALA A CA  1 
ATOM   276  C C   . ALA A 1 35  ? -13.929 -3.021  10.582  1.00 37.40 ? 35  ALA A C   1 
ATOM   277  O O   . ALA A 1 35  ? -13.396 -1.964  10.246  1.00 38.23 ? 35  ALA A O   1 
ATOM   278  C CB  . ALA A 1 35  ? -16.398 -3.238  10.297  1.00 37.46 ? 35  ALA A CB  1 
ATOM   279  N N   . ALA A 1 36  ? -13.581 -3.699  11.670  1.00 36.61 ? 36  ALA A N   1 
ATOM   280  C CA  . ALA A 1 36  ? -12.652 -3.176  12.668  1.00 35.98 ? 36  ALA A CA  1 
ATOM   281  C C   . ALA A 1 36  ? -11.200 -3.168  12.201  1.00 35.72 ? 36  ALA A C   1 
ATOM   282  O O   . ALA A 1 36  ? -10.341 -2.566  12.847  1.00 35.37 ? 36  ALA A O   1 
ATOM   283  C CB  . ALA A 1 36  ? -12.775 -3.967  13.946  1.00 36.19 ? 36  ALA A CB  1 
ATOM   284  N N   . SER A 1 37  ? -10.934 -3.842  11.085  1.00 35.24 ? 37  SER A N   1 
ATOM   285  C CA  . SER A 1 37  ? -9.589  -3.901  10.516  1.00 34.46 ? 37  SER A CA  1 
ATOM   286  C C   . SER A 1 37  ? -9.469  -3.007  9.288   1.00 33.86 ? 37  SER A C   1 
ATOM   287  O O   . SER A 1 37  ? -8.458  -3.035  8.591   1.00 32.91 ? 37  SER A O   1 
ATOM   288  C CB  . SER A 1 37  ? -9.231  -5.337  10.146  1.00 34.33 ? 37  SER A CB  1 
ATOM   289  O OG  . SER A 1 37  ? -9.581  -6.214  11.201  1.00 34.71 ? 37  SER A OG  1 
ATOM   290  N N   . LYS A 1 38  ? -10.515 -2.229  9.027   1.00 33.49 ? 38  LYS A N   1 
ATOM   291  C CA  . LYS A 1 38  ? -10.507 -1.230  7.965   1.00 33.24 ? 38  LYS A CA  1 
ATOM   292  C C   . LYS A 1 38  ? -9.348  -0.247  8.181   1.00 32.34 ? 38  LYS A C   1 
ATOM   293  O O   . LYS A 1 38  ? -9.285  0.414   9.222   1.00 32.30 ? 38  LYS A O   1 
ATOM   294  C CB  . LYS A 1 38  ? -11.845 -0.491  7.978   1.00 34.66 ? 38  LYS A CB  1 
ATOM   295  C CG  . LYS A 1 38  ? -12.023 0.556   6.907   1.00 36.49 ? 38  LYS A CG  1 
ATOM   296  C CD  . LYS A 1 38  ? -13.305 1.354   7.136   1.00 38.00 ? 38  LYS A CD  1 
ATOM   297  C CE  . LYS A 1 38  ? -14.558 0.543   6.840   1.00 38.49 ? 38  LYS A CE  1 
ATOM   298  N NZ  . LYS A 1 38  ? -15.777 1.387   7.041   1.00 39.40 ? 38  LYS A NZ  1 
ATOM   299  N N   . PRO A 1 39  ? -8.425  -0.146  7.201   1.00 30.12 ? 39  PRO A N   1 
ATOM   300  C CA  . PRO A 1 39  ? -7.250  0.704   7.381   1.00 28.76 ? 39  PRO A CA  1 
ATOM   301  C C   . PRO A 1 39  ? -7.478  2.183   7.054   1.00 28.00 ? 39  PRO A C   1 
ATOM   302  O O   . PRO A 1 39  ? -8.060  2.522   6.016   1.00 28.51 ? 39  PRO A O   1 
ATOM   303  C CB  . PRO A 1 39  ? -6.252  0.119   6.387   1.00 28.20 ? 39  PRO A CB  1 
ATOM   304  C CG  . PRO A 1 39  ? -7.106  -0.358  5.269   1.00 29.36 ? 39  PRO A CG  1 
ATOM   305  C CD  . PRO A 1 39  ? -8.421  -0.809  5.885   1.00 29.49 ? 39  PRO A CD  1 
ATOM   306  N N   . ALA A 1 40  ? -7.032  3.046   7.953   1.00 27.16 ? 40  ALA A N   1 
ATOM   307  C CA  . ALA A 1 40  ? -6.919  4.469   7.686   1.00 26.35 ? 40  ALA A CA  1 
ATOM   308  C C   . ALA A 1 40  ? -5.452  4.718   7.376   1.00 25.91 ? 40  ALA A C   1 
ATOM   309  O O   . ALA A 1 40  ? -4.572  4.272   8.118   1.00 26.42 ? 40  ALA A O   1 
ATOM   310  C CB  . ALA A 1 40  ? -7.335  5.260   8.893   1.00 26.81 ? 40  ALA A CB  1 
ATOM   311  N N   . VAL A 1 41  ? -5.183  5.424   6.289   1.00 24.07 ? 41  VAL A N   1 
ATOM   312  C CA  . VAL A 1 41  ? -3.820  5.668   5.859   1.00 22.71 ? 41  VAL A CA  1 
ATOM   313  C C   . VAL A 1 41  ? -3.481  7.157   5.915   1.00 23.56 ? 41  VAL A C   1 
ATOM   314  O O   . VAL A 1 41  ? -4.157  7.971   5.305   1.00 22.41 ? 41  VAL A O   1 
ATOM   315  C CB  . VAL A 1 41  ? -3.605  5.161   4.428   1.00 21.87 ? 41  VAL A CB  1 
ATOM   316  C CG1 . VAL A 1 41  ? -2.226  5.534   3.940   1.00 21.97 ? 41  VAL A CG1 1 
ATOM   317  C CG2 . VAL A 1 41  ? -3.799  3.663   4.383   1.00 21.38 ? 41  VAL A CG2 1 
ATOM   318  N N   . GLU A 1 42  ? -2.432  7.497   6.658   1.00 23.20 ? 42  GLU A N   1 
ATOM   319  C CA  . GLU A 1 42  ? -1.981  8.872   6.769   1.00 24.57 ? 42  GLU A CA  1 
ATOM   320  C C   . GLU A 1 42  ? -0.649  8.986   6.057   1.00 22.72 ? 42  GLU A C   1 
ATOM   321  O O   . GLU A 1 42  ? 0.296   8.289   6.400   1.00 23.41 ? 42  GLU A O   1 
ATOM   322  C CB  . GLU A 1 42  ? -1.820  9.248   8.250   1.00 25.36 ? 42  GLU A CB  1 
ATOM   323  C CG  . GLU A 1 42  ? -1.264  10.638  8.503   1.00 27.84 ? 42  GLU A CG  1 
ATOM   324  C CD  . GLU A 1 42  ? -0.972  10.902  9.989   1.00 28.52 ? 42  GLU A CD  1 
ATOM   325  O OE1 . GLU A 1 42  ? -1.561  10.229  10.866  1.00 29.55 ? 42  GLU A OE1 1 
ATOM   326  O OE2 . GLU A 1 42  ? -0.142  11.787  10.283  1.00 30.48 ? 42  GLU A OE2 1 
ATOM   327  N N   . ILE A 1 43  ? -0.562  9.867   5.065   1.00 22.81 ? 43  ILE A N   1 
ATOM   328  C CA  . ILE A 1 43  ? 0.687   10.061  4.334   1.00 21.55 ? 43  ILE A CA  1 
ATOM   329  C C   . ILE A 1 43  ? 1.228   11.484  4.497   1.00 22.43 ? 43  ILE A C   1 
ATOM   330  O O   . ILE A 1 43  ? 0.480   12.451  4.409   1.00 21.61 ? 43  ILE A O   1 
ATOM   331  C CB  . ILE A 1 43  ? 0.505   9.784   2.829   1.00 21.79 ? 43  ILE A CB  1 
ATOM   332  C CG1 . ILE A 1 43  ? 0.138   8.315   2.589   1.00 21.81 ? 43  ILE A CG1 1 
ATOM   333  C CG2 . ILE A 1 43  ? 1.766   10.158  2.056   1.00 21.68 ? 43  ILE A CG2 1 
ATOM   334  C CD1 . ILE A 1 43  ? -0.185  8.012   1.146   1.00 22.19 ? 43  ILE A CD1 1 
ATOM   335  N N   . LYS A 1 44  ? 2.530   11.598  4.727   1.00 22.31 ? 44  LYS A N   1 
ATOM   336  C CA  . LYS A 1 44  ? 3.214   12.877  4.592   1.00 23.38 ? 44  LYS A CA  1 
ATOM   337  C C   . LYS A 1 44  ? 4.298   12.739  3.542   1.00 22.17 ? 44  LYS A C   1 
ATOM   338  O O   . LYS A 1 44  ? 5.268   12.023  3.760   1.00 21.61 ? 44  LYS A O   1 
ATOM   339  C CB  . LYS A 1 44  ? 3.858   13.297  5.905   1.00 25.17 ? 44  LYS A CB  1 
ATOM   340  C CG  . LYS A 1 44  ? 4.481   14.681  5.827   1.00 27.08 ? 44  LYS A CG  1 
ATOM   341  C CD  . LYS A 1 44  ? 5.244   15.028  7.105   1.00 29.62 ? 44  LYS A CD  1 
ATOM   342  C CE  . LYS A 1 44  ? 5.140   16.519  7.395   1.00 30.99 ? 44  LYS A CE  1 
ATOM   343  N NZ  . LYS A 1 44  ? 3.774   16.857  7.917   1.00 32.07 ? 44  LYS A NZ  1 
ATOM   344  N N   . GLN A 1 45  ? 4.133   13.420  2.412   1.00 21.43 ? 45  GLN A N   1 
ATOM   345  C CA  . GLN A 1 45  ? 5.142   13.377  1.356   1.00 22.17 ? 45  GLN A CA  1 
ATOM   346  C C   . GLN A 1 45  ? 5.908   14.683  1.297   1.00 23.08 ? 45  GLN A C   1 
ATOM   347  O O   . GLN A 1 45  ? 5.311   15.749  1.229   1.00 21.56 ? 45  GLN A O   1 
ATOM   348  C CB  . GLN A 1 45  ? 4.500   13.137  -0.006  1.00 21.88 ? 45  GLN A CB  1 
ATOM   349  C CG  . GLN A 1 45  ? 5.502   13.141  -1.142  1.00 22.65 ? 45  GLN A CG  1 
ATOM   350  C CD  . GLN A 1 45  ? 4.847   13.124  -2.498  1.00 22.74 ? 45  GLN A CD  1 
ATOM   351  O OE1 . GLN A 1 45  ? 3.636   13.058  -2.598  1.00 24.21 ? 45  GLN A OE1 1 
ATOM   352  N NE2 . GLN A 1 45  ? 5.652   13.163  -3.555  1.00 23.03 ? 45  GLN A NE2 1 
ATOM   353  N N   . GLU A 1 46  ? 7.232   14.591  1.316   1.00 23.58 ? 46  GLU A N   1 
ATOM   354  C CA  . GLU A 1 46  ? 8.064   15.749  1.084   1.00 24.85 ? 46  GLU A CA  1 
ATOM   355  C C   . GLU A 1 46  ? 9.005   15.426  -0.065  1.00 24.87 ? 46  GLU A C   1 
ATOM   356  O O   . GLU A 1 46  ? 10.082  14.865  0.132   1.00 24.58 ? 46  GLU A O   1 
ATOM   357  C CB  . GLU A 1 46  ? 8.797   16.121  2.365   1.00 26.36 ? 46  GLU A CB  1 
ATOM   358  C CG  . GLU A 1 46  ? 7.801   16.384  3.498   1.00 27.90 ? 46  GLU A CG  1 
ATOM   359  C CD  . GLU A 1 46  ? 8.370   17.179  4.633   1.00 29.76 ? 46  GLU A CD  1 
ATOM   360  O OE1 . GLU A 1 46  ? 7.596   17.947  5.259   1.00 30.88 ? 46  GLU A OE1 1 
ATOM   361  O OE2 . GLU A 1 46  ? 9.578   17.041  4.906   1.00 30.30 ? 46  GLU A OE2 1 
ATOM   362  N N   . GLY A 1 47  ? 8.573   15.752  -1.277  1.00 24.18 ? 47  GLY A N   1 
ATOM   363  C CA  . GLY A 1 47  ? 9.330   15.356  -2.464  1.00 24.21 ? 47  GLY A CA  1 
ATOM   364  C C   . GLY A 1 47  ? 9.365   13.845  -2.586  1.00 24.18 ? 47  GLY A C   1 
ATOM   365  O O   . GLY A 1 47  ? 8.313   13.195  -2.684  1.00 24.13 ? 47  GLY A O   1 
ATOM   366  N N   . ASP A 1 48  ? 10.567  13.272  -2.582  1.00 23.78 ? 48  ASP A N   1 
ATOM   367  C CA  . ASP A 1 48  ? 10.705  11.828  -2.727  1.00 23.66 ? 48  ASP A CA  1 
ATOM   368  C C   . ASP A 1 48  ? 10.687  11.128  -1.379  1.00 22.87 ? 48  ASP A C   1 
ATOM   369  O O   . ASP A 1 48  ? 10.842  9.918   -1.317  1.00 22.22 ? 48  ASP A O   1 
ATOM   370  C CB  . ASP A 1 48  ? 12.014  11.470  -3.429  1.00 24.93 ? 48  ASP A CB  1 
ATOM   371  C CG  . ASP A 1 48  ? 11.961  11.658  -4.934  1.00 25.40 ? 48  ASP A CG  1 
ATOM   372  O OD1 . ASP A 1 48  ? 10.872  11.861  -5.508  1.00 25.89 ? 48  ASP A OD1 1 
ATOM   373  O OD2 . ASP A 1 48  ? 13.046  11.585  -5.548  1.00 26.00 ? 48  ASP A OD2 1 
ATOM   374  N N   . THR A 1 49  ? 10.516  11.884  -0.301  1.00 21.52 ? 49  THR A N   1 
ATOM   375  C CA  . THR A 1 49  ? 10.532  11.307  1.039   1.00 22.14 ? 49  THR A CA  1 
ATOM   376  C C   . THR A 1 49  ? 9.123   11.116  1.568   1.00 22.95 ? 49  THR A C   1 
ATOM   377  O O   . THR A 1 49  ? 8.334   12.061  1.592   1.00 21.94 ? 49  THR A O   1 
ATOM   378  C CB  . THR A 1 49  ? 11.336  12.174  2.018   1.00 22.76 ? 49  THR A CB  1 
ATOM   379  O OG1 . THR A 1 49  ? 12.675  12.278  1.546   1.00 22.16 ? 49  THR A OG1 1 
ATOM   380  C CG2 . THR A 1 49  ? 11.372  11.543  3.414   1.00 23.09 ? 49  THR A CG2 1 
ATOM   381  N N   . PHE A 1 50  ? 8.811   9.890   1.986   1.00 22.45 ? 50  PHE A N   1 
ATOM   382  C CA  . PHE A 1 50  ? 7.480   9.559   2.476   1.00 22.96 ? 50  PHE A CA  1 
ATOM   383  C C   . PHE A 1 50  ? 7.475   9.077   3.932   1.00 23.56 ? 50  PHE A C   1 
ATOM   384  O O   . PHE A 1 50  ? 8.380   8.381   4.377   1.00 23.68 ? 50  PHE A O   1 
ATOM   385  C CB  . PHE A 1 50  ? 6.848   8.474   1.600   1.00 21.64 ? 50  PHE A CB  1 
ATOM   386  C CG  . PHE A 1 50  ? 6.401   8.964   0.251   1.00 21.73 ? 50  PHE A CG  1 
ATOM   387  C CD1 . PHE A 1 50  ? 7.304   9.086   -0.795  1.00 21.80 ? 50  PHE A CD1 1 
ATOM   388  C CD2 . PHE A 1 50  ? 5.061   9.280   0.024   1.00 21.65 ? 50  PHE A CD2 1 
ATOM   389  C CE1 . PHE A 1 50  ? 6.900   9.539   -2.040  1.00 21.65 ? 50  PHE A CE1 1 
ATOM   390  C CE2 . PHE A 1 50  ? 4.645   9.733   -1.215  1.00 21.14 ? 50  PHE A CE2 1 
ATOM   391  C CZ  . PHE A 1 50  ? 5.571   9.867   -2.250  1.00 21.45 ? 50  PHE A CZ  1 
ATOM   392  N N   . TYR A 1 51  ? 6.426   9.454   4.652   1.00 23.70 ? 51  TYR A N   1 
ATOM   393  C CA  . TYR A 1 51  ? 6.035   8.788   5.882   1.00 24.54 ? 51  TYR A CA  1 
ATOM   394  C C   . TYR A 1 51  ? 4.628   8.278   5.641   1.00 24.06 ? 51  TYR A C   1 
ATOM   395  O O   . TYR A 1 51  ? 3.727   9.062   5.318   1.00 22.35 ? 51  TYR A O   1 
ATOM   396  C CB  . TYR A 1 51  ? 6.031   9.788   7.033   1.00 26.77 ? 51  TYR A CB  1 
ATOM   397  C CG  . TYR A 1 51  ? 5.235   9.379   8.259   1.00 27.04 ? 51  TYR A CG  1 
ATOM   398  C CD1 . TYR A 1 51  ? 5.757   8.472   9.174   1.00 27.70 ? 51  TYR A CD1 1 
ATOM   399  C CD2 . TYR A 1 51  ? 3.993   9.945   8.532   1.00 27.19 ? 51  TYR A CD2 1 
ATOM   400  C CE1 . TYR A 1 51  ? 5.056   8.102   10.302  1.00 27.29 ? 51  TYR A CE1 1 
ATOM   401  C CE2 . TYR A 1 51  ? 3.277   9.583   9.682   1.00 27.39 ? 51  TYR A CE2 1 
ATOM   402  C CZ  . TYR A 1 51  ? 3.827   8.665   10.561  1.00 27.84 ? 51  TYR A CZ  1 
ATOM   403  O OH  . TYR A 1 51  ? 3.156   8.287   11.708  1.00 28.02 ? 51  TYR A OH  1 
ATOM   404  N N   . ILE A 1 52  ? 4.434   6.970   5.759   1.00 23.61 ? 52  ILE A N   1 
ATOM   405  C CA  . ILE A 1 52  ? 3.089   6.418   5.663   1.00 23.58 ? 52  ILE A CA  1 
ATOM   406  C C   . ILE A 1 52  ? 2.734   5.636   6.920   1.00 23.94 ? 52  ILE A C   1 
ATOM   407  O O   . ILE A 1 52  ? 3.421   4.678   7.275   1.00 23.38 ? 52  ILE A O   1 
ATOM   408  C CB  . ILE A 1 52  ? 2.961   5.491   4.459   1.00 23.33 ? 52  ILE A CB  1 
ATOM   409  C CG1 . ILE A 1 52  ? 3.444   6.200   3.194   1.00 23.07 ? 52  ILE A CG1 1 
ATOM   410  C CG2 . ILE A 1 52  ? 1.518   5.042   4.292   1.00 23.21 ? 52  ILE A CG2 1 
ATOM   411  C CD1 . ILE A 1 52  ? 3.321   5.341   1.967   1.00 23.94 ? 52  ILE A CD1 1 
ATOM   412  N N   . LYS A 1 53  ? 1.658   6.041   7.582   1.00 24.55 ? 53  LYS A N   1 
ATOM   413  C CA  . LYS A 1 53  ? 1.169   5.304   8.731   1.00 25.53 ? 53  LYS A CA  1 
ATOM   414  C C   . LYS A 1 53  ? -0.153  4.635   8.403   1.00 25.93 ? 53  LYS A C   1 
ATOM   415  O O   . LYS A 1 53  ? -1.112  5.312   8.080   1.00 25.15 ? 53  LYS A O   1 
ATOM   416  C CB  . LYS A 1 53  ? 0.952   6.247   9.910   1.00 26.41 ? 53  LYS A CB  1 
ATOM   417  C CG  . LYS A 1 53  ? 0.534   5.535   11.180  1.00 27.96 ? 53  LYS A CG  1 
ATOM   418  C CD  . LYS A 1 53  ? 0.142   6.527   12.258  1.00 29.25 ? 53  LYS A CD  1 
ATOM   419  C CE  . LYS A 1 53  ? 0.689   6.087   13.610  1.00 30.86 ? 53  LYS A CE  1 
ATOM   420  N NZ  . LYS A 1 53  ? -0.157  6.612   14.741  1.00 31.24 ? 53  LYS A NZ  1 
ATOM   421  N N   . THR A 1 54  ? -0.200  3.311   8.506   1.00 27.03 ? 54  THR A N   1 
ATOM   422  C CA  . THR A 1 54  ? -1.430  2.573   8.335   1.00 27.82 ? 54  THR A CA  1 
ATOM   423  C C   . THR A 1 54  ? -1.963  2.156   9.700   1.00 28.84 ? 54  THR A C   1 
ATOM   424  O O   . THR A 1 54  ? -1.235  1.575   10.511  1.00 28.88 ? 54  THR A O   1 
ATOM   425  C CB  . THR A 1 54  ? -1.204  1.338   7.453   1.00 28.28 ? 54  THR A CB  1 
ATOM   426  O OG1 . THR A 1 54  ? -0.602  1.749   6.216   1.00 27.07 ? 54  THR A OG1 1 
ATOM   427  C CG2 . THR A 1 54  ? -2.538  0.622   7.170   1.00 27.68 ? 54  THR A CG2 1 
ATOM   428  N N   . SER A 1 55  ? -3.231  2.460   9.958   1.00 29.26 ? 55  SER A N   1 
ATOM   429  C CA  . SER A 1 55  ? -3.832  2.176   11.253  1.00 30.50 ? 55  SER A CA  1 
ATOM   430  C C   . SER A 1 55  ? -5.227  1.580   11.141  1.00 30.48 ? 55  SER A C   1 
ATOM   431  O O   . SER A 1 55  ? -6.036  2.029   10.329  1.00 30.79 ? 55  SER A O   1 
ATOM   432  C CB  . SER A 1 55  ? -3.907  3.457   12.087  1.00 30.69 ? 55  SER A CB  1 
ATOM   433  O OG  . SER A 1 55  ? -2.614  3.984   12.294  1.00 32.04 ? 55  SER A OG  1 
ATOM   434  N N   . THR A 1 56  ? -5.497  0.574   11.972  1.00 29.85 ? 56  THR A N   1 
ATOM   435  C CA  . THR A 1 56  ? -6.837  0.017   12.133  1.00 29.77 ? 56  THR A CA  1 
ATOM   436  C C   . THR A 1 56  ? -7.264  0.253   13.583  1.00 30.46 ? 56  THR A C   1 
ATOM   437  O O   . THR A 1 56  ? -6.580  0.970   14.311  1.00 28.82 ? 56  THR A O   1 
ATOM   438  C CB  . THR A 1 56  ? -6.853  -1.490  11.842  1.00 29.32 ? 56  THR A CB  1 
ATOM   439  O OG1 . THR A 1 56  ? -6.169  -2.185  12.888  1.00 28.87 ? 56  THR A OG1 1 
ATOM   440  C CG2 . THR A 1 56  ? -6.167  -1.791  10.519  1.00 28.47 ? 56  THR A CG2 1 
ATOM   441  N N   . THR A 1 57  ? -8.377  -0.343  14.009  1.00 31.31 ? 57  THR A N   1 
ATOM   442  C CA  . THR A 1 57  ? -8.777  -0.245  15.421  1.00 32.43 ? 57  THR A CA  1 
ATOM   443  C C   . THR A 1 57  ? -7.791  -0.925  16.388  1.00 32.74 ? 57  THR A C   1 
ATOM   444  O O   . THR A 1 57  ? -7.730  -0.561  17.574  1.00 32.67 ? 57  THR A O   1 
ATOM   445  C CB  . THR A 1 57  ? -10.196 -0.814  15.687  1.00 32.74 ? 57  THR A CB  1 
ATOM   446  O OG1 . THR A 1 57  ? -10.207 -2.226  15.444  1.00 33.51 ? 57  THR A OG1 1 
ATOM   447  C CG2 . THR A 1 57  ? -11.238 -0.135  14.804  1.00 32.93 ? 57  THR A CG2 1 
ATOM   448  N N   . VAL A 1 58  ? -7.031  -1.906  15.894  1.00 32.14 ? 58  VAL A N   1 
ATOM   449  C CA  . VAL A 1 58  ? -6.167  -2.706  16.765  1.00 32.37 ? 58  VAL A CA  1 
ATOM   450  C C   . VAL A 1 58  ? -4.674  -2.650  16.449  1.00 32.84 ? 58  VAL A C   1 
ATOM   451  O O   . VAL A 1 58  ? -3.852  -3.049  17.275  1.00 32.14 ? 58  VAL A O   1 
ATOM   452  C CB  . VAL A 1 58  ? -6.593  -4.206  16.818  1.00 32.38 ? 58  VAL A CB  1 
ATOM   453  C CG1 . VAL A 1 58  ? -7.383  -4.496  18.071  1.00 32.78 ? 58  VAL A CG1 1 
ATOM   454  C CG2 . VAL A 1 58  ? -7.373  -4.610  15.572  1.00 32.69 ? 58  VAL A CG2 1 
ATOM   455  N N   . ARG A 1 59  ? -4.318  -2.186  15.256  1.00 32.94 ? 59  ARG A N   1 
ATOM   456  C CA  . ARG A 1 59  ? -2.918  -2.136  14.886  1.00 34.05 ? 59  ARG A CA  1 
ATOM   457  C C   . ARG A 1 59  ? -2.539  -0.816  14.256  1.00 33.41 ? 59  ARG A C   1 
ATOM   458  O O   . ARG A 1 59  ? -3.371  -0.136  13.664  1.00 32.04 ? 59  ARG A O   1 
ATOM   459  C CB  . ARG A 1 59  ? -2.543  -3.309  13.975  1.00 35.22 ? 59  ARG A CB  1 
ATOM   460  C CG  . ARG A 1 59  ? -2.380  -4.611  14.745  1.00 36.95 ? 59  ARG A CG  1 
ATOM   461  C CD  . ARG A 1 59  ? -1.932  -5.777  13.878  1.00 37.65 ? 59  ARG A CD  1 
ATOM   462  N NE  . ARG A 1 59  ? -1.482  -6.882  14.723  1.00 39.99 ? 59  ARG A NE  1 
ATOM   463  C CZ  . ARG A 1 59  ? -2.297  -7.709  15.376  0.80 40.59 ? 59  ARG A CZ  1 
ATOM   464  N NH1 . ARG A 1 59  ? -1.790  -8.682  16.125  0.80 41.16 ? 59  ARG A NH1 1 
ATOM   465  N NH2 . ARG A 1 59  ? -3.616  -7.568  15.281  0.80 40.60 ? 59  ARG A NH2 1 
ATOM   466  N N   . THR A 1 60  ? -1.275  -0.449  14.432  1.00 33.66 ? 60  THR A N   1 
ATOM   467  C CA  A THR A 1 60  ? -0.730  0.770   13.864  0.50 33.61 ? 60  THR A CA  1 
ATOM   468  C CA  B THR A 1 60  ? -0.727  0.765   13.841  0.50 33.74 ? 60  THR A CA  1 
ATOM   469  C C   . THR A 1 60  ? 0.699   0.497   13.428  1.00 34.03 ? 60  THR A C   1 
ATOM   470  O O   . THR A 1 60  ? 1.500   -0.005  14.218  1.00 34.21 ? 60  THR A O   1 
ATOM   471  C CB  A THR A 1 60  ? -0.717  1.902   14.903  0.50 33.73 ? 60  THR A CB  1 
ATOM   472  C CB  B THR A 1 60  ? -0.715  1.965   14.815  0.50 33.98 ? 60  THR A CB  1 
ATOM   473  O OG1 A THR A 1 60  ? -1.952  1.901   15.628  0.50 34.33 ? 60  THR A OG1 1 
ATOM   474  O OG1 B THR A 1 60  ? -0.101  1.582   16.053  0.50 33.99 ? 60  THR A OG1 1 
ATOM   475  C CG2 A THR A 1 60  ? -0.529  3.242   14.232  0.50 33.14 ? 60  THR A CG2 1 
ATOM   476  C CG2 B THR A 1 60  ? -2.118  2.467   15.074  0.50 34.44 ? 60  THR A CG2 1 
ATOM   477  N N   . THR A 1 61  ? 1.012   0.816   12.180  1.00 33.93 ? 61  THR A N   1 
ATOM   478  C CA  . THR A 1 61  ? 2.357   0.639   11.669  1.00 34.07 ? 61  THR A CA  1 
ATOM   479  C C   . THR A 1 61  ? 2.734   1.870   10.858  1.00 33.98 ? 61  THR A C   1 
ATOM   480  O O   . THR A 1 61  ? 1.866   2.606   10.382  1.00 32.54 ? 61  THR A O   1 
ATOM   481  C CB  . THR A 1 61  ? 2.515   -0.665  10.835  1.00 34.98 ? 61  THR A CB  1 
ATOM   482  O OG1 . THR A 1 61  ? 1.358   -0.872  10.028  1.00 36.65 ? 61  THR A OG1 1 
ATOM   483  C CG2 . THR A 1 61  ? 2.666   -1.869  11.735  1.00 35.67 ? 61  THR A CG2 1 
ATOM   484  N N   . GLU A 1 62  ? 4.030   2.120   10.743  1.00 33.65 ? 62  GLU A N   1 
ATOM   485  C CA  . GLU A 1 62  ? 4.517   3.223   9.929   1.00 33.90 ? 62  GLU A CA  1 
ATOM   486  C C   . GLU A 1 62  ? 5.744   2.800   9.134   1.00 32.61 ? 62  GLU A C   1 
ATOM   487  O O   . GLU A 1 62  ? 6.587   2.053   9.639   1.00 31.70 ? 62  GLU A O   1 
ATOM   488  C CB  . GLU A 1 62  ? 4.835   4.441   10.801  1.00 34.34 ? 62  GLU A CB  1 
ATOM   489  C CG  . GLU A 1 62  ? 5.253   4.093   12.230  1.00 35.92 ? 62  GLU A CG  1 
ATOM   490  C CD  . GLU A 1 62  ? 5.783   5.289   13.003  1.00 35.69 ? 62  GLU A CD  1 
ATOM   491  O OE1 . GLU A 1 62  ? 5.482   6.434   12.609  1.00 36.42 ? 62  GLU A OE1 1 
ATOM   492  O OE2 . GLU A 1 62  ? 6.512   5.084   14.003  1.00 36.56 ? 62  GLU A OE2 1 
ATOM   493  N N   . ILE A 1 63  ? 5.829   3.262   7.887   1.00 30.46 ? 63  ILE A N   1 
ATOM   494  C CA  . ILE A 1 63  ? 7.066   3.147   7.129   1.00 29.24 ? 63  ILE A CA  1 
ATOM   495  C C   . ILE A 1 63  ? 7.587   4.533   6.753   1.00 28.77 ? 63  ILE A C   1 
ATOM   496  O O   . ILE A 1 63  ? 6.826   5.426   6.375   1.00 28.52 ? 63  ILE A O   1 
ATOM   497  C CB  . ILE A 1 63  ? 6.942   2.244   5.864   1.00 29.54 ? 63  ILE A CB  1 
ATOM   498  C CG1 . ILE A 1 63  ? 5.959   2.819   4.845   1.00 29.63 ? 63  ILE A CG1 1 
ATOM   499  C CG2 . ILE A 1 63  ? 6.540   0.843   6.240   1.00 30.36 ? 63  ILE A CG2 1 
ATOM   500  C CD1 . ILE A 1 63  ? 5.907   2.031   3.533   1.00 28.96 ? 63  ILE A CD1 1 
ATOM   501  N N   . ASN A 1 64  ? 8.893   4.709   6.881   1.00 27.73 ? 64  ASN A N   1 
ATOM   502  C CA  . ASN A 1 64  ? 9.540   5.912   6.415   1.00 27.46 ? 64  ASN A CA  1 
ATOM   503  C C   . ASN A 1 64  ? 10.480  5.510   5.284   1.00 26.76 ? 64  ASN A C   1 
ATOM   504  O O   . ASN A 1 64  ? 11.330  4.637   5.456   1.00 26.52 ? 64  ASN A O   1 
ATOM   505  C CB  . ASN A 1 64  ? 10.308  6.591   7.548   1.00 28.13 ? 64  ASN A CB  1 
ATOM   506  C CG  . ASN A 1 64  ? 9.395   7.205   8.612   1.00 28.97 ? 64  ASN A CG  1 
ATOM   507  O OD1 . ASN A 1 64  ? 8.925   8.337   8.474   1.00 29.44 ? 64  ASN A OD1 1 
ATOM   508  N ND2 . ASN A 1 64  ? 9.188   6.476   9.707   1.00 29.04 ? 64  ASN A ND2 1 
ATOM   509  N N   . PHE A 1 65  ? 10.316  6.117   4.115   1.00 24.87 ? 65  PHE A N   1 
ATOM   510  C CA  . PHE A 1 65  ? 11.181  5.759   3.003   1.00 23.18 ? 65  PHE A CA  1 
ATOM   511  C C   . PHE A 1 65  ? 11.431  6.933   2.069   1.00 22.29 ? 65  PHE A C   1 
ATOM   512  O O   . PHE A 1 65  ? 10.688  7.907   2.046   1.00 21.68 ? 65  PHE A O   1 
ATOM   513  C CB  . PHE A 1 65  ? 10.650  4.524   2.247   1.00 21.90 ? 65  PHE A CB  1 
ATOM   514  C CG  . PHE A 1 65  ? 9.344   4.755   1.510   1.00 21.26 ? 65  PHE A CG  1 
ATOM   515  C CD1 . PHE A 1 65  ? 9.345   5.230   0.207   1.00 20.84 ? 65  PHE A CD1 1 
ATOM   516  C CD2 . PHE A 1 65  ? 8.125   4.507   2.128   1.00 21.23 ? 65  PHE A CD2 1 
ATOM   517  C CE1 . PHE A 1 65  ? 8.168   5.448   -0.482  1.00 20.10 ? 65  PHE A CE1 1 
ATOM   518  C CE2 . PHE A 1 65  ? 6.929   4.717   1.447   1.00 20.40 ? 65  PHE A CE2 1 
ATOM   519  C CZ  . PHE A 1 65  ? 6.955   5.198   0.134   1.00 20.85 ? 65  PHE A CZ  1 
ATOM   520  N N   . LYS A 1 66  ? 12.519  6.848   1.325   1.00 21.49 ? 66  LYS A N   1 
ATOM   521  C CA  . LYS A 1 66  ? 12.757  7.781   0.250   1.00 21.45 ? 66  LYS A CA  1 
ATOM   522  C C   . LYS A 1 66  ? 12.800  6.973   -1.032  1.00 20.61 ? 66  LYS A C   1 
ATOM   523  O O   . LYS A 1 66  ? 13.369  5.886   -1.063  1.00 20.71 ? 66  LYS A O   1 
ATOM   524  C CB  . LYS A 1 66  ? 14.058  8.530   0.483   1.00 22.02 ? 66  LYS A CB  1 
ATOM   525  C CG  . LYS A 1 66  ? 14.427  9.525   -0.604  1.00 23.90 ? 66  LYS A CG  1 
ATOM   526  C CD  . LYS A 1 66  ? 15.442  10.528  -0.063  1.00 25.72 ? 66  LYS A CD  1 
ATOM   527  C CE  . LYS A 1 66  ? 16.321  11.085  -1.167  1.00 26.48 ? 66  LYS A CE  1 
ATOM   528  N NZ  . LYS A 1 66  ? 15.682  12.152  -1.984  1.00 26.50 ? 66  LYS A NZ  1 
ATOM   529  N N   . VAL A 1 67  ? 12.178  7.489   -2.086  1.00 19.98 ? 67  VAL A N   1 
ATOM   530  C CA  . VAL A 1 67  ? 12.152  6.783   -3.360  1.00 19.13 ? 67  VAL A CA  1 
ATOM   531  C C   . VAL A 1 67  ? 13.582  6.599   -3.840  1.00 19.77 ? 67  VAL A C   1 
ATOM   532  O O   . VAL A 1 67  ? 14.375  7.543   -3.817  1.00 19.08 ? 67  VAL A O   1 
ATOM   533  C CB  . VAL A 1 67  ? 11.325  7.556   -4.392  1.00 19.39 ? 67  VAL A CB  1 
ATOM   534  C CG1 . VAL A 1 67  ? 11.511  6.992   -5.803  1.00 18.84 ? 67  VAL A CG1 1 
ATOM   535  C CG2 . VAL A 1 67  ? 9.853   7.563   -3.977  1.00 19.38 ? 67  VAL A CG2 1 
ATOM   536  N N   . GLY A 1 68  ? 13.930  5.376   -4.221  1.00 19.90 ? 68  GLY A N   1 
ATOM   537  C CA  . GLY A 1 68  ? 15.282  5.088   -4.693  1.00 20.52 ? 68  GLY A CA  1 
ATOM   538  C C   . GLY A 1 68  ? 16.210  4.516   -3.633  1.00 20.47 ? 68  GLY A C   1 
ATOM   539  O O   . GLY A 1 68  ? 17.303  4.053   -3.947  1.00 21.07 ? 68  GLY A O   1 
ATOM   540  N N   . GLU A 1 69  ? 15.774  4.531   -2.378  1.00 20.20 ? 69  GLU A N   1 
ATOM   541  C CA  . GLU A 1 69  ? 16.608  4.063   -1.272  1.00 20.59 ? 69  GLU A CA  1 
ATOM   542  C C   . GLU A 1 69  ? 15.951  2.863   -0.602  1.00 20.55 ? 69  GLU A C   1 
ATOM   543  O O   . GLU A 1 69  ? 14.783  2.927   -0.228  1.00 19.24 ? 69  GLU A O   1 
ATOM   544  C CB  . GLU A 1 69  ? 16.806  5.183   -0.248  1.00 20.29 ? 69  GLU A CB  1 
ATOM   545  C CG  . GLU A 1 69  ? 17.287  6.478   -0.902  1.00 21.66 ? 69  GLU A CG  1 
ATOM   546  C CD  . GLU A 1 69  ? 17.703  7.539   0.096   1.00 21.84 ? 69  GLU A CD  1 
ATOM   547  O OE1 . GLU A 1 69  ? 17.526  7.350   1.317   1.00 22.89 ? 69  GLU A OE1 1 
ATOM   548  O OE2 . GLU A 1 69  ? 18.222  8.573   -0.346  1.00 22.26 ? 69  GLU A OE2 1 
ATOM   549  N N   . GLU A 1 70  ? 16.698  1.771   -0.474  1.00 19.86 ? 70  GLU A N   1 
ATOM   550  C CA  . GLU A 1 70  ? 16.175  0.535   0.124   1.00 22.04 ? 70  GLU A CA  1 
ATOM   551  C C   . GLU A 1 70  ? 15.821  0.691   1.601   1.00 21.93 ? 70  GLU A C   1 
ATOM   552  O O   . GLU A 1 70  ? 16.566  1.311   2.365   1.00 22.14 ? 70  GLU A O   1 
ATOM   553  C CB  . GLU A 1 70  ? 17.167  -0.627  -0.065  1.00 21.67 ? 70  GLU A CB  1 
ATOM   554  C CG  . GLU A 1 70  ? 17.420  -0.967  -1.549  1.00 22.36 ? 70  GLU A CG  1 
ATOM   555  C CD  . GLU A 1 70  ? 18.561  -1.960  -1.746  1.00 23.88 ? 70  GLU A CD  1 
ATOM   556  O OE1 . GLU A 1 70  ? 19.263  -2.250  -0.766  1.00 24.02 ? 70  GLU A OE1 1 
ATOM   557  O OE2 . GLU A 1 70  ? 18.749  -2.448  -2.887  1.00 25.73 ? 70  GLU A OE2 1 
