data_3FK2
# 
_entry.id   3FK2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3FK2         
RCSB  RCSB050685   
WWPDB D_1000050685 
# 
_pdbx_database_status.entry_id                        3FK2 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2008-12-15 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nedyalkova, L.'                       1  
'Tong, Y.'                             2  
'Tempel, W.'                           3  
'Loppnau, P.'                          4  
'Arrowsmith, C.H.'                     5  
'Edwards, A.M.'                        6  
'Bountra, C.'                          7  
'Weigelt, J.'                          8  
'Bochkarev, A.'                        9  
'Park, H.'                             10 
'Structural Genomics Consortium (SGC)' 11 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of the RhoGAP domain of human glucocorticoid receptor DNA-binding factor 1' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nedyalkova, L.'   1  
primary 'Tong, Y.'         2  
primary 'Tempel, W.'       3  
primary 'Loppnau, P.'      4  
primary 'Arrowsmith, C.H.' 5  
primary 'Edwards, A.M.'    6  
primary 'Bountra, C.'      7  
primary 'Weigelt, J.'      8  
primary 'Bochkarev, A.'    9  
primary 'Park, H.'         10 
# 
_cell.entry_id           3FK2 
_cell.length_a           165.025 
_cell.length_b           72.408 
_cell.length_c           72.863 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              16 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3FK2 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.Int_Tables_number                18 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glucocorticoid receptor DNA-binding factor 1' 28880.037 4 ? ? 'UNP residues 1212-1439' ? 
2 non-polymer syn 'UNKNOWN ATOM OR ION'                          ?         8 ? ? ?                        ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Glucocorticoid receptor repression factor 1, GRF-1, Rho GAP p190A, p190-A' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHHHHHHSSGRENLYFQGDPRRRNILRSLRRNTKKPKPKPRPSITKATWESNYFGVPLTTVVTPEKPIPIFIERCIEYIE
ATGLSTEGIYRVSGNKSEMESLQRQFDQDHNLDLAEKDFTVNTVAGAMKSFFSELPDPLVPYNMQIDLVEAHKINDREQK
LHALKEVLKKFPKENHEVFKYVISHLNKVSHNNKVNLMTSENLSICFWPTLMRPDFSTMDALTATRTYQTIIELFIQQCP
FFFYNR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHSSGRENLYFQGDPRRRNILRSLRRNTKKPKPKPRPSITKATWESNYFGVPLTTVVTPEKPIPIFIERCIEYIE
ATGLSTEGIYRVSGNKSEMESLQRQFDQDHNLDLAEKDFTVNTVAGAMKSFFSELPDPLVPYNMQIDLVEAHKINDREQK
LHALKEVLKKFPKENHEVFKYVISHLNKVSHNNKVNLMTSENLSICFWPTLMRPDFSTMDALTATRTYQTIIELFIQQCP
FFFYNR
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  ARG n 
1 12  GLU n 
1 13  ASN n 
1 14  LEU n 
1 15  TYR n 
1 16  PHE n 
1 17  GLN n 
1 18  GLY n 
1 19  ASP n 
1 20  PRO n 
1 21  ARG n 
1 22  ARG n 
1 23  ARG n 
1 24  ASN n 
1 25  ILE n 
1 26  LEU n 
1 27  ARG n 
1 28  SER n 
1 29  LEU n 
1 30  ARG n 
1 31  ARG n 
1 32  ASN n 
1 33  THR n 
1 34  LYS n 
1 35  LYS n 
1 36  PRO n 
1 37  LYS n 
1 38  PRO n 
1 39  LYS n 
1 40  PRO n 
1 41  ARG n 
1 42  PRO n 
1 43  SER n 
1 44  ILE n 
1 45  THR n 
1 46  LYS n 
1 47  ALA n 
1 48  THR n 
1 49  TRP n 
1 50  GLU n 
1 51  SER n 
1 52  ASN n 
1 53  TYR n 
1 54  PHE n 
1 55  GLY n 
1 56  VAL n 
1 57  PRO n 
1 58  LEU n 
1 59  THR n 
1 60  THR n 
1 61  VAL n 
1 62  VAL n 
1 63  THR n 
1 64  PRO n 
1 65  GLU n 
1 66  LYS n 
1 67  PRO n 
1 68  ILE n 
1 69  PRO n 
1 70  ILE n 
1 71  PHE n 
1 72  ILE n 
1 73  GLU n 
1 74  ARG n 
1 75  CYS n 
1 76  ILE n 
1 77  GLU n 
1 78  TYR n 
1 79  ILE n 
1 80  GLU n 
1 81  ALA n 
1 82  THR n 
1 83  GLY n 
1 84  LEU n 
1 85  SER n 
1 86  THR n 
1 87  GLU n 
1 88  GLY n 
1 89  ILE n 
1 90  TYR n 
1 91  ARG n 
1 92  VAL n 
1 93  SER n 
1 94  GLY n 
1 95  ASN n 
1 96  LYS n 
1 97  SER n 
1 98  GLU n 
1 99  MET n 
1 100 GLU n 
1 101 SER n 
1 102 LEU n 
1 103 GLN n 
1 104 ARG n 
1 105 GLN n 
1 106 PHE n 
1 107 ASP n 
1 108 GLN n 
1 109 ASP n 
1 110 HIS n 
1 111 ASN n 
1 112 LEU n 
1 113 ASP n 
1 114 LEU n 
1 115 ALA n 
1 116 GLU n 
1 117 LYS n 
1 118 ASP n 
1 119 PHE n 
1 120 THR n 
1 121 VAL n 
1 122 ASN n 
1 123 THR n 
1 124 VAL n 
1 125 ALA n 
1 126 GLY n 
1 127 ALA n 
1 128 MET n 
1 129 LYS n 
1 130 SER n 
1 131 PHE n 
1 132 PHE n 
1 133 SER n 
1 134 GLU n 
1 135 LEU n 
1 136 PRO n 
1 137 ASP n 
1 138 PRO n 
1 139 LEU n 
1 140 VAL n 
1 141 PRO n 
1 142 TYR n 
1 143 ASN n 
1 144 MET n 
1 145 GLN n 
1 146 ILE n 
1 147 ASP n 
1 148 LEU n 
1 149 VAL n 
1 150 GLU n 
1 151 ALA n 
1 152 HIS n 
1 153 LYS n 
1 154 ILE n 
1 155 ASN n 
1 156 ASP n 
1 157 ARG n 
1 158 GLU n 
1 159 GLN n 
1 160 LYS n 
1 161 LEU n 
1 162 HIS n 
1 163 ALA n 
1 164 LEU n 
1 165 LYS n 
1 166 GLU n 
1 167 VAL n 
1 168 LEU n 
1 169 LYS n 
1 170 LYS n 
1 171 PHE n 
1 172 PRO n 
1 173 LYS n 
1 174 GLU n 
1 175 ASN n 
1 176 HIS n 
1 177 GLU n 
1 178 VAL n 
1 179 PHE n 
1 180 LYS n 
1 181 TYR n 
1 182 VAL n 
1 183 ILE n 
1 184 SER n 
1 185 HIS n 
1 186 LEU n 
1 187 ASN n 
1 188 LYS n 
1 189 VAL n 
1 190 SER n 
1 191 HIS n 
1 192 ASN n 
1 193 ASN n 
1 194 LYS n 
1 195 VAL n 
1 196 ASN n 
1 197 LEU n 
1 198 MET n 
1 199 THR n 
1 200 SER n 
1 201 GLU n 
1 202 ASN n 
1 203 LEU n 
1 204 SER n 
1 205 ILE n 
1 206 CYS n 
1 207 PHE n 
1 208 TRP n 
1 209 PRO n 
1 210 THR n 
1 211 LEU n 
1 212 MET n 
1 213 ARG n 
1 214 PRO n 
1 215 ASP n 
1 216 PHE n 
1 217 SER n 
1 218 THR n 
1 219 MET n 
1 220 ASP n 
1 221 ALA n 
1 222 LEU n 
1 223 THR n 
1 224 ALA n 
1 225 THR n 
1 226 ARG n 
1 227 THR n 
1 228 TYR n 
1 229 GLN n 
1 230 THR n 
1 231 ILE n 
1 232 ILE n 
1 233 GLU n 
1 234 LEU n 
1 235 PHE n 
1 236 ILE n 
1 237 GLN n 
1 238 GLN n 
1 239 CYS n 
1 240 PRO n 
1 241 PHE n 
1 242 PHE n 
1 243 PHE n 
1 244 TYR n 
1 245 ASN n 
1 246 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'GRLF1, GRF1, KIAA1722' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-V2R-pRARE2' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28-MHL 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'The authors suspect that the sample was truncated by in-situ proteolysis.' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GRLF1_HUMAN 
_struct_ref.pdbx_db_accession          Q9NRY4 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DPRRRNILRSLRRNTKKPKPKPRPSITKATWESNYFGVPLTTVVTPEKPIPIFIERCIEYIEATGLSTEGIYRVSGNKSE
MESLQRQFDQDHNLDLAEKDFTVNTVAGAMKSFFSELPDPLVPYNMQIDLVEAHKINDREQKLHALKEVLKKFPKENHEV
FKYVISHLNKVSHNNKVNLMTSENLSICFWPTLMRPDFSTMDALTATRTYQTIIELFIQQCPFFFYNR
;
_struct_ref.pdbx_align_begin           1212 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3FK2 A 19 ? 246 ? Q9NRY4 1212 ? 1439 ? 1212 1439 
2 1 3FK2 B 19 ? 246 ? Q9NRY4 1212 ? 1439 ? 1212 1439 
3 1 3FK2 C 19 ? 246 ? Q9NRY4 1212 ? 1439 ? 1212 1439 
4 1 3FK2 D 19 ? 246 ? Q9NRY4 1212 ? 1439 ? 1212 1439 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3FK2 MET A 1  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1194 1  
1 3FK2 HIS A 2  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1195 2  
1 3FK2 HIS A 3  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1196 3  
1 3FK2 HIS A 4  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1197 4  
1 3FK2 HIS A 5  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1198 5  
1 3FK2 HIS A 6  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1199 6  
1 3FK2 HIS A 7  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1200 7  
1 3FK2 SER A 8  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1201 8  
1 3FK2 SER A 9  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1202 9  
1 3FK2 GLY A 10 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1203 10 
1 3FK2 ARG A 11 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1204 11 
1 3FK2 GLU A 12 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1205 12 
1 3FK2 ASN A 13 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1206 13 
1 3FK2 LEU A 14 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1207 14 
1 3FK2 TYR A 15 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1208 15 
1 3FK2 PHE A 16 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1209 16 
1 3FK2 GLN A 17 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1210 17 
1 3FK2 GLY A 18 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1211 18 
2 3FK2 MET B 1  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1194 19 
2 3FK2 HIS B 2  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1195 20 
2 3FK2 HIS B 3  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1196 21 
2 3FK2 HIS B 4  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1197 22 
2 3FK2 HIS B 5  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1198 23 
2 3FK2 HIS B 6  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1199 24 
2 3FK2 HIS B 7  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1200 25 
2 3FK2 SER B 8  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1201 26 
2 3FK2 SER B 9  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1202 27 
2 3FK2 GLY B 10 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1203 28 
2 3FK2 ARG B 11 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1204 29 
2 3FK2 GLU B 12 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1205 30 
2 3FK2 ASN B 13 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1206 31 
2 3FK2 LEU B 14 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1207 32 
2 3FK2 TYR B 15 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1208 33 
2 3FK2 PHE B 16 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1209 34 
2 3FK2 GLN B 17 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1210 35 
2 3FK2 GLY B 18 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1211 36 
3 3FK2 MET C 1  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1194 37 
3 3FK2 HIS C 2  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1195 38 
3 3FK2 HIS C 3  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1196 39 
3 3FK2 HIS C 4  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1197 40 
3 3FK2 HIS C 5  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1198 41 
3 3FK2 HIS C 6  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1199 42 
3 3FK2 HIS C 7  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1200 43 
3 3FK2 SER C 8  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1201 44 
3 3FK2 SER C 9  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1202 45 
3 3FK2 GLY C 10 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1203 46 
3 3FK2 ARG C 11 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1204 47 
3 3FK2 GLU C 12 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1205 48 
3 3FK2 ASN C 13 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1206 49 
3 3FK2 LEU C 14 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1207 50 
3 3FK2 TYR C 15 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1208 51 
3 3FK2 PHE C 16 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1209 52 
3 3FK2 GLN C 17 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1210 53 
3 3FK2 GLY C 18 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1211 54 
4 3FK2 MET D 1  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1194 55 
4 3FK2 HIS D 2  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1195 56 
4 3FK2 HIS D 3  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1196 57 
4 3FK2 HIS D 4  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1197 58 
4 3FK2 HIS D 5  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1198 59 
4 3FK2 HIS D 6  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1199 60 
4 3FK2 HIS D 7  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1200 61 
4 3FK2 SER D 8  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1201 62 
4 3FK2 SER D 9  ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1202 63 
4 3FK2 GLY D 10 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1203 64 
4 3FK2 ARG D 11 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1204 65 
4 3FK2 GLU D 12 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1205 66 
4 3FK2 ASN D 13 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1206 67 
4 3FK2 LEU D 14 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1207 68 
4 3FK2 TYR D 15 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1208 69 
4 3FK2 PHE D 16 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1209 70 
4 3FK2 GLN D 17 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1210 71 
4 3FK2 GLY D 18 ? UNP Q9NRY4 ? ? 'EXPRESSION TAG' 1211 72 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE               ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE              ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE            ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'       ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE              ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE             ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'       ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE               ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE             ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE            ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE               ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE            ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE         ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE               ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE             ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN            ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE              ? 'C9 H11 N O3'    181.189 
UNX non-polymer         . 'UNKNOWN ATOM OR ION' ? ?                ?       
VAL 'L-peptide linking' y VALINE                ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3FK2 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_percent_sol   48.0 
_exptl_crystal.density_Matthews      2.4 
_exptl_crystal.density_meas          ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.pdbx_details    
;26% PEG 3350, 0.1M Bis-Tris, 0.2M lithium sulfate, 0.001M DTT, 1:100 (w/w) trypsin, pH 6.0, vapor diffusion, sitting drop, temperature 291K
;
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC Q315' 
_diffrn_detector.pdbx_collection_date   2008-11-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97883 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_wavelength_list        0.97883 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
# 
_reflns.entry_id                     3FK2 
_reflns.d_resolution_high            2.800 
_reflns.d_resolution_low             40.000 
_reflns.number_obs                   21961 
_reflns.pdbx_Rmerge_I_obs            0.157 
_reflns.pdbx_netI_over_sigmaI        5.000 
_reflns.pdbx_chi_squared             1.255 
_reflns.pdbx_redundancy              5.100 
_reflns.percent_possible_obs         98.100 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
2.80 2.90  ? ? ? 0.598 ? ? 1.120 3.50 ? 1955 89.00  ? 1  
2.90 3.02  ? ? ? 0.514 ? ? 1.132 4.10 ? 2098 95.20  ? 2  
3.02 3.15  ? ? ? 0.440 ? ? 1.126 4.70 ? 2142 98.60  ? 3  
3.15 3.32  ? ? ? 0.368 ? ? 1.244 5.20 ? 2211 99.60  ? 4  
3.32 3.53  ? ? ? 0.284 ? ? 1.508 5.50 ? 2188 99.80  ? 5  
3.53 3.80  ? ? ? 0.212 ? ? 1.227 5.70 ? 2244 100.00 ? 6  
3.80 4.18  ? ? ? 0.154 ? ? 1.402 5.70 ? 2214 100.00 ? 7  
4.18 4.79  ? ? ? 0.124 ? ? 1.442 5.70 ? 2250 99.90  ? 8  
4.79 6.03  ? ? ? 0.130 ? ? 1.150 5.50 ? 2275 99.70  ? 9  
6.03 40.00 ? ? ? 0.057 ? ? 1.068 5.40 ? 2384 99.00  ? 10 
# 
_refine.entry_id                                 3FK2 
_refine.ls_d_res_high                            2.800 
_refine.ls_d_res_low                             36.431 
_refine.ls_percent_reflns_obs                    96.150 
_refine.ls_number_reflns_obs                     21824 
_refine.ls_R_factor_obs                          0.226 
_refine.ls_R_factor_R_work                       0.223 
_refine.ls_R_factor_R_free                       0.273 
_refine.ls_percent_reflns_R_free                 4.700 
_refine.ls_number_reflns_R_free                  1878 
_refine.B_iso_mean                               45.711 
_refine.aniso_B[1][1]                            5.775 
_refine.aniso_B[2][2]                            -0.526 
_refine.aniso_B[3][3]                            -6.284 
_refine.aniso_B[1][2]                            -0.000 
_refine.aniso_B[1][3]                            -0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.110 
_refine.pdbx_solvent_shrinkage_radii             0.900 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      'pdb entry 2OSA' 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            'Thin shells (SFTOOLS)' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6157 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         8 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               6165 
_refine_hist.d_res_high                       2.800 
_refine_hist.d_res_low                        36.431 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           6315 0.006  ? ? 'X-RAY DIFFRACTION' ? 
f_angle_d          8597 1.005  ? ? 'X-RAY DIFFRACTION' ? 
f_chiral_restr     973  0.074  ? ? 'X-RAY DIFFRACTION' ? 
f_plane_restr      1111 0.003  ? ? 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 2230 18.871 ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 C 1504 ?     ? POSITIONAL 1 'X-RAY DIFFRACTION' 1 ? ? ? 
2 D 1504 0.030 ? POSITIONAL 1 'X-RAY DIFFRACTION' 2 ? ? ? 
3 A 1515 0.033 ? POSITIONAL 1 'X-RAY DIFFRACTION' 3 ? ? ? 
1 A 1297 ?     ? POSITIONAL 2 'X-RAY DIFFRACTION' 4 ? ? ? 
2 B 1297 0.035 ? POSITIONAL 2 'X-RAY DIFFRACTION' 5 ? ? ? 
1 A 175  ?     ? POSITIONAL 3 'X-RAY DIFFRACTION' 6 ? ? ? 
2 B 175  0.038 ? POSITIONAL 3 'X-RAY DIFFRACTION' 7 ? ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.800  2.8758  2499 0.3075 79.00  .      . . .   . . . . 
'X-RAY DIFFRACTION' . 2.8758 2.9604  2528 0.3117 87.00  0.3821 . . 252 . . . . 
'X-RAY DIFFRACTION' . 2.9604 3.0559  3024 0.2805 94.00  .      . . .   . . . . 
'X-RAY DIFFRACTION' . 3.0559 3.1651  2874 0.2799 97.00  0.3541 . . 252 . . . . 
'X-RAY DIFFRACTION' . 3.1651 3.2917  2984 0.2347 99.00  0.2997 . . 181 . . . . 
'X-RAY DIFFRACTION' . 3.2917 3.4414  3073 0.2220 99.00  0.3097 . . 65  . . . . 
'X-RAY DIFFRACTION' . 3.4414 3.6227  2986 0.2144 99.00  0.2510 . . 178 . . . . 
'X-RAY DIFFRACTION' . 3.6227 3.8495  2959 0.1959 100.00 0.2211 . . 202 . . . . 
'X-RAY DIFFRACTION' . 3.8495 4.1463  3026 0.1671 99.00  0.2652 . . 138 . . . . 
'X-RAY DIFFRACTION' . 4.1463 4.5628  3052 0.1641 99.00  0.1809 . . 130 . . . . 
'X-RAY DIFFRACTION' . 4.5628 5.2214  2988 0.1612 100.00 0.2229 . . 195 . . . . 
'X-RAY DIFFRACTION' . 5.2214 6.5721  3049 0.2275 100.00 0.2698 . . 133 . . . . 
'X-RAY DIFFRACTION' . 6.5721 36.4346 3011 0.2256 99.00  0.2737 . . 152 . . . . 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 ? 1 
2 ? 1 
3 ? 1 
1 ? 2 
2 ? 2 
1 ? 3 
2 ? 3 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 'chain C and (resseq 1244:1437 )' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 'chain D and (resseq 1244:1437 )' 
3 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 'chain A and (resseq 1244:1437 )' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2 'chain A and (resseq 1244:1407 )' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2 'chain B and (resseq 1244:1407 )' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3 'chain A and (resseq 1418:1437 )' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3 'chain B and (resseq 1418:1437 )' 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
# 
_struct.entry_id                  3FK2 
_struct.title                     'Crystal structure of the RhoGAP domain of human glucocorticoid receptor DNA-binding factor 1' 
_struct.pdbx_descriptor           'Glucocorticoid receptor DNA-binding factor 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3FK2 
_struct_keywords.text            
;Structural Genomics Consortium, GTPase-activating protein, SGC, Alternative splicing, Anti-oncogene, Cell cycle, Cytoplasm, DNA-binding, GTPase activation, Nucleus, Phosphoprotein, Repressor, Transcription, Transcription regulation, SIGNALING PROTEIN, HYDROLASE ACTIVATOR
;
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN, HYDROLASE ACTIVATOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 2 ? 
K N N 2 ? 
L N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 57  ? VAL A 62  ? PRO A 1250 VAL A 1255 5 ? 6  
HELX_P HELX_P2  2  PRO A 69  ? GLY A 83  ? PRO A 1262 GLY A 1276 1 ? 15 
HELX_P HELX_P3  3  ASN A 95  ? ASP A 109 ? ASN A 1288 ASP A 1302 1 ? 15 
HELX_P HELX_P4  4  LEU A 114 ? ASP A 118 ? LEU A 1307 ASP A 1311 5 ? 5  
HELX_P HELX_P5  5  THR A 120 ? LEU A 135 ? THR A 1313 LEU A 1328 1 ? 16 
HELX_P HELX_P6  6  PRO A 141 ? HIS A 152 ? PRO A 1334 HIS A 1345 1 ? 12 
HELX_P HELX_P7  7  ASP A 156 ? LYS A 170 ? ASP A 1349 LYS A 1363 1 ? 15 
HELX_P HELX_P8  8  PRO A 172 ? HIS A 191 ? PRO A 1365 HIS A 1384 1 ? 20 
HELX_P HELX_P9  9  ASN A 192 ? LEU A 197 ? ASN A 1385 LEU A 1390 1 ? 6  
HELX_P HELX_P10 10 THR A 199 ? ARG A 213 ? THR A 1392 ARG A 1406 1 ? 15 
HELX_P HELX_P11 11 ASP A 220 ? GLN A 238 ? ASP A 1413 GLN A 1431 1 ? 19 
HELX_P HELX_P12 12 GLN A 238 ? TYR A 244 ? GLN A 1431 TYR A 1437 1 ? 7  
HELX_P HELX_P13 13 PRO B 57  ? VAL B 62  ? PRO B 1250 VAL B 1255 5 ? 6  
HELX_P HELX_P14 14 PRO B 69  ? GLY B 83  ? PRO B 1262 GLY B 1276 1 ? 15 
HELX_P HELX_P15 15 ASN B 95  ? ASP B 109 ? ASN B 1288 ASP B 1302 1 ? 15 
HELX_P HELX_P16 16 LEU B 114 ? ASP B 118 ? LEU B 1307 ASP B 1311 5 ? 5  
HELX_P HELX_P17 17 THR B 120 ? LEU B 135 ? THR B 1313 LEU B 1328 1 ? 16 
HELX_P HELX_P18 18 PRO B 141 ? HIS B 152 ? PRO B 1334 HIS B 1345 1 ? 12 
HELX_P HELX_P19 19 ASP B 156 ? LYS B 170 ? ASP B 1349 LYS B 1363 1 ? 15 
HELX_P HELX_P20 20 PRO B 172 ? HIS B 191 ? PRO B 1365 HIS B 1384 1 ? 20 
HELX_P HELX_P21 21 ASN B 192 ? LEU B 197 ? ASN B 1385 LEU B 1390 1 ? 6  
HELX_P HELX_P22 22 THR B 199 ? ARG B 213 ? THR B 1392 ARG B 1406 1 ? 15 
HELX_P HELX_P23 23 ASP B 220 ? GLN B 238 ? ASP B 1413 GLN B 1431 1 ? 19 
HELX_P HELX_P24 24 GLN B 238 ? TYR B 244 ? GLN B 1431 TYR B 1437 1 ? 7  
HELX_P HELX_P25 25 PRO C 57  ? VAL C 62  ? PRO C 1250 VAL C 1255 5 ? 6  
HELX_P HELX_P26 26 PRO C 69  ? GLY C 83  ? PRO C 1262 GLY C 1276 1 ? 15 
HELX_P HELX_P27 27 ASN C 95  ? ASP C 109 ? ASN C 1288 ASP C 1302 1 ? 15 
HELX_P HELX_P28 28 LEU C 114 ? ASP C 118 ? LEU C 1307 ASP C 1311 5 ? 5  
HELX_P HELX_P29 29 THR C 120 ? LEU C 135 ? THR C 1313 LEU C 1328 1 ? 16 
HELX_P HELX_P30 30 PRO C 141 ? HIS C 152 ? PRO C 1334 HIS C 1345 1 ? 12 
HELX_P HELX_P31 31 ASP C 156 ? LYS C 170 ? ASP C 1349 LYS C 1363 1 ? 15 
HELX_P HELX_P32 32 PRO C 172 ? ASN C 192 ? PRO C 1365 ASN C 1385 1 ? 21 
HELX_P HELX_P33 33 ASN C 192 ? LEU C 197 ? ASN C 1385 LEU C 1390 1 ? 6  
HELX_P HELX_P34 34 THR C 199 ? ARG C 213 ? THR C 1392 ARG C 1406 1 ? 15 
HELX_P HELX_P35 35 ASP C 220 ? GLN C 238 ? ASP C 1413 GLN C 1431 1 ? 19 
HELX_P HELX_P36 36 GLN C 238 ? TYR C 244 ? GLN C 1431 TYR C 1437 1 ? 7  
HELX_P HELX_P37 37 PRO D 57  ? VAL D 62  ? PRO D 1250 VAL D 1255 5 ? 6  
HELX_P HELX_P38 38 PRO D 69  ? GLY D 83  ? PRO D 1262 GLY D 1276 1 ? 15 
HELX_P HELX_P39 39 ASN D 95  ? ASP D 109 ? ASN D 1288 ASP D 1302 1 ? 15 
HELX_P HELX_P40 40 LEU D 114 ? ASP D 118 ? LEU D 1307 ASP D 1311 5 ? 5  
HELX_P HELX_P41 41 THR D 120 ? LEU D 135 ? THR D 1313 LEU D 1328 1 ? 16 
HELX_P HELX_P42 42 PRO D 141 ? HIS D 152 ? PRO D 1334 HIS D 1345 1 ? 12 
HELX_P HELX_P43 43 ASP D 156 ? LYS D 170 ? ASP D 1349 LYS D 1363 1 ? 15 
HELX_P HELX_P44 44 PRO D 172 ? ASN D 192 ? PRO D 1365 ASN D 1385 1 ? 21 
HELX_P HELX_P45 45 ASN D 192 ? LEU D 197 ? ASN D 1385 LEU D 1390 1 ? 6  
HELX_P HELX_P46 46 THR D 199 ? ARG D 213 ? THR D 1392 ARG D 1406 1 ? 15 
HELX_P HELX_P47 47 ASP D 220 ? GLN D 238 ? ASP D 1413 GLN D 1431 1 ? 19 
HELX_P HELX_P48 48 GLN D 238 ? TYR D 244 ? GLN D 1431 TYR D 1437 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE UNX A 1' 
AC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE UNX B 2' 
AC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE UNX C 3' 
AC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE UNX D 4' 
AC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE UNX A 5' 
AC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE UNX B 6' 
AC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE UNX C 7' 
AC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE UNX D 8' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 1 THR A 120 ? THR A 1313 . ? 1_555 ? 
2  AC2 1 THR B 120 ? THR B 1313 . ? 1_555 ? 
3  AC3 1 THR C 120 ? THR C 1313 . ? 1_555 ? 
4  AC4 1 THR D 120 ? THR D 1313 . ? 1_555 ? 
5  AC5 6 GLN A 238 ? GLN A 1431 . ? 1_555 ? 
6  AC5 6 UNX J .   ? UNX C 7    . ? 2_565 ? 
7  AC5 6 GLN C 237 ? GLN C 1430 . ? 2_565 ? 
8  AC5 6 GLN C 238 ? GLN C 1431 . ? 2_565 ? 
9  AC5 6 PRO C 240 ? PRO C 1433 . ? 2_565 ? 
10 AC5 6 PHE C 241 ? PHE C 1434 . ? 2_565 ? 
11 AC6 5 GLN B 238 ? GLN B 1431 . ? 1_555 ? 
12 AC6 5 UNX L .   ? UNX D 8    . ? 2_565 ? 
13 AC6 5 GLN D 238 ? GLN D 1431 . ? 2_565 ? 
14 AC6 5 PRO D 240 ? PRO D 1433 . ? 2_565 ? 
15 AC6 5 PHE D 241 ? PHE D 1434 . ? 2_565 ? 
16 AC7 6 UNX F .   ? UNX A 5    . ? 2_565 ? 
17 AC7 6 GLN A 238 ? GLN A 1431 . ? 2_565 ? 
18 AC7 6 PRO A 240 ? PRO A 1433 . ? 2_565 ? 
19 AC7 6 PHE A 241 ? PHE A 1434 . ? 2_565 ? 
20 AC7 6 GLN C 238 ? GLN C 1431 . ? 1_555 ? 
21 AC7 6 PHE C 241 ? PHE C 1434 . ? 1_555 ? 
22 AC8 5 UNX H .   ? UNX B 6    . ? 2_565 ? 
23 AC8 5 GLN B 238 ? GLN B 1431 . ? 2_565 ? 
24 AC8 5 PRO B 240 ? PRO B 1433 . ? 2_565 ? 
25 AC8 5 PHE B 241 ? PHE B 1434 . ? 2_565 ? 
26 AC8 5 GLN D 238 ? GLN D 1431 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3FK2 
_atom_sites.fract_transf_matrix[1][1]   0.006060 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013811 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013724 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
X 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . TRP A 1 49  ? 39.252 28.750 19.451  1.00 44.12  ? 1242 TRP A N   1 
ATOM   2    C CA  . TRP A 1 49  ? 39.842 27.407 19.326  1.00 71.90  ? 1242 TRP A CA  1 
ATOM   3    C C   . TRP A 1 49  ? 39.371 26.652 18.068  1.00 61.75  ? 1242 TRP A C   1 
ATOM   4    O O   . TRP A 1 49  ? 38.343 26.979 17.481  1.00 47.28  ? 1242 TRP A O   1 
ATOM   5    C CB  . TRP A 1 49  ? 39.614 26.567 20.600  1.00 55.90  ? 1242 TRP A CB  1 
ATOM   6    C CG  . TRP A 1 49  ? 38.167 26.267 20.908  1.00 59.35  ? 1242 TRP A CG  1 
ATOM   7    C CD1 . TRP A 1 49  ? 37.239 27.134 21.416  1.00 68.77  ? 1242 TRP A CD1 1 
ATOM   8    C CD2 . TRP A 1 49  ? 37.490 25.014 20.733  1.00 48.81  ? 1242 TRP A CD2 1 
ATOM   9    N NE1 . TRP A 1 49  ? 36.026 26.501 21.558  1.00 67.96  ? 1242 TRP A NE1 1 
ATOM   10   C CE2 . TRP A 1 49  ? 36.152 25.201 21.147  1.00 52.40  ? 1242 TRP A CE2 1 
ATOM   11   C CE3 . TRP A 1 49  ? 37.882 23.756 20.265  1.00 53.45  ? 1242 TRP A CE3 1 
ATOM   12   C CZ2 . TRP A 1 49  ? 35.205 24.175 21.107  1.00 49.31  ? 1242 TRP A CZ2 1 
ATOM   13   C CZ3 . TRP A 1 49  ? 36.937 22.737 20.222  1.00 56.61  ? 1242 TRP A CZ3 1 
ATOM   14   C CH2 . TRP A 1 49  ? 35.614 22.954 20.639  1.00 50.43  ? 1242 TRP A CH2 1 
ATOM   15   N N   . GLU A 1 50  ? 40.141 25.649 17.655  1.00 59.50  ? 1243 GLU A N   1 
ATOM   16   C CA  . GLU A 1 50  ? 39.838 24.888 16.448  1.00 59.35  ? 1243 GLU A CA  1 
ATOM   17   C C   . GLU A 1 50  ? 39.275 23.525 16.835  1.00 64.85  ? 1243 GLU A C   1 
ATOM   18   O O   . GLU A 1 50  ? 39.495 23.061 17.953  1.00 64.87  ? 1243 GLU A O   1 
ATOM   19   C CB  . GLU A 1 50  ? 41.100 24.724 15.587  1.00 53.71  ? 1243 GLU A CB  1 
ATOM   20   N N   . SER A 1 51  ? 38.550 22.885 15.917  1.00 73.15  ? 1244 SER A N   1 
ATOM   21   C CA  . SER A 1 51  ? 37.935 21.589 16.205  1.00 72.28  ? 1244 SER A CA  1 
ATOM   22   C C   . SER A 1 51  ? 37.642 20.746 14.960  1.00 73.77  ? 1244 SER A C   1 
ATOM   23   O O   . SER A 1 51  ? 37.342 21.274 13.887  1.00 70.17  ? 1244 SER A O   1 
ATOM   24   C CB  . SER A 1 51  ? 36.650 21.776 17.022  1.00 61.77  ? 1244 SER A CB  1 
ATOM   25   O OG  . SER A 1 51  ? 35.995 20.537 17.246  1.00 61.47  ? 1244 SER A OG  1 
ATOM   26   N N   . ASN A 1 52  ? 37.738 19.430 15.125  1.00 61.25  ? 1245 ASN A N   1 
ATOM   27   C CA  . ASN A 1 52  ? 37.375 18.483 14.085  1.00 61.74  ? 1245 ASN A CA  1 
ATOM   28   C C   . ASN A 1 52  ? 35.900 18.109 14.193  1.00 71.08  ? 1245 ASN A C   1 
ATOM   29   O O   . ASN A 1 52  ? 35.326 17.517 13.273  1.00 61.02  ? 1245 ASN A O   1 
ATOM   30   C CB  . ASN A 1 52  ? 38.222 17.214 14.218  1.00 77.26  ? 1245 ASN A CB  1 
ATOM   31   C CG  . ASN A 1 52  ? 37.940 16.450 15.522  1.00 101.36 ? 1245 ASN A CG  1 
ATOM   32   O OD1 . ASN A 1 52  ? 37.429 15.323 15.506  1.00 87.57  ? 1245 ASN A OD1 1 
ATOM   33   N ND2 . ASN A 1 52  ? 38.262 17.072 16.652  1.00 77.21  ? 1245 ASN A ND2 1 
ATOM   34   N N   . TYR A 1 53  ? 35.290 18.451 15.328  1.00 74.47  ? 1246 TYR A N   1 
ATOM   35   C CA  . TYR A 1 53  ? 33.926 18.018 15.630  1.00 68.11  ? 1246 TYR A CA  1 
ATOM   36   C C   . TYR A 1 53  ? 32.914 19.160 15.583  1.00 60.62  ? 1246 TYR A C   1 
ATOM   37   O O   . TYR A 1 53  ? 31.842 19.025 14.994  1.00 52.76  ? 1246 TYR A O   1 
ATOM   38   C CB  . TYR A 1 53  ? 33.870 17.325 16.995  1.00 67.97  ? 1246 TYR A CB  1 
ATOM   39   C CG  . TYR A 1 53  ? 32.639 16.472 17.177  1.00 60.57  ? 1246 TYR A CG  1 
ATOM   40   C CD1 . TYR A 1 53  ? 31.546 16.934 17.898  1.00 56.91  ? 1246 TYR A CD1 1 
ATOM   41   C CD2 . TYR A 1 53  ? 32.564 15.205 16.614  1.00 54.24  ? 1246 TYR A CD2 1 
ATOM   42   C CE1 . TYR A 1 53  ? 30.412 16.153 18.063  1.00 51.38  ? 1246 TYR A CE1 1 
ATOM   43   C CE2 . TYR A 1 53  ? 31.435 14.419 16.769  1.00 68.84  ? 1246 TYR A CE2 1 
ATOM   44   C CZ  . TYR A 1 53  ? 30.361 14.899 17.495  1.00 67.39  ? 1246 TYR A CZ  1 
ATOM   45   O OH  . TYR A 1 53  ? 29.239 14.117 17.647  1.00 62.58  ? 1246 TYR A OH  1 
ATOM   46   N N   . PHE A 1 54  ? 33.253 20.278 16.213  1.00 58.53  ? 1247 PHE A N   1 
ATOM   47   C CA  . PHE A 1 54  ? 32.369 21.436 16.209  1.00 55.39  ? 1247 PHE A CA  1 
ATOM   48   C C   . PHE A 1 54  ? 32.691 22.392 15.069  1.00 52.67  ? 1247 PHE A C   1 
ATOM   49   O O   . PHE A 1 54  ? 33.850 22.559 14.684  1.00 63.61  ? 1247 PHE A O   1 
ATOM   50   C CB  . PHE A 1 54  ? 32.432 22.160 17.547  1.00 36.30  ? 1247 PHE A CB  1 
ATOM   51   C CG  . PHE A 1 54  ? 32.097 21.290 18.710  1.00 47.88  ? 1247 PHE A CG  1 
ATOM   52   C CD1 . PHE A 1 54  ? 33.095 20.650 19.423  1.00 58.59  ? 1247 PHE A CD1 1 
ATOM   53   C CD2 . PHE A 1 54  ? 30.781 21.110 19.096  1.00 52.17  ? 1247 PHE A CD2 1 
ATOM   54   C CE1 . PHE A 1 54  ? 32.786 19.849 20.505  1.00 63.17  ? 1247 PHE A CE1 1 
ATOM   55   C CE2 . PHE A 1 54  ? 30.465 20.309 20.175  1.00 49.45  ? 1247 PHE A CE2 1 
ATOM   56   C CZ  . PHE A 1 54  ? 31.469 19.677 20.880  1.00 54.63  ? 1247 PHE A CZ  1 
ATOM   57   N N   . GLY A 1 55  ? 31.652 23.015 14.530  1.00 48.29  ? 1248 GLY A N   1 
ATOM   58   C CA  . GLY A 1 55  ? 31.816 23.930 13.418  1.00 59.22  ? 1248 GLY A CA  1 
ATOM   59   C C   . GLY A 1 55  ? 32.096 23.238 12.096  1.00 50.44  ? 1248 GLY A C   1 
ATOM   60   O O   . GLY A 1 55  ? 32.488 23.888 11.127  1.00 48.94  ? 1248 GLY A O   1 
ATOM   61   N N   . VAL A 1 56  ? 31.904 21.921 12.055  1.00 45.04  ? 1249 VAL A N   1 
ATOM   62   C CA  . VAL A 1 56  ? 32.066 21.167 10.817  1.00 45.62  ? 1249 VAL A CA  1 
ATOM   63   C C   . VAL A 1 56  ? 30.708 20.676 10.335  1.00 46.66  ? 1249 VAL A C   1 
ATOM   64   O O   . VAL A 1 56  ? 29.795 20.524 11.137  1.00 52.84  ? 1249 VAL A O   1 
ATOM   65   C CB  . VAL A 1 56  ? 33.031 19.983 10.994  1.00 45.43  ? 1249 VAL A CB  1 
ATOM   66   C CG1 . VAL A 1 56  ? 34.244 20.414 11.793  1.00 42.80  ? 1249 VAL A CG1 1 
ATOM   67   C CG2 . VAL A 1 56  ? 32.340 18.821 11.670  1.00 53.26  ? 1249 VAL A CG2 1 
ATOM   68   N N   . PRO A 1 57  ? 30.564 20.449 9.019   1.00 51.01  ? 1250 PRO A N   1 
ATOM   69   C CA  . PRO A 1 57  ? 29.302 20.010 8.412   1.00 55.90  ? 1250 PRO A CA  1 
ATOM   70   C C   . PRO A 1 57  ? 28.641 18.879 9.188   1.00 51.16  ? 1250 PRO A C   1 
ATOM   71   O O   . PRO A 1 57  ? 29.333 18.065 9.803   1.00 45.99  ? 1250 PRO A O   1 
ATOM   72   C CB  . PRO A 1 57  ? 29.740 19.522 7.034   1.00 44.10  ? 1250 PRO A CB  1 
ATOM   73   C CG  . PRO A 1 57  ? 30.897 20.374 6.709   1.00 51.08  ? 1250 PRO A CG  1 
ATOM   74   C CD  . PRO A 1 57  ? 31.614 20.642 8.005   1.00 49.05  ? 1250 PRO A CD  1 
ATOM   75   N N   . LEU A 1 58  ? 27.314 18.829 9.152   1.00 44.28  ? 1251 LEU A N   1 
ATOM   76   C CA  . LEU A 1 58  ? 26.566 17.862 9.950   1.00 50.48  ? 1251 LEU A CA  1 
ATOM   77   C C   . LEU A 1 58  ? 26.884 16.414 9.574   1.00 45.44  ? 1251 LEU A C   1 
ATOM   78   O O   . LEU A 1 58  ? 27.058 15.558 10.441  1.00 45.88  ? 1251 LEU A O   1 
ATOM   79   C CB  . LEU A 1 58  ? 25.063 18.129 9.850   1.00 43.41  ? 1251 LEU A CB  1 
ATOM   80   C CG  . LEU A 1 58  ? 24.126 17.195 10.615  1.00 38.59  ? 1251 LEU A CG  1 
ATOM   81   C CD1 . LEU A 1 58  ? 24.396 17.258 12.110  1.00 31.02  ? 1251 LEU A CD1 1 
ATOM   82   C CD2 . LEU A 1 58  ? 22.679 17.550 10.302  1.00 37.35  ? 1251 LEU A CD2 1 
ATOM   83   N N   . THR A 1 59  ? 26.975 16.150 8.279   1.00 46.96  ? 1252 THR A N   1 
ATOM   84   C CA  . THR A 1 59  ? 27.253 14.803 7.787   1.00 57.91  ? 1252 THR A CA  1 
ATOM   85   C C   . THR A 1 59  ? 28.602 14.241 8.258   1.00 58.78  ? 1252 THR A C   1 
ATOM   86   O O   . THR A 1 59  ? 28.785 13.022 8.319   1.00 57.83  ? 1252 THR A O   1 
ATOM   87   C CB  . THR A 1 59  ? 27.182 14.758 6.249   1.00 59.38  ? 1252 THR A CB  1 
ATOM   88   O OG1 . THR A 1 59  ? 27.980 15.820 5.704   1.00 54.67  ? 1252 THR A OG1 1 
ATOM   89   C CG2 . THR A 1 59  ? 25.730 14.909 5.783   1.00 46.70  ? 1252 THR A CG2 1 
ATOM   90   N N   . THR A 1 60  ? 29.534 15.135 8.585   1.00 58.65  ? 1253 THR A N   1 
ATOM   91   C CA  . THR A 1 60  ? 30.867 14.753 9.048   1.00 52.11  ? 1253 THR A CA  1 
ATOM   92   C C   . THR A 1 60  ? 30.841 14.081 10.424  1.00 57.74  ? 1253 THR A C   1 
ATOM   93   O O   . THR A 1 60  ? 31.730 13.289 10.756  1.00 51.34  ? 1253 THR A O   1 
ATOM   94   C CB  . THR A 1 60  ? 31.800 15.981 9.101   1.00 57.57  ? 1253 THR A CB  1 
ATOM   95   O OG1 . THR A 1 60  ? 32.254 16.295 7.781   1.00 56.50  ? 1253 THR A OG1 1 
ATOM   96   C CG2 . THR A 1 60  ? 33.004 15.721 9.997   1.00 54.30  ? 1253 THR A CG2 1 
ATOM   97   N N   . VAL A 1 61  ? 29.820 14.400 11.218  1.00 57.67  ? 1254 VAL A N   1 
ATOM   98   C CA  . VAL A 1 61  ? 29.717 13.881 12.581  1.00 47.43  ? 1254 VAL A CA  1 
ATOM   99   C C   . VAL A 1 61  ? 28.513 12.954 12.782  1.00 44.77  ? 1254 VAL A C   1 
ATOM   100  O O   . VAL A 1 61  ? 28.093 12.698 13.909  1.00 42.08  ? 1254 VAL A O   1 
ATOM   101  C CB  . VAL A 1 61  ? 29.676 15.023 13.622  1.00 49.54  ? 1254 VAL A CB  1 
ATOM   102  C CG1 . VAL A 1 61  ? 30.980 15.790 13.617  1.00 55.69  ? 1254 VAL A CG1 1 
ATOM   103  C CG2 . VAL A 1 61  ? 28.513 15.960 13.346  1.00 55.16  ? 1254 VAL A CG2 1 
ATOM   104  N N   . VAL A 1 62  ? 27.954 12.458 11.685  1.00 49.69  ? 1255 VAL A N   1 
ATOM   105  C CA  . VAL A 1 62  ? 26.890 11.457 11.752  1.00 50.04  ? 1255 VAL A CA  1 
ATOM   106  C C   . VAL A 1 62  ? 27.019 10.443 10.627  1.00 61.62  ? 1255 VAL A C   1 
ATOM   107  O O   . VAL A 1 62  ? 27.565 10.741 9.563   1.00 75.78  ? 1255 VAL A O   1 
ATOM   108  C CB  . VAL A 1 62  ? 25.460 12.078 11.688  1.00 54.24  ? 1255 VAL A CB  1 
ATOM   109  C CG1 . VAL A 1 62  ? 25.272 13.141 12.775  1.00 52.67  ? 1255 VAL A CG1 1 
ATOM   110  C CG2 . VAL A 1 62  ? 25.162 12.644 10.301  1.00 31.55  ? 1255 VAL A CG2 1 
ATOM   111  N N   . THR A 1 63  ? 26.510 9.243  10.875  1.00 65.55  ? 1256 THR A N   1 
ATOM   112  C CA  . THR A 1 63  ? 26.460 8.192  9.870   1.00 62.82  ? 1256 THR A CA  1 
ATOM   113  C C   . THR A 1 63  ? 24.998 7.795  9.707   1.00 67.23  ? 1256 THR A C   1 
ATOM   114  O O   . THR A 1 63  ? 24.180 8.112  10.567  1.00 66.71  ? 1256 THR A O   1 
ATOM   115  C CB  . THR A 1 63  ? 27.292 6.973  10.309  1.00 66.34  ? 1256 THR A CB  1 
ATOM   116  O OG1 . THR A 1 63  ? 26.604 6.264  11.348  1.00 65.20  ? 1256 THR A OG1 1 
ATOM   117  C CG2 . THR A 1 63  ? 28.654 7.420  10.824  1.00 50.08  ? 1256 THR A CG2 1 
ATOM   118  N N   . PRO A 1 64  ? 24.649 7.119  8.598   1.00 81.17  ? 1257 PRO A N   1 
ATOM   119  C CA  . PRO A 1 64  ? 23.244 6.706  8.467   1.00 74.59  ? 1257 PRO A CA  1 
ATOM   120  C C   . PRO A 1 64  ? 22.861 5.658  9.511   1.00 71.18  ? 1257 PRO A C   1 
ATOM   121  O O   . PRO A 1 64  ? 21.672 5.470  9.779   1.00 70.72  ? 1257 PRO A O   1 
ATOM   122  C CB  . PRO A 1 64  ? 23.173 6.111  7.052   1.00 49.73  ? 1257 PRO A CB  1 
ATOM   123  C CG  . PRO A 1 64  ? 24.346 6.705  6.327   1.00 52.75  ? 1257 PRO A CG  1 
ATOM   124  C CD  . PRO A 1 64  ? 25.421 6.853  7.371   1.00 70.45  ? 1257 PRO A CD  1 
ATOM   125  N N   . GLU A 1 65  ? 23.861 5.003  10.098  1.00 64.59  ? 1258 GLU A N   1 
ATOM   126  C CA  . GLU A 1 65  ? 23.628 3.937  11.070  1.00 68.37  ? 1258 GLU A CA  1 
ATOM   127  C C   . GLU A 1 65  ? 23.568 4.484  12.495  1.00 72.85  ? 1258 GLU A C   1 
ATOM   128  O O   . GLU A 1 65  ? 22.927 3.898  13.375  1.00 70.85  ? 1258 GLU A O   1 
ATOM   129  C CB  . GLU A 1 65  ? 24.716 2.857  10.962  1.00 74.13  ? 1258 GLU A CB  1 
ATOM   130  C CG  . GLU A 1 65  ? 24.944 2.297  9.547   1.00 89.00  ? 1258 GLU A CG  1 
ATOM   131  C CD  . GLU A 1 65  ? 26.091 2.982  8.798   1.00 95.05  ? 1258 GLU A CD  1 
ATOM   132  O OE1 . GLU A 1 65  ? 27.222 3.016  9.335   1.00 92.78  ? 1258 GLU A OE1 1 
ATOM   133  O OE2 . GLU A 1 65  ? 25.865 3.469  7.663   1.00 74.82  ? 1258 GLU A OE2 1 
ATOM   134  N N   . LYS A 1 66  ? 24.254 5.604  12.712  1.00 69.39  ? 1259 LYS A N   1 
ATOM   135  C CA  . LYS A 1 66  ? 24.248 6.308  13.993  1.00 67.79  ? 1259 LYS A CA  1 
ATOM   136  C C   . LYS A 1 66  ? 24.054 7.807  13.720  1.00 63.14  ? 1259 LYS A C   1 
ATOM   137  O O   . LYS A 1 66  ? 25.001 8.590  13.831  1.00 51.88  ? 1259 LYS A O   1 
ATOM   138  C CB  . LYS A 1 66  ? 25.552 6.043  14.760  1.00 40.27  ? 1259 LYS A CB  1 
ATOM   139  N N   . PRO A 1 67  ? 22.809 8.204  13.379  1.00 62.66  ? 1260 PRO A N   1 
ATOM   140  C CA  . PRO A 1 67  ? 22.422 9.480  12.752  1.00 58.13  ? 1260 PRO A CA  1 
ATOM   141  C C   . PRO A 1 67  ? 22.453 10.681 13.687  1.00 54.30  ? 1260 PRO A C   1 
ATOM   142  O O   . PRO A 1 67  ? 22.490 11.823 13.226  1.00 55.74  ? 1260 PRO A O   1 
ATOM   143  C CB  . PRO A 1 67  ? 20.968 9.232  12.301  1.00 47.28  ? 1260 PRO A CB  1 
ATOM   144  C CG  . PRO A 1 67  ? 20.679 7.786  12.599  1.00 57.49  ? 1260 PRO A CG  1 
ATOM   145  C CD  . PRO A 1 67  ? 21.626 7.390  13.687  1.00 53.47  ? 1260 PRO A CD  1 
ATOM   146  N N   . ILE A 1 68  ? 22.416 10.422 14.986  1.00 53.66  ? 1261 ILE A N   1 
ATOM   147  C CA  . ILE A 1 68  ? 22.482 11.484 15.976  1.00 49.13  ? 1261 ILE A CA  1 
ATOM   148  C C   . ILE A 1 68  ? 23.935 11.703 16.390  1.00 44.64  ? 1261 ILE A C   1 
ATOM   149  O O   . ILE A 1 68  ? 24.625 10.763 16.780  1.00 46.37  ? 1261 ILE A O   1 
ATOM   150  C CB  . ILE A 1 68  ? 21.604 11.150 17.222  1.00 41.45  ? 1261 ILE A CB  1 
ATOM   151  C CG1 . ILE A 1 68  ? 20.249 10.591 16.782  1.00 37.65  ? 1261 ILE A CG1 1 
ATOM   152  C CG2 . ILE A 1 68  ? 21.400 12.378 18.097  1.00 36.35  ? 1261 ILE A CG2 1 
ATOM   153  C CD1 . ILE A 1 68  ? 19.475 11.511 15.856  1.00 38.03  ? 1261 ILE A CD1 1 
ATOM   154  N N   . PRO A 1 69  ? 24.411 12.946 16.281  1.00 42.30  ? 1262 PRO A N   1 
ATOM   155  C CA  . PRO A 1 69  ? 25.752 13.266 16.768  1.00 40.33  ? 1262 PRO A CA  1 
ATOM   156  C C   . PRO A 1 69  ? 25.929 12.790 18.206  1.00 44.35  ? 1262 PRO A C   1 
ATOM   157  O O   . PRO A 1 69  ? 25.069 13.042 19.044  1.00 51.49  ? 1262 PRO A O   1 
ATOM   158  C CB  . PRO A 1 69  ? 25.781 14.791 16.705  1.00 35.51  ? 1262 PRO A CB  1 
ATOM   159  C CG  . PRO A 1 69  ? 24.856 15.122 15.599  1.00 42.75  ? 1262 PRO A CG  1 
ATOM   160  C CD  . PRO A 1 69  ? 23.760 14.098 15.640  1.00 39.94  ? 1262 PRO A CD  1 
ATOM   161  N N   . ILE A 1 70  ? 27.034 12.111 18.488  1.00 47.95  ? 1263 ILE A N   1 
ATOM   162  C CA  . ILE A 1 70  ? 27.282 11.591 19.828  1.00 45.59  ? 1263 ILE A CA  1 
ATOM   163  C C   . ILE A 1 70  ? 27.209 12.683 20.903  1.00 45.67  ? 1263 ILE A C   1 
ATOM   164  O O   . ILE A 1 70  ? 26.671 12.456 21.985  1.00 48.40  ? 1263 ILE A O   1 
ATOM   165  C CB  . ILE A 1 70  ? 28.623 10.815 19.897  1.00 49.57  ? 1263 ILE A CB  1 
ATOM   166  C CG1 . ILE A 1 70  ? 28.435 9.396  19.361  1.00 48.40  ? 1263 ILE A CG1 1 
ATOM   167  C CG2 . ILE A 1 70  ? 29.153 10.747 21.320  1.00 55.46  ? 1263 ILE A CG2 1 
ATOM   168  C CD1 . ILE A 1 70  ? 28.104 9.336  17.880  1.00 69.65  ? 1263 ILE A CD1 1 
ATOM   169  N N   . PHE A 1 71  ? 27.733 13.868 20.604  1.00 41.95  ? 1264 PHE A N   1 
ATOM   170  C CA  . PHE A 1 71  ? 27.684 14.976 21.554  1.00 42.22  ? 1264 PHE A CA  1 
ATOM   171  C C   . PHE A 1 71  ? 26.242 15.321 21.906  1.00 47.53  ? 1264 PHE A C   1 
ATOM   172  O O   . PHE A 1 71  ? 25.932 15.598 23.071  1.00 42.71  ? 1264 PHE A O   1 
ATOM   173  C CB  . PHE A 1 71  ? 28.408 16.213 21.005  1.00 40.54  ? 1264 PHE A CB  1 
ATOM   174  C CG  . PHE A 1 71  ? 28.382 17.394 21.934  1.00 37.84  ? 1264 PHE A CG  1 
ATOM   175  C CD1 . PHE A 1 71  ? 29.133 17.390 23.098  1.00 40.71  ? 1264 PHE A CD1 1 
ATOM   176  C CD2 . PHE A 1 71  ? 27.607 18.507 21.648  1.00 38.77  ? 1264 PHE A CD2 1 
ATOM   177  C CE1 . PHE A 1 71  ? 29.119 18.476 23.966  1.00 40.46  ? 1264 PHE A CE1 1 
ATOM   178  C CE2 . PHE A 1 71  ? 27.586 19.601 22.510  1.00 43.41  ? 1264 PHE A CE2 1 
ATOM   179  C CZ  . PHE A 1 71  ? 28.347 19.585 23.672  1.00 45.45  ? 1264 PHE A CZ  1 
ATOM   180  N N   . ILE A 1 72  ? 25.362 15.296 20.903  1.00 36.72  ? 1265 ILE A N   1 
ATOM   181  C CA  . ILE A 1 72  ? 23.952 15.611 21.122  1.00 38.32  ? 1265 ILE A CA  1 
ATOM   182  C C   . ILE A 1 72  ? 23.292 14.557 21.999  1.00 41.12  ? 1265 ILE A C   1 
ATOM   183  O O   . ILE A 1 72  ? 22.526 14.889 22.904  1.00 45.26  ? 1265 ILE A O   1 
ATOM   184  C CB  . ILE A 1 72  ? 23.175 15.778 19.801  1.00 36.11  ? 1265 ILE A CB  1 
ATOM   185  C CG1 . ILE A 1 72  ? 23.653 17.022 19.056  1.00 32.69  ? 1265 ILE A CG1 1 
ATOM   186  C CG2 . ILE A 1 72  ? 21.697 15.908 20.068  1.00 36.84  ? 1265 ILE A CG2 1 
ATOM   187  C CD1 . ILE A 1 72  ? 23.627 18.277 19.891  1.00 32.62  ? 1265 ILE A CD1 1 
ATOM   188  N N   . GLU A 1 73  ? 23.599 13.289 21.740  1.00 37.83  ? 1266 GLU A N   1 
ATOM   189  C CA  . GLU A 1 73  ? 23.145 12.215 22.620  1.00 46.99  ? 1266 GLU A CA  1 
ATOM   190  C C   . GLU A 1 73  ? 23.572 12.411 24.086  1.00 53.27  ? 1266 GLU A C   1 
ATOM   191  O O   . GLU A 1 73  ? 22.740 12.329 24.990  1.00 47.99  ? 1266 GLU A O   1 
ATOM   192  C CB  . GLU A 1 73  ? 23.592 10.847 22.102  1.00 51.57  ? 1266 GLU A CB  1 
ATOM   193  C CG  . GLU A 1 73  ? 22.501 10.112 21.335  1.00 74.53  ? 1266 GLU A CG  1 
ATOM   194  C CD  . GLU A 1 73  ? 22.983 8.824  20.694  1.00 83.16  ? 1266 GLU A CD  1 
ATOM   195  O OE1 . GLU A 1 73  ? 22.136 7.942  20.437  1.00 71.23  ? 1266 GLU A OE1 1 
ATOM   196  O OE2 . GLU A 1 73  ? 24.202 8.698  20.442  1.00 80.06  ? 1266 GLU A OE2 1 
ATOM   197  N N   . ARG A 1 74  ? 24.856 12.671 24.323  1.00 44.05  ? 1267 ARG A N   1 
ATOM   198  C CA  . ARG A 1 74  ? 25.339 12.877 25.687  1.00 50.10  ? 1267 ARG A CA  1 
ATOM   199  C C   . ARG A 1 74  ? 24.554 13.958 26.398  1.00 53.24  ? 1267 ARG A C   1 
ATOM   200  O O   . ARG A 1 74  ? 24.086 13.759 27.516  1.00 63.27  ? 1267 ARG A O   1 
ATOM   201  C CB  . ARG A 1 74  ? 26.817 13.269 25.715  1.00 52.93  ? 1267 ARG A CB  1 
ATOM   202  C CG  . ARG A 1 74  ? 27.755 12.152 25.386  1.00 63.55  ? 1267 ARG A CG  1 
ATOM   203  C CD  . ARG A 1 74  ? 27.457 10.897 26.182  1.00 55.43  ? 1267 ARG A CD  1 
ATOM   204  N NE  . ARG A 1 74  ? 27.921 9.739  25.434  1.00 59.34  ? 1267 ARG A NE  1 
ATOM   205  C CZ  . ARG A 1 74  ? 29.184 9.575  25.051  1.00 82.81  ? 1267 ARG A CZ  1 
ATOM   206  N NH1 . ARG A 1 74  ? 30.100 10.492 25.362  1.00 63.66  ? 1267 ARG A NH1 1 
ATOM   207  N NH2 . ARG A 1 74  ? 29.533 8.497  24.359  1.00 91.55  ? 1267 ARG A NH2 1 
ATOM   208  N N   . CYS A 1 75  ? 24.430 15.109 25.752  1.00 41.33  ? 1268 CYS A N   1 
ATOM   209  C CA  . CYS A 1 75  ? 23.824 16.266 26.388  1.00 36.16  ? 1268 CYS A CA  1 
ATOM   210  C C   . CYS A 1 75  ? 22.342 16.054 26.642  1.00 42.14  ? 1268 CYS A C   1 
ATOM   211  O O   . CYS A 1 75  ? 21.846 16.339 27.731  1.00 41.95  ? 1268 CYS A O   1 
ATOM   212  C CB  . CYS A 1 75  ? 24.032 17.514 25.537  1.00 40.66  ? 1268 CYS A CB  1 
ATOM   213  S SG  . CYS A 1 75  ? 25.745 17.958 25.338  1.00 36.11  ? 1268 CYS A SG  1 
ATOM   214  N N   . ILE A 1 76  ? 21.632 15.556 25.634  1.00 38.15  ? 1269 ILE A N   1 
ATOM   215  C CA  . ILE A 1 76  ? 20.187 15.398 25.755  1.00 40.31  ? 1269 ILE A CA  1 
ATOM   216  C C   . ILE A 1 76  ? 19.853 14.322 26.778  1.00 44.10  ? 1269 ILE A C   1 
ATOM   217  O O   . ILE A 1 76  ? 18.959 14.498 27.605  1.00 46.54  ? 1269 ILE A O   1 
ATOM   218  C CB  . ILE A 1 76  ? 19.511 15.107 24.392  1.00 43.09  ? 1269 ILE A CB  1 
ATOM   219  C CG1 . ILE A 1 76  ? 19.485 16.378 23.536  1.00 40.72  ? 1269 ILE A CG1 1 
ATOM   220  C CG2 . ILE A 1 76  ? 18.095 14.585 24.588  1.00 28.67  ? 1269 ILE A CG2 1 
ATOM   221  C CD1 . ILE A 1 76  ? 18.548 16.307 22.349  1.00 34.54  ? 1269 ILE A CD1 1 
ATOM   222  N N   . GLU A 1 77  ? 20.590 13.217 26.734  1.00 46.03  ? 1270 GLU A N   1 
ATOM   223  C CA  . GLU A 1 77  ? 20.384 12.130 27.685  1.00 36.04  ? 1270 GLU A CA  1 
ATOM   224  C C   . GLU A 1 77  ? 20.726 12.561 29.111  1.00 47.03  ? 1270 GLU A C   1 
ATOM   225  O O   . GLU A 1 77  ? 20.085 12.132 30.072  1.00 60.09  ? 1270 GLU A O   1 
ATOM   226  C CB  . GLU A 1 77  ? 21.178 10.889 27.275  1.00 28.61  ? 1270 GLU A CB  1 
ATOM   227  C CG  . GLU A 1 77  ? 20.549 10.142 26.098  1.00 44.13  ? 1270 GLU A CG  1 
ATOM   228  C CD  . GLU A 1 77  ? 21.360 8.942  25.639  1.00 62.87  ? 1270 GLU A CD  1 
ATOM   229  O OE1 . GLU A 1 77  ? 22.035 8.310  26.481  1.00 49.66  ? 1270 GLU A OE1 1 
ATOM   230  O OE2 . GLU A 1 77  ? 21.315 8.627  24.428  1.00 73.19  ? 1270 GLU A OE2 1 
ATOM   231  N N   . TYR A 1 78  ? 21.721 13.427 29.246  1.00 37.59  ? 1271 TYR A N   1 
ATOM   232  C CA  . TYR A 1 78  ? 22.127 13.922 30.552  1.00 39.29  ? 1271 TYR A CA  1 
ATOM   233  C C   . TYR A 1 78  ? 21.133 14.952 31.062  1.00 45.40  ? 1271 TYR A C   1 
ATOM   234  O O   . TYR A 1 78  ? 20.790 14.972 32.245  1.00 49.15  ? 1271 TYR A O   1 
ATOM   235  C CB  . TYR A 1 78  ? 23.524 14.539 30.476  1.00 41.03  ? 1271 TYR A CB  1 
ATOM   236  C CG  . TYR A 1 78  ? 24.006 15.159 31.769  1.00 46.95  ? 1271 TYR A CG  1 
ATOM   237  C CD1 . TYR A 1 78  ? 24.550 14.375 32.786  1.00 44.44  ? 1271 TYR A CD1 1 
ATOM   238  C CD2 . TYR A 1 78  ? 23.933 16.529 31.968  1.00 42.19  ? 1271 TYR A CD2 1 
ATOM   239  C CE1 . TYR A 1 78  ? 24.997 14.945 33.972  1.00 39.84  ? 1271 TYR A CE1 1 
ATOM   240  C CE2 . TYR A 1 78  ? 24.374 17.105 33.150  1.00 50.08  ? 1271 TYR A CE2 1 
ATOM   241  C CZ  . TYR A 1 78  ? 24.903 16.307 34.145  1.00 47.71  ? 1271 TYR A CZ  1 
ATOM   242  O OH  . TYR A 1 78  ? 25.344 16.885 35.308  1.00 42.90  ? 1271 TYR A OH  1 
ATOM   243  N N   . ILE A 1 79  ? 20.677 15.814 30.161  1.00 46.05  ? 1272 ILE A N   1 
ATOM   244  C CA  . ILE A 1 79  ? 19.689 16.828 30.503  1.00 43.35  ? 1272 ILE A CA  1 
ATOM   245  C C   . ILE A 1 79  ? 18.356 16.186 30.874  1.00 46.62  ? 1272 ILE A C   1 
ATOM   246  O O   . ILE A 1 79  ? 17.651 16.668 31.758  1.00 44.04  ? 1272 ILE A O   1 
ATOM   247  C CB  . ILE A 1 79  ? 19.492 17.825 29.348  1.00 42.83  ? 1272 ILE A CB  1 
ATOM   248  C CG1 . ILE A 1 79  ? 20.641 18.837 29.326  1.00 46.28  ? 1272 ILE A CG1 1 
ATOM   249  C CG2 . ILE A 1 79  ? 18.174 18.554 29.494  1.00 34.22  ? 1272 ILE A CG2 1 
ATOM   250  C CD1 . ILE A 1 79  ? 20.881 19.450 27.954  1.00 38.33  ? 1272 ILE A CD1 1 
ATOM   251  N N   . GLU A 1 80  ? 18.015 15.091 30.203  1.00 40.60  ? 1273 GLU A N   1 
ATOM   252  C CA  . GLU A 1 80  ? 16.784 14.379 30.520  1.00 41.53  ? 1273 GLU A CA  1 
ATOM   253  C C   . GLU A 1 80  ? 16.877 13.701 31.888  1.00 51.13  ? 1273 GLU A C   1 
ATOM   254  O O   . GLU A 1 80  ? 15.878 13.578 32.603  1.00 53.89  ? 1273 GLU A O   1 
ATOM   255  C CB  . GLU A 1 80  ? 16.420 13.384 29.408  1.00 32.18  ? 1273 GLU A CB  1 
ATOM   256  C CG  . GLU A 1 80  ? 15.720 14.043 28.234  1.00 30.80  ? 1273 GLU A CG  1 
ATOM   257  C CD  . GLU A 1 80  ? 15.229 13.063 27.193  1.00 45.83  ? 1273 GLU A CD  1 
ATOM   258  O OE1 . GLU A 1 80  ? 15.257 11.840 27.468  1.00 39.76  ? 1273 GLU A OE1 1 
ATOM   259  O OE2 . GLU A 1 80  ? 14.806 13.522 26.100  1.00 36.85  ? 1273 GLU A OE2 1 
ATOM   260  N N   . ALA A 1 81  ? 18.086 13.292 32.261  1.00 51.36  ? 1274 ALA A N   1 
ATOM   261  C CA  . ALA A 1 81  ? 18.293 12.617 33.533  1.00 48.69  ? 1274 ALA A CA  1 
ATOM   262  C C   . ALA A 1 81  ? 18.633 13.576 34.669  1.00 39.72  ? 1274 ALA A C   1 
ATOM   263  O O   . ALA A 1 81  ? 18.606 13.191 35.832  1.00 57.25  ? 1274 ALA A O   1 
ATOM   264  C CB  . ALA A 1 81  ? 19.366 11.538 33.400  1.00 44.48  ? 1274 ALA A CB  1 
ATOM   265  N N   . THR A 1 82  ? 18.945 14.823 34.340  1.00 44.43  ? 1275 THR A N   1 
ATOM   266  C CA  . THR A 1 82  ? 19.409 15.766 35.362  1.00 51.94  ? 1275 THR A CA  1 
ATOM   267  C C   . THR A 1 82  ? 18.627 17.092 35.436  1.00 56.48  ? 1275 THR A C   1 
ATOM   268  O O   . THR A 1 82  ? 18.540 17.706 36.505  1.00 54.61  ? 1275 THR A O   1 
ATOM   269  C CB  . THR A 1 82  ? 20.935 16.062 35.230  1.00 29.58  ? 1275 THR A CB  1 
ATOM   270  N N   . GLY A 1 83  ? 18.044 17.525 34.319  1.00 59.13  ? 1276 GLY A N   1 
ATOM   271  C CA  . GLY A 1 83  ? 17.493 18.873 34.249  1.00 56.08  ? 1276 GLY A CA  1 
ATOM   272  C C   . GLY A 1 83  ? 16.049 19.125 33.821  1.00 54.88  ? 1276 GLY A C   1 
ATOM   273  O O   . GLY A 1 83  ? 15.682 20.280 33.580  1.00 43.26  ? 1276 GLY A O   1 
ATOM   274  N N   . LEU A 1 84  ? 15.225 18.079 33.737  1.00 40.69  ? 1277 LEU A N   1 
ATOM   275  C CA  . LEU A 1 84  ? 13.825 18.238 33.338  1.00 24.96  ? 1277 LEU A CA  1 
ATOM   276  C C   . LEU A 1 84  ? 12.984 19.098 34.300  1.00 35.43  ? 1277 LEU A C   1 
ATOM   277  O O   . LEU A 1 84  ? 11.867 19.507 33.963  1.00 31.47  ? 1277 LEU A O   1 
ATOM   278  C CB  . LEU A 1 84  ? 13.155 16.872 33.161  1.00 26.89  ? 1277 LEU A CB  1 
ATOM   279  C CG  . LEU A 1 84  ? 13.485 16.078 31.901  1.00 40.11  ? 1277 LEU A CG  1 
ATOM   280  C CD1 . LEU A 1 84  ? 12.509 14.917 31.759  1.00 39.81  ? 1277 LEU A CD1 1 
ATOM   281  C CD2 . LEU A 1 84  ? 13.453 16.978 30.671  1.00 30.49  ? 1277 LEU A CD2 1 
ATOM   282  N N   . SER A 1 85  ? 13.506 19.362 35.495  1.00 35.98  ? 1278 SER A N   1 
ATOM   283  C CA  . SER A 1 85  ? 12.769 20.146 36.482  1.00 35.18  ? 1278 SER A CA  1 
ATOM   284  C C   . SER A 1 85  ? 13.386 21.528 36.730  1.00 39.62  ? 1278 SER A C   1 
ATOM   285  O O   . SER A 1 85  ? 12.878 22.308 37.543  1.00 34.40  ? 1278 SER A O   1 
ATOM   286  C CB  . SER A 1 85  ? 12.654 19.380 37.803  1.00 40.61  ? 1278 SER A CB  1 
ATOM   287  O OG  . SER A 1 85  ? 11.926 18.174 37.638  1.00 47.11  ? 1278 SER A OG  1 
ATOM   288  N N   . THR A 1 86  ? 14.473 21.840 36.030  1.00 31.65  ? 1279 THR A N   1 
ATOM   289  C CA  . THR A 1 86  ? 15.148 23.114 36.252  1.00 36.70  ? 1279 THR A CA  1 
ATOM   290  C C   . THR A 1 86  ? 14.398 24.276 35.600  1.00 38.56  ? 1279 THR A C   1 
ATOM   291  O O   . THR A 1 86  ? 14.126 24.252 34.398  1.00 40.04  ? 1279 THR A O   1 
ATOM   292  C CB  . THR A 1 86  ? 16.607 23.077 35.765  1.00 34.62  ? 1279 THR A CB  1 
ATOM   293  O OG1 . THR A 1 86  ? 16.665 23.456 34.389  1.00 53.63  ? 1279 THR A OG1 1 
ATOM   294  C CG2 . THR A 1 86  ? 17.189 21.681 35.936  1.00 36.50  ? 1279 THR A CG2 1 
ATOM   295  N N   . GLU A 1 87  ? 14.055 25.287 36.396  1.00 41.68  ? 1280 GLU A N   1 
ATOM   296  C CA  . GLU A 1 87  ? 13.316 26.435 35.873  1.00 34.45  ? 1280 GLU A CA  1 
ATOM   297  C C   . GLU A 1 87  ? 14.059 27.057 34.716  1.00 35.07  ? 1280 GLU A C   1 
ATOM   298  O O   . GLU A 1 87  ? 15.276 27.228 34.763  1.00 38.37  ? 1280 GLU A O   1 
ATOM   299  C CB  . GLU A 1 87  ? 13.052 27.491 36.946  1.00 28.78  ? 1280 GLU A CB  1 
ATOM   300  C CG  . GLU A 1 87  ? 11.726 27.319 37.674  1.00 50.90  ? 1280 GLU A CG  1 
ATOM   301  C CD  . GLU A 1 87  ? 11.400 28.481 38.605  1.00 68.91  ? 1280 GLU A CD  1 
ATOM   302  O OE1 . GLU A 1 87  ? 10.318 28.447 39.246  1.00 64.20  ? 1280 GLU A OE1 1 
ATOM   303  O OE2 . GLU A 1 87  ? 12.225 29.421 38.696  1.00 56.87  ? 1280 GLU A OE2 1 
ATOM   304  N N   . GLY A 1 88  ? 13.312 27.371 33.665  1.00 46.07  ? 1281 GLY A N   1 
ATOM   305  C CA  . GLY A 1 88  ? 13.843 28.074 32.510  1.00 41.04  ? 1281 GLY A CA  1 
ATOM   306  C C   . GLY A 1 88  ? 14.933 27.365 31.724  1.00 35.25  ? 1281 GLY A C   1 
ATOM   307  O O   . GLY A 1 88  ? 15.669 28.009 30.985  1.00 43.35  ? 1281 GLY A O   1 
ATOM   308  N N   . ILE A 1 89  ? 15.043 26.048 31.866  1.00 32.32  ? 1282 ILE A N   1 
ATOM   309  C CA  . ILE A 1 89  ? 16.040 25.316 31.099  1.00 33.71  ? 1282 ILE A CA  1 
ATOM   310  C C   . ILE A 1 89  ? 15.961 25.699 29.614  1.00 39.39  ? 1282 ILE A C   1 
ATOM   311  O O   . ILE A 1 89  ? 14.869 25.801 29.044  1.00 25.77  ? 1282 ILE A O   1 
ATOM   312  C CB  . ILE A 1 89  ? 15.903 23.793 31.271  1.00 31.14  ? 1282 ILE A CB  1 
ATOM   313  C CG1 . ILE A 1 89  ? 17.160 23.102 30.739  1.00 25.91  ? 1282 ILE A CG1 1 
ATOM   314  C CG2 . ILE A 1 89  ? 14.619 23.285 30.600  1.00 16.22  ? 1282 ILE A CG2 1 
ATOM   315  C CD1 . ILE A 1 89  ? 17.130 21.616 30.832  1.00 41.71  ? 1282 ILE A CD1 1 
ATOM   316  N N   . TYR A 1 90  ? 17.135 25.921 29.018  1.00 42.93  ? 1283 TYR A N   1 
ATOM   317  C CA  . TYR A 1 90  ? 17.296 26.354 27.622  1.00 32.10  ? 1283 TYR A CA  1 
ATOM   318  C C   . TYR A 1 90  ? 17.059 27.851 27.408  1.00 40.65  ? 1283 TYR A C   1 
ATOM   319  O O   . TYR A 1 90  ? 17.580 28.435 26.462  1.00 45.97  ? 1283 TYR A O   1 
ATOM   320  C CB  . TYR A 1 90  ? 16.424 25.545 26.665  1.00 31.16  ? 1283 TYR A CB  1 
ATOM   321  C CG  . TYR A 1 90  ? 16.878 24.124 26.480  1.00 33.09  ? 1283 TYR A CG  1 
ATOM   322  C CD1 . TYR A 1 90  ? 16.020 23.069 26.731  1.00 30.50  ? 1283 TYR A CD1 1 
ATOM   323  C CD2 . TYR A 1 90  ? 18.170 23.834 26.061  1.00 34.52  ? 1283 TYR A CD2 1 
ATOM   324  C CE1 . TYR A 1 90  ? 16.430 21.765 26.565  1.00 35.94  ? 1283 TYR A CE1 1 
ATOM   325  C CE2 . TYR A 1 90  ? 18.589 22.530 25.889  1.00 32.06  ? 1283 TYR A CE2 1 
ATOM   326  C CZ  . TYR A 1 90  ? 17.712 21.503 26.144  1.00 32.71  ? 1283 TYR A CZ  1 
ATOM   327  O OH  . TYR A 1 90  ? 18.111 20.207 25.979  1.00 32.22  ? 1283 TYR A OH  1 
ATOM   328  N N   . ARG A 1 91  ? 16.269 28.467 28.281  1.00 34.97  ? 1284 ARG A N   1 
ATOM   329  C CA  . ARG A 1 91  ? 16.010 29.903 28.195  1.00 39.37  ? 1284 ARG A CA  1 
ATOM   330  C C   . ARG A 1 91  ? 17.116 30.681 28.891  1.00 45.84  ? 1284 ARG A C   1 
ATOM   331  O O   . ARG A 1 91  ? 17.632 31.655 28.356  1.00 49.14  ? 1284 ARG A O   1 
ATOM   332  C CB  . ARG A 1 91  ? 14.664 30.236 28.826  1.00 38.94  ? 1284 ARG A CB  1 
ATOM   333  C CG  . ARG A 1 91  ? 14.307 31.699 28.829  1.00 33.30  ? 1284 ARG A CG  1 
ATOM   334  C CD  . ARG A 1 91  ? 12.975 31.903 29.545  1.00 47.00  ? 1284 ARG A CD  1 
ATOM   335  N NE  . ARG A 1 91  ? 13.070 31.639 30.982  1.00 64.05  ? 1284 ARG A NE  1 
ATOM   336  C CZ  . ARG A 1 91  ? 12.023 31.426 31.778  1.00 80.80  ? 1284 ARG A CZ  1 
ATOM   337  N NH1 . ARG A 1 91  ? 10.784 31.430 31.277  1.00 47.22  ? 1284 ARG A NH1 1 
ATOM   338  N NH2 . ARG A 1 91  ? 12.216 31.201 33.077  1.00 71.54  ? 1284 ARG A NH2 1 
ATOM   339  N N   . VAL A 1 92  ? 17.472 30.236 30.090  1.00 42.90  ? 1285 VAL A N   1 
ATOM   340  C CA  . VAL A 1 92  ? 18.594 30.787 30.837  1.00 46.00  ? 1285 VAL A CA  1 
ATOM   341  C C   . VAL A 1 92  ? 19.915 30.478 30.133  1.00 55.98  ? 1285 VAL A C   1 
ATOM   342  O O   . VAL A 1 92  ? 20.180 29.331 29.747  1.00 54.08  ? 1285 VAL A O   1 
ATOM   343  C CB  . VAL A 1 92  ? 18.648 30.193 32.257  1.00 44.06  ? 1285 VAL A CB  1 
ATOM   344  C CG1 . VAL A 1 92  ? 19.926 30.598 32.950  1.00 44.74  ? 1285 VAL A CG1 1 
ATOM   345  C CG2 . VAL A 1 92  ? 17.420 30.604 33.060  1.00 28.39  ? 1285 VAL A CG2 1 
ATOM   346  N N   . SER A 1 93  ? 20.744 31.498 29.956  1.00 65.19  ? 1286 SER A N   1 
ATOM   347  C CA  . SER A 1 93  ? 22.042 31.280 29.339  1.00 75.25  ? 1286 SER A CA  1 
ATOM   348  C C   . SER A 1 93  ? 23.044 30.882 30.403  1.00 78.05  ? 1286 SER A C   1 
ATOM   349  O O   . SER A 1 93  ? 22.954 31.329 31.548  1.00 79.78  ? 1286 SER A O   1 
ATOM   350  C CB  . SER A 1 93  ? 22.524 32.525 28.596  1.00 80.62  ? 1286 SER A CB  1 
ATOM   351  O OG  . SER A 1 93  ? 23.704 32.228 27.861  1.00 98.32  ? 1286 SER A OG  1 
ATOM   352  N N   . GLY A 1 94  ? 24.003 30.048 30.025  1.00 70.79  ? 1287 GLY A N   1 
ATOM   353  C CA  . GLY A 1 94  ? 24.964 29.537 30.982  1.00 77.68  ? 1287 GLY A CA  1 
ATOM   354  C C   . GLY A 1 94  ? 26.328 30.175 30.856  1.00 67.67  ? 1287 GLY A C   1 
ATOM   355  O O   . GLY A 1 94  ? 26.552 31.014 29.983  1.00 62.55  ? 1287 GLY A O   1 
ATOM   356  N N   . ASN A 1 95  ? 27.238 29.771 31.735  1.00 59.37  ? 1288 ASN A N   1 
ATOM   357  C CA  . ASN A 1 95  ? 28.609 30.255 31.700  1.00 70.60  ? 1288 ASN A CA  1 
ATOM   358  C C   . ASN A 1 95  ? 29.266 29.933 30.361  1.00 63.28  ? 1288 ASN A C   1 
ATOM   359  O O   . ASN A 1 95  ? 29.452 28.769 30.020  1.00 60.07  ? 1288 ASN A O   1 
ATOM   360  C CB  . ASN A 1 95  ? 29.409 29.653 32.861  1.00 67.72  ? 1288 ASN A CB  1 
ATOM   361  C CG  . ASN A 1 95  ? 30.730 30.357 33.084  1.00 82.62  ? 1288 ASN A CG  1 
ATOM   362  O OD1 . ASN A 1 95  ? 31.702 30.114 32.370  1.00 85.24  ? 1288 ASN A OD1 1 
ATOM   363  N ND2 . ASN A 1 95  ? 30.776 31.236 34.082  1.00 93.81  ? 1288 ASN A ND2 1 
ATOM   364  N N   . LYS A 1 96  ? 29.602 30.968 29.597  1.00 67.36  ? 1289 LYS A N   1 
ATOM   365  C CA  . LYS A 1 96  ? 30.229 30.778 28.289  1.00 64.12  ? 1289 LYS A CA  1 
ATOM   366  C C   . LYS A 1 96  ? 31.570 30.051 28.417  1.00 63.59  ? 1289 LYS A C   1 
ATOM   367  O O   . LYS A 1 96  ? 31.943 29.266 27.546  1.00 64.11  ? 1289 LYS A O   1 
ATOM   368  C CB  . LYS A 1 96  ? 30.400 32.113 27.550  1.00 46.44  ? 1289 LYS A CB  1 
ATOM   369  N N   . SER A 1 97  ? 32.287 30.300 29.509  1.00 63.16  ? 1290 SER A N   1 
ATOM   370  C CA  . SER A 1 97  ? 33.549 29.609 29.760  1.00 67.38  ? 1290 SER A CA  1 
ATOM   371  C C   . SER A 1 97  ? 33.325 28.116 29.998  1.00 65.17  ? 1290 SER A C   1 
ATOM   372  O O   . SER A 1 97  ? 34.053 27.274 29.471  1.00 60.25  ? 1290 SER A O   1 
ATOM   373  C CB  . SER A 1 97  ? 34.284 30.229 30.955  1.00 55.28  ? 1290 SER A CB  1 