ATOM   558  N N   . PHE A 1 71  ? 14.680  0.125   1.992   1.00 22.20 ? 71  PHE A N   1 
ATOM   559  C CA  . PHE A 1 71  ? 14.245  0.122   3.392   1.00 22.72 ? 71  PHE A CA  1 
ATOM   560  C C   . PHE A 1 71  ? 13.673  -1.245  3.735   1.00 23.58 ? 71  PHE A C   1 
ATOM   561  O O   . PHE A 1 71  ? 13.466  -2.066  2.851   1.00 22.36 ? 71  PHE A O   1 
ATOM   562  C CB  . PHE A 1 71  ? 13.208  1.227   3.651   1.00 22.93 ? 71  PHE A CB  1 
ATOM   563  C CG  . PHE A 1 71  ? 11.897  1.039   2.907   1.00 23.15 ? 71  PHE A CG  1 
ATOM   564  C CD1 . PHE A 1 71  ? 11.789  1.354   1.559   1.00 22.61 ? 71  PHE A CD1 1 
ATOM   565  C CD2 . PHE A 1 71  ? 10.763  0.576   3.573   1.00 22.94 ? 71  PHE A CD2 1 
ATOM   566  C CE1 . PHE A 1 71  ? 10.596  1.188   0.890   1.00 22.26 ? 71  PHE A CE1 1 
ATOM   567  C CE2 . PHE A 1 71  ? 9.568   0.405   2.906   1.00 22.58 ? 71  PHE A CE2 1 
ATOM   568  C CZ  . PHE A 1 71  ? 9.486   0.712   1.564   1.00 22.73 ? 71  PHE A CZ  1 
ATOM   569  N N   . GLU A 1 72  ? 13.436  -1.499  5.016   1.00 24.87 ? 72  GLU A N   1 
ATOM   570  C CA  . GLU A 1 72  ? 12.880  -2.779  5.426   1.00 26.46 ? 72  GLU A CA  1 
ATOM   571  C C   . GLU A 1 72  ? 11.430  -2.615  5.871   1.00 26.74 ? 72  GLU A C   1 
ATOM   572  O O   . GLU A 1 72  ? 11.076  -1.628  6.517   1.00 26.57 ? 72  GLU A O   1 
ATOM   573  C CB  . GLU A 1 72  ? 13.751  -3.437  6.507   1.00 27.80 ? 72  GLU A CB  1 
ATOM   574  C CG  . GLU A 1 72  ? 15.003  -4.108  5.913   1.00 29.22 ? 72  GLU A CG  1 
ATOM   575  C CD  . GLU A 1 72  ? 15.996  -4.631  6.942   1.00 29.77 ? 72  GLU A CD  1 
ATOM   576  O OE1 . GLU A 1 72  ? 15.616  -4.831  8.118   1.00 29.80 ? 72  GLU A OE1 1 
ATOM   577  O OE2 . GLU A 1 72  ? 17.177  -4.850  6.550   1.00 31.81 ? 72  GLU A OE2 1 
ATOM   578  N N   . GLU A 1 73  ? 10.588  -3.564  5.477   1.00 27.58 ? 73  GLU A N   1 
ATOM   579  C CA  . GLU A 1 73  ? 9.199   -3.605  5.927   1.00 28.69 ? 73  GLU A CA  1 
ATOM   580  C C   . GLU A 1 73  ? 8.754   -5.063  6.028   1.00 29.70 ? 73  GLU A C   1 
ATOM   581  O O   . GLU A 1 73  ? 9.580   -5.948  6.223   1.00 30.40 ? 73  GLU A O   1 
ATOM   582  C CB  . GLU A 1 73  ? 8.290   -2.813  4.976   1.00 28.28 ? 73  GLU A CB  1 
ATOM   583  C CG  . GLU A 1 73  ? 8.429   -3.186  3.510   1.00 27.67 ? 73  GLU A CG  1 
ATOM   584  C CD  . GLU A 1 73  ? 7.336   -2.573  2.659   1.00 28.21 ? 73  GLU A CD  1 
ATOM   585  O OE1 . GLU A 1 73  ? 6.427   -1.958  3.241   1.00 27.73 ? 73  GLU A OE1 1 
ATOM   586  O OE2 . GLU A 1 73  ? 7.382   -2.705  1.417   1.00 26.74 ? 73  GLU A OE2 1 
ATOM   587  N N   . GLN A 1 74  ? 7.460   -5.310  5.888   1.00 31.06 ? 74  GLN A N   1 
ATOM   588  C CA  . GLN A 1 74  ? 6.929   -6.678  5.899   1.00 33.16 ? 74  GLN A CA  1 
ATOM   589  C C   . GLN A 1 74  ? 5.989   -6.898  4.717   1.00 33.77 ? 74  GLN A C   1 
ATOM   590  O O   . GLN A 1 74  ? 5.304   -5.969  4.291   1.00 32.96 ? 74  GLN A O   1 
ATOM   591  C CB  . GLN A 1 74  ? 6.185   -6.957  7.210   1.00 33.49 ? 74  GLN A CB  1 
ATOM   592  C CG  . GLN A 1 74  ? 7.102   -7.123  8.408   1.00 34.89 ? 74  GLN A CG  1 
ATOM   593  C CD  . GLN A 1 74  ? 6.403   -7.722  9.624   1.00 35.10 ? 74  GLN A CD  1 
ATOM   594  O OE1 . GLN A 1 74  ? 5.172   -7.774  9.696   1.00 35.76 ? 74  GLN A OE1 1 
ATOM   595  N NE2 . GLN A 1 74  ? 7.194   -8.184  10.582  1.00 35.96 ? 74  GLN A NE2 1 
ATOM   596  N N   . THR A 1 75  ? 5.964   -8.123  4.191   1.00 34.79 ? 75  THR A N   1 
ATOM   597  C CA  . THR A 1 75  ? 5.062   -8.474  3.099   1.00 36.21 ? 75  THR A CA  1 
ATOM   598  C C   . THR A 1 75  ? 3.626   -8.537  3.608   1.00 38.03 ? 75  THR A C   1 
ATOM   599  O O   . THR A 1 75  ? 3.378   -8.424  4.811   1.00 38.58 ? 75  THR A O   1 
ATOM   600  C CB  . THR A 1 75  ? 5.416   -9.833  2.466   1.00 35.99 ? 75  THR A CB  1 
ATOM   601  O OG1 . THR A 1 75  ? 5.308   -10.858 3.456   1.00 36.01 ? 75  THR A OG1 1 
ATOM   602  C CG2 . THR A 1 75  ? 6.838   -9.824  1.933   1.00 36.11 ? 75  THR A CG2 1 
ATOM   603  N N   . VAL A 1 76  ? 2.684   -8.716  2.686   1.00 39.43 ? 76  VAL A N   1 
ATOM   604  C CA  . VAL A 1 76  ? 1.261   -8.696  3.022   1.00 40.69 ? 76  VAL A CA  1 
ATOM   605  C C   . VAL A 1 76  ? 0.933   -9.669  4.155   1.00 41.36 ? 76  VAL A C   1 
ATOM   606  O O   . VAL A 1 76  ? 0.094   -9.382  5.014   1.00 42.18 ? 76  VAL A O   1 
ATOM   607  C CB  . VAL A 1 76  ? 0.376   -8.958  1.776   1.00 40.73 ? 76  VAL A CB  1 
ATOM   608  C CG1 . VAL A 1 76  ? 0.708   -10.307 1.151   1.00 41.35 ? 76  VAL A CG1 1 
ATOM   609  C CG2 . VAL A 1 76  ? -1.096  -8.865  2.127   1.00 41.26 ? 76  VAL A CG2 1 
ATOM   610  N N   . ASP A 1 77  ? 1.606   -10.811 4.168   1.00 41.44 ? 77  ASP A N   1 
ATOM   611  C CA  . ASP A 1 77  ? 1.409   -11.787 5.228   1.00 41.65 ? 77  ASP A CA  1 
ATOM   612  C C   . ASP A 1 77  ? 2.512   -11.723 6.285   1.00 41.50 ? 77  ASP A C   1 
ATOM   613  O O   . ASP A 1 77  ? 2.896   -12.748 6.855   1.00 42.37 ? 77  ASP A O   1 
ATOM   614  C CB  . ASP A 1 77  ? 1.302   -13.198 4.650   1.00 42.13 ? 77  ASP A CB  1 
ATOM   615  C CG  . ASP A 1 77  ? 2.402   -13.503 3.654   1.00 42.51 ? 77  ASP A CG  1 
ATOM   616  O OD1 . ASP A 1 77  ? 3.177   -12.579 3.325   1.00 42.32 ? 77  ASP A OD1 1 
ATOM   617  O OD2 . ASP A 1 77  ? 2.479   -14.664 3.189   1.00 43.09 ? 77  ASP A OD2 1 
ATOM   618  N N   . GLY A 1 78  ? 3.028   -10.519 6.523   1.00 40.04 ? 78  GLY A N   1 
ATOM   619  C CA  . GLY A 1 78  ? 3.875   -10.247 7.680   1.00 38.68 ? 78  GLY A CA  1 
ATOM   620  C C   . GLY A 1 78  ? 5.310   -10.749 7.686   1.00 37.69 ? 78  GLY A C   1 
ATOM   621  O O   . GLY A 1 78  ? 5.934   -10.810 8.741   1.00 38.08 ? 78  GLY A O   1 
ATOM   622  N N   . ARG A 1 79  ? 5.852   -11.101 6.527   1.00 36.57 ? 79  ARG A N   1 
ATOM   623  C CA  . ARG A 1 79  ? 7.242   -11.557 6.467   1.00 35.69 ? 79  ARG A CA  1 
ATOM   624  C C   . ARG A 1 79  ? 8.214   -10.410 6.164   1.00 34.22 ? 79  ARG A C   1 
ATOM   625  O O   . ARG A 1 79  ? 8.089   -9.755  5.143   1.00 34.50 ? 79  ARG A O   1 
ATOM   626  C CB  . ARG A 1 79  ? 7.397   -12.680 5.441   1.00 36.29 ? 79  ARG A CB  1 
ATOM   627  C CG  . ARG A 1 79  ? 6.581   -13.935 5.753   1.00 36.66 ? 79  ARG A CG  1 
ATOM   628  C CD  . ARG A 1 79  ? 6.429   -14.820 4.523   1.00 37.28 ? 79  ARG A CD  1 
ATOM   629  N NE  . ARG A 1 79  ? 7.658   -15.548 4.221   1.00 36.98 ? 79  ARG A NE  1 
ATOM   630  C CZ  . ARG A 1 79  ? 7.802   -16.394 3.207   1.00 36.93 ? 79  ARG A CZ  1 
ATOM   631  N NH1 . ARG A 1 79  ? 6.789   -16.628 2.384   1.00 37.21 ? 79  ARG A NH1 1 
ATOM   632  N NH2 . ARG A 1 79  ? 8.964   -16.999 3.010   1.00 36.64 ? 79  ARG A NH2 1 
ATOM   633  N N   . PRO A 1 80  ? 9.190   -10.170 7.058   1.00 33.15 ? 80  PRO A N   1 
ATOM   634  C CA  . PRO A 1 80  ? 10.209  -9.137  6.846   1.00 31.60 ? 80  PRO A CA  1 
ATOM   635  C C   . PRO A 1 80  ? 10.791  -9.141  5.431   1.00 30.04 ? 80  PRO A C   1 
ATOM   636  O O   . PRO A 1 80  ? 11.123  -10.197 4.890   1.00 29.15 ? 80  PRO A O   1 
ATOM   637  C CB  . PRO A 1 80  ? 11.303  -9.488  7.869   1.00 32.44 ? 80  PRO A CB  1 
ATOM   638  C CG  . PRO A 1 80  ? 10.828  -10.744 8.591   1.00 32.86 ? 80  PRO A CG  1 
ATOM   639  C CD  . PRO A 1 80  ? 9.361   -10.852 8.352   1.00 33.04 ? 80  PRO A CD  1 
ATOM   640  N N   . CYS A 1 81  ? 10.909  -7.959  4.832   1.00 28.22 ? 81  CYS A N   1 
ATOM   641  C CA  . CYS A 1 81  ? 11.464  -7.866  3.491   1.00 26.81 ? 81  CYS A CA  1 
ATOM   642  C C   . CYS A 1 81  ? 12.181  -6.537  3.293   1.00 26.21 ? 81  CYS A C   1 
ATOM   643  O O   . CYS A 1 81  ? 11.940  -5.585  4.022   1.00 26.40 ? 81  CYS A O   1 
ATOM   644  C CB  . CYS A 1 81  ? 10.351  -8.014  2.454   1.00 26.56 ? 81  CYS A CB  1 
ATOM   645  S SG  . CYS A 1 81  ? 9.219   -6.625  2.444   1.00 25.30 ? 81  CYS A SG  1 
ATOM   646  N N   . LYS A 1 82  ? 13.063  -6.495  2.301   1.00 25.42 ? 82  LYS A N   1 
ATOM   647  C CA  . LYS A 1 82  ? 13.717  -5.275  1.898   1.00 25.02 ? 82  LYS A CA  1 
ATOM   648  C C   . LYS A 1 82  ? 12.975  -4.745  0.690   1.00 24.35 ? 82  LYS A C   1 
ATOM   649  O O   . LYS A 1 82  ? 12.716  -5.491  -0.257  1.00 24.46 ? 82  LYS A O   1 
ATOM   650  C CB  . LYS A 1 82  ? 15.168  -5.563  1.515   1.00 25.39 ? 82  LYS A CB  1 
ATOM   651  C CG  . LYS A 1 82  ? 15.956  -4.340  1.150   1.00 25.50 ? 82  LYS A CG  1 
ATOM   652  C CD  . LYS A 1 82  ? 17.420  -4.682  0.957   1.00 25.68 ? 82  LYS A CD  1 
ATOM   653  C CE  . LYS A 1 82  ? 17.716  -5.154  -0.457  1.00 25.15 ? 82  LYS A CE  1 
ATOM   654  N NZ  . LYS A 1 82  ? 19.190  -5.320  -0.629  1.00 24.23 ? 82  LYS A NZ  1 
ATOM   655  N N   . SER A 1 83  ? 12.629  -3.462  0.724   1.00 23.67 ? 83  SER A N   1 
ATOM   656  C CA  . SER A 1 83  ? 11.824  -2.864  -0.329  1.00 23.59 ? 83  SER A CA  1 
ATOM   657  C C   . SER A 1 83  ? 12.582  -1.749  -1.019  1.00 23.49 ? 83  SER A C   1 
ATOM   658  O O   . SER A 1 83  ? 13.444  -1.111  -0.418  1.00 24.07 ? 83  SER A O   1 
ATOM   659  C CB  . SER A 1 83  ? 10.525  -2.298  0.262   1.00 24.27 ? 83  SER A CB  1 
ATOM   660  O OG  . SER A 1 83  ? 9.680   -3.324  0.745   1.00 24.23 ? 83  SER A OG  1 
ATOM   661  N N   . LEU A 1 84  ? 12.231  -1.504  -2.276  1.00 22.55 ? 84  LEU A N   1 
ATOM   662  C CA  . LEU A 1 84  ? 12.797  -0.407  -3.055  1.00 22.56 ? 84  LEU A CA  1 
ATOM   663  C C   . LEU A 1 84  ? 11.686  0.194   -3.898  1.00 22.32 ? 84  LEU A C   1 
ATOM   664  O O   . LEU A 1 84  ? 11.069  -0.494  -4.706  1.00 21.37 ? 84  LEU A O   1 
ATOM   665  C CB  . LEU A 1 84  ? 13.918  -0.925  -3.961  1.00 22.60 ? 84  LEU A CB  1 
ATOM   666  C CG  . LEU A 1 84  ? 14.553  0.094   -4.914  1.00 22.86 ? 84  LEU A CG  1 
ATOM   667  C CD1 . LEU A 1 84  ? 15.176  1.215   -4.134  1.00 23.03 ? 84  LEU A CD1 1 
ATOM   668  C CD2 . LEU A 1 84  ? 15.606  -0.596  -5.793  1.00 23.05 ? 84  LEU A CD2 1 
ATOM   669  N N   . VAL A 1 85  ? 11.421  1.476   -3.693  1.00 22.47 ? 85  VAL A N   1 
ATOM   670  C CA  . VAL A 1 85  ? 10.365  2.167   -4.407  1.00 22.67 ? 85  VAL A CA  1 
ATOM   671  C C   . VAL A 1 85  ? 10.973  2.993   -5.530  1.00 23.11 ? 85  VAL A C   1 
ATOM   672  O O   . VAL A 1 85  ? 12.026  3.625   -5.365  1.00 23.02 ? 85  VAL A O   1 
ATOM   673  C CB  . VAL A 1 85  ? 9.554   3.097   -3.449  1.00 23.10 ? 85  VAL A CB  1 
ATOM   674  C CG1 . VAL A 1 85  ? 8.491   3.863   -4.201  1.00 23.49 ? 85  VAL A CG1 1 
ATOM   675  C CG2 . VAL A 1 85  ? 8.926   2.291   -2.337  1.00 22.74 ? 85  VAL A CG2 1 
ATOM   676  N N   . LYS A 1 86  ? 10.301  2.991   -6.672  1.00 23.03 ? 86  LYS A N   1 
ATOM   677  C CA  . LYS A 1 86  ? 10.729  3.759   -7.817  1.00 24.01 ? 86  LYS A CA  1 
ATOM   678  C C   . LYS A 1 86  ? 9.506   4.465   -8.383  1.00 24.53 ? 86  LYS A C   1 
ATOM   679  O O   . LYS A 1 86  ? 8.385   3.969   -8.264  1.00 23.65 ? 86  LYS A O   1 
ATOM   680  C CB  . LYS A 1 86  ? 11.329  2.817   -8.870  0.80 24.80 ? 86  LYS A CB  1 
ATOM   681  C CG  . LYS A 1 86  ? 12.305  3.471   -9.827  0.50 25.44 ? 86  LYS A CG  1 
ATOM   682  C CD  . LYS A 1 86  ? 13.750  3.279   -9.366  0.40 25.48 ? 86  LYS A CD  1 
ATOM   683  C CE  . LYS A 1 86  ? 14.706  4.214   -10.089 0.40 25.26 ? 86  LYS A CE  1 
ATOM   684  N NZ  . LYS A 1 86  ? 16.130  3.797   -9.895  0.40 24.90 ? 86  LYS A NZ  1 
ATOM   685  N N   . TRP A 1 87  ? 9.710   5.629   -8.986  1.00 24.39 ? 87  TRP A N   1 
ATOM   686  C CA  . TRP A 1 87  ? 8.614   6.285   -9.685  1.00 26.58 ? 87  TRP A CA  1 
ATOM   687  C C   . TRP A 1 87  ? 8.340   5.593   -11.017 1.00 28.73 ? 87  TRP A C   1 
ATOM   688  O O   . TRP A 1 87  ? 9.258   5.410   -11.819 1.00 29.25 ? 87  TRP A O   1 
ATOM   689  C CB  . TRP A 1 87  ? 8.949   7.754   -9.938  1.00 25.87 ? 87  TRP A CB  1 
ATOM   690  C CG  . TRP A 1 87  ? 8.864   8.636   -8.728  1.00 25.80 ? 87  TRP A CG  1 
ATOM   691  C CD1 . TRP A 1 87  ? 9.886   9.323   -8.144  1.00 25.34 ? 87  TRP A CD1 1 
ATOM   692  C CD2 . TRP A 1 87  ? 7.685   8.943   -7.968  1.00 25.60 ? 87  TRP A CD2 1 
ATOM   693  N NE1 . TRP A 1 87  ? 9.416   10.043  -7.071  1.00 25.57 ? 87  TRP A NE1 1 
ATOM   694  C CE2 . TRP A 1 87  ? 8.068   9.828   -6.944  1.00 25.50 ? 87  TRP A CE2 1 
ATOM   695  C CE3 . TRP A 1 87  ? 6.341   8.567   -8.068  1.00 25.51 ? 87  TRP A CE3 1 
ATOM   696  C CZ2 . TRP A 1 87  ? 7.158   10.328  -6.007  1.00 25.50 ? 87  TRP A CZ2 1 
ATOM   697  C CZ3 . TRP A 1 87  ? 5.442   9.068   -7.141  1.00 25.71 ? 87  TRP A CZ3 1 
ATOM   698  C CH2 . TRP A 1 87  ? 5.853   9.940   -6.129  1.00 25.30 ? 87  TRP A CH2 1 
ATOM   699  N N   . GLU A 1 88  ? 7.095   5.188   -11.258 1.00 30.37 ? 88  GLU A N   1 
ATOM   700  C CA  . GLU A 1 88  ? 6.733   4.721   -12.590 1.00 32.64 ? 88  GLU A CA  1 
ATOM   701  C C   . GLU A 1 88  ? 6.294   5.887   -13.454 1.00 33.89 ? 88  GLU A C   1 
ATOM   702  O O   . GLU A 1 88  ? 6.502   5.894   -14.676 1.00 35.24 ? 88  GLU A O   1 
ATOM   703  C CB  . GLU A 1 88  ? 5.644   3.655   -12.552 1.00 33.51 ? 88  GLU A CB  1 
ATOM   704  C CG  . GLU A 1 88  ? 5.073   3.374   -13.941 1.00 33.95 ? 88  GLU A CG  1 
ATOM   705  C CD  . GLU A 1 88  ? 4.220   2.141   -13.973 1.00 34.69 ? 88  GLU A CD  1 
ATOM   706  O OE1 . GLU A 1 88  ? 4.747   1.045   -13.664 1.00 34.50 ? 88  GLU A OE1 1 
ATOM   707  O OE2 . GLU A 1 88  ? 3.025   2.274   -14.312 1.00 35.04 ? 88  GLU A OE2 1 
ATOM   708  N N   . SER A 1 89  ? 5.681   6.875   -12.813 1.00 34.56 ? 89  SER A N   1 
ATOM   709  C CA  . SER A 1 89  ? 5.356   8.122   -13.465 1.00 35.32 ? 89  SER A CA  1 
ATOM   710  C C   . SER A 1 89  ? 5.192   9.182   -12.391 1.00 35.67 ? 89  SER A C   1 
ATOM   711  O O   . SER A 1 89  ? 5.460   8.928   -11.211 1.00 35.95 ? 89  SER A O   1 
ATOM   712  C CB  . SER A 1 89  ? 4.085   7.978   -14.310 1.00 36.16 ? 89  SER A CB  1 
ATOM   713  O OG  . SER A 1 89  ? 2.916   8.076   -13.515 1.00 37.09 ? 89  SER A OG  1 
ATOM   714  N N   . GLU A 1 90  ? 4.757   10.374  -12.785 1.00 35.37 ? 90  GLU A N   1 
ATOM   715  C CA  . GLU A 1 90  ? 4.615   11.469  -11.832 1.00 34.48 ? 90  GLU A CA  1 
ATOM   716  C C   . GLU A 1 90  ? 3.619   11.135  -10.724 1.00 33.85 ? 90  GLU A C   1 
ATOM   717  O O   . GLU A 1 90  ? 3.768   11.588  -9.586  1.00 34.02 ? 90  GLU A O   1 
ATOM   718  C CB  . GLU A 1 90  ? 4.171   12.740  -12.546 1.00 35.70 ? 90  GLU A CB  1 
ATOM   719  C CG  . GLU A 1 90  ? 4.369   14.001  -11.733 0.80 36.12 ? 90  GLU A CG  1 
ATOM   720  C CD  . GLU A 1 90  ? 4.117   15.247  -12.552 0.70 36.44 ? 90  GLU A CD  1 
ATOM   721  O OE1 . GLU A 1 90  ? 3.234   15.197  -13.437 0.70 36.36 ? 90  GLU A OE1 1 
ATOM   722  O OE2 . GLU A 1 90  ? 4.803   16.265  -12.315 0.60 36.50 ? 90  GLU A OE2 1 
ATOM   723  N N   . ASN A 1 91  ? 2.600   10.342  -11.055 1.00 31.54 ? 91  ASN A N   1 
ATOM   724  C CA  . ASN A 1 91  ? 1.550   10.055  -10.083 1.00 29.15 ? 91  ASN A CA  1 
ATOM   725  C C   . ASN A 1 91  ? 1.519   8.611   -9.574  1.00 26.63 ? 91  ASN A C   1 
ATOM   726  O O   . ASN A 1 91  ? 0.567   8.202   -8.930  1.00 26.33 ? 91  ASN A O   1 
ATOM   727  C CB  . ASN A 1 91  ? 0.181   10.455  -10.642 1.00 29.92 ? 91  ASN A CB  1 
ATOM   728  C CG  . ASN A 1 91  ? -0.316  9.506   -11.716 0.80 30.12 ? 91  ASN A CG  1 
ATOM   729  O OD1 . ASN A 1 91  ? 0.436   9.102   -12.603 0.50 30.44 ? 91  ASN A OD1 1 
ATOM   730  N ND2 . ASN A 1 91  ? -1.598  9.145   -11.639 0.70 30.59 ? 91  ASN A ND2 1 
ATOM   731  N N   . LYS A 1 92  ? 2.561   7.839   -9.847  1.00 24.42 ? 92  LYS A N   1 
ATOM   732  C CA  . LYS A 1 92  ? 2.541   6.436   -9.467  1.00 22.88 ? 92  LYS A CA  1 
ATOM   733  C C   . LYS A 1 92  ? 3.904   5.939   -9.050  1.00 22.85 ? 92  LYS A C   1 
ATOM   734  O O   . LYS A 1 92  ? 4.887   6.117   -9.785  1.00 22.27 ? 92  LYS A O   1 
ATOM   735  C CB  . LYS A 1 92  ? 2.043   5.587   -10.630 1.00 22.38 ? 92  LYS A CB  1 
ATOM   736  C CG  . LYS A 1 92  ? 2.321   4.097   -10.461 1.00 21.71 ? 92  LYS A CG  1 
ATOM   737  C CD  . LYS A 1 92  ? 1.643   3.311   -11.566 1.00 21.90 ? 92  LYS A CD  1 
ATOM   738  C CE  . LYS A 1 92  ? 1.911   1.844   -11.440 1.00 21.54 ? 92  LYS A CE  1 
ATOM   739  N NZ  . LYS A 1 92  ? 1.185   1.098   -12.501 1.00 21.72 ? 92  LYS A NZ  1 
ATOM   740  N N   . MET A 1 93  ? 3.960   5.301   -7.880  1.00 21.70 ? 93  MET A N   1 
ATOM   741  C CA  . MET A 1 93  ? 5.187   4.684   -7.406  1.00 22.08 ? 93  MET A CA  1 
ATOM   742  C C   . MET A 1 93  ? 4.994   3.181   -7.377  1.00 21.63 ? 93  MET A C   1 
ATOM   743  O O   . MET A 1 93  ? 3.867   2.706   -7.239  1.00 20.48 ? 93  MET A O   1 
ATOM   744  C CB  . MET A 1 93  ? 5.585   5.229   -6.032  1.00 22.48 ? 93  MET A CB  1 
ATOM   745  C CG  . MET A 1 93  ? 4.757   4.747   -4.865  1.00 24.00 ? 93  MET A CG  1 
ATOM   746  S SD  . MET A 1 93  ? 5.169   5.694   -3.374  1.00 25.06 ? 93  MET A SD  1 
ATOM   747  C CE  . MET A 1 93  ? 4.012   7.036   -3.489  1.00 24.56 ? 93  MET A CE  1 
ATOM   748  N N   . VAL A 1 94  ? 6.080   2.433   -7.561  1.00 21.88 ? 94  VAL A N   1 
ATOM   749  C CA  . VAL A 1 94  ? 6.027   0.978   -7.540  1.00 22.78 ? 94  VAL A CA  1 
ATOM   750  C C   . VAL A 1 94  ? 7.102   0.463   -6.595  1.00 23.41 ? 94  VAL A C   1 
ATOM   751  O O   . VAL A 1 94  ? 8.223   0.980   -6.594  1.00 23.98 ? 94  VAL A O   1 
ATOM   752  C CB  . VAL A 1 94  ? 6.278   0.403   -8.954  1.00 23.94 ? 94  VAL A CB  1 
ATOM   753  C CG1 . VAL A 1 94  ? 6.361   -1.130  -8.916  1.00 24.74 ? 94  VAL A CG1 1 
ATOM   754  C CG2 . VAL A 1 94  ? 5.189   0.870   -9.928  1.00 23.41 ? 94  VAL A CG2 1 
ATOM   755  N N   . CYS A 1 95  ? 6.780   -0.559  -5.806  1.00 23.72 ? 95  CYS A N   1 
ATOM   756  C CA  . CYS A 1 95  ? 7.735   -1.108  -4.835  1.00 22.72 ? 95  CYS A CA  1 
ATOM   757  C C   . CYS A 1 95  ? 7.977   -2.595  -5.048  1.00 23.05 ? 95  CYS A C   1 
ATOM   758  O O   . CYS A 1 95  ? 7.042   -3.404  -4.959  1.00 21.98 ? 95  CYS A O   1 
ATOM   759  C CB  . CYS A 1 95  ? 7.220   -0.898  -3.424  1.00 22.84 ? 95  CYS A CB  1 
ATOM   760  S SG  . CYS A 1 95  ? 8.298   -1.502  -2.125  1.00 24.47 ? 95  CYS A SG  1 
ATOM   761  N N   . GLU A 1 96  ? 9.227   -2.944  -5.343  1.00 22.72 ? 96  GLU A N   1 
ATOM   762  C CA  . GLU A 1 96  ? 9.651   -4.332  -5.411  1.00 23.14 ? 96  GLU A CA  1 
ATOM   763  C C   . GLU A 1 96  ? 10.147  -4.784  -4.043  1.00 23.36 ? 96  GLU A C   1 
ATOM   764  O O   . GLU A 1 96  ? 10.889  -4.073  -3.366  1.00 22.49 ? 96  GLU A O   1 
ATOM   765  C CB  . GLU A 1 96  ? 10.778  -4.519  -6.431  0.80 24.13 ? 96  GLU A CB  1 
ATOM   766  C CG  . GLU A 1 96  ? 11.906  -3.509  -6.286  0.40 24.27 ? 96  GLU A CG  1 
ATOM   767  C CD  . GLU A 1 96  ? 13.237  -4.050  -6.769  0.40 24.27 ? 96  GLU A CD  1 
ATOM   768  O OE1 . GLU A 1 96  ? 14.247  -3.325  -6.646  0.40 24.39 ? 96  GLU A OE1 1 
ATOM   769  O OE2 . GLU A 1 96  ? 13.274  -5.199  -7.264  0.40 24.20 ? 96  GLU A OE2 1 
ATOM   770  N N   . GLN A 1 97  ? 9.734   -5.975  -3.650  1.00 23.52 ? 97  GLN A N   1 
ATOM   771  C CA  . GLN A 1 97  ? 10.082  -6.511  -2.349  1.00 24.69 ? 97  GLN A CA  1 
ATOM   772  C C   . GLN A 1 97  ? 10.914  -7.780  -2.515  1.00 25.93 ? 97  GLN A C   1 
ATOM   773  O O   . GLN A 1 97  ? 10.720  -8.540  -3.466  1.00 25.71 ? 97  GLN A O   1 
ATOM   774  C CB  . GLN A 1 97  ? 8.810   -6.823  -1.568  1.00 24.20 ? 97  GLN A CB  1 
ATOM   775  C CG  . GLN A 1 97  ? 8.030   -5.608  -1.104  1.00 24.18 ? 97  GLN A CG  1 
ATOM   776  C CD  . GLN A 1 97  ? 6.731   -5.998  -0.449  1.00 24.18 ? 97  GLN A CD  1 
ATOM   777  O OE1 . GLN A 1 97  ? 6.152   -7.023  -0.784  1.00 25.13 ? 97  GLN A OE1 1 
ATOM   778  N NE2 . GLN A 1 97  ? 6.264   -5.190  0.483   1.00 23.42 ? 97  GLN A NE2 1 
ATOM   779  N N   . LYS A 1 98  ? 11.846  -7.993  -1.590  1.00 27.45 ? 98  LYS A N   1 
ATOM   780  C CA  . LYS A 1 98  ? 12.657  -9.193  -1.560  1.00 28.95 ? 98  LYS A CA  1 
ATOM   781  C C   . LYS A 1 98  ? 12.737  -9.702  -0.119  1.00 29.67 ? 98  LYS A C   1 
ATOM   782  O O   . LYS A 1 98  ? 13.203  -8.991  0.766   1.00 29.48 ? 98  LYS A O   1 
ATOM   783  C CB  . LYS A 1 98  ? 14.067  -8.895  -2.071  1.00 30.96 ? 98  LYS A CB  1 
ATOM   784  C CG  . LYS A 1 98  ? 14.856  -10.153 -2.433  1.00 33.03 ? 98  LYS A CG  1 
ATOM   785  C CD  . LYS A 1 98  ? 16.364  -9.893  -2.503  1.00 34.55 ? 98  LYS A CD  1 
ATOM   786  C CE  . LYS A 1 98  ? 16.707  -8.741  -3.434  1.00 36.02 ? 98  LYS A CE  1 
ATOM   787  N NZ  . LYS A 1 98  ? 18.113  -8.865  -3.914  1.00 36.53 ? 98  LYS A NZ  1 
ATOM   788  N N   . LEU A 1 99  ? 12.276  -10.928 0.111   1.00 30.47 ? 99  LEU A N   1 
ATOM   789  C CA  . LEU A 1 99  ? 12.297  -11.524 1.450   1.00 31.07 ? 99  LEU A CA  1 
ATOM   790  C C   . LEU A 1 99  ? 13.700  -11.465 2.039   1.00 31.43 ? 99  LEU A C   1 
ATOM   791  O O   . LEU A 1 99  ? 14.678  -11.669 1.336   1.00 30.77 ? 99  LEU A O   1 
ATOM   792  C CB  . LEU A 1 99  ? 11.814  -12.973 1.386   1.00 31.63 ? 99  LEU A CB  1 
ATOM   793  C CG  . LEU A 1 99  ? 10.303  -13.152 1.200   1.00 32.32 ? 99  LEU A CG  1 
ATOM   794  C CD1 . LEU A 1 99  ? 9.975   -14.552 0.705   1.00 32.81 ? 99  LEU A CD1 1 
ATOM   795  C CD2 . LEU A 1 99  ? 9.565   -12.853 2.504   1.00 32.54 ? 99  LEU A CD2 1 
ATOM   796  N N   . LEU A 1 100 ? 13.793  -11.176 3.331   1.00 32.91 ? 100 LEU A N   1 
ATOM   797  C CA  . LEU A 1 100 ? 15.082  -11.123 4.013   1.00 34.41 ? 100 LEU A CA  1 
ATOM   798  C C   . LEU A 1 100 ? 15.620  -12.517 4.268   1.00 35.51 ? 100 LEU A C   1 
ATOM   799  O O   . LEU A 1 100 ? 16.829  -12.748 4.241   1.00 35.98 ? 100 LEU A O   1 
ATOM   800  C CB  . LEU A 1 100 ? 14.952  -10.354 5.320   1.00 33.73 ? 100 LEU A CB  1 
ATOM   801  C CG  . LEU A 1 100 ? 14.801  -8.846  5.138   1.00 33.90 ? 100 LEU A CG  1 
ATOM   802  C CD1 . LEU A 1 100 ? 14.560  -8.165  6.475   1.00 33.86 ? 100 LEU A CD1 1 
ATOM   803  C CD2 . LEU A 1 100 ? 16.036  -8.284  4.458   1.00 34.03 ? 100 LEU A CD2 1 
ATOM   804  N N   . LYS A 1 101 ? 14.705  -13.445 4.511   1.00 37.05 ? 101 LYS A N   1 
ATOM   805  C CA  . LYS A 1 101 ? 15.054  -14.827 4.783   1.00 38.03 ? 101 LYS A CA  1 
ATOM   806  C C   . LYS A 1 101 ? 14.045  -15.748 4.125   1.00 38.22 ? 101 LYS A C   1 
ATOM   807  O O   . LYS A 1 101 ? 12.835  -15.555 4.255   1.00 38.79 ? 101 LYS A O   1 
ATOM   808  C CB  . LYS A 1 101 ? 15.074  -15.086 6.291   1.00 38.97 ? 101 LYS A CB  1 
ATOM   809  C CG  . LYS A 1 101 ? 16.136  -14.297 7.038   1.00 39.75 ? 101 LYS A CG  1 
ATOM   810  C CD  . LYS A 1 101 ? 16.260  -14.781 8.470   1.00 40.64 ? 101 LYS A CD  1 
ATOM   811  C CE  . LYS A 1 101 ? 17.451  -14.143 9.171   1.00 41.26 ? 101 LYS A CE  1 
ATOM   812  N NZ  . LYS A 1 101 ? 17.569  -14.636 10.575  1.00 41.67 ? 101 LYS A NZ  1 
ATOM   813  N N   . GLY A 1 102 ? 14.549  -16.743 3.409   1.00 37.90 ? 102 GLY A N   1 
ATOM   814  C CA  . GLY A 1 102 ? 13.702  -17.759 2.817   1.00 37.27 ? 102 GLY A CA  1 
ATOM   815  C C   . GLY A 1 102 ? 13.246  -17.406 1.421   1.00 37.21 ? 102 GLY A C   1 
ATOM   816  O O   . GLY A 1 102 ? 13.725  -16.440 0.814   1.00 36.54 ? 102 GLY A O   1 
ATOM   817  N N   . GLU A 1 103 ? 12.312  -18.203 0.909   1.00 36.34 ? 103 GLU A N   1 
ATOM   818  C CA  . GLU A 1 103 ? 11.758  -17.979 -0.411  1.00 35.77 ? 103 GLU A CA  1 
ATOM   819  C C   . GLU A 1 103 ? 10.253  -17.799 -0.282  1.00 34.11 ? 103 GLU A C   1 
ATOM   820  O O   . GLU A 1 103 ? 9.661   -18.138 0.744   1.00 33.54 ? 103 GLU A O   1 
ATOM   821  C CB  . GLU A 1 103 ? 12.106  -19.146 -1.344  1.00 37.23 ? 103 GLU A CB  1 
ATOM   822  C CG  . GLU A 1 103 ? 13.553  -19.124 -1.853  1.00 38.50 ? 103 GLU A CG  1 
ATOM   823  C CD  . GLU A 1 103 ? 14.165  -20.510 -1.968  1.00 39.61 ? 103 GLU A CD  1 
ATOM   824  O OE1 . GLU A 1 103 ? 14.208  -21.233 -0.943  1.00 40.21 ? 103 GLU A OE1 1 
ATOM   825  O OE2 . GLU A 1 103 ? 14.619  -20.879 -3.081  1.00 40.65 ? 103 GLU A OE2 1 
ATOM   826  N N   . GLY A 1 104 ? 9.634   -17.252 -1.318  1.00 31.85 ? 104 GLY A N   1 
ATOM   827  C CA  . GLY A 1 104 ? 8.203   -17.001 -1.267  1.00 30.41 ? 104 GLY A CA  1 
ATOM   828  C C   . GLY A 1 104 ? 7.659   -16.497 -2.579  1.00 29.59 ? 104 GLY A C   1 
ATOM   829  O O   . GLY A 1 104 ? 8.376   -16.435 -3.574  1.00 30.47 ? 104 GLY A O   1 
ATOM   830  N N   . PRO A 1 105 ? 6.375   -16.131 -2.597  1.00 29.22 ? 105 PRO A N   1 
ATOM   831  C CA  . PRO A 1 105 ? 5.819   -15.554 -3.812  1.00 28.45 ? 105 PRO A CA  1 
ATOM   832  C C   . PRO A 1 105 ? 6.549   -14.245 -4.128  1.00 27.89 ? 105 PRO A C   1 
ATOM   833  O O   . PRO A 1 105 ? 7.130   -13.645 -3.236  1.00 27.77 ? 105 PRO A O   1 
ATOM   834  C CB  . PRO A 1 105 ? 4.360   -15.258 -3.438  1.00 28.81 ? 105 PRO A CB  1 
ATOM   835  C CG  . PRO A 1 105 ? 4.081   -16.020 -2.189  1.00 29.13 ? 105 PRO A CG  1 
ATOM   836  C CD  . PRO A 1 105 ? 5.402   -16.206 -1.493  1.00 29.11 ? 105 PRO A CD  1 
ATOM   837  N N   . LYS A 1 106 ? 6.531   -13.818 -5.383  1.00 28.07 ? 106 LYS A N   1 
ATOM   838  C CA  . LYS A 1 106 ? 7.040   -12.502 -5.734  1.00 29.21 ? 106 LYS A CA  1 
ATOM   839  C C   . LYS A 1 106 ? 5.997   -11.466 -5.304  1.00 28.36 ? 106 LYS A C   1 
ATOM   840  O O   . LYS A 1 106 ? 4.859   -11.504 -5.774  1.00 28.29 ? 106 LYS A O   1 
ATOM   841  C CB  . LYS A 1 106 ? 7.284   -12.418 -7.237  1.00 31.12 ? 106 LYS A CB  1 
ATOM   842  C CG  . LYS A 1 106 ? 8.269   -11.335 -7.655  1.00 33.59 ? 106 LYS A CG  1 
ATOM   843  C CD  . LYS A 1 106 ? 8.145   -11.025 -9.150  1.00 34.93 ? 106 LYS A CD  1 
ATOM   844  C CE  . LYS A 1 106 ? 9.138   -9.940  -9.568  1.00 35.80 ? 106 LYS A CE  1 
ATOM   845  N NZ  . LYS A 1 106 ? 8.943   -9.477  -10.978 1.00 37.47 ? 106 LYS A NZ  1 
ATOM   846  N N   . THR A 1 107 ? 6.369   -10.562 -4.396  1.00 26.90 ? 107 THR A N   1 
ATOM   847  C CA  . THR A 1 107 ? 5.414   -9.564  -3.888  1.00 25.21 ? 107 THR A CA  1 
ATOM   848  C C   . THR A 1 107 ? 5.823   -8.134  -4.227  1.00 24.44 ? 107 THR A C   1 
ATOM   849  O O   . THR A 1 107 ? 7.004   -7.786  -4.235  1.00 23.99 ? 107 THR A O   1 
ATOM   850  C CB  . THR A 1 107 ? 5.189   -9.669  -2.350  1.00 25.78 ? 107 THR A CB  1 
ATOM   851  O OG1 . THR A 1 107 ? 6.443   -9.516  -1.670  1.00 25.64 ? 107 THR A OG1 1 
ATOM   852  C CG2 . THR A 1 107 ? 4.537   -11.003 -1.974  1.00 26.40 ? 107 THR A CG2 1 
ATOM   853  N N   . SER A 1 108 ? 4.840   -7.301  -4.537  1.00 22.95 ? 108 SER A N   1 
ATOM   854  C CA  . SER A 1 108 ? 5.126   -5.914  -4.843  1.00 22.63 ? 108 SER A CA  1 
ATOM   855  C C   . SER A 1 108 ? 3.909   -5.108  -4.519  1.00 22.40 ? 108 SER A C   1 
ATOM   856  O O   . SER A 1 108 ? 2.822   -5.668  -4.330  1.00 22.72 ? 108 SER A O   1 
ATOM   857  C CB  . SER A 1 108 ? 5.465   -5.728  -6.316  1.00 22.81 ? 108 SER A CB  1 
ATOM   858  O OG  . SER A 1 108 ? 4.432   -6.223  -7.146  1.00 24.60 ? 108 SER A OG  1 
ATOM   859  N N   . TRP A 1 109 ? 4.081   -3.798  -4.466  1.00 22.00 ? 109 TRP A N   1 
ATOM   860  C CA  . TRP A 1 109 ? 2.933   -2.919  -4.304  1.00 21.62 ? 109 TRP A CA  1 
ATOM   861  C C   . TRP A 1 109 ? 3.051   -1.653  -5.140  1.00 22.06 ? 109 TRP A C   1 
ATOM   862  O O   . TRP A 1 109 ? 4.124   -1.344  -5.668  1.00 21.57 ? 109 TRP A O   1 
ATOM   863  C CB  . TRP A 1 109 ? 2.613   -2.651  -2.827  1.00 21.68 ? 109 TRP A CB  1 
ATOM   864  C CG  . TRP A 1 109 ? 3.664   -1.972  -1.943  1.00 21.85 ? 109 TRP A CG  1 
ATOM   865  C CD1 . TRP A 1 109 ? 4.421   -2.567  -0.974  1.00 22.36 ? 109 TRP A CD1 1 
ATOM   866  C CD2 . TRP A 1 109 ? 3.986   -0.569  -1.891  1.00 21.92 ? 109 TRP A CD2 1 
ATOM   867  N NE1 . TRP A 1 109 ? 5.222   -1.635  -0.348  1.00 21.68 ? 109 TRP A NE1 1 
ATOM   868  C CE2 . TRP A 1 109 ? 4.970   -0.401  -0.890  1.00 22.33 ? 109 TRP A CE2 1 
ATOM   869  C CE3 . TRP A 1 109 ? 3.562   0.553   -2.617  1.00 21.84 ? 109 TRP A CE3 1 
ATOM   870  C CZ2 . TRP A 1 109 ? 5.528   0.845   -0.590  1.00 22.47 ? 109 TRP A CZ2 1 
ATOM   871  C CZ3 . TRP A 1 109 ? 4.125   1.797   -2.323  1.00 22.08 ? 109 TRP A CZ3 1 
ATOM   872  C CH2 . TRP A 1 109 ? 5.091   1.930   -1.306  1.00 21.93 ? 109 TRP A CH2 1 
ATOM   873  N N   . THR A 1 110 ? 1.937   -0.954  -5.328  1.00 21.21 ? 110 THR A N   1 
ATOM   874  C CA  . THR A 1 110 ? 1.973   0.296   -6.072  1.00 21.41 ? 110 THR A CA  1 
ATOM   875  C C   . THR A 1 110 ? 1.052   1.262   -5.358  1.00 20.59 ? 110 THR A C   1 
ATOM   876  O O   . THR A 1 110 ? 0.120   0.833   -4.686  1.00 20.24 ? 110 THR A O   1 
ATOM   877  C CB  . THR A 1 110 ? 1.533   0.139   -7.554  1.00 22.05 ? 110 THR A CB  1 
ATOM   878  O OG1 . THR A 1 110 ? 0.101   0.025   -7.650  1.00 23.03 ? 110 THR A OG1 1 
ATOM   879  C CG2 . THR A 1 110 ? 2.171   -1.097  -8.206  1.00 23.06 ? 110 THR A CG2 1 
ATOM   880  N N   . LEU A 1 111 ? 1.327   2.548   -5.489  1.00 20.06 ? 111 LEU A N   1 
ATOM   881  C CA  . LEU A 1 111 ? 0.447   3.588   -4.958  1.00 20.49 ? 111 LEU A CA  1 
ATOM   882  C C   . LEU A 1 111 ? 0.303   4.623   -6.053  1.00 20.58 ? 111 LEU A C   1 
ATOM   883  O O   . LEU A 1 111 ? 1.293   5.062   -6.612  1.00 18.68 ? 111 LEU A O   1 
ATOM   884  C CB  . LEU A 1 111 ? 1.050   4.254   -3.700  1.00 20.38 ? 111 LEU A CB  1 
ATOM   885  C CG  . LEU A 1 111 ? 0.715   3.733   -2.287  1.00 21.42 ? 111 LEU A CG  1 
ATOM   886  C CD1 . LEU A 1 111 ? 1.276   4.689   -1.216  1.00 20.45 ? 111 LEU A CD1 1 
ATOM   887  C CD2 . LEU A 1 111 ? -0.791  3.535   -2.069  1.00 21.08 ? 111 LEU A CD2 1 
ATOM   888  N N   . GLU A 1 112 ? -0.921  5.025   -6.369  1.00 21.29 ? 112 GLU A N   1 
ATOM   889  C CA  . GLU A 1 112 ? -1.088  6.036   -7.402  1.00 22.52 ? 112 GLU A CA  1 
ATOM   890  C C   . GLU A 1 112 ? -2.271  6.946   -7.120  1.00 23.50 ? 112 GLU A C   1 
ATOM   891  O O   . GLU A 1 112 ? -3.256  6.529   -6.516  1.00 22.93 ? 112 GLU A O   1 
ATOM   892  C CB  . GLU A 1 112 ? -1.192  5.391   -8.789  1.00 22.66 ? 112 GLU A CB  1 
ATOM   893  C CG  . GLU A 1 112 ? -2.482  4.642   -9.077  1.00 23.10 ? 112 GLU A CG  1 
ATOM   894  C CD  . GLU A 1 112 ? -2.344  3.679   -10.249 1.00 23.79 ? 112 GLU A CD  1 
ATOM   895  O OE1 . GLU A 1 112 ? -2.160  4.154   -11.392 1.00 22.95 ? 112 GLU A OE1 1 
ATOM   896  O OE2 . GLU A 1 112 ? -2.416  2.449   -10.021 1.00 24.59 ? 112 GLU A OE2 1 
ATOM   897  N N   . LEU A 1 113 ? -2.148  8.193   -7.563  1.00 25.88 ? 113 LEU A N   1 
ATOM   898  C CA  . LEU A 1 113 ? -3.162  9.214   -7.388  1.00 27.66 ? 113 LEU A CA  1 
ATOM   899  C C   . LEU A 1 113 ? -3.893  9.439   -8.688  1.00 29.48 ? 113 LEU A C   1 
ATOM   900  O O   . LEU A 1 113 ? -3.262  9.648   -9.723  1.00 30.33 ? 113 LEU A O   1 
ATOM   901  C CB  . LEU A 1 113 ? -2.484  10.535  -7.048  1.00 28.67 ? 113 LEU A CB  1 
ATOM   902  C CG  . LEU A 1 113 ? -2.066  10.895  -5.636  1.00 29.06 ? 113 LEU A CG  1 
ATOM   903  C CD1 . LEU A 1 113 ? -1.437  12.277  -5.663  1.00 28.87 ? 113 LEU A CD1 1 
ATOM   904  C CD2 . LEU A 1 113 ? -3.287  10.876  -4.733  1.00 29.50 ? 113 LEU A CD2 1 
ATOM   905  N N   . THR A 1 114 ? -5.219  9.427   -8.648  1.00 30.01 ? 114 THR A N   1 
ATOM   906  C CA  . THR A 1 114 ? -5.986  9.762   -9.832  1.00 31.18 ? 114 THR A CA  1 
ATOM   907  C C   . THR A 1 114 ? -6.134  11.286  -9.905  1.00 32.89 ? 114 THR A C   1 
ATOM   908  O O   . THR A 1 114 ? -5.766  12.000  -8.964  1.00 33.25 ? 114 THR A O   1 
ATOM   909  C CB  . THR A 1 114 ? -7.354  9.099   -9.818  1.00 30.41 ? 114 THR A CB  1 
ATOM   910  O OG1 . THR A 1 114 ? -8.170  9.736   -8.836  1.00 30.06 ? 114 THR A OG1 1 
ATOM   911  C CG2 . THR A 1 114 ? -7.231  7.614   -9.487  1.00 30.24 ? 114 THR A CG2 1 
ATOM   912  N N   . ASN A 1 115 ? -6.643  11.796  -11.024 1.00 35.22 ? 115 ASN A N   1 
ATOM   913  C CA  . ASN A 1 115 ? -6.809  13.238  -11.141 1.00 37.01 ? 115 ASN A CA  1 
ATOM   914  C C   . ASN A 1 115 ? -8.055  13.716  -10.412 1.00 37.39 ? 115 ASN A C   1 
ATOM   915  O O   . ASN A 1 115 ? -8.229  14.905  -10.202 1.00 38.55 ? 115 ASN A O   1 
ATOM   916  C CB  . ASN A 1 115 ? -6.776  13.723  -12.595 1.00 38.19 ? 115 ASN A CB  1 
ATOM   917  C CG  . ASN A 1 115 ? -6.006  15.035  -12.749 1.00 38.90 ? 115 ASN A CG  1 
ATOM   918  O OD1 . ASN A 1 115 ? -6.386  16.069  -12.201 1.00 38.94 ? 115 ASN A OD1 1 
ATOM   919  N ND2 . ASN A 1 115 ? -4.908  14.987  -13.488 1.00 40.04 ? 115 ASN A ND2 1 
ATOM   920  N N   . ASP A 1 116 ? -8.909  12.777  -10.014 1.00 37.38 ? 116 ASP A N   1 
ATOM   921  C CA  . ASP A 1 116 ? -10.007 13.078  -9.105  1.00 37.43 ? 116 ASP A CA  1 
ATOM   922  C C   . ASP A 1 116 ? -9.566  12.974  -7.648  1.00 36.83 ? 116 ASP A C   1 
ATOM   923  O O   . ASP A 1 116 ? -10.368 13.149  -6.739  1.00 37.82 ? 116 ASP A O   1 
ATOM   924  C CB  . ASP A 1 116 ? -11.183 12.140  -9.356  1.00 38.86 ? 116 ASP A CB  1 
ATOM   925  C CG  . ASP A 1 116 ? -11.934 12.477  -10.628 1.00 40.20 ? 116 ASP A CG  1 
ATOM   926  O OD1 . ASP A 1 116 ? -11.652 13.537  -11.231 1.00 41.08 ? 116 ASP A OD1 1 
ATOM   927  O OD2 . ASP A 1 116 ? -12.807 11.679  -11.026 1.00 41.15 ? 116 ASP A OD2 1 
ATOM   928  N N   . GLY A 1 117 ? -8.288  12.688  -7.435  1.00 35.66 ? 117 GLY A N   1 
ATOM   929  C CA  . GLY A 1 117 ? -7.723  12.637  -6.092  1.00 34.26 ? 117 GLY A CA  1 
ATOM   930  C C   . GLY A 1 117 ? -8.137  11.427  -5.275  1.00 32.77 ? 117 GLY A C   1 
ATOM   931  O O   . GLY A 1 117 ? -8.369  11.531  -4.071  1.00 33.35 ? 117 GLY A O   1 
ATOM   932  N N   . GLU A 1 118 ? -8.254  10.277  -5.926  1.00 30.70 ? 118 GLU A N   1 
ATOM   933  C CA  . GLU A 1 118 ? -8.415  9.029   -5.198  1.00 28.62 ? 118 GLU A CA  1 
ATOM   934  C C   . GLU A 1 118 ? -7.033  8.435   -5.121  1.00 26.52 ? 118 GLU A C   1 
ATOM   935  O O   . GLU A 1 118 ? -6.225  8.646   -6.019  1.00 25.53 ? 118 GLU A O   1 
ATOM   936  C CB  . GLU A 1 118 ? -9.314  8.064   -5.958  1.00 29.69 ? 118 GLU A CB  1 
ATOM   937  C CG  . GLU A 1 118 ? -10.767 8.456   -5.966  1.00 31.73 ? 118 GLU A CG  1 
ATOM   938  C CD  . GLU A 1 118 ? -11.292 8.592   -7.368  1.00 33.31 ? 118 GLU A CD  1 
ATOM   939  O OE1 . GLU A 1 118 ? -10.521 8.317   -8.319  1.00 33.55 ? 118 GLU A OE1 1 
ATOM   940  O OE2 . GLU A 1 118 ? -12.468 8.986   -7.518  0.90 34.59 ? 118 GLU A OE2 1 
ATOM   941  N N   . LEU A 1 119 ? -6.767  7.676   -4.067  1.00 23.48 ? 119 LEU A N   1 
ATOM   942  C CA  . LEU A 1 119 ? -5.484  7.002   -3.933  1.00 22.14 ? 119 LEU A CA  1 
ATOM   943  C C   . LEU A 1 119 ? -5.707  5.528   -4.177  1.00 21.34 ? 119 LEU A C   1 
ATOM   944  O O   . LEU A 1 119 ? -6.527  4.909   -3.507  1.00 21.25 ? 119 LEU A O   1 
ATOM   945  C CB  . LEU A 1 119 ? -4.926  7.211   -2.521  1.00 21.41 ? 119 LEU A CB  1 
ATOM   946  C CG  . LEU A 1 119 ? -3.608  6.517   -2.180  1.00 20.69 ? 119 LEU A CG  1 
ATOM   947  C CD1 . LEU A 1 119 ? -2.412  7.240   -2.814  1.00 19.79 ? 119 LEU A CD1 1 
ATOM   948  C CD2 . LEU A 1 119 ? -3.467  6.463   -0.677  1.00 20.95 ? 119 LEU A CD2 1 
ATOM   949  N N   . ILE A 1 120 ? -4.983  4.960   -5.133  1.00 21.40 ? 120 ILE A N   1 
ATOM   950  C CA  . ILE A 1 120 ? -5.143  3.544   -5.435  1.00 21.91 ? 120 ILE A CA  1 
ATOM   951  C C   . ILE A 1 120 ? -3.960  2.771   -4.918  1.00 22.36 ? 120 ILE A C   1 
ATOM   952  O O   . ILE A 1 120 ? -2.828  3.074   -5.257  1.00 22.08 ? 120 ILE A O   1 
ATOM   953  C CB  . ILE A 1 120 ? -5.251  3.294   -6.936  1.00 22.47 ? 120 ILE A CB  1 
ATOM   954  C CG1 . ILE A 1 120 ? -6.433  4.082   -7.517  1.00 22.73 ? 120 ILE A CG1 1 
ATOM   955  C CG2 . ILE A 1 120 ? -5.356  1.785   -7.219  1.00 22.11 ? 120 ILE A CG2 1 
ATOM   956  C CD1 . ILE A 1 120 ? -6.448  4.153   -9.027  1.00 22.68 ? 120 ILE A CD1 1 
ATOM   957  N N   . ASP A 1 121 ? -4.230  1.771   -4.091  1.00 21.87 ? 121 ASP A N   1 
ATOM   958  C CA  . ASP A 1 121 ? -3.181  0.944   -3.525  1.00 22.35 ? 121 ASP A CA  1 
ATOM   959  C C   . ASP A 1 121 ? -3.369  -0.461  -4.088  1.00 21.78 ? 121 ASP A C   1 
ATOM   960  O O   . ASP A 1 121 ? -4.435  -1.055  -3.913  1.00 20.74 ? 121 ASP A O   1 
ATOM   961  C CB  . ASP A 1 121 ? -3.322  0.931   -2.003  1.00 24.14 ? 121 ASP A CB  1 
ATOM   962  C CG  . ASP A 1 121 ? -2.444  -0.111  -1.339  1.00 25.89 ? 121 ASP A CG  1 
ATOM   963  O OD1 . ASP A 1 121 ? -2.063  -1.088  -2.014  1.00 27.87 ? 121 ASP A OD1 1 
ATOM   964  O OD2 . ASP A 1 121 ? -2.149  0.030   -0.140  1.00 26.88 ? 121 ASP A OD2 1 
ATOM   965  N N   . THR A 1 122 ? -2.368  -0.985  -4.791  1.00 21.48 ? 122 THR A N   1 
ATOM   966  C CA  . THR A 1 122 ? -2.443  -2.370  -5.249  1.00 21.33 ? 122 THR A CA  1 
ATOM   967  C C   . THR A 1 122 ? -1.357  -3.183  -4.584  1.00 22.37 ? 122 THR A C   1 
ATOM   968  O O   . THR A 1 122 ? -0.281  -2.663  -4.252  1.00 21.37 ? 122 THR A O   1 
ATOM   969  C CB  . THR A 1 122 ? -2.346  -2.540  -6.783  1.00 22.29 ? 122 THR A CB  1 
ATOM   970  O OG1 . THR A 1 122 ? -0.963  -2.519  -7.183  1.00 22.52 ? 122 THR A OG1 1 
ATOM   971  C CG2 . THR A 1 122 ? -3.131  -1.457  -7.505  1.00 21.22 ? 122 THR A CG2 1 
ATOM   972  N N   . MET A 1 123 ? -1.657  -4.458  -4.368  1.00 23.01 ? 123 MET A N   1 
ATOM   973  C CA  . MET A 1 123 ? -0.706  -5.405  -3.799  1.00 25.53 ? 123 MET A CA  1 
ATOM   974  C C   . MET A 1 123 ? -0.748  -6.655  -4.667  1.00 24.32 ? 123 MET A C   1 
ATOM   975  O O   . MET A 1 123 ? -1.830  -7.211  -4.891  1.00 23.55 ? 123 MET A O   1 
ATOM   976  C CB  . MET A 1 123 ? -1.123  -5.788  -2.379  0.90 26.27 ? 123 MET A CB  1 
ATOM   977  C CG  . MET A 1 123 ? -1.275  -4.642  -1.405  0.70 28.39 ? 123 MET A CG  1 
ATOM   978  S SD  . MET A 1 123 ? -2.839  -4.739  -0.500  0.70 29.93 ? 123 MET A SD  1 
ATOM   979  C CE  . MET A 1 123 ? -3.849  -3.640  -1.481  0.80 28.19 ? 123 MET A CE  1 
ATOM   980  N N   . THR A 1 124 ? 0.416   -7.096  -5.144  1.00 24.15 ? 124 THR A N   1 
ATOM   981  C CA  . THR A 1 124 ? 0.519   -8.310  -5.953  1.00 25.24 ? 124 THR A CA  1 
ATOM   982  C C   . THR A 1 124 ? 1.343   -9.383  -5.257  1.00 25.85 ? 124 THR A C   1 
ATOM   983  O O   . THR A 1 124 ? 2.341   -9.084  -4.576  1.00 25.45 ? 124 THR A O   1 
ATOM   984  C CB  . THR A 1 124 ? 1.158   -8.025  -7.322  1.00 25.82 ? 124 THR A CB  1 
ATOM   985  O OG1 . THR A 1 124 ? 0.398   -7.030  -8.001  1.00 25.51 ? 124 THR A OG1 1 
ATOM   986  C CG2 . THR A 1 124 ? 1.192   -9.293  -8.186  1.00 26.13 ? 124 THR A CG2 1 
ATOM   987  N N   . ALA A 1 125 ? 0.899   -10.631 -5.397  1.00 25.67 ? 125 ALA A N   1 
ATOM   988  C CA  . ALA A 1 125 ? 1.692   -11.792 -5.010  1.00 26.01 ? 125 ALA A CA  1 
ATOM   989  C C   . ALA A 1 125 ? 1.613   -12.765 -6.168  1.00 26.32 ? 125 ALA A C   1 
ATOM   990  O O   . ALA A 1 125 ? 0.562   -13.342 -6.421  1.00 25.60 ? 125 ALA A O   1 
ATOM   991  C CB  . ALA A 1 125 ? 1.156   -12.422 -3.751  1.00 25.84 ? 125 ALA A CB  1 
ATOM   992  N N   . ASP A 1 126 ? 2.723   -12.915 -6.889  1.00 27.33 ? 126 ASP A N   1 
ATOM   993  C CA  . ASP A 1 126 ? 2.749   -13.709 -8.113  1.00 27.75 ? 126 ASP A CA  1 
ATOM   994  C C   . ASP A 1 126 ? 1.693   -13.213 -9.104  1.00 27.90 ? 126 ASP A C   1 
ATOM   995  O O   . ASP A 1 126 ? 1.814   -12.108 -9.637  1.00 28.29 ? 126 ASP A O   1 
ATOM   996  C CB  . ASP A 1 126 ? 2.577   -15.205 -7.802  1.00 27.76 ? 126 ASP A CB  1 
ATOM   997  C CG  . ASP A 1 126 ? 3.779   -15.792 -7.080  1.00 28.63 ? 126 ASP A CG  1 
ATOM   998  O OD1 . ASP A 1 126 ? 4.889   -15.259 -7.255  1.00 28.48 ? 126 ASP A OD1 1 
ATOM   999  O OD2 . ASP A 1 126 ? 3.618   -16.780 -6.332  1.00 29.33 ? 126 ASP A OD2 1 
ATOM   1000 N N   . ASP A 1 127 ? 0.665   -14.025 -9.345  1.00 27.76 ? 127 ASP A N   1 
ATOM   1001 C CA  . ASP A 1 127 ? -0.358  -13.706 -10.349 1.00 28.40 ? 127 ASP A CA  1 
ATOM   1002 C C   . ASP A 1 127 ? -1.656  -13.155 -9.748  1.00 27.20 ? 127 ASP A C   1 
ATOM   1003 O O   . ASP A 1 127 ? -2.664  -13.053 -10.447 1.00 27.17 ? 127 ASP A O   1 
ATOM   1004 C CB  . ASP A 1 127 ? -0.696  -14.943 -11.193 1.00 29.22 ? 127 ASP A CB  1 
ATOM   1005 C CG  . ASP A 1 127 ? -1.033  -16.163 -10.337 1.00 30.03 ? 127 ASP A CG  1 
ATOM   1006 O OD1 . ASP A 1 127 ? -0.691  -16.165 -9.137  1.00 30.22 ? 127 ASP A OD1 1 
ATOM   1007 O OD2 . ASP A 1 127 ? -1.628  -17.124 -10.867 1.00 31.16 ? 127 ASP A OD2 1 
ATOM   1008 N N   . VAL A 1 128 ? -1.625  -12.794 -8.470  1.00 25.09 ? 128 VAL A N   1 
ATOM   1009 C CA  . VAL A 1 128 ? -2.828  -12.352 -7.768  1.00 24.15 ? 128 VAL A CA  1 
ATOM   1010 C C   . VAL A 1 128 ? -2.712  -10.883 -7.365  1.00 22.91 ? 128 VAL A C   1 
ATOM   1011 O O   . VAL A 1 128 ? -1.716  -10.492 -6.758  1.00 22.89 ? 128 VAL A O   1 
ATOM   1012 C CB  . VAL A 1 128 ? -3.048  -13.212 -6.499  1.00 24.29 ? 128 VAL A CB  1 
ATOM   1013 C CG1 . VAL A 1 128 ? -4.373  -12.874 -5.837  1.00 23.69 ? 128 VAL A CG1 1 
ATOM   1014 C CG2 . VAL A 1 128 ? -2.987  -14.684 -6.848  1.00 25.01 ? 128 VAL A CG2 1 
ATOM   1015 N N   . VAL A 1 129 ? -3.720  -10.074 -7.698  1.00 21.82 ? 129 VAL A N   1 
ATOM   1016 C CA  . VAL A 1 129 ? -3.702  -8.646  -7.370  1.00 21.17 ? 129 VAL A CA  1 
ATOM   1017 C C   . VAL A 1 129 ? -4.870  -8.264  -6.443  1.00 20.34 ? 129 VAL A C   1 
ATOM   1018 O O   . VAL A 1 129 ? -6.000  -8.647  -6.688  1.00 18.79 ? 129 VAL A O   1 
ATOM   1019 C CB  . VAL A 1 129 ? -3.764  -7.775  -8.657  1.00 21.85 ? 129 VAL A CB  1 
ATOM   1020 C CG1 . VAL A 1 129 ? -3.741  -6.278  -8.310  1.00 21.03 ? 129 VAL A CG1 1 
ATOM   1021 C CG2 . VAL A 1 129 ? -2.616  -8.121  -9.605  1.00 21.56 ? 129 VAL A CG2 1 
ATOM   1022 N N   . CYS A 1 130 ? -4.578  -7.544  -5.363  1.00 21.13 ? 130 CYS A N   1 
ATOM   1023 C CA  . CYS A 1 130 ? -5.612  -6.910  -4.553  1.00 20.94 ? 130 CYS A CA  1 
ATOM   1024 C C   . CYS A 1 130 ? -5.516  -5.395  -4.719  1.00 19.54 ? 130 CYS A C   1 
ATOM   1025 O O   . CYS A 1 130 ? -4.419  -4.823  -4.672  1.00 17.50 ? 130 CYS A O   1 
ATOM   1026 C CB  . CYS A 1 130 ? -5.444  -7.240  -3.068  1.00 22.14 ? 130 CYS A CB  1 
ATOM   1027 S SG  . CYS A 1 130 ? -6.402  -6.122  -2.016  1.00 25.79 ? 130 CYS A SG  1 
ATOM   1028 N N   . THR A 1 131 ? -6.669  -4.754  -4.885  1.00 18.76 ? 131 THR A N   1 
ATOM   1029 C CA  . THR A 1 131 ? -6.738  -3.313  -5.074  1.00 17.56 ? 131 THR A CA  1 
ATOM   1030 C C   . THR A 1 131 ? -7.589  -2.672  -3.978  1.00 17.64 ? 131 THR A C   1 
ATOM   1031 O O   . THR A 1 131 ? -8.693  -3.151  -3.688  1.00 14.96 ? 131 THR A O   1 
ATOM   1032 C CB  . THR A 1 131 ? -7.339  -2.957  -6.449  1.00 17.71 ? 131 THR A CB  1 
ATOM   1033 O OG1 . THR A 1 131 ? -6.461  -3.408  -7.490  1.00 19.10 ? 131 THR A OG1 1 
ATOM   1034 C CG2 . THR A 1 131 ? -7.517  -1.426  -6.595  1.00 18.02 ? 131 THR A CG2 1 
ATOM   1035 N N   . LYS A 1 132 ? -7.071  -1.597  -3.388  1.00 16.79 ? 132 LYS A N   1 
ATOM   1036 C CA  . LYS A 1 132 ? -7.832  -0.786  -2.442  1.00 19.17 ? 132 LYS A CA  1 
ATOM   1037 C C   . LYS A 1 132 ? -7.852  0.654   -2.909  1.00 18.97 ? 132 LYS A C   1 
ATOM   1038 O O   . LYS A 1 132 ? -6.906  1.120   -3.536  1.00 19.42 ? 132 LYS A O   1 
ATOM   1039 C CB  . LYS A 1 132 ? -7.229  -0.865  -1.034  1.00 19.12 ? 132 LYS A CB  1 
ATOM   1040 C CG  . LYS A 1 132 ? -7.061  -2.288  -0.530  1.00 20.86 ? 132 LYS A CG  1 
ATOM   1041 C CD  . LYS A 1 132 ? -6.513  -2.336  0.897   1.00 22.00 ? 132 LYS A CD  1 
ATOM   1042 C CE  . LYS A 1 132 ? -6.307  -3.791  1.290   1.00 23.95 ? 132 LYS A CE  1 
ATOM   1043 N NZ  . LYS A 1 132 ? -5.769  -3.965  2.672   1.00 24.65 ? 132 LYS A NZ  1 
ATOM   1044 N N   . VAL A 1 133 ? -8.940  1.358   -2.620  1.00 18.49 ? 133 VAL A N   1 
ATOM   1045 C CA  . VAL A 1 133 ? -9.049  2.752   -3.034  1.00 17.89 ? 133 VAL A CA  1 
ATOM   1046 C C   . VAL A 1 133 ? -9.462  3.590   -1.845  1.00 18.21 ? 133 VAL A C   1 
ATOM   1047 O O   . VAL A 1 133 ? -10.330 3.180   -1.058  1.00 18.24 ? 133 VAL A O   1 
ATOM   1048 C CB  . VAL A 1 133 ? -10.037 2.931   -4.198  1.00 18.41 ? 133 VAL A CB  1 
ATOM   1049 C CG1 . VAL A 1 133 ? -10.027 4.369   -4.688  1.00 17.68 ? 133 VAL A CG1 1 
ATOM   1050 C CG2 . VAL A 1 133 ? -9.685  1.976   -5.361  1.00 16.75 ? 133 VAL A CG2 1 
ATOM   1051 N N   . PHE A 1 134 ? -8.803  4.744   -1.717  1.00 17.58 ? 134 PHE A N   1 
ATOM   1052 C CA  . PHE A 1 134 ? -8.980  5.671   -0.614  1.00 18.71 ? 134 PHE A CA  1 
ATOM   1053 C C   . PHE A 1 134 ? -9.318  7.046   -1.175  1.00 17.94 ? 134 PHE A C   1 
ATOM   1054 O O   . PHE A 1 134 ? -9.028  7.343   -2.328  1.00 18.25 ? 134 PHE A O   1 
ATOM   1055 C CB  . PHE A 1 134 ? -7.669  5.796   0.193   1.00 18.30 ? 134 PHE A CB  1 
ATOM   1056 C CG  . PHE A 1 134 ? -7.195  4.509   0.822   1.00 18.98 ? 134 PHE A CG  1 
ATOM   1057 C CD1 . PHE A 1 134 ? -6.485  3.572   0.076   1.00 18.39 ? 134 PHE A CD1 1 
ATOM   1058 C CD2 . PHE A 1 134 ? -7.419  4.260   2.172   1.00 19.10 ? 134 PHE A CD2 1 
ATOM   1059 C CE1 . PHE A 1 134 ? -6.031  2.375   0.659   1.00 19.89 ? 134 PHE A CE1 1 
ATOM   1060 C CE2 . PHE A 1 134 ? -6.985  3.081   2.760   1.00 19.92 ? 134 PHE A CE2 1 
ATOM   1061 C CZ  . PHE A 1 134 ? -6.280  2.127   1.992   1.00 19.15 ? 134 PHE A CZ  1 
ATOM   1062 N N   . VAL A 1 135 ? -9.936  7.888   -0.362  1.00 19.29 ? 135 VAL A N   1 
ATOM   1063 C CA  . VAL A 1 135 ? -10.147 9.290   -0.715  1.00 19.60 ? 135 VAL A CA  1 
ATOM   1064 C C   . VAL A 1 135 ? -9.730  10.089  0.499   1.00 20.41 ? 135 VAL A C   1 
ATOM   1065 O O   . VAL A 1 135 ? -9.647  9.541   1.585   1.00 19.88 ? 135 VAL A O   1 
ATOM   1066 C CB  . VAL A 1 135 ? -11.634 9.627   -1.051  1.00 20.78 ? 135 VAL A CB  1 
ATOM   1067 C CG1 . VAL A 1 135 ? -12.121 8.843   -2.249  1.00 21.37 ? 135 VAL A CG1 1 
ATOM   1068 C CG2 . VAL A 1 135 ? -12.525 9.375   0.152   1.00 20.77 ? 135 VAL A CG2 1 
ATOM   1069 N N   . ARG A 1 136 ? -9.455  11.378  0.328   1.00 21.48 ? 136 ARG A N   1 
ATOM   1070 C CA  . ARG A 1 136 ? -8.993  12.185  1.454   1.00 23.36 ? 136 ARG A CA  1 
ATOM   1071 C C   . ARG A 1 136 ? -10.119 12.612  2.381   1.00 25.60 ? 136 ARG A C   1 
ATOM   1072 O O   . ARG A 1 136 ? -11.221 12.934  1.939   1.00 25.65 ? 136 ARG A O   1 
ATOM   1073 C CB  . ARG A 1 136 ? -8.302  13.454  0.972   1.00 23.50 ? 136 ARG A CB  1 
ATOM   1074 C CG  . ARG A 1 136 ? -6.845  13.337  0.662   1.00 23.34 ? 136 ARG A CG  1 
ATOM   1075 C CD  . ARG A 1 136 ? -6.276  14.724  0.424   1.00 23.97 ? 136 ARG A CD  1 
ATOM   1076 N NE  . ARG A 1 136 ? -4.923  14.673  -0.113  1.00 25.07 ? 136 ARG A NE  1 
ATOM   1077 C CZ  . ARG A 1 136 ? -4.627  14.773  -1.403  1.00 24.49 ? 136 ARG A CZ  1 
ATOM   1078 N NH1 . ARG A 1 136 ? -5.589  14.945  -2.298  1.00 24.95 ? 136 ARG A NH1 1 
ATOM   1079 N NH2 . ARG A 1 136 ? -3.364  14.713  -1.795  1.00 24.93 ? 136 ARG A NH2 1 
ATOM   1080 N N   . GLU A 1 137 ? -9.826  12.637  3.672   1.00 27.01 ? 137 GLU A N   1 
ATOM   1081 C CA  . GLU A 1 137 ? -10.719 13.274  4.618   1.00 29.60 ? 137 GLU A CA  1 
ATOM   1082 C C   . GLU A 1 137 ? -10.506 14.781  4.525   1.00 29.74 ? 137 GLU A C   1 
ATOM   1083 O O   . GLU A 1 137 ? -11.455 15.547  4.363   1.00 30.74 ? 137 GLU A O   1 
ATOM   1084 C CB  . GLU A 1 137 ? -10.424 12.799  6.037   1.00 30.95 ? 137 GLU A CB  1 
ATOM   1085 C CG  . GLU A 1 137 ? -11.449 13.273  7.041   1.00 33.12 ? 137 GLU A CG  1 
ATOM   1086 C CD  . GLU A 1 137 ? -11.038 12.977  8.455   1.00 34.22 ? 137 GLU A CD  1 
ATOM   1087 O OE1 . GLU A 1 137 ? -9.847  13.196  8.783   1.00 34.73 ? 137 GLU A OE1 1 
ATOM   1088 O OE2 . GLU A 1 137 ? -11.908 12.533  9.233   1.00 35.16 ? 137 GLU A OE2 1 
ATOM   1089 O OXT . GLU A 1 137 ? -9.371  15.257  4.598   1.00 29.53 ? 137 GLU A OXT 1 
ATOM   1090 N N   . PRO B 1 1   ? -12.419 -29.144 -33.644 1.00 37.55 ? 1   PRO B N   1 
ATOM   1091 C CA  . PRO B 1 1   ? -12.053 -29.841 -32.413 1.00 37.52 ? 1   PRO B CA  1 
ATOM   1092 C C   . PRO B 1 1   ? -13.026 -29.577 -31.274 1.00 37.36 ? 1   PRO B C   1 
ATOM   1093 O O   . PRO B 1 1   ? -14.035 -28.894 -31.452 1.00 38.16 ? 1   PRO B O   1 
ATOM   1094 C CB  . PRO B 1 1   ? -10.685 -29.251 -32.067 1.00 37.30 ? 1   PRO B CB  1 
ATOM   1095 C CG  . PRO B 1 1   ? -10.666 -27.919 -32.728 1.00 37.19 ? 1   PRO B CG  1 
ATOM   1096 C CD  . PRO B 1 1   ? -11.473 -28.062 -33.976 1.00 37.66 ? 1   PRO B CD  1 
ATOM   1097 N N   . ASN B 1 2   ? -12.701 -30.125 -30.109 1.00 36.65 ? 2   ASN B N   1 
ATOM   1098 C CA  . ASN B 1 2   ? -13.533 -30.025 -28.928 1.00 34.98 ? 2   ASN B CA  1 
ATOM   1099 C C   . ASN B 1 2   ? -12.995 -28.909 -28.055 1.00 33.66 ? 2   ASN B C   1 
ATOM   1100 O O   . ASN B 1 2   ? -11.877 -29.010 -27.550 1.00 32.70 ? 2   ASN B O   1 
ATOM   1101 C CB  . ASN B 1 2   ? -13.467 -31.347 -28.153 1.00 34.96 ? 2   ASN B CB  1 
ATOM   1102 C CG  . ASN B 1 2   ? -14.586 -31.498 -27.137 1.00 35.06 ? 2   ASN B CG  1 
ATOM   1103 O OD1 . ASN B 1 2   ? -15.365 -30.574 -26.899 1.00 34.75 ? 2   ASN B OD1 1 
ATOM   1104 N ND2 . ASN B 1 2   ? -14.669 -32.676 -26.531 1.00 35.29 ? 2   ASN B ND2 1 
ATOM   1105 N N   . PHE B 1 3   ? -13.790 -27.856 -27.877 1.00 32.47 ? 3   PHE B N   1 
ATOM   1106 C CA  . PHE B 1 3   ? -13.425 -26.754 -26.993 1.00 31.43 ? 3   PHE B CA  1 
ATOM   1107 C C   . PHE B 1 3   ? -13.638 -27.170 -25.533 1.00 31.24 ? 3   PHE B C   1 
ATOM   1108 O O   . PHE B 1 3   ? -13.113 -26.546 -24.620 1.00 30.96 ? 3   PHE B O   1 
ATOM   1109 C CB  . PHE B 1 3   ? -14.255 -25.496 -27.308 1.00 31.10 ? 3   PHE B CB  1 
ATOM   1110 C CG  . PHE B 1 3   ? -13.783 -24.725 -28.523 1.00 31.27 ? 3   PHE B CG  1 
ATOM   1111 C CD1 . PHE B 1 3   ? -14.017 -25.203 -29.811 1.00 31.37 ? 3   PHE B CD1 1 
ATOM   1112 C CD2 . PHE B 1 3   ? -13.114 -23.521 -28.382 1.00 31.12 ? 3   PHE B CD2 1 
ATOM   1113 C CE1 . PHE B 1 3   ? -13.584 -24.492 -30.931 1.00 30.86 ? 3   PHE B CE1 1 
ATOM   1114 C CE2 . PHE B 1 3   ? -12.683 -22.807 -29.495 1.00 30.89 ? 3   PHE B CE2 1 
ATOM   1115 C CZ  . PHE B 1 3   ? -12.917 -23.298 -30.771 1.00 30.73 ? 3   PHE B CZ  1 
ATOM   1116 N N   . SER B 1 4   ? -14.414 -28.228 -25.320 1.00 30.71 ? 4   SER B N   1 
ATOM   1117 C CA  . SER B 1 4   ? -14.739 -28.682 -23.965 1.00 30.08 ? 4   SER B CA  1 
ATOM   1118 C C   . SER B 1 4   ? -13.515 -28.870 -23.082 1.00 30.20 ? 4   SER B C   1 
ATOM   1119 O O   . SER B 1 4   ? -12.472 -29.363 -23.517 1.00 30.73 ? 4   SER B O   1 
ATOM   1120 C CB  . SER B 1 4   ? -15.554 -29.973 -24.005 1.00 29.98 ? 4   SER B CB  1 