ATOM   374  N N   . GLU A 1 98  ? 32.310 27.793 30.791  1.00 61.26  ? 1291 GLU A N   1 
ATOM   375  C CA  . GLU A 1 98  ? 32.010 26.404 31.117  1.00 61.15  ? 1291 GLU A CA  1 
ATOM   376  C C   . GLU A 1 98  ? 31.563 25.581 29.901  1.00 64.32  ? 1291 GLU A C   1 
ATOM   377  O O   . GLU A 1 98  ? 31.804 24.369 29.837  1.00 51.44  ? 1291 GLU A O   1 
ATOM   378  C CB  . GLU A 1 98  ? 30.978 26.336 32.241  1.00 60.60  ? 1291 GLU A CB  1 
ATOM   379  C CG  . GLU A 1 98  ? 31.553 26.734 33.576  1.00 70.42  ? 1291 GLU A CG  1 
ATOM   380  C CD  . GLU A 1 98  ? 32.826 25.957 33.891  1.00 82.68  ? 1291 GLU A CD  1 
ATOM   381  O OE1 . GLU A 1 98  ? 32.730 24.765 34.252  1.00 89.10  ? 1291 GLU A OE1 1 
ATOM   382  O OE2 . GLU A 1 98  ? 33.925 26.539 33.776  1.00 74.32  ? 1291 GLU A OE2 1 
ATOM   383  N N   . MET A 1 99  ? 30.922 26.236 28.937  1.00 57.64  ? 1292 MET A N   1 
ATOM   384  C CA  . MET A 1 99  ? 30.500 25.546 27.727  1.00 49.27  ? 1292 MET A CA  1 
ATOM   385  C C   . MET A 1 99  ? 31.694 25.290 26.823  1.00 55.29  ? 1292 MET A C   1 
ATOM   386  O O   . MET A 1 99  ? 31.879 24.178 26.326  1.00 57.45  ? 1292 MET A O   1 
ATOM   387  C CB  . MET A 1 99  ? 29.450 26.349 26.963  1.00 51.83  ? 1292 MET A CB  1 
ATOM   388  C CG  . MET A 1 99  ? 28.206 26.684 27.745  1.00 52.20  ? 1292 MET A CG  1 
ATOM   389  S SD  . MET A 1 99  ? 27.010 27.522 26.687  1.00 50.09  ? 1292 MET A SD  1 
ATOM   390  C CE  . MET A 1 99  ? 26.122 28.494 27.896  1.00 57.87  ? 1292 MET A CE  1 
ATOM   391  N N   . GLU A 1 100 ? 32.491 26.332 26.596  0.50 44.89  ? 1293 GLU A N   1 
ATOM   392  C CA  . GLU A 1 100 ? 33.684 26.212 25.774  0.50 40.40  ? 1293 GLU A CA  1 
ATOM   393  C C   . GLU A 1 100 ? 34.530 25.087 26.343  0.50 47.67  ? 1293 GLU A C   1 
ATOM   394  O O   . GLU A 1 100 ? 35.107 24.285 25.608  0.50 42.30  ? 1293 GLU A O   1 
ATOM   395  C CB  . GLU A 1 100 ? 34.459 27.525 25.784  0.50 38.92  ? 1293 GLU A CB  1 
ATOM   396  C CG  . GLU A 1 100 ? 35.573 27.631 24.757  0.50 47.87  ? 1293 GLU A CG  1 
ATOM   397  C CD  . GLU A 1 100 ? 36.232 28.996 24.783  0.50 54.97  ? 1293 GLU A CD  1 
ATOM   398  O OE1 . GLU A 1 100 ? 35.559 29.969 25.186  0.50 52.59  ? 1293 GLU A OE1 1 
ATOM   399  O OE2 . GLU A 1 100 ? 37.418 29.102 24.409  0.50 58.67  ? 1293 GLU A OE2 1 
ATOM   400  N N   . SER A 1 101 ? 34.573 25.030 27.668  1.00 47.20  ? 1294 SER A N   1 
ATOM   401  C CA  . SER A 1 101 ? 35.267 23.972 28.381  1.00 45.79  ? 1294 SER A CA  1 
ATOM   402  C C   . SER A 1 101 ? 34.683 22.599 28.037  1.00 53.86  ? 1294 SER A C   1 
ATOM   403  O O   . SER A 1 101 ? 35.402 21.708 27.587  1.00 50.12  ? 1294 SER A O   1 
ATOM   404  C CB  . SER A 1 101 ? 35.200 24.228 29.889  1.00 52.54  ? 1294 SER A CB  1 
ATOM   405  O OG  . SER A 1 101 ? 35.775 23.161 30.626  1.00 67.81  ? 1294 SER A OG  1 
ATOM   406  N N   . LEU A 1 102 ? 33.379 22.436 28.246  1.00 51.32  ? 1295 LEU A N   1 
ATOM   407  C CA  . LEU A 1 102 ? 32.703 21.170 27.961  1.00 47.83  ? 1295 LEU A CA  1 
ATOM   408  C C   . LEU A 1 102 ? 32.943 20.724 26.522  1.00 47.18  ? 1295 LEU A C   1 
ATOM   409  O O   . LEU A 1 102 ? 33.212 19.553 26.257  1.00 41.83  ? 1295 LEU A O   1 
ATOM   410  C CB  . LEU A 1 102 ? 31.198 21.273 28.259  1.00 46.61  ? 1295 LEU A CB  1 
ATOM   411  C CG  . LEU A 1 102 ? 30.289 20.099 27.872  1.00 42.87  ? 1295 LEU A CG  1 
ATOM   412  C CD1 . LEU A 1 102 ? 30.916 18.782 28.229  1.00 53.08  ? 1295 LEU A CD1 1 
ATOM   413  C CD2 . LEU A 1 102 ? 28.922 20.217 28.526  1.00 46.01  ? 1295 LEU A CD2 1 
ATOM   414  N N   . GLN A 1 103 ? 32.849 21.664 25.592  1.00 49.34  ? 1296 GLN A N   1 
ATOM   415  C CA  . GLN A 1 103 ? 33.081 21.352 24.193  1.00 54.13  ? 1296 GLN A CA  1 
ATOM   416  C C   . GLN A 1 103 ? 34.531 20.944 23.960  1.00 60.03  ? 1296 GLN A C   1 
ATOM   417  O O   . GLN A 1 103 ? 34.798 19.951 23.278  1.00 53.72  ? 1296 GLN A O   1 
ATOM   418  C CB  . GLN A 1 103 ? 32.693 22.531 23.305  1.00 52.09  ? 1296 GLN A CB  1 
ATOM   419  C CG  . GLN A 1 103 ? 31.327 22.380 22.683  1.00 45.59  ? 1296 GLN A CG  1 
ATOM   420  C CD  . GLN A 1 103 ? 30.743 23.705 22.233  1.00 73.63  ? 1296 GLN A CD  1 
ATOM   421  O OE1 . GLN A 1 103 ? 31.270 24.774 22.556  1.00 84.97  ? 1296 GLN A OE1 1 
ATOM   422  N NE2 . GLN A 1 103 ? 29.642 23.643 21.490  1.00 60.65  ? 1296 GLN A NE2 1 
ATOM   423  N N   . ARG A 1 104 ? 35.463 21.707 24.530  1.00 51.96  ? 1297 ARG A N   1 
ATOM   424  C CA  . ARG A 1 104 ? 36.878 21.387 24.396  1.00 51.03  ? 1297 ARG A CA  1 
ATOM   425  C C   . ARG A 1 104 ? 37.179 19.999 24.950  1.00 52.43  ? 1297 ARG A C   1 
ATOM   426  O O   . ARG A 1 104 ? 37.837 19.189 24.298  1.00 49.66  ? 1297 ARG A O   1 
ATOM   427  C CB  . ARG A 1 104 ? 37.739 22.428 25.107  1.00 56.79  ? 1297 ARG A CB  1 
ATOM   428  C CG  . ARG A 1 104 ? 38.096 23.646 24.275  1.00 68.98  ? 1297 ARG A CG  1 
ATOM   429  C CD  . ARG A 1 104 ? 39.492 24.134 24.641  1.00 66.04  ? 1297 ARG A CD  1 
ATOM   430  N NE  . ARG A 1 104 ? 39.702 25.531 24.282  1.00 75.17  ? 1297 ARG A NE  1 
ATOM   431  C CZ  . ARG A 1 104 ? 40.900 26.089 24.147  1.00 86.68  ? 1297 ARG A CZ  1 
ATOM   432  N NH1 . ARG A 1 104 ? 41.996 25.364 24.328  1.00 77.66  ? 1297 ARG A NH1 1 
ATOM   433  N NH2 . ARG A 1 104 ? 41.005 27.370 23.823  1.00 85.38  ? 1297 ARG A NH2 1 
ATOM   434  N N   . GLN A 1 105 ? 36.689 19.729 26.156  1.00 53.08  ? 1298 GLN A N   1 
ATOM   435  C CA  . GLN A 1 105 ? 36.944 18.454 26.813  1.00 58.45  ? 1298 GLN A CA  1 
ATOM   436  C C   . GLN A 1 105 ? 36.341 17.293 26.038  1.00 61.06  ? 1298 GLN A C   1 
ATOM   437  O O   . GLN A 1 105 ? 36.918 16.203 25.999  1.00 68.10  ? 1298 GLN A O   1 
ATOM   438  C CB  . GLN A 1 105 ? 36.401 18.454 28.239  1.00 55.48  ? 1298 GLN A CB  1 
ATOM   439  C CG  . GLN A 1 105 ? 36.968 19.533 29.135  1.00 49.37  ? 1298 GLN A CG  1 
ATOM   440  C CD  . GLN A 1 105 ? 36.771 19.193 30.595  1.00 65.90  ? 1298 GLN A CD  1 
ATOM   441  O OE1 . GLN A 1 105 ? 36.937 18.038 30.995  1.00 49.59  ? 1298 GLN A OE1 1 
ATOM   442  N NE2 . GLN A 1 105 ? 36.410 20.189 31.400  1.00 60.81  ? 1298 GLN A NE2 1 
ATOM   443  N N   . PHE A 1 106 ? 35.175 17.516 25.438  1.00 58.53  ? 1299 PHE A N   1 
ATOM   444  C CA  . PHE A 1 106 ? 34.558 16.476 24.626  1.00 58.13  ? 1299 PHE A CA  1 
ATOM   445  C C   . PHE A 1 106 ? 35.395 16.270 23.379  1.00 60.85  ? 1299 PHE A C   1 
ATOM   446  O O   . PHE A 1 106 ? 35.604 15.143 22.930  1.00 68.43  ? 1299 PHE A O   1 
ATOM   447  C CB  . PHE A 1 106 ? 33.127 16.834 24.240  1.00 49.96  ? 1299 PHE A CB  1 
ATOM   448  C CG  . PHE A 1 106 ? 32.479 15.818 23.347  1.00 54.51  ? 1299 PHE A CG  1 
ATOM   449  C CD1 . PHE A 1 106 ? 32.631 15.886 21.965  1.00 50.02  ? 1299 PHE A CD1 1 
ATOM   450  C CD2 . PHE A 1 106 ? 31.731 14.783 23.886  1.00 48.93  ? 1299 PHE A CD2 1 
ATOM   451  C CE1 . PHE A 1 106 ? 32.043 14.945 21.130  1.00 48.37  ? 1299 PHE A CE1 1 
ATOM   452  C CE2 . PHE A 1 106 ? 31.136 13.834 23.056  1.00 58.75  ? 1299 PHE A CE2 1 
ATOM   453  C CZ  . PHE A 1 106 ? 31.295 13.918 21.675  1.00 59.00  ? 1299 PHE A CZ  1 
ATOM   454  N N   . ASP A 1 107 ? 35.880 17.375 22.828  1.00 53.47  ? 1300 ASP A N   1 
ATOM   455  C CA  . ASP A 1 107 ? 36.723 17.333 21.644  1.00 62.83  ? 1300 ASP A CA  1 
ATOM   456  C C   . ASP A 1 107 ? 37.920 16.410 21.863  1.00 71.78  ? 1300 ASP A C   1 
ATOM   457  O O   . ASP A 1 107 ? 38.343 15.705 20.947  1.00 71.59  ? 1300 ASP A O   1 
ATOM   458  C CB  . ASP A 1 107 ? 37.202 18.739 21.292  1.00 57.88  ? 1300 ASP A CB  1 
ATOM   459  C CG  . ASP A 1 107 ? 37.342 18.949 19.803  1.00 68.91  ? 1300 ASP A CG  1 
ATOM   460  O OD1 . ASP A 1 107 ? 37.042 18.006 19.035  1.00 72.48  ? 1300 ASP A OD1 1 
ATOM   461  O OD2 . ASP A 1 107 ? 37.744 20.062 19.403  1.00 75.02  ? 1300 ASP A OD2 1 
ATOM   462  N N   . GLN A 1 108 ? 38.456 16.412 23.082  1.00 67.90  ? 1301 GLN A N   1 
ATOM   463  C CA  . GLN A 1 108 ? 39.613 15.585 23.409  1.00 64.88  ? 1301 GLN A CA  1 
ATOM   464  C C   . GLN A 1 108 ? 39.266 14.097 23.412  1.00 74.63  ? 1301 GLN A C   1 
ATOM   465  O O   . GLN A 1 108 ? 39.904 13.312 22.710  1.00 81.99  ? 1301 GLN A O   1 
ATOM   466  C CB  . GLN A 1 108 ? 40.250 16.017 24.730  1.00 66.60  ? 1301 GLN A CB  1 
ATOM   467  C CG  . GLN A 1 108 ? 40.878 17.402 24.684  1.00 67.23  ? 1301 GLN A CG  1 
ATOM   468  C CD  . GLN A 1 108 ? 41.638 17.742 25.952  1.00 88.87  ? 1301 GLN A CD  1 
ATOM   469  O OE1 . GLN A 1 108 ? 42.352 16.899 26.498  1.00 86.00  ? 1301 GLN A OE1 1 
ATOM   470  N NE2 . GLN A 1 108 ? 41.495 18.982 26.425  1.00 69.21  ? 1301 GLN A NE2 1 
ATOM   471  N N   . ASP A 1 109 ? 38.263 13.700 24.191  1.00 66.92  ? 1302 ASP A N   1 
ATOM   472  C CA  . ASP A 1 109 ? 37.739 12.337 24.059  1.00 86.43  ? 1302 ASP A CA  1 
ATOM   473  C C   . ASP A 1 109 ? 36.204 12.267 24.075  1.00 67.05  ? 1302 ASP A C   1 
ATOM   474  O O   . ASP A 1 109 ? 35.537 12.919 24.870  1.00 55.88  ? 1302 ASP A O   1 
ATOM   475  C CB  . ASP A 1 109 ? 38.414 11.345 25.033  1.00 84.94  ? 1302 ASP A CB  1 
ATOM   476  C CG  . ASP A 1 109 ? 37.578 11.045 26.258  1.00 76.12  ? 1302 ASP A CG  1 
ATOM   477  O OD1 . ASP A 1 109 ? 37.571 11.870 27.200  1.00 53.75  ? 1302 ASP A OD1 1 
ATOM   478  O OD2 . ASP A 1 109 ? 36.957 9.958  26.285  1.00 72.85  ? 1302 ASP A OD2 1 
ATOM   479  N N   . HIS A 1 110 ? 35.664 11.474 23.159  1.00 67.69  ? 1303 HIS A N   1 
ATOM   480  C CA  . HIS A 1 110 ? 34.236 11.451 22.881  1.00 67.93  ? 1303 HIS A CA  1 
ATOM   481  C C   . HIS A 1 110 ? 33.450 10.593 23.864  1.00 76.25  ? 1303 HIS A C   1 
ATOM   482  O O   . HIS A 1 110 ? 32.218 10.534 23.802  1.00 75.69  ? 1303 HIS A O   1 
ATOM   483  C CB  . HIS A 1 110 ? 33.997 10.961 21.450  1.00 59.38  ? 1303 HIS A CB  1 
ATOM   484  C CG  . HIS A 1 110 ? 34.497 11.905 20.401  1.00 67.04  ? 1303 HIS A CG  1 
ATOM   485  N ND1 . HIS A 1 110 ? 35.263 13.011 20.702  1.00 68.70  ? 1303 HIS A ND1 1 
ATOM   486  C CD2 . HIS A 1 110 ? 34.364 11.895 19.053  1.00 58.58  ? 1303 HIS A CD2 1 
ATOM   487  C CE1 . HIS A 1 110 ? 35.568 13.651 19.585  1.00 71.75  ? 1303 HIS A CE1 1 
ATOM   488  N NE2 . HIS A 1 110 ? 35.037 12.992 18.571  1.00 76.29  ? 1303 HIS A NE2 1 
ATOM   489  N N   . ASN A 1 111 ? 34.162 9.921  24.762  1.00 75.67  ? 1304 ASN A N   1 
ATOM   490  C CA  . ASN A 1 111 ? 33.513 9.104  25.778  1.00 79.44  ? 1304 ASN A CA  1 
ATOM   491  C C   . ASN A 1 111 ? 33.296 9.890  27.064  1.00 74.86  ? 1304 ASN A C   1 
ATOM   492  O O   . ASN A 1 111 ? 32.939 9.325  28.099  1.00 76.94  ? 1304 ASN A O   1 
ATOM   493  C CB  . ASN A 1 111 ? 34.318 7.832  26.042  1.00 83.47  ? 1304 ASN A CB  1 
ATOM   494  C CG  . ASN A 1 111 ? 34.012 6.732  25.040  1.00 99.20  ? 1304 ASN A CG  1 
ATOM   495  O OD1 . ASN A 1 111 ? 34.881 6.312  24.274  1.00 79.01  ? 1304 ASN A OD1 1 
ATOM   496  N ND2 . ASN A 1 111 ? 32.767 6.265  25.037  1.00 93.03  ? 1304 ASN A ND2 1 
ATOM   497  N N   . LEU A 1 112 ? 33.508 11.202 26.981  1.00 68.38  ? 1305 LEU A N   1 
ATOM   498  C CA  . LEU A 1 112 ? 33.367 12.085 28.129  1.00 65.19  ? 1305 LEU A CA  1 
ATOM   499  C C   . LEU A 1 112 ? 32.088 11.763 28.878  1.00 72.44  ? 1305 LEU A C   1 
ATOM   500  O O   . LEU A 1 112 ? 31.038 11.573 28.261  1.00 79.44  ? 1305 LEU A O   1 
ATOM   501  C CB  . LEU A 1 112 ? 33.343 13.544 27.677  1.00 57.56  ? 1305 LEU A CB  1 
ATOM   502  C CG  . LEU A 1 112 ? 33.244 14.575 28.800  1.00 66.12  ? 1305 LEU A CG  1 
ATOM   503  C CD1 . LEU A 1 112 ? 34.574 14.692 29.528  1.00 82.04  ? 1305 LEU A CD1 1 
ATOM   504  C CD2 . LEU A 1 112 ? 32.824 15.920 28.257  1.00 54.41  ? 1305 LEU A CD2 1 
ATOM   505  N N   . ASP A 1 113 ? 32.176 11.691 30.203  1.00 61.09  ? 1306 ASP A N   1 
ATOM   506  C CA  . ASP A 1 113 ? 30.997 11.430 31.020  1.00 77.84  ? 1306 ASP A CA  1 
ATOM   507  C C   . ASP A 1 113 ? 30.609 12.673 31.812  1.00 78.96  ? 1306 ASP A C   1 
ATOM   508  O O   . ASP A 1 113 ? 31.317 13.074 32.739  1.00 79.36  ? 1306 ASP A O   1 
ATOM   509  C CB  . ASP A 1 113 ? 31.233 10.244 31.957  1.00 80.03  ? 1306 ASP A CB  1 
ATOM   510  C CG  . ASP A 1 113 ? 29.935 9.588  32.401  1.00 91.01  ? 1306 ASP A CG  1 
ATOM   511  O OD1 . ASP A 1 113 ? 29.091 10.290 33.000  1.00 98.52  ? 1306 ASP A OD1 1 
ATOM   512  O OD2 . ASP A 1 113 ? 29.759 8.373  32.150  1.00 80.55  ? 1306 ASP A OD2 1 
ATOM   513  N N   . LEU A 1 114 ? 29.483 13.278 31.445  1.00 72.49  ? 1307 LEU A N   1 
ATOM   514  C CA  . LEU A 1 114 ? 29.057 14.529 32.068  1.00 78.87  ? 1307 LEU A CA  1 
ATOM   515  C C   . LEU A 1 114 ? 28.732 14.346 33.546  1.00 72.55  ? 1307 LEU A C   1 
ATOM   516  O O   . LEU A 1 114 ? 28.780 15.299 34.325  1.00 68.77  ? 1307 LEU A O   1 
ATOM   517  C CB  . LEU A 1 114 ? 27.856 15.112 31.332  1.00 62.63  ? 1307 LEU A CB  1 
ATOM   518  C CG  . LEU A 1 114 ? 28.051 15.218 29.831  1.00 43.59  ? 1307 LEU A CG  1 
ATOM   519  C CD1 . LEU A 1 114 ? 26.879 15.943 29.236  1.00 54.07  ? 1307 LEU A CD1 1 
ATOM   520  C CD2 . LEU A 1 114 ? 29.339 15.951 29.547  1.00 54.26  ? 1307 LEU A CD2 1 
ATOM   521  N N   . ALA A 1 115 ? 28.394 13.116 33.920  1.00 80.20  ? 1308 ALA A N   1 
ATOM   522  C CA  . ALA A 1 115 ? 28.158 12.778 35.316  1.00 87.72  ? 1308 ALA A CA  1 
ATOM   523  C C   . ALA A 1 115 ? 29.432 13.012 36.124  1.00 90.74  ? 1308 ALA A C   1 
ATOM   524  O O   . ALA A 1 115 ? 29.428 13.735 37.124  1.00 82.08  ? 1308 ALA A O   1 
ATOM   525  C CB  . ALA A 1 115 ? 27.701 11.325 35.442  1.00 61.80  ? 1308 ALA A CB  1 
ATOM   526  N N   . GLU A 1 116 ? 30.525 12.409 35.666  1.00 82.48  ? 1309 GLU A N   1 
ATOM   527  C CA  . GLU A 1 116 ? 31.797 12.472 36.377  1.00 86.17  ? 1309 GLU A CA  1 
ATOM   528  C C   . GLU A 1 116 ? 32.498 13.829 36.266  1.00 80.96  ? 1309 GLU A C   1 
ATOM   529  O O   . GLU A 1 116 ? 33.663 13.957 36.656  1.00 79.26  ? 1309 GLU A O   1 
ATOM   530  C CB  . GLU A 1 116 ? 32.731 11.362 35.881  1.00 66.21  ? 1309 GLU A CB  1 
ATOM   531  N N   . LYS A 1 117 ? 31.803 14.841 35.752  1.00 69.14  ? 1310 LYS A N   1 
ATOM   532  C CA  . LYS A 1 117 ? 32.466 16.117 35.474  1.00 72.44  ? 1310 LYS A CA  1 
ATOM   533  C C   . LYS A 1 117 ? 31.798 17.343 36.110  1.00 73.86  ? 1310 LYS A C   1 
ATOM   534  O O   . LYS A 1 117 ? 32.266 18.470 35.936  1.00 71.92  ? 1310 LYS A O   1 
ATOM   535  C CB  . LYS A 1 117 ? 32.667 16.316 33.963  1.00 43.95  ? 1310 LYS A CB  1 
ATOM   536  N N   . ASP A 1 118 ? 30.714 17.119 36.849  1.00 69.96  ? 1311 ASP A N   1 
ATOM   537  C CA  . ASP A 1 118 ? 30.066 18.184 37.629  1.00 89.96  ? 1311 ASP A CA  1 
ATOM   538  C C   . ASP A 1 118 ? 29.755 19.474 36.844  1.00 80.43  ? 1311 ASP A C   1 
ATOM   539  O O   . ASP A 1 118 ? 30.065 20.579 37.298  1.00 64.21  ? 1311 ASP A O   1 
ATOM   540  C CB  . ASP A 1 118 ? 30.890 18.514 38.887  1.00 60.80  ? 1311 ASP A CB  1 
ATOM   541  N N   . PHE A 1 119 ? 29.130 19.334 35.678  1.00 70.32  ? 1312 PHE A N   1 
ATOM   542  C CA  . PHE A 1 119 ? 28.730 20.496 34.891  1.00 55.24  ? 1312 PHE A CA  1 
ATOM   543  C C   . PHE A 1 119 ? 27.315 20.921 35.248  1.00 59.81  ? 1312 PHE A C   1 
ATOM   544  O O   . PHE A 1 119 ? 26.433 20.075 35.432  1.00 59.73  ? 1312 PHE A O   1 
ATOM   545  C CB  . PHE A 1 119 ? 28.771 20.171 33.401  1.00 62.80  ? 1312 PHE A CB  1 
ATOM   546  C CG  . PHE A 1 119 ? 30.134 20.314 32.767  1.00 58.33  ? 1312 PHE A CG  1 
ATOM   547  C CD1 . PHE A 1 119 ? 30.760 19.220 32.178  1.00 50.15  ? 1312 PHE A CD1 1 
ATOM   548  C CD2 . PHE A 1 119 ? 30.773 21.542 32.733  1.00 49.05  ? 1312 PHE A CD2 1 
ATOM   549  C CE1 . PHE A 1 119 ? 32.000 19.346 31.580  1.00 38.76  ? 1312 PHE A CE1 1 
ATOM   550  C CE2 . PHE A 1 119 ? 32.017 21.672 32.134  1.00 44.35  ? 1312 PHE A CE2 1 
ATOM   551  C CZ  . PHE A 1 119 ? 32.630 20.571 31.561  1.00 40.96  ? 1312 PHE A CZ  1 
ATOM   552  N N   . THR A 1 120 ? 27.098 22.230 35.331  1.00 55.57  ? 1313 THR A N   1 
ATOM   553  C CA  . THR A 1 120 ? 25.762 22.775 35.541  1.00 52.89  ? 1313 THR A CA  1 
ATOM   554  C C   . THR A 1 120 ? 24.844 22.217 34.459  1.00 60.10  ? 1313 THR A C   1 
ATOM   555  O O   . THR A 1 120 ? 25.288 21.966 33.338  1.00 60.76  ? 1313 THR A O   1 
ATOM   556  C CB  . THR A 1 120 ? 25.760 24.317 35.421  1.00 60.07  ? 1313 THR A CB  1 
ATOM   557  O OG1 . THR A 1 120 ? 26.955 24.848 35.999  1.00 84.55  ? 1313 THR A OG1 1 
ATOM   558  C CG2 . THR A 1 120 ? 24.551 24.933 36.120  1.00 71.25  ? 1313 THR A CG2 1 
ATOM   559  N N   . VAL A 1 121 ? 23.571 22.019 34.786  1.00 58.38  ? 1314 VAL A N   1 
ATOM   560  C CA  . VAL A 1 121 ? 22.599 21.570 33.793  1.00 46.21  ? 1314 VAL A CA  1 
ATOM   561  C C   . VAL A 1 121 ? 22.448 22.617 32.685  1.00 47.61  ? 1314 VAL A C   1 
ATOM   562  O O   . VAL A 1 121 ? 22.388 22.279 31.505  1.00 51.15  ? 1314 VAL A O   1 
ATOM   563  C CB  . VAL A 1 121 ? 21.233 21.234 34.441  1.00 47.80  ? 1314 VAL A CB  1 
ATOM   564  C CG1 . VAL A 1 121 ? 20.656 22.450 35.138  1.00 69.88  ? 1314 VAL A CG1 1 
ATOM   565  C CG2 . VAL A 1 121 ? 20.262 20.689 33.409  1.00 53.90  ? 1314 VAL A CG2 1 
ATOM   566  N N   . ASN A 1 122 ? 22.409 23.888 33.067  1.00 49.62  ? 1315 ASN A N   1 
ATOM   567  C CA  . ASN A 1 122 ? 22.365 24.987 32.104  1.00 47.28  ? 1315 ASN A CA  1 
ATOM   568  C C   . ASN A 1 122 ? 23.588 25.039 31.194  1.00 47.63  ? 1315 ASN A C   1 
ATOM   569  O O   . ASN A 1 122 ? 23.499 25.432 30.031  1.00 45.99  ? 1315 ASN A O   1 
ATOM   570  C CB  . ASN A 1 122 ? 22.208 26.326 32.828  1.00 41.88  ? 1315 ASN A CB  1 
ATOM   571  C CG  . ASN A 1 122 ? 20.769 26.621 33.185  1.00 58.93  ? 1315 ASN A CG  1 
ATOM   572  O OD1 . ASN A 1 122 ? 19.862 26.419 32.372  1.00 69.80  ? 1315 ASN A OD1 1 
ATOM   573  N ND2 . ASN A 1 122 ? 20.547 27.101 34.400  1.00 45.64  ? 1315 ASN A ND2 1 
ATOM   574  N N   . THR A 1 123 ? 24.738 24.657 31.732  1.00 53.26  ? 1316 THR A N   1 
ATOM   575  C CA  . THR A 1 123 ? 25.960 24.618 30.944  1.00 44.11  ? 1316 THR A CA  1 
ATOM   576  C C   . THR A 1 123 ? 25.858 23.551 29.855  1.00 46.10  ? 1316 THR A C   1 
ATOM   577  O O   . THR A 1 123 ? 26.239 23.790 28.713  1.00 47.00  ? 1316 THR A O   1 
ATOM   578  C CB  . THR A 1 123 ? 27.182 24.378 31.838  1.00 44.35  ? 1316 THR A CB  1 
ATOM   579  O OG1 . THR A 1 123 ? 27.361 25.515 32.692  1.00 55.37  ? 1316 THR A OG1 1 
ATOM   580  C CG2 . THR A 1 123 ? 28.440 24.165 31.007  1.00 29.41  ? 1316 THR A CG2 1 
ATOM   581  N N   . VAL A 1 124 ? 25.325 22.383 30.203  1.00 43.10  ? 1317 VAL A N   1 
ATOM   582  C CA  . VAL A 1 124 ? 25.142 21.313 29.231  1.00 37.56  ? 1317 VAL A CA  1 
ATOM   583  C C   . VAL A 1 124 ? 24.043 21.648 28.231  1.00 40.22  ? 1317 VAL A C   1 
ATOM   584  O O   . VAL A 1 124 ? 24.124 21.292 27.058  1.00 39.76  ? 1317 VAL A O   1 
ATOM   585  C CB  . VAL A 1 124 ? 24.789 19.992 29.908  1.00 40.31  ? 1317 VAL A CB  1 
ATOM   586  C CG1 . VAL A 1 124 ? 24.565 18.912 28.859  1.00 34.96  ? 1317 VAL A CG1 1 
ATOM   587  C CG2 . VAL A 1 124 ? 25.886 19.587 30.874  1.00 40.53  ? 1317 VAL A CG2 1 
ATOM   588  N N   . ALA A 1 125 ? 23.008 22.335 28.700  1.00 47.75  ? 1318 ALA A N   1 
ATOM   589  C CA  . ALA A 1 125 ? 21.923 22.761 27.823  1.00 41.06  ? 1318 ALA A CA  1 
ATOM   590  C C   . ALA A 1 125 ? 22.431 23.774 26.802  1.00 38.41  ? 1318 ALA A C   1 
ATOM   591  O O   . ALA A 1 125 ? 22.196 23.631 25.603  1.00 42.78  ? 1318 ALA A O   1 
ATOM   592  C CB  . ALA A 1 125 ? 20.773 23.338 28.636  1.00 34.99  ? 1318 ALA A CB  1 
ATOM   593  N N   . GLY A 1 126 ? 23.134 24.791 27.288  1.00 39.06  ? 1319 GLY A N   1 
ATOM   594  C CA  . GLY A 1 126 ? 23.720 25.799 26.427  1.00 41.54  ? 1319 GLY A CA  1 
ATOM   595  C C   . GLY A 1 126 ? 24.772 25.250 25.475  1.00 43.36  ? 1319 GLY A C   1 
ATOM   596  O O   . GLY A 1 126 ? 24.912 25.728 24.351  1.00 49.49  ? 1319 GLY A O   1 
ATOM   597  N N   . ALA A 1 127 ? 25.519 24.246 25.919  1.00 42.98  ? 1320 ALA A N   1 
ATOM   598  C CA  . ALA A 1 127 ? 26.545 23.630 25.082  1.00 44.62  ? 1320 ALA A CA  1 
ATOM   599  C C   . ALA A 1 127 ? 25.909 22.776 23.987  1.00 44.70  ? 1320 ALA A C   1 
ATOM   600  O O   . ALA A 1 127 ? 26.488 22.575 22.919  1.00 42.11  ? 1320 ALA A O   1 
ATOM   601  C CB  . ALA A 1 127 ? 27.499 22.796 25.932  1.00 43.95  ? 1320 ALA A CB  1 
ATOM   602  N N   . MET A 1 128 ? 24.710 22.277 24.261  1.00 39.97  ? 1321 MET A N   1 
ATOM   603  C CA  . MET A 1 128 ? 23.968 21.504 23.279  1.00 40.62  ? 1321 MET A CA  1 
ATOM   604  C C   . MET A 1 128 ? 23.440 22.424 22.173  1.00 39.30  ? 1321 MET A C   1 
ATOM   605  O O   . MET A 1 128 ? 23.557 22.117 20.990  1.00 34.11  ? 1321 MET A O   1 
ATOM   606  C CB  . MET A 1 128 ? 22.845 20.713 23.970  1.00 30.42  ? 1321 MET A CB  1 
ATOM   607  C CG  . MET A 1 128 ? 22.041 19.793 23.065  1.00 30.11  ? 1321 MET A CG  1 
ATOM   608  S SD  . MET A 1 128 ? 20.571 20.613 22.393  1.00 38.60  ? 1321 MET A SD  1 
ATOM   609  C CE  . MET A 1 128 ? 19.935 19.320 21.342  1.00 64.33  ? 1321 MET A CE  1 
ATOM   610  N N   . LYS A 1 129 ? 22.882 23.565 22.561  1.00 36.20  ? 1322 LYS A N   1 
ATOM   611  C CA  . LYS A 1 129 ? 22.450 24.553 21.584  1.00 36.38  ? 1322 LYS A CA  1 
ATOM   612  C C   . LYS A 1 129 ? 23.639 25.036 20.767  1.00 41.39  ? 1322 LYS A C   1 
ATOM   613  O O   . LYS A 1 129 ? 23.547 25.200 19.550  1.00 35.73  ? 1322 LYS A O   1 
ATOM   614  C CB  . LYS A 1 129 ? 21.767 25.742 22.262  1.00 30.28  ? 1322 LYS A CB  1 
ATOM   615  C CG  . LYS A 1 129 ? 20.266 25.584 22.439  1.00 40.30  ? 1322 LYS A CG  1 
ATOM   616  C CD  . LYS A 1 129 ? 19.537 26.917 22.344  1.00 33.37  ? 1322 LYS A CD  1 
ATOM   617  C CE  . LYS A 1 129 ? 19.752 27.768 23.577  1.00 44.18  ? 1322 LYS A CE  1 
ATOM   618  N NZ  . LYS A 1 129 ? 19.297 29.172 23.376  1.00 38.52  ? 1322 LYS A NZ  1 
ATOM   619  N N   . SER A 1 130 ? 24.757 25.259 21.449  1.00 40.54  ? 1323 SER A N   1 
ATOM   620  C CA  . SER A 1 130 ? 25.951 25.798 20.810  1.00 41.51  ? 1323 SER A CA  1 
ATOM   621  C C   . SER A 1 130 ? 26.399 24.946 19.620  1.00 42.21  ? 1323 SER A C   1 
ATOM   622  O O   . SER A 1 130 ? 26.836 25.464 18.593  1.00 35.22  ? 1323 SER A O   1 
ATOM   623  C CB  . SER A 1 130 ? 27.086 25.931 21.823  1.00 36.03  ? 1323 SER A CB  1 
ATOM   624  O OG  . SER A 1 130 ? 28.161 26.666 21.265  1.00 50.51  ? 1323 SER A OG  1 
ATOM   625  N N   . PHE A 1 131 ? 26.287 23.633 19.757  1.00 41.00  ? 1324 PHE A N   1 
ATOM   626  C CA  . PHE A 1 131 ? 26.677 22.748 18.679  1.00 33.21  ? 1324 PHE A CA  1 
ATOM   627  C C   . PHE A 1 131 ? 25.912 23.103 17.418  1.00 38.77  ? 1324 PHE A C   1 
ATOM   628  O O   . PHE A 1 131 ? 26.463 23.099 16.322  1.00 37.28  ? 1324 PHE A O   1 
ATOM   629  C CB  . PHE A 1 131 ? 26.410 21.291 19.050  1.00 34.78  ? 1324 PHE A CB  1 
ATOM   630  C CG  . PHE A 1 131 ? 26.516 20.352 17.889  1.00 34.44  ? 1324 PHE A CG  1 
ATOM   631  C CD1 . PHE A 1 131 ? 27.739 19.822 17.517  1.00 28.37  ? 1324 PHE A CD1 1 
ATOM   632  C CD2 . PHE A 1 131 ? 25.396 20.016 17.152  1.00 29.30  ? 1324 PHE A CD2 1 
ATOM   633  C CE1 . PHE A 1 131 ? 27.840 18.970 16.440  1.00 35.74  ? 1324 PHE A CE1 1 
ATOM   634  C CE2 . PHE A 1 131 ? 25.496 19.164 16.074  1.00 35.26  ? 1324 PHE A CE2 1 
ATOM   635  C CZ  . PHE A 1 131 ? 26.720 18.638 15.719  1.00 34.78  ? 1324 PHE A CZ  1 
ATOM   636  N N   . PHE A 1 132 ? 24.631 23.408 17.581  1.00 41.97  ? 1325 PHE A N   1 
ATOM   637  C CA  . PHE A 1 132 ? 23.769 23.691 16.439  1.00 38.05  ? 1325 PHE A CA  1 
ATOM   638  C C   . PHE A 1 132 ? 24.011 25.066 15.831  1.00 37.25  ? 1325 PHE A C   1 
ATOM   639  O O   . PHE A 1 132 ? 23.943 25.227 14.624  1.00 41.26  ? 1325 PHE A O   1 
ATOM   640  C CB  . PHE A 1 132 ? 22.298 23.504 16.809  1.00 32.80  ? 1325 PHE A CB  1 
ATOM   641  C CG  . PHE A 1 132 ? 21.899 22.067 16.934  1.00 34.30  ? 1325 PHE A CG  1 
ATOM   642  C CD1 . PHE A 1 132 ? 21.968 21.226 15.837  1.00 31.76  ? 1325 PHE A CD1 1 
ATOM   643  C CD2 . PHE A 1 132 ? 21.476 21.550 18.149  1.00 37.41  ? 1325 PHE A CD2 1 
ATOM   644  C CE1 . PHE A 1 132 ? 21.613 19.902 15.944  1.00 37.48  ? 1325 PHE A CE1 1 
ATOM   645  C CE2 . PHE A 1 132 ? 21.118 20.225 18.265  1.00 30.53  ? 1325 PHE A CE2 1 
ATOM   646  C CZ  . PHE A 1 132 ? 21.189 19.398 17.162  1.00 43.81  ? 1325 PHE A CZ  1 
ATOM   647  N N   . SER A 1 133 ? 24.296 26.053 16.668  1.00 41.95  ? 1326 SER A N   1 
ATOM   648  C CA  . SER A 1 133 ? 24.614 27.380 16.166  1.00 43.14  ? 1326 SER A CA  1 
ATOM   649  C C   . SER A 1 133 ? 26.028 27.435 15.595  1.00 38.00  ? 1326 SER A C   1 
ATOM   650  O O   . SER A 1 133 ? 26.391 28.393 14.922  1.00 45.27  ? 1326 SER A O   1 
ATOM   651  C CB  . SER A 1 133 ? 24.407 28.454 17.243  1.00 33.92  ? 1326 SER A CB  1 
ATOM   652  O OG  . SER A 1 133 ? 24.863 28.015 18.502  1.00 49.25  ? 1326 SER A OG  1 
ATOM   653  N N   . GLU A 1 134 ? 26.821 26.403 15.849  1.00 39.77  ? 1327 GLU A N   1 
ATOM   654  C CA  . GLU A 1 134 ? 28.170 26.345 15.299  1.00 42.78  ? 1327 GLU A CA  1 
ATOM   655  C C   . GLU A 1 134 ? 28.226 25.599 13.961  1.00 45.94  ? 1327 GLU A C   1 
ATOM   656  O O   . GLU A 1 134 ? 29.217 25.693 13.234  1.00 46.46  ? 1327 GLU A O   1 
ATOM   657  C CB  . GLU A 1 134 ? 29.141 25.719 16.304  1.00 40.41  ? 1327 GLU A CB  1 
ATOM   658  C CG  . GLU A 1 134 ? 29.596 26.654 17.406  1.00 50.96  ? 1327 GLU A CG  1 
ATOM   659  C CD  . GLU A 1 134 ? 30.178 25.912 18.604  1.00 63.91  ? 1327 GLU A CD  1 
ATOM   660  O OE1 . GLU A 1 134 ? 30.212 24.666 18.589  1.00 57.10  ? 1327 GLU A OE1 1 
ATOM   661  O OE2 . GLU A 1 134 ? 30.601 26.576 19.572  1.00 72.38  ? 1327 GLU A OE2 1 
ATOM   662  N N   . LEU A 1 135 ? 27.169 24.855 13.641  1.00 42.67  ? 1328 LEU A N   1 
ATOM   663  C CA  . LEU A 1 135 ? 27.104 24.143 12.370  1.00 35.91  ? 1328 LEU A CA  1 
ATOM   664  C C   . LEU A 1 135 ? 27.195 25.149 11.252  1.00 40.87  ? 1328 LEU A C   1 
ATOM   665  O O   . LEU A 1 135 ? 26.577 26.208 11.330  1.00 44.94  ? 1328 LEU A O   1 
ATOM   666  C CB  . LEU A 1 135 ? 25.795 23.371 12.232  1.00 38.30  ? 1328 LEU A CB  1 
ATOM   667  C CG  . LEU A 1 135 ? 25.622 22.046 12.976  1.00 37.93  ? 1328 LEU A CG  1 
ATOM   668  C CD1 . LEU A 1 135 ? 24.227 21.504 12.747  1.00 32.57  ? 1328 LEU A CD1 1 
ATOM   669  C CD2 . LEU A 1 135 ? 26.666 21.023 12.551  1.00 35.57  ? 1328 LEU A CD2 1 
ATOM   670  N N   . PRO A 1 136 ? 27.974 24.830 10.211  1.00 43.11  ? 1329 PRO A N   1 
ATOM   671  C CA  . PRO A 1 136 ? 28.128 25.664 9.013   1.00 38.22  ? 1329 PRO A CA  1 
ATOM   672  C C   . PRO A 1 136 ? 26.779 26.025 8.406   1.00 37.24  ? 1329 PRO A C   1 
ATOM   673  O O   . PRO A 1 136 ? 26.574 27.162 8.004   1.00 42.23  ? 1329 PRO A O   1 
ATOM   674  C CB  . PRO A 1 136 ? 28.907 24.763 8.064   1.00 38.94  ? 1329 PRO A CB  1 
ATOM   675  C CG  . PRO A 1 136 ? 29.698 23.888 8.963   1.00 52.52  ? 1329 PRO A CG  1 
ATOM   676  C CD  . PRO A 1 136 ? 28.829 23.636 10.165  1.00 47.39  ? 1329 PRO A CD  1 
ATOM   677  N N   . ASP A 1 137 ? 25.865 25.065 8.353   1.00 44.12  ? 1330 ASP A N   1 
ATOM   678  C CA  . ASP A 1 137 ? 24.504 25.331 7.895   1.00 41.49  ? 1330 ASP A CA  1 
ATOM   679  C C   . ASP A 1 137 ? 23.484 24.972 8.981   1.00 41.84  ? 1330 ASP A C   1 
ATOM   680  O O   . ASP A 1 137 ? 23.678 24.013 9.732   1.00 39.62  ? 1330 ASP A O   1 
ATOM   681  C CB  . ASP A 1 137 ? 24.226 24.561 6.609   1.00 43.45  ? 1330 ASP A CB  1 
ATOM   682  C CG  . ASP A 1 137 ? 25.324 24.759 5.569   1.00 63.66  ? 1330 ASP A CG  1 
ATOM   683  O OD1 . ASP A 1 137 ? 25.623 25.933 5.237   1.00 46.36  ? 1330 ASP A OD1 1 
ATOM   684  O OD2 . ASP A 1 137 ? 25.888 23.741 5.090   1.00 58.31  ? 1330 ASP A OD2 1 
ATOM   685  N N   . PRO A 1 138 ? 22.395 25.755 9.077   1.00 40.83  ? 1331 PRO A N   1 
ATOM   686  C CA  . PRO A 1 138 ? 21.397 25.551 10.132  1.00 36.23  ? 1331 PRO A CA  1 
ATOM   687  C C   . PRO A 1 138 ? 20.781 24.165 10.026  1.00 38.24  ? 1331 PRO A C   1 
ATOM   688  O O   . PRO A 1 138 ? 20.671 23.636 8.922   1.00 44.90  ? 1331 PRO A O   1 
ATOM   689  C CB  . PRO A 1 138 ? 20.349 26.624 9.820   1.00 32.45  ? 1331 PRO A CB  1 
ATOM   690  C CG  . PRO A 1 138 ? 20.545 26.918 8.363   1.00 29.67  ? 1331 PRO A CG  1 
ATOM   691  C CD  . PRO A 1 138 ? 22.025 26.885 8.209   1.00 36.65  ? 1331 PRO A CD  1 
ATOM   692  N N   . LEU A 1 139 ? 20.390 23.580 11.151  1.00 32.05  ? 1332 LEU A N   1 
ATOM   693  C CA  . LEU A 1 139 ? 19.827 22.239 11.127  1.00 31.56  ? 1332 LEU A CA  1 
ATOM   694  C C   . LEU A 1 139 ? 18.667 22.171 10.144  1.00 34.13  ? 1332 LEU A C   1 
ATOM   695  O O   . LEU A 1 139 ? 18.565 21.240 9.352   1.00 33.75  ? 1332 LEU A O   1 
ATOM   696  C CB  . LEU A 1 139 ? 19.355 21.820 12.515  1.00 31.10  ? 1332 LEU A CB  1 
ATOM   697  C CG  . LEU A 1 139 ? 18.849 20.384 12.601  1.00 26.26  ? 1332 LEU A CG  1 
ATOM   698  C CD1 . LEU A 1 139 ? 19.918 19.435 12.111  1.00 31.58  ? 1332 LEU A CD1 1 
ATOM   699  C CD2 . LEU A 1 139 ? 18.454 20.052 14.021  1.00 39.80  ? 1332 LEU A CD2 1 
ATOM   700  N N   . VAL A 1 140 ? 17.783 23.158 10.208  1.00 33.09  ? 1333 VAL A N   1 
ATOM   701  C CA  . VAL A 1 140 ? 16.684 23.251 9.268   1.00 28.38  ? 1333 VAL A CA  1 
ATOM   702  C C   . VAL A 1 140 ? 17.169 24.084 8.096   1.00 38.91  ? 1333 VAL A C   1 
ATOM   703  O O   . VAL A 1 140 ? 17.300 25.306 8.210   1.00 35.58  ? 1333 VAL A O   1 
ATOM   704  C CB  . VAL A 1 140 ? 15.483 23.915 9.922   1.00 30.65  ? 1333 VAL A CB  1 
ATOM   705  C CG1 . VAL A 1 140 ? 14.316 23.996 8.966   1.00 37.35  ? 1333 VAL A CG1 1 
ATOM   706  C CG2 . VAL A 1 140 ? 15.094 23.138 11.154  1.00 39.59  ? 1333 VAL A CG2 1 
ATOM   707  N N   . PRO A 1 141 ? 17.442 23.422 6.957   1.00 38.10  ? 1334 PRO A N   1 
ATOM   708  C CA  . PRO A 1 141 ? 18.078 24.065 5.805   1.00 37.08  ? 1334 PRO A CA  1 
ATOM   709  C C   . PRO A 1 141 ? 17.232 25.205 5.249   1.00 38.71  ? 1334 PRO A C   1 
ATOM   710  O O   . PRO A 1 141 ? 16.001 25.144 5.297   1.00 35.65  ? 1334 PRO A O   1 
ATOM   711  C CB  . PRO A 1 141 ? 18.192 22.921 4.797   1.00 36.03  ? 1334 PRO A CB  1 
ATOM   712  C CG  . PRO A 1 141 ? 18.141 21.684 5.635   1.00 26.45  ? 1334 PRO A CG  1 
ATOM   713  C CD  . PRO A 1 141 ? 17.141 22.010 6.682   1.00 32.15  ? 1334 PRO A CD  1 
ATOM   714  N N   . TYR A 1 142 ? 17.891 26.236 4.732   1.00 40.91  ? 1335 TYR A N   1 
ATOM   715  C CA  . TYR A 1 142 ? 17.191 27.435 4.282   1.00 39.10  ? 1335 TYR A CA  1 
ATOM   716  C C   . TYR A 1 142 ? 16.117 27.163 3.238   1.00 39.42  ? 1335 TYR A C   1 
ATOM   717  O O   . TYR A 1 142 ? 15.036 27.756 3.299   1.00 41.01  ? 1335 TYR A O   1 
ATOM   718  C CB  . TYR A 1 142 ? 18.176 28.481 3.775   1.00 30.15  ? 1335 TYR A CB  1 
ATOM   719  C CG  . TYR A 1 142 ? 19.006 29.083 4.874   1.00 36.38  ? 1335 TYR A CG  1 
ATOM   720  C CD1 . TYR A 1 142 ? 18.415 29.859 5.866   1.00 35.19  ? 1335 TYR A CD1 1 
ATOM   721  C CD2 . TYR A 1 142 ? 20.379 28.872 4.932   1.00 34.09  ? 1335 TYR A CD2 1 
ATOM   722  C CE1 . TYR A 1 142 ? 19.162 30.411 6.889   1.00 32.77  ? 1335 TYR A CE1 1 
ATOM   723  C CE2 . TYR A 1 142 ? 21.139 29.424 5.953   1.00 36.04  ? 1335 TYR A CE2 1 
ATOM   724  C CZ  . TYR A 1 142 ? 20.526 30.192 6.927   1.00 38.28  ? 1335 TYR A CZ  1 
ATOM   725  O OH  . TYR A 1 142 ? 21.278 30.748 7.939   1.00 36.81  ? 1335 TYR A OH  1 
ATOM   726  N N   . ASN A 1 143 ? 16.411 26.280 2.285   1.00 37.77  ? 1336 ASN A N   1 
ATOM   727  C CA  . ASN A 1 143 ? 15.435 25.918 1.256   1.00 45.59  ? 1336 ASN A CA  1 
ATOM   728  C C   . ASN A 1 143 ? 14.151 25.342 1.859   1.00 44.03  ? 1336 ASN A C   1 
ATOM   729  O O   . ASN A 1 143 ? 13.050 25.720 1.453   1.00 45.28  ? 1336 ASN A O   1 
ATOM   730  C CB  . ASN A 1 143 ? 16.032 24.955 0.222   1.00 34.45  ? 1336 ASN A CB  1 
ATOM   731  C CG  . ASN A 1 143 ? 16.868 23.873 0.856   1.00 52.78  ? 1336 ASN A CG  1 
ATOM   732  O OD1 . ASN A 1 143 ? 17.846 24.160 1.550   1.00 67.46  ? 1336 ASN A OD1 1 
ATOM   733  N ND2 . ASN A 1 143 ? 16.492 22.619 0.627   1.00 50.90  ? 1336 ASN A ND2 1 
ATOM   734  N N   . MET A 1 144 ? 14.296 24.443 2.831   1.00 38.15  ? 1337 MET A N   1 
ATOM   735  C CA  . MET A 1 144 ? 13.145 23.922 3.562   1.00 35.11  ? 1337 MET A CA  1 
ATOM   736  C C   . MET A 1 144 ? 12.401 25.034 4.298   1.00 34.94  ? 1337 MET A C   1 
ATOM   737  O O   . MET A 1 144 ? 11.178 24.992 4.445   1.00 39.23  ? 1337 MET A O   1 
ATOM   738  C CB  . MET A 1 144 ? 13.567 22.839 4.553   1.00 34.67  ? 1337 MET A CB  1 
ATOM   739  C CG  . MET A 1 144 ? 14.172 21.587 3.927   1.00 45.78  ? 1337 MET A CG  1 
ATOM   740  S SD  . MET A 1 144 ? 13.093 20.705 2.774   1.00 45.59  ? 1337 MET A SD  1 
ATOM   741  C CE  . MET A 1 144 ? 13.354 21.670 1.293   1.00 43.44  ? 1337 MET A CE  1 
ATOM   742  N N   . GLN A 1 145 ? 13.137 26.034 4.760   1.00 39.02  ? 1338 GLN A N   1 
ATOM   743  C CA  . GLN A 1 145 ? 12.520 27.117 5.520   1.00 37.84  ? 1338 GLN A CA  1 
ATOM   744  C C   . GLN A 1 145 ? 11.505 27.850 4.681   1.00 37.25  ? 1338 GLN A C   1 
ATOM   745  O O   . GLN A 1 145 ? 10.430 28.210 5.172   1.00 34.69  ? 1338 GLN A O   1 
ATOM   746  C CB  . GLN A 1 145 ? 13.566 28.101 6.028   1.00 29.95  ? 1338 GLN A CB  1 
ATOM   747  C CG  . GLN A 1 145 ? 14.513 27.495 7.039   1.00 36.05  ? 1338 GLN A CG  1 
ATOM   748  C CD  . GLN A 1 145 ? 15.321 28.550 7.748   1.00 37.11  ? 1338 GLN A CD  1 
ATOM   749  O OE1 . GLN A 1 145 ? 14.886 29.697 7.876   1.00 38.26  ? 1338 GLN A OE1 1 
ATOM   750  N NE2 . GLN A 1 145 ? 16.509 28.177 8.206   1.00 30.59  ? 1338 GLN A NE2 1 
ATOM   751  N N   . ILE A 1 146 ? 11.858 28.074 3.417   1.00 38.37  ? 1339 ILE A N   1 
ATOM   752  C CA  . ILE A 1 146 ? 10.983 28.792 2.505   1.00 42.30  ? 1339 ILE A CA  1 
ATOM   753  C C   . ILE A 1 146 ? 9.641  28.067 2.435   1.00 44.23  ? 1339 ILE A C   1 
ATOM   754  O O   . ILE A 1 146 ? 8.589  28.680 2.635   1.00 35.75  ? 1339 ILE A O   1 
ATOM   755  C CB  . ILE A 1 146 ? 11.605 28.924 1.098   1.00 49.16  ? 1339 ILE A CB  1 
ATOM   756  C CG1 . ILE A 1 146 ? 13.050 29.421 1.203   1.00 56.01  ? 1339 ILE A CG1 1 
ATOM   757  C CG2 . ILE A 1 146 ? 10.788 29.884 0.254   1.00 49.84  ? 1339 ILE A CG2 1 
ATOM   758  C CD1 . ILE A 1 146 ? 13.893 29.206 -0.059  1.00 51.54  ? 1339 ILE A CD1 1 
ATOM   759  N N   . ASP A 1 147 ? 9.698  26.758 2.188   1.00 34.20  ? 1340 ASP A N   1 
ATOM   760  C CA  . ASP A 1 147 ? 8.509  25.926 2.100   1.00 36.69  ? 1340 ASP A CA  1 
ATOM   761  C C   . ASP A 1 147 ? 7.740  25.918 3.417   1.00 48.89  ? 1340 ASP A C   1 
ATOM   762  O O   . ASP A 1 147 ? 6.497  26.008 3.437   1.00 44.31  ? 1340 ASP A O   1 
ATOM   763  C CB  . ASP A 1 147 ? 8.889  24.496 1.710   1.00 41.75  ? 1340 ASP A CB  1 
ATOM   764  C CG  . ASP A 1 147 ? 9.536  24.415 0.332   1.00 54.75  ? 1340 ASP A CG  1 
ATOM   765  O OD1 . ASP A 1 147 ? 9.328  25.346 -0.484  1.00 56.30  ? 1340 ASP A OD1 1 
ATOM   766  O OD2 . ASP A 1 147 ? 10.252 23.421 0.065   1.00 48.19  ? 1340 ASP A OD2 1 
ATOM   767  N N   . LEU A 1 148 ? 8.479  25.798 4.517   1.00 39.83  ? 1341 LEU A N   1 
ATOM   768  C CA  . LEU A 1 148 ? 7.862  25.825 5.834   1.00 30.46  ? 1341 LEU A CA  1 
ATOM   769  C C   . LEU A 1 148 ? 7.043  27.098 5.990   1.00 37.76  ? 1341 LEU A C   1 
ATOM   770  O O   . LEU A 1 148 ? 5.881  27.053 6.392   1.00 40.20  ? 1341 LEU A O   1 
ATOM   771  C CB  . LEU A 1 148 ? 8.920  25.730 6.931   1.00 29.72  ? 1341 LEU A CB  1 
ATOM   772  C CG  . LEU A 1 148 ? 9.509  24.345 7.211   1.00 32.69  ? 1341 LEU A CG  1 
ATOM   773  C CD1 . LEU A 1 148 ? 10.570 24.431 8.292   1.00 26.30  ? 1341 LEU A CD1 1 
ATOM   774  C CD2 . LEU A 1 148 ? 8.431  23.352 7.616   1.00 20.31  ? 1341 LEU A CD2 1 
ATOM   775  N N   . VAL A 1 149 ? 7.647  28.238 5.659   1.00 36.48  ? 1342 VAL A N   1 
ATOM   776  C CA  . VAL A 1 149 ? 6.964  29.523 5.804   1.00 37.19  ? 1342 VAL A CA  1 
ATOM   777  C C   . VAL A 1 149 ? 5.722  29.610 4.908   1.00 46.45  ? 1342 VAL A C   1 
ATOM   778  O O   . VAL A 1 149 ? 4.696  30.172 5.302   1.00 55.39  ? 1342 VAL A O   1 
ATOM   779  C CB  . VAL A 1 149 ? 7.914  30.714 5.537   1.00 38.84  ? 1342 VAL A CB  1 
ATOM   780  C CG1 . VAL A 1 149 ? 7.144  32.027 5.509   1.00 26.48  ? 1342 VAL A CG1 1 
ATOM   781  C CG2 . VAL A 1 149 ? 8.986  30.763 6.598   1.00 29.12  ? 1342 VAL A CG2 1 
ATOM   782  N N   . GLU A 1 150 ? 5.816  29.044 3.709   1.00 40.74  ? 1343 GLU A N   1 
ATOM   783  C CA  . GLU A 1 150 ? 4.686  29.028 2.785   1.00 43.69  ? 1343 GLU A CA  1 
ATOM   784  C C   . GLU A 1 150 ? 3.506  28.240 3.360   1.00 44.09  ? 1343 GLU A C   1 
ATOM   785  O O   . GLU A 1 150 ? 2.375  28.741 3.391   1.00 41.31  ? 1343 GLU A O   1 
ATOM   786  C CB  . GLU A 1 150 ? 5.097  28.441 1.425   1.00 62.00  ? 1343 GLU A CB  1 
ATOM   787  C CG  . GLU A 1 150 ? 5.931  29.365 0.539   1.00 55.31  ? 1343 GLU A CG  1 
ATOM   788  C CD  . GLU A 1 150 ? 5.160  30.586 0.080   1.00 63.82  ? 1343 GLU A CD  1 
ATOM   789  O OE1 . GLU A 1 150 ? 4.113  30.416 -0.578  1.00 60.35  ? 1343 GLU A OE1 1 
ATOM   790  O OE2 . GLU A 1 150 ? 5.603  31.718 0.372   1.00 78.50  ? 1343 GLU A OE2 1 
ATOM   791  N N   . ALA A 1 151 ? 3.772  27.012 3.810   1.00 38.46  ? 1344 ALA A N   1 
ATOM   792  C CA  . ALA A 1 151 ? 2.723  26.162 4.367   1.00 34.25  ? 1344 ALA A CA  1 
ATOM   793  C C   . ALA A 1 151 ? 2.012  26.880 5.493   1.00 35.33  ? 1344 ALA A C   1 
ATOM   794  O O   . ALA A 1 151 ? 0.785  26.843 5.599   1.00 44.73  ? 1344 ALA A O   1 
ATOM   795  C CB  . ALA A 1 151 ? 3.298  24.859 4.862   1.00 27.99  ? 1344 ALA A CB  1 
ATOM   796  N N   . HIS A 1 152 ? 2.797  27.547 6.328   1.00 38.36  ? 1345 HIS A N   1 
ATOM   797  C CA  . HIS A 1 152 ? 2.273  28.291 7.468   1.00 49.51  ? 1345 HIS A CA  1 
ATOM   798  C C   . HIS A 1 152 ? 1.193  29.316 7.086   1.00 51.46  ? 1345 HIS A C   1 
ATOM   799  O O   . HIS A 1 152 ? 0.410  29.742 7.935   1.00 53.23  ? 1345 HIS A O   1 
ATOM   800  C CB  . HIS A 1 152 ? 3.424  28.980 8.207   1.00 48.18  ? 1345 HIS A CB  1 
ATOM   801  C CG  . HIS A 1 152 ? 2.998  29.734 9.426   1.00 46.92  ? 1345 HIS A CG  1 
ATOM   802  N ND1 . HIS A 1 152 ? 2.486  29.110 10.543  1.00 44.98  ? 1345 HIS A ND1 1 
ATOM   803  C CD2 . HIS A 1 152 ? 3.023  31.057 9.710   1.00 49.52  ? 1345 HIS A CD2 1 
ATOM   804  C CE1 . HIS A 1 152 ? 2.205  30.018 11.461  1.00 52.78  ? 1345 HIS A CE1 1 
ATOM   805  N NE2 . HIS A 1 152 ? 2.523  31.207 10.982  1.00 70.92  ? 1345 HIS A NE2 1 
ATOM   806  N N   . LYS A 1 153 ? 1.153  29.713 5.817   1.00 44.72  ? 1346 LYS A N   1 
ATOM   807  C CA  . LYS A 1 153 ? 0.157  30.673 5.356   1.00 40.57  ? 1346 LYS A CA  1 
ATOM   808  C C   . LYS A 1 153 ? -1.244 30.082 5.440   1.00 49.38  ? 1346 LYS A C   1 
ATOM   809  O O   . LYS A 1 153 ? -2.222 30.806 5.641   1.00 54.06  ? 1346 LYS A O   1 
ATOM   810  C CB  . LYS A 1 153 ? 0.433  31.094 3.914   1.00 49.60  ? 1346 LYS A CB  1 
ATOM   811  C CG  . LYS A 1 153 ? 1.705  31.889 3.691   1.00 48.50  ? 1346 LYS A CG  1 
ATOM   812  C CD  . LYS A 1 153 ? 1.737  32.365 2.249   1.00 58.81  ? 1346 LYS A CD  1 
ATOM   813  C CE  . LYS A 1 153 ? 3.132  32.722 1.784   1.00 70.55  ? 1346 LYS A CE  1 
ATOM   814  N NZ  . LYS A 1 153 ? 3.151  32.950 0.311   1.00 63.90  ? 1346 LYS A NZ  1 
ATOM   815  N N   . ILE A 1 154 ? -1.337 28.768 5.269   1.00 37.64  ? 1347 ILE A N   1 
ATOM   816  C CA  . ILE A 1 154 ? -2.622 28.083 5.362   1.00 43.60  ? 1347 ILE A CA  1 
ATOM   817  C C   . ILE A 1 154 ? -3.231 28.262 6.755   1.00 52.73  ? 1347 ILE A C   1 
ATOM   818  O O   . ILE A 1 154 ? -2.646 27.852 7.763   1.00 54.01  ? 1347 ILE A O   1 
ATOM   819  C CB  . ILE A 1 154 ? -2.488 26.586 5.064   1.00 40.10  ? 1347 ILE A CB  1 
ATOM   820  C CG1 . ILE A 1 154 ? -1.791 26.378 3.727   1.00 37.37  ? 1347 ILE A CG1 1 
ATOM   821  C CG2 . ILE A 1 154 ? -3.857 25.933 5.039   1.00 40.20  ? 1347 ILE A CG2 1 
ATOM   822  C CD1 . ILE A 1 154 ? -1.508 24.935 3.419   1.00 40.90  ? 1347 ILE A CD1 1 
ATOM   823  N N   . ASN A 1 155 ? -4.411 28.869 6.801   1.00 48.31  ? 1348 ASN A N   1 
ATOM   824  C CA  . ASN A 1 155 ? -5.030 29.247 8.065   1.00 50.18  ? 1348 ASN A CA  1 
ATOM   825  C C   . ASN A 1 155 ? -5.695 28.101 8.822   1.00 45.68  ? 1348 ASN A C   1 
ATOM   826  O O   . ASN A 1 155 ? -5.704 28.091 10.053  1.00 64.73  ? 1348 ASN A O   1 
ATOM   827  C CB  . ASN A 1 155 ? -6.030 30.382 7.845   1.00 57.69  ? 1348 ASN A CB  1 
ATOM   828  C CG  . ASN A 1 155 ? -5.347 31.711 7.605   1.00 76.61  ? 1348 ASN A CG  1 
ATOM   829  O OD1 . ASN A 1 155 ? -4.559 32.175 8.436   1.00 58.67  ? 1348 ASN A OD1 1 
ATOM   830  N ND2 . ASN A 1 155 ? -5.640 32.333 6.461   1.00 70.24  ? 1348 ASN A ND2 1 
ATOM   831  N N   . ASP A 1 156 ? -6.262 27.144 8.096   1.00 43.32  ? 1349 ASP A N   1 
ATOM   832  C CA  . ASP A 1 156 ? -6.936 26.031 8.743   1.00 38.82  ? 1349 ASP A CA  1 
ATOM   833  C C   . ASP A 1 156 ? -5.892 25.127 9.376   1.00 52.74  ? 1349 ASP A C   1 
ATOM   834  O O   . ASP A 1 156 ? -4.912 24.756 8.725   1.00 46.30  ? 1349 ASP A O   1 
ATOM   835  C CB  . ASP A 1 156 ? -7.761 25.246 7.736   1.00 39.51  ? 1349 ASP A CB  1 
ATOM   836  C CG  . ASP A 1 156 ? -8.417 24.035 8.347   1.00 51.87  ? 1349 ASP A CG  1 
ATOM   837  O OD1 . ASP A 1 156 ? -9.482 24.201 8.988   1.00 52.29  ? 1349 ASP A OD1 1 
ATOM   838  O OD2 . ASP A 1 156 ? -7.867 22.921 8.175   1.00 40.91  ? 1349 ASP A OD2 1 
ATOM   839  N N   . ARG A 1 157 ? -6.106 24.769 10.640  1.00 52.32  ? 1350 ARG A N   1 
ATOM   840  C CA  . ARG A 1 157 ? -5.069 24.092 11.412  1.00 45.84  ? 1350 ARG A CA  1 
ATOM   841  C C   . ARG A 1 157 ? -4.682 22.713 10.862  1.00 42.28  ? 1350 ARG A C   1 
ATOM   842  O O   . ARG A 1 157 ? -3.500 22.424 10.699  1.00 37.44  ? 1350 ARG A O   1 
ATOM   843  C CB  . ARG A 1 157 ? -5.458 23.999 12.886  1.00 43.36  ? 1350 ARG A CB  1 
ATOM   844  C CG  . ARG A 1 157 ? -4.348 23.449 13.755  1.00 32.49  ? 1350 ARG A CG  1 
ATOM   845  C CD  . ARG A 1 157 ? -3.072 24.233 13.551  1.00 31.35  ? 1350 ARG A CD  1 
ATOM   846  N NE  . ARG A 1 157 ? -3.194 25.573 14.115  1.00 48.47  ? 1350 ARG A NE  1 
ATOM   847  C CZ  . ARG A 1 157 ? -2.848 25.889 15.360  1.00 39.87  ? 1350 ARG A CZ  1 
ATOM   848  N NH1 . ARG A 1 157 ? -3.008 27.135 15.796  1.00 19.07  ? 1350 ARG A NH1 1 
ATOM   849  N NH2 . ARG A 1 157 ? -2.343 24.956 16.164  1.00 33.08  ? 1350 ARG A NH2 1 
ATOM   850  N N   . GLU A 1 158 ? -5.664 21.863 10.578  1.00 39.78  ? 1351 GLU A N   1 
ATOM   851  C CA  . GLU A 1 158 ? -5.348 20.550 10.039  1.00 36.10  ? 1351 GLU A CA  1 
ATOM   852  C C   . GLU A 1 158 ? -4.640 20.664 8.689   1.00 48.70  ? 1351 GLU A C   1 
ATOM   853  O O   . GLU A 1 158 ? -3.643 19.982 8.437   1.00 44.82  ? 1351 GLU A O   1 
ATOM   854  C CB  . GLU A 1 158 ? -6.597 19.688 9.900   1.00 30.57  ? 1351 GLU A CB  1 
ATOM   855  C CG  . GLU A 1 158 ? -6.278 18.306 9.352   1.00 46.25  ? 1351 GLU A CG  1 
ATOM   856  C CD  . GLU A 1 158 ? -7.505 17.452 9.114   1.00 48.48  ? 1351 GLU A CD  1 
ATOM   857  O OE1 . GLU A 1 158 ? -7.334 16.271 8.742   1.00 57.30  ? 1351 GLU A OE1 1 
ATOM   858  O OE2 . GLU A 1 158 ? -8.632 17.954 9.296   1.00 37.41  ? 1351 GLU A OE2 1 
ATOM   859  N N   . GLN A 1 159 ? -5.161 21.523 7.819   1.00 56.00  ? 1352 GLN A N   1 
ATOM   860  C CA  . GLN A 1 159 ? -4.548 21.753 6.510   1.00 48.58  ? 1352 GLN A CA  1 
ATOM   861  C C   . GLN A 1 159 ? -3.100 22.180 6.684   1.00 46.02  ? 1352 GLN A C   1 
ATOM   862  O O   . GLN A 1 159 ? -2.195 21.640 6.045   1.00 47.00  ? 1352 GLN A O   1 
ATOM   863  C CB  . GLN A 1 159 ? -5.310 22.837 5.740   1.00 54.37  ? 1352 GLN A CB  1 
ATOM   864  C CG  . GLN A 1 159 ? -6.612 22.361 5.114   1.00 51.13  ? 1352 GLN A CG  1 
ATOM   865  C CD  . GLN A 1 159 ? -6.382 21.263 4.113   1.00 64.61  ? 1352 GLN A CD  1 
ATOM   866  O OE1 . GLN A 1 159 ? -5.862 21.499 3.013   1.00 64.56  ? 1352 GLN A OE1 1 
ATOM   867  N NE2 . GLN A 1 159 ? -6.762 20.046 4.485   1.00 52.05  ? 1352 GLN A NE2 1 
ATOM   868  N N   . LYS A 1 160 ? -2.900 23.150 7.569   1.00 37.42  ? 1353 LYS A N   1 
ATOM   869  C CA  . LYS A 1 160 ? -1.581 23.693 7.861   1.00 31.12  ? 1353 LYS A CA  1 
ATOM   870  C C   . LYS A 1 160 ? -0.617 22.598 8.268   1.00 35.04  ? 1353 LYS A C   1 
ATOM   871  O O   . LYS A 1 160 ? 0.514  22.530 7.784   1.00 30.37  ? 1353 LYS A O   1 
ATOM   872  C CB  . LYS A 1 160 ? -1.692 24.698 8.998   1.00 35.65  ? 1353 LYS A CB  1 
ATOM   873  C CG  . LYS A 1 160 ? -0.461 25.542 9.251   1.00 34.47  ? 1353 LYS A CG  1 
ATOM   874  C CD  . LYS A 1 160 ? -0.761 26.523 10.376  1.00 35.40  ? 1353 LYS A CD  1 
ATOM   875  C CE  . LYS A 1 160 ? -0.270 27.906 10.043  1.00 47.53  ? 1353 LYS A CE  1 
ATOM   876  N NZ  . LYS A 1 160 ? -1.007 28.946 10.811  1.00 62.13  ? 1353 LYS A NZ  1 
ATOM   877  N N   . LEU A 1 161 ? -1.060 21.735 9.168   1.00 29.21  ? 1354 LEU A N   1 
ATOM   878  C CA  . LEU A 1 161 ? -0.182 20.699 9.669   1.00 28.68  ? 1354 LEU A CA  1 
ATOM   879  C C   . LEU A 1 161 ? 0.195  19.711 8.569   1.00 36.00  ? 1354 LEU A C   1 
ATOM   880  O O   . LEU A 1 161 ? 1.342  19.254 8.518   1.00 34.04  ? 1354 LEU A O   1 
ATOM   881  C CB  . LEU A 1 161 ? -0.790 19.999 10.889  1.00 39.41  ? 1354 LEU A CB  1 
ATOM   882  C CG  . LEU A 1 161 ? -0.843 20.876 12.147  1.00 28.95  ? 1354 LEU A CG  1 
ATOM   883  C CD1 . LEU A 1 161 ? -1.577 20.182 13.273  1.00 23.30  ? 1354 LEU A CD1 1 
ATOM   884  C CD2 . LEU A 1 161 ? 0.554  21.258 12.589  1.00 28.92  ? 1354 LEU A CD2 1 
ATOM   885  N N   . HIS A 1 162 ? -0.747 19.388 7.679   1.00 34.62  ? 1355 HIS A N   1 
ATOM   886  C CA  . HIS A 1 162 ? -0.422 18.493 6.560   1.00 38.17  ? 1355 HIS A CA  1 
ATOM   887  C C   . HIS A 1 162 ? 0.634  19.145 5.662   1.00 37.43  ? 1355 HIS A C   1 
ATOM   888  O O   . HIS A 1 162 ? 1.672  18.536 5.336   1.00 28.38  ? 1355 HIS A O   1 
ATOM   889  C CB  . HIS A 1 162 ? -1.666 18.096 5.757   1.00 29.78  ? 1355 HIS A CB  1 
ATOM   890  C CG  . HIS A 1 162 ? -2.536 17.099 6.457   1.00 54.72  ? 1355 HIS A CG  1 
ATOM   891  N ND1 . HIS A 1 162 ? -3.842 17.367 6.819   1.00 59.81  ? 1355 HIS A ND1 1 
ATOM   892  C CD2 . HIS A 1 162 ? -2.275 15.841 6.892   1.00 45.92  ? 1355 HIS A CD2 1 
ATOM   893  C CE1 . HIS A 1 162 ? -4.353 16.312 7.430   1.00 50.93  ? 1355 HIS A CE1 1 
ATOM   894  N NE2 . HIS A 1 162 ? -3.425 15.372 7.487   1.00 63.97  ? 1355 HIS A NE2 1 
ATOM   895  N N   . ALA A 1 163 ? 0.370  20.396 5.286   1.00 33.31  ? 1356 ALA A N   1 
ATOM   896  C CA  . ALA A 1 163 ? 1.312  21.173 4.491   1.00 22.71  ? 1356 ALA A CA  1 
ATOM   897  C C   . ALA A 1 163 ? 2.697  21.094 5.107   1.00 31.37  ? 1356 ALA A C   1 
ATOM   898  O O   . ALA A 1 163 ? 3.680  20.821 4.418   1.00 38.09  ? 1356 ALA A O   1 
ATOM   899  C CB  . ALA A 1 163 ? 0.863  22.618 4.396   1.00 21.78  ? 1356 ALA A CB  1 
ATOM   900  N N   . LEU A 1 164 ? 2.769  21.326 6.415   1.00 38.78  ? 1357 LEU A N   1 
ATOM   901  C CA  . LEU A 1 164 ? 4.044  21.311 7.124   1.00 32.37  ? 1357 LEU A CA  1 
ATOM   902  C C   . LEU A 1 164 ? 4.683  19.934 7.091   1.00 27.13  ? 1357 LEU A C   1 
ATOM   903  O O   . LEU A 1 164 ? 5.876  19.807 6.845   1.00 31.23  ? 1357 LEU A O   1 
ATOM   904  C CB  . LEU A 1 164 ? 3.873  21.787 8.569   1.00 30.21  ? 1357 LEU A CB  1 
ATOM   905  C CG  . LEU A 1 164 ? 3.708  23.297 8.741   1.00 25.67  ? 1357 LEU A CG  1 
ATOM   906  C CD1 . LEU A 1 164 ? 3.067  23.632 10.065  1.00 27.34  ? 1357 LEU A CD1 1 
ATOM   907  C CD2 . LEU A 1 164 ? 5.052  23.987 8.611   1.00 20.05  ? 1357 LEU A CD2 1 
ATOM   908  N N   . LYS A 1 165 ? 3.895  18.899 7.339   1.00 25.41  ? 1358 LYS A N   1 
ATOM   909  C CA  . LYS A 1 165 ? 4.453  17.559 7.343   1.00 35.75  ? 1358 LYS A CA  1 
ATOM   910  C C   . LYS A 1 165 ? 4.994  17.227 5.954   1.00 41.15  ? 1358 LYS A C   1 
ATOM   911  O O   . LYS A 1 165 ? 5.967  16.475 5.815   1.00 34.76  ? 1358 LYS A O   1 
ATOM   912  C CB  . LYS A 1 165 ? 3.415  16.524 7.784   1.00 31.89  ? 1358 LYS A CB  1 
ATOM   913  C CG  . LYS A 1 165 ? 4.025  15.173 8.143   1.00 29.89  ? 1358 LYS A CG  1 
ATOM   914  C CD  . LYS A 1 165 ? 2.949  14.200 8.568   1.00 37.86  ? 1358 LYS A CD  1 
ATOM   915  C CE  . LYS A 1 165 ? 3.535  12.988 9.255   1.00 41.87  ? 1358 LYS A CE  1 
ATOM   916  N NZ  . LYS A 1 165 ? 2.451  12.132 9.800   1.00 51.97  ? 1358 LYS A NZ  1 
ATOM   917  N N   . GLU A 1 166 ? 4.366  17.799 4.931   1.00 33.86  ? 1359 GLU A N   1 
ATOM   918  C CA  . GLU A 1 166 ? 4.833  17.595 3.567   1.00 38.85  ? 1359 GLU A CA  1 
ATOM   919  C C   . GLU A 1 166 ? 6.241  18.131 3.371   1.00 38.58  ? 1359 GLU A C   1 
ATOM   920  O O   . GLU A 1 166 ? 7.094  17.444 2.820   1.00 49.99  ? 1359 GLU A O   1 
ATOM   921  C CB  . GLU A 1 166 ? 3.875  18.223 2.549   1.00 47.15  ? 1359 GLU A CB  1 
ATOM   922  C CG  . GLU A 1 166 ? 2.847  17.248 1.967   1.00 44.24  ? 1359 GLU A CG  1 
ATOM   923  C CD  . GLU A 1 166 ? 3.500  16.124 1.197   1.00 61.30  ? 1359 GLU A CD  1 
ATOM   924  O OE1 . GLU A 1 166 ? 3.268  14.945 1.548   1.00 61.72  ? 1359 GLU A OE1 1 
ATOM   925  O OE2 . GLU A 1 166 ? 4.260  16.426 0.253   1.00 51.85  ? 1359 GLU A OE2 1 
ATOM   926  N N   . VAL A 1 167 ? 6.485  19.359 3.819   1.00 39.50  ? 1360 VAL A N   1 
ATOM   927  C CA  . VAL A 1 167 ? 7.835  19.915 3.761   1.00 36.09  ? 1360 VAL A CA  1 
ATOM   928  C C   . VAL A 1 167 ? 8.769  19.009 4.533   1.00 29.81  ? 1360 VAL A C   1 
ATOM   929  O O   . VAL A 1 167 ? 9.879  18.725 4.105   1.00 32.87  ? 1360 VAL A O   1 
ATOM   930  C CB  . VAL A 1 167 ? 7.931  21.323 4.369   1.00 27.45  ? 1360 VAL A CB  1 
ATOM   931  C CG1 . VAL A 1 167 ? 9.371  21.790 4.344   1.00 26.40  ? 1360 VAL A CG1 1 
ATOM   932  C CG2 . VAL A 1 167 ? 7.040  22.299 3.616   1.00 29.49  ? 1360 VAL A CG2 1 
ATOM   933  N N   . LEU A 1 168 ? 8.293  18.543 5.677   1.00 35.26  ? 1361 LEU A N   1 
ATOM   934  C CA  . LEU A 1 168 ? 9.097  17.714 6.556   1.00 35.02  ? 1361 LEU A CA  1 
ATOM   935  C C   . LEU A 1 168 ? 9.591  16.473 5.828   1.00 39.74  ? 1361 LEU A C   1 
ATOM   936  O O   . LEU A 1 168 ? 10.652 15.954 6.147   1.00 46.57  ? 1361 LEU A O   1 
ATOM   937  C CB  . LEU A 1 168 ? 8.300  17.339 7.806   1.00 34.63  ? 1361 LEU A CB  1 
ATOM   938  C CG  . LEU A 1 168 ? 9.120  16.672 8.906   1.00 40.68  ? 1361 LEU A CG  1 
ATOM   939  C CD1 . LEU A 1 168 ? 10.254 17.580 9.333   1.00 39.26  ? 1361 LEU A CD1 1 
ATOM   940  C CD2 . LEU A 1 168 ? 8.230  16.319 10.093  1.00 43.29  ? 1361 LEU A CD2 1 
ATOM   941  N N   . LYS A 1 169 ? 8.824  16.012 4.840   1.00 47.00  ? 1362 LYS A N   1 
ATOM   942  C CA  . LYS A 1 169 ? 9.202  14.854 4.018   1.00 47.63  ? 1362 LYS A CA  1 
ATOM   943  C C   . LYS A 1 169 ? 10.355 15.167 3.072   1.00 45.92  ? 1362 LYS A C   1 
ATOM   944  O O   . LYS A 1 169 ? 11.076 14.274 2.640   1.00 46.67  ? 1362 LYS A O   1 
ATOM   945  C CB  . LYS A 1 169 ? 8.014  14.364 3.185   1.00 40.33  ? 1362 LYS A CB  1 
ATOM   946  C CG  . LYS A 1 169 ? 6.931  13.676 3.989   1.00 64.59  ? 1362 LYS A CG  1 
ATOM   947  C CD  . LYS A 1 169 ? 5.742  13.339 3.106   1.00 63.07  ? 1362 LYS A CD  1 
ATOM   948  C CE  . LYS A 1 169 ? 4.615  12.720 3.913   1.00 67.79  ? 1362 LYS A CE  1 
ATOM   949  N NZ  . LYS A 1 169 ? 3.412  12.495 3.071   1.00 64.90  ? 1362 LYS A NZ  1 
ATOM   950  N N   . LYS A 1 170 ? 10.521 16.440 2.742   1.00 36.90  ? 1363 LYS A N   1 
ATOM   951  C CA  . LYS A 1 170 ? 11.556 16.844 1.797   1.00 37.97  ? 1363 LYS A CA  1 
ATOM   952  C C   . LYS A 1 170 ? 12.900 17.170 2.463   1.00 46.74  ? 1363 LYS A C   1 
ATOM   953  O O   . LYS A 1 170 ? 13.867 17.525 1.783   1.00 45.08  ? 1363 LYS A O   1 
ATOM   954  C CB  . LYS A 1 170 ? 11.081 18.043 0.963   1.00 42.36  ? 1363 LYS A CB  1 
ATOM   955  C CG  . LYS A 1 170 ? 10.004 17.705 -0.070  1.00 56.12  ? 1363 LYS A CG  1 
ATOM   956  C CD  . LYS A 1 170 ? 9.975  18.723 -1.207  1.00 59.52  ? 1363 LYS A CD  1 
ATOM   957  N N   . PHE A 1 171 ? 12.959 17.066 3.788   1.00 43.68  ? 1364 PHE A N   1 
ATOM   958  C CA  . PHE A 1 171 ? 14.204 17.321 4.507   1.00 38.82  ? 1364 PHE A CA  1 
ATOM   959  C C   . PHE A 1 171 ? 15.262 16.328 4.053   1.00 38.87  ? 1364 PHE A C   1 
ATOM   960  O O   . PHE A 1 171 ? 14.960 15.159 3.834   1.00 43.73  ? 1364 PHE A O   1 
ATOM   961  C CB  . PHE A 1 171 ? 14.000 17.159 6.019   1.00 46.92  ? 1364 PHE A CB  1 
ATOM   962  C CG  . PHE A 1 171 ? 13.554 18.412 6.727   1.00 39.85  ? 1364 PHE A CG  1 
ATOM   963  C CD1 . PHE A 1 171 ? 12.516 19.179 6.230   1.00 30.55  ? 1364 PHE A CD1 1 
ATOM   964  C CD2 . PHE A 1 171 ? 14.156 18.796 7.916   1.00 33.72  ? 1364 PHE A CD2 1 
ATOM   965  C CE1 . PHE A 1 171 ? 12.107 20.321 6.891   1.00 36.26  ? 1364 PHE A CE1 1 
ATOM   966  C CE2 . PHE A 1 171 ? 13.753 19.939 8.579   1.00 31.57  ? 1364 PHE A CE2 1 
ATOM   967  C CZ  . PHE A 1 171 ? 12.728 20.701 8.072   1.00 31.78  ? 1364 PHE A CZ  1 
ATOM   968  N N   . PRO A 1 172 ? 16.508 16.790 3.906   1.00 40.31  ? 1365 PRO A N   1 
ATOM   969  C CA  . PRO A 1 172 ? 17.641 15.864 3.817   1.00 31.51  ? 1365 PRO A CA  1 
ATOM   970  C C   . PRO A 1 172 ? 17.556 14.904 4.993   1.00 44.68  ? 1365 PRO A C   1 
ATOM   971  O O   . PRO A 1 172 ? 17.260 15.347 6.105   1.00 46.52  ? 1365 PRO A O   1 
ATOM   972  C CB  . PRO A 1 172 ? 18.848 16.779 4.002   1.00 32.50  ? 1365 PRO A CB  1 
ATOM   973  C CG  . PRO A 1 172 ? 18.392 18.110 3.505   1.00 45.11  ? 1365 PRO A CG  1 
ATOM   974  C CD  . PRO A 1 172 ? 16.919 18.199 3.793   1.00 43.17  ? 1365 PRO A CD  1 
ATOM   975  N N   . LYS A 1 173 ? 17.807 13.619 4.766   1.00 44.78  ? 1366 LYS A N   1 
ATOM   976  C CA  . LYS A 1 173 ? 17.588 12.633 5.815   1.00 41.88  ? 1366 LYS A CA  1 
ATOM   977  C C   . LYS A 1 173 ? 18.480 12.850 7.033   1.00 44.32  ? 1366 LYS A C   1 
ATOM   978  O O   . LYS A 1 173 ? 18.047 12.645 8.161   1.00 42.74  ? 1366 LYS A O   1 
ATOM   979  C CB  . LYS A 1 173 ? 17.732 11.202 5.287   1.00 45.21  ? 1366 LYS A CB  1 
ATOM   980  C CG  . LYS A 1 173 ? 17.340 10.137 6.316   1.00 55.40  ? 1366 LYS A CG  1 
ATOM   981  C CD  . LYS A 1 173 ? 16.847 8.866  5.646   1.00 82.46  ? 1366 LYS A CD  1 
ATOM   982  C CE  . LYS A 1 173 ? 16.151 7.951  6.641   1.00 84.63  ? 1366 LYS A CE  1 
ATOM   983  N NZ  . LYS A 1 173 ? 15.384 6.873  5.948   1.00 87.19  ? 1366 LYS A NZ  1 
ATOM   984  N N   . GLU A 1 174 ? 19.723 13.259 6.807   1.00 42.43  ? 1367 GLU A N   1 
ATOM   985  C CA  . GLU A 1 174 ? 20.633 13.520 7.913   1.00 44.61  ? 1367 GLU A CA  1 
ATOM   986  C C   . GLU A 1 174 ? 20.000 14.532 8.874   1.00 50.90  ? 1367 GLU A C   1 
ATOM   987  O O   . GLU A 1 174 ? 19.948 14.314 10.094  1.00 45.79  ? 1367 GLU A O   1 
ATOM   988  C CB  . GLU A 1 174 ? 21.979 14.046 7.406   1.00 41.24  ? 1367 GLU A CB  1 
ATOM   989  C CG  . GLU A 1 174 ? 22.777 13.064 6.567   1.00 57.49  ? 1367 GLU A CG  1 
ATOM   990  C CD  . GLU A 1 174 ? 22.207 12.876 5.162   1.00 89.23  ? 1367 GLU A CD  1 
ATOM   991  O OE1 . GLU A 1 174 ? 22.501 11.826 4.544   1.00 83.57  ? 1367 GLU A OE1 1 
ATOM   992  O OE2 . GLU A 1 174 ? 21.469 13.769 4.676   1.00 68.76  ? 1367 GLU A OE2 1 
ATOM   993  N N   . ASN A 1 175 ? 19.514 15.636 8.317   1.00 36.32  ? 1368 ASN A N   1 
ATOM   994  C CA  . ASN A 1 175 ? 18.898 16.681 9.122   1.00 47.31  ? 1368 ASN A CA  1 
ATOM   995  C C   . ASN A 1 175 ? 17.589 16.223 9.745   1.00 46.43  ? 1368 ASN A C   1 
ATOM   996  O O   . ASN A 1 175 ? 17.317 16.504 10.918  1.00 41.51  ? 1368 ASN A O   1 
ATOM   997  C CB  . ASN A 1 175 ? 18.648 17.937 8.285   1.00 40.56  ? 1368 ASN A CB  1 
ATOM   998  C CG  . ASN A 1 175 ? 19.873 18.379 7.524   1.00 43.98  ? 1368 ASN A CG  1 
ATOM   999  O OD1 . ASN A 1 175 ? 20.411 17.637 6.706   1.00 53.76  ? 1368 ASN A OD1 1 
ATOM   1000 N ND2 . ASN A 1 175 ? 20.320 19.594 7.784   1.00 46.42  ? 1368 ASN A ND2 1 
ATOM   1001 N N   . HIS A 1 176 ? 16.774 15.529 8.951   1.00 46.18  ? 1369 HIS A N   1 
ATOM   1002 C CA  . HIS A 1 176 ? 15.458 15.121 9.408   1.00 38.24  ? 1369 HIS A CA  1 
ATOM   1003 C C   . HIS A 1 176 ? 15.580 14.305 10.688  1.00 39.14  ? 1369 HIS A C   1 
ATOM   1004 O O   . HIS A 1 176 ? 14.797 14.483 11.626  1.00 35.66  ? 1369 HIS A O   1 
ATOM   1005 C CB  . HIS A 1 176 ? 14.715 14.333 8.336   1.00 30.52  ? 1369 HIS A CB  1 
ATOM   1006 C CG  . HIS A 1 176 ? 13.397 13.801 8.798   1.00 36.14  ? 1369 HIS A CG  1 
ATOM   1007 N ND1 . HIS A 1 176 ? 12.211 14.462 8.569   1.00 39.79  ? 1369 HIS A ND1 1 
ATOM   1008 C CD2 . HIS A 1 176 ? 13.079 12.687 9.504   1.00 30.84  ? 1369 HIS A CD2 1 
ATOM   1009 C CE1 . HIS A 1 176 ? 11.215 13.773 9.099   1.00 40.32  ? 1369 HIS A CE1 1 
ATOM   1010 N NE2 . HIS A 1 176 ? 11.714 12.694 9.674   1.00 35.76  ? 1369 HIS A NE2 1 
ATOM   1011 N N   . GLU A 1 177 ? 16.577 13.426 10.724  1.00 36.08  ? 1370 GLU A N   1 
ATOM   1012 C CA  . GLU A 1 177 ? 16.834 12.602 11.902  1.00 42.21  ? 1370 GLU A CA  1 
ATOM   1013 C C   . GLU A 1 177 ? 17.202 13.425 13.136  1.00 42.28  ? 1370 GLU A C   1 
ATOM   1014 O O   . GLU A 1 177 ? 16.617 13.245 14.210  1.00 38.47  ? 1370 GLU A O   1 
ATOM   1015 C CB  . GLU A 1 177 ? 17.922 11.566 11.614  1.00 44.88  ? 1370 GLU A CB  1 
ATOM   1016 C CG  . GLU A 1 177 ? 17.418 10.420 10.780  1.00 35.99  ? 1370 GLU A CG  1 
ATOM   1017 C CD  . GLU A 1 177 ? 16.055 9.958  11.241  1.00 61.90  ? 1370 GLU A CD  1 
ATOM   1018 O OE1 . GLU A 1 177 ? 15.063 10.228 10.521  1.00 57.53  ? 1370 GLU A OE1 1 
ATOM   1019 O OE2 . GLU A 1 177 ? 15.981 9.355  12.339  1.00 58.59  ? 1370 GLU A OE2 1 
ATOM   1020 N N   . VAL A 1 178 ? 18.171 14.324 12.985  1.00 38.62  ? 1371 VAL A N   1 
ATOM   1021 C CA  . VAL A 1 178 ? 18.579 15.172 14.098  1.00 34.84  ? 1371 VAL A CA  1 
ATOM   1022 C C   . VAL A 1 178 ? 17.438 16.083 14.504  1.00 32.76  ? 1371 VAL A C   1 
ATOM   1023 O O   . VAL A 1 178 ? 17.167 16.236 15.689  1.00 35.31  ? 1371 VAL A O   1 
ATOM   1024 C CB  . VAL A 1 178 ? 19.820 16.008 13.772  1.00 38.01  ? 1371 VAL A CB  1 
ATOM   1025 C CG1 . VAL A 1 178 ? 20.259 16.799 14.987  1.00 25.95  ? 1371 VAL A CG1 1 
ATOM   1026 C CG2 . VAL A 1 178 ? 20.946 15.112 13.297  1.00 39.36  ? 1371 VAL A CG2 1 
ATOM   1027 N N   . PHE A 1 179 ? 16.754 16.670 13.525  1.00 30.48  ? 1372 PHE A N   1 
ATOM   1028 C CA  . PHE A 1 179 ? 15.577 17.481 13.829  1.00 34.48  ? 1372 PHE A CA  1 
ATOM   1029 C C   . PHE A 1 179 ? 14.561 16.684 14.639  1.00 36.32  ? 1372 PHE A C   1 
ATOM   1030 O O   . PHE A 1 179 ? 14.055 17.167 15.649  1.00 34.46  ? 1372 PHE A O   1 
ATOM   1031 C CB  . PHE A 1 179 ? 14.917 18.020 12.564  1.00 26.76  ? 1372 PHE A CB  1 
ATOM   1032 C CG  . PHE A 1 179 ? 13.938 19.131 12.824  1.00 30.18  ? 1372 PHE A CG  1 
ATOM   1033 C CD1 . PHE A 1 179 ? 14.340 20.293 13.473  1.00 34.60  ? 1372 PHE A CD1 1 
ATOM   1034 C CD2 . PHE A 1 179 ? 12.619 19.027 12.407  1.00 32.18  ? 1372 PHE A CD2 1 
ATOM   1035 C CE1 . PHE A 1 179 ? 13.441 21.332 13.709  1.00 29.41  ? 1372 PHE A CE1 1 
ATOM   1036 C CE2 . PHE A 1 179 ? 11.711 20.063 12.636  1.00 32.02  ? 1372 PHE A CE2 1 
ATOM   1037 C CZ  . PHE A 1 179 ? 12.123 21.213 13.288  1.00 24.66  ? 1372 PHE A CZ  1 
ATOM   1038 N N   . LYS A 1 180 ? 14.269 15.463 14.191  1.00 38.71  ? 1373 LYS A N   1 
ATOM   1039 C CA  . LYS A 1 180 ? 13.326 14.599 14.882  1.00 29.42  ? 1373 LYS A CA  1 
ATOM   1040 C C   . LYS A 1 180 ? 13.769 14.422 16.322  1.00 28.95  ? 1373 LYS A C   1 