ATOM   1121 O OG  . SER B 1 4   ? -16.903 -29.712 -24.347 1.00 30.00 ? 4   SER B OG  1 
ATOM   1122 N N   . GLY B 1 5   ? -13.649 -28.476 -21.825 1.00 30.12 ? 5   GLY B N   1 
ATOM   1123 C CA  . GLY B 1 5   ? -12.569 -28.658 -20.882 1.00 28.90 ? 5   GLY B CA  1 
ATOM   1124 C C   . GLY B 1 5   ? -12.472 -27.542 -19.877 1.00 29.12 ? 5   GLY B C   1 
ATOM   1125 O O   . GLY B 1 5   ? -13.326 -26.643 -19.816 1.00 27.70 ? 5   GLY B O   1 
ATOM   1126 N N   . ASN B 1 6   ? -11.428 -27.616 -19.068 1.00 28.95 ? 6   ASN B N   1 
ATOM   1127 C CA  . ASN B 1 6   ? -11.166 -26.597 -18.082 1.00 29.23 ? 6   ASN B CA  1 
ATOM   1128 C C   . ASN B 1 6   ? -9.862  -25.948 -18.471 1.00 28.04 ? 6   ASN B C   1 
ATOM   1129 O O   . ASN B 1 6   ? -8.857  -26.622 -18.611 1.00 28.31 ? 6   ASN B O   1 
ATOM   1130 C CB  . ASN B 1 6   ? -11.101 -27.228 -16.687 1.00 30.33 ? 6   ASN B CB  1 
ATOM   1131 C CG  . ASN B 1 6   ? -12.464 -27.329 -16.037 1.00 31.61 ? 6   ASN B CG  1 
ATOM   1132 O OD1 . ASN B 1 6   ? -12.942 -26.374 -15.437 1.00 33.40 ? 6   ASN B OD1 1 
ATOM   1133 N ND2 . ASN B 1 6   ? -13.104 -28.481 -16.163 1.00 33.19 ? 6   ASN B ND2 1 
ATOM   1134 N N   . TRP B 1 7   ? -9.886  -24.638 -18.669 1.00 27.38 ? 7   TRP B N   1 
ATOM   1135 C CA  . TRP B 1 7   ? -8.780  -23.958 -19.308 1.00 26.28 ? 7   TRP B CA  1 
ATOM   1136 C C   . TRP B 1 7   ? -8.046  -23.040 -18.338 1.00 26.05 ? 7   TRP B C   1 
ATOM   1137 O O   . TRP B 1 7   ? -8.657  -22.223 -17.666 1.00 24.58 ? 7   TRP B O   1 
ATOM   1138 C CB  . TRP B 1 7   ? -9.291  -23.169 -20.523 1.00 26.15 ? 7   TRP B CB  1 
ATOM   1139 C CG  . TRP B 1 7   ? -9.879  -24.057 -21.583 1.00 26.20 ? 7   TRP B CG  1 
ATOM   1140 C CD1 . TRP B 1 7   ? -11.185 -24.433 -21.711 1.00 26.55 ? 7   TRP B CD1 1 
ATOM   1141 C CD2 . TRP B 1 7   ? -9.171  -24.704 -22.648 1.00 26.58 ? 7   TRP B CD2 1 
ATOM   1142 N NE1 . TRP B 1 7   ? -11.337 -25.265 -22.808 1.00 26.36 ? 7   TRP B NE1 1 
ATOM   1143 C CE2 . TRP B 1 7   ? -10.116 -25.444 -23.397 1.00 26.16 ? 7   TRP B CE2 1 
ATOM   1144 C CE3 . TRP B 1 7   ? -7.833  -24.714 -23.056 1.00 26.47 ? 7   TRP B CE3 1 
ATOM   1145 C CZ2 . TRP B 1 7   ? -9.760  -26.191 -24.529 1.00 26.60 ? 7   TRP B CZ2 1 
ATOM   1146 C CZ3 . TRP B 1 7   ? -7.484  -25.464 -24.180 1.00 26.60 ? 7   TRP B CZ3 1 
ATOM   1147 C CH2 . TRP B 1 7   ? -8.443  -26.185 -24.898 1.00 26.30 ? 7   TRP B CH2 1 
ATOM   1148 N N   . LYS B 1 8   ? -6.733  -23.180 -18.269 1.00 26.47 ? 8   LYS B N   1 
ATOM   1149 C CA  . LYS B 1 8   ? -5.949  -22.309 -17.404 1.00 28.54 ? 8   LYS B CA  1 
ATOM   1150 C C   . LYS B 1 8   ? -5.048  -21.397 -18.218 1.00 27.75 ? 8   LYS B C   1 
ATOM   1151 O O   . LYS B 1 8   ? -4.473  -21.798 -19.232 1.00 27.77 ? 8   LYS B O   1 
ATOM   1152 C CB  . LYS B 1 8   ? -5.142  -23.112 -16.387 1.00 29.78 ? 8   LYS B CB  1 
ATOM   1153 C CG  . LYS B 1 8   ? -4.208  -24.120 -16.993 1.00 31.62 ? 8   LYS B CG  1 
ATOM   1154 C CD  . LYS B 1 8   ? -3.209  -24.611 -15.962 1.00 33.03 ? 8   LYS B CD  1 
ATOM   1155 C CE  . LYS B 1 8   ? -2.485  -25.823 -16.491 1.00 34.73 ? 8   LYS B CE  1 
ATOM   1156 N NZ  . LYS B 1 8   ? -1.450  -26.315 -15.538 1.00 36.28 ? 8   LYS B NZ  1 
ATOM   1157 N N   . ILE B 1 9   ? -4.945  -20.162 -17.758 1.00 27.96 ? 9   ILE B N   1 
ATOM   1158 C CA  . ILE B 1 9   ? -4.291  -19.106 -18.497 1.00 27.75 ? 9   ILE B CA  1 
ATOM   1159 C C   . ILE B 1 9   ? -2.771  -19.247 -18.452 1.00 28.18 ? 9   ILE B C   1 
ATOM   1160 O O   . ILE B 1 9   ? -2.192  -19.605 -17.415 1.00 27.41 ? 9   ILE B O   1 
ATOM   1161 C CB  . ILE B 1 9   ? -4.781  -17.706 -18.014 1.00 27.99 ? 9   ILE B CB  1 
ATOM   1162 C CG1 . ILE B 1 9   ? -4.368  -16.608 -19.003 1.00 27.18 ? 9   ILE B CG1 1 
ATOM   1163 C CG2 . ILE B 1 9   ? -4.333  -17.422 -16.576 1.00 28.41 ? 9   ILE B CG2 1 
ATOM   1164 C CD1 . ILE B 1 9   ? -5.180  -15.313 -18.874 1.00 27.71 ? 9   ILE B CD1 1 
ATOM   1165 N N   . ILE B 1 10  ? -2.128  -19.009 -19.596 1.00 27.74 ? 10  ILE B N   1 
ATOM   1166 C CA  . ILE B 1 10  ? -0.666  -18.990 -19.649 1.00 28.24 ? 10  ILE B CA  1 
ATOM   1167 C C   . ILE B 1 10  ? -0.095  -17.627 -20.091 1.00 28.78 ? 10  ILE B C   1 
ATOM   1168 O O   . ILE B 1 10  ? 1.055   -17.299 -19.785 1.00 28.19 ? 10  ILE B O   1 
ATOM   1169 C CB  . ILE B 1 10  ? -0.096  -20.128 -20.532 1.00 28.27 ? 10  ILE B CB  1 
ATOM   1170 C CG1 . ILE B 1 10  ? -0.603  -20.009 -21.968 1.00 28.97 ? 10  ILE B CG1 1 
ATOM   1171 C CG2 . ILE B 1 10  ? -0.420  -21.488 -19.943 1.00 28.23 ? 10  ILE B CG2 1 
ATOM   1172 C CD1 . ILE B 1 10  ? -0.292  -21.219 -22.813 1.00 29.83 ? 10  ILE B CD1 1 
ATOM   1173 N N   . ARG B 1 11  ? -0.908  -16.841 -20.794 1.00 28.75 ? 11  ARG B N   1 
ATOM   1174 C CA  . ARG B 1 11  ? -0.511  -15.520 -21.276 1.00 29.93 ? 11  ARG B CA  1 
ATOM   1175 C C   . ARG B 1 11  ? -1.707  -14.598 -21.267 1.00 29.21 ? 11  ARG B C   1 
ATOM   1176 O O   . ARG B 1 11  ? -2.823  -15.033 -21.528 1.00 29.69 ? 11  ARG B O   1 
ATOM   1177 C CB  . ARG B 1 11  ? 0.012   -15.597 -22.722 1.00 30.12 ? 11  ARG B CB  1 
ATOM   1178 C CG  . ARG B 1 11  ? 1.447   -16.062 -22.868 0.80 31.12 ? 11  ARG B CG  1 
ATOM   1179 C CD  . ARG B 1 11  ? 2.410   -14.943 -22.532 0.60 31.05 ? 11  ARG B CD  1 
ATOM   1180 N NE  . ARG B 1 11  ? 2.507   -13.978 -23.621 0.40 31.06 ? 11  ARG B NE  1 
ATOM   1181 C CZ  . ARG B 1 11  ? 3.612   -13.764 -24.326 0.40 30.87 ? 11  ARG B CZ  1 
ATOM   1182 N NH1 . ARG B 1 11  ? 3.613   -12.869 -25.305 0.30 30.72 ? 11  ARG B NH1 1 
ATOM   1183 N NH2 . ARG B 1 11  ? 4.717   -14.440 -24.042 0.40 30.63 ? 11  ARG B NH2 1 
ATOM   1184 N N   . SER B 1 12  ? -1.469  -13.320 -20.998 1.00 29.28 ? 12  SER B N   1 
ATOM   1185 C CA  . SER B 1 12  ? -2.506  -12.297 -21.119 1.00 29.13 ? 12  SER B CA  1 
ATOM   1186 C C   . SER B 1 12  ? -1.879  -10.965 -21.531 1.00 30.07 ? 12  SER B C   1 
ATOM   1187 O O   . SER B 1 12  ? -0.787  -10.615 -21.070 1.00 29.67 ? 12  SER B O   1 
ATOM   1188 C CB  . SER B 1 12  ? -3.253  -12.111 -19.805 1.00 29.02 ? 12  SER B CB  1 
ATOM   1189 O OG  . SER B 1 12  ? -4.087  -10.967 -19.890 1.00 28.06 ? 12  SER B OG  1 
ATOM   1190 N N   . GLU B 1 13  ? -2.574  -10.227 -22.388 1.00 30.69 ? 13  GLU B N   1 
ATOM   1191 C CA  . GLU B 1 13  ? -2.032  -9.003  -22.962 1.00 31.60 ? 13  GLU B CA  1 
ATOM   1192 C C   . GLU B 1 13  ? -3.122  -7.975  -23.266 1.00 30.70 ? 13  GLU B C   1 
ATOM   1193 O O   . GLU B 1 13  ? -4.152  -8.313  -23.846 1.00 30.70 ? 13  GLU B O   1 
ATOM   1194 C CB  . GLU B 1 13  ? -1.268  -9.339  -24.244 1.00 33.06 ? 13  GLU B CB  1 
ATOM   1195 C CG  . GLU B 1 13  ? -0.580  -8.172  -24.883 1.00 34.99 ? 13  GLU B CG  1 
ATOM   1196 C CD  . GLU B 1 13  ? 0.603   -8.606  -25.724 1.00 37.01 ? 13  GLU B CD  1 
ATOM   1197 O OE1 . GLU B 1 13  ? 0.759   -9.830  -25.946 1.00 37.23 ? 13  GLU B OE1 1 
ATOM   1198 O OE2 . GLU B 1 13  ? 1.386   -7.723  -26.147 1.00 37.86 ? 13  GLU B OE2 1 
ATOM   1199 N N   . ASN B 1 14  ? -2.877  -6.732  -22.858 1.00 29.70 ? 14  ASN B N   1 
ATOM   1200 C CA  . ASN B 1 14  ? -3.711  -5.582  -23.206 1.00 29.34 ? 14  ASN B CA  1 
ATOM   1201 C C   . ASN B 1 14  ? -5.065  -5.521  -22.524 1.00 28.47 ? 14  ASN B C   1 
ATOM   1202 O O   . ASN B 1 14  ? -5.962  -4.852  -23.023 1.00 28.19 ? 14  ASN B O   1 
ATOM   1203 C CB  . ASN B 1 14  ? -3.922  -5.484  -24.720 1.00 30.78 ? 14  ASN B CB  1 
ATOM   1204 C CG  . ASN B 1 14  ? -2.817  -4.725  -25.412 1.00 32.35 ? 14  ASN B CG  1 
ATOM   1205 O OD1 . ASN B 1 14  ? -2.112  -3.936  -24.793 1.00 33.06 ? 14  ASN B OD1 1 
ATOM   1206 N ND2 . ASN B 1 14  ? -2.656  -4.965  -26.707 1.00 33.28 ? 14  ASN B ND2 1 
ATOM   1207 N N   . PHE B 1 15  ? -5.229  -6.221  -21.405 1.00 27.20 ? 15  PHE B N   1 
ATOM   1208 C CA  . PHE B 1 15  ? -6.525  -6.213  -20.738 1.00 25.97 ? 15  PHE B CA  1 
ATOM   1209 C C   . PHE B 1 15  ? -6.857  -4.789  -20.302 1.00 25.11 ? 15  PHE B C   1 
ATOM   1210 O O   . PHE B 1 15  ? -7.871  -4.237  -20.696 1.00 23.97 ? 15  PHE B O   1 
ATOM   1211 C CB  . PHE B 1 15  ? -6.560  -7.200  -19.559 1.00 26.48 ? 15  PHE B CB  1 
ATOM   1212 C CG  . PHE B 1 15  ? -7.848  -7.178  -18.782 1.00 26.14 ? 15  PHE B CG  1 
ATOM   1213 C CD1 . PHE B 1 15  ? -9.050  -7.479  -19.395 1.00 26.47 ? 15  PHE B CD1 1 
ATOM   1214 C CD2 . PHE B 1 15  ? -7.853  -6.870  -17.430 1.00 26.72 ? 15  PHE B CD2 1 
ATOM   1215 C CE1 . PHE B 1 15  ? -10.224 -7.466  -18.689 1.00 26.04 ? 15  PHE B CE1 1 
ATOM   1216 C CE2 . PHE B 1 15  ? -9.030  -6.852  -16.717 1.00 25.84 ? 15  PHE B CE2 1 
ATOM   1217 C CZ  . PHE B 1 15  ? -10.216 -7.152  -17.342 1.00 26.23 ? 15  PHE B CZ  1 
ATOM   1218 N N   . GLU B 1 16  ? -5.982  -4.169  -19.523 1.00 24.73 ? 16  GLU B N   1 
ATOM   1219 C CA  . GLU B 1 16  ? -6.283  -2.819  -19.051 1.00 25.53 ? 16  GLU B CA  1 
ATOM   1220 C C   . GLU B 1 16  ? -6.308  -1.780  -20.180 1.00 25.84 ? 16  GLU B C   1 
ATOM   1221 O O   . GLU B 1 16  ? -7.055  -0.811  -20.113 1.00 26.35 ? 16  GLU B O   1 
ATOM   1222 C CB  . GLU B 1 16  ? -5.330  -2.385  -17.933 1.00 25.68 ? 16  GLU B CB  1 
ATOM   1223 C CG  . GLU B 1 16  ? -5.671  -1.014  -17.403 1.00 26.32 ? 16  GLU B CG  1 
ATOM   1224 C CD  . GLU B 1 16  ? -4.815  -0.595  -16.223 1.00 27.46 ? 16  GLU B CD  1 
ATOM   1225 O OE1 . GLU B 1 16  ? -4.085  -1.446  -15.664 1.00 26.93 ? 16  GLU B OE1 1 
ATOM   1226 O OE2 . GLU B 1 16  ? -4.883  0.599   -15.867 1.00 27.67 ? 16  GLU B OE2 1 
ATOM   1227 N N   . GLU B 1 17  ? -5.497  -1.975  -21.215 1.00 26.63 ? 17  GLU B N   1 
ATOM   1228 C CA  . GLU B 1 17  ? -5.476  -1.018  -22.326 1.00 28.26 ? 17  GLU B CA  1 
ATOM   1229 C C   . GLU B 1 17  ? -6.805  -1.047  -23.048 1.00 28.21 ? 17  GLU B C   1 
ATOM   1230 O O   . GLU B 1 17  ? -7.311  -0.023  -23.502 1.00 28.93 ? 17  GLU B O   1 
ATOM   1231 C CB  . GLU B 1 17  ? -4.356  -1.343  -23.314 1.00 28.97 ? 17  GLU B CB  1 
ATOM   1232 C CG  . GLU B 1 17  ? -4.200  -0.304  -24.427 0.70 30.35 ? 17  GLU B CG  1 
ATOM   1233 C CD  . GLU B 1 17  ? -3.489  0.959   -23.953 0.70 31.06 ? 17  GLU B CD  1 
ATOM   1234 O OE1 . GLU B 1 17  ? -2.925  0.946   -22.836 0.70 31.11 ? 17  GLU B OE1 1 
ATOM   1235 O OE2 . GLU B 1 17  ? -3.489  1.956   -24.704 0.70 31.38 ? 17  GLU B OE2 1 
ATOM   1236 N N   . LEU B 1 18  ? -7.367  -2.241  -23.143 1.00 27.53 ? 18  LEU B N   1 
ATOM   1237 C CA  . LEU B 1 18  ? -8.678  -2.437  -23.734 1.00 27.22 ? 18  LEU B CA  1 
ATOM   1238 C C   . LEU B 1 18  ? -9.731  -1.627  -22.984 1.00 26.48 ? 18  LEU B C   1 
ATOM   1239 O O   . LEU B 1 18  ? -10.552 -0.953  -23.600 1.00 27.38 ? 18  LEU B O   1 
ATOM   1240 C CB  . LEU B 1 18  ? -9.038  -3.917  -23.701 1.00 27.22 ? 18  LEU B CB  1 
ATOM   1241 C CG  . LEU B 1 18  ? -10.399 -4.313  -24.265 1.00 27.98 ? 18  LEU B CG  1 
ATOM   1242 C CD1 . LEU B 1 18  ? -10.416 -4.096  -25.755 1.00 27.74 ? 18  LEU B CD1 1 
ATOM   1243 C CD2 . LEU B 1 18  ? -10.707 -5.749  -23.929 1.00 28.54 ? 18  LEU B CD2 1 
ATOM   1244 N N   . LEU B 1 19  ? -9.713  -1.698  -21.657 1.00 24.74 ? 19  LEU B N   1 
ATOM   1245 C CA  . LEU B 1 19  ? -10.693 -0.984  -20.849 1.00 23.06 ? 19  LEU B CA  1 
ATOM   1246 C C   . LEU B 1 19  ? -10.471 0.513   -20.967 1.00 22.90 ? 19  LEU B C   1 
ATOM   1247 O O   . LEU B 1 19  ? -11.417 1.298   -20.976 1.00 22.58 ? 19  LEU B O   1 
ATOM   1248 C CB  . LEU B 1 19  ? -10.575 -1.391  -19.375 1.00 23.29 ? 19  LEU B CB  1 
ATOM   1249 C CG  . LEU B 1 19  ? -10.903 -2.840  -18.965 1.00 24.01 ? 19  LEU B CG  1 
ATOM   1250 C CD1 . LEU B 1 19  ? -10.800 -3.003  -17.437 1.00 23.04 ? 19  LEU B CD1 1 
ATOM   1251 C CD2 . LEU B 1 19  ? -12.289 -3.270  -19.463 1.00 22.90 ? 19  LEU B CD2 1 
ATOM   1252 N N   . LYS B 1 20  ? -9.200  0.883   -21.028 1.00 23.35 ? 20  LYS B N   1 
ATOM   1253 C CA  . LYS B 1 20  ? -8.776  2.264   -21.073 1.00 25.10 ? 20  LYS B CA  1 
ATOM   1254 C C   . LYS B 1 20  ? -9.299  2.951   -22.324 1.00 25.91 ? 20  LYS B C   1 
ATOM   1255 O O   . LYS B 1 20  ? -9.801  4.061   -22.253 1.00 25.44 ? 20  LYS B O   1 
ATOM   1256 C CB  . LYS B 1 20  ? -7.256  2.337   -21.047 1.00 25.00 ? 20  LYS B CB  1 
ATOM   1257 C CG  . LYS B 1 20  ? -6.695  3.753   -20.948 1.00 27.12 ? 20  LYS B CG  1 
ATOM   1258 C CD  . LYS B 1 20  ? -5.198  3.751   -21.194 1.00 27.89 ? 20  LYS B CD  1 
ATOM   1259 C CE  . LYS B 1 20  ? -4.631  5.171   -21.221 1.00 27.75 ? 20  LYS B CE  1 
ATOM   1260 N NZ  . LYS B 1 20  ? -4.095  5.543   -19.892 1.00 29.17 ? 20  LYS B NZ  1 
ATOM   1261 N N   . VAL B 1 21  ? -9.177  2.286   -23.469 1.00 26.80 ? 21  VAL B N   1 
ATOM   1262 C CA  . VAL B 1 21  ? -9.663  2.854   -24.727 1.00 27.84 ? 21  VAL B CA  1 
ATOM   1263 C C   . VAL B 1 21  ? -11.180 2.849   -24.841 1.00 28.23 ? 21  VAL B C   1 
ATOM   1264 O O   . VAL B 1 21  ? -11.734 3.496   -25.723 1.00 29.38 ? 21  VAL B O   1 
ATOM   1265 C CB  . VAL B 1 21  ? -9.018  2.183   -25.965 1.00 28.18 ? 21  VAL B CB  1 
ATOM   1266 C CG1 . VAL B 1 21  ? -7.530  2.052   -25.744 1.00 29.22 ? 21  VAL B CG1 1 
ATOM   1267 C CG2 . VAL B 1 21  ? -9.649  0.835   -26.254 1.00 28.80 ? 21  VAL B CG2 1 
ATOM   1268 N N   . LEU B 1 22  ? -11.851 2.138   -23.935 1.00 28.59 ? 22  LEU B N   1 
ATOM   1269 C CA  . LEU B 1 22  ? -13.312 2.121   -23.891 1.00 28.17 ? 22  LEU B CA  1 
ATOM   1270 C C   . LEU B 1 22  ? -13.861 3.153   -22.909 1.00 27.52 ? 22  LEU B C   1 
ATOM   1271 O O   . LEU B 1 22  ? -15.062 3.218   -22.671 1.00 27.41 ? 22  LEU B O   1 
ATOM   1272 C CB  . LEU B 1 22  ? -13.818 0.723   -23.517 1.00 28.74 ? 22  LEU B CB  1 
ATOM   1273 C CG  . LEU B 1 22  ? -13.697 -0.345  -24.610 1.00 27.97 ? 22  LEU B CG  1 
ATOM   1274 C CD1 . LEU B 1 22  ? -13.672 -1.723  -23.992 1.00 29.34 ? 22  LEU B CD1 1 
ATOM   1275 C CD2 . LEU B 1 22  ? -14.843 -0.223  -25.592 1.00 27.81 ? 22  LEU B CD2 1 
ATOM   1276 N N   . GLY B 1 23  ? -12.965 3.942   -22.328 1.00 27.10 ? 23  GLY B N   1 
ATOM   1277 C CA  . GLY B 1 23  ? -13.351 5.013   -21.406 1.00 26.05 ? 23  GLY B CA  1 
ATOM   1278 C C   . GLY B 1 23  ? -13.472 4.640   -19.936 1.00 25.44 ? 23  GLY B C   1 
ATOM   1279 O O   . GLY B 1 23  ? -13.949 5.446   -19.139 1.00 25.90 ? 23  GLY B O   1 
ATOM   1280 N N   . VAL B 1 24  ? -13.071 3.425   -19.568 1.00 24.60 ? 24  VAL B N   1 
ATOM   1281 C CA  . VAL B 1 24  ? -13.103 3.005   -18.165 1.00 23.89 ? 24  VAL B CA  1 
ATOM   1282 C C   . VAL B 1 24  ? -12.038 3.782   -17.382 1.00 23.97 ? 24  VAL B C   1 
ATOM   1283 O O   . VAL B 1 24  ? -10.860 3.779   -17.756 1.00 23.23 ? 24  VAL B O   1 
ATOM   1284 C CB  . VAL B 1 24  ? -12.856 1.489   -18.004 1.00 23.97 ? 24  VAL B CB  1 
ATOM   1285 C CG1 . VAL B 1 24  ? -13.006 1.084   -16.551 1.00 22.83 ? 24  VAL B CG1 1 
ATOM   1286 C CG2 . VAL B 1 24  ? -13.818 0.688   -18.870 1.00 24.03 ? 24  VAL B CG2 1 
ATOM   1287 N N   . ASN B 1 25  ? -12.452 4.470   -16.319 1.00 23.98 ? 25  ASN B N   1 
ATOM   1288 C CA  . ASN B 1 25  ? -11.509 5.271   -15.543 1.00 23.63 ? 25  ASN B CA  1 
ATOM   1289 C C   . ASN B 1 25  ? -10.547 4.421   -14.726 1.00 23.30 ? 25  ASN B C   1 
ATOM   1290 O O   . ASN B 1 25  ? -10.850 3.280   -14.398 1.00 21.84 ? 25  ASN B O   1 
ATOM   1291 C CB  . ASN B 1 25  ? -12.222 6.321   -14.678 1.00 24.97 ? 25  ASN B CB  1 
ATOM   1292 C CG  . ASN B 1 25  ? -12.867 5.744   -13.443 1.00 26.59 ? 25  ASN B CG  1 
ATOM   1293 O OD1 . ASN B 1 25  ? -12.300 4.888   -12.761 1.00 26.97 ? 25  ASN B OD1 1 
ATOM   1294 N ND2 . ASN B 1 25  ? -14.063 6.226   -13.132 1.00 26.41 ? 25  ASN B ND2 1 
ATOM   1295 N N   . VAL B 1 26  ? -9.402  4.994   -14.380 1.00 22.69 ? 26  VAL B N   1 
ATOM   1296 C CA  . VAL B 1 26  ? -8.289  4.213   -13.876 1.00 22.83 ? 26  VAL B CA  1 
ATOM   1297 C C   . VAL B 1 26  ? -8.597  3.468   -12.577 1.00 23.18 ? 26  VAL B C   1 
ATOM   1298 O O   . VAL B 1 26  ? -8.117  2.345   -12.390 1.00 22.99 ? 26  VAL B O   1 
ATOM   1299 C CB  . VAL B 1 26  ? -6.978  5.054   -13.808 1.00 22.87 ? 26  VAL B CB  1 
ATOM   1300 C CG1 . VAL B 1 26  ? -7.047  6.119   -12.711 1.00 22.35 ? 26  VAL B CG1 1 
ATOM   1301 C CG2 . VAL B 1 26  ? -5.787  4.156   -13.624 1.00 23.42 ? 26  VAL B CG2 1 
ATOM   1302 N N   . MET B 1 27  ? -9.430  4.054   -11.716 1.00 23.95 ? 27  MET B N   1 
ATOM   1303 C CA  . MET B 1 27  ? -9.879  3.367   -10.495 1.00 26.05 ? 27  MET B CA  1 
ATOM   1304 C C   . MET B 1 27  ? -10.620 2.081   -10.804 1.00 24.78 ? 27  MET B C   1 
ATOM   1305 O O   . MET B 1 27  ? -10.349 1.041   -10.207 1.00 24.19 ? 27  MET B O   1 
ATOM   1306 C CB  . MET B 1 27  ? -10.808 4.245   -9.654  1.00 27.52 ? 27  MET B CB  1 
ATOM   1307 C CG  . MET B 1 27  ? -11.484 3.443   -8.527  1.00 29.91 ? 27  MET B CG  1 
ATOM   1308 S SD  . MET B 1 27  ? -12.716 4.359   -7.615  1.00 31.87 ? 27  MET B SD  1 
ATOM   1309 C CE  . MET B 1 27  ? -13.894 4.729   -8.916  1.00 32.30 ? 27  MET B CE  1 
ATOM   1310 N N   . LEU B 1 28  ? -11.595 2.160   -11.708 1.00 23.13 ? 28  LEU B N   1 
ATOM   1311 C CA  . LEU B 1 28  ? -12.344 0.973   -12.078 1.00 22.22 ? 28  LEU B CA  1 
ATOM   1312 C C   . LEU B 1 28  ? -11.475 -0.049  -12.811 1.00 22.00 ? 28  LEU B C   1 
ATOM   1313 O O   . LEU B 1 28  ? -11.721 -1.247  -12.710 1.00 20.22 ? 28  LEU B O   1 
ATOM   1314 C CB  . LEU B 1 28  ? -13.578 1.326   -12.911 1.00 23.08 ? 28  LEU B CB  1 
ATOM   1315 C CG  . LEU B 1 28  ? -14.619 2.236   -12.251 1.00 23.25 ? 28  LEU B CG  1 
ATOM   1316 C CD1 . LEU B 1 28  ? -15.863 2.399   -13.150 1.00 23.71 ? 28  LEU B CD1 1 
ATOM   1317 C CD2 . LEU B 1 28  ? -15.004 1.706   -10.882 1.00 23.70 ? 28  LEU B CD2 1 
ATOM   1318 N N   . ARG B 1 29  ? -10.480 0.419   -13.568 1.00 22.25 ? 29  ARG B N   1 
ATOM   1319 C CA  . ARG B 1 29  ? -9.573  -0.502  -14.247 1.00 22.06 ? 29  ARG B CA  1 
ATOM   1320 C C   . ARG B 1 29  ? -8.740  -1.282  -13.244 1.00 22.91 ? 29  ARG B C   1 
ATOM   1321 O O   . ARG B 1 29  ? -8.489  -2.483  -13.429 1.00 23.52 ? 29  ARG B O   1 
ATOM   1322 C CB  . ARG B 1 29  ? -8.640  0.235   -15.194 1.00 22.01 ? 29  ARG B CB  1 
ATOM   1323 C CG  . ARG B 1 29  ? -9.355  0.978   -16.284 1.00 21.86 ? 29  ARG B CG  1 
ATOM   1324 C CD  . ARG B 1 29  ? -8.447  1.272   -17.451 1.00 21.54 ? 29  ARG B CD  1 
ATOM   1325 N NE  . ARG B 1 29  ? -7.183  1.914   -17.107 1.00 21.90 ? 29  ARG B NE  1 
ATOM   1326 C CZ  . ARG B 1 29  ? -6.948  3.218   -17.235 1.00 22.86 ? 29  ARG B CZ  1 
ATOM   1327 N NH1 . ARG B 1 29  ? -7.912  4.028   -17.662 1.00 24.12 ? 29  ARG B NH1 1 
ATOM   1328 N NH2 . ARG B 1 29  ? -5.757  3.714   -16.925 1.00 21.57 ? 29  ARG B NH2 1 
ATOM   1329 N N   . LYS B 1 30  ? -8.292  -0.605  -12.192 1.00 21.45 ? 30  LYS B N   1 
ATOM   1330 C CA  . LYS B 1 30  ? -7.480  -1.270  -11.183 1.00 21.71 ? 30  LYS B CA  1 
ATOM   1331 C C   . LYS B 1 30  ? -8.340  -2.201  -10.346 1.00 20.72 ? 30  LYS B C   1 
ATOM   1332 O O   . LYS B 1 30  ? -7.893  -3.260  -9.928  1.00 18.55 ? 30  LYS B O   1 
ATOM   1333 C CB  . LYS B 1 30  ? -6.748  -0.263  -10.308 1.00 21.55 ? 30  LYS B CB  1 
ATOM   1334 C CG  . LYS B 1 30  ? -5.797  0.617   -11.072 1.00 21.24 ? 30  LYS B CG  1 
ATOM   1335 C CD  . LYS B 1 30  ? -4.740  -0.179  -11.830 1.00 22.09 ? 30  LYS B CD  1 
ATOM   1336 C CE  . LYS B 1 30  ? -3.908  0.764   -12.686 1.00 23.72 ? 30  LYS B CE  1 
ATOM   1337 N NZ  . LYS B 1 30  ? -2.864  0.067   -13.502 1.00 23.43 ? 30  LYS B NZ  1 
ATOM   1338 N N   . ILE B 1 31  ? -9.587  -1.815  -10.116 1.00 20.54 ? 31  ILE B N   1 
ATOM   1339 C CA  . ILE B 1 31  ? -10.512 -2.728  -9.460  1.00 20.67 ? 31  ILE B CA  1 
ATOM   1340 C C   . ILE B 1 31  ? -10.715 -3.953  -10.358 1.00 21.13 ? 31  ILE B C   1 
ATOM   1341 O O   . ILE B 1 31  ? -10.703 -5.101  -9.894  1.00 21.22 ? 31  ILE B O   1 
ATOM   1342 C CB  . ILE B 1 31  ? -11.838 -2.026  -9.132  1.00 20.60 ? 31  ILE B CB  1 
ATOM   1343 C CG1 . ILE B 1 31  ? -11.618 -0.996  -8.014  1.00 20.70 ? 31  ILE B CG1 1 
ATOM   1344 C CG2 . ILE B 1 31  ? -12.907 -3.028  -8.747  1.00 20.85 ? 31  ILE B CG2 1 
ATOM   1345 C CD1 . ILE B 1 31  ? -11.429 -1.600  -6.624  1.00 22.07 ? 31  ILE B CD1 1 
ATOM   1346 N N   . ALA B 1 32  ? -10.866 -3.697  -11.652 1.00 21.46 ? 32  ALA B N   1 
ATOM   1347 C CA  . ALA B 1 32  ? -11.092 -4.750  -12.638 1.00 21.98 ? 32  ALA B CA  1 
ATOM   1348 C C   . ALA B 1 32  ? -9.940  -5.757  -12.702 1.00 22.54 ? 32  ALA B C   1 
ATOM   1349 O O   . ALA B 1 32  ? -10.166 -6.972  -12.791 1.00 21.80 ? 32  ALA B O   1 
ATOM   1350 C CB  . ALA B 1 32  ? -11.308 -4.122  -14.013 1.00 22.00 ? 32  ALA B CB  1 
ATOM   1351 N N   . VAL B 1 33  ? -8.702  -5.261  -12.678 1.00 22.74 ? 33  VAL B N   1 
ATOM   1352 C CA  . VAL B 1 33  ? -7.546  -6.168  -12.716 1.00 23.36 ? 33  VAL B CA  1 
ATOM   1353 C C   . VAL B 1 33  ? -7.438  -7.006  -11.438 1.00 23.73 ? 33  VAL B C   1 
ATOM   1354 O O   . VAL B 1 33  ? -7.115  -8.190  -11.510 1.00 23.41 ? 33  VAL B O   1 
ATOM   1355 C CB  . VAL B 1 33  ? -6.192  -5.453  -12.995 1.00 25.18 ? 33  VAL B CB  1 
ATOM   1356 C CG1 . VAL B 1 33  ? -6.295  -4.509  -14.204 1.00 24.34 ? 33  VAL B CG1 1 
ATOM   1357 C CG2 . VAL B 1 33  ? -5.697  -4.716  -11.787 1.00 26.16 ? 33  VAL B CG2 1 
ATOM   1358 N N   . ALA B 1 34  ? -7.705  -6.401  -10.276 1.00 21.63 ? 34  ALA B N   1 
ATOM   1359 C CA  . ALA B 1 34  ? -7.814  -7.183  -9.035  1.00 21.98 ? 34  ALA B CA  1 
ATOM   1360 C C   . ALA B 1 34  ? -8.805  -8.341  -9.221  1.00 22.58 ? 34  ALA B C   1 
ATOM   1361 O O   . ALA B 1 34  ? -8.467  -9.519  -9.015  1.00 22.36 ? 34  ALA B O   1 
ATOM   1362 C CB  . ALA B 1 34  ? -8.265  -6.289  -7.884  1.00 21.20 ? 34  ALA B CB  1 
ATOM   1363 N N   . ALA B 1 35  ? -10.023 -7.991  -9.632  1.00 23.30 ? 35  ALA B N   1 
ATOM   1364 C CA  . ALA B 1 35  ? -11.112 -8.955  -9.818  1.00 24.67 ? 35  ALA B CA  1 
ATOM   1365 C C   . ALA B 1 35  ? -10.912 -9.944  -10.963 1.00 25.62 ? 35  ALA B C   1 
ATOM   1366 O O   . ALA B 1 35  ? -11.696 -10.897 -11.108 1.00 26.22 ? 35  ALA B O   1 
ATOM   1367 C CB  . ALA B 1 35  ? -12.425 -8.221  -10.012 1.00 25.00 ? 35  ALA B CB  1 
ATOM   1368 N N   . ALA B 1 36  ? -9.896  -9.718  -11.789 1.00 25.64 ? 36  ALA B N   1 
ATOM   1369 C CA  . ALA B 1 36  ? -9.639  -10.605 -12.924 1.00 26.67 ? 36  ALA B CA  1 
ATOM   1370 C C   . ALA B 1 36  ? -8.508  -11.591 -12.675 1.00 27.07 ? 36  ALA B C   1 
ATOM   1371 O O   . ALA B 1 36  ? -8.021  -12.229 -13.614 1.00 27.08 ? 36  ALA B O   1 
ATOM   1372 C CB  . ALA B 1 36  ? -9.351  -9.794  -14.185 1.00 27.23 ? 36  ALA B CB  1 
ATOM   1373 N N   . SER B 1 37  ? -8.078  -11.715 -11.420 1.00 26.61 ? 37  SER B N   1 
ATOM   1374 C CA  . SER B 1 37  ? -6.895  -12.518 -11.099 1.00 26.64 ? 37  SER B CA  1 
ATOM   1375 C C   . SER B 1 37  ? -7.136  -14.000 -11.358 1.00 26.87 ? 37  SER B C   1 
ATOM   1376 O O   . SER B 1 37  ? -8.187  -14.527 -11.011 1.00 27.61 ? 37  SER B O   1 
ATOM   1377 C CB  . SER B 1 37  ? -6.494  -12.318 -9.633  1.00 26.45 ? 37  SER B CB  1 
ATOM   1378 O OG  . SER B 1 37  ? -6.324  -10.944 -9.336  1.00 26.97 ? 37  SER B OG  1 
ATOM   1379 N N   . LYS B 1 38  ? -6.158  -14.670 -11.959 1.00 28.33 ? 38  LYS B N   1 
ATOM   1380 C CA  . LYS B 1 38  ? -6.217  -16.127 -12.144 1.00 28.98 ? 38  LYS B CA  1 
ATOM   1381 C C   . LYS B 1 38  ? -7.542  -16.597 -12.709 1.00 29.29 ? 38  LYS B C   1 
ATOM   1382 O O   . LYS B 1 38  ? -8.256  -17.352 -12.049 1.00 30.12 ? 38  LYS B O   1 
ATOM   1383 C CB  . LYS B 1 38  ? -5.993  -16.842 -10.813 1.00 30.12 ? 38  LYS B CB  1 
ATOM   1384 C CG  . LYS B 1 38  ? -4.619  -16.646 -10.219 1.00 31.16 ? 38  LYS B CG  1 
ATOM   1385 C CD  . LYS B 1 38  ? -4.445  -17.498 -8.967  1.00 32.28 ? 38  LYS B CD  1 
ATOM   1386 C CE  . LYS B 1 38  ? -4.228  -18.958 -9.326  1.00 32.58 ? 38  LYS B CE  1 
ATOM   1387 N NZ  . LYS B 1 38  ? -3.773  -19.727 -8.133  1.00 33.48 ? 38  LYS B NZ  1 
ATOM   1388 N N   . PRO B 1 39  ? -7.880  -16.161 -13.927 1.00 29.80 ? 39  PRO B N   1 
ATOM   1389 C CA  . PRO B 1 39  ? -9.132  -16.593 -14.547 1.00 31.03 ? 39  PRO B CA  1 
ATOM   1390 C C   . PRO B 1 39  ? -9.071  -18.032 -15.046 1.00 32.15 ? 39  PRO B C   1 
ATOM   1391 O O   . PRO B 1 39  ? -8.098  -18.421 -15.702 1.00 33.22 ? 39  PRO B O   1 
ATOM   1392 C CB  . PRO B 1 39  ? -9.279  -15.645 -15.736 1.00 30.51 ? 39  PRO B CB  1 
ATOM   1393 C CG  . PRO B 1 39  ? -7.890  -15.260 -16.070 1.00 30.29 ? 39  PRO B CG  1 
ATOM   1394 C CD  . PRO B 1 39  ? -7.132  -15.223 -14.779 1.00 29.95 ? 39  PRO B CD  1 
ATOM   1395 N N   . ALA B 1 40  ? -10.106 -18.804 -14.728 1.00 32.65 ? 40  ALA B N   1 
ATOM   1396 C CA  . ALA B 1 40  ? -10.241 -20.184 -15.185 1.00 32.74 ? 40  ALA B CA  1 
ATOM   1397 C C   . ALA B 1 40  ? -11.518 -20.287 -16.009 1.00 33.10 ? 40  ALA B C   1 
ATOM   1398 O O   . ALA B 1 40  ? -12.597 -19.901 -15.539 1.00 33.67 ? 40  ALA B O   1 
ATOM   1399 C CB  . ALA B 1 40  ? -10.300 -21.130 -13.992 1.00 32.60 ? 40  ALA B CB  1 
ATOM   1400 N N   . VAL B 1 41  ? -11.393 -20.782 -17.239 1.00 31.46 ? 41  VAL B N   1 
ATOM   1401 C CA  . VAL B 1 41  ? -12.516 -20.877 -18.160 1.00 30.65 ? 41  VAL B CA  1 
ATOM   1402 C C   . VAL B 1 41  ? -12.948 -22.337 -18.284 1.00 30.74 ? 41  VAL B C   1 