ATOM   1041 O O   . LYS A 1 180 ? 12.990 14.642 17.243  1.00 31.12  ? 1373 LYS A O   1 
ATOM   1042 C CB  . LYS A 1 180 ? 13.248 13.241 14.193  1.00 37.65  ? 1373 LYS A CB  1 
ATOM   1043 C CG  . LYS A 1 180 ? 12.154 12.311 14.711  1.00 30.34  ? 1373 LYS A CG  1 
ATOM   1044 C CD  . LYS A 1 180 ? 12.529 10.861 14.424  1.00 42.22  ? 1373 LYS A CD  1 
ATOM   1045 C CE  . LYS A 1 180 ? 11.376 9.905  14.672  1.00 55.17  ? 1373 LYS A CE  1 
ATOM   1046 N NZ  . LYS A 1 180 ? 10.560 9.655  13.439  1.00 65.86  ? 1373 LYS A NZ  1 
ATOM   1047 N N   . TYR A 1 181 ? 15.032 14.051 16.510  1.00 30.49  ? 1374 TYR A N   1 
ATOM   1048 C CA  . TYR A 1 181 ? 15.587 13.806 17.845  1.00 32.26  ? 1374 TYR A CA  1 
ATOM   1049 C C   . TYR A 1 181 ? 15.433 15.021 18.759  1.00 36.90  ? 1374 TYR A C   1 
ATOM   1050 O O   . TYR A 1 181 ? 14.862 14.931 19.851  1.00 33.79  ? 1374 TYR A O   1 
ATOM   1051 C CB  . TYR A 1 181 ? 17.063 13.415 17.725  1.00 31.51  ? 1374 TYR A CB  1 
ATOM   1052 C CG  . TYR A 1 181 ? 17.716 12.900 18.992  1.00 30.71  ? 1374 TYR A CG  1 
ATOM   1053 C CD1 . TYR A 1 181 ? 17.598 11.572 19.368  1.00 29.07  ? 1374 TYR A CD1 1 
ATOM   1054 C CD2 . TYR A 1 181 ? 18.484 13.736 19.787  1.00 28.68  ? 1374 TYR A CD2 1 
ATOM   1055 C CE1 . TYR A 1 181 ? 18.213 11.091 20.509  1.00 23.88  ? 1374 TYR A CE1 1 
ATOM   1056 C CE2 . TYR A 1 181 ? 19.102 13.269 20.931  1.00 39.97  ? 1374 TYR A CE2 1 
ATOM   1057 C CZ  . TYR A 1 181 ? 18.961 11.944 21.291  1.00 45.82  ? 1374 TYR A CZ  1 
ATOM   1058 O OH  . TYR A 1 181 ? 19.575 11.474 22.436  1.00 51.09  ? 1374 TYR A OH  1 
ATOM   1059 N N   . VAL A 1 182 ? 15.946 16.161 18.305  1.00 37.26  ? 1375 VAL A N   1 
ATOM   1060 C CA  . VAL A 1 182 ? 15.867 17.388 19.079  1.00 32.71  ? 1375 VAL A CA  1 
ATOM   1061 C C   . VAL A 1 182 ? 14.418 17.737 19.417  1.00 33.08  ? 1375 VAL A C   1 
ATOM   1062 O O   . VAL A 1 182 ? 14.087 18.000 20.575  1.00 27.27  ? 1375 VAL A O   1 
ATOM   1063 C CB  . VAL A 1 182 ? 16.549 18.557 18.351  1.00 27.09  ? 1375 VAL A CB  1 
ATOM   1064 C CG1 . VAL A 1 182 ? 16.439 19.827 19.167  1.00 32.62  ? 1375 VAL A CG1 1 
ATOM   1065 C CG2 . VAL A 1 182 ? 17.995 18.229 18.096  1.00 30.76  ? 1375 VAL A CG2 1 
ATOM   1066 N N   . ILE A 1 183 ? 13.549 17.722 18.413  1.00 31.37  ? 1376 ILE A N   1 
ATOM   1067 C CA  . ILE A 1 183 ? 12.167 18.125 18.630  1.00 24.57  ? 1376 ILE A CA  1 
ATOM   1068 C C   . ILE A 1 183 ? 11.465 17.224 19.635  1.00 28.31  ? 1376 ILE A C   1 
ATOM   1069 O O   . ILE A 1 183 ? 10.771 17.713 20.513  1.00 30.62  ? 1376 ILE A O   1 
ATOM   1070 C CB  . ILE A 1 183 ? 11.357 18.199 17.324  1.00 28.82  ? 1376 ILE A CB  1 
ATOM   1071 C CG1 . ILE A 1 183 ? 11.911 19.300 16.416  1.00 27.71  ? 1376 ILE A CG1 1 
ATOM   1072 C CG2 . ILE A 1 183 ? 9.885  18.475 17.617  1.00 25.49  ? 1376 ILE A CG2 1 
ATOM   1073 C CD1 . ILE A 1 183 ? 11.899 20.664 17.056  1.00 28.00  ? 1376 ILE A CD1 1 
ATOM   1074 N N   . SER A 1 184 ? 11.633 15.911 19.525  1.00 29.19  ? 1377 SER A N   1 
ATOM   1075 C CA  . SER A 1 184 ? 10.970 15.040 20.488  1.00 24.54  ? 1377 SER A CA  1 
ATOM   1076 C C   . SER A 1 184 ? 11.495 15.320 21.877  1.00 27.67  ? 1377 SER A C   1 
ATOM   1077 O O   . SER A 1 184 ? 10.728 15.380 22.829  1.00 34.05  ? 1377 SER A O   1 
ATOM   1078 C CB  . SER A 1 184 ? 11.077 13.556 20.133  1.00 20.10  ? 1377 SER A CB  1 
ATOM   1079 O OG  . SER A 1 184 ? 11.858 13.347 18.979  1.00 44.82  ? 1377 SER A OG  1 
ATOM   1080 N N   . HIS A 1 185 ? 12.800 15.520 21.991  1.00 28.18  ? 1378 HIS A N   1 
ATOM   1081 C CA  . HIS A 1 185 ? 13.390 15.899 23.271  1.00 23.03  ? 1378 HIS A CA  1 
ATOM   1082 C C   . HIS A 1 185 ? 12.702 17.136 23.842  1.00 28.15  ? 1378 HIS A C   1 
ATOM   1083 O O   . HIS A 1 185 ? 12.356 17.182 25.022  1.00 28.19  ? 1378 HIS A O   1 
ATOM   1084 C CB  . HIS A 1 185 ? 14.888 16.162 23.126  1.00 21.24  ? 1378 HIS A CB  1 
ATOM   1085 C CG  . HIS A 1 185 ? 15.497 16.811 24.323  1.00 23.18  ? 1378 HIS A CG  1 
ATOM   1086 N ND1 . HIS A 1 185 ? 15.418 16.265 25.586  1.00 33.61  ? 1378 HIS A ND1 1 
ATOM   1087 C CD2 . HIS A 1 185 ? 16.186 17.968 24.459  1.00 28.33  ? 1378 HIS A CD2 1 
ATOM   1088 C CE1 . HIS A 1 185 ? 16.029 17.057 26.448  1.00 30.50  ? 1378 HIS A CE1 1 
ATOM   1089 N NE2 . HIS A 1 185 ? 16.504 18.098 25.790  1.00 32.65  ? 1378 HIS A NE2 1 
ATOM   1090 N N   . LEU A 1 186 ? 12.514 18.146 23.002  1.00 29.52  ? 1379 LEU A N   1 
ATOM   1091 C CA  . LEU A 1 186 ? 11.871 19.380 23.437  1.00 24.36  ? 1379 LEU A CA  1 
ATOM   1092 C C   . LEU A 1 186 ? 10.427 19.106 23.801  1.00 26.96  ? 1379 LEU A C   1 
ATOM   1093 O O   . LEU A 1 186 ? 9.881  19.695 24.738  1.00 31.69  ? 1379 LEU A O   1 
ATOM   1094 C CB  . LEU A 1 186 ? 11.933 20.447 22.344  1.00 23.87  ? 1379 LEU A CB  1 
ATOM   1095 C CG  . LEU A 1 186 ? 13.311 21.026 22.053  1.00 28.50  ? 1379 LEU A CG  1 
ATOM   1096 C CD1 . LEU A 1 186 ? 13.179 22.171 21.080  1.00 28.11  ? 1379 LEU A CD1 1 
ATOM   1097 C CD2 . LEU A 1 186 ? 13.970 21.479 23.350  1.00 25.33  ? 1379 LEU A CD2 1 
ATOM   1098 N N   . ASN A 1 187 ? 9.799  18.208 23.055  1.00 25.22  ? 1380 ASN A N   1 
ATOM   1099 C CA  . ASN A 1 187 ? 8.431  17.847 23.362  1.00 25.12  ? 1380 ASN A CA  1 
ATOM   1100 C C   . ASN A 1 187 ? 8.358  17.288 24.773  1.00 31.93  ? 1380 ASN A C   1 
ATOM   1101 O O   . ASN A 1 187 ? 7.419  17.563 25.510  1.00 29.96  ? 1380 ASN A O   1 
ATOM   1102 C CB  . ASN A 1 187 ? 7.921  16.812 22.384  1.00 19.56  ? 1380 ASN A CB  1 
ATOM   1103 C CG  . ASN A 1 187 ? 6.551  16.341 22.733  1.00 26.90  ? 1380 ASN A CG  1 
ATOM   1104 O OD1 . ASN A 1 187 ? 6.381  15.242 23.271  1.00 33.26  ? 1380 ASN A OD1 1 
ATOM   1105 N ND2 . ASN A 1 187 ? 5.552  17.178 22.464  1.00 19.62  ? 1380 ASN A ND2 1 
ATOM   1106 N N   . LYS A 1 188 ? 9.366  16.506 25.143  1.00 25.83  ? 1381 LYS A N   1 
ATOM   1107 C CA  . LYS A 1 188 ? 9.418  15.916 26.465  1.00 24.76  ? 1381 LYS A CA  1 
ATOM   1108 C C   . LYS A 1 188 ? 9.646  16.979 27.545  1.00 30.50  ? 1381 LYS A C   1 
ATOM   1109 O O   . LYS A 1 188 ? 8.921  17.035 28.544  1.00 25.70  ? 1381 LYS A O   1 
ATOM   1110 C CB  . LYS A 1 188 ? 10.485 14.821 26.533  1.00 25.15  ? 1381 LYS A CB  1 
ATOM   1111 C CG  . LYS A 1 188 ? 10.438 14.024 27.820  1.00 31.89  ? 1381 LYS A CG  1 
ATOM   1112 C CD  . LYS A 1 188 ? 11.592 13.060 27.925  1.00 34.58  ? 1381 LYS A CD  1 
ATOM   1113 C CE  . LYS A 1 188 ? 11.400 11.851 27.031  1.00 44.30  ? 1381 LYS A CE  1 
ATOM   1114 N NZ  . LYS A 1 188 ? 12.267 10.726 27.491  1.00 61.71  ? 1381 LYS A NZ  1 
ATOM   1115 N N   . VAL A 1 189 ? 10.647 17.830 27.352  1.00 30.66  ? 1382 VAL A N   1 
ATOM   1116 C CA  . VAL A 1 189 ? 10.889 18.895 28.316  1.00 26.70  ? 1382 VAL A CA  1 
ATOM   1117 C C   . VAL A 1 189 ? 9.575  19.629 28.562  1.00 26.07  ? 1382 VAL A C   1 
ATOM   1118 O O   . VAL A 1 189 ? 9.249  19.981 29.695  1.00 26.72  ? 1382 VAL A O   1 
ATOM   1119 C CB  . VAL A 1 189 ? 11.953 19.886 27.821  1.00 24.86  ? 1382 VAL A CB  1 
ATOM   1120 C CG1 . VAL A 1 189 ? 12.065 21.050 28.776  1.00 19.89  ? 1382 VAL A CG1 1 
ATOM   1121 C CG2 . VAL A 1 189 ? 13.302 19.188 27.651  1.00 21.47  ? 1382 VAL A CG2 1 
ATOM   1122 N N   . SER A 1 190 ? 8.801  19.819 27.500  1.00 19.17  ? 1383 SER A N   1 
ATOM   1123 C CA  . SER A 1 190 ? 7.574  20.587 27.601  1.00 22.95  ? 1383 SER A CA  1 
ATOM   1124 C C   . SER A 1 190 ? 6.506  19.891 28.441  1.00 26.49  ? 1383 SER A C   1 
ATOM   1125 O O   . SER A 1 190 ? 5.607  20.543 28.965  1.00 23.17  ? 1383 SER A O   1 
ATOM   1126 C CB  . SER A 1 190 ? 7.029  20.900 26.209  1.00 25.15  ? 1383 SER A CB  1 
ATOM   1127 O OG  . SER A 1 190 ? 6.148  19.890 25.760  1.00 26.98  ? 1383 SER A OG  1 
ATOM   1128 N N   . HIS A 1 191 ? 6.601  18.571 28.576  1.00 26.64  ? 1384 HIS A N   1 
ATOM   1129 C CA  . HIS A 1 191 ? 5.612  17.840 29.363  1.00 24.77  ? 1384 HIS A CA  1 
ATOM   1130 C C   . HIS A 1 191 ? 5.735  18.120 30.858  1.00 33.00  ? 1384 HIS A C   1 
ATOM   1131 O O   . HIS A 1 191 ? 4.852  17.755 31.638  1.00 28.63  ? 1384 HIS A O   1 
ATOM   1132 C CB  . HIS A 1 191 ? 5.687  16.337 29.118  1.00 29.63  ? 1384 HIS A CB  1 
ATOM   1133 C CG  . HIS A 1 191 ? 5.250  15.920 27.748  1.00 46.13  ? 1384 HIS A CG  1 
ATOM   1134 N ND1 . HIS A 1 191 ? 4.414  16.689 26.966  1.00 37.39  ? 1384 HIS A ND1 1 
ATOM   1135 C CD2 . HIS A 1 191 ? 5.517  14.804 27.028  1.00 45.72  ? 1384 HIS A CD2 1 
ATOM   1136 C CE1 . HIS A 1 191 ? 4.199  16.073 25.817  1.00 44.55  ? 1384 HIS A CE1 1 
ATOM   1137 N NE2 . HIS A 1 191 ? 4.855  14.926 25.830  1.00 54.34  ? 1384 HIS A NE2 1 
ATOM   1138 N N   . ASN A 1 192 ? 6.828  18.762 31.256  1.00 26.05  ? 1385 ASN A N   1 
ATOM   1139 C CA  . ASN A 1 192 ? 7.018  19.110 32.649  1.00 28.76  ? 1385 ASN A CA  1 
ATOM   1140 C C   . ASN A 1 192 ? 6.952  20.629 32.865  1.00 39.94  ? 1385 ASN A C   1 
ATOM   1141 O O   . ASN A 1 192 ? 7.565  21.172 33.793  1.00 35.95  ? 1385 ASN A O   1 
ATOM   1142 C CB  . ASN A 1 192 ? 8.341  18.532 33.163  1.00 27.69  ? 1385 ASN A CB  1 
ATOM   1143 C CG  . ASN A 1 192 ? 8.361  18.377 34.676  1.00 36.71  ? 1385 ASN A CG  1 
ATOM   1144 O OD1 . ASN A 1 192 ? 7.363  17.975 35.286  1.00 29.68  ? 1385 ASN A OD1 1 
ATOM   1145 N ND2 . ASN A 1 192 ? 9.495  18.707 35.291  1.00 27.20  ? 1385 ASN A ND2 1 
ATOM   1146 N N   . ASN A 1 193 ? 6.193  21.317 32.016  1.00 38.47  ? 1386 ASN A N   1 
ATOM   1147 C CA  . ASN A 1 193 ? 6.187  22.781 32.037  1.00 34.59  ? 1386 ASN A CA  1 
ATOM   1148 C C   . ASN A 1 193 ? 5.648  23.407 33.330  1.00 35.13  ? 1386 ASN A C   1 
ATOM   1149 O O   . ASN A 1 193 ? 6.075  24.495 33.715  1.00 33.99  ? 1386 ASN A O   1 
ATOM   1150 C CB  . ASN A 1 193 ? 5.480  23.354 30.799  1.00 29.96  ? 1386 ASN A CB  1 
ATOM   1151 C CG  . ASN A 1 193 ? 3.993  23.091 30.806  1.00 31.30  ? 1386 ASN A CG  1 
ATOM   1152 O OD1 . ASN A 1 193 ? 3.231  23.754 31.514  1.00 26.59  ? 1386 ASN A OD1 1 
ATOM   1153 N ND2 . ASN A 1 193 ? 3.567  22.123 30.010  1.00 34.50  ? 1386 ASN A ND2 1 
ATOM   1154 N N   . LYS A 1 194 ? 4.724  22.722 34.002  1.00 33.10  ? 1387 LYS A N   1 
ATOM   1155 C CA  . LYS A 1 194 ? 4.207  23.210 35.279  1.00 25.97  ? 1387 LYS A CA  1 
ATOM   1156 C C   . LYS A 1 194 ? 5.372  23.444 36.221  1.00 34.23  ? 1387 LYS A C   1 
ATOM   1157 O O   . LYS A 1 194 ? 5.359  24.377 37.010  1.00 34.19  ? 1387 LYS A O   1 
ATOM   1158 C CB  . LYS A 1 194 ? 3.281  22.188 35.920  1.00 37.07  ? 1387 LYS A CB  1 
ATOM   1159 C CG  . LYS A 1 194 ? 2.125  21.735 35.067  1.00 52.62  ? 1387 LYS A CG  1 
ATOM   1160 C CD  . LYS A 1 194 ? 0.875  22.529 35.357  1.00 32.71  ? 1387 LYS A CD  1 
ATOM   1161 C CE  . LYS A 1 194 ? -0.353 21.665 35.144  1.00 49.43  ? 1387 LYS A CE  1 
ATOM   1162 N NZ  . LYS A 1 194 ? -1.592 22.476 35.067  1.00 63.60  ? 1387 LYS A NZ  1 
ATOM   1163 N N   . VAL A 1 195 ? 6.377  22.579 36.134  1.00 34.10  ? 1388 VAL A N   1 
ATOM   1164 C CA  . VAL A 1 195 ? 7.554  22.681 36.982  1.00 33.99  ? 1388 VAL A CA  1 
ATOM   1165 C C   . VAL A 1 195 ? 8.660  23.518 36.346  1.00 36.10  ? 1388 VAL A C   1 
ATOM   1166 O O   . VAL A 1 195 ? 9.100  24.511 36.926  1.00 45.84  ? 1388 VAL A O   1 
ATOM   1167 C CB  . VAL A 1 195 ? 8.105  21.290 37.350  1.00 33.70  ? 1388 VAL A CB  1 
ATOM   1168 C CG1 . VAL A 1 195 ? 9.472  21.404 38.014  1.00 21.41  ? 1388 VAL A CG1 1 
ATOM   1169 C CG2 . VAL A 1 195 ? 7.135  20.574 38.255  1.00 36.91  ? 1388 VAL A CG2 1 
ATOM   1170 N N   . ASN A 1 196 ? 9.111  23.125 35.159  1.00 28.87  ? 1389 ASN A N   1 
ATOM   1171 C CA  . ASN A 1 196 ? 10.267 23.782 34.557  1.00 31.61  ? 1389 ASN A CA  1 
ATOM   1172 C C   . ASN A 1 196 ? 9.905  25.059 33.815  1.00 32.12  ? 1389 ASN A C   1 
ATOM   1173 O O   . ASN A 1 196 ? 10.787 25.803 33.383  1.00 27.25  ? 1389 ASN A O   1 
ATOM   1174 C CB  . ASN A 1 196 ? 11.058 22.821 33.663  1.00 27.88  ? 1389 ASN A CB  1 
ATOM   1175 C CG  . ASN A 1 196 ? 10.259 22.321 32.484  1.00 30.17  ? 1389 ASN A CG  1 
ATOM   1176 O OD1 . ASN A 1 196 ? 9.407  23.027 31.941  1.00 27.78  ? 1389 ASN A OD1 1 
ATOM   1177 N ND2 . ASN A 1 196 ? 10.542 21.097 32.069  1.00 26.54  ? 1389 ASN A ND2 1 
ATOM   1178 N N   . LEU A 1 197 ? 8.602  25.302 33.675  1.00 31.07  ? 1390 LEU A N   1 
ATOM   1179 C CA  . LEU A 1 197 ? 8.089  26.558 33.119  1.00 35.41  ? 1390 LEU A CA  1 
ATOM   1180 C C   . LEU A 1 197 ? 8.272  26.681 31.609  1.00 36.13  ? 1390 LEU A C   1 
ATOM   1181 O O   . LEU A 1 197 ? 7.948  27.711 31.019  1.00 39.49  ? 1390 LEU A O   1 
ATOM   1182 C CB  . LEU A 1 197 ? 8.744  27.762 33.800  1.00 43.93  ? 1390 LEU A CB  1 
ATOM   1183 C CG  . LEU A 1 197 ? 8.663  27.864 35.317  1.00 41.39  ? 1390 LEU A CG  1 
ATOM   1184 C CD1 . LEU A 1 197 ? 9.287  29.188 35.743  1.00 39.18  ? 1390 LEU A CD1 1 
ATOM   1185 C CD2 . LEU A 1 197 ? 7.226  27.731 35.793  1.00 20.45  ? 1390 LEU A CD2 1 
ATOM   1186 N N   . MET A 1 198 ? 8.789  25.637 30.984  1.00 30.01  ? 1391 MET A N   1 
ATOM   1187 C CA  . MET A 1 198 ? 9.063  25.702 29.566  1.00 31.91  ? 1391 MET A CA  1 
ATOM   1188 C C   . MET A 1 198 ? 7.987  25.001 28.741  1.00 35.74  ? 1391 MET A C   1 
ATOM   1189 O O   . MET A 1 198 ? 8.119  23.823 28.390  1.00 34.96  ? 1391 MET A O   1 
ATOM   1190 C CB  . MET A 1 198 ? 10.453 25.141 29.270  1.00 28.81  ? 1391 MET A CB  1 
ATOM   1191 C CG  . MET A 1 198 ? 11.583 25.932 29.932  1.00 32.67  ? 1391 MET A CG  1 
ATOM   1192 S SD  . MET A 1 198 ? 11.489 27.722 29.615  1.00 34.19  ? 1391 MET A SD  1 
ATOM   1193 C CE  . MET A 1 198 ? 12.249 27.827 27.998  1.00 21.11  ? 1391 MET A CE  1 
ATOM   1194 N N   . THR A 1 199 ? 6.914  25.732 28.452  1.00 31.09  ? 1392 THR A N   1 
ATOM   1195 C CA  . THR A 1 199 ? 5.911  25.290 27.490  1.00 34.24  ? 1392 THR A CA  1 
ATOM   1196 C C   . THR A 1 199 ? 6.533  25.160 26.087  1.00 38.18  ? 1392 THR A C   1 
ATOM   1197 O O   . THR A 1 199 ? 7.643  25.639 25.839  1.00 35.10  ? 1392 THR A O   1 
ATOM   1198 C CB  . THR A 1 199 ? 4.708  26.267 27.444  1.00 36.01  ? 1392 THR A CB  1 
ATOM   1199 O OG1 . THR A 1 199 ? 5.171  27.607 27.225  1.00 34.28  ? 1392 THR A OG1 1 
ATOM   1200 C CG2 . THR A 1 199 ? 3.914  26.212 28.743  1.00 11.21  ? 1392 THR A CG2 1 
ATOM   1201 N N   . SER A 1 200 ? 5.832  24.505 25.169  1.00 39.08  ? 1393 SER A N   1 
ATOM   1202 C CA  . SER A 1 200 ? 6.340  24.387 23.810  1.00 34.93  ? 1393 SER A CA  1 
ATOM   1203 C C   . SER A 1 200 ? 6.541  25.766 23.159  1.00 40.02  ? 1393 SER A C   1 
ATOM   1204 O O   . SER A 1 200 ? 7.498  25.977 22.389  1.00 29.36  ? 1393 SER A O   1 
ATOM   1205 C CB  . SER A 1 200 ? 5.443  23.486 22.964  1.00 29.15  ? 1393 SER A CB  1 
ATOM   1206 O OG  . SER A 1 200 ? 4.189  23.298 23.587  1.00 62.68  ? 1393 SER A OG  1 
ATOM   1207 N N   . GLU A 1 201 ? 5.659  26.713 23.480  1.00 38.01  ? 1394 GLU A N   1 
ATOM   1208 C CA  . GLU A 1 201 ? 5.856  28.082 23.012  1.00 30.40  ? 1394 GLU A CA  1 
ATOM   1209 C C   . GLU A 1 201 ? 7.209  28.610 23.476  1.00 35.51  ? 1394 GLU A C   1 
ATOM   1210 O O   . GLU A 1 201 ? 8.019  29.083 22.673  1.00 28.57  ? 1394 GLU A O   1 
ATOM   1211 C CB  . GLU A 1 201 ? 4.753  28.998 23.509  1.00 34.86  ? 1394 GLU A CB  1 
ATOM   1212 C CG  . GLU A 1 201 ? 4.998  30.466 23.196  1.00 41.49  ? 1394 GLU A CG  1 
ATOM   1213 C CD  . GLU A 1 201 ? 3.849  31.361 23.652  1.00 61.91  ? 1394 GLU A CD  1 
ATOM   1214 O OE1 . GLU A 1 201 ? 3.236  31.051 24.701  1.00 65.84  ? 1394 GLU A OE1 1 
ATOM   1215 O OE2 . GLU A 1 201 ? 3.562  32.372 22.966  1.00 53.52  ? 1394 GLU A OE2 1 
ATOM   1216 N N   . ASN A 1 202 ? 7.457  28.521 24.779  1.00 30.45  ? 1395 ASN A N   1 
ATOM   1217 C CA  . ASN A 1 202 ? 8.737  28.965 25.320  1.00 33.25  ? 1395 ASN A CA  1 
ATOM   1218 C C   . ASN A 1 202 ? 9.926  28.270 24.668  1.00 32.85  ? 1395 ASN A C   1 
ATOM   1219 O O   . ASN A 1 202 ? 10.900 28.917 24.286  1.00 34.58  ? 1395 ASN A O   1 
ATOM   1220 C CB  . ASN A 1 202 ? 8.778  28.792 26.835  1.00 32.00  ? 1395 ASN A CB  1 
ATOM   1221 C CG  . ASN A 1 202 ? 7.857  29.751 27.542  1.00 38.96  ? 1395 ASN A CG  1 
ATOM   1222 O OD1 . ASN A 1 202 ? 7.300  30.665 26.922  1.00 35.45  ? 1395 ASN A OD1 1 
ATOM   1223 N ND2 . ASN A 1 202 ? 7.683  29.553 28.848  1.00 41.39  ? 1395 ASN A ND2 1 
ATOM   1224 N N   . LEU A 1 203 ? 9.837  26.955 24.532  1.00 31.27  ? 1396 LEU A N   1 
ATOM   1225 C CA  . LEU A 1 203 ? 10.938 26.192 23.975  1.00 28.16  ? 1396 LEU A CA  1 
ATOM   1226 C C   . LEU A 1 203 ? 11.299 26.605 22.549  1.00 31.85  ? 1396 LEU A C   1 
ATOM   1227 O O   . LEU A 1 203 ? 12.483 26.664 22.217  1.00 30.13  ? 1396 LEU A O   1 
ATOM   1228 C CB  . LEU A 1 203 ? 10.646 24.701 24.064  1.00 27.35  ? 1396 LEU A CB  1 
ATOM   1229 C CG  . LEU A 1 203 ? 10.805 24.196 25.489  1.00 24.44  ? 1396 LEU A CG  1 
ATOM   1230 C CD1 . LEU A 1 203 ? 10.237 22.812 25.603  1.00 31.23  ? 1396 LEU A CD1 1 
ATOM   1231 C CD2 . LEU A 1 203 ? 12.263 24.207 25.889  1.00 24.05  ? 1396 LEU A CD2 1 
ATOM   1232 N N   . SER A 1 204 ? 10.298 26.897 21.712  1.00 28.20  ? 1397 SER A N   1 
ATOM   1233 C CA  . SER A 1 204 ? 10.592 27.395 20.357  1.00 39.20  ? 1397 SER A CA  1 
ATOM   1234 C C   . SER A 1 204 ? 11.253 28.759 20.403  1.00 41.57  ? 1397 SER A C   1 
ATOM   1235 O O   . SER A 1 204 ? 12.101 29.066 19.567  1.00 43.34  ? 1397 SER A O   1 
ATOM   1236 C CB  . SER A 1 204 ? 9.353  27.458 19.462  1.00 29.60  ? 1397 SER A CB  1 
ATOM   1237 O OG  . SER A 1 204 ? 8.276  28.076 20.128  1.00 49.75  ? 1397 SER A OG  1 
ATOM   1238 N N   . ILE A 1 205 ? 10.862 29.573 21.382  1.00 31.07  ? 1398 ILE A N   1 
ATOM   1239 C CA  . ILE A 1 205 ? 11.473 30.878 21.564  1.00 26.99  ? 1398 ILE A CA  1 
ATOM   1240 C C   . ILE A 1 205 ? 12.980 30.739 21.793  1.00 29.42  ? 1398 ILE A C   1 
ATOM   1241 O O   . ILE A 1 205 ? 13.763 31.541 21.297  1.00 36.03  ? 1398 ILE A O   1 
ATOM   1242 C CB  . ILE A 1 205 ? 10.802 31.662 22.704  1.00 30.42  ? 1398 ILE A CB  1 
ATOM   1243 C CG1 . ILE A 1 205 ? 9.370  32.029 22.313  1.00 25.30  ? 1398 ILE A CG1 1 
ATOM   1244 C CG2 . ILE A 1 205 ? 11.598 32.926 23.047  1.00 20.83  ? 1398 ILE A CG2 1 
ATOM   1245 C CD1 . ILE A 1 205 ? 8.586  32.672 23.432  1.00 20.66  ? 1398 ILE A CD1 1 
ATOM   1246 N N   . CYS A 1 206 ? 13.391 29.716 22.529  1.00 26.15  ? 1399 CYS A N   1 
ATOM   1247 C CA  . CYS A 1 206 ? 14.816 29.476 22.732  1.00 36.82  ? 1399 CYS A CA  1 
ATOM   1248 C C   . CYS A 1 206 ? 15.460 28.820 21.527  1.00 39.41  ? 1399 CYS A C   1 
ATOM   1249 O O   . CYS A 1 206 ? 16.673 28.909 21.346  1.00 41.10  ? 1399 CYS A O   1 
ATOM   1250 C CB  . CYS A 1 206 ? 15.052 28.562 23.927  1.00 37.27  ? 1399 CYS A CB  1 
ATOM   1251 S SG  . CYS A 1 206 ? 14.107 28.992 25.369  1.00 56.86  ? 1399 CYS A SG  1 
ATOM   1252 N N   . PHE A 1 207 ? 14.662 28.146 20.707  1.00 29.86  ? 1400 PHE A N   1 
ATOM   1253 C CA  . PHE A 1 207 ? 15.256 27.280 19.695  1.00 33.82  ? 1400 PHE A CA  1 
ATOM   1254 C C   . PHE A 1 207 ? 15.204 27.721 18.225  1.00 36.19  ? 1400 PHE A C   1 
ATOM   1255 O O   . PHE A 1 207 ? 16.114 27.380 17.454  1.00 33.19  ? 1400 PHE A O   1 
ATOM   1256 C CB  . PHE A 1 207 ? 14.773 25.836 19.862  1.00 31.53  ? 1400 PHE A CB  1 
ATOM   1257 C CG  . PHE A 1 207 ? 15.651 25.019 20.765  1.00 27.73  ? 1400 PHE A CG  1 
ATOM   1258 C CD1 . PHE A 1 207 ? 16.800 24.430 20.281  1.00 29.00  ? 1400 PHE A CD1 1 
ATOM   1259 C CD2 . PHE A 1 207 ? 15.339 24.858 22.097  1.00 27.33  ? 1400 PHE A CD2 1 
ATOM   1260 C CE1 . PHE A 1 207 ? 17.616 23.692 21.106  1.00 25.22  ? 1400 PHE A CE1 1 
ATOM   1261 C CE2 . PHE A 1 207 ? 16.156 24.120 22.922  1.00 28.98  ? 1400 PHE A CE2 1 
ATOM   1262 C CZ  . PHE A 1 207 ? 17.292 23.538 22.423  1.00 28.18  ? 1400 PHE A CZ  1 
ATOM   1263 N N   . TRP A 1 208 ? 14.176 28.471 17.831  1.00 28.63  ? 1401 TRP A N   1 
ATOM   1264 C CA  . TRP A 1 208 ? 14.013 28.756 16.408  1.00 30.90  ? 1401 TRP A CA  1 
ATOM   1265 C C   . TRP A 1 208 ? 15.179 29.541 15.795  1.00 32.73  ? 1401 TRP A C   1 
ATOM   1266 O O   . TRP A 1 208 ? 15.576 29.271 14.661  1.00 30.69  ? 1401 TRP A O   1 
ATOM   1267 C CB  . TRP A 1 208 ? 12.648 29.370 16.076  1.00 29.07  ? 1401 TRP A CB  1 
ATOM   1268 C CG  . TRP A 1 208 ? 12.472 30.773 16.510  1.00 31.23  ? 1401 TRP A CG  1 
ATOM   1269 C CD1 . TRP A 1 208 ? 11.705 31.219 17.542  1.00 35.02  ? 1401 TRP A CD1 1 
ATOM   1270 C CD2 . TRP A 1 208 ? 13.053 31.931 15.912  1.00 34.15  ? 1401 TRP A CD2 1 
ATOM   1271 N NE1 . TRP A 1 208 ? 11.782 32.588 17.638  1.00 37.50  ? 1401 TRP A NE1 1 
ATOM   1272 C CE2 . TRP A 1 208 ? 12.609 33.049 16.650  1.00 37.92  ? 1401 TRP A CE2 1 
ATOM   1273 C CE3 . TRP A 1 208 ? 13.914 32.133 14.832  1.00 30.93  ? 1401 TRP A CE3 1 
ATOM   1274 C CZ2 . TRP A 1 208 ? 12.997 34.348 16.340  1.00 36.68  ? 1401 TRP A CZ2 1 
ATOM   1275 C CZ3 . TRP A 1 208 ? 14.304 33.423 14.530  1.00 39.83  ? 1401 TRP A CZ3 1 
ATOM   1276 C CH2 . TRP A 1 208 ? 13.843 34.515 15.280  1.00 42.37  ? 1401 TRP A CH2 1 
ATOM   1277 N N   . PRO A 1 209 ? 15.749 30.498 16.543  1.00 33.14  ? 1402 PRO A N   1 
ATOM   1278 C CA  . PRO A 1 209 ? 16.931 31.163 15.981  1.00 30.89  ? 1402 PRO A CA  1 
ATOM   1279 C C   . PRO A 1 209 ? 18.079 30.180 15.792  1.00 29.38  ? 1402 PRO A C   1 
ATOM   1280 O O   . PRO A 1 209 ? 18.750 30.186 14.762  1.00 38.29  ? 1402 PRO A O   1 
ATOM   1281 C CB  . PRO A 1 209 ? 17.290 32.195 17.047  1.00 21.41  ? 1402 PRO A CB  1 
ATOM   1282 C CG  . PRO A 1 209 ? 15.993 32.447 17.761  1.00 30.89  ? 1402 PRO A CG  1 
ATOM   1283 C CD  . PRO A 1 209 ? 15.323 31.111 17.810  1.00 28.53  ? 1402 PRO A CD  1 
ATOM   1284 N N   . THR A 1 210 ? 18.290 29.324 16.780  1.00 32.20  ? 1403 THR A N   1 
ATOM   1285 C CA  . THR A 1 210 ? 19.394 28.380 16.733  1.00 35.68  ? 1403 THR A CA  1 
ATOM   1286 C C   . THR A 1 210 ? 19.234 27.380 15.593  1.00 43.80  ? 1403 THR A C   1 
ATOM   1287 O O   . THR A 1 210 ? 20.187 27.097 14.862  1.00 47.56  ? 1403 THR A O   1 
ATOM   1288 C CB  . THR A 1 210 ? 19.530 27.622 18.064  1.00 43.64  ? 1403 THR A CB  1 
ATOM   1289 O OG1 . THR A 1 210 ? 19.666 28.561 19.141  1.00 37.68  ? 1403 THR A OG1 1 
ATOM   1290 C CG2 . THR A 1 210 ? 20.740 26.707 18.031  1.00 39.77  ? 1403 THR A CG2 1 
ATOM   1291 N N   . LEU A 1 211 ? 18.023 26.856 15.437  1.00 35.35  ? 1404 LEU A N   1 
ATOM   1292 C CA  . LEU A 1 211 ? 17.766 25.812 14.448  1.00 33.32  ? 1404 LEU A CA  1 
ATOM   1293 C C   . LEU A 1 211 ? 17.590 26.337 13.026  1.00 37.37  ? 1404 LEU A C   1 
ATOM   1294 O O   . LEU A 1 211 ? 17.744 25.588 12.063  1.00 43.21  ? 1404 LEU A O   1 
ATOM   1295 C CB  . LEU A 1 211 ? 16.550 24.978 14.851  1.00 33.08  ? 1404 LEU A CB  1 
ATOM   1296 C CG  . LEU A 1 211 ? 16.688 24.252 16.191  1.00 41.59  ? 1404 LEU A CG  1 
ATOM   1297 C CD1 . LEU A 1 211 ? 15.414 23.524 16.544  1.00 25.65  ? 1404 LEU A CD1 1 
ATOM   1298 C CD2 . LEU A 1 211 ? 17.870 23.287 16.157  1.00 38.06  ? 1404 LEU A CD2 1 
ATOM   1299 N N   . MET A 1 212 ? 17.287 27.623 12.883  1.00 38.71  ? 1405 MET A N   1 
ATOM   1300 C CA  . MET A 1 212 ? 16.993 28.159 11.558  1.00 33.97  ? 1405 MET A CA  1 
ATOM   1301 C C   . MET A 1 212 ? 17.896 29.291 11.076  1.00 35.20  ? 1405 MET A C   1 
ATOM   1302 O O   . MET A 1 212 ? 18.075 29.450 9.872   1.00 47.55  ? 1405 MET A O   1 
ATOM   1303 C CB  . MET A 1 212 ? 15.521 28.532 11.456  1.00 27.90  ? 1405 MET A CB  1 
ATOM   1304 C CG  . MET A 1 212 ? 14.623 27.319 11.562  1.00 25.32  ? 1405 MET A CG  1 
ATOM   1305 S SD  . MET A 1 212 ? 12.889 27.756 11.540  1.00 39.15  ? 1405 MET A SD  1 
ATOM   1306 C CE  . MET A 1 212 ? 12.144 26.212 11.061  1.00 54.87  ? 1405 MET A CE  1 
ATOM   1307 N N   . ARG A 1 213 ? 18.475 30.060 11.991  1.00 28.68  ? 1406 ARG A N   1 
ATOM   1308 C CA  . ARG A 1 213 ? 19.406 31.126 11.601  1.00 37.15  ? 1406 ARG A CA  1 
ATOM   1309 C C   . ARG A 1 213 ? 18.856 32.060 10.536  1.00 47.37  ? 1406 ARG A C   1 
ATOM   1310 O O   . ARG A 1 213 ? 19.482 32.227 9.494   1.00 43.91  ? 1406 ARG A O   1 
ATOM   1311 C CB  . ARG A 1 213 ? 20.697 30.532 11.038  1.00 26.57  ? 1406 ARG A CB  1 
ATOM   1312 C CG  . ARG A 1 213 ? 21.784 30.390 12.035  1.00 50.19  ? 1406 ARG A CG  1 
ATOM   1313 C CD  . ARG A 1 213 ? 23.126 30.661 11.405  1.00 29.81  ? 1406 ARG A CD  1 
ATOM   1314 N NE  . ARG A 1 213 ? 23.647 29.498 10.700  1.00 45.14  ? 1406 ARG A NE  1 
ATOM   1315 C CZ  . ARG A 1 213 ? 24.051 28.385 11.302  1.00 44.59  ? 1406 ARG A CZ  1 
ATOM   1316 N NH1 . ARG A 1 213 ? 23.964 28.277 12.623  1.00 46.07  ? 1406 ARG A NH1 1 
ATOM   1317 N NH2 . ARG A 1 213 ? 24.525 27.381 10.585  1.00 38.70  ? 1406 ARG A NH2 1 
ATOM   1318 N N   . PRO A 1 214 ? 17.694 32.672 10.782  1.00 42.41  ? 1407 PRO A N   1 
ATOM   1319 C CA  . PRO A 1 214 ? 17.107 33.512 9.737   1.00 48.38  ? 1407 PRO A CA  1 
ATOM   1320 C C   . PRO A 1 214 ? 18.030 34.686 9.442   1.00 52.41  ? 1407 PRO A C   1 
ATOM   1321 O O   . PRO A 1 214 ? 18.706 35.148 10.349  1.00 59.00  ? 1407 PRO A O   1 
ATOM   1322 C CB  . PRO A 1 214 ? 15.800 33.997 10.371  1.00 60.84  ? 1407 PRO A CB  1 
ATOM   1323 C CG  . PRO A 1 214 ? 15.518 33.025 11.468  1.00 58.61  ? 1407 PRO A CG  1 
ATOM   1324 C CD  . PRO A 1 214 ? 16.866 32.644 11.994  1.00 50.50  ? 1407 PRO A CD  1 
ATOM   1325 N N   . ASP A 1 215 ? 18.110 35.124 8.190   1.00 56.54  ? 1408 ASP A N   1 
ATOM   1326 C CA  . ASP A 1 215 ? 18.890 36.311 7.872   1.00 54.39  ? 1408 ASP A CA  1 
ATOM   1327 C C   . ASP A 1 215 ? 17.953 37.516 7.859   1.00 69.78  ? 1408 ASP A C   1 
ATOM   1328 O O   . ASP A 1 215 ? 17.002 37.568 7.070   1.00 69.30  ? 1408 ASP A O   1 
ATOM   1329 C CB  . ASP A 1 215 ? 19.600 36.158 6.527   1.00 62.44  ? 1408 ASP A CB  1 
ATOM   1330 C CG  . ASP A 1 215 ? 20.600 37.274 6.270   1.00 83.42  ? 1408 ASP A CG  1 
ATOM   1331 O OD1 . ASP A 1 215 ? 20.636 38.243 7.062   1.00 72.07  ? 1408 ASP A OD1 1 
ATOM   1332 O OD2 . ASP A 1 215 ? 21.354 37.182 5.277   1.00 79.36  ? 1408 ASP A OD2 1 
ATOM   1333 N N   . PHE A 1 216 ? 18.217 38.481 8.738   1.00 71.19  ? 1409 PHE A N   1 
ATOM   1334 C CA  . PHE A 1 216 ? 17.278 39.581 8.954   1.00 73.34  ? 1409 PHE A CA  1 
ATOM   1335 C C   . PHE A 1 216 ? 17.525 40.841 8.127   1.00 82.24  ? 1409 PHE A C   1 
ATOM   1336 O O   . PHE A 1 216 ? 17.046 41.925 8.461   1.00 80.33  ? 1409 PHE A O   1 
ATOM   1337 C CB  . PHE A 1 216 ? 17.148 39.900 10.441  1.00 75.91  ? 1409 PHE A CB  1 
ATOM   1338 C CG  . PHE A 1 216 ? 16.239 38.959 11.166  1.00 64.39  ? 1409 PHE A CG  1 
ATOM   1339 C CD1 . PHE A 1 216 ? 15.052 38.556 10.585  1.00 57.72  ? 1409 PHE A CD1 1 
ATOM   1340 C CD2 . PHE A 1 216 ? 16.566 38.477 12.418  1.00 68.61  ? 1409 PHE A CD2 1 
ATOM   1341 C CE1 . PHE A 1 216 ? 14.208 37.689 11.233  1.00 57.93  ? 1409 PHE A CE1 1 
ATOM   1342 C CE2 . PHE A 1 216 ? 15.723 37.608 13.076  1.00 66.04  ? 1409 PHE A CE2 1 
ATOM   1343 C CZ  . PHE A 1 216 ? 14.537 37.214 12.477  1.00 63.60  ? 1409 PHE A CZ  1 
ATOM   1344 N N   . SER A 1 217 ? 18.275 40.683 7.047   1.00 87.74  ? 1410 SER A N   1 
ATOM   1345 C CA  . SER A 1 217 ? 18.258 41.644 5.963   1.00 75.48  ? 1410 SER A CA  1 
ATOM   1346 C C   . SER A 1 217 ? 17.539 40.958 4.803   1.00 93.29  ? 1410 SER A C   1 
ATOM   1347 O O   . SER A 1 217 ? 17.975 41.035 3.656   1.00 112.03 ? 1410 SER A O   1 
ATOM   1348 C CB  . SER A 1 217 ? 19.681 42.033 5.569   1.00 66.08  ? 1410 SER A CB  1 
ATOM   1349 N N   . THR A 1 218 ? 16.445 40.266 5.122   1.00 86.82  ? 1411 THR A N   1 
ATOM   1350 C CA  . THR A 1 218 ? 15.683 39.490 4.138   1.00 81.59  ? 1411 THR A CA  1 
ATOM   1351 C C   . THR A 1 218 ? 14.206 39.382 4.528   1.00 87.63  ? 1411 THR A C   1 
ATOM   1352 O O   . THR A 1 218 ? 13.404 38.786 3.802   1.00 79.84  ? 1411 THR A O   1 
ATOM   1353 C CB  . THR A 1 218 ? 16.265 38.071 3.963   1.00 59.71  ? 1411 THR A CB  1 
ATOM   1354 N N   . MET A 1 219 ? 13.869 39.963 5.680   1.00 82.79  ? 1412 MET A N   1 
ATOM   1355 C CA  . MET A 1 219 ? 12.517 39.948 6.239   1.00 73.29  ? 1412 MET A CA  1 
ATOM   1356 C C   . MET A 1 219 ? 12.482 40.869 7.453   1.00 73.67  ? 1412 MET A C   1 
ATOM   1357 O O   . MET A 1 219 ? 13.509 41.125 8.084   1.00 69.66  ? 1412 MET A O   1 
ATOM   1358 C CB  . MET A 1 219 ? 12.127 38.532 6.663   1.00 45.56  ? 1412 MET A CB  1 
ATOM   1359 C CG  . MET A 1 219 ? 13.217 37.840 7.471   1.00 65.72  ? 1412 MET A CG  1 
ATOM   1360 S SD  . MET A 1 219 ? 13.240 36.053 7.299   1.00 101.36 ? 1412 MET A SD  1 
ATOM   1361 C CE  . MET A 1 219 ? 13.238 35.870 5.513   1.00 64.16  ? 1412 MET A CE  1 
ATOM   1362 N N   . ASP A 1 220 ? 11.298 41.371 7.777   1.00 66.44  ? 1413 ASP A N   1 
ATOM   1363 C CA  . ASP A 1 220 ? 11.124 42.172 8.979   1.00 56.27  ? 1413 ASP A CA  1 
ATOM   1364 C C   . ASP A 1 220 ? 11.364 41.306 10.212  1.00 58.35  ? 1413 ASP A C   1 
ATOM   1365 O O   . ASP A 1 220 ? 10.747 40.248 10.360  1.00 53.98  ? 1413 ASP A O   1 
ATOM   1366 C CB  . ASP A 1 220 ? 9.710  42.752 9.022   1.00 55.48  ? 1413 ASP A CB  1 
ATOM   1367 C CG  . ASP A 1 220 ? 9.420  43.481 10.318  1.00 71.61  ? 1413 ASP A CG  1 
ATOM   1368 O OD1 . ASP A 1 220 ? 10.336 44.153 10.855  1.00 71.63  ? 1413 ASP A OD1 1 
ATOM   1369 O OD2 . ASP A 1 220 ? 8.269  43.382 10.793  1.00 75.44  ? 1413 ASP A OD2 1 
ATOM   1370 N N   . ALA A 1 221 ? 12.249 41.759 11.097  1.00 54.48  ? 1414 ALA A N   1 
ATOM   1371 C CA  . ALA A 1 221 ? 12.628 40.974 12.276  1.00 52.49  ? 1414 ALA A CA  1 
ATOM   1372 C C   . ALA A 1 221 ? 11.448 40.547 13.154  1.00 55.07  ? 1414 ALA A C   1 
ATOM   1373 O O   . ALA A 1 221 ? 11.384 39.387 13.577  1.00 52.11  ? 1414 ALA A O   1 
ATOM   1374 C CB  . ALA A 1 221 ? 13.678 41.698 13.106  1.00 41.95  ? 1414 ALA A CB  1 
ATOM   1375 N N   . LEU A 1 222 ? 10.517 41.462 13.426  1.00 49.50  ? 1415 LEU A N   1 
ATOM   1376 C CA  . LEU A 1 222 ? 9.353  41.114 14.260  1.00 63.95  ? 1415 LEU A CA  1 
ATOM   1377 C C   . LEU A 1 222 ? 8.374  40.110 13.599  1.00 54.79  ? 1415 LEU A C   1 
ATOM   1378 O O   . LEU A 1 222 ? 7.922  39.163 14.251  1.00 47.87  ? 1415 LEU A O   1 
ATOM   1379 C CB  . LEU A 1 222 ? 8.611  42.365 14.767  1.00 48.55  ? 1415 LEU A CB  1 
ATOM   1380 N N   . THR A 1 223 ? 8.050  40.302 12.321  1.00 44.07  ? 1416 THR A N   1 
ATOM   1381 C CA  . THR A 1 223 ? 7.138  39.379 11.658  1.00 57.44  ? 1416 THR A CA  1 
ATOM   1382 C C   . THR A 1 223 ? 7.794  38.001 11.451  1.00 60.37  ? 1416 THR A C   1 
ATOM   1383 O O   . THR A 1 223 ? 7.159  36.952 11.650  1.00 44.08  ? 1416 THR A O   1 
ATOM   1384 C CB  . THR A 1 223 ? 6.615  39.948 10.322  1.00 48.38  ? 1416 THR A CB  1 
ATOM   1385 N N   . ALA A 1 224 ? 9.067  38.004 11.060  1.00 58.25  ? 1417 ALA A N   1 
ATOM   1386 C CA  . ALA A 1 224 ? 9.786  36.748 10.891  1.00 52.82  ? 1417 ALA A CA  1 
ATOM   1387 C C   . ALA A 1 224 ? 9.857  36.050 12.236  1.00 53.53  ? 1417 ALA A C   1 
ATOM   1388 O O   . ALA A 1 224 ? 9.895  34.817 12.317  1.00 52.62  ? 1417 ALA A O   1 
ATOM   1389 C CB  . ALA A 1 224 ? 11.175 36.989 10.345  1.00 53.29  ? 1417 ALA A CB  1 
ATOM   1390 N N   . THR A 1 225 ? 9.864  36.843 13.299  1.00 46.60  ? 1418 THR A N   1 
ATOM   1391 C CA  . THR A 1 225 ? 9.928  36.260 14.626  1.00 42.76  ? 1418 THR A CA  1 
ATOM   1392 C C   . THR A 1 225 ? 8.675  35.435 14.908  1.00 38.96  ? 1418 THR A C   1 
ATOM   1393 O O   . THR A 1 225 ? 8.778  34.262 15.251  1.00 37.89  ? 1418 THR A O   1 
ATOM   1394 C CB  . THR A 1 225 ? 10.177 37.314 15.715  1.00 35.51  ? 1418 THR A CB  1 
ATOM   1395 O OG1 . THR A 1 225 ? 11.493 37.845 15.549  1.00 43.63  ? 1418 THR A OG1 1 
ATOM   1396 C CG2 . THR A 1 225 ? 10.073 36.692 17.101  1.00 39.85  ? 1418 THR A CG2 1 
ATOM   1397 N N   . ARG A 1 226 ? 7.498  36.033 14.734  1.00 33.29  ? 1419 ARG A N   1 
ATOM   1398 C CA  . ARG A 1 226 ? 6.253  35.333 15.058  1.00 31.22  ? 1419 ARG A CA  1 
ATOM   1399 C C   . ARG A 1 226 ? 6.116  34.089 14.200  1.00 36.71  ? 1419 ARG A C   1 
ATOM   1400 O O   . ARG A 1 226 ? 5.640  33.055 14.660  1.00 41.68  ? 1419 ARG A O   1 
ATOM   1401 C CB  . ARG A 1 226 ? 5.030  36.250 14.889  1.00 24.93  ? 1419 ARG A CB  1 
ATOM   1402 N N   . THR A 1 227 ? 6.568  34.190 12.954  1.00 43.36  ? 1420 THR A N   1 
ATOM   1403 C CA  . THR A 1 227 ? 6.421  33.104 11.991  1.00 39.52  ? 1420 THR A CA  1 
ATOM   1404 C C   . THR A 1 227 ? 7.279  31.889 12.334  1.00 38.27  ? 1420 THR A C   1 
ATOM   1405 O O   . THR A 1 227 ? 6.776  30.771 12.403  1.00 41.90  ? 1420 THR A O   1 
ATOM   1406 C CB  . THR A 1 227 ? 6.736  33.578 10.568  1.00 45.01  ? 1420 THR A CB  1 
ATOM   1407 O OG1 . THR A 1 227 ? 5.683  34.436 10.116  1.00 51.14  ? 1420 THR A OG1 1 
ATOM   1408 C CG2 . THR A 1 227 ? 6.860  32.392 9.613   1.00 36.94  ? 1420 THR A CG2 1 
ATOM   1409 N N   . TYR A 1 228 ? 8.572  32.101 12.541  1.00 36.04  ? 1421 TYR A N   1 
ATOM   1410 C CA  . TYR A 1 228 ? 9.452  30.997 12.899  1.00 36.99  ? 1421 TYR A CA  1 
ATOM   1411 C C   . TYR A 1 228 ? 9.088  30.423 14.263  1.00 34.10  ? 1421 TYR A C   1 
ATOM   1412 O O   . TYR A 1 228 ? 9.103  29.207 14.463  1.00 39.73  ? 1421 TYR A O   1 
ATOM   1413 C CB  . TYR A 1 228 ? 10.913 31.439 12.880  1.00 36.13  ? 1421 TYR A CB  1 
ATOM   1414 C CG  . TYR A 1 228 ? 11.398 31.744 11.495  1.00 39.87  ? 1421 TYR A CG  1 
ATOM   1415 C CD1 . TYR A 1 228 ? 11.922 32.990 11.178  1.00 60.43  ? 1421 TYR A CD1 1 
ATOM   1416 C CD2 . TYR A 1 228 ? 11.314 30.795 10.493  1.00 35.25  ? 1421 TYR A CD2 1 
ATOM   1417 C CE1 . TYR A 1 228 ? 12.363 33.273 9.900   1.00 56.15  ? 1421 TYR A CE1 1 
ATOM   1418 C CE2 . TYR A 1 228 ? 11.754 31.068 9.218   1.00 46.87  ? 1421 TYR A CE2 1 
ATOM   1419 C CZ  . TYR A 1 228 ? 12.273 32.307 8.929   1.00 45.07  ? 1421 TYR A CZ  1 
ATOM   1420 O OH  . TYR A 1 228 ? 12.698 32.572 7.660   1.00 51.28  ? 1421 TYR A OH  1 
ATOM   1421 N N   . GLN A 1 229 ? 8.754  31.299 15.199  1.00 27.15  ? 1422 GLN A N   1 
ATOM   1422 C CA  . GLN A 1 229 ? 8.439  30.859 16.550  1.00 36.70  ? 1422 GLN A CA  1 
ATOM   1423 C C   . GLN A 1 229 ? 7.292  29.862 16.503  1.00 33.76  ? 1422 GLN A C   1 
ATOM   1424 O O   . GLN A 1 229 ? 7.394  28.755 17.041  1.00 33.75  ? 1422 GLN A O   1 
ATOM   1425 C CB  . GLN A 1 229 ? 8.106  32.054 17.449  1.00 35.73  ? 1422 GLN A CB  1 
ATOM   1426 C CG  . GLN A 1 229 ? 7.344  31.722 18.719  1.00 31.51  ? 1422 GLN A CG  1 
ATOM   1427 C CD  . GLN A 1 229 ? 7.046  32.965 19.557  1.00 64.96  ? 1422 GLN A CD  1 
ATOM   1428 O OE1 . GLN A 1 229 ? 7.624  34.041 19.337  1.00 58.69  ? 1422 GLN A OE1 1 
ATOM   1429 N NE2 . GLN A 1 229 ? 6.141  32.821 20.522  1.00 61.31  ? 1422 GLN A NE2 1 
ATOM   1430 N N   . THR A 1 230 ? 6.210  30.249 15.838  1.00 23.89  ? 1423 THR A N   1 
ATOM   1431 C CA  . THR A 1 230 ? 5.044  29.379 15.730  1.00 30.93  ? 1423 THR A CA  1 
ATOM   1432 C C   . THR A 1 230 ? 5.347  28.071 14.994  1.00 33.50  ? 1423 THR A C   1 
ATOM   1433 O O   . THR A 1 230 ? 4.862  27.006 15.368  1.00 36.03  ? 1423 THR A O   1 
ATOM   1434 C CB  . THR A 1 230 ? 3.867  30.082 15.032  1.00 31.59  ? 1423 THR A CB  1 
ATOM   1435 O OG1 . THR A 1 230 ? 3.567  31.300 15.715  1.00 34.90  ? 1423 THR A OG1 1 
ATOM   1436 C CG2 . THR A 1 230 ? 2.637  29.198 15.056  1.00 34.16  ? 1423 THR A CG2 1 
ATOM   1437 N N   . ILE A 1 231 ? 6.138  28.144 13.937  1.00 28.56  ? 1424 ILE A N   1 
ATOM   1438 C CA  . ILE A 1 231 ? 6.425  26.943 13.178  1.00 33.23  ? 1424 ILE A CA  1 
ATOM   1439 C C   . ILE A 1 231 ? 7.069  25.919 14.111  1.00 29.96  ? 1424 ILE A C   1 
ATOM   1440 O O   . ILE A 1 231 ? 6.591  24.793 14.229  1.00 28.01  ? 1424 ILE A O   1 
ATOM   1441 C CB  . ILE A 1 231 ? 7.296  27.227 11.928  1.00 40.36  ? 1424 ILE A CB  1 
ATOM   1442 C CG1 . ILE A 1 231 ? 6.503  28.045 10.906  1.00 32.70  ? 1424 ILE A CG1 1 
ATOM   1443 C CG2 . ILE A 1 231 ? 7.765  25.926 11.295  1.00 28.98  ? 1424 ILE A CG2 1 
ATOM   1444 C CD1 . ILE A 1 231 ? 7.270  28.388 9.653   1.00 25.16  ? 1424 ILE A CD1 1 
ATOM   1445 N N   . ILE A 1 232 ? 8.128  26.326 14.804  1.00 26.16  ? 1425 ILE A N   1 
ATOM   1446 C CA  . ILE A 1 232 ? 8.830  25.414 15.695  1.00 26.81  ? 1425 ILE A CA  1 
ATOM   1447 C C   . ILE A 1 232 ? 7.936  24.970 16.858  1.00 27.46  ? 1425 ILE A C   1 
ATOM   1448 O O   . ILE A 1 232 ? 8.006  23.829 17.309  1.00 32.83  ? 1425 ILE A O   1 
ATOM   1449 C CB  . ILE A 1 232 ? 10.152 26.016 16.199  1.00 26.69  ? 1425 ILE A CB  1 
ATOM   1450 C CG1 . ILE A 1 232 ? 11.089 26.235 15.022  1.00 30.57  ? 1425 ILE A CG1 1 
ATOM   1451 C CG2 . ILE A 1 232 ? 10.832 25.086 17.194  1.00 17.85  ? 1425 ILE A CG2 1 
ATOM   1452 C CD1 . ILE A 1 232 ? 11.608 24.934 14.429  1.00 30.38  ? 1425 ILE A CD1 1 
ATOM   1453 N N   . GLU A 1 233 ? 7.076  25.861 17.326  1.00 24.26  ? 1426 GLU A N   1 
ATOM   1454 C CA  . GLU A 1 233 ? 6.168  25.513 18.411  1.00 26.82  ? 1426 GLU A CA  1 
ATOM   1455 C C   . GLU A 1 233 ? 5.257  24.382 17.964  1.00 29.96  ? 1426 GLU A C   1 
ATOM   1456 O O   . GLU A 1 233 ? 4.959  23.492 18.752  1.00 33.77  ? 1426 GLU A O   1 
ATOM   1457 C CB  . GLU A 1 233 ? 5.358  26.731 18.874  1.00 28.62  ? 1426 GLU A CB  1 
ATOM   1458 C CG  . GLU A 1 233 ? 4.219  26.438 19.848  1.00 32.40  ? 1426 GLU A CG  1 
ATOM   1459 C CD  . GLU A 1 233 ? 3.542  27.726 20.342  1.00 57.79  ? 1426 GLU A CD  1 
ATOM   1460 O OE1 . GLU A 1 233 ? 2.490  27.646 21.013  1.00 48.78  ? 1426 GLU A OE1 1 
ATOM   1461 O OE2 . GLU A 1 233 ? 4.066  28.829 20.059  1.00 58.33  ? 1426 GLU A OE2 1 
ATOM   1462 N N   . LEU A 1 234 ? 4.838  24.406 16.699  1.00 24.23  ? 1427 LEU A N   1 
ATOM   1463 C CA  . LEU A 1 234 ? 3.954  23.368 16.174  1.00 25.25  ? 1427 LEU A CA  1 
ATOM   1464 C C   . LEU A 1 234 ? 4.681  22.038 16.065  1.00 32.20  ? 1427 LEU A C   1 
ATOM   1465 O O   . LEU A 1 234 ? 4.123  20.982 16.382  1.00 30.00  ? 1427 LEU A O   1 
ATOM   1466 C CB  . LEU A 1 234 ? 3.386  23.760 14.809  1.00 20.81  ? 1427 LEU A CB  1 
ATOM   1467 C CG  . LEU A 1 234 ? 2.376  24.907 14.841  1.00 27.38  ? 1427 LEU A CG  1 
ATOM   1468 C CD1 . LEU A 1 234 ? 2.128  25.456 13.439  1.00 25.43  ? 1427 LEU A CD1 1 
ATOM   1469 C CD2 . LEU A 1 234 ? 1.075  24.479 15.497  1.00 18.43  ? 1427 LEU A CD2 1 
ATOM   1470 N N   . PHE A 1 235 ? 5.926  22.083 15.609  1.00 23.41  ? 1428 PHE A N   1 
ATOM   1471 C CA  . PHE A 1 235 ? 6.699  20.860 15.509  1.00 31.84  ? 1428 PHE A CA  1 
ATOM   1472 C C   . PHE A 1 235 ? 6.889  20.234 16.886  1.00 31.18  ? 1428 PHE A C   1 
ATOM   1473 O O   . PHE A 1 235 ? 6.909  19.007 17.030  1.00 29.07  ? 1428 PHE A O   1 
ATOM   1474 C CB  . PHE A 1 235 ? 8.049  21.125 14.855  1.00 31.39  ? 1428 PHE A CB  1 
ATOM   1475 C CG  . PHE A 1 235 ? 7.985  21.183 13.368  1.00 35.79  ? 1428 PHE A CG  1 
ATOM   1476 C CD1 . PHE A 1 235 ? 8.265  22.357 12.693  1.00 37.42  ? 1428 PHE A CD1 1 
ATOM   1477 C CD2 . PHE A 1 235 ? 7.620  20.068 12.641  1.00 30.28  ? 1428 PHE A CD2 1 
ATOM   1478 C CE1 . PHE A 1 235 ? 8.192  22.413 11.320  1.00 24.02  ? 1428 PHE A CE1 1 
ATOM   1479 C CE2 . PHE A 1 235 ? 7.551  20.124 11.270  1.00 35.10  ? 1428 PHE A CE2 1 
ATOM   1480 C CZ  . PHE A 1 235 ? 7.835  21.302 10.614  1.00 28.71  ? 1428 PHE A CZ  1 
ATOM   1481 N N   . ILE A 1 236 ? 7.033  21.087 17.894  1.00 26.60  ? 1429 ILE A N   1 
ATOM   1482 C CA  . ILE A 1 236 ? 7.246  20.620 19.255  1.00 25.17  ? 1429 ILE A CA  1 
ATOM   1483 C C   . ILE A 1 236 ? 5.948  20.072 19.845  1.00 25.28  ? 1429 ILE A C   1 
ATOM   1484 O O   . ILE A 1 236 ? 5.910  18.981 20.414  1.00 25.30  ? 1429 ILE A O   1 
ATOM   1485 C CB  . ILE A 1 236 ? 7.803  21.738 20.150  1.00 22.46  ? 1429 ILE A CB  1 
ATOM   1486 C CG1 . ILE A 1 236 ? 9.221  22.093 19.717  1.00 21.55  ? 1429 ILE A CG1 1 
ATOM   1487 C CG2 . ILE A 1 236 ? 7.792  21.308 21.602  1.00 21.11  ? 1429 ILE A CG2 1 
ATOM   1488 C CD1 . ILE A 1 236 ? 9.837  23.212 20.514  1.00 23.14  ? 1429 ILE A CD1 1 
ATOM   1489 N N   . GLN A 1 237 ? 4.871  20.826 19.694  1.00 29.16  ? 1430 GLN A N   1 
ATOM   1490 C CA  . GLN A 1 237 ? 3.610  20.439 20.297  1.00 22.40  ? 1430 GLN A CA  1 
ATOM   1491 C C   . GLN A 1 237 ? 2.953  19.305 19.544  1.00 25.32  ? 1430 GLN A C   1 
ATOM   1492 O O   . GLN A 1 237 ? 2.292  18.473 20.148  1.00 28.38  ? 1430 GLN A O   1 
ATOM   1493 C CB  . GLN A 1 237 ? 2.657  21.622 20.363  1.00 23.19  ? 1430 GLN A CB  1 
ATOM   1494 C CG  . GLN A 1 237 ? 1.404  21.333 21.144  1.00 45.52  ? 1430 GLN A CG  1 
ATOM   1495 C CD  . GLN A 1 237 ? 0.716  22.601 21.608  1.00 82.80  ? 1430 GLN A CD  1 
ATOM   1496 O OE1 . GLN A 1 237 ? 0.831  23.661 20.977  1.00 67.32  ? 1430 GLN A OE1 1 
ATOM   1497 N NE2 . GLN A 1 237 ? -0.005 22.501 22.723  1.00 84.39  ? 1430 GLN A NE2 1 
ATOM   1498 N N   . GLN A 1 238 ? 3.115  19.281 18.226  1.00 21.97  ? 1431 GLN A N   1 
ATOM   1499 C CA  . GLN A 1 238 ? 2.507  18.229 17.428  1.00 23.33  ? 1431 GLN A CA  1 
ATOM   1500 C C   . GLN A 1 238 ? 3.538  17.176 17.035  1.00 26.87  ? 1431 GLN A C   1 
ATOM   1501 O O   . GLN A 1 238 ? 3.386  16.460 16.049  1.00 32.67  ? 1431 GLN A O   1 
ATOM   1502 C CB  . GLN A 1 238 ? 1.800  18.805 16.211  1.00 20.90  ? 1431 GLN A CB  1 
ATOM   1503 C CG  . GLN A 1 238 ? 0.865  19.951 16.537  1.00 22.52  ? 1431 GLN A CG  1 
ATOM   1504 C CD  . GLN A 1 238 ? -0.102 19.646 17.671  1.00 20.41  ? 1431 GLN A CD  1 
ATOM   1505 O OE1 . GLN A 1 238 ? -0.548 20.552 18.369  1.00 32.17  ? 1431 GLN A OE1 1 
ATOM   1506 N NE2 . GLN A 1 238 ? -0.434 18.373 17.852  1.00 31.95  ? 1431 GLN A NE2 1 
ATOM   1507 N N   . CYS A 1 239 ? 4.584  17.088 17.840  1.00 24.68  ? 1432 CYS A N   1 
ATOM   1508 C CA  . CYS A 1 239 ? 5.627  16.096 17.670  1.00 27.87  ? 1432 CYS A CA  1 
ATOM   1509 C C   . CYS A 1 239 ? 5.092  14.718 17.233  1.00 35.74  ? 1432 CYS A C   1 
ATOM   1510 O O   . CYS A 1 239 ? 5.586  14.157 16.254  1.00 31.30  ? 1432 CYS A O   1 
ATOM   1511 C CB  . CYS A 1 239 ? 6.437  15.982 18.969  1.00 24.61  ? 1432 CYS A CB  1 
ATOM   1512 S SG  . CYS A 1 239 ? 7.899  14.962 18.834  1.00 37.64  ? 1432 CYS A SG  1 
ATOM   1513 N N   . PRO A 1 240 ? 4.092  14.164 17.960  1.00 30.97  ? 1433 PRO A N   1 
ATOM   1514 C CA  . PRO A 1 240 ? 3.558  12.844 17.589  1.00 34.45  ? 1433 PRO A CA  1 
ATOM   1515 C C   . PRO A 1 240 ? 3.037  12.785 16.146  1.00 35.21  ? 1433 PRO A C   1 
ATOM   1516 O O   . PRO A 1 240 ? 3.321  11.837 15.423  1.00 37.07  ? 1433 PRO A O   1 
ATOM   1517 C CB  . PRO A 1 240 ? 2.402  12.635 18.579  1.00 26.46  ? 1433 PRO A CB  1 
ATOM   1518 C CG  . PRO A 1 240 ? 2.748  13.477 19.742  1.00 30.23  ? 1433 PRO A CG  1 
ATOM   1519 C CD  . PRO A 1 240 ? 3.459  14.680 19.188  1.00 30.81  ? 1433 PRO A CD  1 
ATOM   1520 N N   . PHE A 1 241 ? 2.283  13.796 15.742  1.00 31.52  ? 1434 PHE A N   1 
ATOM   1521 C CA  . PHE A 1 241 ? 1.728  13.851 14.402  1.00 25.85  ? 1434 PHE A CA  1 
ATOM   1522 C C   . PHE A 1 241 ? 2.832  13.935 13.367  1.00 34.07  ? 1434 PHE A C   1 
ATOM   1523 O O   . PHE A 1 241 ? 2.726  13.340 12.293  1.00 35.59  ? 1434 PHE A O   1 
ATOM   1524 C CB  . PHE A 1 241 ? 0.806  15.062 14.281  1.00 36.23  ? 1434 PHE A CB  1 
ATOM   1525 C CG  . PHE A 1 241 ? 0.384  15.375 12.878  1.00 42.35  ? 1434 PHE A CG  1 
ATOM   1526 C CD1 . PHE A 1 241 ? -0.659 14.672 12.284  1.00 36.62  ? 1434 PHE A CD1 1 
ATOM   1527 C CD2 . PHE A 1 241 ? 1.010  16.396 12.159  1.00 39.43  ? 1434 PHE A CD2 1 
ATOM   1528 C CE1 . PHE A 1 241 ? -1.066 14.966 10.997  1.00 34.24  ? 1434 PHE A CE1 1 
ATOM   1529 C CE2 . PHE A 1 241 ? 0.610  16.702 10.870  1.00 34.91  ? 1434 PHE A CE2 1 
ATOM   1530 C CZ  . PHE A 1 241 ? -0.428 15.987 10.284  1.00 41.53  ? 1434 PHE A CZ  1 
ATOM   1531 N N   . PHE A 1 242 ? 3.891  14.676 13.688  1.00 32.33  ? 1435 PHE A N   1 
ATOM   1532 C CA  . PHE A 1 242 ? 4.983  14.874 12.742  1.00 30.81  ? 1435 PHE A CA  1 
ATOM   1533 C C   . PHE A 1 242 ? 5.987  13.729 12.712  1.00 34.47  ? 1435 PHE A C   1 
ATOM   1534 O O   . PHE A 1 242 ? 6.656  13.543 11.704  1.00 37.25  ? 1435 PHE A O   1 
ATOM   1535 C CB  . PHE A 1 242 ? 5.737  16.176 13.024  1.00 29.87  ? 1435 PHE A CB  1 
ATOM   1536 C CG  . PHE A 1 242 ? 4.985  17.414 12.646  1.00 33.27  ? 1435 PHE A CG  1 
ATOM   1537 C CD1 . PHE A 1 242 ? 4.577  18.312 13.619  1.00 32.34  ? 1435 PHE A CD1 1 
ATOM   1538 C CD2 . PHE A 1 242 ? 4.697  17.689 11.318  1.00 27.83  ? 1435 PHE A CD2 1 
ATOM   1539 C CE1 . PHE A 1 242 ? 3.891  19.452 13.279  1.00 30.95  ? 1435 PHE A CE1 1 
ATOM   1540 C CE2 . PHE A 1 242 ? 4.010  18.829 10.967  1.00 23.52  ? 1435 PHE A CE2 1 
ATOM   1541 C CZ  . PHE A 1 242 ? 3.602  19.709 11.945  1.00 34.57  ? 1435 PHE A CZ  1 
ATOM   1542 N N   . PHE A 1 243 ? 6.104  12.967 13.800  1.00 32.18  ? 1436 PHE A N   1 
ATOM   1543 C CA  . PHE A 1 243 ? 7.230  12.037 13.927  1.00 26.00  ? 1436 PHE A CA  1 
ATOM   1544 C C   . PHE A 1 243 ? 6.959  10.610 14.421  1.00 36.92  ? 1436 PHE A C   1 
ATOM   1545 O O   . PHE A 1 243 ? 7.907  9.846  14.590  1.00 46.31  ? 1436 PHE A O   1 
ATOM   1546 C CB  . PHE A 1 243 ? 8.311  12.641 14.830  1.00 28.82  ? 1436 PHE A CB  1 
ATOM   1547 C CG  . PHE A 1 243 ? 8.885  13.929 14.327  1.00 29.81  ? 1436 PHE A CG  1 
ATOM   1548 C CD1 . PHE A 1 243 ? 8.610  15.123 14.967  1.00 28.48  ? 1436 PHE A CD1 1 
ATOM   1549 C CD2 . PHE A 1 243 ? 9.717  13.949 13.224  1.00 37.61  ? 1436 PHE A CD2 1 
ATOM   1550 C CE1 . PHE A 1 243 ? 9.153  16.308 14.510  1.00 26.84  ? 1436 PHE A CE1 1 
ATOM   1551 C CE2 . PHE A 1 243 ? 10.259 15.138 12.762  1.00 40.26  ? 1436 PHE A CE2 1 
ATOM   1552 C CZ  . PHE A 1 243 ? 9.980  16.314 13.409  1.00 29.25  ? 1436 PHE A CZ  1 
ATOM   1553 N N   . TYR A 1 244 ? 5.705  10.235 14.665  1.00 38.43  ? 1437 TYR A N   1 
ATOM   1554 C CA  . TYR A 1 244 ? 5.427  8.902  15.220  1.00 40.17  ? 1437 TYR A CA  1 
ATOM   1555 C C   . TYR A 1 244 ? 5.163  7.821  14.171  1.00 47.63  ? 1437 TYR A C   1 
ATOM   1556 O O   . TYR A 1 244 ? 4.321  7.985  13.292  1.00 53.64  ? 1437 TYR A O   1 
ATOM   1557 C CB  . TYR A 1 244 ? 4.271  8.966  16.213  1.00 38.81  ? 1437 TYR A CB  1 
ATOM   1558 C CG  . TYR A 1 244 ? 4.666  9.514  17.555  1.00 38.64  ? 1437 TYR A CG  1 
ATOM   1559 C CD1 . TYR A 1 244 ? 5.930  10.038 17.758  1.00 39.84  ? 1437 TYR A CD1 1 
ATOM   1560 C CD2 . TYR A 1 244 ? 3.770  9.535  18.617  1.00 46.62  ? 1437 TYR A CD2 1 
ATOM   1561 C CE1 . TYR A 1 244 ? 6.306  10.561 18.990  1.00 41.25  ? 1437 TYR A CE1 1 
ATOM   1562 C CE2 . TYR A 1 244 ? 4.134  10.057 19.857  1.00 40.53  ? 1437 TYR A CE2 1 
ATOM   1563 C CZ  . TYR A 1 244 ? 5.407  10.569 20.030  1.00 41.23  ? 1437 TYR A CZ  1 
ATOM   1564 O OH  . TYR A 1 244 ? 5.798  11.097 21.238  1.00 37.46  ? 1437 TYR A OH  1 
ATOM   1565 N N   . TRP B 1 49  ? 40.509 45.744 -14.847 1.00 75.20  ? 1242 TRP B N   1 
ATOM   1566 C CA  . TRP B 1 49  ? 41.140 47.066 -14.752 1.00 102.30 ? 1242 TRP B CA  1 
ATOM   1567 C C   . TRP B 1 49  ? 40.689 47.883 -13.529 1.00 82.73  ? 1242 TRP B C   1 
ATOM   1568 O O   . TRP B 1 49  ? 39.697 47.553 -12.870 1.00 59.61  ? 1242 TRP B O   1 
ATOM   1569 C CB  . TRP B 1 49  ? 40.943 47.865 -16.048 1.00 93.74  ? 1242 TRP B CB  1 
ATOM   1570 C CG  . TRP B 1 49  ? 39.535 47.834 -16.580 1.00 105.67 ? 1242 TRP B CG  1 
ATOM   1571 C CD1 . TRP B 1 49  ? 38.887 46.764 -17.144 1.00 106.11 ? 1242 TRP B CD1 1 
ATOM   1572 C CD2 . TRP B 1 49  ? 38.607 48.923 -16.606 1.00 78.63  ? 1242 TRP B CD2 1 
ATOM   1573 N NE1 . TRP B 1 49  ? 37.610 47.123 -17.511 1.00 85.20  ? 1242 TRP B NE1 1 
ATOM   1574 C CE2 . TRP B 1 49  ? 37.413 48.441 -17.192 1.00 81.20  ? 1242 TRP B CE2 1 
ATOM   1575 C CE3 . TRP B 1 49  ? 38.667 50.255 -16.192 1.00 58.39  ? 1242 TRP B CE3 1 
ATOM   1576 C CZ2 . TRP B 1 49  ? 36.291 49.247 -17.370 1.00 60.35  ? 1242 TRP B CZ2 1 
ATOM   1577 C CZ3 . TRP B 1 49  ? 37.557 51.051 -16.370 1.00 73.32  ? 1242 TRP B CZ3 1 
ATOM   1578 C CH2 . TRP B 1 49  ? 36.381 50.544 -16.954 1.00 66.96  ? 1242 TRP B CH2 1 
ATOM   1579 N N   . GLU B 1 50  ? 41.436 48.944 -13.231 1.00 74.98  ? 1243 GLU B N   1 
ATOM   1580 C CA  . GLU B 1 50  ? 41.216 49.729 -12.016 1.00 90.77  ? 1243 GLU B CA  1 
ATOM   1581 C C   . GLU B 1 50  ? 40.596 51.094 -12.310 1.00 84.56  ? 1243 GLU B C   1 
ATOM   1582 O O   . GLU B 1 50  ? 41.260 51.994 -12.830 1.00 73.34  ? 1243 GLU B O   1 
ATOM   1583 C CB  . GLU B 1 50  ? 42.527 49.907 -11.242 1.00 74.27  ? 1243 GLU B CB  1 
ATOM   1584 C CG  . GLU B 1 50  ? 43.254 48.604 -10.940 1.00 77.79  ? 1243 GLU B CG  1 
ATOM   1585 C CD  . GLU B 1 50  ? 44.587 48.823 -10.245 1.00 83.83  ? 1243 GLU B CD  1 
ATOM   1586 N N   . SER B 1 51  ? 39.323 51.248 -11.962 1.00 76.01  ? 1244 SER B N   1 
ATOM   1587 C CA  . SER B 1 51  ? 38.616 52.491 -12.252 1.00 71.46  ? 1244 SER B CA  1 
ATOM   1588 C C   . SER B 1 51  ? 38.282 53.310 -11.005 1.00 71.92  ? 1244 SER B C   1 
ATOM   1589 O O   . SER B 1 51  ? 38.002 52.768 -9.930  1.00 69.90  ? 1244 SER B O   1 
ATOM   1590 C CB  . SER B 1 51  ? 37.339 52.214 -13.054 1.00 62.79  ? 1244 SER B CB  1 
ATOM   1591 N N   . ASN B 1 52  ? 38.319 54.625 -11.170 1.00 57.95  ? 1245 ASN B N   1 
ATOM   1592 C CA  . ASN B 1 52  ? 37.908 55.546 -10.126 1.00 62.17  ? 1245 ASN B CA  1 
ATOM   1593 C C   . ASN B 1 52  ? 36.417 55.861 -10.242 1.00 68.54  ? 1245 ASN B C   1 
ATOM   1594 O O   . ASN B 1 52  ? 35.833 56.476 -9.349  1.00 55.76  ? 1245 ASN B O   1 
ATOM   1595 C CB  . ASN B 1 52  ? 38.719 56.842 -10.223 1.00 65.12  ? 1245 ASN B CB  1 
ATOM   1596 N N   . TYR B 1 53  ? 35.808 55.441 -11.352 1.00 72.24  ? 1246 TYR B N   1 
ATOM   1597 C CA  . TYR B 1 53  ? 34.424 55.805 -11.659 1.00 63.70  ? 1246 TYR B CA  1 
ATOM   1598 C C   . TYR B 1 53  ? 33.480 54.611 -11.615 1.00 62.91  ? 1246 TYR B C   1 
ATOM   1599 O O   . TYR B 1 53  ? 32.409 54.679 -11.010 1.00 60.37  ? 1246 TYR B O   1 
ATOM   1600 C CB  . TYR B 1 53  ? 34.329 56.487 -13.027 1.00 69.56  ? 1246 TYR B CB  1 
ATOM   1601 C CG  . TYR B 1 53  ? 33.057 57.277 -13.219 1.00 58.14  ? 1246 TYR B CG  1 
ATOM   1602 C CD1 . TYR B 1 53  ? 31.986 56.746 -13.926 1.00 53.78  ? 1246 TYR B CD1 1 
ATOM   1603 C CD2 . TYR B 1 53  ? 32.926 58.553 -12.689 1.00 48.64  ? 1246 TYR B CD2 1 
ATOM   1604 C CE1 . TYR B 1 53  ? 30.818 57.465 -14.105 1.00 49.27  ? 1246 TYR B CE1 1 
ATOM   1605 C CE2 . TYR B 1 53  ? 31.764 59.278 -12.858 1.00 63.17  ? 1246 TYR B CE2 1 
ATOM   1606 C CZ  . TYR B 1 53  ? 30.710 58.730 -13.567 1.00 65.66  ? 1246 TYR B CZ  1 
ATOM   1607 O OH  . TYR B 1 53  ? 29.546 59.453 -13.738 1.00 63.57  ? 1246 TYR B OH  1 
ATOM   1608 N N   . PHE B 1 54  ? 33.874 53.519 -12.262 1.00 60.35  ? 1247 PHE B N   1 
ATOM   1609 C CA  . PHE B 1 54  ? 33.060 52.307 -12.258 1.00 57.61  ? 1247 PHE B CA  1 
ATOM   1610 C C   . PHE B 1 54  ? 33.424 51.378 -11.106 1.00 57.56  ? 1247 PHE B C   1 
ATOM   1611 O O   . PHE B 1 54  ? 34.588 51.282 -10.704 1.00 62.01  ? 1247 PHE B O   1 
ATOM   1612 C CB  . PHE B 1 54  ? 33.174 51.572 -13.596 1.00 38.28  ? 1247 PHE B CB  1 
ATOM   1613 C CG  . PHE B 1 54  ? 32.796 52.417 -14.766 1.00 48.09  ? 1247 PHE B CG  1 
ATOM   1614 C CD1 . PHE B 1 54  ? 33.756 53.128 -15.459 1.00 56.56  ? 1247 PHE B CD1 1 
ATOM   1615 C CD2 . PHE B 1 54  ? 31.473 52.528 -15.156 1.00 54.60  ? 1247 PHE B CD2 1 
ATOM   1616 C CE1 . PHE B 1 54  ? 33.405 53.917 -16.533 1.00 62.53  ? 1247 PHE B CE1 1 
ATOM   1617 C CE2 . PHE B 1 54  ? 31.115 53.320 -16.228 1.00 48.97  ? 1247 PHE B CE2 1 
ATOM   1618 C CZ  . PHE B 1 54  ? 32.080 54.014 -16.917 1.00 55.35  ? 1247 PHE B CZ  1 
ATOM   1619 N N   . GLY B 1 55  ? 32.414 50.698 -10.576 1.00 56.10  ? 1248 GLY B N   1 
ATOM   1620 C CA  . GLY B 1 55  ? 32.606 49.802 -9.450  1.00 61.52  ? 1248 GLY B CA  1 
ATOM   1621 C C   . GLY B 1 55  ? 32.859 50.513 -8.132  1.00 50.09  ? 1248 GLY B C   1 
ATOM   1622 O O   . GLY B 1 55  ? 33.293 49.884 -7.171  1.00 49.38  ? 1248 GLY B O   1 
ATOM   1623 N N   . VAL B 1 56  ? 32.601 51.818 -8.089  1.00 43.39  ? 1249 VAL B N   1 
ATOM   1624 C CA  . VAL B 1 56  ? 32.723 52.580 -6.853  1.00 45.43  ? 1249 VAL B CA  1 
ATOM   1625 C C   . VAL B 1 56  ? 31.335 52.997 -6.369  1.00 47.03  ? 1249 VAL B C   1 
ATOM   1626 O O   . VAL B 1 56  ? 30.402 53.078 -7.162  1.00 53.28  ? 1249 VAL B O   1 
ATOM   1627 C CB  . VAL B 1 56  ? 33.625 53.816 -7.039  1.00 48.37  ? 1249 VAL B CB  1 
ATOM   1628 C CG1 . VAL B 1 56  ? 34.859 53.440 -7.850  1.00 41.24  ? 1249 VAL B CG1 1 
ATOM   1629 C CG2 . VAL B 1 56  ? 32.863 54.940 -7.717  1.00 52.59  ? 1249 VAL B CG2 1 
ATOM   1630 N N   . PRO B 1 57  ? 31.191 53.243 -5.059  1.00 58.47  ? 1250 PRO B N   1 
ATOM   1631 C CA  . PRO B 1 57  ? 29.912 53.638 -4.453  1.00 60.84  ? 1250 PRO B CA  1 
ATOM   1632 C C   . PRO B 1 57  ? 29.192 54.731 -5.234  1.00 52.06  ? 1250 PRO B C   1 
ATOM   1633 O O   . PRO B 1 57  ? 29.832 55.598 -5.824  1.00 49.84  ? 1250 PRO B O   1 
ATOM   1634 C CB  . PRO B 1 57  ? 30.333 54.169 -3.083  1.00 45.94  ? 1250 PRO B CB  1 
ATOM   1635 C CG  . PRO B 1 57  ? 31.519 53.350 -2.744  1.00 56.91  ? 1250 PRO B CG  1 
ATOM   1636 C CD  . PRO B 1 57  ? 32.254 53.116 -4.048  1.00 59.28  ? 1250 PRO B CD  1 
ATOM   1637 N N   . LEU B 1 58  ? 27.867 54.688 -5.224  1.00 47.20  ? 1251 LEU B N   1 
ATOM   1638 C CA  . LEU B 1 58  ? 27.075 55.608 -6.025  1.00 51.20  ? 1251 LEU B CA  1 
ATOM   1639 C C   . LEU B 1 58  ? 27.336 57.065 -5.642  1.00 42.61  ? 1251 LEU B C   1 
ATOM   1640 O O   . LEU B 1 58  ? 27.471 57.924 -6.507  1.00 50.10  ? 1251 LEU B O   1 
ATOM   1641 C CB  . LEU B 1 58  ? 25.587 55.257 -5.922  1.00 38.42  ? 1251 LEU B CB  1 
ATOM   1642 C CG  . LEU B 1 58  ? 24.601 56.132 -6.693  1.00 38.32  ? 1251 LEU B CG  1 
ATOM   1643 C CD1 . LEU B 1 58  ? 24.896 56.077 -8.177  1.00 31.75  ? 1251 LEU B CD1 1 
ATOM   1644 C CD2 . LEU B 1 58  ? 23.173 55.694 -6.400  1.00 37.52  ? 1251 LEU B CD2 1 
ATOM   1645 N N   . THR B 1 59  ? 27.424 57.336 -4.347  1.00 45.84  ? 1252 THR B N   1 
ATOM   1646 C CA  . THR B 1 59  ? 27.603 58.702 -3.859  1.00 62.75  ? 1252 THR B CA  1 
ATOM   1647 C C   . THR B 1 59  ? 28.918 59.338 -4.329  1.00 61.43  ? 1252 THR B C   1 
ATOM   1648 O O   . THR B 1 59  ? 29.039 60.566 -4.393  1.00 63.47  ? 1252 THR B O   1 
ATOM   1649 C CB  . THR B 1 59  ? 27.513 58.759 -2.317  1.00 58.25  ? 1252 THR B CB  1 
ATOM   1650 O OG1 . THR B 1 59  ? 28.359 57.750 -1.756  1.00 54.95  ? 1252 THR B OG1 1 
ATOM   1651 C CG2 . THR B 1 59  ? 26.081 58.508 -1.859  1.00 45.90  ? 1252 THR B CG2 1 
ATOM   1652 N N   . THR B 1 60  ? 29.892 58.496 -4.661  1.00 55.09  ? 1253 THR B N   1 
ATOM   1653 C CA  . THR B 1 60  ? 31.202 58.955 -5.126  1.00 50.28  ? 1253 THR B CA  1 
ATOM   1654 C C   . THR B 1 60  ? 31.148 59.601 -6.506  1.00 51.35  ? 1253 THR B C   1 
ATOM   1655 O O   . THR B 1 60  ? 31.999 60.421 -6.845  1.00 42.71  ? 1253 THR B O   1 
ATOM   1656 C CB  . THR B 1 60  ? 32.208 57.787 -5.177  1.00 60.28  ? 1253 THR B CB  1 
ATOM   1657 O OG1 . THR B 1 60  ? 32.687 57.516 -3.858  1.00 59.49  ? 1253 THR B OG1 1 
ATOM   1658 C CG2 . THR B 1 60  ? 33.392 58.118 -6.082  1.00 52.08  ? 1253 THR B CG2 1 
ATOM   1659 N N   . VAL B 1 61  ? 30.149 59.219 -7.299  1.00 58.70  ? 1254 VAL B N   1 
ATOM   1660 C CA  . VAL B 1 61  ? 30.010 59.724 -8.660  1.00 46.02  ? 1254 VAL B CA  1 
ATOM   1661 C C   . VAL B 1 61  ? 28.757 60.575 -8.863  1.00 43.16  ? 1254 VAL B C   1 
ATOM   1662 O O   . VAL B 1 61  ? 28.352 60.808 -9.998  1.00 42.90  ? 1254 VAL B O   1 
ATOM   1663 C CB  . VAL B 1 61  ? 30.023 58.583 -9.688  1.00 43.53  ? 1254 VAL B CB  1 
ATOM   1664 C CG1 . VAL B 1 61  ? 31.352 57.865 -9.659  1.00 52.41  ? 1254 VAL B CG1 1 
ATOM   1665 C CG2 . VAL B 1 61  ? 28.900 57.608 -9.412  1.00 58.01  ? 1254 VAL B CG2 1 
ATOM   1666 N N   . VAL B 1 62  ? 28.151 61.032 -7.765  1.00 40.86  ? 1255 VAL B N   1 
ATOM   1667 C CA  . VAL B 1 62  ? 27.052 61.992 -7.834  1.00 43.57  ? 1255 VAL B CA  1 
ATOM   1668 C C   . VAL B 1 62  ? 27.134 63.032 -6.730  1.00 54.28  ? 1255 VAL B C   1 
ATOM   1669 O O   . VAL B 1 62  ? 27.699 62.780 -5.667  1.00 72.43  ? 1255 VAL B O   1 
ATOM   1670 C CB  . VAL B 1 62  ? 25.660 61.313 -7.754  1.00 50.94  ? 1255 VAL B CB  1 
ATOM   1671 C CG1 . VAL B 1 62  ? 25.518 60.242 -8.824  1.00 54.98  ? 1255 VAL B CG1 1 
ATOM   1672 C CG2 . VAL B 1 62  ? 25.421 60.725 -6.383  1.00 34.56  ? 1255 VAL B CG2 1 
ATOM   1673 N N   . THR B 1 63  ? 26.563 64.203 -6.993  1.00 63.71  ? 1256 THR B N   1 
ATOM   1674 C CA  . THR B 1 63  ? 26.446 65.259 -5.994  1.00 63.90  ? 1256 THR B CA  1 
ATOM   1675 C C   . THR B 1 63  ? 24.963 65.580 -5.834  1.00 64.62  ? 1256 THR B C   1 
ATOM   1676 O O   . THR B 1 63  ? 24.163 65.211 -6.687  1.00 60.79  ? 1256 THR B O   1 
ATOM   1677 C CB  . THR B 1 63  ? 27.226 66.525 -6.412  1.00 63.83  ? 1256 THR B CB  1 
ATOM   1678 O OG1 . THR B 1 63  ? 26.510 67.227 -7.438  1.00 63.27  ? 1256 THR B OG1 1 
ATOM   1679 C CG2 . THR B 1 63  ? 28.611 66.149 -6.921  1.00 51.24  ? 1256 THR B CG2 1 
ATOM   1680 N N   . PRO B 1 64  ? 24.581 66.247 -4.733  1.00 80.25  ? 1257 PRO B N   1 
ATOM   1681 C CA  . PRO B 1 64  ? 23.160 66.592 -4.605  1.00 70.77  ? 1257 PRO B CA  1 
ATOM   1682 C C   . PRO B 1 64  ? 22.728 67.609 -5.660  1.00 70.37  ? 1257 PRO B C   1 
ATOM   1683 O O   . PRO B 1 64  ? 21.531 67.727 -5.939  1.00 66.81  ? 1257 PRO B O   1 
ATOM   1684 C CB  . PRO B 1 64  ? 23.074 67.208 -3.203  1.00 51.76  ? 1257 PRO B CB  1 
ATOM   1685 C CG  . PRO B 1 64  ? 24.267 66.686 -2.478  1.00 53.24  ? 1257 PRO B CG  1 
ATOM   1686 C CD  . PRO B 1 64  ? 25.342 66.578 -3.515  1.00 68.39  ? 1257 PRO B CD  1 
ATOM   1687 N N   . GLU B 1 65  ? 23.696 68.324 -6.236  1.00 70.14  ? 1258 GLU B N   1 
ATOM   1688 C CA  . GLU B 1 65  ? 23.422 69.376 -7.218  1.00 66.39  ? 1258 GLU B CA  1 
ATOM   1689 C C   . GLU B 1 65  ? 23.409 68.820 -8.638  1.00 71.61  ? 1258 GLU B C   1 
ATOM   1690 O O   . GLU B 1 65  ? 22.750 69.371 -9.527  1.00 77.48  ? 1258 GLU B O   1 
ATOM   1691 C CB  . GLU B 1 65  ? 24.449 70.512 -7.112  1.00 74.59  ? 1258 GLU B CB  1 
ATOM   1692 C CG  . GLU B 1 65  ? 24.644 71.082 -5.699  1.00 82.93  ? 1258 GLU B CG  1 
ATOM   1693 C CD  . GLU B 1 65  ? 25.815 70.443 -4.953  1.00 92.32  ? 1258 GLU B CD  1 
ATOM   1694 O OE1 . GLU B 1 65  ? 26.945 70.455 -5.490  1.00 91.54  ? 1258 GLU B OE1 1 
ATOM   1695 O OE2 . GLU B 1 65  ? 25.610 69.937 -3.827  1.00 72.24  ? 1258 GLU B OE2 1 
ATOM   1696 N N   . LYS B 1 66  ? 24.151 67.733 -8.839  1.00 64.95  ? 1259 LYS B N   1 
ATOM   1697 C CA  . LYS B 1 66  ? 24.175 67.006 -10.107 1.00 64.09  ? 1259 LYS B CA  1 
ATOM   1698 C C   . LYS B 1 66  ? 24.050 65.509 -9.821  1.00 55.44  ? 1259 LYS B C   1 
ATOM   1699 O O   . LYS B 1 66  ? 25.040 64.780 -9.915  1.00 47.76  ? 1259 LYS B O   1 
ATOM   1700 C CB  . LYS B 1 66  ? 25.474 67.293 -10.879 1.00 44.87  ? 1259 LYS B CB  1 
ATOM   1701 C CG  . LYS B 1 66  ? 25.451 68.550 -11.748 1.00 36.41  ? 1259 LYS B CG  1 
ATOM   1702 N N   . PRO B 1 67  ? 22.822 65.051 -9.493  1.00 58.32  ? 1260 PRO B N   1 
ATOM   1703 C CA  . PRO B 1 67  ? 22.480 63.761 -8.869  1.00 56.39  ? 1260 PRO B CA  1 
ATOM   1704 C C   . PRO B 1 67  ? 22.584 62.551 -9.788  1.00 49.65  ? 1260 PRO B C   1 
ATOM   1705 O O   . PRO B 1 67  ? 22.687 61.419 -9.312  1.00 49.32  ? 1260 PRO B O   1 
ATOM   1706 C CB  . PRO B 1 67  ? 21.007 63.942 -8.455  1.00 45.90  ? 1260 PRO B CB  1 
ATOM   1707 C CG  . PRO B 1 67  ? 20.673 65.378 -8.723  1.00 54.04  ? 1260 PRO B CG  1 