ATOM   1403 O O   . VAL B 1 41  ? -12.159 -23.179 -18.710 1.00 30.74 ? 41  VAL B O   1 
ATOM   1404 C CB  . VAL B 1 41  ? -12.129 -20.326 -19.563 1.00 30.36 ? 41  VAL B CB  1 
ATOM   1405 C CG1 . VAL B 1 41  ? -13.317 -20.323 -20.512 1.00 29.83 ? 41  VAL B CG1 1 
ATOM   1406 C CG2 . VAL B 1 41  ? -11.567 -18.919 -19.443 1.00 30.16 ? 41  VAL B CG2 1 
ATOM   1407 N N   . GLU B 1 42  ? -14.172 -22.652 -17.865 1.00 30.04 ? 42  GLU B N   1 
ATOM   1408 C CA  . GLU B 1 42  ? -14.717 -23.987 -18.105 1.00 30.29 ? 42  GLU B CA  1 
ATOM   1409 C C   . GLU B 1 42  ? -15.617 -23.930 -19.327 1.00 28.96 ? 42  GLU B C   1 
ATOM   1410 O O   . GLU B 1 42  ? -16.517 -23.108 -19.392 1.00 27.92 ? 42  GLU B O   1 
ATOM   1411 C CB  . GLU B 1 42  ? -15.508 -24.516 -16.903 1.00 30.79 ? 42  GLU B CB  1 
ATOM   1412 C CG  . GLU B 1 42  ? -16.441 -25.681 -17.279 1.00 33.31 ? 42  GLU B CG  1 
ATOM   1413 C CD  . GLU B 1 42  ? -17.091 -26.373 -16.083 1.00 33.38 ? 42  GLU B CD  1 
ATOM   1414 O OE1 . GLU B 1 42  ? -17.483 -25.688 -15.125 1.00 34.75 ? 42  GLU B OE1 1 
ATOM   1415 O OE2 . GLU B 1 42  ? -17.220 -27.617 -16.116 1.00 35.78 ? 42  GLU B OE2 1 
ATOM   1416 N N   . ILE B 1 43  ? -15.365 -24.800 -20.299 1.00 28.13 ? 43  ILE B N   1 
ATOM   1417 C CA  . ILE B 1 43  ? -16.170 -24.823 -21.509 1.00 27.63 ? 43  ILE B CA  1 
ATOM   1418 C C   . ILE B 1 43  ? -16.890 -26.153 -21.650 1.00 27.36 ? 43  ILE B C   1 
ATOM   1419 O O   . ILE B 1 43  ? -16.289 -27.206 -21.506 1.00 26.81 ? 43  ILE B O   1 
ATOM   1420 C CB  . ILE B 1 43  ? -15.323 -24.518 -22.775 1.00 27.70 ? 43  ILE B CB  1 
ATOM   1421 C CG1 . ILE B 1 43  ? -14.726 -23.111 -22.692 1.00 27.36 ? 43  ILE B CG1 1 
ATOM   1422 C CG2 . ILE B 1 43  ? -16.180 -24.624 -24.040 1.00 26.81 ? 43  ILE B CG2 1 
ATOM   1423 C CD1 . ILE B 1 43  ? -14.184 -22.612 -24.012 1.00 27.61 ? 43  ILE B CD1 1 
ATOM   1424 N N   . LYS B 1 44  ? -18.193 -26.095 -21.898 1.00 28.03 ? 44  LYS B N   1 
ATOM   1425 C CA  . LYS B 1 44  ? -18.957 -27.282 -22.227 1.00 28.68 ? 44  LYS B CA  1 
ATOM   1426 C C   . LYS B 1 44  ? -19.546 -27.055 -23.619 1.00 29.52 ? 44  LYS B C   1 
ATOM   1427 O O   . LYS B 1 44  ? -20.508 -26.308 -23.775 1.00 29.23 ? 44  LYS B O   1 
ATOM   1428 C CB  . LYS B 1 44  ? -20.075 -27.500 -21.207 0.80 28.46 ? 44  LYS B CB  1 
ATOM   1429 C CG  . LYS B 1 44  ? -20.691 -28.902 -21.200 0.50 28.90 ? 44  LYS B CG  1 
ATOM   1430 C CD  . LYS B 1 44  ? -21.773 -29.006 -20.120 0.40 28.70 ? 44  LYS B CD  1 
ATOM   1431 C CE  . LYS B 1 44  ? -22.208 -30.447 -19.864 0.30 28.91 ? 44  LYS B CE  1 
ATOM   1432 N NZ  . LYS B 1 44  ? -21.329 -31.153 -18.889 0.20 28.47 ? 44  LYS B NZ  1 
ATOM   1433 N N   . GLN B 1 45  ? -18.941 -27.690 -24.618 1.00 30.39 ? 45  GLN B N   1 
ATOM   1434 C CA  . GLN B 1 45  ? -19.376 -27.565 -25.992 1.00 31.37 ? 45  GLN B CA  1 
ATOM   1435 C C   . GLN B 1 45  ? -20.125 -28.812 -26.454 1.00 32.42 ? 45  GLN B C   1 
ATOM   1436 O O   . GLN B 1 45  ? -19.583 -29.918 -26.436 1.00 32.19 ? 45  GLN B O   1 
ATOM   1437 C CB  . GLN B 1 45  ? -18.179 -27.332 -26.909 1.00 31.46 ? 45  GLN B CB  1 
ATOM   1438 C CG  . GLN B 1 45  ? -18.568 -27.370 -28.368 1.00 31.26 ? 45  GLN B CG  1 
ATOM   1439 C CD  . GLN B 1 45  ? -17.385 -27.451 -29.300 1.00 31.09 ? 45  GLN B CD  1 
ATOM   1440 O OE1 . GLN B 1 45  ? -16.257 -27.668 -28.873 1.00 31.42 ? 45  GLN B OE1 1 
ATOM   1441 N NE2 . GLN B 1 45  ? -17.641 -27.267 -30.591 1.00 30.66 ? 45  GLN B NE2 1 
ATOM   1442 N N   . GLU B 1 46  ? -21.375 -28.621 -26.859 1.00 33.76 ? 46  GLU B N   1 
ATOM   1443 C CA  . GLU B 1 46  ? -22.161 -29.673 -27.492 1.00 35.00 ? 46  GLU B CA  1 
ATOM   1444 C C   . GLU B 1 46  ? -22.605 -29.203 -28.878 1.00 34.27 ? 46  GLU B C   1 
ATOM   1445 O O   . GLU B 1 46  ? -23.634 -28.551 -29.027 1.00 33.90 ? 46  GLU B O   1 
ATOM   1446 C CB  . GLU B 1 46  ? -23.353 -30.046 -26.614 1.00 35.65 ? 46  GLU B CB  1 
ATOM   1447 C CG  . GLU B 1 46  ? -22.923 -30.476 -25.201 1.00 36.82 ? 46  GLU B CG  1 
ATOM   1448 C CD  . GLU B 1 46  ? -24.092 -30.785 -24.285 1.00 37.38 ? 46  GLU B CD  1 
ATOM   1449 O OE1 . GLU B 1 46  ? -23.951 -30.593 -23.051 1.00 38.86 ? 46  GLU B OE1 1 
ATOM   1450 O OE2 . GLU B 1 46  ? -25.149 -31.213 -24.793 1.00 38.24 ? 46  GLU B OE2 1 
ATOM   1451 N N   . GLY B 1 47  ? -21.796 -29.516 -29.884 1.00 34.31 ? 47  GLY B N   1 
ATOM   1452 C CA  . GLY B 1 47  ? -22.043 -29.052 -31.250 1.00 33.78 ? 47  GLY B CA  1 
ATOM   1453 C C   . GLY B 1 47  ? -21.879 -27.550 -31.406 1.00 33.36 ? 47  GLY B C   1 
ATOM   1454 O O   . GLY B 1 47  ? -20.773 -27.019 -31.295 1.00 33.68 ? 47  GLY B O   1 
ATOM   1455 N N   . ASP B 1 48  ? -22.987 -26.877 -31.689 1.00 32.55 ? 48  ASP B N   1 
ATOM   1456 C CA  . ASP B 1 48  ? -23.026 -25.428 -31.845 1.00 32.55 ? 48  ASP B CA  1 
ATOM   1457 C C   . ASP B 1 48  ? -23.379 -24.752 -30.519 1.00 32.13 ? 48  ASP B C   1 
ATOM   1458 O O   . ASP B 1 48  ? -23.260 -23.544 -30.386 1.00 31.29 ? 48  ASP B O   1 
ATOM   1459 C CB  . ASP B 1 48  ? -24.068 -25.035 -32.892 1.00 32.38 ? 48  ASP B CB  1 
ATOM   1460 C CG  . ASP B 1 48  ? -23.525 -25.061 -34.319 1.00 32.78 ? 48  ASP B CG  1 
ATOM   1461 O OD1 . ASP B 1 48  ? -22.350 -25.420 -34.537 1.00 32.46 ? 48  ASP B OD1 1 
ATOM   1462 O OD2 . ASP B 1 48  ? -24.296 -24.700 -35.231 1.00 33.08 ? 48  ASP B OD2 1 
ATOM   1463 N N   . THR B 1 49  ? -23.816 -25.542 -29.542 1.00 31.88 ? 49  THR B N   1 
ATOM   1464 C CA  . THR B 1 49  ? -24.234 -25.001 -28.256 1.00 31.45 ? 49  THR B CA  1 
ATOM   1465 C C   . THR B 1 49  ? -23.059 -24.949 -27.274 1.00 30.91 ? 49  THR B C   1 
ATOM   1466 O O   . THR B 1 49  ? -22.333 -25.932 -27.111 1.00 29.62 ? 49  THR B O   1 
ATOM   1467 C CB  . THR B 1 49  ? -25.393 -25.820 -27.674 1.00 32.49 ? 49  THR B CB  1 
ATOM   1468 O OG1 . THR B 1 49  ? -26.461 -25.856 -28.628 1.00 32.70 ? 49  THR B OG1 1 
ATOM   1469 C CG2 . THR B 1 49  ? -25.903 -25.196 -26.381 1.00 32.22 ? 49  THR B CG2 1 
ATOM   1470 N N   . PHE B 1 50  ? -22.866 -23.786 -26.648 1.00 30.29 ? 50  PHE B N   1 
ATOM   1471 C CA  . PHE B 1 50  ? -21.759 -23.581 -25.719 1.00 29.47 ? 50  PHE B CA  1 
ATOM   1472 C C   . PHE B 1 50  ? -22.219 -23.121 -24.328 1.00 29.46 ? 50  PHE B C   1 
ATOM   1473 O O   . PHE B 1 50  ? -23.116 -22.281 -24.193 1.00 29.23 ? 50  PHE B O   1 
ATOM   1474 C CB  . PHE B 1 50  ? -20.755 -22.566 -26.292 1.00 29.65 ? 50  PHE B CB  1 
ATOM   1475 C CG  . PHE B 1 50  ? -19.874 -23.115 -27.389 1.00 29.47 ? 50  PHE B CG  1 
ATOM   1476 C CD1 . PHE B 1 50  ? -20.344 -23.219 -28.693 1.00 29.49 ? 50  PHE B CD1 1 
ATOM   1477 C CD2 . PHE B 1 50  ? -18.568 -23.498 -27.122 1.00 29.76 ? 50  PHE B CD2 1 
ATOM   1478 C CE1 . PHE B 1 50  ? -19.534 -23.716 -29.707 1.00 28.95 ? 50  PHE B CE1 1 
ATOM   1479 C CE2 . PHE B 1 50  ? -17.748 -23.997 -28.131 1.00 29.69 ? 50  PHE B CE2 1 
ATOM   1480 C CZ  . PHE B 1 50  ? -18.237 -24.107 -29.428 1.00 29.46 ? 50  PHE B CZ  1 
ATOM   1481 N N   . TYR B 1 51  ? -21.612 -23.709 -23.302 1.00 29.58 ? 51  TYR B N   1 
ATOM   1482 C CA  . TYR B 1 51  ? -21.664 -23.197 -21.940 1.00 29.59 ? 51  TYR B CA  1 
ATOM   1483 C C   . TYR B 1 51  ? -20.250 -22.765 -21.610 1.00 28.08 ? 51  TYR B C   1 
ATOM   1484 O O   . TYR B 1 51  ? -19.316 -23.540 -21.755 1.00 27.57 ? 51  TYR B O   1 
ATOM   1485 C CB  . TYR B 1 51  ? -22.124 -24.284 -20.957 1.00 32.18 ? 51  TYR B CB  1 
ATOM   1486 C CG  . TYR B 1 51  ? -21.863 -23.971 -19.494 1.00 33.13 ? 51  TYR B CG  1 
ATOM   1487 C CD1 . TYR B 1 51  ? -22.686 -23.091 -18.789 1.00 33.85 ? 51  TYR B CD1 1 
ATOM   1488 C CD2 . TYR B 1 51  ? -20.801 -24.562 -18.813 1.00 33.60 ? 51  TYR B CD2 1 
ATOM   1489 C CE1 . TYR B 1 51  ? -22.444 -22.802 -17.451 1.00 33.80 ? 51  TYR B CE1 1 
ATOM   1490 C CE2 . TYR B 1 51  ? -20.558 -24.285 -17.472 1.00 33.51 ? 51  TYR B CE2 1 
ATOM   1491 C CZ  . TYR B 1 51  ? -21.385 -23.408 -16.802 1.00 33.46 ? 51  TYR B CZ  1 
ATOM   1492 O OH  . TYR B 1 51  ? -21.153 -23.132 -15.475 1.00 34.06 ? 51  TYR B OH  1 
ATOM   1493 N N   . ILE B 1 52  ? -20.074 -21.517 -21.211 1.00 27.17 ? 52  ILE B N   1 
ATOM   1494 C CA  . ILE B 1 52  ? -18.744 -21.050 -20.865 1.00 26.78 ? 52  ILE B CA  1 
ATOM   1495 C C   . ILE B 1 52  ? -18.813 -20.386 -19.506 1.00 27.87 ? 52  ILE B C   1 
ATOM   1496 O O   . ILE B 1 52  ? -19.558 -19.417 -19.310 1.00 27.44 ? 52  ILE B O   1 
ATOM   1497 C CB  . ILE B 1 52  ? -18.199 -20.039 -21.888 1.00 26.44 ? 52  ILE B CB  1 
ATOM   1498 C CG1 . ILE B 1 52  ? -18.241 -20.615 -23.306 1.00 26.12 ? 52  ILE B CG1 1 
ATOM   1499 C CG2 . ILE B 1 52  ? -16.752 -19.666 -21.570 1.00 25.60 ? 52  ILE B CG2 1 
ATOM   1500 C CD1 . ILE B 1 52  ? -17.571 -19.700 -24.320 1.00 25.38 ? 52  ILE B CD1 1 
ATOM   1501 N N   . LYS B 1 53  ? -18.034 -20.910 -18.573 1.00 28.27 ? 53  LYS B N   1 
ATOM   1502 C CA  . LYS B 1 53  ? -18.016 -20.386 -17.224 1.00 29.52 ? 53  LYS B CA  1 
ATOM   1503 C C   . LYS B 1 53  ? -16.640 -19.805 -16.951 1.00 29.86 ? 53  LYS B C   1 
ATOM   1504 O O   . LYS B 1 53  ? -15.624 -20.492 -17.088 1.00 28.45 ? 53  LYS B O   1 
ATOM   1505 C CB  . LYS B 1 53  ? -18.339 -21.504 -16.233 1.00 31.24 ? 53  LYS B CB  1 
ATOM   1506 C CG  . LYS B 1 53  ? -18.327 -21.100 -14.759 1.00 33.18 ? 53  LYS B CG  1 
ATOM   1507 C CD  . LYS B 1 53  ? -18.259 -22.344 -13.897 1.00 34.59 ? 53  LYS B CD  1 
ATOM   1508 C CE  . LYS B 1 53  ? -19.089 -22.204 -12.643 1.00 36.14 ? 53  LYS B CE  1 
ATOM   1509 N NZ  . LYS B 1 53  ? -18.783 -23.307 -11.668 1.00 36.93 ? 53  LYS B NZ  1 
ATOM   1510 N N   . THR B 1 54  ? -16.603 -18.529 -16.594 1.00 30.34 ? 54  THR B N   1 
ATOM   1511 C CA  . THR B 1 54  ? -15.341 -17.892 -16.269 1.00 30.67 ? 54  THR B CA  1 
ATOM   1512 C C   . THR B 1 54  ? -15.303 -17.594 -14.789 1.00 31.66 ? 54  THR B C   1 
ATOM   1513 O O   . THR B 1 54  ? -16.186 -16.930 -14.259 1.00 31.22 ? 54  THR B O   1 
ATOM   1514 C CB  . THR B 1 54  ? -15.121 -16.600 -17.063 1.00 31.14 ? 54  THR B CB  1 
ATOM   1515 O OG1 . THR B 1 54  ? -15.160 -16.887 -18.465 1.00 30.40 ? 54  THR B OG1 1 
ATOM   1516 C CG2 . THR B 1 54  ? -13.765 -15.977 -16.703 1.00 31.54 ? 54  THR B CG2 1 
ATOM   1517 N N   . SER B 1 55  ? -14.273 -18.106 -14.129 1.00 32.79 ? 55  SER B N   1 
ATOM   1518 C CA  . SER B 1 55  ? -14.071 -17.898 -12.710 1.00 33.95 ? 55  SER B CA  1 
ATOM   1519 C C   . SER B 1 55  ? -12.763 -17.137 -12.507 1.00 34.00 ? 55  SER B C   1 
ATOM   1520 O O   . SER B 1 55  ? -11.775 -17.384 -13.206 1.00 34.51 ? 55  SER B O   1 
ATOM   1521 C CB  . SER B 1 55  ? -13.996 -19.237 -11.980 1.00 35.66 ? 55  SER B CB  1 
ATOM   1522 O OG  . SER B 1 55  ? -15.282 -19.796 -11.778 1.00 37.27 ? 55  SER B OG  1 
ATOM   1523 N N   . THR B 1 56  ? -12.772 -16.188 -11.580 1.00 32.12 ? 56  THR B N   1 
ATOM   1524 C CA  . THR B 1 56  ? -11.542 -15.562 -11.117 1.00 30.58 ? 56  THR B CA  1 
ATOM   1525 C C   . THR B 1 56  ? -11.478 -15.820 -9.625  1.00 30.62 ? 56  THR B C   1 
ATOM   1526 O O   . THR B 1 56  ? -12.250 -16.620 -9.100  1.00 30.00 ? 56  THR B O   1 
ATOM   1527 C CB  . THR B 1 56  ? -11.524 -14.051 -11.398 1.00 30.24 ? 56  THR B CB  1 
ATOM   1528 O OG1 . THR B 1 56  ? -12.549 -13.404 -10.626 1.00 29.79 ? 56  THR B OG1 1 
ATOM   1529 C CG2 . THR B 1 56  ? -11.747 -13.779 -12.879 1.00 29.87 ? 56  THR B CG2 1 
ATOM   1530 N N   . THR B 1 57  ? -10.571 -15.154 -8.927  1.00 31.09 ? 57  THR B N   1 
ATOM   1531 C CA  . THR B 1 57  ? -10.469 -15.371 -7.492  1.00 31.08 ? 57  THR B CA  1 
ATOM   1532 C C   . THR B 1 57  ? -11.675 -14.771 -6.762  1.00 32.73 ? 57  THR B C   1 
ATOM   1533 O O   . THR B 1 57  ? -11.987 -15.179 -5.647  1.00 32.53 ? 57  THR B O   1 
ATOM   1534 C CB  . THR B 1 57  ? -9.126  -14.854 -6.907  1.00 30.95 ? 57  THR B CB  1 
ATOM   1535 O OG1 . THR B 1 57  ? -8.913  -13.497 -7.303  1.00 30.19 ? 57  THR B OG1 1 
ATOM   1536 C CG2 . THR B 1 57  ? -7.956  -15.703 -7.410  1.00 29.65 ? 57  THR B CG2 1 
ATOM   1537 N N   . VAL B 1 58  ? -12.373 -13.832 -7.408  1.00 33.90 ? 58  VAL B N   1 
ATOM   1538 C CA  . VAL B 1 58  ? -13.506 -13.148 -6.765  1.00 35.65 ? 58  VAL B CA  1 
ATOM   1539 C C   . VAL B 1 58  ? -14.876 -13.421 -7.383  1.00 36.70 ? 58  VAL B C   1 
ATOM   1540 O O   . VAL B 1 58  ? -15.874 -13.442 -6.669  1.00 36.93 ? 58  VAL B O   1 
ATOM   1541 C CB  . VAL B 1 58  ? -13.321 -11.610 -6.717  1.00 35.52 ? 58  VAL B CB  1 
ATOM   1542 C CG1 . VAL B 1 58  ? -12.019 -11.249 -6.058  1.00 35.34 ? 58  VAL B CG1 1 
ATOM   1543 C CG2 . VAL B 1 58  ? -13.380 -11.025 -8.098  1.00 35.99 ? 58  VAL B CG2 1 
ATOM   1544 N N   . ARG B 1 59  ? -14.919 -13.615 -8.700  1.00 38.14 ? 59  ARG B N   1 
ATOM   1545 C CA  . ARG B 1 59  ? -16.178 -13.677 -9.446  1.00 40.46 ? 59  ARG B CA  1 
ATOM   1546 C C   . ARG B 1 59  ? -16.286 -14.901 -10.345 1.00 39.86 ? 59  ARG B C   1 
ATOM   1547 O O   . ARG B 1 59  ? -15.309 -15.341 -10.943 1.00 39.36 ? 59  ARG B O   1 
ATOM   1548 C CB  . ARG B 1 59  ? -16.352 -12.430 -10.323 1.00 41.08 ? 59  ARG B CB  1 
ATOM   1549 C CG  . ARG B 1 59  ? -16.705 -11.167 -9.572  1.00 42.97 ? 59  ARG B CG  1 
ATOM   1550 C CD  . ARG B 1 59  ? -16.717 -9.940  -10.493 1.00 43.24 ? 59  ARG B CD  1 
ATOM   1551 N NE  . ARG B 1 59  ? -16.882 -8.707  -9.724  1.00 45.18 ? 59  ARG B NE  1 
ATOM   1552 C CZ  . ARG B 1 59  ? -16.154 -7.605  -9.893  1.00 46.08 ? 59  ARG B CZ  1 
ATOM   1553 N NH1 . ARG B 1 59  ? -16.382 -6.535  -9.133  1.00 46.37 ? 59  ARG B NH1 1 
ATOM   1554 N NH2 . ARG B 1 59  ? -15.211 -7.563  -10.827 1.00 46.18 ? 59  ARG B NH2 1 
ATOM   1555 N N   . THR B 1 60  ? -17.496 -15.435 -10.444 1.00 40.00 ? 60  THR B N   1 
ATOM   1556 C CA  . THR B 1 60  ? -17.798 -16.467 -11.417 1.00 40.02 ? 60  THR B CA  1 
ATOM   1557 C C   . THR B 1 60  ? -18.984 -16.023 -12.258 1.00 40.15 ? 60  THR B C   1 
ATOM   1558 O O   . THR B 1 60  ? -20.058 -15.733 -11.717 1.00 39.82 ? 60  THR B O   1 
ATOM   1559 C CB  . THR B 1 60  ? -18.132 -17.798 -10.741 1.00 40.37 ? 60  THR B CB  1 
ATOM   1560 O OG1 . THR B 1 60  ? -16.966 -18.296 -10.078 1.00 40.36 ? 60  THR B OG1 1 
ATOM   1561 C CG2 . THR B 1 60  ? -18.585 -18.814 -11.775 1.00 40.23 ? 60  THR B CG2 1 
ATOM   1562 N N   . THR B 1 61  ? -18.777 -15.950 -13.573 1.00 39.43 ? 61  THR B N   1 
ATOM   1563 C CA  . THR B 1 61  ? -19.833 -15.580 -14.516 1.00 39.30 ? 61  THR B CA  1 
ATOM   1564 C C   . THR B 1 61  ? -20.033 -16.676 -15.557 1.00 39.02 ? 61  THR B C   1 
ATOM   1565 O O   . THR B 1 61  ? -19.139 -17.484 -15.796 1.00 39.11 ? 61  THR B O   1 
ATOM   1566 C CB  . THR B 1 61  ? -19.522 -14.263 -15.235 1.00 39.52 ? 61  THR B CB  1 
ATOM   1567 O OG1 . THR B 1 61  ? -18.194 -14.319 -15.758 1.00 39.85 ? 61  THR B OG1 1 
ATOM   1568 C CG2 . THR B 1 61  ? -19.627 -13.075 -14.273 1.00 40.00 ? 61  THR B CG2 1 
ATOM   1569 N N   . GLU B 1 62  ? -21.205 -16.692 -16.181 1.00 38.59 ? 62  GLU B N   1 
ATOM   1570 C CA  . GLU B 1 62  ? -21.579 -17.771 -17.085 1.00 38.25 ? 62  GLU B CA  1 
ATOM   1571 C C   . GLU B 1 62  ? -22.323 -17.237 -18.294 1.00 37.21 ? 62  GLU B C   1 
ATOM   1572 O O   . GLU B 1 62  ? -23.220 -16.404 -18.160 1.00 36.54 ? 62  GLU B O   1 
ATOM   1573 C CB  . GLU B 1 62  ? -22.481 -18.773 -16.362 1.00 38.79 ? 62  GLU B CB  1 
ATOM   1574 C CG  . GLU B 1 62  ? -21.843 -19.436 -15.157 1.00 39.81 ? 62  GLU B CG  1 
ATOM   1575 C CD  . GLU B 1 62  ? -22.800 -20.355 -14.420 1.00 40.36 ? 62  GLU B CD  1 
ATOM   1576 O OE1 . GLU B 1 62  ? -22.471 -21.552 -14.268 1.00 40.64 ? 62  GLU B OE1 1 
ATOM   1577 O OE2 . GLU B 1 62  ? -23.887 -19.883 -14.008 1.00 41.46 ? 62  GLU B OE2 1 
ATOM   1578 N N   . ILE B 1 63  ? -21.960 -17.719 -19.478 1.00 36.19 ? 63  ILE B N   1 
ATOM   1579 C CA  . ILE B 1 63  ? -22.767 -17.453 -20.661 1.00 35.45 ? 63  ILE B CA  1 
ATOM   1580 C C   . ILE B 1 63  ? -23.227 -18.757 -21.315 1.00 34.49 ? 63  ILE B C   1 
ATOM   1581 O O   . ILE B 1 63  ? -22.527 -19.769 -21.283 1.00 33.60 ? 63  ILE B O   1 
ATOM   1582 C CB  . ILE B 1 63  ? -22.044 -16.556 -21.702 1.00 36.02 ? 63  ILE B CB  1 
ATOM   1583 C CG1 . ILE B 1 63  ? -20.712 -17.174 -22.128 1.00 36.11 ? 63  ILE B CG1 1 
ATOM   1584 C CG2 . ILE B 1 63  ? -21.836 -15.151 -21.155 1.00 37.01 ? 63  ILE B CG2 1 
ATOM   1585 C CD1 . ILE B 1 63  ? -20.115 -16.535 -23.359 1.00 36.48 ? 63  ILE B CD1 1 
ATOM   1586 N N   . ASN B 1 64  ? -24.422 -18.716 -21.890 1.00 34.05 ? 64  ASN B N   1 
ATOM   1587 C CA  . ASN B 1 64  ? -24.953 -19.823 -22.673 1.00 34.01 ? 64  ASN B CA  1 
ATOM   1588 C C   . ASN B 1 64  ? -25.300 -19.288 -24.057 1.00 32.70 ? 64  ASN B C   1 
ATOM   1589 O O   . ASN B 1 64  ? -25.972 -18.268 -24.162 1.00 31.27 ? 64  ASN B O   1 
ATOM   1590 C CB  . ASN B 1 64  ? -26.225 -20.371 -22.021 1.00 35.34 ? 64  ASN B CB  1 
ATOM   1591 C CG  . ASN B 1 64  ? -25.966 -21.043 -20.685 1.00 36.42 ? 64  ASN B CG  1 
ATOM   1592 O OD1 . ASN B 1 64  ? -25.529 -22.199 -20.628 1.00 36.57 ? 64  ASN B OD1 1 
ATOM   1593 N ND2 . ASN B 1 64  ? -26.264 -20.331 -19.595 1.00 36.75 ? 64  ASN B ND2 1 
ATOM   1594 N N   . PHE B 1 65  ? -24.845 -19.966 -25.107 1.00 31.38 ? 65  PHE B N   1 
ATOM   1595 C CA  . PHE B 1 65  ? -25.197 -19.566 -26.471 1.00 30.43 ? 65  PHE B CA  1 
ATOM   1596 C C   . PHE B 1 65  ? -25.105 -20.691 -27.490 1.00 30.69 ? 65  PHE B C   1 
ATOM   1597 O O   . PHE B 1 65  ? -24.438 -21.701 -27.281 1.00 30.81 ? 65  PHE B O   1 
ATOM   1598 C CB  . PHE B 1 65  ? -24.338 -18.392 -26.940 1.00 29.58 ? 65  PHE B CB  1 
ATOM   1599 C CG  . PHE B 1 65  ? -22.882 -18.729 -27.119 1.00 29.29 ? 65  PHE B CG  1 
ATOM   1600 C CD1 . PHE B 1 65  ? -22.413 -19.249 -28.320 1.00 29.36 ? 65  PHE B CD1 1 
ATOM   1601 C CD2 . PHE B 1 65  ? -21.980 -18.519 -26.092 1.00 29.22 ? 65  PHE B CD2 1 
ATOM   1602 C CE1 . PHE B 1 65  ? -21.082 -19.558 -28.485 1.00 28.85 ? 65  PHE B CE1 1 
ATOM   1603 C CE2 . PHE B 1 65  ? -20.643 -18.818 -26.256 1.00 28.89 ? 65  PHE B CE2 1 
ATOM   1604 C CZ  . PHE B 1 65  ? -20.194 -19.339 -27.452 1.00 29.18 ? 65  PHE B CZ  1 
ATOM   1605 N N   . LYS B 1 66  ? -25.794 -20.491 -28.606 1.00 31.20 ? 66  LYS B N   1 
ATOM   1606 C CA  . LYS B 1 66  ? -25.657 -21.346 -29.764 1.00 31.08 ? 66  LYS B CA  1 
ATOM   1607 C C   . LYS B 1 66  ? -25.111 -20.460 -30.878 1.00 30.10 ? 66  LYS B C   1 
ATOM   1608 O O   . LYS B 1 66  ? -25.570 -19.331 -31.070 1.00 29.24 ? 66  LYS B O   1 
ATOM   1609 C CB  . LYS B 1 66  ? -27.012 -21.946 -30.154 1.00 31.56 ? 66  LYS B CB  1 
ATOM   1610 C CG  . LYS B 1 66  ? -26.950 -23.046 -31.222 1.00 32.25 ? 66  LYS B CG  1 
ATOM   1611 C CD  . LYS B 1 66  ? -28.337 -23.689 -31.426 1.00 32.93 ? 66  LYS B CD  1 
ATOM   1612 C CE  . LYS B 1 66  ? -28.447 -24.421 -32.767 1.00 33.91 ? 66  LYS B CE  1 
ATOM   1613 N NZ  . LYS B 1 66  ? -27.744 -25.743 -32.783 1.00 35.32 ? 66  LYS B NZ  1 
ATOM   1614 N N   . VAL B 1 67  ? -24.096 -20.961 -31.570 1.00 29.63 ? 67  VAL B N   1 
ATOM   1615 C CA  . VAL B 1 67  ? -23.555 -20.297 -32.737 1.00 29.36 ? 67  VAL B CA  1 
ATOM   1616 C C   . VAL B 1 67  ? -24.718 -20.062 -33.678 1.00 29.87 ? 67  VAL B C   1 
ATOM   1617 O O   . VAL B 1 67  ? -25.507 -20.971 -33.928 1.00 29.43 ? 67  VAL B O   1 
ATOM   1618 C CB  . VAL B 1 67  ? -22.484 -21.178 -33.421 1.00 28.78 ? 67  VAL B CB  1 
ATOM   1619 C CG1 . VAL B 1 67  ? -21.977 -20.535 -34.699 1.00 28.31 ? 67  VAL B CG1 1 
ATOM   1620 C CG2 . VAL B 1 67  ? -21.323 -21.427 -32.475 1.00 28.63 ? 67  VAL B CG2 1 
ATOM   1621 N N   . GLY B 1 68  ? -24.853 -18.827 -34.155 1.00 30.47 ? 68  GLY B N   1 
ATOM   1622 C CA  . GLY B 1 68  ? -25.901 -18.479 -35.110 1.00 32.54 ? 68  GLY B CA  1 
ATOM   1623 C C   . GLY B 1 68  ? -27.178 -17.934 -34.496 1.00 33.82 ? 68  GLY B C   1 
ATOM   1624 O O   . GLY B 1 68  ? -28.059 -17.464 -35.211 1.00 34.04 ? 68  GLY B O   1 
ATOM   1625 N N   . GLU B 1 69  ? -27.285 -17.988 -33.173 1.00 34.08 ? 69  GLU B N   1 
ATOM   1626 C CA  . GLU B 1 69  ? -28.465 -17.458 -32.495 1.00 35.49 ? 69  GLU B CA  1 
ATOM   1627 C C   . GLU B 1 69  ? -28.099 -16.339 -31.520 1.00 35.03 ? 69  GLU B C   1 
ATOM   1628 O O   . GLU B 1 69  ? -27.269 -16.524 -30.628 1.00 34.17 ? 69  GLU B O   1 
ATOM   1629 C CB  . GLU B 1 69  ? -29.245 -18.577 -31.788 1.00 35.75 ? 69  GLU B CB  1 
ATOM   1630 C CG  . GLU B 1 69  ? -30.000 -19.495 -32.745 1.00 37.45 ? 69  GLU B CG  1 
ATOM   1631 C CD  . GLU B 1 69  ? -30.805 -20.586 -32.053 1.00 37.75 ? 69  GLU B CD  1 
ATOM   1632 O OE1 . GLU B 1 69  ? -31.165 -20.427 -30.865 1.00 38.55 ? 69  GLU B OE1 1 
ATOM   1633 O OE2 . GLU B 1 69  ? -31.083 -21.619 -32.704 1.00 39.19 ? 69  GLU B OE2 1 
ATOM   1634 N N   . GLU B 1 70  ? -28.721 -15.180 -31.716 1.00 35.20 ? 70  GLU B N   1 
ATOM   1635 C CA  . GLU B 1 70  ? -28.544 -14.011 -30.853 1.00 35.44 ? 70  GLU B CA  1 
ATOM   1636 C C   . GLU B 1 70  ? -28.764 -14.310 -29.376 1.00 35.01 ? 70  GLU B C   1 
ATOM   1637 O O   . GLU B 1 70  ? -29.741 -14.958 -29.002 1.00 34.32 ? 70  GLU B O   1 
ATOM   1638 C CB  . GLU B 1 70  ? -29.547 -12.936 -31.239 1.00 36.64 ? 70  GLU B CB  1 
ATOM   1639 C CG  . GLU B 1 70  ? -29.000 -11.749 -31.974 1.00 38.43 ? 70  GLU B CG  1 
ATOM   1640 C CD  . GLU B 1 70  ? -30.043 -10.657 -32.077 1.00 39.51 ? 70  GLU B CD  1 
ATOM   1641 O OE1 . GLU B 1 70  ? -31.177 -10.952 -32.509 1.00 40.37 ? 70  GLU B OE1 1 
ATOM   1642 O OE2 . GLU B 1 70  ? -29.743 -9.508  -31.717 1.00 39.85 ? 70  GLU B OE2 1 
ATOM   1643 N N   . PHE B 1 71  ? -27.879 -13.798 -28.527 1.00 34.01 ? 71  PHE B N   1 
ATOM   1644 C CA  . PHE B 1 71  ? -28.081 -13.920 -27.090 1.00 33.30 ? 71  PHE B CA  1 
ATOM   1645 C C   . PHE B 1 71  ? -27.669 -12.632 -26.412 1.00 34.01 ? 71  PHE B C   1 
ATOM   1646 O O   . PHE B 1 71  ? -27.067 -11.769 -27.039 1.00 34.48 ? 71  PHE B O   1 
ATOM   1647 C CB  . PHE B 1 71  ? -27.320 -15.121 -26.510 1.00 31.82 ? 71  PHE B CB  1 
ATOM   1648 C CG  . PHE B 1 71  ? -25.829 -15.008 -26.613 1.00 31.25 ? 71  PHE B CG  1 
ATOM   1649 C CD1 . PHE B 1 71  ? -25.177 -15.290 -27.809 1.00 30.53 ? 71  PHE B CD1 1 
ATOM   1650 C CD2 . PHE B 1 71  ? -25.071 -14.636 -25.511 1.00 30.86 ? 71  PHE B CD2 1 
ATOM   1651 C CE1 . PHE B 1 71  ? -23.803 -15.187 -27.901 1.00 30.50 ? 71  PHE B CE1 1 
ATOM   1652 C CE2 . PHE B 1 71  ? -23.695 -14.536 -25.599 1.00 30.50 ? 71  PHE B CE2 1 
ATOM   1653 C CZ  . PHE B 1 71  ? -23.062 -14.810 -26.791 1.00 30.77 ? 71  PHE B CZ  1 
ATOM   1654 N N   . GLU B 1 72  ? -28.016 -12.491 -25.139 1.00 34.48 ? 72  GLU B N   1 
ATOM   1655 C CA  . GLU B 1 72  ? -27.674 -11.285 -24.406 1.00 35.18 ? 72  GLU B CA  1 
ATOM   1656 C C   . GLU B 1 72  ? -26.528 -11.555 -23.447 1.00 34.51 ? 72  GLU B C   1 
ATOM   1657 O O   . GLU B 1 72  ? -26.517 -12.568 -22.738 1.00 33.87 ? 72  GLU B O   1 
ATOM   1658 C CB  . GLU B 1 72  ? -28.894 -10.726 -23.649 1.00 36.06 ? 72  GLU B CB  1 
ATOM   1659 C CG  . GLU B 1 72  ? -28.592 -9.424  -22.908 1.00 36.65 ? 72  GLU B CG  1 
ATOM   1660 C CD  . GLU B 1 72  ? -29.801 -8.818  -22.208 1.00 36.71 ? 72  GLU B CD  1 
ATOM   1661 O OE1 . GLU B 1 72  ? -29.588 -7.944  -21.343 1.00 37.38 ? 72  GLU B OE1 1 
ATOM   1662 O OE2 . GLU B 1 72  ? -30.951 -9.202  -22.516 1.00 37.06 ? 72  GLU B OE2 1 
ATOM   1663 N N   . GLU B 1 73  ? -25.546 -10.656 -23.466 1.00 33.97 ? 73  GLU B N   1 
ATOM   1664 C CA  . GLU B 1 73  ? -24.453 -10.677 -22.514 1.00 33.22 ? 73  GLU B CA  1 
ATOM   1665 C C   . GLU B 1 73  ? -24.073 -9.237  -22.172 1.00 33.67 ? 73  GLU B C   1 
ATOM   1666 O O   . GLU B 1 73  ? -24.913 -8.351  -22.229 1.00 33.73 ? 73  GLU B O   1 
ATOM   1667 C CB  . GLU B 1 73  ? -23.263 -11.470 -23.057 1.00 33.20 ? 73  GLU B CB  1 
ATOM   1668 C CG  . GLU B 1 73  ? -22.660 -10.936 -24.345 1.00 32.75 ? 73  GLU B CG  1 
ATOM   1669 C CD  . GLU B 1 73  ? -21.395 -11.675 -24.719 1.00 32.32 ? 73  GLU B CD  1 
ATOM   1670 O OE1 . GLU B 1 73  ? -20.835 -12.357 -23.838 1.00 31.91 ? 73  GLU B OE1 1 
ATOM   1671 O OE2 . GLU B 1 73  ? -20.961 -11.582 -25.880 1.00 31.49 ? 73  GLU B OE2 1 
ATOM   1672 N N   . GLN B 1 74  ? -22.823 -9.006  -21.790 1.00 34.48 ? 74  GLN B N   1 
ATOM   1673 C CA  . GLN B 1 74  ? -22.331 -7.648  -21.558 1.00 34.63 ? 74  GLN B CA  1 
ATOM   1674 C C   . GLN B 1 74  ? -21.023 -7.444  -22.299 1.00 33.88 ? 74  GLN B C   1 
ATOM   1675 O O   . GLN B 1 74  ? -20.285 -8.400  -22.521 1.00 34.39 ? 74  GLN B O   1 
ATOM   1676 C CB  . GLN B 1 74  ? -22.099 -7.402  -20.061 1.00 35.32 ? 74  GLN B CB  1 
ATOM   1677 C CG  . GLN B 1 74  ? -23.329 -7.642  -19.197 1.00 35.80 ? 74  GLN B CG  1 
ATOM   1678 C CD  . GLN B 1 74  ? -23.137 -7.243  -17.742 1.00 36.22 ? 74  GLN B CD  1 
ATOM   1679 O OE1 . GLN B 1 74  ? -22.017 -7.001  -17.284 1.00 36.86 ? 74  GLN B OE1 1 
ATOM   1680 N NE2 . GLN B 1 74  ? -24.243 -7.168  -17.007 1.00 36.97 ? 74  GLN B NE2 1 
ATOM   1681 N N   . THR B 1 75  ? -20.725 -6.203  -22.669 1.00 32.69 ? 75  THR B N   1 
ATOM   1682 C CA  . THR B 1 75  ? -19.396 -5.872  -23.173 1.00 32.34 ? 75  THR B CA  1 
ATOM   1683 C C   . THR B 1 75  ? -18.376 -6.037  -22.048 1.00 32.80 ? 75  THR B C   1 
ATOM   1684 O O   . THR B 1 75  ? -18.743 -6.195  -20.878 1.00 32.46 ? 75  THR B O   1 
ATOM   1685 C CB  . THR B 1 75  ? -19.316 -4.431  -23.667 1.00 31.33 ? 75  THR B CB  1 
ATOM   1686 O OG1 . THR B 1 75  ? -19.546 -3.553  -22.563 1.00 30.94 ? 75  THR B OG1 1 
ATOM   1687 C CG2 . THR B 1 75  ? -20.359 -4.161  -24.752 1.00 30.73 ? 75  THR B CG2 1 
ATOM   1688 N N   . VAL B 1 76  ? -17.095 -5.979  -22.399 1.00 33.08 ? 76  VAL B N   1 
ATOM   1689 C CA  . VAL B 1 76  ? -16.030 -6.151  -21.415 1.00 33.30 ? 76  VAL B CA  1 
ATOM   1690 C C   . VAL B 1 76  ? -16.098 -5.087  -20.323 1.00 33.95 ? 76  VAL B C   1 
ATOM   1691 O O   . VAL B 1 76  ? -15.749 -5.356  -19.165 1.00 34.68 ? 76  VAL B O   1 
ATOM   1692 C CB  . VAL B 1 76  ? -14.634 -6.178  -22.076 1.00 33.10 ? 76  VAL B CB  1 
ATOM   1693 C CG1 . VAL B 1 76  ? -14.321 -4.849  -22.723 1.00 33.35 ? 76  VAL B CG1 1 
ATOM   1694 C CG2 . VAL B 1 76  ? -13.569 -6.550  -21.054 1.00 33.10 ? 76  VAL B CG2 1 
ATOM   1695 N N   . ASP B 1 77  ? -16.584 -3.899  -20.675 1.00 33.28 ? 77  ASP B N   1 
ATOM   1696 C CA  . ASP B 1 77  ? -16.712 -2.815  -19.705 1.00 33.91 ? 77  ASP B CA  1 
ATOM   1697 C C   . ASP B 1 77  ? -18.079 -2.730  -19.023 1.00 34.46 ? 77  ASP B C   1 
ATOM   1698 O O   . ASP B 1 77  ? -18.325 -1.814  -18.240 1.00 34.90 ? 77  ASP B O   1 
ATOM   1699 C CB  . ASP B 1 77  ? -16.331 -1.471  -20.320 1.00 33.73 ? 77  ASP B CB  1 
ATOM   1700 C CG  . ASP B 1 77  ? -17.183 -1.117  -21.508 1.00 34.14 ? 77  ASP B CG  1 
ATOM   1701 O OD1 . ASP B 1 77  ? -17.390 -2.001  -22.364 1.00 34.04 ? 77  ASP B OD1 1 
ATOM   1702 O OD2 . ASP B 1 77  ? -17.634 0.044   -21.588 1.00 34.05 ? 77  ASP B OD2 1 
ATOM   1703 N N   . GLY B 1 78  ? -18.964 -3.678  -19.314 1.00 34.75 ? 78  GLY B N   1 
ATOM   1704 C CA  . GLY B 1 78  ? -20.143 -3.888  -18.479 1.00 35.24 ? 78  GLY B CA  1 
ATOM   1705 C C   . GLY B 1 78  ? -21.482 -3.481  -19.058 1.00 36.32 ? 78  GLY B C   1 
ATOM   1706 O O   . GLY B 1 78  ? -22.511 -3.688  -18.426 1.00 36.57 ? 78  GLY B O   1 
ATOM   1707 N N   . ARG B 1 79  ? -21.471 -2.925  -20.267 1.00 36.43 ? 79  ARG B N   1 
ATOM   1708 C CA  . ARG B 1 79  ? -22.680 -2.441  -20.927 1.00 36.45 ? 79  ARG B CA  1 
ATOM   1709 C C   . ARG B 1 79  ? -23.462 -3.604  -21.546 1.00 36.43 ? 79  ARG B C   1 
ATOM   1710 O O   . ARG B 1 79  ? -22.867 -4.533  -22.085 1.00 36.65 ? 79  ARG B O   1 
ATOM   1711 C CB  . ARG B 1 79  ? -22.298 -1.397  -21.989 1.00 36.60 ? 79  ARG B CB  1 
ATOM   1712 C CG  . ARG B 1 79  ? -21.437 -0.250  -21.431 1.00 37.05 ? 79  ARG B CG  1 
ATOM   1713 C CD  . ARG B 1 79  ? -20.872 0.680   -22.512 1.00 37.50 ? 79  ARG B CD  1 
ATOM   1714 N NE  . ARG B 1 79  ? -20.228 -0.081  -23.579 1.00 39.19 ? 79  ARG B NE  1 
ATOM   1715 C CZ  . ARG B 1 79  ? -19.116 0.280   -24.216 1.00 39.45 ? 79  ARG B CZ  1 
ATOM   1716 N NH1 . ARG B 1 79  ? -18.492 1.407   -23.900 1.00 39.89 ? 79  ARG B NH1 1 
ATOM   1717 N NH2 . ARG B 1 79  ? -18.619 -0.504  -25.166 1.00 39.72 ? 79  ARG B NH2 1 
ATOM   1718 N N   . PRO B 1 80  ? -24.803 -3.576  -21.452 1.00 35.82 ? 80  PRO B N   1 
ATOM   1719 C CA  . PRO B 1 80  ? -25.558 -4.711  -21.979 1.00 35.40 ? 80  PRO B CA  1 
ATOM   1720 C C   . PRO B 1 80  ? -25.539 -4.723  -23.499 1.00 34.55 ? 80  PRO B C   1 
ATOM   1721 O O   . PRO B 1 80  ? -25.630 -3.671  -24.126 1.00 33.94 ? 80  PRO B O   1 
ATOM   1722 C CB  . PRO B 1 80  ? -26.986 -4.480  -21.448 1.00 35.93 ? 80  PRO B CB  1 
ATOM   1723 C CG  . PRO B 1 80  ? -26.873 -3.374  -20.429 1.00 36.44 ? 80  PRO B CG  1 
ATOM   1724 C CD  . PRO B 1 80  ? -25.683 -2.557  -20.858 1.00 36.23 ? 80  PRO B CD  1 
ATOM   1725 N N   . CYS B 1 81  ? -25.393 -5.908  -24.087 1.00 34.15 ? 81  CYS B N   1 
ATOM   1726 C CA  . CYS B 1 81  ? -25.312 -6.020  -25.541 1.00 32.80 ? 81  CYS B CA  1 
ATOM   1727 C C   . CYS B 1 81  ? -26.015 -7.273  -26.038 1.00 32.49 ? 81  CYS B C   1 
ATOM   1728 O O   . CYS B 1 81  ? -26.279 -8.202  -25.267 1.00 32.02 ? 81  CYS B O   1 
ATOM   1729 C CB  . CYS B 1 81  ? -23.846 -6.021  -25.995 1.00 32.21 ? 81  CYS B CB  1 
ATOM   1730 S SG  . CYS B 1 81  ? -22.923 -7.512  -25.538 1.00 31.28 ? 81  CYS B SG  1 
ATOM   1731 N N   . LYS B 1 82  ? -26.338 -7.283  -27.329 1.00 31.99 ? 82  LYS B N   1 
ATOM   1732 C CA  . LYS B 1 82  ? -26.826 -8.485  -27.984 1.00 30.80 ? 82  LYS B CA  1 
ATOM   1733 C C   . LYS B 1 82  ? -25.665 -9.025  -28.807 1.00 30.12 ? 82  LYS B C   1 
ATOM   1734 O O   . LYS B 1 82  ? -25.002 -8.272  -29.523 1.00 29.10 ? 82  LYS B O   1 
ATOM   1735 C CB  . LYS B 1 82  ? -28.007 -8.138  -28.883 1.00 32.35 ? 82  LYS B CB  1 
ATOM   1736 C CG  . LYS B 1 82  ? -29.253 -8.962  -28.632 0.80 32.85 ? 82  LYS B CG  1 
ATOM   1737 C CD  . LYS B 1 82  ? -30.498 -8.178  -29.026 0.50 33.56 ? 82  LYS B CD  1 
ATOM   1738 C CE  . LYS B 1 82  ? -30.205 -7.226  -30.184 0.50 33.54 ? 82  LYS B CE  1 
ATOM   1739 N NZ  . LYS B 1 82  ? -31.367 -7.097  -31.108 0.50 33.57 ? 82  LYS B NZ  1 
ATOM   1740 N N   . SER B 1 83  ? -25.407 -10.324 -28.694 1.00 29.82 ? 83  SER B N   1 
ATOM   1741 C CA  . SER B 1 83  ? -24.239 -10.919 -29.324 1.00 28.91 ? 83  SER B CA  1 
ATOM   1742 C C   . SER B 1 83  ? -24.630 -12.006 -30.318 1.00 28.91 ? 83  SER B C   1 
ATOM   1743 O O   . SER B 1 83  ? -25.675 -12.626 -30.185 1.00 28.19 ? 83  SER B O   1 
ATOM   1744 C CB  . SER B 1 83  ? -23.291 -11.491 -28.271 1.00 29.02 ? 83  SER B CB  1 
ATOM   1745 O OG  . SER B 1 83  ? -22.769 -10.469 -27.434 1.00 29.13 ? 83  SER B OG  1 
ATOM   1746 N N   . LEU B 1 84  ? -23.778 -12.220 -31.315 1.00 28.76 ? 84  LEU B N   1 
ATOM   1747 C CA  . LEU B 1 84  ? -24.017 -13.233 -32.332 1.00 28.26 ? 84  LEU B CA  1 
ATOM   1748 C C   . LEU B 1 84  ? -22.693 -13.893 -32.731 1.00 27.65 ? 84  LEU B C   1 
ATOM   1749 O O   . LEU B 1 84  ? -21.797 -13.236 -33.254 1.00 27.23 ? 84  LEU B O   1 
ATOM   1750 C CB  . LEU B 1 84  ? -24.692 -12.608 -33.554 1.00 28.46 ? 84  LEU B CB  1 
ATOM   1751 C CG  . LEU B 1 84  ? -25.026 -13.605 -34.665 1.00 29.09 ? 84  LEU B CG  1 
ATOM   1752 C CD1 . LEU B 1 84  ? -25.958 -14.688 -34.126 1.00 29.25 ? 84  LEU B CD1 1 
ATOM   1753 C CD2 . LEU B 1 84  ? -25.618 -12.922 -35.903 1.00 28.56 ? 84  LEU B CD2 1 
ATOM   1754 N N   . VAL B 1 85  ? -22.574 -15.187 -32.459 1.00 27.13 ? 85  VAL B N   1 
ATOM   1755 C CA  . VAL B 1 85  ? -21.342 -15.928 -32.736 1.00 26.35 ? 85  VAL B CA  1 
ATOM   1756 C C   . VAL B 1 85  ? -21.461 -16.724 -34.042 1.00 27.23 ? 85  VAL B C   1 
ATOM   1757 O O   . VAL B 1 85  ? -22.504 -17.333 -34.333 1.00 27.12 ? 85  VAL B O   1 
ATOM   1758 C CB  . VAL B 1 85  ? -20.983 -16.882 -31.572 1.00 26.35 ? 85  VAL B CB  1 
ATOM   1759 C CG1 . VAL B 1 85  ? -19.738 -17.692 -31.890 1.00 26.30 ? 85  VAL B CG1 1 
ATOM   1760 C CG2 . VAL B 1 85  ? -20.787 -16.094 -30.280 1.00 25.43 ? 85  VAL B CG2 1 
ATOM   1761 N N   . LYS B 1 86  ? -20.384 -16.715 -34.818 1.00 27.42 ? 86  LYS B N   1 
ATOM   1762 C CA  . LYS B 1 86  ? -20.329 -17.440 -36.077 1.00 27.66 ? 86  LYS B CA  1 
ATOM   1763 C C   . LYS B 1 86  ? -18.968 -18.095 -36.218 1.00 27.66 ? 86  LYS B C   1 
ATOM   1764 O O   . LYS B 1 86  ? -17.961 -17.525 -35.801 1.00 27.21 ? 86  LYS B O   1 
ATOM   1765 C CB  . LYS B 1 86  ? -20.565 -16.488 -37.249 1.00 28.39 ? 86  LYS B CB  1 
ATOM   1766 C CG  . LYS B 1 86  ? -21.841 -15.664 -37.144 1.00 29.09 ? 86  LYS B CG  1 
ATOM   1767 C CD  . LYS B 1 86  ? -22.243 -15.121 -38.511 1.00 29.96 ? 86  LYS B CD  1 
ATOM   1768 C CE  . LYS B 1 86  ? -23.509 -14.281 -38.434 1.00 29.80 ? 86  LYS B CE  1 
ATOM   1769 N NZ  . LYS B 1 86  ? -23.717 -13.466 -39.680 1.00 30.51 ? 86  LYS B NZ  1 
ATOM   1770 N N   . TRP B 1 87  ? -18.937 -19.292 -36.797 1.00 27.98 ? 87  TRP B N   1 
ATOM   1771 C CA  . TRP B 1 87  ? -17.668 -19.952 -37.098 1.00 29.14 ? 87  TRP B CA  1 
ATOM   1772 C C   . TRP B 1 87  ? -16.911 -19.214 -38.183 1.00 31.01 ? 87  TRP B C   1 
ATOM   1773 O O   . TRP B 1 87  ? -17.449 -18.958 -39.265 1.00 30.59 ? 87  TRP B O   1 
ATOM   1774 C CB  . TRP B 1 87  ? -17.887 -21.388 -37.570 1.00 28.76 ? 87  TRP B CB  1 
ATOM   1775 C CG  . TRP B 1 87  ? -18.453 -22.278 -36.528 1.00 28.88 ? 87  TRP B CG  1 
ATOM   1776 C CD1 . TRP B 1 87  ? -19.716 -22.786 -36.487 1.00 28.46 ? 87  TRP B CD1 1 
ATOM   1777 C CD2 . TRP B 1 87  ? -17.780 -22.767 -35.362 1.00 28.49 ? 87  TRP B CD2 1 
ATOM   1778 N NE1 . TRP B 1 87  ? -19.876 -23.561 -35.361 1.00 28.54 ? 87  TRP B NE1 1 
ATOM   1779 C CE2 . TRP B 1 87  ? -18.701 -23.563 -34.654 1.00 28.49 ? 87  TRP B CE2 1 
ATOM   1780 C CE3 . TRP B 1 87  ? -16.486 -22.608 -34.850 1.00 28.77 ? 87  TRP B CE3 1 
ATOM   1781 C CZ2 . TRP B 1 87  ? -18.373 -24.201 -33.461 1.00 28.62 ? 87  TRP B CZ2 1 
ATOM   1782 C CZ3 . TRP B 1 87  ? -16.160 -23.244 -33.660 1.00 28.64 ? 87  TRP B CZ3 1 
ATOM   1783 C CH2 . TRP B 1 87  ? -17.100 -24.026 -32.980 1.00 28.66 ? 87  TRP B CH2 1 
ATOM   1784 N N   . GLU B 1 88  ? -15.656 -18.882 -37.906 1.00 32.77 ? 88  GLU B N   1 
ATOM   1785 C CA  . GLU B 1 88  ? -14.774 -18.381 -38.946 1.00 35.47 ? 88  GLU B CA  1 
ATOM   1786 C C   . GLU B 1 88  ? -14.071 -19.549 -39.642 1.00 36.80 ? 88  GLU B C   1 
ATOM   1787 O O   . GLU B 1 88  ? -13.768 -19.484 -40.829 1.00 37.99 ? 88  GLU B O   1 
ATOM   1788 C CB  . GLU B 1 88  ? -13.759 -17.402 -38.368 1.00 36.38 ? 88  GLU B CB  1 
ATOM   1789 C CG  . GLU B 1 88  ? -12.780 -16.865 -39.392 1.00 37.92 ? 88  GLU B CG  1 
ATOM   1790 C CD  . GLU B 1 88  ? -11.778 -15.916 -38.777 1.00 38.50 ? 88  GLU B CD  1 
ATOM   1791 O OE1 . GLU B 1 88  ? -12.198 -14.857 -38.274 1.00 39.42 ? 88  GLU B OE1 1 
ATOM   1792 O OE2 . GLU B 1 88  ? -10.571 -16.231 -38.795 1.00 39.35 ? 88  GLU B OE2 1 
ATOM   1793 N N   . SER B 1 89  ? -13.832 -20.622 -38.897 1.00 37.82 ? 89  SER B N   1 
ATOM   1794 C CA  . SER B 1 89  ? -13.250 -21.843 -39.447 1.00 38.48 ? 89  SER B CA  1 
ATOM   1795 C C   . SER B 1 89  ? -13.709 -23.005 -38.593 1.00 38.47 ? 89  SER B C   1 
ATOM   1796 O O   . SER B 1 89  ? -14.614 -22.853 -37.774 1.00 39.16 ? 89  SER B O   1 
ATOM   1797 C CB  . SER B 1 89  ? -11.722 -21.768 -39.420 1.00 39.03 ? 89  SER B CB  1 
ATOM   1798 O OG  . SER B 1 89  ? -11.236 -21.812 -38.088 1.00 39.02 ? 89  SER B OG  1 
ATOM   1799 N N   . GLU B 1 90  ? -13.081 -24.165 -38.765 1.00 38.31 ? 90  GLU B N   1 
ATOM   1800 C CA  . GLU B 1 90  ? -13.342 -25.299 -37.883 1.00 37.83 ? 90  GLU B CA  1 
ATOM   1801 C C   . GLU B 1 90  ? -12.826 -25.069 -36.462 1.00 35.90 ? 90  GLU B C   1 
ATOM   1802 O O   . GLU B 1 90  ? -13.314 -25.689 -35.520 1.00 36.28 ? 90  GLU B O   1 
ATOM   1803 C CB  . GLU B 1 90  ? -12.720 -26.593 -38.428 1.00 39.90 ? 90  GLU B CB  1 
ATOM   1804 C CG  . GLU B 1 90  ? -13.707 -27.543 -39.100 1.00 41.91 ? 90  GLU B CG  1 
ATOM   1805 C CD  . GLU B 1 90  ? -13.466 -28.999 -38.714 1.00 43.65 ? 90  GLU B CD  1 
ATOM   1806 O OE1 . GLU B 1 90  ? -12.287 -29.394 -38.539 1.00 44.39 ? 90  GLU B OE1 1 
ATOM   1807 O OE2 . GLU B 1 90  ? -14.458 -29.751 -38.573 1.00 44.45 ? 90  GLU B OE2 1 
ATOM   1808 N N   . ASN B 1 91  ? -11.838 -24.194 -36.301 1.00 33.76 ? 91  ASN B N   1 
ATOM   1809 C CA  A ASN B 1 91  ? -11.253 -24.021 -34.971 0.50 32.49 ? 91  ASN B CA  1 
ATOM   1810 C CA  B ASN B 1 91  ? -11.157 -23.994 -35.020 0.50 32.29 ? 91  ASN B CA  1 
ATOM   1811 C C   . ASN B 1 91  ? -11.383 -22.628 -34.378 1.00 31.53 ? 91  ASN B C   1 
ATOM   1812 O O   . ASN B 1 91  ? -10.854 -22.364 -33.306 1.00 31.19 ? 91  ASN B O   1 
ATOM   1813 C CB  A ASN B 1 91  ? -9.794  -24.482 -34.943 0.50 32.76 ? 91  ASN B CB  1 
ATOM   1814 C CB  B ASN B 1 91  ? -9.647  -24.178 -35.195 0.50 32.16 ? 91  ASN B CB  1 
ATOM   1815 C CG  A ASN B 1 91  ? -8.895  -23.630 -35.809 0.50 32.82 ? 91  ASN B CG  1 
ATOM   1816 C CG  B ASN B 1 91  ? -9.267  -25.585 -35.603 0.50 32.24 ? 91  ASN B CG  1 
ATOM   1817 O OD1 A ASN B 1 91  ? -9.205  -23.362 -36.967 0.50 33.64 ? 91  ASN B OD1 1 
ATOM   1818 O OD1 B ASN B 1 91  ? -9.728  -26.097 -36.623 0.50 31.95 ? 91  ASN B OD1 1 
ATOM   1819 N ND2 A ASN B 1 91  ? -7.770  -23.202 -35.254 0.50 32.92 ? 91  ASN B ND2 1 
ATOM   1820 N ND2 B ASN B 1 91  ? -8.403  -26.212 -34.811 0.50 31.71 ? 91  ASN B ND2 1 
ATOM   1821 N N   . LYS B 1 92  ? -12.119 -21.745 -35.051 1.00 29.95 ? 92  LYS B N   1 
ATOM   1822 C CA  . LYS B 1 92  ? -12.233 -20.357 -34.596 1.00 28.98 ? 92  LYS B CA  1 
ATOM   1823 C C   . LYS B 1 92  ? -13.650 -19.811 -34.743 1.00 28.35 ? 92  LYS B C   1 
ATOM   1824 O O   . LYS B 1 92  ? -14.250 -19.919 -35.807 1.00 27.49 ? 92  LYS B O   1 
ATOM   1825 C CB  . LYS B 1 92  ? -11.235 -19.461 -35.353 1.00 29.02 ? 92  LYS B CB  1 
ATOM   1826 C CG  . LYS B 1 92  ? -11.249 -18.001 -34.929 1.00 29.40 ? 92  LYS B CG  1 
ATOM   1827 C CD  . LYS B 1 92  ? -10.056 -17.210 -35.463 1.00 29.49 ? 92  LYS B CD  1 
ATOM   1828 C CE  . LYS B 1 92  ? -10.112 -15.767 -34.965 1.00 30.21 ? 92  LYS B CE  1 
ATOM   1829 N NZ  . LYS B 1 92  ? -8.872  -14.973 -35.240 1.00 29.87 ? 92  LYS B NZ  1 
ATOM   1830 N N   . MET B 1 93  ? -14.180 -19.232 -33.667 1.00 27.20 ? 93  MET B N   1 
ATOM   1831 C CA  . MET B 1 93  ? -15.480 -18.583 -33.713 1.00 26.73 ? 93  MET B CA  1 
ATOM   1832 C C   . MET B 1 93  ? -15.290 -17.102 -33.443 1.00 26.07 ? 93  MET B C   1 
ATOM   1833 O O   . MET B 1 93  ? -14.331 -16.709 -32.780 1.00 25.16 ? 93  MET B O   1 
ATOM   1834 C CB  . MET B 1 93  ? -16.430 -19.178 -32.675 1.00 27.30 ? 93  MET B CB  1 
ATOM   1835 C CG  . MET B 1 93  ? -16.101 -18.765 -31.241 1.00 27.76 ? 93  MET B CG  1 
ATOM   1836 S SD  . MET B 1 93  ? -17.019 -19.678 -29.989 1.00 27.97 ? 93  MET B SD  1 
ATOM   1837 C CE  . MET B 1 93  ? -16.252 -21.284 -30.093 1.00 27.49 ? 93  MET B CE  1 
ATOM   1838 N N   . VAL B 1 94  ? -16.207 -16.284 -33.955 1.00 25.79 ? 94  VAL B N   1 
ATOM   1839 C CA  . VAL B 1 94  ? -16.092 -14.830 -33.859 1.00 26.16 ? 94  VAL B CA  1 
ATOM   1840 C C   . VAL B 1 94  ? -17.424 -14.282 -33.386 1.00 26.30 ? 94  VAL B C   1 
ATOM   1841 O O   . VAL B 1 94  ? -18.474 -14.763 -33.802 1.00 25.54 ? 94  VAL B O   1 
ATOM   1842 C CB  . VAL B 1 94  ? -15.766 -14.215 -35.233 1.00 27.07 ? 94  VAL B CB  1 
ATOM   1843 C CG1 . VAL B 1 94  ? -15.672 -12.689 -35.143 1.00 26.81 ? 94  VAL B CG1 1 
ATOM   1844 C CG2 . VAL B 1 94  ? -14.465 -14.826 -35.802 1.00 28.37 ? 94  VAL B CG2 1 
ATOM   1845 N N   . CYS B 1 95  ? -17.397 -13.280 -32.521 1.00 27.47 ? 95  CYS B N   1 
ATOM   1846 C CA  . CYS B 1 95  ? -18.643 -12.743 -31.984 1.00 27.73 ? 95  CYS B CA  1 
ATOM   1847 C C   . CYS B 1 95  ? -18.728 -11.238 -32.164 1.00 28.22 ? 95  CYS B C   1 
ATOM   1848 O O   . CYS B 1 95  ? -17.861 -10.504 -31.693 1.00 27.54 ? 95  CYS B O   1 
ATOM   1849 C CB  . CYS B 1 95  ? -18.777 -13.096 -30.506 1.00 28.43 ? 95  CYS B CB  1 
ATOM   1850 S SG  . CYS B 1 95  ? -20.314 -12.520 -29.734 1.00 29.61 ? 95  CYS B SG  1 
ATOM   1851 N N   . GLU B 1 96  ? -19.772 -10.784 -32.854 1.00 28.56 ? 96  GLU B N   1 
ATOM   1852 C CA  . GLU B 1 96  ? -20.038 -9.360  -32.996 1.00 29.61 ? 96  GLU B CA  1 
ATOM   1853 C C   . GLU B 1 96  ? -21.018 -8.902  -31.921 1.00 30.19 ? 96  GLU B C   1 
ATOM   1854 O O   . GLU B 1 96  ? -22.010 -9.572  -31.637 1.00 30.58 ? 96  GLU B O   1 
ATOM   1855 C CB  . GLU B 1 96  ? -20.576 -9.032  -34.396 0.80 29.81 ? 96  GLU B CB  1 
ATOM   1856 C CG  . GLU B 1 96  ? -21.580 -10.062 -34.951 0.60 30.15 ? 96  GLU B CG  1 
ATOM   1857 C CD  . GLU B 1 96  ? -22.149 -9.661  -36.309 0.50 29.99 ? 96  GLU B CD  1 
ATOM   1858 O OE1 . GLU B 1 96  ? -22.881 -10.476 -36.915 0.40 29.71 ? 96  GLU B OE1 1 
ATOM   1859 O OE2 . GLU B 1 96  ? -21.866 -8.530  -36.766 0.30 29.98 ? 96  GLU B OE2 1 
ATOM   1860 N N   . GLN B 1 97  ? -20.727 -7.763  -31.311 1.00 31.11 ? 97  GLN B N   1 
ATOM   1861 C CA  . GLN B 1 97  ? -21.575 -7.246  -30.252 1.00 31.77 ? 97  GLN B CA  1 
ATOM   1862 C C   . GLN B 1 97  ? -22.325 -6.001  -30.714 1.00 33.02 ? 97  GLN B C   1 
ATOM   1863 O O   . GLN B 1 97  ? -21.788 -5.193  -31.484 1.00 32.98 ? 97  GLN B O   1 
ATOM   1864 C CB  . GLN B 1 97  ? -20.743 -6.986  -28.997 1.00 31.89 ? 97  GLN B CB  1 
ATOM   1865 C CG  . GLN B 1 97  ? -20.263 -8.264  -28.326 1.00 31.28 ? 97  GLN B CG  1 
ATOM   1866 C CD  . GLN B 1 97  ? -19.444 -8.015  -27.075 1.00 31.28 ? 97  GLN B CD  1 
ATOM   1867 O OE1 . GLN B 1 97  ? -18.928 -6.917  -26.861 1.00 31.16 ? 97  GLN B OE1 1 
ATOM   1868 N NE2 . GLN B 1 97  ? -19.312 -9.041  -26.240 1.00 30.65 ? 97  GLN B NE2 1 
ATOM   1869 N N   . LYS B 1 98  ? -23.580 -5.882  -30.283 1.00 33.63 ? 98  LYS B N   1 
ATOM   1870 C CA  . LYS B 1 98  ? -24.408 -4.712  -30.573 1.00 34.97 ? 98  LYS B CA  1 
ATOM   1871 C C   . LYS B 1 98  ? -25.072 -4.263  -29.277 1.00 34.95 ? 98  LYS B C   1 
ATOM   1872 O O   . LYS B 1 98  ? -25.731 -5.053  -28.612 1.00 33.91 ? 98  LYS B O   1 
ATOM   1873 C CB  . LYS B 1 98  ? -25.482 -5.056  -31.610 1.00 36.44 ? 98  LYS B CB  1 
ATOM   1874 C CG  . LYS B 1 98  ? -26.091 -3.847  -32.326 1.00 38.71 ? 98  LYS B CG  1 
ATOM   1875 C CD  . LYS B 1 98  ? -27.498 -4.147  -32.852 1.00 39.97 ? 98  LYS B CD  1 
ATOM   1876 C CE  . LYS B 1 98  ? -27.634 -5.604  -33.309 1.00 40.73 ? 98  LYS B CE  1 
ATOM   1877 N NZ  . LYS B 1 98  ? -28.988 -6.159  -32.995 1.00 41.61 ? 98  LYS B NZ  1 
ATOM   1878 N N   . LEU B 1 99  ? -24.892 -2.998  -28.911 1.00 36.05 ? 99  LEU B N   1 
ATOM   1879 C CA  . LEU B 1 99  ? -25.472 -2.483  -27.672 1.00 37.17 ? 99  LEU B CA  1 
ATOM   1880 C C   . LEU B 1 99  ? -26.986 -2.567  -27.723 1.00 38.22 ? 99  LEU B C   1 
ATOM   1881 O O   . LEU B 1 99  ? -27.585 -2.340  -28.771 1.00 38.12 ? 99  LEU B O   1 
ATOM   1882 C CB  . LEU B 1 99  ? -25.034 -1.040  -27.428 1.00 37.24 ? 99  LEU B CB  1 
ATOM   1883 C CG  . LEU B 1 99  ? -23.528 -0.790  -27.335 1.00 37.22 ? 99  LEU B CG  1 
ATOM   1884 C CD1 . LEU B 1 99  ? -23.254 0.696   -27.284 1.00 37.63 ? 99  LEU B CD1 1 
ATOM   1885 C CD2 . LEU B 1 99  ? -22.930 -1.477  -26.121 1.00 37.20 ? 99  LEU B CD2 1 
ATOM   1886 N N   . LEU B 1 100 ? -27.602 -2.912  -26.596 1.00 40.01 ? 100 LEU B N   1 
ATOM   1887 C CA  . LEU B 1 100 ? -29.059 -2.920  -26.499 1.00 41.83 ? 100 LEU B CA  1 
ATOM   1888 C C   . LEU B 1 100 ? -29.581 -1.493  -26.582 1.00 43.58 ? 100 LEU B C   1 
ATOM   1889 O O   . LEU B 1 100 ? -30.527 -1.208  -27.318 1.00 44.12 ? 100 LEU B O   1 
ATOM   1890 C CB  . LEU B 1 100 ? -29.519 -3.565  -25.186 1.00 41.54 ? 100 LEU B CB  1 
ATOM   1891 C CG  . LEU B 1 100 ? -29.255 -5.065  -25.013 1.00 41.54 ? 100 LEU B CG  1 
ATOM   1892 C CD1 . LEU B 1 100 ? -29.712 -5.561  -23.658 1.00 41.21 ? 100 LEU B CD1 1 
ATOM   1893 C CD2 . LEU B 1 100 ? -29.923 -5.867  -26.117 1.00 41.73 ? 100 LEU B CD2 1 
ATOM   1894 N N   . LYS B 1 101 ? -28.957 -0.598  -25.823 1.00 45.18 ? 101 LYS B N   1 
ATOM   1895 C CA  . LYS B 1 101 ? -29.361 0.804   -25.805 1.00 46.92 ? 101 LYS B CA  1 
ATOM   1896 C C   . LYS B 1 101 ? -28.174 1.740   -26.039 1.00 47.29 ? 101 LYS B C   1 
ATOM   1897 O O   . LYS B 1 101 ? -27.155 1.660   -25.351 1.00 47.65 ? 101 LYS B O   1 
ATOM   1898 C CB  . LYS B 1 101 ? -30.071 1.146   -24.487 1.00 47.36 ? 101 LYS B CB  1 
ATOM   1899 C CG  . LYS B 1 101 ? -31.346 0.347   -24.250 1.00 47.87 ? 101 LYS B CG  1 
ATOM   1900 C CD  . LYS B 1 101 ? -31.926 0.602   -22.871 1.00 48.06 ? 101 LYS B CD  1 
ATOM   1901 C CE  . LYS B 1 101 ? -33.104 -0.324  -22.603 1.00 48.74 ? 101 LYS B CE  1 
ATOM   1902 N NZ  . LYS B 1 101 ? -34.147 -0.235  -23.669 1.00 48.86 ? 101 LYS B NZ  1 
ATOM   1903 N N   . GLY B 1 102 ? -28.314 2.625   -27.019 1.00 47.65 ? 102 GLY B N   1 
ATOM   1904 C CA  . GLY B 1 102 ? -27.287 3.617   -27.301 1.00 47.37 ? 102 GLY B CA  1 
ATOM   1905 C C   . GLY B 1 102 ? -26.273 3.138   -28.315 1.00 47.20 ? 102 GLY B C   1 
ATOM   1906 O O   . GLY B 1 102 ? -26.461 2.114   -28.970 1.00 47.15 ? 102 GLY B O   1 
ATOM   1907 N N   . GLU B 1 103 ? -25.191 3.892   -28.448 1.00 46.92 ? 103 GLU B N   1 
ATOM   1908 C CA  . GLU B 1 103 ? -24.107 3.525   -29.343 1.00 46.02 ? 103 GLU B CA  1 
ATOM   1909 C C   . GLU B 1 103 ? -22.789 3.584   -28.593 1.00 44.75 ? 103 GLU B C   1 
ATOM   1910 O O   . GLU B 1 103 ? -22.733 4.019   -27.441 1.00 44.46 ? 103 GLU B O   1 
ATOM   1911 C CB  . GLU B 1 103 ? -24.058 4.457   -30.544 1.00 46.86 ? 103 GLU B CB  1 
ATOM   1912 C CG  . GLU B 1 103 ? -25.380 4.635   -31.240 1.00 48.08 ? 103 GLU B CG  1 
ATOM   1913 C CD  . GLU B 1 103 ? -25.477 5.974   -31.932 1.00 48.84 ? 103 GLU B CD  1 
ATOM   1914 O OE1 . GLU B 1 103 ? -26.192 6.859   -31.403 1.00 48.98 ? 103 GLU B OE1 1 
ATOM   1915 O OE2 . GLU B 1 103 ? -24.825 6.147   -32.991 1.00 49.22 ? 103 GLU B OE2 1 
ATOM   1916 N N   . GLY B 1 104 ? -21.731 3.135   -29.256 1.00 43.20 ? 104 GLY B N   1 
ATOM   1917 C CA  . GLY B 1 104 ? -20.413 3.053   -28.640 1.00 41.61 ? 104 GLY B CA  1 
ATOM   1918 C C   . GLY B 1 104 ? -19.421 2.489   -29.633 1.00 40.41 ? 104 GLY B C   1 
ATOM   1919 O O   . GLY B 1 104 ? -19.750 2.315   -30.808 1.00 39.75 ? 104 GLY B O   1 
ATOM   1920 N N   . PRO B 1 105 ? -18.202 2.186   -29.165 1.00 39.30 ? 105 PRO B N   1 
ATOM   1921 C CA  . PRO B 1 105 ? -17.181 1.667   -30.057 1.00 38.40 ? 105 PRO B CA  1 
ATOM   1922 C C   . PRO B 1 105 ? -17.541 0.256   -30.453 1.00 37.65 ? 105 PRO B C   1 
ATOM   1923 O O   . PRO B 1 105 ? -18.248 -0.433  -29.714 1.00 37.80 ? 105 PRO B O   1 
ATOM   1924 C CB  . PRO B 1 105 ? -15.911 1.655   -29.193 1.00 38.55 ? 105 PRO B CB  1 
ATOM   1925 C CG  . PRO B 1 105 ? -16.258 2.369   -27.937 1.00 38.86 ? 105 PRO B CG  1 
ATOM   1926 C CD  . PRO B 1 105 ? -17.733 2.287   -27.777 1.00 39.20 ? 105 PRO B CD  1 
ATOM   1927 N N   . LYS B 1 106 ? -17.066 -0.164  -31.615 1.00 36.68 ? 106 LYS B N   1 
ATOM   1928 C CA  . LYS B 1 106 ? -17.284 -1.518  -32.084 1.00 36.66 ? 106 LYS B CA  1 
ATOM   1929 C C   . LYS B 1 106 ? -16.506 -2.491  -31.194 1.00 34.77 ? 106 LYS B C   1 
ATOM   1930 O O   . LYS B 1 106 ? -15.291 -2.369  -31.042 1.00 34.61 ? 106 LYS B O   1 
ATOM   1931 C CB  . LYS B 1 106 ? -16.820 -1.635  -33.542 1.00 37.39 ? 106 LYS B CB  1 
ATOM   1932 C CG  . LYS B 1 106 ? -17.425 -2.797  -34.321 1.00 38.19 ? 106 LYS B CG  1 
ATOM   1933 C CD  . LYS B 1 106 ? -16.739 -2.949  -35.673 1.00 38.48 ? 106 LYS B CD  1 
ATOM   1934 C CE  . LYS B 1 106 ? -17.285 -4.145  -36.446 1.00 39.56 ? 106 LYS B CE  1 
ATOM   1935 N NZ  . LYS B 1 106 ? -18.740 -3.996  -36.733 1.00 40.07 ? 106 LYS B NZ  1 
ATOM   1936 N N   . THR B 1 107 ? -17.218 -3.439  -30.592 1.00 33.69 ? 107 THR B N   1 
ATOM   1937 C CA  . THR B 1 107 ? -16.593 -4.463  -29.751 1.00 31.11 ? 107 THR B CA  1 
ATOM   1938 C C   . THR B 1 107 ? -16.864 -5.849  -30.320 1.00 30.50 ? 107 THR B C   1 
ATOM   1939 O O   . THR B 1 107 ? -17.934 -6.112  -30.862 1.00 30.58 ? 107 THR B O   1 
ATOM   1940 C CB  . THR B 1 107 ? -17.094 -4.413  -28.294 1.00 30.83 ? 107 THR B CB  1 
ATOM   1941 O OG1 . THR B 1 107 ? -18.503 -4.677  -28.255 1.00 29.98 ? 107 THR B OG1 1 
ATOM   1942 C CG2 . THR B 1 107 ? -16.804 -3.048  -27.655 1.00 30.05 ? 107 THR B CG2 1 
ATOM   1943 N N   . SER B 1 108 ? -15.880 -6.730  -30.211 1.00 30.25 ? 108 SER B N   1 
ATOM   1944 C CA  . SER B 1 108 ? -16.039 -8.113  -30.647 1.00 29.15 ? 108 SER B CA  1 
ATOM   1945 C C   . SER B 1 108 ? -15.141 -8.997  -29.816 1.00 28.62 ? 108 SER B C   1 
ATOM   1946 O O   . SER B 1 108 ? -14.241 -8.503  -29.130 1.00 28.49 ? 108 SER B O   1 
ATOM   1947 C CB  . SER B 1 108 ? -15.670 -8.253  -32.122 1.00 29.57 ? 108 SER B CB  1 
ATOM   1948 O OG  . SER B 1 108 ? -14.329 -7.850  -32.354 1.00 29.57 ? 108 SER B OG  1 
ATOM   1949 N N   . TRP B 1 109 ? -15.394 -10.302 -29.853 1.00 27.76 ? 109 TRP B N   1 
ATOM   1950 C CA  . TRP B 1 109 ? -14.459 -11.261 -29.290 1.00 27.00 ? 109 TRP B CA  1 
ATOM   1951 C C   . TRP B 1 109 ? -14.380 -12.504 -30.158 1.00 26.44 ? 109 TRP B C   1 
ATOM   1952 O O   . TRP B 1 109 ? -15.278 -12.773 -30.961 1.00 26.28 ? 109 TRP B O   1 
ATOM   1953 C CB  . TRP B 1 109 ? -14.796 -11.623 -27.835 1.00 27.24 ? 109 TRP B CB  1 
ATOM   1954 C CG  . TRP B 1 109 ? -16.169 -12.243 -27.591 1.00 27.05 ? 109 TRP B CG  1 
ATOM   1955 C CD1 . TRP B 1 109 ? -17.276 -11.610 -27.100 1.00 27.28 ? 109 TRP B CD1 1 
ATOM   1956 C CD2 . TRP B 1 109 ? -16.550 -13.615 -27.789 1.00 27.14 ? 109 TRP B CD2 1 
ATOM   1957 N NE1 . TRP B 1 109 ? -18.328 -12.495 -26.999 1.00 27.73 ? 109 TRP B NE1 1 
ATOM   1958 C CE2 . TRP B 1 109 ? -17.903 -13.734 -27.407 1.00 27.37 ? 109 TRP B CE2 1 
ATOM   1959 C CE3 . TRP B 1 109 ? -15.881 -14.751 -28.263 1.00 27.30 ? 109 TRP B CE3 1 
ATOM   1960 C CZ2 . TRP B 1 109 ? -18.597 -14.939 -27.483 1.00 27.00 ? 109 TRP B CZ2 1 
ATOM   1961 C CZ3 . TRP B 1 109 ? -16.570 -15.946 -28.336 1.00 27.35 ? 109 TRP B CZ3 1 
ATOM   1962 C CH2 . TRP B 1 109 ? -17.918 -16.030 -27.947 1.00 27.48 ? 109 TRP B CH2 1 
ATOM   1963 N N   . THR B 1 110 ? -13.284 -13.239 -30.011 1.00 25.82 ? 110 THR B N   1 
ATOM   1964 C CA  . THR B 1 110 ? -13.102 -14.496 -30.709 1.00 25.33 ? 110 THR B CA  1 
ATOM   1965 C C   . THR B 1 110 ? -12.562 -15.558 -29.750 1.00 25.89 ? 110 THR B C   1 
ATOM   1966 O O   . THR B 1 110 ? -11.918 -15.240 -28.744 1.00 24.57 ? 110 THR B O   1 