ATOM   1708 C CD  . PRO B 1 67  ? 21.608 65.822 -9.799  1.00 56.99  ? 1260 PRO B CD  1 
ATOM   1709 N N   . ILE B 1 68  ? 22.528 62.791 -11.090 1.00 54.87  ? 1261 ILE B N   1 
ATOM   1710 C CA  . ILE B 1 68  ? 22.660 61.722 -12.068 1.00 46.28  ? 1261 ILE B CA  1 
ATOM   1711 C C   . ILE B 1 68  ? 24.125 61.592 -12.474 1.00 42.19  ? 1261 ILE B C   1 
ATOM   1712 O O   . ILE B 1 68  ? 24.764 62.572 -12.849 1.00 46.43  ? 1261 ILE B O   1 
ATOM   1713 C CB  . ILE B 1 68  ? 21.791 62.005 -13.313 1.00 41.67  ? 1261 ILE B CB  1 
ATOM   1714 C CG1 . ILE B 1 68  ? 20.409 62.513 -12.890 1.00 40.89  ? 1261 ILE B CG1 1 
ATOM   1715 C CG2 . ILE B 1 68  ? 21.659 60.764 -14.164 1.00 35.16  ? 1261 ILE B CG2 1 
ATOM   1716 C CD1 . ILE B 1 68  ? 19.658 61.556 -11.966 1.00 39.24  ? 1261 ILE B CD1 1 
ATOM   1717 N N   . PRO B 1 69  ? 24.674 60.380 -12.368 1.00 42.60  ? 1262 PRO B N   1 
ATOM   1718 C CA  . PRO B 1 69  ? 26.037 60.133 -12.845 1.00 38.71  ? 1262 PRO B CA  1 
ATOM   1719 C C   . PRO B 1 69  ? 26.190 60.595 -14.290 1.00 44.91  ? 1262 PRO B C   1 
ATOM   1720 O O   . PRO B 1 69  ? 25.328 60.293 -15.120 1.00 49.03  ? 1262 PRO B O   1 
ATOM   1721 C CB  . PRO B 1 69  ? 26.163 58.615 -12.754 1.00 35.14  ? 1262 PRO B CB  1 
ATOM   1722 C CG  . PRO B 1 69  ? 25.232 58.226 -11.666 1.00 38.76  ? 1262 PRO B CG  1 
ATOM   1723 C CD  . PRO B 1 69  ? 24.088 59.204 -11.704 1.00 40.69  ? 1262 PRO B CD  1 
ATOM   1724 N N   . ILE B 1 70  ? 27.267 61.319 -14.587 1.00 46.18  ? 1263 ILE B N   1 
ATOM   1725 C CA  . ILE B 1 70  ? 27.469 61.858 -15.931 1.00 45.65  ? 1263 ILE B CA  1 
ATOM   1726 C C   . ILE B 1 70  ? 27.463 60.762 -17.000 1.00 42.76  ? 1263 ILE B C   1 
ATOM   1727 O O   . ILE B 1 70  ? 26.914 60.948 -18.086 1.00 41.87  ? 1263 ILE B O   1 
ATOM   1728 C CB  . ILE B 1 70  ? 28.748 62.715 -16.018 1.00 53.42  ? 1263 ILE B CB  1 
ATOM   1729 C CG1 . ILE B 1 70  ? 28.469 64.116 -15.484 1.00 54.01  ? 1263 ILE B CG1 1 
ATOM   1730 C CG2 . ILE B 1 70  ? 29.233 62.832 -17.450 1.00 59.46  ? 1263 ILE B CG2 1 
ATOM   1731 C CD1 . ILE B 1 70  ? 28.159 64.155 -13.994 1.00 78.19  ? 1263 ILE B CD1 1 
ATOM   1732 N N   . PHE B 1 71  ? 28.053 59.614 -16.682 1.00 40.68  ? 1264 PHE B N   1 
ATOM   1733 C CA  . PHE B 1 71  ? 28.045 58.487 -17.607 1.00 41.20  ? 1264 PHE B CA  1 
ATOM   1734 C C   . PHE B 1 71  ? 26.619 58.078 -17.958 1.00 44.52  ? 1264 PHE B C   1 
ATOM   1735 O O   . PHE B 1 71  ? 26.317 57.775 -19.121 1.00 43.82  ? 1264 PHE B O   1 
ATOM   1736 C CB  . PHE B 1 71  ? 28.823 57.291 -17.048 1.00 33.85  ? 1264 PHE B CB  1 
ATOM   1737 C CG  . PHE B 1 71  ? 28.875 56.112 -17.983 1.00 35.92  ? 1264 PHE B CG  1 
ATOM   1738 C CD1 . PHE B 1 71  ? 29.620 56.162 -19.152 1.00 38.44  ? 1264 PHE B CD1 1 
ATOM   1739 C CD2 . PHE B 1 71  ? 28.172 54.955 -17.698 1.00 40.31  ? 1264 PHE B CD2 1 
ATOM   1740 C CE1 . PHE B 1 71  ? 29.664 55.076 -20.012 1.00 41.29  ? 1264 PHE B CE1 1 
ATOM   1741 C CE2 . PHE B 1 71  ? 28.216 53.859 -18.555 1.00 37.65  ? 1264 PHE B CE2 1 
ATOM   1742 C CZ  . PHE B 1 71  ? 28.964 53.919 -19.709 1.00 42.32  ? 1264 PHE B CZ  1 
ATOM   1743 N N   . ILE B 1 72  ? 25.743 58.078 -16.956 1.00 35.56  ? 1265 ILE B N   1 
ATOM   1744 C CA  . ILE B 1 72  ? 24.351 57.682 -17.168 1.00 39.65  ? 1265 ILE B CA  1 
ATOM   1745 C C   . ILE B 1 72  ? 23.615 58.689 -18.040 1.00 35.98  ? 1265 ILE B C   1 
ATOM   1746 O O   . ILE B 1 72  ? 22.835 58.308 -18.913 1.00 39.50  ? 1265 ILE B O   1 
ATOM   1747 C CB  . ILE B 1 72  ? 23.586 57.457 -15.845 1.00 35.53  ? 1265 ILE B CB  1 
ATOM   1748 C CG1 . ILE B 1 72  ? 24.130 56.233 -15.113 1.00 29.97  ? 1265 ILE B CG1 1 
ATOM   1749 C CG2 . ILE B 1 72  ? 22.119 57.233 -16.116 1.00 34.38  ? 1265 ILE B CG2 1 
ATOM   1750 C CD1 . ILE B 1 72  ? 24.196 54.995 -15.970 1.00 27.15  ? 1265 ILE B CD1 1 
ATOM   1751 N N   . GLU B 1 73  ? 23.870 59.972 -17.806 1.00 31.86  ? 1266 GLU B N   1 
ATOM   1752 C CA  . GLU B 1 73  ? 23.369 61.007 -18.700 1.00 42.42  ? 1266 GLU B CA  1 
ATOM   1753 C C   . GLU B 1 73  ? 23.817 60.813 -20.159 1.00 52.76  ? 1266 GLU B C   1 
ATOM   1754 O O   . GLU B 1 73  ? 22.980 60.834 -21.063 1.00 49.22  ? 1266 GLU B O   1 
ATOM   1755 C CB  . GLU B 1 73  ? 23.739 62.399 -18.197 1.00 48.86  ? 1266 GLU B CB  1 
ATOM   1756 C CG  . GLU B 1 73  ? 22.621 63.074 -17.429 1.00 70.29  ? 1266 GLU B CG  1 
ATOM   1757 C CD  . GLU B 1 73  ? 23.036 64.395 -16.807 1.00 84.46  ? 1266 GLU B CD  1 
ATOM   1758 O OE1 . GLU B 1 73  ? 22.143 65.234 -16.560 1.00 80.31  ? 1266 GLU B OE1 1 
ATOM   1759 O OE2 . GLU B 1 73  ? 24.247 64.594 -16.559 1.00 82.83  ? 1266 GLU B OE2 1 
ATOM   1760 N N   . ARG B 1 74  ? 25.117 60.616 -20.393 1.00 41.50  ? 1267 ARG B N   1 
ATOM   1761 C CA  . ARG B 1 74  ? 25.610 60.435 -21.759 1.00 45.46  ? 1267 ARG B CA  1 
ATOM   1762 C C   . ARG B 1 74  ? 24.884 59.318 -22.472 1.00 50.47  ? 1267 ARG B C   1 
ATOM   1763 O O   . ARG B 1 74  ? 24.428 59.493 -23.602 1.00 62.19  ? 1267 ARG B O   1 
ATOM   1764 C CB  . ARG B 1 74  ? 27.104 60.123 -21.800 1.00 50.44  ? 1267 ARG B CB  1 
ATOM   1765 C CG  . ARG B 1 74  ? 27.999 61.296 -21.514 1.00 65.03  ? 1267 ARG B CG  1 
ATOM   1766 C CD  . ARG B 1 74  ? 27.620 62.541 -22.302 1.00 56.15  ? 1267 ARG B CD  1 
ATOM   1767 N NE  . ARG B 1 74  ? 28.017 63.727 -21.552 1.00 56.98  ? 1267 ARG B NE  1 
ATOM   1768 C CZ  . ARG B 1 74  ? 29.266 63.961 -21.165 1.00 77.92  ? 1267 ARG B CZ  1 
ATOM   1769 N NH1 . ARG B 1 74  ? 30.228 63.096 -21.472 1.00 66.84  ? 1267 ARG B NH1 1 
ATOM   1770 N NH2 . ARG B 1 74  ? 29.555 65.054 -20.474 1.00 84.61  ? 1267 ARG B NH2 1 
ATOM   1771 N N   . CYS B 1 75  ? 24.798 58.163 -21.820 1.00 37.83  ? 1268 CYS B N   1 
ATOM   1772 C CA  . CYS B 1 75  ? 24.256 56.973 -22.469 1.00 32.70  ? 1268 CYS B CA  1 
ATOM   1773 C C   . CYS B 1 75  ? 22.768 57.090 -22.709 1.00 36.98  ? 1268 CYS B C   1 
ATOM   1774 O O   . CYS B 1 75  ? 22.280 56.729 -23.772 1.00 39.76  ? 1268 CYS B O   1 
ATOM   1775 C CB  . CYS B 1 75  ? 24.513 55.735 -21.625 1.00 40.92  ? 1268 CYS B CB  1 
ATOM   1776 S SG  . CYS B 1 75  ? 26.222 55.382 -21.358 1.00 37.47  ? 1268 CYS B SG  1 
ATOM   1777 N N   . ILE B 1 76  ? 22.041 57.580 -21.712 1.00 31.92  ? 1269 ILE B N   1 
ATOM   1778 C CA  . ILE B 1 76  ? 20.595 57.668 -21.825 1.00 35.76  ? 1269 ILE B CA  1 
ATOM   1779 C C   . ILE B 1 76  ? 20.207 58.716 -22.864 1.00 42.42  ? 1269 ILE B C   1 
ATOM   1780 O O   . ILE B 1 76  ? 19.339 58.482 -23.705 1.00 43.66  ? 1269 ILE B O   1 
ATOM   1781 C CB  . ILE B 1 76  ? 19.922 57.943 -20.453 1.00 41.20  ? 1269 ILE B CB  1 
ATOM   1782 C CG1 . ILE B 1 76  ? 19.948 56.673 -19.592 1.00 42.49  ? 1269 ILE B CG1 1 
ATOM   1783 C CG2 . ILE B 1 76  ? 18.485 58.405 -20.627 1.00 31.60  ? 1269 ILE B CG2 1 
ATOM   1784 C CD1 . ILE B 1 76  ? 18.946 56.675 -18.438 1.00 30.63  ? 1269 ILE B CD1 1 
ATOM   1785 N N   . GLU B 1 77  ? 20.874 59.862 -22.820 1.00 40.85  ? 1270 GLU B N   1 
ATOM   1786 C CA  . GLU B 1 77  ? 20.610 60.920 -23.777 1.00 31.93  ? 1270 GLU B CA  1 
ATOM   1787 C C   . GLU B 1 77  ? 20.964 60.487 -25.203 1.00 45.23  ? 1270 GLU B C   1 
ATOM   1788 O O   . GLU B 1 77  ? 20.292 60.870 -26.166 1.00 54.59  ? 1270 GLU B O   1 
ATOM   1789 C CB  . GLU B 1 77  ? 21.348 62.198 -23.380 1.00 25.99  ? 1270 GLU B CB  1 
ATOM   1790 C CG  . GLU B 1 77  ? 20.702 62.907 -22.197 1.00 43.37  ? 1270 GLU B CG  1 
ATOM   1791 C CD  . GLU B 1 77  ? 21.445 64.158 -21.768 1.00 61.33  ? 1270 GLU B CD  1 
ATOM   1792 O OE1 . GLU B 1 77  ? 22.100 64.785 -22.630 1.00 56.94  ? 1270 GLU B OE1 1 
ATOM   1793 O OE2 . GLU B 1 77  ? 21.375 64.512 -20.569 1.00 74.65  ? 1270 GLU B OE2 1 
ATOM   1794 N N   . TYR B 1 78  ? 22.006 59.673 -25.332 1.00 37.53  ? 1271 TYR B N   1 
ATOM   1795 C CA  . TYR B 1 78  ? 22.449 59.196 -26.637 1.00 39.82  ? 1271 TYR B CA  1 
ATOM   1796 C C   . TYR B 1 78  ? 21.514 58.121 -27.155 1.00 42.33  ? 1271 TYR B C   1 
ATOM   1797 O O   . TYR B 1 78  ? 21.196 58.080 -28.342 1.00 46.23  ? 1271 TYR B O   1 
ATOM   1798 C CB  . TYR B 1 78  ? 23.874 58.647 -26.553 1.00 39.96  ? 1271 TYR B CB  1 
ATOM   1799 C CG  . TYR B 1 78  ? 24.384 58.046 -27.845 1.00 46.09  ? 1271 TYR B CG  1 
ATOM   1800 C CD1 . TYR B 1 78  ? 24.902 58.851 -28.856 1.00 44.68  ? 1271 TYR B CD1 1 
ATOM   1801 C CD2 . TYR B 1 78  ? 24.358 56.672 -28.050 1.00 42.72  ? 1271 TYR B CD2 1 
ATOM   1802 C CE1 . TYR B 1 78  ? 25.376 58.302 -30.035 1.00 38.52  ? 1271 TYR B CE1 1 
ATOM   1803 C CE2 . TYR B 1 78  ? 24.824 56.118 -29.225 1.00 46.36  ? 1271 TYR B CE2 1 
ATOM   1804 C CZ  . TYR B 1 78  ? 25.331 56.940 -30.213 1.00 43.69  ? 1271 TYR B CZ  1 
ATOM   1805 O OH  . TYR B 1 78  ? 25.800 56.391 -31.377 1.00 45.77  ? 1271 TYR B OH  1 
ATOM   1806 N N   . ILE B 1 79  ? 21.085 57.247 -26.252 1.00 42.87  ? 1272 ILE B N   1 
ATOM   1807 C CA  . ILE B 1 79  ? 20.160 56.180 -26.593 1.00 36.65  ? 1272 ILE B CA  1 
ATOM   1808 C C   . ILE B 1 79  ? 18.800 56.756 -26.963 1.00 45.75  ? 1272 ILE B C   1 
ATOM   1809 O O   . ILE B 1 79  ? 18.117 56.238 -27.851 1.00 43.94  ? 1272 ILE B O   1 
ATOM   1810 C CB  . ILE B 1 79  ? 20.010 55.183 -25.436 1.00 41.07  ? 1272 ILE B CB  1 
ATOM   1811 C CG1 . ILE B 1 79  ? 21.200 54.215 -25.415 1.00 49.75  ? 1272 ILE B CG1 1 
ATOM   1812 C CG2 . ILE B 1 79  ? 18.728 54.397 -25.577 1.00 29.96  ? 1272 ILE B CG2 1 
ATOM   1813 C CD1 . ILE B 1 79  ? 21.490 53.615 -24.040 1.00 38.62  ? 1272 ILE B CD1 1 
ATOM   1814 N N   . GLU B 1 80  ? 18.408 57.839 -26.295 1.00 41.92  ? 1273 GLU B N   1 
ATOM   1815 C CA  . GLU B 1 80  ? 17.141 58.490 -26.619 1.00 39.87  ? 1273 GLU B CA  1 
ATOM   1816 C C   . GLU B 1 80  ? 17.194 59.155 -27.987 1.00 48.57  ? 1273 GLU B C   1 
ATOM   1817 O O   . GLU B 1 80  ? 16.190 59.211 -28.700 1.00 51.37  ? 1273 GLU B O   1 
ATOM   1818 C CB  . GLU B 1 80  ? 16.717 59.476 -25.527 1.00 30.10  ? 1273 GLU B CB  1 
ATOM   1819 C CG  . GLU B 1 80  ? 16.037 58.781 -24.350 1.00 32.64  ? 1273 GLU B CG  1 
ATOM   1820 C CD  . GLU B 1 80  ? 15.517 59.732 -23.296 1.00 41.51  ? 1273 GLU B CD  1 
ATOM   1821 O OE1 . GLU B 1 80  ? 15.459 60.957 -23.558 1.00 34.94  ? 1273 GLU B OE1 1 
ATOM   1822 O OE2 . GLU B 1 80  ? 15.152 59.242 -22.205 1.00 34.75  ? 1273 GLU B OE2 1 
ATOM   1823 N N   . ALA B 1 81  ? 18.378 59.630 -28.363 1.00 52.85  ? 1274 ALA B N   1 
ATOM   1824 C CA  . ALA B 1 81  ? 18.559 60.296 -29.646 1.00 45.83  ? 1274 ALA B CA  1 
ATOM   1825 C C   . ALA B 1 81  ? 18.954 59.340 -30.767 1.00 39.15  ? 1274 ALA B C   1 
ATOM   1826 O O   . ALA B 1 81  ? 18.874 59.701 -31.940 1.00 64.75  ? 1274 ALA B O   1 
ATOM   1827 C CB  . ALA B 1 81  ? 19.574 61.428 -29.527 1.00 44.42  ? 1274 ALA B CB  1 
ATOM   1828 N N   . THR B 1 82  ? 19.363 58.124 -30.424 1.00 38.36  ? 1275 THR B N   1 
ATOM   1829 C CA  . THR B 1 82  ? 19.860 57.199 -31.441 1.00 42.57  ? 1275 THR B CA  1 
ATOM   1830 C C   . THR B 1 82  ? 19.161 55.832 -31.497 1.00 48.59  ? 1275 THR B C   1 
ATOM   1831 O O   . THR B 1 82  ? 19.114 55.208 -32.556 1.00 52.88  ? 1275 THR B O   1 
ATOM   1832 C CB  . THR B 1 82  ? 21.394 57.011 -31.334 1.00 25.28  ? 1275 THR B CB  1 
ATOM   1833 N N   . GLY B 1 83  ? 18.599 55.375 -30.380 1.00 59.45  ? 1276 GLY B N   1 
ATOM   1834 C CA  . GLY B 1 83  ? 18.107 54.005 -30.296 1.00 53.06  ? 1276 GLY B CA  1 
ATOM   1835 C C   . GLY B 1 83  ? 16.681 53.683 -29.863 1.00 46.63  ? 1276 GLY B C   1 
ATOM   1836 O O   . GLY B 1 83  ? 16.374 52.513 -29.626 1.00 31.96  ? 1276 GLY B O   1 
ATOM   1837 N N   . LEU B 1 84  ? 15.806 54.684 -29.776 1.00 38.61  ? 1277 LEU B N   1 
ATOM   1838 C CA  . LEU B 1 84  ? 14.406 54.449 -29.401 1.00 26.28  ? 1277 LEU B CA  1 
ATOM   1839 C C   . LEU B 1 84  ? 13.617 53.527 -30.351 1.00 34.27  ? 1277 LEU B C   1 
ATOM   1840 O O   . LEU B 1 84  ? 12.548 53.031 -29.984 1.00 26.45  ? 1277 LEU B O   1 
ATOM   1841 C CB  . LEU B 1 84  ? 13.658 55.772 -29.245 1.00 27.29  ? 1277 LEU B CB  1 
ATOM   1842 C CG  . LEU B 1 84  ? 13.917 56.597 -27.992 1.00 38.18  ? 1277 LEU B CG  1 
ATOM   1843 C CD1 . LEU B 1 84  ? 12.883 57.711 -27.888 1.00 36.82  ? 1277 LEU B CD1 1 
ATOM   1844 C CD2 . LEU B 1 84  ? 13.905 55.717 -26.749 1.00 28.26  ? 1277 LEU B CD2 1 
ATOM   1845 N N   . SER B 1 85  ? 14.131 53.308 -31.564 1.00 32.88  ? 1278 SER B N   1 
ATOM   1846 C CA  . SER B 1 85  ? 13.439 52.468 -32.552 1.00 33.11  ? 1278 SER B CA  1 
ATOM   1847 C C   . SER B 1 85  ? 14.141 51.124 -32.808 1.00 37.63  ? 1278 SER B C   1 
ATOM   1848 O O   . SER B 1 85  ? 13.676 50.317 -33.619 1.00 29.22  ? 1278 SER B O   1 
ATOM   1849 C CB  . SER B 1 85  ? 13.251 53.210 -33.884 1.00 35.91  ? 1278 SER B CB  1 
ATOM   1850 O OG  . SER B 1 85  ? 12.451 54.371 -33.739 1.00 37.84  ? 1278 SER B OG  1 
ATOM   1851 N N   . THR B 1 86  ? 15.250 50.875 -32.120 1.00 30.88  ? 1279 THR B N   1 
ATOM   1852 C CA  . THR B 1 86  ? 15.984 49.631 -32.329 1.00 33.95  ? 1279 THR B CA  1 
ATOM   1853 C C   . THR B 1 86  ? 15.305 48.434 -31.666 1.00 32.99  ? 1279 THR B C   1 
ATOM   1854 O O   . THR B 1 86  ? 15.047 48.434 -30.463 1.00 31.98  ? 1279 THR B O   1 
ATOM   1855 C CB  . THR B 1 86  ? 17.427 49.739 -31.831 1.00 33.41  ? 1279 THR B CB  1 
ATOM   1856 O OG1 . THR B 1 86  ? 17.482 49.383 -30.444 1.00 54.94  ? 1279 THR B OG1 1 
ATOM   1857 C CG2 . THR B 1 86  ? 17.951 51.158 -32.032 1.00 36.54  ? 1279 THR B CG2 1 
ATOM   1858 N N   . GLU B 1 87  ? 15.009 47.412 -32.458 1.00 36.71  ? 1280 GLU B N   1 
ATOM   1859 C CA  . GLU B 1 87  ? 14.330 46.243 -31.921 1.00 33.66  ? 1280 GLU B CA  1 
ATOM   1860 C C   . GLU B 1 87  ? 15.111 45.676 -30.745 1.00 36.73  ? 1280 GLU B C   1 
ATOM   1861 O O   . GLU B 1 87  ? 16.340 45.561 -30.789 1.00 38.75  ? 1280 GLU B O   1 
ATOM   1862 C CB  . GLU B 1 87  ? 14.113 45.169 -32.990 1.00 26.43  ? 1280 GLU B CB  1 
ATOM   1863 C CG  . GLU B 1 87  ? 12.772 45.258 -33.705 1.00 44.93  ? 1280 GLU B CG  1 
ATOM   1864 C CD  . GLU B 1 87  ? 12.497 44.069 -34.637 1.00 65.75  ? 1280 GLU B CD  1 
ATOM   1865 O OE1 . GLU B 1 87  ? 11.431 44.045 -35.293 1.00 57.02  ? 1280 GLU B OE1 1 
ATOM   1866 O OE2 . GLU B 1 87  ? 13.342 43.155 -34.719 1.00 64.37  ? 1280 GLU B OE2 1 
ATOM   1867 N N   . GLY B 1 88  ? 14.379 45.355 -29.684 1.00 48.44  ? 1281 GLY B N   1 
ATOM   1868 C CA  . GLY B 1 88  ? 14.922 44.658 -28.533 1.00 36.00  ? 1281 GLY B CA  1 
ATOM   1869 C C   . GLY B 1 88  ? 15.960 45.414 -27.748 1.00 30.91  ? 1281 GLY B C   1 
ATOM   1870 O O   . GLY B 1 88  ? 16.739 44.806 -27.024 1.00 44.14  ? 1281 GLY B O   1 
ATOM   1871 N N   . ILE B 1 89  ? 15.981 46.735 -27.878 1.00 33.55  ? 1282 ILE B N   1 
ATOM   1872 C CA  . ILE B 1 89  ? 16.955 47.530 -27.144 1.00 31.27  ? 1282 ILE B CA  1 
ATOM   1873 C C   . ILE B 1 89  ? 16.900 47.183 -25.658 1.00 38.92  ? 1282 ILE B C   1 
ATOM   1874 O O   . ILE B 1 89  ? 15.809 47.050 -25.091 1.00 28.96  ? 1282 ILE B O   1 
ATOM   1875 C CB  . ILE B 1 89  ? 16.747 49.035 -27.349 1.00 29.55  ? 1282 ILE B CB  1 
ATOM   1876 C CG1 . ILE B 1 89  ? 17.971 49.790 -26.832 1.00 26.79  ? 1282 ILE B CG1 1 
ATOM   1877 C CG2 . ILE B 1 89  ? 15.450 49.502 -26.697 1.00 13.93  ? 1282 ILE B CG2 1 
ATOM   1878 C CD1 . ILE B 1 89  ? 17.870 51.267 -26.953 1.00 43.67  ? 1282 ILE B CD1 1 
ATOM   1879 N N   . TYR B 1 90  ? 18.083 47.014 -25.060 1.00 42.56  ? 1283 TYR B N   1 
ATOM   1880 C CA  . TYR B 1 90  ? 18.259 46.584 -23.663 1.00 31.52  ? 1283 TYR B CA  1 
ATOM   1881 C C   . TYR B 1 90  ? 18.102 45.074 -23.430 1.00 36.20  ? 1283 TYR B C   1 
ATOM   1882 O O   . TYR B 1 90  ? 18.642 44.534 -22.475 1.00 42.80  ? 1283 TYR B O   1 
ATOM   1883 C CB  . TYR B 1 90  ? 17.337 47.357 -22.730 1.00 29.28  ? 1283 TYR B CB  1 
ATOM   1884 C CG  . TYR B 1 90  ? 17.723 48.799 -22.552 1.00 30.00  ? 1283 TYR B CG  1 
ATOM   1885 C CD1 . TYR B 1 90  ? 16.819 49.814 -22.823 1.00 29.07  ? 1283 TYR B CD1 1 
ATOM   1886 C CD2 . TYR B 1 90  ? 18.993 49.147 -22.114 1.00 33.54  ? 1283 TYR B CD2 1 
ATOM   1887 C CE1 . TYR B 1 90  ? 17.162 51.137 -22.656 1.00 29.04  ? 1283 TYR B CE1 1 
ATOM   1888 C CE2 . TYR B 1 90  ? 19.350 50.469 -21.944 1.00 32.89  ? 1283 TYR B CE2 1 
ATOM   1889 C CZ  . TYR B 1 90  ? 18.430 51.460 -22.218 1.00 31.11  ? 1283 TYR B CZ  1 
ATOM   1890 O OH  . TYR B 1 90  ? 18.780 52.776 -22.041 1.00 28.21  ? 1283 TYR B OH  1 
ATOM   1891 N N   . ARG B 1 91  ? 17.354 44.407 -24.299 1.00 35.06  ? 1284 ARG B N   1 
ATOM   1892 C CA  . ARG B 1 91  ? 17.161 42.966 -24.208 1.00 39.98  ? 1284 ARG B CA  1 
ATOM   1893 C C   . ARG B 1 91  ? 18.314 42.243 -24.896 1.00 48.31  ? 1284 ARG B C   1 
ATOM   1894 O O   . ARG B 1 91  ? 18.863 41.275 -24.371 1.00 49.70  ? 1284 ARG B O   1 
ATOM   1895 C CB  . ARG B 1 91  ? 15.838 42.578 -24.855 1.00 32.43  ? 1284 ARG B CB  1 
ATOM   1896 C CG  . ARG B 1 91  ? 15.547 41.102 -24.846 1.00 33.73  ? 1284 ARG B CG  1 
ATOM   1897 C CD  . ARG B 1 91  ? 14.221 40.837 -25.539 1.00 42.53  ? 1284 ARG B CD  1 
ATOM   1898 N NE  . ARG B 1 91  ? 14.309 41.083 -26.975 1.00 60.74  ? 1284 ARG B NE  1 
ATOM   1899 C CZ  . ARG B 1 91  ? 13.257 41.209 -27.778 1.00 77.64  ? 1284 ARG B CZ  1 
ATOM   1900 N NH1 . ARG B 1 91  ? 12.023 41.127 -27.280 1.00 48.08  ? 1284 ARG B NH1 1 
ATOM   1901 N NH2 . ARG B 1 91  ? 13.437 41.424 -29.079 1.00 68.10  ? 1284 ARG B NH2 1 
ATOM   1902 N N   . VAL B 1 92  ? 18.671 42.729 -26.079 1.00 45.05  ? 1285 VAL B N   1 
ATOM   1903 C CA  . VAL B 1 92  ? 19.811 42.216 -26.824 1.00 50.65  ? 1285 VAL B CA  1 
ATOM   1904 C C   . VAL B 1 92  ? 21.105 42.575 -26.107 1.00 51.75  ? 1285 VAL B C   1 
ATOM   1905 O O   . VAL B 1 92  ? 21.306 43.720 -25.715 1.00 47.95  ? 1285 VAL B O   1 
ATOM   1906 C CB  . VAL B 1 92  ? 19.846 42.797 -28.255 1.00 46.31  ? 1285 VAL B CB  1 
ATOM   1907 C CG1 . VAL B 1 92  ? 21.158 42.466 -28.930 1.00 42.78  ? 1285 VAL B CG1 1 
ATOM   1908 C CG2 . VAL B 1 92  ? 18.657 42.285 -29.077 1.00 31.65  ? 1285 VAL B CG2 1 
ATOM   1909 N N   . SER B 1 93  ? 21.979 41.592 -25.925 1.00 64.94  ? 1286 SER B N   1 
ATOM   1910 C CA  . SER B 1 93  ? 23.277 41.864 -25.326 1.00 72.62  ? 1286 SER B CA  1 
ATOM   1911 C C   . SER B 1 93  ? 24.266 42.316 -26.390 1.00 78.45  ? 1286 SER B C   1 
ATOM   1912 O O   . SER B 1 93  ? 24.207 41.872 -27.540 1.00 77.88  ? 1286 SER B O   1 
ATOM   1913 C CB  . SER B 1 93  ? 23.818 40.640 -24.602 1.00 67.61  ? 1286 SER B CB  1 
ATOM   1914 O OG  . SER B 1 93  ? 24.984 40.992 -23.887 1.00 88.73  ? 1286 SER B OG  1 
ATOM   1915 N N   . GLY B 1 94  ? 25.178 43.199 -26.004 1.00 68.30  ? 1287 GLY B N   1 
ATOM   1916 C CA  . GLY B 1 94  ? 26.114 43.766 -26.956 1.00 79.16  ? 1287 GLY B CA  1 
ATOM   1917 C C   . GLY B 1 94  ? 27.511 43.193 -26.843 1.00 68.87  ? 1287 GLY B C   1 
ATOM   1918 O O   . GLY B 1 94  ? 27.787 42.361 -25.983 1.00 60.08  ? 1287 GLY B O   1 
ATOM   1919 N N   . ASN B 1 95  ? 28.395 43.645 -27.722 1.00 68.16  ? 1288 ASN B N   1 
ATOM   1920 C CA  . ASN B 1 95  ? 29.787 43.224 -27.692 1.00 73.34  ? 1288 ASN B CA  1 
ATOM   1921 C C   . ASN B 1 95  ? 30.433 43.588 -26.358 1.00 65.29  ? 1288 ASN B C   1 
ATOM   1922 O O   . ASN B 1 95  ? 30.557 44.767 -26.022 1.00 62.48  ? 1288 ASN B O   1 
ATOM   1923 C CB  . ASN B 1 95  ? 30.552 43.866 -28.853 1.00 66.32  ? 1288 ASN B CB  1 
ATOM   1924 C CG  . ASN B 1 95  ? 31.909 43.241 -29.069 1.00 81.57  ? 1288 ASN B CG  1 
ATOM   1925 O OD1 . ASN B 1 95  ? 32.864 43.544 -28.356 1.00 77.62  ? 1288 ASN B OD1 1 
ATOM   1926 N ND2 . ASN B 1 95  ? 32.005 42.364 -30.064 1.00 102.36 ? 1288 ASN B ND2 1 
ATOM   1927 N N   . LYS B 1 96  ? 30.837 42.577 -25.597 1.00 64.14  ? 1289 LYS B N   1 
ATOM   1928 C CA  . LYS B 1 96  ? 31.432 42.811 -24.283 1.00 60.96  ? 1289 LYS B CA  1 
ATOM   1929 C C   . LYS B 1 96  ? 32.735 43.604 -24.389 1.00 60.34  ? 1289 LYS B C   1 
ATOM   1930 O O   . LYS B 1 96  ? 33.075 44.378 -23.493 1.00 53.44  ? 1289 LYS B O   1 
ATOM   1931 C CB  . LYS B 1 96  ? 31.657 41.490 -23.538 1.00 47.88  ? 1289 LYS B CB  1 
ATOM   1932 N N   . SER B 1 97  ? 33.461 43.413 -25.489 1.00 74.50  ? 1290 SER B N   1 
ATOM   1933 C CA  . SER B 1 97  ? 34.697 44.165 -25.735 1.00 72.05  ? 1290 SER B CA  1 
ATOM   1934 C C   . SER B 1 97  ? 34.399 45.645 -25.999 1.00 62.92  ? 1290 SER B C   1 
ATOM   1935 O O   . SER B 1 97  ? 35.084 46.532 -25.490 1.00 51.36  ? 1290 SER B O   1 
ATOM   1936 C CB  . SER B 1 97  ? 35.488 43.564 -26.905 1.00 54.29  ? 1290 SER B CB  1 
ATOM   1937 N N   . GLU B 1 98  ? 33.363 45.903 -26.790 1.00 65.14  ? 1291 GLU B N   1 
ATOM   1938 C CA  . GLU B 1 98  ? 32.983 47.271 -27.119 1.00 61.43  ? 1291 GLU B CA  1 
ATOM   1939 C C   . GLU B 1 98  ? 32.500 48.068 -25.902 1.00 63.57  ? 1291 GLU B C   1 
ATOM   1940 O O   . GLU B 1 98  ? 32.699 49.280 -25.827 1.00 51.16  ? 1291 GLU B O   1 
ATOM   1941 C CB  . GLU B 1 98  ? 31.942 47.278 -28.240 1.00 58.64  ? 1291 GLU B CB  1 
ATOM   1942 C CG  . GLU B 1 98  ? 32.530 46.903 -29.582 1.00 69.91  ? 1291 GLU B CG  1 
ATOM   1943 C CD  . GLU B 1 98  ? 33.766 47.725 -29.908 1.00 87.79  ? 1291 GLU B CD  1 
ATOM   1944 O OE1 . GLU B 1 98  ? 33.614 48.911 -30.276 1.00 95.89  ? 1291 GLU B OE1 1 
ATOM   1945 O OE2 . GLU B 1 98  ? 34.889 47.184 -29.795 1.00 81.28  ? 1291 GLU B OE2 1 
ATOM   1946 N N   . MET B 1 99  ? 31.871 47.394 -24.945 1.00 58.01  ? 1292 MET B N   1 
ATOM   1947 C CA  . MET B 1 99  ? 31.417 48.082 -23.742 1.00 45.55  ? 1292 MET B CA  1 
ATOM   1948 C C   . MET B 1 99  ? 32.598 48.410 -22.849 1.00 53.51  ? 1292 MET B C   1 
ATOM   1949 O O   . MET B 1 99  ? 32.737 49.544 -22.381 1.00 46.63  ? 1292 MET B O   1 
ATOM   1950 C CB  . MET B 1 99  ? 30.414 47.234 -22.968 1.00 45.84  ? 1292 MET B CB  1 
ATOM   1951 C CG  . MET B 1 99  ? 29.214 46.803 -23.763 1.00 47.93  ? 1292 MET B CG  1 
ATOM   1952 S SD  . MET B 1 99  ? 28.126 45.866 -22.705 1.00 50.71  ? 1292 MET B SD  1 
ATOM   1953 C CE  . MET B 1 99  ? 27.237 44.862 -23.898 1.00 62.96  ? 1292 MET B CE  1 
ATOM   1954 N N   . GLU B 1 100 ? 33.436 47.402 -22.601 0.50 47.78  ? 1293 GLU B N   1 
ATOM   1955 C CA  . GLU B 1 100 ? 34.630 47.578 -21.786 0.50 40.06  ? 1293 GLU B CA  1 
ATOM   1956 C C   . GLU B 1 100 ? 35.416 48.749 -22.357 0.50 47.65  ? 1293 GLU B C   1 
ATOM   1957 O O   . GLU B 1 100 ? 35.937 49.594 -21.624 0.50 37.50  ? 1293 GLU B O   1 
ATOM   1958 C CB  . GLU B 1 100 ? 35.473 46.303 -21.789 0.50 35.70  ? 1293 GLU B CB  1 
ATOM   1959 N N   . SER B 1 101 ? 35.470 48.796 -23.685 1.00 49.50  ? 1294 SER B N   1 
ATOM   1960 C CA  . SER B 1 101 ? 36.120 49.881 -24.401 1.00 45.15  ? 1294 SER B CA  1 
ATOM   1961 C C   . SER B 1 101 ? 35.473 51.227 -24.070 1.00 56.28  ? 1294 SER B C   1 
ATOM   1962 O O   . SER B 1 101 ? 36.157 52.151 -23.631 1.00 44.50  ? 1294 SER B O   1 
ATOM   1963 C CB  . SER B 1 101 ? 36.070 49.613 -25.909 1.00 59.59  ? 1294 SER B CB  1 
ATOM   1964 O OG  . SER B 1 101 ? 36.619 50.687 -26.663 1.00 68.21  ? 1294 SER B OG  1 
ATOM   1965 N N   . LEU B 1 102 ? 34.156 51.327 -24.279 1.00 59.45  ? 1295 LEU B N   1 
ATOM   1966 C CA  . LEU B 1 102 ? 33.406 52.558 -24.000 1.00 46.86  ? 1295 LEU B CA  1 
ATOM   1967 C C   . LEU B 1 102 ? 33.598 53.009 -22.555 1.00 48.32  ? 1295 LEU B C   1 
ATOM   1968 O O   . LEU B 1 102 ? 33.808 54.191 -22.281 1.00 43.68  ? 1295 LEU B O   1 
ATOM   1969 C CB  . LEU B 1 102 ? 31.915 52.371 -24.305 1.00 47.44  ? 1295 LEU B CB  1 
ATOM   1970 C CG  . LEU B 1 102 ? 30.931 53.479 -23.911 1.00 40.08  ? 1295 LEU B CG  1 
ATOM   1971 C CD1 . LEU B 1 102 ? 31.470 54.832 -24.290 1.00 53.51  ? 1295 LEU B CD1 1 
ATOM   1972 C CD2 . LEU B 1 102 ? 29.578 53.247 -24.568 1.00 44.86  ? 1295 LEU B CD2 1 
ATOM   1973 N N   . GLN B 1 103 ? 33.536 52.062 -21.628 1.00 47.37  ? 1296 GLN B N   1 
ATOM   1974 C CA  . GLN B 1 103 ? 33.778 52.393 -20.236 1.00 53.48  ? 1296 GLN B CA  1 
ATOM   1975 C C   . GLN B 1 103 ? 35.206 52.900 -20.018 1.00 58.84  ? 1296 GLN B C   1 
ATOM   1976 O O   . GLN B 1 103 ? 35.416 53.925 -19.360 1.00 46.62  ? 1296 GLN B O   1 
ATOM   1977 C CB  . GLN B 1 103 ? 33.459 51.199 -19.335 1.00 53.24  ? 1296 GLN B CB  1 
ATOM   1978 C CG  . GLN B 1 103 ? 32.073 51.276 -18.726 1.00 46.74  ? 1296 GLN B CG  1 
ATOM   1979 C CD  . GLN B 1 103 ? 31.555 49.932 -18.291 1.00 68.34  ? 1296 GLN B CD  1 
ATOM   1980 O OE1 . GLN B 1 103 ? 32.132 48.895 -18.622 1.00 78.43  ? 1296 GLN B OE1 1 
ATOM   1981 N NE2 . GLN B 1 103 ? 30.454 49.936 -17.550 1.00 62.26  ? 1296 GLN B NE2 1 
ATOM   1982 N N   . ARG B 1 104 ? 36.182 52.188 -20.579 1.00 53.59  ? 1297 ARG B N   1 
ATOM   1983 C CA  . ARG B 1 104 ? 37.577 52.586 -20.437 1.00 47.92  ? 1297 ARG B CA  1 
ATOM   1984 C C   . ARG B 1 104 ? 37.809 53.980 -21.007 1.00 48.19  ? 1297 ARG B C   1 
ATOM   1985 O O   . ARG B 1 104 ? 38.454 54.821 -20.385 1.00 41.90  ? 1297 ARG B O   1 
ATOM   1986 C CB  . ARG B 1 104 ? 38.502 51.590 -21.132 1.00 56.36  ? 1297 ARG B CB  1 
ATOM   1987 C CG  . ARG B 1 104 ? 38.916 50.397 -20.296 1.00 68.60  ? 1297 ARG B CG  1 
ATOM   1988 C CD  . ARG B 1 104 ? 40.318 49.959 -20.680 1.00 64.24  ? 1297 ARG B CD  1 
ATOM   1989 N NE  . ARG B 1 104 ? 40.599 48.578 -20.301 1.00 84.89  ? 1297 ARG B NE  1 
ATOM   1990 C CZ  . ARG B 1 104 ? 41.825 48.084 -20.148 1.00 99.71  ? 1297 ARG B CZ  1 
ATOM   1991 N NH1 . ARG B 1 104 ? 42.887 48.863 -20.330 1.00 78.72  ? 1297 ARG B NH1 1 
ATOM   1992 N NH2 . ARG B 1 104 ? 41.991 46.811 -19.804 1.00 95.34  ? 1297 ARG B NH2 1 
ATOM   1993 N N   . GLN B 1 105 ? 37.282 54.222 -22.200 1.00 51.62  ? 1298 GLN B N   1 
ATOM   1994 C CA  . GLN B 1 105 ? 37.474 55.506 -22.865 1.00 52.50  ? 1298 GLN B CA  1 
ATOM   1995 C C   . GLN B 1 105 ? 36.797 56.630 -22.111 1.00 57.23  ? 1298 GLN B C   1 
ATOM   1996 O O   . GLN B 1 105 ? 37.287 57.757 -22.099 1.00 63.21  ? 1298 GLN B O   1 
ATOM   1997 C CB  . GLN B 1 105 ? 36.931 55.479 -24.289 1.00 53.19  ? 1298 GLN B CB  1 
ATOM   1998 C CG  . GLN B 1 105 ? 37.528 54.420 -25.182 1.00 54.39  ? 1298 GLN B CG  1 
ATOM   1999 C CD  . GLN B 1 105 ? 37.336 54.765 -26.638 1.00 65.67  ? 1298 GLN B CD  1 
ATOM   2000 O OE1 . GLN B 1 105 ? 37.460 55.935 -27.024 1.00 39.44  ? 1298 GLN B OE1 1 
ATOM   2001 N NE2 . GLN B 1 105 ? 37.026 53.758 -27.459 1.00 62.15  ? 1298 GLN B NE2 1 
ATOM   2002 N N   . PHE B 1 106 ? 35.653 56.336 -21.501 1.00 61.76  ? 1299 PHE B N   1 
ATOM   2003 C CA  . PHE B 1 106 ? 34.973 57.335 -20.687 1.00 57.55  ? 1299 PHE B CA  1 
ATOM   2004 C C   . PHE B 1 106 ? 35.819 57.606 -19.447 1.00 59.49  ? 1299 PHE B C   1 
ATOM   2005 O O   . PHE B 1 106 ? 36.004 58.750 -19.029 1.00 56.76  ? 1299 PHE B O   1 
ATOM   2006 C CB  . PHE B 1 106 ? 33.561 56.877 -20.291 1.00 42.22  ? 1299 PHE B CB  1 
ATOM   2007 C CG  . PHE B 1 106 ? 32.844 57.856 -19.404 1.00 50.83  ? 1299 PHE B CG  1 
ATOM   2008 C CD1 . PHE B 1 106 ? 33.001 57.808 -18.021 1.00 52.54  ? 1299 PHE B CD1 1 
ATOM   2009 C CD2 . PHE B 1 106 ? 32.046 58.851 -19.947 1.00 50.05  ? 1299 PHE B CD2 1 
ATOM   2010 C CE1 . PHE B 1 106 ? 32.366 58.723 -17.192 1.00 48.60  ? 1299 PHE B CE1 1 
ATOM   2011 C CE2 . PHE B 1 106 ? 31.401 59.776 -19.127 1.00 55.49  ? 1299 PHE B CE2 1 
ATOM   2012 C CZ  . PHE B 1 106 ? 31.560 59.709 -17.746 1.00 61.16  ? 1299 PHE B CZ  1 
ATOM   2013 N N   . ASP B 1 107 ? 36.341 56.533 -18.869 1.00 56.80  ? 1300 ASP B N   1 
ATOM   2014 C CA  . ASP B 1 107 ? 37.180 56.630 -17.690 1.00 60.42  ? 1300 ASP B CA  1 
ATOM   2015 C C   . ASP B 1 107 ? 38.326 57.622 -17.925 1.00 71.49  ? 1300 ASP B C   1 
ATOM   2016 O O   . ASP B 1 107 ? 38.717 58.355 -17.015 1.00 70.38  ? 1300 ASP B O   1 
ATOM   2017 C CB  . ASP B 1 107 ? 37.723 55.244 -17.336 1.00 59.46  ? 1300 ASP B CB  1 
ATOM   2018 C CG  . ASP B 1 107 ? 37.836 55.026 -15.848 1.00 63.65  ? 1300 ASP B CG  1 
ATOM   2019 O OD1 . ASP B 1 107 ? 37.482 55.951 -15.085 1.00 64.81  ? 1300 ASP B OD1 1 
ATOM   2020 O OD2 . ASP B 1 107 ? 38.276 53.928 -15.446 1.00 68.09  ? 1300 ASP B OD2 1 
ATOM   2021 N N   . GLN B 1 108 ? 38.854 57.648 -19.149 1.00 74.42  ? 1301 GLN B N   1 
ATOM   2022 C CA  . GLN B 1 108 ? 39.980 58.521 -19.485 1.00 69.09  ? 1301 GLN B CA  1 
ATOM   2023 C C   . GLN B 1 108 ? 39.572 59.989 -19.491 1.00 66.76  ? 1301 GLN B C   1 
ATOM   2024 O O   . GLN B 1 108 ? 40.180 60.807 -18.804 1.00 68.88  ? 1301 GLN B O   1 
ATOM   2025 C CB  . GLN B 1 108 ? 40.628 58.115 -20.814 1.00 62.05  ? 1301 GLN B CB  1 
ATOM   2026 C CG  . GLN B 1 108 ? 41.339 56.764 -20.754 1.00 72.16  ? 1301 GLN B CG  1 
ATOM   2027 C CD  . GLN B 1 108 ? 42.138 56.464 -22.011 1.00 90.08  ? 1301 GLN B CD  1 
ATOM   2028 O OE1 . GLN B 1 108 ? 42.769 57.353 -22.588 1.00 76.89  ? 1301 GLN B OE1 1 
ATOM   2029 N NE2 . GLN B 1 108 ? 42.115 55.203 -22.443 1.00 79.69  ? 1301 GLN B NE2 1 
ATOM   2030 N N   . ASP B 1 109 ? 38.547 60.329 -20.264 1.00 68.81  ? 1302 ASP B N   1 
ATOM   2031 C CA  . ASP B 1 109 ? 37.947 61.662 -20.145 1.00 84.62  ? 1302 ASP B CA  1 
ATOM   2032 C C   . ASP B 1 109 ? 36.403 61.659 -20.170 1.00 70.31  ? 1302 ASP B C   1 
ATOM   2033 O O   . ASP B 1 109 ? 35.763 60.999 -20.988 1.00 54.79  ? 1302 ASP B O   1 
ATOM   2034 C CB  . ASP B 1 109 ? 38.566 62.670 -21.129 1.00 81.57  ? 1302 ASP B CB  1 
ATOM   2035 C CG  . ASP B 1 109 ? 37.697 62.927 -22.349 1.00 77.05  ? 1302 ASP B CG  1 
ATOM   2036 O OD1 . ASP B 1 109 ? 37.702 62.091 -23.286 1.00 60.86  ? 1302 ASP B OD1 1 
ATOM   2037 O OD2 . ASP B 1 109 ? 37.037 63.992 -22.378 1.00 60.60  ? 1302 ASP B OD2 1 
ATOM   2038 N N   . HIS B 1 110 ? 35.822 62.402 -19.237 1.00 70.46  ? 1303 HIS B N   1 
ATOM   2039 C CA  . HIS B 1 110 ? 34.393 62.340 -18.974 1.00 66.98  ? 1303 HIS B CA  1 
ATOM   2040 C C   . HIS B 1 110 ? 33.566 63.143 -19.973 1.00 72.00  ? 1303 HIS B C   1 