ATOM   1967 C CB  . THR B 1 110 ? -12.100 -14.368 -31.875 1.00 25.26 ? 110 THR B CB  1 
ATOM   1968 O OG1 . THR B 1 110 ? -10.778 -14.182 -31.356 1.00 25.32 ? 110 THR B OG1 1 
ATOM   1969 C CG2 . THR B 1 110 ? -12.440 -13.190 -32.793 1.00 25.10 ? 110 THR B CG2 1 
ATOM   1970 N N   . LEU B 1 111 ? -12.808 -16.825 -30.080 1.00 26.28 ? 111 LEU B N   1 
ATOM   1971 C CA  . LEU B 1 111 ? -12.146 -17.934 -29.403 1.00 26.39 ? 111 LEU B CA  1 
ATOM   1972 C C   . LEU B 1 111 ? -11.582 -18.872 -30.462 1.00 26.90 ? 111 LEU B C   1 
ATOM   1973 O O   . LEU B 1 111 ? -12.282 -19.238 -31.391 1.00 25.66 ? 111 LEU B O   1 
ATOM   1974 C CB  . LEU B 1 111 ? -13.121 -18.712 -28.528 1.00 26.89 ? 111 LEU B CB  1 
ATOM   1975 C CG  . LEU B 1 111 ? -13.430 -18.343 -27.077 1.00 27.03 ? 111 LEU B CG  1 
ATOM   1976 C CD1 . LEU B 1 111 ? -14.281 -19.433 -26.488 1.00 26.90 ? 111 LEU B CD1 1 
ATOM   1977 C CD2 . LEU B 1 111 ? -12.168 -18.206 -26.266 1.00 26.94 ? 111 LEU B CD2 1 
ATOM   1978 N N   . GLU B 1 112 ? -10.319 -19.253 -30.324 1.00 27.72 ? 112 GLU B N   1 
ATOM   1979 C CA  . GLU B 1 112 ? -9.711  -20.203 -31.250 1.00 29.61 ? 112 GLU B CA  1 
ATOM   1980 C C   . GLU B 1 112 ? -9.007  -21.311 -30.488 1.00 30.44 ? 112 GLU B C   1 
ATOM   1981 O O   . GLU B 1 112 ? -8.273  -21.042 -29.551 1.00 30.62 ? 112 GLU B O   1 
ATOM   1982 C CB  . GLU B 1 112 ? -8.699  -19.501 -32.158 1.00 30.04 ? 112 GLU B CB  1 
ATOM   1983 C CG  . GLU B 1 112 ? -7.946  -20.455 -33.070 1.00 30.59 ? 112 GLU B CG  1 
ATOM   1984 C CD  . GLU B 1 112 ? -6.968  -19.763 -34.001 1.00 31.20 ? 112 GLU B CD  1 
ATOM   1985 O OE1 . GLU B 1 112 ? -6.813  -18.526 -33.926 1.00 30.96 ? 112 GLU B OE1 1 
ATOM   1986 O OE2 . GLU B 1 112 ? -6.356  -20.475 -34.824 1.00 32.98 ? 112 GLU B OE2 1 
ATOM   1987 N N   . LEU B 1 113 ? -9.228  -22.555 -30.896 1.00 31.92 ? 113 LEU B N   1 
ATOM   1988 C CA  . LEU B 1 113 ? -8.510  -23.693 -30.332 1.00 33.10 ? 113 LEU B CA  1 
ATOM   1989 C C   . LEU B 1 113 ? -7.485  -24.158 -31.358 1.00 34.39 ? 113 LEU B C   1 
ATOM   1990 O O   . LEU B 1 113 ? -7.861  -24.758 -32.353 1.00 34.17 ? 113 LEU B O   1 
ATOM   1991 C CB  . LEU B 1 113 ? -9.489  -24.837 -30.037 1.00 33.74 ? 113 LEU B CB  1 
ATOM   1992 C CG  . LEU B 1 113 ? -9.173  -25.789 -28.875 1.00 34.09 ? 113 LEU B CG  1 
ATOM   1993 C CD1 . LEU B 1 113 ? -9.498  -27.209 -29.272 1.00 34.50 ? 113 LEU B CD1 1 
ATOM   1994 C CD2 . LEU B 1 113 ? -7.723  -25.692 -28.434 1.00 34.10 ? 113 LEU B CD2 1 
ATOM   1995 N N   . THR B 1 114 ? -6.201  -23.874 -31.145 1.00 35.85 ? 114 THR B N   1 
ATOM   1996 C CA  . THR B 1 114 ? -5.193  -24.231 -32.153 1.00 38.03 ? 114 THR B CA  1 
ATOM   1997 C C   . THR B 1 114 ? -4.925  -25.736 -32.226 1.00 39.41 ? 114 THR B C   1 
ATOM   1998 O O   . THR B 1 114 ? -5.564  -26.536 -31.531 1.00 39.67 ? 114 THR B O   1 
ATOM   1999 C CB  . THR B 1 114 ? -3.858  -23.458 -31.969 1.00 38.02 ? 114 THR B CB  1 
ATOM   2000 O OG1 . THR B 1 114 ? -3.042  -24.111 -30.991 1.00 39.07 ? 114 THR B OG1 1 
ATOM   2001 C CG2 . THR B 1 114 ? -4.112  -22.025 -31.544 1.00 37.78 ? 114 THR B CG2 1 
ATOM   2002 N N   . ASN B 1 115 ? -3.988  -26.122 -33.085 1.00 41.12 ? 115 ASN B N   1 
ATOM   2003 C CA  . ASN B 1 115 ? -3.608  -27.523 -33.210 1.00 42.07 ? 115 ASN B CA  1 
ATOM   2004 C C   . ASN B 1 115 ? -2.691  -27.967 -32.070 1.00 42.52 ? 115 ASN B C   1 
ATOM   2005 O O   . ASN B 1 115 ? -2.640  -29.146 -31.731 1.00 43.67 ? 115 ASN B O   1 
ATOM   2006 C CB  . ASN B 1 115 ? -2.936  -27.788 -34.554 1.00 42.77 ? 115 ASN B CB  1 
ATOM   2007 C CG  . ASN B 1 115 ? -3.314  -29.137 -35.133 0.70 43.09 ? 115 ASN B CG  1 
ATOM   2008 O OD1 . ASN B 1 115 ? -2.452  -29.965 -35.435 0.60 43.12 ? 115 ASN B OD1 1 
ATOM   2009 N ND2 . ASN B 1 115 ? -4.616  -29.369 -35.282 0.60 42.98 ? 115 ASN B ND2 1 
ATOM   2010 N N   . ASP B 1 116 ? -1.964  -27.014 -31.494 1.00 42.23 ? 116 ASP B N   1 
ATOM   2011 C CA  . ASP B 1 116 ? -1.131  -27.271 -30.327 1.00 41.76 ? 116 ASP B CA  1 
ATOM   2012 C C   . ASP B 1 116 ? -2.000  -27.440 -29.088 1.00 40.46 ? 116 ASP B C   1 
ATOM   2013 O O   . ASP B 1 116 ? -1.493  -27.649 -27.986 1.00 40.51 ? 116 ASP B O   1 
ATOM   2014 C CB  . ASP B 1 116 ? -0.151  -26.116 -30.102 1.00 43.01 ? 116 ASP B CB  1 
ATOM   2015 C CG  . ASP B 1 116 ? 0.803   -25.916 -31.265 1.00 43.88 ? 116 ASP B CG  1 
ATOM   2016 O OD1 . ASP B 1 116 ? 0.743   -26.707 -32.235 1.00 44.69 ? 116 ASP B OD1 1 
ATOM   2017 O OD2 . ASP B 1 116 ? 1.615   -24.962 -31.206 1.00 44.28 ? 116 ASP B OD2 1 
ATOM   2018 N N   . GLY B 1 117 ? -3.311  -27.338 -29.270 1.00 39.32 ? 117 GLY B N   1 
ATOM   2019 C CA  . GLY B 1 117 ? -4.253  -27.472 -28.159 1.00 37.56 ? 117 GLY B CA  1 
ATOM   2020 C C   . GLY B 1 117 ? -4.311  -26.250 -27.256 1.00 36.52 ? 117 GLY B C   1 
ATOM   2021 O O   . GLY B 1 117 ? -4.568  -26.369 -26.055 1.00 36.99 ? 117 GLY B O   1 
ATOM   2022 N N   . GLU B 1 118 ? -4.079  -25.074 -27.831 1.00 35.11 ? 118 GLU B N   1 
ATOM   2023 C CA  . GLU B 1 118 ? -4.111  -23.828 -27.070 1.00 34.29 ? 118 GLU B CA  1 
ATOM   2024 C C   . GLU B 1 118 ? -5.380  -23.065 -27.384 1.00 32.27 ? 118 GLU B C   1 
ATOM   2025 O O   . GLU B 1 118 ? -5.826  -23.039 -28.528 1.00 32.50 ? 118 GLU B O   1 
ATOM   2026 C CB  . GLU B 1 118 ? -2.906  -22.950 -27.409 1.00 34.81 ? 118 GLU B CB  1 
ATOM   2027 C CG  . GLU B 1 118 ? -1.583  -23.471 -26.895 1.00 35.50 ? 118 GLU B CG  1 
ATOM   2028 C CD  . GLU B 1 118 ? -0.450  -22.479 -27.097 1.00 36.06 ? 118 GLU B CD  1 
ATOM   2029 O OE1 . GLU B 1 118 ? -0.530  -21.654 -28.034 1.00 36.78 ? 118 GLU B OE1 1 
ATOM   2030 O OE2 . GLU B 1 118 ? 0.529   -22.532 -26.317 1.00 37.25 ? 118 GLU B OE2 1 
ATOM   2031 N N   . LEU B 1 119 ? -5.957  -22.431 -26.375 1.00 29.11 ? 119 LEU B N   1 
ATOM   2032 C CA  . LEU B 1 119 ? -7.154  -21.645 -26.589 1.00 26.85 ? 119 LEU B CA  1 
ATOM   2033 C C   . LEU B 1 119 ? -6.763  -20.174 -26.608 1.00 25.49 ? 119 LEU B C   1 
ATOM   2034 O O   . LEU B 1 119 ? -6.287  -19.647 -25.616 1.00 24.99 ? 119 LEU B O   1 
ATOM   2035 C CB  . LEU B 1 119 ? -8.184  -21.922 -25.491 1.00 26.97 ? 119 LEU B CB  1 
ATOM   2036 C CG  . LEU B 1 119 ? -9.546  -21.220 -25.546 1.00 26.33 ? 119 LEU B CG  1 
ATOM   2037 C CD1 . LEU B 1 119 ? -10.452 -21.796 -26.627 1.00 26.77 ? 119 LEU B CD1 1 
ATOM   2038 C CD2 . LEU B 1 119 ? -10.241 -21.299 -24.193 1.00 26.48 ? 119 LEU B CD2 1 
ATOM   2039 N N   . ILE B 1 120 ? -6.939  -19.529 -27.752 1.00 24.69 ? 120 ILE B N   1 
ATOM   2040 C CA  . ILE B 1 120 ? -6.692  -18.101 -27.875 1.00 24.67 ? 120 ILE B CA  1 
ATOM   2041 C C   . ILE B 1 120 ? -8.001  -17.339 -27.749 1.00 25.11 ? 120 ILE B C   1 
ATOM   2042 O O   . ILE B 1 120 ? -8.937  -17.550 -28.524 1.00 24.74 ? 120 ILE B O   1 
ATOM   2043 C CB  . ILE B 1 120 ? -6.044  -17.751 -29.225 1.00 25.32 ? 120 ILE B CB  1 
ATOM   2044 C CG1 . ILE B 1 120 ? -4.873  -18.697 -29.518 1.00 25.07 ? 120 ILE B CG1 1 
ATOM   2045 C CG2 . ILE B 1 120 ? -5.622  -16.295 -29.236 1.00 24.42 ? 120 ILE B CG2 1 
ATOM   2046 C CD1 . ILE B 1 120 ? -4.242  -18.503 -30.901 1.00 25.83 ? 120 ILE B CD1 1 
ATOM   2047 N N   . ASP B 1 121 ? -8.057  -16.453 -26.762 1.00 25.59 ? 121 ASP B N   1 
ATOM   2048 C CA  . ASP B 1 121 ? -9.242  -15.666 -26.456 1.00 26.35 ? 121 ASP B CA  1 
ATOM   2049 C C   . ASP B 1 121 ? -8.890  -14.212 -26.723 1.00 26.70 ? 121 ASP B C   1 
ATOM   2050 O O   . ASP B 1 121 ? -8.013  -13.663 -26.057 1.00 26.70 ? 121 ASP B O   1 
ATOM   2051 C CB  . ASP B 1 121 ? -9.595  -15.870 -24.978 1.00 27.95 ? 121 ASP B CB  1 
ATOM   2052 C CG  . ASP B 1 121 ? -10.674 -14.916 -24.475 1.00 29.93 ? 121 ASP B CG  1 
ATOM   2053 O OD1 . ASP B 1 121 ? -10.762 -13.764 -24.955 1.00 30.28 ? 121 ASP B OD1 1 
ATOM   2054 O OD2 . ASP B 1 121 ? -11.425 -15.317 -23.559 1.00 31.09 ? 121 ASP B OD2 1 
ATOM   2055 N N   . THR B 1 122 ? -9.512  -13.596 -27.730 1.00 26.34 ? 122 THR B N   1 
ATOM   2056 C CA  . THR B 1 122 ? -9.237  -12.191 -28.015 1.00 25.94 ? 122 THR B CA  1 
ATOM   2057 C C   . THR B 1 122 ? -10.491 -11.347 -27.834 1.00 26.59 ? 122 THR B C   1 
ATOM   2058 O O   . THR B 1 122 ? -11.607 -11.801 -28.108 1.00 25.20 ? 122 THR B O   1 
ATOM   2059 C CB  . THR B 1 122 ? -8.694  -11.951 -29.429 1.00 26.41 ? 122 THR B CB  1 
ATOM   2060 O OG1 . THR B 1 122 ? -9.766  -12.047 -30.369 1.00 26.78 ? 122 THR B OG1 1 
ATOM   2061 C CG2 . THR B 1 122 ? -7.585  -12.935 -29.784 1.00 25.56 ? 122 THR B CG2 1 
ATOM   2062 N N   . MET B 1 123 ? -10.295 -10.129 -27.349 1.00 27.55 ? 123 MET B N   1 
ATOM   2063 C CA  . MET B 1 123 ? -11.372 -9.153  -27.194 1.00 29.37 ? 123 MET B CA  1 
ATOM   2064 C C   . MET B 1 123 ? -10.872 -7.857  -27.814 1.00 29.10 ? 123 MET B C   1 
ATOM   2065 O O   . MET B 1 123 ? -9.770  -7.408  -27.510 1.00 27.90 ? 123 MET B O   1 
ATOM   2066 C CB  . MET B 1 123 ? -11.696 -8.919  -25.718 1.00 30.26 ? 123 MET B CB  1 
ATOM   2067 C CG  . MET B 1 123 ? -12.451 -10.050 -25.027 1.00 31.74 ? 123 MET B CG  1 
ATOM   2068 S SD  . MET B 1 123 ? -12.654 -9.753  -23.256 1.00 33.92 ? 123 MET B SD  1 
ATOM   2069 C CE  . MET B 1 123 ? -10.936 -9.652  -22.747 1.00 32.62 ? 123 MET B CE  1 
ATOM   2070 N N   . THR B 1 124 ? -11.687 -7.271  -28.685 1.00 29.78 ? 124 THR B N   1 
ATOM   2071 C CA  . THR B 1 124 ? -11.292 -6.103  -29.461 1.00 30.26 ? 124 THR B CA  1 
ATOM   2072 C C   . THR B 1 124 ? -12.240 -4.937  -29.213 1.00 31.12 ? 124 THR B C   1 
ATOM   2073 O O   . THR B 1 124 ? -13.434 -5.124  -28.991 1.00 30.27 ? 124 THR B O   1 
ATOM   2074 C CB  . THR B 1 124 ? -11.264 -6.436  -30.964 1.00 30.19 ? 124 THR B CB  1 
ATOM   2075 O OG1 . THR B 1 124 ? -10.349 -7.519  -31.193 1.00 29.42 ? 124 THR B OG1 1 
ATOM   2076 C CG2 . THR B 1 124 ? -10.835 -5.229  -31.793 1.00 29.92 ? 124 THR B CG2 1 
ATOM   2077 N N   . ALA B 1 125 ? -11.683 -3.737  -29.218 1.00 32.89 ? 125 ALA B N   1 
ATOM   2078 C CA  . ALA B 1 125 ? -12.463 -2.510  -29.226 1.00 34.88 ? 125 ALA B CA  1 
ATOM   2079 C C   . ALA B 1 125 ? -11.706 -1.569  -30.133 1.00 36.35 ? 125 ALA B C   1 
ATOM   2080 O O   . ALA B 1 125 ? -10.535 -1.250  -29.878 1.00 36.20 ? 125 ALA B O   1 
ATOM   2081 C CB  . ALA B 1 125 ? -12.581 -1.928  -27.837 1.00 34.92 ? 125 ALA B CB  1 
ATOM   2082 N N   . ASP B 1 126 ? -12.361 -1.148  -31.207 1.00 38.32 ? 126 ASP B N   1 
ATOM   2083 C CA  . ASP B 1 126 ? -11.698 -0.343  -32.216 1.00 39.60 ? 126 ASP B CA  1 
ATOM   2084 C C   . ASP B 1 126 ? -10.373 -0.997  -32.582 1.00 39.73 ? 126 ASP B C   1 
ATOM   2085 O O   . ASP B 1 126 ? -10.357 -2.087  -33.152 1.00 40.27 ? 126 ASP B O   1 
ATOM   2086 C CB  . ASP B 1 126 ? -11.475 1.085   -31.712 1.00 40.52 ? 126 ASP B CB  1 
ATOM   2087 C CG  . ASP B 1 126 ? -12.768 1.859   -31.559 1.00 41.05 ? 126 ASP B CG  1 
ATOM   2088 O OD1 . ASP B 1 126 ? -13.825 1.350   -31.984 1.00 41.45 ? 126 ASP B OD1 1 
ATOM   2089 O OD2 . ASP B 1 126 ? -12.721 2.985   -31.019 1.00 41.34 ? 126 ASP B OD2 1 
ATOM   2090 N N   . ASP B 1 127 ? -9.266  -0.348  -32.231 1.00 39.96 ? 127 ASP B N   1 
ATOM   2091 C CA  . ASP B 1 127 ? -7.948  -0.800  -32.678 1.00 40.06 ? 127 ASP B CA  1 
ATOM   2092 C C   . ASP B 1 127 ? -7.120  -1.439  -31.569 1.00 38.87 ? 127 ASP B C   1 
ATOM   2093 O O   . ASP B 1 127 ? -5.906  -1.575  -31.698 1.00 39.10 ? 127 ASP B O   1 
ATOM   2094 C CB  . ASP B 1 127 ? -7.160  0.371   -33.274 1.00 41.51 ? 127 ASP B CB  1 
ATOM   2095 C CG  . ASP B 1 127 ? -6.794  1.414   -32.233 1.00 42.61 ? 127 ASP B CG  1 
ATOM   2096 O OD1 . ASP B 1 127 ? -7.677  1.790   -31.427 1.00 43.12 ? 127 ASP B OD1 1 
ATOM   2097 O OD2 . ASP B 1 127 ? -5.623  1.859   -32.218 1.00 43.47 ? 127 ASP B OD2 1 
ATOM   2098 N N   . VAL B 1 128 ? -7.758  -1.815  -30.470 1.00 36.65 ? 128 VAL B N   1 
ATOM   2099 C CA  . VAL B 1 128 ? -7.018  -2.452  -29.385 1.00 34.84 ? 128 VAL B CA  1 
ATOM   2100 C C   . VAL B 1 128 ? -7.498  -3.878  -29.240 1.00 33.23 ? 128 VAL B C   1 
ATOM   2101 O O   . VAL B 1 128 ? -8.701  -4.118  -29.191 1.00 32.80 ? 128 VAL B O   1 
ATOM   2102 C CB  . VAL B 1 128 ? -7.205  -1.707  -28.054 1.00 34.88 ? 128 VAL B CB  1 
ATOM   2103 C CG1 . VAL B 1 128 ? -6.482  -2.424  -26.929 1.00 35.41 ? 128 VAL B CG1 1 
ATOM   2104 C CG2 . VAL B 1 128 ? -6.698  -0.285  -28.174 1.00 35.65 ? 128 VAL B CG2 1 
ATOM   2105 N N   . VAL B 1 129 ? -6.559  -4.817  -29.187 1.00 31.59 ? 129 VAL B N   1 
ATOM   2106 C CA  . VAL B 1 129 ? -6.889  -6.219  -28.998 1.00 29.62 ? 129 VAL B CA  1 
ATOM   2107 C C   . VAL B 1 129 ? -6.302  -6.747  -27.688 1.00 28.84 ? 129 VAL B C   1 
ATOM   2108 O O   . VAL B 1 129 ? -5.090  -6.677  -27.469 1.00 29.00 ? 129 VAL B O   1 
ATOM   2109 C CB  . VAL B 1 129 ? -6.366  -7.080  -30.152 1.00 29.68 ? 129 VAL B CB  1 
ATOM   2110 C CG1 . VAL B 1 129 ? -6.802  -8.531  -29.973 1.00 29.07 ? 129 VAL B CG1 1 
ATOM   2111 C CG2 . VAL B 1 129 ? -6.844  -6.538  -31.489 1.00 30.02 ? 129 VAL B CG2 1 
ATOM   2112 N N   . CYS B 1 130 ? -7.166  -7.252  -26.812 1.00 27.37 ? 130 CYS B N   1 
ATOM   2113 C CA  . CYS B 1 130 ? -6.730  -7.990  -25.631 1.00 26.76 ? 130 CYS B CA  1 
ATOM   2114 C C   . CYS B 1 130 ? -6.639  -9.482  -25.955 1.00 26.84 ? 130 CYS B C   1 
ATOM   2115 O O   . CYS B 1 130 ? -7.635  -10.092 -26.337 1.00 27.25 ? 130 CYS B O   1 
ATOM   2116 C CB  . CYS B 1 130 ? -7.707  -7.790  -24.476 1.00 26.26 ? 130 CYS B CB  1 
ATOM   2117 S SG  . CYS B 1 130 ? -7.337  -8.849  -23.062 1.00 27.17 ? 130 CYS B SG  1 
ATOM   2118 N N   . THR B 1 131 ? -5.451  -10.068 -25.829 1.00 27.01 ? 131 THR B N   1 
ATOM   2119 C CA  . THR B 1 131 ? -5.273  -11.496 -26.127 1.00 26.14 ? 131 THR B CA  1 
ATOM   2120 C C   . THR B 1 131 ? -4.902  -12.310 -24.883 1.00 25.54 ? 131 THR B C   1 
ATOM   2121 O O   . THR B 1 131 ? -3.897  -12.039 -24.236 1.00 25.35 ? 131 THR B O   1 
ATOM   2122 C CB  . THR B 1 131 ? -4.201  -11.733 -27.216 1.00 26.51 ? 131 THR B CB  1 
ATOM   2123 O OG1 . THR B 1 131 ? -4.529  -10.984 -28.391 1.00 25.99 ? 131 THR B OG1 1 
ATOM   2124 C CG2 . THR B 1 131 ? -4.112  -13.218 -27.579 1.00 26.88 ? 131 THR B CG2 1 
ATOM   2125 N N   . LYS B 1 132 ? -5.724  -13.306 -24.567 1.00 25.15 ? 132 LYS B N   1 
ATOM   2126 C CA  . LYS B 1 132 ? -5.416  -14.284 -23.527 1.00 25.20 ? 132 LYS B CA  1 
ATOM   2127 C C   . LYS B 1 132 ? -5.214  -15.661 -24.168 1.00 25.49 ? 132 LYS B C   1 
ATOM   2128 O O   . LYS B 1 132 ? -5.912  -16.011 -25.137 1.00 25.15 ? 132 LYS B O   1 
ATOM   2129 C CB  . LYS B 1 132 ? -6.540  -14.340 -22.493 1.00 26.01 ? 132 LYS B CB  1 
ATOM   2130 C CG  . LYS B 1 132 ? -7.046  -12.962 -22.068 1.00 26.69 ? 132 LYS B CG  1 
ATOM   2131 C CD  . LYS B 1 132 ? -7.830  -12.995 -20.755 1.00 27.77 ? 132 LYS B CD  1 
ATOM   2132 C CE  . LYS B 1 132 ? -8.837  -11.860 -20.747 1.00 28.97 ? 132 LYS B CE  1 
ATOM   2133 N NZ  . LYS B 1 132 ? -8.903  -11.120 -19.452 1.00 29.64 ? 132 LYS B NZ  1 
ATOM   2134 N N   . VAL B 1 133 ? -4.244  -16.416 -23.653 1.00 24.02 ? 133 VAL B N   1 
ATOM   2135 C CA  . VAL B 1 133 ? -3.998  -17.781 -24.125 1.00 24.20 ? 133 VAL B CA  1 
ATOM   2136 C C   . VAL B 1 133 ? -4.078  -18.773 -22.964 1.00 23.85 ? 133 VAL B C   1 
ATOM   2137 O O   . VAL B 1 133 ? -3.429  -18.582 -21.928 1.00 24.12 ? 133 VAL B O   1 
ATOM   2138 C CB  . VAL B 1 133 ? -2.645  -17.923 -24.839 1.00 24.22 ? 133 VAL B CB  1 
ATOM   2139 C CG1 . VAL B 1 133 ? -2.466  -19.345 -25.332 1.00 24.72 ? 133 VAL B CG1 1 
ATOM   2140 C CG2 . VAL B 1 133 ? -2.540  -16.945 -26.015 1.00 24.57 ? 133 VAL B CG2 1 
ATOM   2141 N N   . PHE B 1 134 ? -4.878  -19.823 -23.154 1.00 23.87 ? 134 PHE B N   1 
ATOM   2142 C CA  . PHE B 1 134 ? -5.103  -20.861 -22.148 1.00 23.02 ? 134 PHE B CA  1 
ATOM   2143 C C   . PHE B 1 134 ? -4.606  -22.211 -22.649 1.00 23.74 ? 134 PHE B C   1 
ATOM   2144 O O   . PHE B 1 134 ? -4.480  -22.428 -23.854 1.00 23.05 ? 134 PHE B O   1 
ATOM   2145 C CB  . PHE B 1 134 ? -6.605  -20.982 -21.848 1.00 22.12 ? 134 PHE B CB  1 
ATOM   2146 C CG  . PHE B 1 134 ? -7.233  -19.702 -21.362 1.00 21.56 ? 134 PHE B CG  1 
ATOM   2147 C CD1 . PHE B 1 134 ? -7.565  -18.693 -22.254 1.00 21.32 ? 134 PHE B CD1 1 
ATOM   2148 C CD2 . PHE B 1 134 ? -7.491  -19.512 -20.014 1.00 21.05 ? 134 PHE B CD2 1 
ATOM   2149 C CE1 . PHE B 1 134 ? -8.133  -17.504 -21.815 1.00 21.88 ? 134 PHE B CE1 1 
ATOM   2150 C CE2 . PHE B 1 134 ? -8.070  -18.326 -19.564 1.00 21.61 ? 134 PHE B CE2 1 
ATOM   2151 C CZ  . PHE B 1 134 ? -8.378  -17.316 -20.467 1.00 21.87 ? 134 PHE B CZ  1 
ATOM   2152 N N   . VAL B 1 135 ? -4.335  -23.120 -21.723 1.00 25.44 ? 135 VAL B N   1 
ATOM   2153 C CA  . VAL B 1 135 ? -4.127  -24.522 -22.069 1.00 27.50 ? 135 VAL B CA  1 
ATOM   2154 C C   . VAL B 1 135 ? -5.053  -25.378 -21.221 1.00 29.37 ? 135 VAL B C   1 
ATOM   2155 O O   . VAL B 1 135 ? -5.481  -24.953 -20.141 1.00 28.34 ? 135 VAL B O   1 
ATOM   2156 C CB  . VAL B 1 135 ? -2.668  -24.982 -21.850 1.00 28.47 ? 135 VAL B CB  1 
ATOM   2157 C CG1 . VAL B 1 135 ? -1.744  -24.344 -22.878 1.00 29.08 ? 135 VAL B CG1 1 
ATOM   2158 C CG2 . VAL B 1 135 ? -2.202  -24.682 -20.422 1.00 29.26 ? 135 VAL B CG2 1 
ATOM   2159 N N   . ARG B 1 136 ? -5.372  -26.578 -21.707 1.00 30.02 ? 136 ARG B N   1 
ATOM   2160 C CA  . ARG B 1 136 ? -6.239  -27.470 -20.961 1.00 31.58 ? 136 ARG B CA  1 
ATOM   2161 C C   . ARG B 1 136 ? -5.538  -27.945 -19.719 1.00 31.51 ? 136 ARG B C   1 
ATOM   2162 O O   . ARG B 1 136 ? -4.406  -28.421 -19.780 1.00 31.81 ? 136 ARG B O   1 
ATOM   2163 C CB  . ARG B 1 136 ? -6.648  -28.683 -21.792 1.00 32.65 ? 136 ARG B CB  1 
ATOM   2164 C CG  . ARG B 1 136 ? -8.093  -28.663 -22.224 1.00 33.78 ? 136 ARG B CG  1 
ATOM   2165 C CD  . ARG B 1 136 ? -8.531  -30.047 -22.653 1.00 34.42 ? 136 ARG B CD  1 
ATOM   2166 N NE  . ARG B 1 136 ? -9.650  -29.975 -23.584 1.00 35.17 ? 136 ARG B NE  1 
ATOM   2167 C CZ  . ARG B 1 136 ? -9.510  -30.003 -24.899 1.00 35.23 ? 136 ARG B CZ  1 
ATOM   2168 N NH1 . ARG B 1 136 ? -8.304  -30.117 -25.437 1.00 35.82 ? 136 ARG B NH1 1 
ATOM   2169 N NH2 . ARG B 1 136 ? -10.572 -29.930 -25.669 1.00 35.87 ? 136 ARG B NH2 1 
ATOM   2170 N N   . GLU B 1 137 ? -6.215  -27.816 -18.589 1.00 31.96 ? 137 GLU B N   1 
ATOM   2171 C CA  . GLU B 1 137 ? -5.695  -28.367 -17.360 1.00 32.11 ? 137 GLU B CA  1 
ATOM   2172 C C   . GLU B 1 137 ? -5.810  -29.881 -17.397 1.00 31.93 ? 137 GLU B C   1 
ATOM   2173 O O   . GLU B 1 137 ? -4.832  -30.586 -17.162 1.00 31.98 ? 137 GLU B O   1 
ATOM   2174 C CB  . GLU B 1 137 ? -6.444  -27.812 -16.155 1.00 33.82 ? 137 GLU B CB  1 
ATOM   2175 C CG  . GLU B 1 137 ? -5.780  -28.178 -14.842 1.00 35.00 ? 137 GLU B CG  1 
ATOM   2176 C CD  . GLU B 1 137 ? -6.382  -27.461 -13.665 1.00 35.45 ? 137 GLU B CD  1 
ATOM   2177 O OE1 . GLU B 1 137 ? -7.626  -27.509 -13.500 1.00 36.32 ? 137 GLU B OE1 1 
ATOM   2178 O OE2 . GLU B 1 137 ? -5.600  -26.867 -12.894 1.00 35.76 ? 137 GLU B OE2 1 
ATOM   2179 O OXT . GLU B 1 137 ? -6.882  -30.428 -17.663 1.00 31.51 ? 137 GLU B OXT 1 
HETATM 2180 C C   . ACT C 2 .   ? -6.175  -10.907 -16.735 1.00 48.16 ? 138 ACT B C   1 
HETATM 2181 O O   . ACT C 2 .   ? -5.869  -12.000 -16.205 1.00 48.31 ? 138 ACT B O   1 
HETATM 2182 O OXT . ACT C 2 .   ? -6.490  -10.950 -17.945 1.00 47.99 ? 138 ACT B OXT 1 
HETATM 2183 C CH3 . ACT C 2 .   ? -6.165  -9.621  -15.967 1.00 47.86 ? 138 ACT B CH3 1 
HETATM 2184 O O   . HOH D 3 .   ? -9.763  12.514  -2.164  1.00 23.26 ? 138 HOH A O   1 
HETATM 2185 O O   A HOH D 3 .   ? 12.519  6.359   -9.445  0.50 10.66 ? 139 HOH A O   1 
HETATM 2186 O O   B HOH D 3 .   ? 14.403  5.733   -8.436  0.50 30.80 ? 139 HOH A O   1 
HETATM 2187 O O   A HOH D 3 .   ? 18.260  -3.108  4.087   0.50 18.75 ? 140 HOH A O   1 
HETATM 2188 O O   B HOH D 3 .   ? 17.801  -1.505  4.745   0.50 32.18 ? 140 HOH A O   1 
HETATM 2189 O O   . HOH D 3 .   ? -15.620 -5.510  13.449  1.00 39.98 ? 141 HOH A O   1 
HETATM 2190 O O   A HOH D 3 .   ? 14.230  4.506   1.980   0.50 3.74  ? 142 HOH A O   1 
HETATM 2191 O O   B HOH D 3 .   ? 15.378  5.661   2.876   0.50 16.98 ? 142 HOH A O   1 
HETATM 2192 O O   . HOH D 3 .   ? 20.582  -1.073  1.308   1.00 31.42 ? 143 HOH A O   1 
HETATM 2193 O O   . HOH D 3 .   ? -6.505  14.748  4.332   1.00 24.62 ? 144 HOH A O   1 
HETATM 2194 O O   . HOH D 3 .   ? -1.653  1.865   -7.358  1.00 21.80 ? 145 HOH A O   1 
HETATM 2195 O O   . HOH D 3 .   ? 16.001  3.129   5.136   1.00 37.15 ? 146 HOH A O   1 
HETATM 2196 O O   . HOH D 3 .   ? 12.860  -7.874  -7.091  1.00 46.55 ? 147 HOH A O   1 
HETATM 2197 O O   . HOH D 3 .   ? 19.300  1.376   2.572   1.00 26.35 ? 148 HOH A O   1 
HETATM 2198 O O   . HOH D 3 .   ? 4.541   -10.499 -9.824  1.00 40.30 ? 149 HOH A O   1 
HETATM 2199 O O   . HOH D 3 .   ? 10.185  2.411   8.057   1.00 37.03 ? 150 HOH A O   1 
HETATM 2200 O O   . HOH D 3 .   ? -4.713  -12.240 14.967  1.00 42.97 ? 151 HOH A O   1 
HETATM 2201 O O   . HOH D 3 .   ? -1.994  14.156  -9.563  1.00 50.34 ? 152 HOH A O   1 
HETATM 2202 O O   . HOH D 3 .   ? -1.623  -10.676 13.103  1.00 50.16 ? 153 HOH A O   1 
HETATM 2203 O O   . HOH D 3 .   ? -1.072  -11.599 8.330   1.00 52.11 ? 154 HOH A O   1 
HETATM 2204 O O   . HOH D 3 .   ? -1.594  -8.346  11.653  1.00 53.93 ? 155 HOH A O   1 
HETATM 2205 O O   . HOH D 3 .   ? -5.219  -19.998 3.185   1.00 27.92 ? 156 HOH A O   1 
HETATM 2206 O O   . HOH D 3 .   ? 6.725   4.452   16.483  1.00 58.44 ? 157 HOH A O   1 
HETATM 2207 O O   . HOH D 3 .   ? 2.944   -4.563  -8.527  1.00 27.05 ? 158 HOH A O   1 
HETATM 2208 O O   . HOH D 3 .   ? 20.443  9.174   3.924   1.00 37.21 ? 159 HOH A O   1 
HETATM 2209 O O   . HOH D 3 .   ? 18.490  9.534   -2.919  1.00 36.13 ? 160 HOH A O   1 
HETATM 2210 O O   . HOH D 3 .   ? 12.529  3.176   -1.700  1.00 19.31 ? 161 HOH A O   1 
HETATM 2211 O O   . HOH D 3 .   ? 7.234   -12.974 0.006   1.00 37.35 ? 162 HOH A O   1 
HETATM 2212 O O   . HOH D 3 .   ? 2.193   2.179   6.616   1.00 26.15 ? 163 HOH A O   1 
HETATM 2213 O O   . HOH D 3 .   ? 2.118   0.692   3.284   1.00 33.22 ? 164 HOH A O   1 
HETATM 2214 O O   . HOH D 3 .   ? -0.709  2.275   2.189   1.00 40.13 ? 165 HOH A O   1 
HETATM 2215 O O   A HOH D 3 .   ? 0.814   -1.112  0.633   0.50 22.21 ? 166 HOH A O   1 
HETATM 2216 O O   B HOH D 3 .   ? 0.841   1.613   0.423   0.50 21.09 ? 166 HOH A O   1 
HETATM 2217 O O   . HOH D 3 .   ? 9.071   -7.836  -6.719  1.00 32.10 ? 167 HOH A O   1 
HETATM 2218 O O   . HOH D 3 .   ? 10.882  -6.127  8.955   1.00 36.10 ? 168 HOH A O   1 
HETATM 2219 O O   . HOH D 3 .   ? -9.413  -3.661  3.429   1.00 43.21 ? 169 HOH A O   1 
HETATM 2220 O O   . HOH D 3 .   ? -5.730  -4.632  12.301  1.00 37.02 ? 170 HOH A O   1 
HETATM 2221 O O   . HOH D 3 .   ? 3.266   -5.078  1.911   1.00 33.86 ? 171 HOH A O   1 
HETATM 2222 O O   . HOH D 3 .   ? 3.853   2.350   -18.210 1.00 45.60 ? 172 HOH A O   1 
HETATM 2223 O O   . HOH D 3 .   ? -1.017  14.295  7.709   1.00 46.84 ? 173 HOH A O   1 
HETATM 2224 O O   A HOH D 3 .   ? -1.435  0.866   3.786   0.50 18.26 ? 174 HOH A O   1 
HETATM 2225 O O   B HOH D 3 .   ? -3.075  0.109   2.547   0.50 23.96 ? 174 HOH A O   1 
HETATM 2226 O O   . HOH D 3 .   ? -16.372 3.273   -6.297  1.00 33.90 ? 175 HOH A O   1 
HETATM 2227 O O   A HOH D 3 .   ? -11.801 -9.458  -0.146  0.50 12.60 ? 176 HOH A O   1 
HETATM 2228 O O   B HOH D 3 .   ? -11.569 -7.281  -0.652  0.50 19.74 ? 176 HOH A O   1 
HETATM 2229 O O   . HOH D 3 .   ? 0.895   -4.480  -7.121  1.00 29.52 ? 177 HOH A O   1 
HETATM 2230 O O   . HOH D 3 .   ? 9.777   2.647   -14.556 1.00 48.19 ? 178 HOH A O   1 
HETATM 2231 O O   . HOH D 3 .   ? -12.741 -15.131 12.508  1.00 46.84 ? 179 HOH A O   1 
HETATM 2232 O O   . HOH D 3 .   ? -14.191 4.803   4.950   1.00 34.22 ? 180 HOH A O   1 
HETATM 2233 O O   . HOH D 3 .   ? -15.191 8.590   14.352  1.00 41.82 ? 181 HOH A O   1 
HETATM 2234 O O   . HOH D 3 .   ? 18.705  -17.579 9.661   1.00 48.69 ? 182 HOH A O   1 
HETATM 2235 O O   . HOH D 3 .   ? -2.064  -10.325 19.022  1.00 54.44 ? 183 HOH A O   1 
HETATM 2236 O O   . HOH D 3 .   ? -8.874  -17.148 -3.314  1.00 36.95 ? 184 HOH A O   1 
HETATM 2237 O O   . HOH D 3 .   ? 0.944   6.717   -14.101 1.00 32.39 ? 185 HOH A O   1 
HETATM 2238 O O   . HOH D 3 .   ? 16.001  -14.071 0.340   1.00 45.81 ? 186 HOH A O   1 
HETATM 2239 O O   . HOH D 3 .   ? 11.548  -16.495 -3.662  1.00 46.00 ? 187 HOH A O   1 
HETATM 2240 O O   . HOH D 3 .   ? 14.170  0.428   6.963   1.00 40.66 ? 188 HOH A O   1 
HETATM 2241 O O   . HOH D 3 .   ? -7.854  -21.959 7.398   1.00 32.03 ? 189 HOH A O   1 
HETATM 2242 O O   . HOH D 3 .   ? 18.966  8.788   -5.034  1.00 51.76 ? 190 HOH A O   1 
HETATM 2243 O O   . HOH D 3 .   ? 18.655  -7.926  6.508   1.00 55.05 ? 191 HOH A O   1 
HETATM 2244 O O   . HOH D 3 .   ? 1.811   -9.001  11.652  1.00 44.52 ? 192 HOH A O   1 
HETATM 2245 O O   . HOH D 3 .   ? -3.798  5.501   15.557  1.00 35.43 ? 193 HOH A O   1 
HETATM 2246 O O   . HOH D 3 .   ? -14.602 -3.413  -4.865  1.00 40.72 ? 194 HOH A O   1 
HETATM 2247 O O   . HOH D 3 .   ? 11.722  -12.840 5.595   1.00 30.64 ? 195 HOH A O   1 
HETATM 2248 O O   . HOH D 3 .   ? -1.578  -1.923  10.082  1.00 42.81 ? 196 HOH A O   1 
HETATM 2249 O O   . HOH D 3 .   ? -12.168 -16.093 0.391   1.00 47.33 ? 197 HOH A O   1 
HETATM 2250 O O   . HOH D 3 .   ? 5.866   -14.725 -9.900  1.00 47.23 ? 198 HOH A O   1 
HETATM 2251 O O   . HOH D 3 .   ? 16.682  -9.145  1.063   1.00 44.39 ? 199 HOH A O   1 
HETATM 2252 O O   . HOH D 3 .   ? 2.151   19.291  1.179   1.00 35.99 ? 200 HOH A O   1 
HETATM 2253 O O   . HOH D 3 .   ? -11.009 -4.799  6.880   1.00 34.00 ? 201 HOH A O   1 
HETATM 2254 O O   . HOH D 3 .   ? -8.251  15.236  -2.429  1.00 31.58 ? 202 HOH A O   1 
HETATM 2255 O O   . HOH D 3 .   ? 10.929  -9.012  -6.916  1.00 36.88 ? 203 HOH A O   1 
HETATM 2256 O O   . HOH D 3 .   ? 4.887   -8.952  -8.040  1.00 28.63 ? 204 HOH A O   1 
HETATM 2257 O O   . HOH D 3 .   ? 9.870   13.942  -6.792  1.00 43.30 ? 205 HOH A O   1 
HETATM 2258 O O   . HOH D 3 .   ? -2.904  16.115  -3.933  1.00 39.48 ? 206 HOH A O   1 
HETATM 2259 O O   . HOH D 3 .   ? 7.358   14.057  -7.241  1.00 45.23 ? 207 HOH A O   1 
HETATM 2260 O O   . HOH D 3 .   ? 15.358  13.645  -4.011  1.00 46.00 ? 208 HOH A O   1 
HETATM 2261 O O   . HOH D 3 .   ? 20.313  11.674  5.310   1.00 53.34 ? 209 HOH A O   1 
HETATM 2262 O O   . HOH D 3 .   ? 5.938   12.725  11.635  1.00 46.97 ? 210 HOH A O   1 
HETATM 2263 O O   . HOH D 3 .   ? 13.887  8.413   5.402   1.00 51.13 ? 211 HOH A O   1 
HETATM 2264 O O   . HOH D 3 .   ? 13.001  9.507   9.308   1.00 48.90 ? 212 HOH A O   1 
HETATM 2265 O O   . HOH D 3 .   ? 9.515   12.661  6.589   1.00 36.84 ? 213 HOH A O   1 
HETATM 2266 O O   . HOH D 3 .   ? 3.420   -7.996  0.081   1.00 35.22 ? 214 HOH A O   1 
HETATM 2267 O O   . HOH D 3 .   ? 1.694   -6.847  -1.813  1.00 38.79 ? 215 HOH A O   1 
HETATM 2268 O O   . HOH D 3 .   ? 11.758  -12.754 -2.376  1.00 41.23 ? 216 HOH A O   1 
HETATM 2269 O O   . HOH D 3 .   ? 9.122   -10.624 -3.656  1.00 31.00 ? 217 HOH A O   1 
HETATM 2270 O O   . HOH D 3 .   ? -2.546  -16.823 -13.203 1.00 50.28 ? 218 HOH A O   1 
HETATM 2271 O O   . HOH D 3 .   ? 2.070   -17.946 -11.523 1.00 41.94 ? 219 HOH A O   1 
HETATM 2272 O O   . HOH D 3 .   ? -8.809  -19.775 -3.978  1.00 46.67 ? 220 HOH A O   1 
HETATM 2273 O O   . HOH D 3 .   ? -2.065  -4.738  3.709   1.00 43.49 ? 221 HOH A O   1 
HETATM 2274 O O   . HOH D 3 .   ? -13.259 -8.781  -3.443  1.00 30.35 ? 222 HOH A O   1 
HETATM 2275 O O   . HOH D 3 .   ? -10.368 4.005   6.182   1.00 26.97 ? 223 HOH A O   1 
HETATM 2276 O O   . HOH D 3 .   ? -12.261 4.367   7.943   1.00 45.73 ? 224 HOH A O   1 
HETATM 2277 O O   . HOH D 3 .   ? -2.092  7.233   16.253  1.00 56.95 ? 225 HOH A O   1 
HETATM 2278 O O   . HOH D 3 .   ? -1.774  6.455   -12.514 1.00 35.93 ? 226 HOH A O   1 
HETATM 2279 O O   . HOH D 3 .   ? -1.070  -0.028  -11.076 1.00 25.84 ? 227 HOH A O   1 
HETATM 2280 O O   . HOH D 3 .   ? 11.609  4.241   -12.718 1.00 50.21 ? 228 HOH A O   1 
HETATM 2281 O O   . HOH D 3 .   ? 16.297  -4.397  -4.337  1.00 28.67 ? 229 HOH A O   1 
HETATM 2282 O O   . HOH D 3 .   ? -14.782 -10.679 9.077   1.00 35.18 ? 230 HOH A O   1 
HETATM 2283 O O   . HOH E 3 .   ? -7.481  -16.299 -32.720 1.00 25.62 ? 139 HOH B O   1 
HETATM 2284 O O   . HOH E 3 .   ? -5.550  -22.761 -35.389 1.00 38.99 ? 140 HOH B O   1 
HETATM 2285 O O   . HOH E 3 .   ? -22.715 2.695   -24.328 1.00 36.30 ? 141 HOH B O   1 
HETATM 2286 O O   . HOH E 3 .   ? -4.159  -32.412 -37.996 1.00 49.06 ? 142 HOH B O   1 
HETATM 2287 O O   . HOH E 3 .   ? -25.448 -28.255 -32.309 1.00 37.88 ? 143 HOH B O   1 
HETATM 2288 O O   . HOH E 3 .   ? -32.850 -7.593  -20.790 1.00 53.06 ? 144 HOH B O   1 
HETATM 2289 O O   . HOH E 3 .   ? -31.382 -3.049  -17.857 1.00 42.68 ? 145 HOH B O   1 
HETATM 2290 O O   . HOH E 3 .   ? -29.264 -1.520  -21.367 1.00 48.08 ? 146 HOH B O   1 
HETATM 2291 O O   . HOH E 3 .   ? -12.374 -7.829  -13.838 1.00 32.35 ? 147 HOH B O   1 
HETATM 2292 O O   . HOH E 3 .   ? -11.619 -10.574 -17.043 1.00 54.90 ? 148 HOH B O   1 
HETATM 2293 O O   . HOH E 3 .   ? -14.163 -10.502 -13.387 1.00 49.77 ? 149 HOH B O   1 
HETATM 2294 O O   . HOH E 3 .   ? -23.896 -13.111 -18.776 1.00 52.97 ? 150 HOH B O   1 
HETATM 2295 O O   . HOH E 3 .   ? -9.200  -24.209 -15.013 1.00 41.34 ? 151 HOH B O   1 
HETATM 2296 O O   . HOH E 3 .   ? -3.062  -3.424  -20.819 1.00 31.74 ? 152 HOH B O   1 
HETATM 2297 O O   . HOH E 3 .   ? -3.803  -4.159  -29.582 1.00 34.96 ? 153 HOH B O   1 
HETATM 2298 O O   . HOH E 3 .   ? -10.596 7.310   -11.795 1.00 42.60 ? 154 HOH B O   1 
HETATM 2299 O O   . HOH E 3 .   ? -30.169 -19.299 -28.488 1.00 45.91 ? 155 HOH B O   1 
HETATM 2300 O O   . HOH E 3 .   ? -0.726  -28.409 -16.627 1.00 51.93 ? 156 HOH B O   1 
HETATM 2301 O O   . HOH E 3 .   ? 0.115   -28.267 -19.238 1.00 49.54 ? 157 HOH B O   1 
HETATM 2302 O O   . HOH E 3 .   ? -14.288 -2.019  -11.875 1.00 28.70 ? 158 HOH B O   1 
HETATM 2303 O O   . HOH E 3 .   ? -12.845 -9.564  -33.485 1.00 36.55 ? 159 HOH B O   1 
HETATM 2304 O O   . HOH E 3 .   ? -14.472 -5.069  -12.050 1.00 37.83 ? 160 HOH B O   1 
HETATM 2305 O O   . HOH E 3 .   ? 0.736   -30.453 -29.034 1.00 58.37 ? 161 HOH B O   1 
HETATM 2306 O O   . HOH E 3 .   ? -5.420  -30.718 -29.700 1.00 43.31 ? 162 HOH B O   1 
HETATM 2307 O O   . HOH E 3 .   ? -12.217 -14.964 -20.458 1.00 50.87 ? 163 HOH B O   1 
HETATM 2308 O O   . HOH E 3 .   ? -15.713 -7.908  -17.515 1.00 49.43 ? 164 HOH B O   1 
HETATM 2309 O O   . HOH E 3 .   ? 6.395   -15.079 -22.138 1.00 42.24 ? 165 HOH B O   1 
HETATM 2310 O O   . HOH E 3 .   ? -19.688 -13.136 -36.306 1.00 35.56 ? 166 HOH B O   1 
HETATM 2311 O O   . HOH E 3 .   ? -18.079 -8.998  -23.525 1.00 44.68 ? 167 HOH B O   1 
HETATM 2312 O O   . HOH E 3 .   ? -17.296 -14.750 -23.683 1.00 42.26 ? 168 HOH B O   1 
HETATM 2313 O O   . HOH E 3 .   ? -1.618  -12.996 -16.207 1.00 39.06 ? 169 HOH B O   1 
HETATM 2314 O O   . HOH E 3 .   ? -11.092 4.328   -29.881 1.00 49.55 ? 170 HOH B O   1 
HETATM 2315 O O   . HOH E 3 .   ? -9.973  -29.877 -18.603 1.00 36.15 ? 171 HOH B O   1 
HETATM 2316 O O   . HOH E 3 .   ? -32.999 -0.215  -30.674 1.00 50.80 ? 172 HOH B O   1 
HETATM 2317 O O   . HOH E 3 .   ? -2.702  -30.239 -15.947 1.00 41.30 ? 173 HOH B O   1 
HETATM 2318 O O   . HOH E 3 .   ? -21.544 -4.626  -34.317 1.00 54.95 ? 174 HOH B O   1 
HETATM 2319 O O   . HOH E 3 .   ? -15.412 -13.869 -13.640 1.00 42.02 ? 175 HOH B O   1 
HETATM 2320 O O   . HOH E 3 .   ? -14.737 -21.431 -14.443 1.00 41.22 ? 176 HOH B O   1 
HETATM 2321 O O   . HOH E 3 .   ? -2.379  -28.981 -21.450 1.00 38.29 ? 177 HOH B O   1 
HETATM 2322 O O   . HOH E 3 .   ? -30.727 -14.865 -33.862 1.00 31.62 ? 178 HOH B O   1 
HETATM 2323 O O   . HOH E 3 .   ? -7.562  -12.303 -34.863 1.00 58.72 ? 179 HOH B O   1 
HETATM 2324 O O   . HOH E 3 .   ? -2.824  0.823   -19.309 1.00 41.26 ? 180 HOH B O   1 
HETATM 2325 O O   . HOH E 3 .   ? -11.293 -9.704  -31.147 1.00 27.60 ? 181 HOH B O   1 
HETATM 2326 O O   . HOH E 3 .   ? -11.685 -24.494 -41.266 1.00 47.46 ? 182 HOH B O   1 
HETATM 2327 O O   . HOH E 3 .   ? -20.229 -3.229  -31.239 1.00 34.88 ? 183 HOH B O   1 
HETATM 2328 O O   . HOH E 3 .   ? -24.421 -16.756 -31.135 1.00 30.83 ? 184 HOH B O   1 
HETATM 2329 O O   . HOH E 3 .   ? -18.206 -28.941 -13.832 1.00 52.97 ? 185 HOH B O   1 
HETATM 2330 O O   . HOH E 3 .   ? -18.650 -31.882 -24.432 1.00 37.23 ? 186 HOH B O   1 
HETATM 2331 O O   . HOH E 3 .   ? -27.527 -17.979 -28.529 1.00 28.43 ? 187 HOH B O   1 
HETATM 2332 O O   . HOH E 3 .   ? -15.348 4.927   -16.098 1.00 36.05 ? 188 HOH B O   1 
HETATM 2333 O O   . HOH E 3 .   ? -3.144  -8.558  -28.107 1.00 35.76 ? 189 HOH B O   1 
HETATM 2334 O O   . HOH E 3 .   ? -18.907 -31.026 -29.717 1.00 41.75 ? 190 HOH B O   1 
HETATM 2335 O O   . HOH E 3 .   ? -19.377 -5.672  -33.333 1.00 40.34 ? 191 HOH B O   1 
HETATM 2336 O O   . HOH E 3 .   ? 1.172   -24.842 -26.161 1.00 47.25 ? 192 HOH B O   1 
HETATM 2337 O O   . HOH E 3 .   ? -33.927 -9.004  -29.845 1.00 50.23 ? 193 HOH B O   1 
HETATM 2338 O O   . HOH E 3 .   ? -3.350  -5.344  -18.680 1.00 35.35 ? 194 HOH B O   1 
HETATM 2339 O O   . HOH E 3 .   ? 3.242   -29.145 -38.461 1.00 46.64 ? 195 HOH B O   1 
HETATM 2340 O O   . HOH E 3 .   ? -16.723 -6.163  -25.254 1.00 31.27 ? 196 HOH B O   1 
HETATM 2341 O O   . HOH E 3 .   ? -27.088 -7.945  -20.260 1.00 43.75 ? 197 HOH B O   1 
HETATM 2342 O O   . HOH E 3 .   ? -23.503 -15.527 -14.181 1.00 41.78 ? 198 HOH B O   1 
HETATM 2343 O O   . HOH E 3 .   ? -3.042  -26.394 -13.331 1.00 49.81 ? 199 HOH B O   1 
HETATM 2344 O O   . HOH E 3 .   ? -6.699  -18.483 -37.481 1.00 51.27 ? 200 HOH B O   1 
HETATM 2345 O O   . HOH E 3 .   ? -15.036 -15.218 -24.553 1.00 39.96 ? 201 HOH B O   1 
HETATM 2346 O O   . HOH E 3 .   ? -9.120  -16.087 -31.092 1.00 26.81 ? 202 HOH B O   1 
HETATM 2347 O O   . HOH E 3 .   ? -5.276  -9.559  -12.611 1.00 36.18 ? 203 HOH B O   1 
HETATM 2348 O O   . HOH E 3 .   ? -9.401  -19.356 -9.759  1.00 45.20 ? 204 HOH B O   1 
HETATM 2349 O O   . HOH E 3 .   ? -2.264  3.121   -15.437 1.00 40.10 ? 205 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PRO 1   1   1   PRO PRO A . n 
A 1 2   ASN 2   2   2   ASN ASN A . n 
A 1 3   PHE 3   3   3   PHE PHE A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLY 5   5   5   GLY GLY A . n 
A 1 6   ASN 6   6   6   ASN ASN A . n 
A 1 7   TRP 7   7   7   TRP TRP A . n 
A 1 8   LYS 8   8   8   LYS LYS A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  ILE 10  10  10  ILE ILE A . n 
A 1 11  ARG 11  11  11  ARG ARG A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLU 13  13  13  GLU GLU A . n 
A 1 14  ASN 14  14  14  ASN ASN A . n 
A 1 15  PHE 15  15  15  PHE PHE A . n 
A 1 16  GLU 16  16  16  GLU GLU A . n 
A 1 17  GLU 17  17  17  GLU GLU A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  VAL 24  24  24  VAL VAL A . n 
A 1 25  ASN 25  25  25  ASN ASN A . n 
A 1 26  VAL 26  26  26  VAL VAL A . n 
A 1 27  MET 27  27  27  MET MET A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  ARG 29  29  29  ARG ARG A . n 
A 1 30  LYS 30  30  30  LYS LYS A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  ALA 32  32  32  ALA ALA A . n 
A 1 33  VAL 33  33  33  VAL VAL A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  ALA 35  35  35  ALA ALA A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  SER 37  37  37  SER SER A . n 
A 1 38  LYS 38  38  38  LYS LYS A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  VAL 41  41  41  VAL VAL A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  ILE 43  43  43  ILE ILE A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  GLN 45  45  45  GLN GLN A . n 
A 1 46  GLU 46  46  46  GLU GLU A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  ASP 48  48  48  ASP ASP A . n 
A 1 49  THR 49  49  49  THR THR A . n 
A 1 50  PHE 50  50  50  PHE PHE A . n 
A 1 51  TYR 51  51  51  TYR TYR A . n 
A 1 52  ILE 52  52  52  ILE ILE A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  THR 54  54  54  THR THR A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  THR 56  56  56  THR THR A . n 
A 1 57  THR 57  57  57  THR THR A . n 
A 1 58  VAL 58  58  58  VAL VAL A . n 
A 1 59  ARG 59  59  59  ARG ARG A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  THR 61  61  61  THR THR A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  ILE 63  63  63  ILE ILE A . n 
A 1 64  ASN 64  64  64  ASN ASN A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  LYS 66  66  66  LYS LYS A . n 
A 1 67  VAL 67  67  67  VAL VAL A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  GLU 69  69  69  GLU GLU A . n 
A 1 70  GLU 70  70  70  GLU GLU A . n 
A 1 71  PHE 71  71  71  PHE PHE A . n 
A 1 72  GLU 72  72  72  GLU GLU A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  VAL 76  76  76  VAL VAL A . n 
A 1 77  ASP 77  77  77  ASP ASP A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  ARG 79  79  79  ARG ARG A . n 
A 1 80  PRO 80  80  80  PRO PRO A . n 
A 1 81  CYS 81  81  81  CYS CYS A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  LEU 84  84  84  LEU LEU A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  LYS 86  86  86  LYS LYS A . n 
A 1 87  TRP 87  87  87  TRP TRP A . n 
A 1 88  GLU 88  88  88  GLU GLU A . n 
A 1 89  SER 89  89  89  SER SER A . n 
A 1 90  GLU 90  90  90  GLU GLU A . n 
A 1 91  ASN 91  91  91  ASN ASN A . n 
A 1 92  LYS 92  92  92  LYS LYS A . n 
A 1 93  MET 93  93  93  MET MET A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  CYS 95  95  95  CYS CYS A . n 
A 1 96  GLU 96  96  96  GLU GLU A . n 
A 1 97  GLN 97  97  97  GLN GLN A . n 
A 1 98  LYS 98  98  98  LYS LYS A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 GLU 103 103 103 GLU GLU A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 PRO 105 105 105 PRO PRO A . n 
A 1 106 LYS 106 106 106 LYS LYS A . n 
A 1 107 THR 107 107 107 THR THR A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 TRP 109 109 109 TRP TRP A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 THR 114 114 114 THR THR A . n 
A 1 115 ASN 115 115 115 ASN ASN A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLU 118 118 118 GLU GLU A . n 
A 1 119 LEU 119 119 119 LEU LEU A . n 
A 1 120 ILE 120 120 120 ILE ILE A . n 
A 1 121 ASP 121 121 121 ASP ASP A . n 
A 1 122 THR 122 122 122 THR THR A . n 
A 1 123 MET 123 123 123 MET MET A . n 
A 1 124 THR 124 124 124 THR THR A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 ASP 126 126 126 ASP ASP A . n 
A 1 127 ASP 127 127 127 ASP ASP A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 CYS 130 130 130 CYS CYS A . n 
A 1 131 THR 131 131 131 THR THR A . n 
A 1 132 LYS 132 132 132 LYS LYS A . n 
A 1 133 VAL 133 133 133 VAL VAL A . n 
A 1 134 PHE 134 134 134 PHE PHE A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 GLU 137 137 137 GLU GLU A . n 
B 1 1   PRO 1   1   1   PRO PRO B . n 
B 1 2   ASN 2   2   2   ASN ASN B . n 
B 1 3   PHE 3   3   3   PHE PHE B . n 
B 1 4   SER 4   4   4   SER SER B . n 
B 1 5   GLY 5   5   5   GLY GLY B . n 
B 1 6   ASN 6   6   6   ASN ASN B . n 
B 1 7   TRP 7   7   7   TRP TRP B . n 
B 1 8   LYS 8   8   8   LYS LYS B . n 
B 1 9   ILE 9   9   9   ILE ILE B . n 
B 1 10  ILE 10  10  10  ILE ILE B . n 
B 1 11  ARG 11  11  11  ARG ARG B . n 
B 1 12  SER 12  12  12  SER SER B . n 
B 1 13  GLU 13  13  13  GLU GLU B . n 
B 1 14  ASN 14  14  14  ASN ASN B . n 
B 1 15  PHE 15  15  15  PHE PHE B . n 
B 1 16  GLU 16  16  16  GLU GLU B . n 
B 1 17  GLU 17  17  17  GLU GLU B . n 
B 1 18  LEU 18  18  18  LEU LEU B . n 
B 1 19  LEU 19  19  19  LEU LEU B . n 
B 1 20  LYS 20  20  20  LYS LYS B . n 
B 1 21  VAL 21  21  21  VAL VAL B . n 
B 1 22  LEU 22  22  22  LEU LEU B . n 
B 1 23  GLY 23  23  23  GLY GLY B . n 
B 1 24  VAL 24  24  24  VAL VAL B . n 
B 1 25  ASN 25  25  25  ASN ASN B . n 
B 1 26  VAL 26  26  26  VAL VAL B . n 
B 1 27  MET 27  27  27  MET MET B . n 
B 1 28  LEU 28  28  28  LEU LEU B . n 
B 1 29  ARG 29  29  29  ARG ARG B . n 
B 1 30  LYS 30  30  30  LYS LYS B . n 
B 1 31  ILE 31  31  31  ILE ILE B . n 
B 1 32  ALA 32  32  32  ALA ALA B . n 
B 1 33  VAL 33  33  33  VAL VAL B . n 
B 1 34  ALA 34  34  34  ALA ALA B . n 
B 1 35  ALA 35  35  35  ALA ALA B . n 
B 1 36  ALA 36  36  36  ALA ALA B . n 
B 1 37  SER 37  37  37  SER SER B . n 
B 1 38  LYS 38  38  38  LYS LYS B . n 
B 1 39  PRO 39  39  39  PRO PRO B . n 
B 1 40  ALA 40  40  40  ALA ALA B . n 
B 1 41  VAL 41  41  41  VAL VAL B . n 
B 1 42  GLU 42  42  42  GLU GLU B . n 
B 1 43  ILE 43  43  43  ILE ILE B . n 
B 1 44  LYS 44  44  44  LYS LYS B . n 
B 1 45  GLN 45  45  45  GLN GLN B . n 
B 1 46  GLU 46  46  46  GLU GLU B . n 
B 1 47  GLY 47  47  47  GLY GLY B . n 
B 1 48  ASP 48  48  48  ASP ASP B . n 
B 1 49  THR 49  49  49  THR THR B . n 
B 1 50  PHE 50  50  50  PHE PHE B . n 
B 1 51  TYR 51  51  51  TYR TYR B . n 
B 1 52  ILE 52  52  52  ILE ILE B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  THR 54  54  54  THR THR B . n 
B 1 55  SER 55  55  55  SER SER B . n 
B 1 56  THR 56  56  56  THR THR B . n 
B 1 57  THR 57  57  57  THR THR B . n 
B 1 58  VAL 58  58  58  VAL VAL B . n 
B 1 59  ARG 59  59  59  ARG ARG B . n 
B 1 60  THR 60  60  60  THR THR B . n 
B 1 61  THR 61  61  61  THR THR B . n 
B 1 62  GLU 62  62  62  GLU GLU B . n 
B 1 63  ILE 63  63  63  ILE ILE B . n 
B 1 64  ASN 64  64  64  ASN ASN B . n 
B 1 65  PHE 65  65  65  PHE PHE B . n 
B 1 66  LYS 66  66  66  LYS LYS B . n 
B 1 67  VAL 67  67  67  VAL VAL B . n 
B 1 68  GLY 68  68  68  GLY GLY B . n 
B 1 69  GLU 69  69  69  GLU GLU B . n 
B 1 70  GLU 70  70  70  GLU GLU B . n 
B 1 71  PHE 71  71  71  PHE PHE B . n 
B 1 72  GLU 72  72  72  GLU GLU B . n 
B 1 73  GLU 73  73  73  GLU GLU B . n 
B 1 74  GLN 74  74  74  GLN GLN B . n 
B 1 75  THR 75  75  75  THR THR B . n 
B 1 76  VAL 76  76  76  VAL VAL B . n 
B 1 77  ASP 77  77  77  ASP ASP B . n 
B 1 78  GLY 78  78  78  GLY GLY B . n 
B 1 79  ARG 79  79  79  ARG ARG B . n 
B 1 80  PRO 80  80  80  PRO PRO B . n 
B 1 81  CYS 81  81  81  CYS CYS B . n 
B 1 82  LYS 82  82  82  LYS LYS B . n 
B 1 83  SER 83  83  83  SER SER B . n 
B 1 84  LEU 84  84  84  LEU LEU B . n 
B 1 85  VAL 85  85  85  VAL VAL B . n 
B 1 86  LYS 86  86  86  LYS LYS B . n 
B 1 87  TRP 87  87  87  TRP TRP B . n 
B 1 88  GLU 88  88  88  GLU GLU B . n 
B 1 89  SER 89  89  89  SER SER B . n 
B 1 90  GLU 90  90  90  GLU GLU B . n 
B 1 91  ASN 91  91  91  ASN ASN B . n 
B 1 92  LYS 92  92  92  LYS LYS B . n 
B 1 93  MET 93  93  93  MET MET B . n 
B 1 94  VAL 94  94  94  VAL VAL B . n 
B 1 95  CYS 95  95  95  CYS CYS B . n 
B 1 96  GLU 96  96  96  GLU GLU B . n 
B 1 97  GLN 97  97  97  GLN GLN B . n 
B 1 98  LYS 98  98  98  LYS LYS B . n 
B 1 99  LEU 99  99  99  LEU LEU B . n 
B 1 100 LEU 100 100 100 LEU LEU B . n 
B 1 101 LYS 101 101 101 LYS LYS B . n 
B 1 102 GLY 102 102 102 GLY GLY B . n 
B 1 103 GLU 103 103 103 GLU GLU B . n 
B 1 104 GLY 104 104 104 GLY GLY B . n 
B 1 105 PRO 105 105 105 PRO PRO B . n 
B 1 106 LYS 106 106 106 LYS LYS B . n 
B 1 107 THR 107 107 107 THR THR B . n 
B 1 108 SER 108 108 108 SER SER B . n 
B 1 109 TRP 109 109 109 TRP TRP B . n 
B 1 110 THR 110 110 110 THR THR B . n 
B 1 111 LEU 111 111 111 LEU LEU B . n 
B 1 112 GLU 112 112 112 GLU GLU B . n 
B 1 113 LEU 113 113 113 LEU LEU B . n 
B 1 114 THR 114 114 114 THR THR B . n 
B 1 115 ASN 115 115 115 ASN ASN B . n 
B 1 116 ASP 116 116 116 ASP ASP B . n 
B 1 117 GLY 117 117 117 GLY GLY B . n 
B 1 118 GLU 118 118 118 GLU GLU B . n 
B 1 119 LEU 119 119 119 LEU LEU B . n 
B 1 120 ILE 120 120 120 ILE ILE B . n 
B 1 121 ASP 121 121 121 ASP ASP B . n 
B 1 122 THR 122 122 122 THR THR B . n 
B 1 123 MET 123 123 123 MET MET B . n 
B 1 124 THR 124 124 124 THR THR B . n 
B 1 125 ALA 125 125 125 ALA ALA B . n 
B 1 126 ASP 126 126 126 ASP ASP B . n 
B 1 127 ASP 127 127 127 ASP ASP B . n 
B 1 128 VAL 128 128 128 VAL VAL B . n 
B 1 129 VAL 129 129 129 VAL VAL B . n 
B 1 130 CYS 130 130 130 CYS CYS B . n 
B 1 131 THR 131 131 131 THR THR B . n 
B 1 132 LYS 132 132 132 LYS LYS B . n 
B 1 133 VAL 133 133 133 VAL VAL B . n 
B 1 134 PHE 134 134 134 PHE PHE B . n 
B 1 135 VAL 135 135 135 VAL VAL B . n 
B 1 136 ARG 136 136 136 ARG ARG B . n 
B 1 137 GLU 137 137 137 GLU GLU B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,D   
2 1 B,C,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-10-27 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2014-11-26 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .        ? 1 
MOLREP   phasing           .        ? 2 
REFMAC   refinement        5.2.0005 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 73  ? ? -147.32 -153.53 
2 1 ASP A 126 ? ? 55.52   -111.78 
3 1 THR B 56  ? ? -120.98 -168.50 
4 1 GLU B 73  ? ? -143.73 -152.99 
5 1 ASP B 126 ? ? 48.34   -112.30 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ACETATE ION' ACT 
3 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 ACT 1  138 138 ACT ACT B . 
D 3 HOH 1  138 138 HOH HOH A . 
D 3 HOH 2  139 139 HOH HOH A . 
D 3 HOH 3  140 140 HOH HOH A . 
D 3 HOH 4  141 141 HOH HOH A . 
D 3 HOH 5  142 142 HOH HOH A . 
D 3 HOH 6  143 143 HOH HOH A . 
D 3 HOH 7  144 144 HOH HOH A . 
D 3 HOH 8  145 145 HOH HOH A . 
D 3 HOH 9  146 146 HOH HOH A . 
D 3 HOH 10 147 147 HOH HOH A . 
D 3 HOH 11 148 148 HOH HOH A . 
D 3 HOH 12 149 149 HOH HOH A . 
D 3 HOH 13 150 150 HOH HOH A . 
D 3 HOH 14 151 151 HOH HOH A . 
D 3 HOH 15 152 152 HOH HOH A . 
D 3 HOH 16 153 153 HOH HOH A . 
D 3 HOH 17 154 154 HOH HOH A . 
D 3 HOH 18 155 155 HOH HOH A . 
D 3 HOH 19 156 156 HOH HOH A . 
D 3 HOH 20 157 157 HOH HOH A . 
D 3 HOH 21 158 158 HOH HOH A . 
D 3 HOH 22 159 159 HOH HOH A . 
D 3 HOH 23 160 160 HOH HOH A . 
D 3 HOH 24 161 161 HOH HOH A . 
D 3 HOH 25 162 162 HOH HOH A . 
D 3 HOH 26 163 163 HOH HOH A . 
D 3 HOH 27 164 164 HOH HOH A . 
D 3 HOH 28 165 165 HOH HOH A . 
D 3 HOH 29 166 166 HOH HOH A . 
D 3 HOH 30 167 167 HOH HOH A . 
D 3 HOH 31 168 168 HOH HOH A . 
D 3 HOH 32 169 169 HOH HOH A . 
D 3 HOH 33 170 170 HOH HOH A . 
D 3 HOH 34 171 171 HOH HOH A . 
D 3 HOH 35 172 172 HOH HOH A . 
D 3 HOH 36 173 173 HOH HOH A . 
D 3 HOH 37 174 174 HOH HOH A . 
D 3 HOH 38 175 175 HOH HOH A . 
D 3 HOH 39 176 176 HOH HOH A . 
D 3 HOH 40 177 177 HOH HOH A . 
D 3 HOH 41 178 178 HOH HOH A . 
D 3 HOH 42 179 179 HOH HOH A . 
D 3 HOH 43 180 180 HOH HOH A . 
D 3 HOH 44 181 181 HOH HOH A . 
D 3 HOH 45 182 182 HOH HOH A . 
D 3 HOH 46 183 183 HOH HOH A . 
D 3 HOH 47 184 184 HOH HOH A . 
D 3 HOH 48 185 185 HOH HOH A . 
D 3 HOH 49 186 186 HOH HOH A . 
D 3 HOH 50 187 187 HOH HOH A . 
D 3 HOH 51 188 188 HOH HOH A . 
D 3 HOH 52 189 189 HOH HOH A . 
D 3 HOH 53 190 190 HOH HOH A . 
D 3 HOH 54 191 191 HOH HOH A . 
D 3 HOH 55 192 192 HOH HOH A . 
D 3 HOH 56 193 193 HOH HOH A . 
D 3 HOH 57 194 194 HOH HOH A . 
D 3 HOH 58 195 195 HOH HOH A . 
D 3 HOH 59 196 196 HOH HOH A . 
D 3 HOH 60 197 197 HOH HOH A . 
D 3 HOH 61 198 198 HOH HOH A . 
D 3 HOH 62 199 199 HOH HOH A . 
D 3 HOH 63 200 200 HOH HOH A . 
D 3 HOH 64 201 201 HOH HOH A . 
D 3 HOH 65 202 202 HOH HOH A . 
D 3 HOH 66 203 203 HOH HOH A . 
D 3 HOH 67 204 204 HOH HOH A . 
D 3 HOH 68 205 205 HOH HOH A . 
D 3 HOH 69 206 206 HOH HOH A . 
D 3 HOH 70 207 207 HOH HOH A . 
D 3 HOH 71 208 208 HOH HOH A . 
D 3 HOH 72 209 209 HOH HOH A . 
D 3 HOH 73 210 210 HOH HOH A . 
D 3 HOH 74 211 211 HOH HOH A . 
D 3 HOH 75 212 212 HOH HOH A . 
D 3 HOH 76 213 213 HOH HOH A . 
D 3 HOH 77 214 214 HOH HOH A . 
D 3 HOH 78 215 215 HOH HOH A . 
D 3 HOH 79 216 216 HOH HOH A . 
D 3 HOH 80 217 217 HOH HOH A . 
D 3 HOH 81 218 218 HOH HOH A . 
D 3 HOH 82 219 219 HOH HOH A . 
D 3 HOH 83 220 220 HOH HOH A . 
D 3 HOH 84 221 221 HOH HOH A . 
D 3 HOH 85 222 222 HOH HOH A . 
D 3 HOH 86 223 223 HOH HOH A . 
D 3 HOH 87 224 224 HOH HOH A . 
D 3 HOH 88 225 225 HOH HOH A . 
D 3 HOH 89 226 226 HOH HOH A . 
D 3 HOH 90 227 227 HOH HOH A . 
D 3 HOH 91 228 228 HOH HOH A . 
D 3 HOH 92 229 229 HOH HOH A . 
D 3 HOH 93 230 230 HOH HOH A . 
E 3 HOH 1  139 139 HOH HOH B . 
E 3 HOH 2  140 140 HOH HOH B . 
E 3 HOH 3  141 141 HOH HOH B . 
E 3 HOH 4  142 142 HOH HOH B . 
E 3 HOH 5  143 143 HOH HOH B . 
E 3 HOH 6  144 144 HOH HOH B . 
E 3 HOH 7  145 145 HOH HOH B . 
E 3 HOH 8  146 146 HOH HOH B . 
E 3 HOH 9  147 147 HOH HOH B . 
E 3 HOH 10 148 148 HOH HOH B . 
E 3 HOH 11 149 149 HOH HOH B . 
E 3 HOH 12 150 150 HOH HOH B . 
E 3 HOH 13 151 151 HOH HOH B . 
E 3 HOH 14 152 152 HOH HOH B . 
E 3 HOH 15 153 153 HOH HOH B . 
E 3 HOH 16 154 154 HOH HOH B . 
E 3 HOH 17 155 155 HOH HOH B . 
E 3 HOH 18 156 156 HOH HOH B . 
E 3 HOH 19 157 157 HOH HOH B . 
E 3 HOH 20 158 158 HOH HOH B . 
E 3 HOH 21 159 159 HOH HOH B . 
E 3 HOH 22 160 160 HOH HOH B . 
E 3 HOH 23 161 161 HOH HOH B . 
E 3 HOH 24 162 162 HOH HOH B . 
E 3 HOH 25 163 163 HOH HOH B . 
E 3 HOH 26 164 164 HOH HOH B . 
E 3 HOH 27 165 165 HOH HOH B . 
E 3 HOH 28 166 166 HOH HOH B . 
E 3 HOH 29 167 167 HOH HOH B . 
E 3 HOH 30 168 168 HOH HOH B . 
E 3 HOH 31 169 169 HOH HOH B . 
E 3 HOH 32 170 170 HOH HOH B . 
E 3 HOH 33 171 171 HOH HOH B . 
E 3 HOH 34 172 172 HOH HOH B . 
E 3 HOH 35 173 173 HOH HOH B . 
E 3 HOH 36 174 174 HOH HOH B . 
E 3 HOH 37 175 175 HOH HOH B . 
E 3 HOH 38 176 176 HOH HOH B . 
E 3 HOH 39 177 177 HOH HOH B . 
E 3 HOH 40 178 178 HOH HOH B . 
E 3 HOH 41 179 179 HOH HOH B . 
E 3 HOH 42 180 180 HOH HOH B . 
E 3 HOH 43 181 181 HOH HOH B . 
E 3 HOH 44 182 182 HOH HOH B . 
E 3 HOH 45 183 183 HOH HOH B . 
E 3 HOH 46 184 184 HOH HOH B . 
E 3 HOH 47 185 185 HOH HOH B . 
E 3 HOH 48 186 186 HOH HOH B . 
E 3 HOH 49 187 187 HOH HOH B . 
E 3 HOH 50 188 188 HOH HOH B . 
E 3 HOH 51 189 189 HOH HOH B . 
E 3 HOH 52 190 190 HOH HOH B . 
E 3 HOH 53 191 191 HOH HOH B . 
E 3 HOH 54 192 192 HOH HOH B . 
E 3 HOH 55 193 193 HOH HOH B . 
E 3 HOH 56 194 194 HOH HOH B . 
E 3 HOH 57 195 195 HOH HOH B . 
E 3 HOH 58 196 196 HOH HOH B . 
E 3 HOH 59 197 197 HOH HOH B . 
E 3 HOH 60 198 198 HOH HOH B . 
E 3 HOH 61 199 199 HOH HOH B . 
E 3 HOH 62 200 200 HOH HOH B . 
E 3 HOH 63 201 201 HOH HOH B . 
E 3 HOH 64 202 202 HOH HOH B . 
E 3 HOH 65 203 203 HOH HOH B . 
E 3 HOH 66 204 204 HOH HOH B . 
E 3 HOH 67 205 205 HOH HOH B . 
#