ATOM   2041 O O   . HIS B 1 110 ? 32.339 63.125 -19.925 1.00 72.03  ? 1303 HIS B O   1 
ATOM   2042 C CB  . HIS B 1 110 ? 34.115 62.819 -17.548 1.00 58.05  ? 1303 HIS B CB  1 
ATOM   2043 C CG  . HIS B 1 110 ? 34.651 61.903 -16.493 1.00 62.38  ? 1303 HIS B CG  1 
ATOM   2044 N ND1 . HIS B 1 110 ? 35.449 60.818 -16.785 1.00 69.75  ? 1303 HIS B ND1 1 
ATOM   2045 C CD2 . HIS B 1 110 ? 34.524 61.925 -15.145 1.00 55.65  ? 1303 HIS B CD2 1 
ATOM   2046 C CE1 . HIS B 1 110 ? 35.780 60.201 -15.664 1.00 72.29  ? 1303 HIS B CE1 1 
ATOM   2047 N NE2 . HIS B 1 110 ? 35.233 60.853 -14.654 1.00 77.11  ? 1303 HIS B NE2 1 
ATOM   2048 N N   . ASN B 1 111 ? 34.238 63.855 -20.869 1.00 76.71  ? 1304 ASN B N   1 
ATOM   2049 C CA  . ASN B 1 111 ? 33.545 64.641 -21.885 1.00 78.09  ? 1304 ASN B CA  1 
ATOM   2050 C C   . ASN B 1 111 ? 33.386 63.840 -23.164 1.00 71.00  ? 1304 ASN B C   1 
ATOM   2051 O O   . ASN B 1 111 ? 33.030 64.380 -24.207 1.00 73.38  ? 1304 ASN B O   1 
ATOM   2052 C CB  . ASN B 1 111 ? 34.285 65.954 -22.164 1.00 84.67  ? 1304 ASN B CB  1 
ATOM   2053 C CG  . ASN B 1 111 ? 33.920 67.050 -21.177 1.00 100.80 ? 1304 ASN B CG  1 
ATOM   2054 O OD1 . ASN B 1 111 ? 34.765 67.533 -20.420 1.00 87.30  ? 1304 ASN B OD1 1 
ATOM   2055 N ND2 . ASN B 1 111 ? 32.650 67.442 -21.174 1.00 93.08  ? 1304 ASN B ND2 1 
ATOM   2056 N N   . LEU B 1 112 ? 33.657 62.543 -23.068 1.00 68.76  ? 1305 LEU B N   1 
ATOM   2057 C CA  . LEU B 1 112 ? 33.560 61.648 -24.212 1.00 65.25  ? 1305 LEU B CA  1 
ATOM   2058 C C   . LEU B 1 112 ? 32.270 61.902 -24.971 1.00 68.27  ? 1305 LEU B C   1 
ATOM   2059 O O   . LEU B 1 112 ? 31.210 62.045 -24.366 1.00 76.47  ? 1305 LEU B O   1 
ATOM   2060 C CB  . LEU B 1 112 ? 33.601 60.193 -23.748 1.00 52.89  ? 1305 LEU B CB  1 
ATOM   2061 C CG  . LEU B 1 112 ? 33.567 59.164 -24.869 1.00 62.83  ? 1305 LEU B CG  1 
ATOM   2062 C CD1 . LEU B 1 112 ? 34.903 59.118 -25.602 1.00 83.94  ? 1305 LEU B CD1 1 
ATOM   2063 C CD2 . LEU B 1 112 ? 33.221 57.810 -24.300 1.00 56.77  ? 1305 LEU B CD2 1 
ATOM   2064 N N   . ASP B 1 113 ? 32.359 61.964 -26.294 1.00 59.02  ? 1306 ASP B N   1 
ATOM   2065 C CA  . ASP B 1 113 ? 31.170 62.160 -27.114 1.00 70.50  ? 1306 ASP B CA  1 
ATOM   2066 C C   . ASP B 1 113 ? 30.851 60.897 -27.907 1.00 79.45  ? 1306 ASP B C   1 
ATOM   2067 O O   . ASP B 1 113 ? 31.580 60.528 -28.830 1.00 80.65  ? 1306 ASP B O   1 
ATOM   2068 C CB  . ASP B 1 113 ? 31.348 63.352 -28.055 1.00 79.04  ? 1306 ASP B CB  1 
ATOM   2069 C CG  . ASP B 1 113 ? 30.020 63.933 -28.516 1.00 92.34  ? 1306 ASP B CG  1 
ATOM   2070 O OD1 . ASP B 1 113 ? 29.213 63.186 -29.111 1.00 93.81  ? 1306 ASP B OD1 1 
ATOM   2071 O OD2 . ASP B 1 113 ? 29.782 65.140 -28.281 1.00 89.95  ? 1306 ASP B OD2 1 
ATOM   2072 N N   . LEU B 1 114 ? 29.755 60.239 -27.546 1.00 67.91  ? 1307 LEU B N   1 
ATOM   2073 C CA  . LEU B 1 114 ? 29.405 58.960 -28.157 1.00 73.78  ? 1307 LEU B CA  1 
ATOM   2074 C C   . LEU B 1 114 ? 29.075 59.111 -29.631 1.00 68.25  ? 1307 LEU B C   1 
ATOM   2075 O O   . LEU B 1 114 ? 29.148 58.146 -30.394 1.00 64.04  ? 1307 LEU B O   1 
ATOM   2076 C CB  . LEU B 1 114 ? 28.233 58.317 -27.425 1.00 61.97  ? 1307 LEU B CB  1 
ATOM   2077 C CG  . LEU B 1 114 ? 28.430 58.224 -25.921 1.00 43.84  ? 1307 LEU B CG  1 
ATOM   2078 C CD1 . LEU B 1 114 ? 27.297 57.437 -25.327 1.00 51.75  ? 1307 LEU B CD1 1 
ATOM   2079 C CD2 . LEU B 1 114 ? 29.764 57.572 -25.623 1.00 51.03  ? 1307 LEU B CD2 1 
ATOM   2080 N N   . ALA B 1 115 ? 28.695 60.325 -30.016 1.00 83.05  ? 1308 ALA B N   1 
ATOM   2081 C CA  . ALA B 1 115 ? 28.437 60.645 -31.414 1.00 87.87  ? 1308 ALA B CA  1 
ATOM   2082 C C   . ALA B 1 115 ? 29.718 60.488 -32.224 1.00 82.62  ? 1308 ALA B C   1 
ATOM   2083 O O   . ALA B 1 115 ? 29.753 59.781 -33.232 1.00 78.34  ? 1308 ALA B O   1 
ATOM   2084 C CB  . ALA B 1 115 ? 27.898 62.064 -31.541 1.00 65.32  ? 1308 ALA B CB  1 
ATOM   2085 N N   . GLU B 1 116 ? 30.777 61.139 -31.759 1.00 73.90  ? 1309 GLU B N   1 
ATOM   2086 C CA  . GLU B 1 116 ? 32.051 61.136 -32.467 1.00 86.60  ? 1309 GLU B CA  1 
ATOM   2087 C C   . GLU B 1 116 ? 32.821 59.813 -32.346 1.00 82.47  ? 1309 GLU B C   1 
ATOM   2088 O O   . GLU B 1 116 ? 33.985 59.738 -32.742 1.00 77.28  ? 1309 GLU B O   1 
ATOM   2089 C CB  . GLU B 1 116 ? 32.927 62.298 -31.977 1.00 67.00  ? 1309 GLU B CB  1 
ATOM   2090 N N   . LYS B 1 117 ? 32.186 58.771 -31.816 1.00 73.27  ? 1310 LYS B N   1 
ATOM   2091 C CA  . LYS B 1 117 ? 32.913 57.532 -31.540 1.00 67.62  ? 1310 LYS B CA  1 
ATOM   2092 C C   . LYS B 1 117 ? 32.308 56.275 -32.174 1.00 72.77  ? 1310 LYS B C   1 
ATOM   2093 O O   . LYS B 1 117 ? 32.843 55.179 -32.002 1.00 73.89  ? 1310 LYS B O   1 
ATOM   2094 C CB  . LYS B 1 117 ? 33.114 57.345 -30.030 1.00 43.32  ? 1310 LYS B CB  1 
ATOM   2095 N N   . ASP B 1 118 ? 31.206 56.436 -32.908 1.00 68.40  ? 1311 ASP B N   1 
ATOM   2096 C CA  . ASP B 1 118 ? 30.616 55.332 -33.684 1.00 90.41  ? 1311 ASP B CA  1 
ATOM   2097 C C   . ASP B 1 118 ? 30.377 54.030 -32.898 1.00 79.71  ? 1311 ASP B C   1 
ATOM   2098 O O   . ASP B 1 118 ? 30.753 52.948 -33.347 1.00 65.76  ? 1311 ASP B O   1 
ATOM   2099 C CB  . ASP B 1 118 ? 31.464 55.034 -34.934 1.00 60.10  ? 1311 ASP B CB  1 
ATOM   2100 N N   . PHE B 1 119 ? 29.745 54.134 -31.733 1.00 70.45  ? 1312 PHE B N   1 
ATOM   2101 C CA  . PHE B 1 119 ? 29.416 52.955 -30.941 1.00 52.12  ? 1312 PHE B CA  1 
ATOM   2102 C C   . PHE B 1 119 ? 28.024 52.455 -31.294 1.00 57.63  ? 1312 PHE B C   1 
ATOM   2103 O O   . PHE B 1 119 ? 27.103 53.248 -31.488 1.00 65.62  ? 1312 PHE B O   1 
ATOM   2104 C CB  . PHE B 1 119 ? 29.437 53.290 -29.454 1.00 62.29  ? 1312 PHE B CB  1 
ATOM   2105 C CG  . PHE B 1 119 ? 30.802 53.226 -28.820 1.00 56.76  ? 1312 PHE B CG  1 
ATOM   2106 C CD1 . PHE B 1 119 ? 31.349 54.349 -28.210 1.00 48.81  ? 1312 PHE B CD1 1 
ATOM   2107 C CD2 . PHE B 1 119 ? 31.521 52.044 -28.808 1.00 44.60  ? 1312 PHE B CD2 1 
ATOM   2108 C CE1 . PHE B 1 119 ? 32.589 54.297 -27.609 1.00 40.92  ? 1312 PHE B CE1 1 
ATOM   2109 C CE2 . PHE B 1 119 ? 32.763 51.985 -28.211 1.00 38.72  ? 1312 PHE B CE2 1 
ATOM   2110 C CZ  . PHE B 1 119 ? 33.299 53.111 -27.609 1.00 41.63  ? 1312 PHE B CZ  1 
ATOM   2111 N N   . THR B 1 120 ? 27.868 51.139 -31.366 1.00 57.62  ? 1313 THR B N   1 
ATOM   2112 C CA  . THR B 1 120 ? 26.558 50.543 -31.585 1.00 49.80  ? 1313 THR B CA  1 
ATOM   2113 C C   . THR B 1 120 ? 25.605 51.056 -30.511 1.00 58.83  ? 1313 THR B C   1 
ATOM   2114 O O   . THR B 1 120 ? 26.025 51.350 -29.389 1.00 51.70  ? 1313 THR B O   1 
ATOM   2115 C CB  . THR B 1 120 ? 26.628 49.018 -31.473 1.00 53.05  ? 1313 THR B CB  1 
ATOM   2116 O OG1 . THR B 1 120 ? 27.846 48.552 -32.054 1.00 87.85  ? 1313 THR B OG1 1 
ATOM   2117 C CG2 . THR B 1 120 ? 25.452 48.362 -32.178 1.00 70.24  ? 1313 THR B CG2 1 
ATOM   2118 N N   . VAL B 1 121 ? 24.325 51.163 -30.846 1.00 52.93  ? 1314 VAL B N   1 
ATOM   2119 C CA  . VAL B 1 121 ? 23.332 51.561 -29.859 1.00 46.11  ? 1314 VAL B CA  1 
ATOM   2120 C C   . VAL B 1 121 ? 23.247 50.522 -28.737 1.00 47.90  ? 1314 VAL B C   1 
ATOM   2121 O O   . VAL B 1 121 ? 23.182 50.871 -27.555 1.00 48.03  ? 1314 VAL B O   1 
ATOM   2122 C CB  . VAL B 1 121 ? 21.947 51.806 -30.502 1.00 48.26  ? 1314 VAL B CB  1 
ATOM   2123 C CG1 . VAL B 1 121 ? 21.435 50.545 -31.165 1.00 66.08  ? 1314 VAL B CG1 1 
ATOM   2124 C CG2 . VAL B 1 121 ? 20.954 52.319 -29.466 1.00 62.34  ? 1314 VAL B CG2 1 
ATOM   2125 N N   . ASN B 1 122 ? 23.265 49.246 -29.114 1.00 48.69  ? 1315 ASN B N   1 
ATOM   2126 C CA  . ASN B 1 122 ? 23.282 48.151 -28.147 1.00 46.13  ? 1315 ASN B CA  1 
ATOM   2127 C C   . ASN B 1 122 ? 24.502 48.181 -27.233 1.00 41.18  ? 1315 ASN B C   1 
ATOM   2128 O O   . ASN B 1 122 ? 24.449 47.771 -26.077 1.00 40.96  ? 1315 ASN B O   1 
ATOM   2129 C CB  . ASN B 1 122 ? 23.210 46.802 -28.870 1.00 37.01  ? 1315 ASN B CB  1 
ATOM   2130 C CG  . ASN B 1 122 ? 21.793 46.401 -29.208 1.00 59.29  ? 1315 ASN B CG  1 
ATOM   2131 O OD1 . ASN B 1 122 ? 20.871 46.583 -28.407 1.00 74.36  ? 1315 ASN B OD1 1 
ATOM   2132 N ND2 . ASN B 1 122 ? 21.607 45.847 -30.393 1.00 41.96  ? 1315 ASN B ND2 1 
ATOM   2133 N N   . THR B 1 123 ? 25.615 48.657 -27.763 1.00 47.39  ? 1316 THR B N   1 
ATOM   2134 C CA  . THR B 1 123 ? 26.827 48.737 -26.977 1.00 44.04  ? 1316 THR B CA  1 
ATOM   2135 C C   . THR B 1 123 ? 26.670 49.793 -25.895 1.00 44.40  ? 1316 THR B C   1 
ATOM   2136 O O   . THR B 1 123 ? 27.090 49.587 -24.755 1.00 47.97  ? 1316 THR B O   1 
ATOM   2137 C CB  . THR B 1 123 ? 28.042 49.037 -27.862 1.00 39.17  ? 1316 THR B CB  1 
ATOM   2138 O OG1 . THR B 1 123 ? 28.288 47.907 -28.704 1.00 51.76  ? 1316 THR B OG1 1 
ATOM   2139 C CG2 . THR B 1 123 ? 29.275 49.319 -27.008 1.00 25.24  ? 1316 THR B CG2 1 
ATOM   2140 N N   . VAL B 1 124 ? 26.053 50.918 -26.249 1.00 44.01  ? 1317 VAL B N   1 
ATOM   2141 C CA  . VAL B 1 124 ? 25.830 51.989 -25.283 1.00 39.43  ? 1317 VAL B CA  1 
ATOM   2142 C C   . VAL B 1 124 ? 24.747 51.601 -24.283 1.00 37.08  ? 1317 VAL B C   1 
ATOM   2143 O O   . VAL B 1 124 ? 24.808 51.969 -23.110 1.00 42.51  ? 1317 VAL B O   1 
ATOM   2144 C CB  . VAL B 1 124 ? 25.444 53.305 -25.961 1.00 39.12  ? 1317 VAL B CB  1 
ATOM   2145 C CG1 . VAL B 1 124 ? 25.161 54.373 -24.913 1.00 34.42  ? 1317 VAL B CG1 1 
ATOM   2146 C CG2 . VAL B 1 124 ? 26.547 53.754 -26.906 1.00 38.53  ? 1317 VAL B CG2 1 
ATOM   2147 N N   . ALA B 1 125 ? 23.759 50.851 -24.749 1.00 40.73  ? 1318 ALA B N   1 
ATOM   2148 C CA  . ALA B 1 125 ? 22.702 50.371 -23.870 1.00 39.71  ? 1318 ALA B CA  1 
ATOM   2149 C C   . ALA B 1 125 ? 23.263 49.399 -22.838 1.00 39.23  ? 1318 ALA B C   1 
ATOM   2150 O O   . ALA B 1 125 ? 22.999 49.528 -21.642 1.00 43.10  ? 1318 ALA B O   1 
ATOM   2151 C CB  . ALA B 1 125 ? 21.589 49.723 -24.673 1.00 32.56  ? 1318 ALA B CB  1 
ATOM   2152 N N   . GLY B 1 126 ? 24.045 48.432 -23.309 1.00 40.94  ? 1319 GLY B N   1 
ATOM   2153 C CA  . GLY B 1 126 ? 24.676 47.455 -22.439 1.00 39.67  ? 1319 GLY B CA  1 
ATOM   2154 C C   . GLY B 1 126 ? 25.702 48.068 -21.500 1.00 38.78  ? 1319 GLY B C   1 
ATOM   2155 O O   . GLY B 1 126 ? 25.865 47.627 -20.370 1.00 47.97  ? 1319 GLY B O   1 
ATOM   2156 N N   . ALA B 1 127 ? 26.403 49.091 -21.965 1.00 38.04  ? 1320 ALA B N   1 
ATOM   2157 C CA  . ALA B 1 127 ? 27.370 49.780 -21.123 1.00 48.15  ? 1320 ALA B CA  1 
ATOM   2158 C C   . ALA B 1 127 ? 26.677 50.608 -20.031 1.00 49.50  ? 1320 ALA B C   1 
ATOM   2159 O O   . ALA B 1 127 ? 27.240 50.851 -18.960 1.00 49.13  ? 1320 ALA B O   1 
ATOM   2160 C CB  . ALA B 1 127 ? 28.280 50.664 -21.973 1.00 43.90  ? 1320 ALA B CB  1 
ATOM   2161 N N   . MET B 1 128 ? 25.458 51.051 -20.315 1.00 41.27  ? 1321 MET B N   1 
ATOM   2162 C CA  . MET B 1 128 ? 24.676 51.793 -19.340 1.00 41.99  ? 1321 MET B CA  1 
ATOM   2163 C C   . MET B 1 128 ? 24.192 50.841 -18.222 1.00 45.39  ? 1321 MET B C   1 
ATOM   2164 O O   . MET B 1 128 ? 24.302 51.150 -17.031 1.00 35.74  ? 1321 MET B O   1 
ATOM   2165 C CB  . MET B 1 128 ? 23.521 52.522 -20.050 1.00 29.55  ? 1321 MET B CB  1 
ATOM   2166 C CG  . MET B 1 128 ? 22.673 53.423 -19.164 1.00 28.22  ? 1321 MET B CG  1 
ATOM   2167 S SD  . MET B 1 128 ? 21.301 52.522 -18.452 1.00 32.35  ? 1321 MET B SD  1 
ATOM   2168 C CE  . MET B 1 128 ? 20.555 53.775 -17.430 1.00 65.80  ? 1321 MET B CE  1 
ATOM   2169 N N   . LYS B 1 129 ? 23.685 49.673 -18.606 1.00 38.53  ? 1322 LYS B N   1 
ATOM   2170 C CA  . LYS B 1 129 ? 23.316 48.665 -17.630 1.00 31.12  ? 1322 LYS B CA  1 
ATOM   2171 C C   . LYS B 1 129 ? 24.541 48.257 -16.807 1.00 42.44  ? 1322 LYS B C   1 
ATOM   2172 O O   . LYS B 1 129 ? 24.485 48.150 -15.581 1.00 39.91  ? 1322 LYS B O   1 
ATOM   2173 C CB  . LYS B 1 129 ? 22.713 47.443 -18.321 1.00 26.82  ? 1322 LYS B CB  1 
ATOM   2174 C CG  . LYS B 1 129 ? 21.204 47.524 -18.515 1.00 40.22  ? 1322 LYS B CG  1 
ATOM   2175 C CD  . LYS B 1 129 ? 20.533 46.156 -18.389 1.00 34.23  ? 1322 LYS B CD  1 
ATOM   2176 C CE  . LYS B 1 129 ? 20.772 45.293 -19.604 1.00 42.81  ? 1322 LYS B CE  1 
ATOM   2177 N NZ  . LYS B 1 129 ? 20.351 43.890 -19.347 1.00 38.51  ? 1322 LYS B NZ  1 
ATOM   2178 N N   . SER B 1 130 ? 25.656 48.046 -17.490 1.00 45.02  ? 1323 SER B N   1 
ATOM   2179 C CA  . SER B 1 130 ? 26.876 47.589 -16.840 1.00 41.32  ? 1323 SER B CA  1 
ATOM   2180 C C   . SER B 1 130 ? 27.276 48.474 -15.664 1.00 38.76  ? 1323 SER B C   1 
ATOM   2181 O O   . SER B 1 130 ? 27.748 47.980 -14.647 1.00 35.80  ? 1323 SER B O   1 
ATOM   2182 C CB  . SER B 1 130 ? 28.018 47.518 -17.850 1.00 37.12  ? 1323 SER B CB  1 
ATOM   2183 O OG  . SER B 1 130 ? 29.147 46.900 -17.268 1.00 56.36  ? 1323 SER B OG  1 
ATOM   2184 N N   . PHE B 1 131 ? 27.089 49.780 -15.801 1.00 37.85  ? 1324 PHE B N   1 
ATOM   2185 C CA  . PHE B 1 131 ? 27.438 50.691 -14.721 1.00 35.03  ? 1324 PHE B CA  1 
ATOM   2186 C C   . PHE B 1 131 ? 26.682 50.330 -13.452 1.00 44.11  ? 1324 PHE B C   1 
ATOM   2187 O O   . PHE B 1 131 ? 27.222 50.424 -12.343 1.00 40.91  ? 1324 PHE B O   1 
ATOM   2188 C CB  . PHE B 1 131 ? 27.112 52.131 -15.093 1.00 33.47  ? 1324 PHE B CB  1 
ATOM   2189 C CG  . PHE B 1 131 ? 27.164 53.076 -13.931 1.00 32.17  ? 1324 PHE B CG  1 
ATOM   2190 C CD1 . PHE B 1 131 ? 28.355 53.673 -13.565 1.00 29.24  ? 1324 PHE B CD1 1 
ATOM   2191 C CD2 . PHE B 1 131 ? 26.026 53.361 -13.201 1.00 25.09  ? 1324 PHE B CD2 1 
ATOM   2192 C CE1 . PHE B 1 131 ? 28.410 54.540 -12.492 1.00 38.03  ? 1324 PHE B CE1 1 
ATOM   2193 C CE2 . PHE B 1 131 ? 26.074 54.230 -12.138 1.00 34.75  ? 1324 PHE B CE2 1 
ATOM   2194 C CZ  . PHE B 1 131 ? 27.272 54.824 -11.778 1.00 37.17  ? 1324 PHE B CZ  1 
ATOM   2195 N N   . PHE B 1 132 ? 25.425 49.927 -13.619 1.00 42.45  ? 1325 PHE B N   1 
ATOM   2196 C CA  . PHE B 1 132 ? 24.576 49.617 -12.479 1.00 37.85  ? 1325 PHE B CA  1 
ATOM   2197 C C   . PHE B 1 132 ? 24.877 48.259 -11.860 1.00 39.60  ? 1325 PHE B C   1 
ATOM   2198 O O   . PHE B 1 132 ? 24.797 48.103 -10.648 1.00 44.50  ? 1325 PHE B O   1 
ATOM   2199 C CB  . PHE B 1 132 ? 23.103 49.730 -12.853 1.00 31.85  ? 1325 PHE B CB  1 
ATOM   2200 C CG  . PHE B 1 132 ? 22.629 51.145 -12.980 1.00 31.17  ? 1325 PHE B CG  1 
ATOM   2201 C CD1 . PHE B 1 132 ? 22.640 51.987 -11.886 1.00 29.40  ? 1325 PHE B CD1 1 
ATOM   2202 C CD2 . PHE B 1 132 ? 22.171 51.633 -14.191 1.00 36.19  ? 1325 PHE B CD2 1 
ATOM   2203 C CE1 . PHE B 1 132 ? 22.210 53.295 -11.998 1.00 38.42  ? 1325 PHE B CE1 1 
ATOM   2204 C CE2 . PHE B 1 132 ? 21.737 52.939 -14.314 1.00 31.32  ? 1325 PHE B CE2 1 
ATOM   2205 C CZ  . PHE B 1 132 ? 21.758 53.774 -13.220 1.00 42.44  ? 1325 PHE B CZ  1 
ATOM   2206 N N   . SER B 1 133 ? 25.229 47.282 -12.686 1.00 42.08  ? 1326 SER B N   1 
ATOM   2207 C CA  . SER B 1 133 ? 25.602 45.971 -12.168 1.00 39.51  ? 1326 SER B CA  1 
ATOM   2208 C C   . SER B 1 133 ? 27.013 45.984 -11.600 1.00 34.05  ? 1326 SER B C   1 
ATOM   2209 O O   . SER B 1 133 ? 27.417 45.040 -10.937 1.00 42.38  ? 1326 SER B O   1 
ATOM   2210 C CB  . SER B 1 133 ? 25.448 44.872 -13.231 1.00 34.57  ? 1326 SER B CB  1 
ATOM   2211 O OG  . SER B 1 133 ? 25.886 45.308 -14.507 1.00 53.87  ? 1326 SER B OG  1 
ATOM   2212 N N   . GLU B 1 134 ? 27.757 47.056 -11.851 1.00 36.26  ? 1327 GLU B N   1 
ATOM   2213 C CA  . GLU B 1 134 ? 29.108 47.183 -11.308 1.00 41.40  ? 1327 GLU B CA  1 
ATOM   2214 C C   . GLU B 1 134 ? 29.135 47.929 -9.977  1.00 45.66  ? 1327 GLU B C   1 
ATOM   2215 O O   . GLU B 1 134 ? 30.130 47.868 -9.245  1.00 48.38  ? 1327 GLU B O   1 
ATOM   2216 C CB  . GLU B 1 134 ? 30.047 47.861 -12.311 1.00 39.82  ? 1327 GLU B CB  1 
ATOM   2217 C CG  . GLU B 1 134 ? 30.550 46.945 -13.419 1.00 49.47  ? 1327 GLU B CG  1 
ATOM   2218 C CD  . GLU B 1 134 ? 31.086 47.720 -14.627 1.00 68.31  ? 1327 GLU B CD  1 
ATOM   2219 O OE1 . GLU B 1 134 ? 31.070 48.973 -14.599 1.00 59.80  ? 1327 GLU B OE1 1 
ATOM   2220 O OE2 . GLU B 1 134 ? 31.523 47.074 -15.608 1.00 67.65  ? 1327 GLU B OE2 1 
ATOM   2221 N N   . LEU B 1 135 ? 28.051 48.641 -9.670  1.00 48.89  ? 1328 LEU B N   1 
ATOM   2222 C CA  . LEU B 1 135 ? 27.954 49.365 -8.407  1.00 40.06  ? 1328 LEU B CA  1 
ATOM   2223 C C   . LEU B 1 135 ? 28.081 48.356 -7.291  1.00 45.08  ? 1328 LEU B C   1 
ATOM   2224 O O   . LEU B 1 135 ? 27.501 47.270 -7.375  1.00 45.06  ? 1328 LEU B O   1 
ATOM   2225 C CB  . LEU B 1 135 ? 26.611 50.081 -8.277  1.00 42.58  ? 1328 LEU B CB  1 
ATOM   2226 C CG  . LEU B 1 135 ? 26.374 51.392 -9.022  1.00 35.78  ? 1328 LEU B CG  1 
ATOM   2227 C CD1 . LEU B 1 135 ? 24.948 51.866 -8.793  1.00 31.28  ? 1328 LEU B CD1 1 
ATOM   2228 C CD2 . LEU B 1 135 ? 27.356 52.437 -8.556  1.00 34.96  ? 1328 LEU B CD2 1 
ATOM   2229 N N   . PRO B 1 136 ? 28.859 48.702 -6.253  1.00 49.15  ? 1329 PRO B N   1 
ATOM   2230 C CA  . PRO B 1 136 ? 29.044 47.890 -5.044  1.00 38.54  ? 1329 PRO B CA  1 
ATOM   2231 C C   . PRO B 1 136 ? 27.701 47.468 -4.451  1.00 41.62  ? 1329 PRO B C   1 
ATOM   2232 O O   . PRO B 1 136 ? 27.543 46.306 -4.078  1.00 42.45  ? 1329 PRO B O   1 
ATOM   2233 C CB  . PRO B 1 136 ? 29.768 48.844 -4.094  1.00 39.99  ? 1329 PRO B CB  1 
ATOM   2234 C CG  . PRO B 1 136 ? 30.516 49.767 -4.986  1.00 54.18  ? 1329 PRO B CG  1 
ATOM   2235 C CD  . PRO B 1 136 ? 29.659 49.940 -6.219  1.00 56.24  ? 1329 PRO B CD  1 
ATOM   2236 N N   . ASP B 1 137 ? 26.746 48.394 -4.383  1.00 45.10  ? 1330 ASP B N   1 
ATOM   2237 C CA  . ASP B 1 137 ? 25.397 48.067 -3.919  1.00 40.82  ? 1330 ASP B CA  1 
ATOM   2238 C C   . ASP B 1 137 ? 24.359 48.369 -5.000  1.00 43.51  ? 1330 ASP B C   1 
ATOM   2239 O O   . ASP B 1 137 ? 24.511 49.321 -5.766  1.00 45.42  ? 1330 ASP B O   1 
ATOM   2240 C CB  . ASP B 1 137 ? 25.089 48.823 -2.627  1.00 46.06  ? 1330 ASP B CB  1 
ATOM   2241 C CG  . ASP B 1 137 ? 26.212 48.693 -1.595  1.00 63.02  ? 1330 ASP B CG  1 
ATOM   2242 O OD1 . ASP B 1 137 ? 26.621 47.543 -1.293  1.00 38.63  ? 1330 ASP B OD1 1 
ATOM   2243 O OD2 . ASP B 1 137 ? 26.689 49.740 -1.094  1.00 58.19  ? 1330 ASP B OD2 1 
ATOM   2244 N N   . PRO B 1 138 ? 23.306 47.544 -5.082  1.00 39.40  ? 1331 PRO B N   1 
ATOM   2245 C CA  . PRO B 1 138 ? 22.314 47.689 -6.151  1.00 33.44  ? 1331 PRO B CA  1 
ATOM   2246 C C   . PRO B 1 138 ? 21.630 49.042 -6.053  1.00 36.46  ? 1331 PRO B C   1 
ATOM   2247 O O   . PRO B 1 138 ? 21.502 49.579 -4.961  1.00 44.71  ? 1331 PRO B O   1 
ATOM   2248 C CB  . PRO B 1 138 ? 21.322 46.560 -5.849  1.00 32.94  ? 1331 PRO B CB  1 
ATOM   2249 C CG  . PRO B 1 138 ? 21.522 46.275 -4.395  1.00 29.38  ? 1331 PRO B CG  1 
ATOM   2250 C CD  . PRO B 1 138 ? 22.994 46.401 -4.216  1.00 33.74  ? 1331 PRO B CD  1 
ATOM   2251 N N   . LEU B 1 139 ? 21.210 49.596 -7.179  1.00 40.03  ? 1332 LEU B N   1 
ATOM   2252 C CA  . LEU B 1 139 ? 20.568 50.902 -7.171  1.00 34.67  ? 1332 LEU B CA  1 
ATOM   2253 C C   . LEU B 1 139 ? 19.398 50.899 -6.200  1.00 32.03  ? 1332 LEU B C   1 
ATOM   2254 O O   . LEU B 1 139 ? 19.220 51.834 -5.424  1.00 31.75  ? 1332 LEU B O   1 
ATOM   2255 C CB  . LEU B 1 139 ? 20.079 51.287 -8.572  1.00 31.15  ? 1332 LEU B CB  1 
ATOM   2256 C CG  . LEU B 1 139 ? 19.496 52.696 -8.667  1.00 24.60  ? 1332 LEU B CG  1 
ATOM   2257 C CD1 . LEU B 1 139 ? 20.504 53.704 -8.164  1.00 31.51  ? 1332 LEU B CD1 1 
ATOM   2258 C CD2 . LEU B 1 139 ? 19.091 53.016 -10.084 1.00 38.22  ? 1332 LEU B CD2 1 
ATOM   2259 N N   . VAL B 1 140 ? 18.590 49.851 -6.255  1.00 30.04  ? 1333 VAL B N   1 
ATOM   2260 C CA  . VAL B 1 140 ? 17.488 49.717 -5.319  1.00 34.18  ? 1333 VAL B CA  1 
ATOM   2261 C C   . VAL B 1 140 ? 18.000 48.929 -4.125  1.00 37.90  ? 1333 VAL B C   1 
ATOM   2262 O O   . VAL B 1 140 ? 18.176 47.721 -4.220  1.00 39.07  ? 1333 VAL B O   1 
ATOM   2263 C CB  . VAL B 1 140 ? 16.294 49.001 -5.966  1.00 31.91  ? 1333 VAL B CB  1 
ATOM   2264 C CG1 . VAL B 1 140 ? 15.141 48.895 -4.999  1.00 31.23  ? 1333 VAL B CG1 1 
ATOM   2265 C CG2 . VAL B 1 140 ? 15.867 49.758 -7.206  1.00 35.97  ? 1333 VAL B CG2 1 
ATOM   2266 N N   . PRO B 1 141 ? 18.246 49.618 -2.997  1.00 33.57  ? 1334 PRO B N   1 
ATOM   2267 C CA  . PRO B 1 141 ? 18.915 49.010 -1.850  1.00 34.56  ? 1334 PRO B CA  1 
ATOM   2268 C C   . PRO B 1 141 ? 18.118 47.833 -1.291  1.00 38.19  ? 1334 PRO B C   1 
ATOM   2269 O O   . PRO B 1 141 ? 16.892 47.826 -1.354  1.00 33.56  ? 1334 PRO B O   1 
ATOM   2270 C CB  . PRO B 1 141 ? 18.987 50.166 -0.842  1.00 35.87  ? 1334 PRO B CB  1 
ATOM   2271 C CG  . PRO B 1 141 ? 18.841 51.401 -1.667  1.00 25.60  ? 1334 PRO B CG  1 
ATOM   2272 C CD  . PRO B 1 141 ? 17.852 51.004 -2.707  1.00 30.92  ? 1334 PRO B CD  1 
ATOM   2273 N N   . TYR B 1 142 ? 18.820 46.842 -0.755  1.00 45.93  ? 1335 TYR B N   1 
ATOM   2274 C CA  . TYR B 1 142 ? 18.180 45.607 -0.320  1.00 40.08  ? 1335 TYR B CA  1 
ATOM   2275 C C   . TYR B 1 142 ? 17.102 45.831 0.724   1.00 37.88  ? 1335 TYR B C   1 
ATOM   2276 O O   . TYR B 1 142 ? 16.064 45.181 0.675   1.00 42.35  ? 1335 TYR B O   1 
ATOM   2277 C CB  . TYR B 1 142 ? 19.216 44.606 0.191   1.00 33.19  ? 1335 TYR B CB  1 
ATOM   2278 C CG  . TYR B 1 142 ? 20.092 44.054 -0.903  1.00 35.43  ? 1335 TYR B CG  1 
ATOM   2279 C CD1 . TYR B 1 142 ? 19.551 43.255 -1.904  1.00 38.04  ? 1335 TYR B CD1 1 
ATOM   2280 C CD2 . TYR B 1 142 ? 21.452 44.336 -0.947  1.00 30.26  ? 1335 TYR B CD2 1 
ATOM   2281 C CE1 . TYR B 1 142 ? 20.338 42.743 -2.917  1.00 33.72  ? 1335 TYR B CE1 1 
ATOM   2282 C CE2 . TYR B 1 142 ? 22.253 43.827 -1.954  1.00 30.83  ? 1335 TYR B CE2 1 
ATOM   2283 C CZ  . TYR B 1 142 ? 21.690 43.029 -2.936  1.00 36.19  ? 1335 TYR B CZ  1 
ATOM   2284 O OH  . TYR B 1 142 ? 22.481 42.516 -3.936  1.00 30.34  ? 1335 TYR B OH  1 
ATOM   2285 N N   . ASN B 1 143 ? 17.345 46.740 1.666   1.00 39.01  ? 1336 ASN B N   1 
ATOM   2286 C CA  . ASN B 1 143 ? 16.358 47.030 2.699   1.00 41.12  ? 1336 ASN B CA  1 
ATOM   2287 C C   . ASN B 1 143 ? 15.054 47.537 2.097   1.00 41.01  ? 1336 ASN B C   1 
ATOM   2288 O O   . ASN B 1 143 ? 13.978 47.118 2.518   1.00 44.67  ? 1336 ASN B O   1 
ATOM   2289 C CB  . ASN B 1 143 ? 16.901 48.025 3.724   1.00 35.97  ? 1336 ASN B CB  1 
ATOM   2290 C CG  . ASN B 1 143 ? 17.679 49.143 3.085   1.00 47.71  ? 1336 ASN B CG  1 
ATOM   2291 O OD1 . ASN B 1 143 ? 18.673 48.903 2.403   1.00 63.65  ? 1336 ASN B OD1 1 
ATOM   2292 N ND2 . ASN B 1 143 ? 17.239 50.377 3.305   1.00 51.47  ? 1336 ASN B ND2 1 
ATOM   2293 N N   . MET B 1 144 ? 15.149 48.430 1.112   1.00 33.61  ? 1337 MET B N   1 
ATOM   2294 C CA  . MET B 1 144 ? 13.961 48.900 0.390   1.00 32.58  ? 1337 MET B CA  1 
ATOM   2295 C C   . MET B 1 144 ? 13.268 47.764 -0.360  1.00 32.80  ? 1337 MET B C   1 
ATOM   2296 O O   . MET B 1 144 ? 12.048 47.756 -0.517  1.00 35.21  ? 1337 MET B O   1 
ATOM   2297 C CB  . MET B 1 144 ? 14.314 50.012 -0.595  1.00 35.62  ? 1337 MET B CB  1 
ATOM   2298 C CG  . MET B 1 144 ? 14.872 51.295 0.025   1.00 43.16  ? 1337 MET B CG  1 
ATOM   2299 S SD  . MET B 1 144 ? 13.763 52.114 1.186   1.00 36.99  ? 1337 MET B SD  1 
ATOM   2300 C CE  . MET B 1 144 ? 14.099 51.183 2.670   1.00 33.13  ? 1337 MET B CE  1 
ATOM   2301 N N   . GLN B 1 145 ? 14.049 46.800 -0.826  1.00 34.98  ? 1338 GLN B N   1 
ATOM   2302 C CA  . GLN B 1 145 ? 13.485 45.682 -1.560  1.00 33.07  ? 1338 GLN B CA  1 
ATOM   2303 C C   . GLN B 1 145 ? 12.508 44.914 -0.699  1.00 34.17  ? 1338 GLN B C   1 
ATOM   2304 O O   . GLN B 1 145 ? 11.445 44.508 -1.168  1.00 34.43  ? 1338 GLN B O   1 
ATOM   2305 C CB  . GLN B 1 145 ? 14.577 44.750 -2.058  1.00 28.33  ? 1338 GLN B CB  1 
ATOM   2306 C CG  . GLN B 1 145 ? 15.495 45.390 -3.072  1.00 35.60  ? 1338 GLN B CG  1 
ATOM   2307 C CD  . GLN B 1 145 ? 16.370 44.376 -3.755  1.00 34.51  ? 1338 GLN B CD  1 
ATOM   2308 O OE1 . GLN B 1 145 ? 15.992 43.204 -3.896  1.00 32.87  ? 1338 GLN B OE1 1 
ATOM   2309 N NE2 . GLN B 1 145 ? 17.558 44.806 -4.167  1.00 27.62  ? 1338 GLN B NE2 1 
ATOM   2310 N N   . ILE B 1 146 ? 12.874 44.716 0.562   1.00 35.09  ? 1339 ILE B N   1 
ATOM   2311 C CA  . ILE B 1 146 ? 12.045 43.946 1.478   1.00 37.31  ? 1339 ILE B CA  1 
ATOM   2312 C C   . ILE B 1 146 ? 10.669 44.592 1.549   1.00 40.63  ? 1339 ILE B C   1 
ATOM   2313 O O   . ILE B 1 146 ? 9.648  43.929 1.351   1.00 31.83  ? 1339 ILE B O   1 
ATOM   2314 C CB  . ILE B 1 146 ? 12.681 43.847 2.884   1.00 45.15  ? 1339 ILE B CB  1 
ATOM   2315 C CG1 . ILE B 1 146 ? 14.139 43.390 2.781   1.00 50.83  ? 1339 ILE B CG1 1 
ATOM   2316 C CG2 . ILE B 1 146 ? 11.912 42.868 3.744   1.00 47.00  ? 1339 ILE B CG2 1 
ATOM   2317 C CD1 . ILE B 1 146 ? 14.970 43.672 4.017   1.00 49.75  ? 1339 ILE B CD1 1 
ATOM   2318 N N   . ASP B 1 147 ? 10.660 45.901 1.792   1.00 37.67  ? 1340 ASP B N   1 
ATOM   2319 C CA  . ASP B 1 147 ? 9.429  46.687 1.866   1.00 38.51  ? 1340 ASP B CA  1 
ATOM   2320 C C   . ASP B 1 147 ? 8.672  46.679 0.552   1.00 41.26  ? 1340 ASP B C   1 
ATOM   2321 O O   . ASP B 1 147 ? 7.440  46.573 0.531   1.00 40.98  ? 1340 ASP B O   1 
ATOM   2322 C CB  . ASP B 1 147 ? 9.737  48.138 2.247   1.00 43.59  ? 1340 ASP B CB  1 
ATOM   2323 C CG  . ASP B 1 147 ? 10.340 48.266 3.628   1.00 49.82  ? 1340 ASP B CG  1 
ATOM   2324 O OD1 . ASP B 1 147 ? 10.159 47.353 4.463   1.00 52.68  ? 1340 ASP B OD1 1 
ATOM   2325 O OD2 . ASP B 1 147 ? 10.999 49.291 3.876   1.00 50.68  ? 1340 ASP B OD2 1 
ATOM   2326 N N   . LEU B 1 148 ? 9.410  46.819 -0.544  1.00 32.82  ? 1341 LEU B N   1 
ATOM   2327 C CA  . LEU B 1 148 ? 8.803  46.745 -1.858  1.00 29.00  ? 1341 LEU B CA  1 
ATOM   2328 C C   . LEU B 1 148 ? 8.043  45.427 -2.005  1.00 37.04  ? 1341 LEU B C   1 
ATOM   2329 O O   . LEU B 1 148 ? 6.877  45.416 -2.412  1.00 37.21  ? 1341 LEU B O   1 
ATOM   2330 C CB  . LEU B 1 148 ? 9.868  46.881 -2.947  1.00 27.53  ? 1341 LEU B CB  1 
ATOM   2331 C CG  . LEU B 1 148 ? 10.373 48.289 -3.262  1.00 26.78  ? 1341 LEU B CG  1 
ATOM   2332 C CD1 . LEU B 1 148 ? 11.430 48.229 -4.334  1.00 20.34  ? 1341 LEU B CD1 1 
ATOM   2333 C CD2 . LEU B 1 148 ? 9.232  49.206 -3.690  1.00 19.16  ? 1341 LEU B CD2 1 
ATOM   2334 N N   . VAL B 1 149 ? 8.698  44.320 -1.661  1.00 30.46  ? 1342 VAL B N   1 
ATOM   2335 C CA  . VAL B 1 149 ? 8.082  43.012 -1.824  1.00 35.26  ? 1342 VAL B CA  1 
ATOM   2336 C C   . VAL B 1 149 ? 6.853  42.864 -0.934  1.00 45.62  ? 1342 VAL B C   1 
ATOM   2337 O O   . VAL B 1 149 ? 5.864  42.243 -1.329  1.00 60.11  ? 1342 VAL B O   1 
ATOM   2338 C CB  . VAL B 1 149 ? 9.083  41.869 -1.567  1.00 43.23  ? 1342 VAL B CB  1 
ATOM   2339 C CG1 . VAL B 1 149 ? 8.357  40.511 -1.501  1.00 25.37  ? 1342 VAL B CG1 1 
ATOM   2340 C CG2 . VAL B 1 149 ? 10.164 41.870 -2.648  1.00 27.82  ? 1342 VAL B CG2 1 
ATOM   2341 N N   . GLU B 1 150 ? 6.911  43.445 0.261   1.00 40.63  ? 1343 GLU B N   1 
ATOM   2342 C CA  . GLU B 1 150 ? 5.779  43.400 1.186   1.00 38.46  ? 1343 GLU B CA  1 
ATOM   2343 C C   . GLU B 1 150 ? 4.580  44.123 0.605   1.00 33.66  ? 1343 GLU B C   1 
ATOM   2344 O O   . GLU B 1 150 ? 3.490  43.573 0.562   1.00 42.36  ? 1343 GLU B O   1 
ATOM   2345 C CB  . GLU B 1 150 ? 6.144  44.002 2.549   1.00 56.10  ? 1343 GLU B CB  1 
ATOM   2346 C CG  . GLU B 1 150 ? 7.031  43.120 3.438   1.00 59.57  ? 1343 GLU B CG  1 
ATOM   2347 C CD  . GLU B 1 150 ? 6.327  41.857 3.916   1.00 63.88  ? 1343 GLU B CD  1 
ATOM   2348 O OE1 . GLU B 1 150 ? 5.270  41.960 4.574   1.00 61.94  ? 1343 GLU B OE1 1 
ATOM   2349 O OE2 . GLU B 1 150 ? 6.841  40.754 3.638   1.00 81.81  ? 1343 GLU B OE2 1 
ATOM   2350 N N   . ALA B 1 151 ? 4.782  45.355 0.153   1.00 34.45  ? 1344 ALA B N   1 
ATOM   2351 C CA  . ALA B 1 151 ? 3.689  46.139 -0.417  1.00 35.19  ? 1344 ALA B CA  1 
ATOM   2352 C C   . ALA B 1 151 ? 3.012  45.373 -1.538  1.00 32.95  ? 1344 ALA B C   1 
ATOM   2353 O O   . ALA B 1 151 ? 1.787  45.350 -1.645  1.00 41.58  ? 1344 ALA B O   1 
ATOM   2354 C CB  . ALA B 1 151 ? 4.190  47.463 -0.925  1.00 23.96  ? 1344 ALA B CB  1 
ATOM   2355 N N   . HIS B 1 152 ? 3.826  44.734 -2.366  1.00 39.24  ? 1345 HIS B N   1 
ATOM   2356 C CA  . HIS B 1 152 ? 3.339  43.950 -3.504  1.00 52.40  ? 1345 HIS B CA  1 
ATOM   2357 C C   . HIS B 1 152 ? 2.302  42.881 -3.130  1.00 50.37  ? 1345 HIS B C   1 
ATOM   2358 O O   . HIS B 1 152 ? 1.529  42.432 -3.981  1.00 43.49  ? 1345 HIS B O   1 
ATOM   2359 C CB  . HIS B 1 152 ? 4.526  43.304 -4.228  1.00 49.54  ? 1345 HIS B CB  1 
ATOM   2360 C CG  . HIS B 1 152 ? 4.141  42.528 -5.446  1.00 44.21  ? 1345 HIS B CG  1 
ATOM   2361 N ND1 . HIS B 1 152 ? 3.574  43.117 -6.556  1.00 44.74  ? 1345 HIS B ND1 1 
ATOM   2362 C CD2 . HIS B 1 152 ? 4.253  41.211 -5.734  1.00 46.37  ? 1345 HIS B CD2 1 
ATOM   2363 C CE1 . HIS B 1 152 ? 3.348  42.195 -7.472  1.00 53.29  ? 1345 HIS B CE1 1 
ATOM   2364 N NE2 . HIS B 1 152 ? 3.751  41.030 -6.999  1.00 67.46  ? 1345 HIS B NE2 1 
ATOM   2365 N N   . LYS B 1 153 ? 2.296  42.477 -1.861  1.00 46.82  ? 1346 LYS B N   1 
ATOM   2366 C CA  . LYS B 1 153 ? 1.348  41.488 -1.369  1.00 37.76  ? 1346 LYS B CA  1 
ATOM   2367 C C   . LYS B 1 153 ? -0.078 42.008 -1.451  1.00 46.24  ? 1346 LYS B C   1 
ATOM   2368 O O   . LYS B 1 153 ? -1.023 41.237 -1.597  1.00 55.50  ? 1346 LYS B O   1 
ATOM   2369 C CB  . LYS B 1 153 ? 1.660  41.117 0.076   1.00 41.36  ? 1346 LYS B CB  1 
ATOM   2370 C CG  . LYS B 1 153 ? 2.991  40.405 0.298   1.00 40.69  ? 1346 LYS B CG  1 
ATOM   2371 C CD  . LYS B 1 153 ? 3.032  39.887 1.728   1.00 56.22  ? 1346 LYS B CD  1 
ATOM   2372 C CE  . LYS B 1 153 ? 4.437  39.601 2.212   1.00 66.68  ? 1346 LYS B CE  1 
ATOM   2373 N NZ  . LYS B 1 153 ? 4.460  39.388 3.701   1.00 65.18  ? 1346 LYS B NZ  1 
ATOM   2374 N N   . ILE B 1 154 ? -0.235 43.320 -1.340  1.00 38.98  ? 1347 ILE B N   1 
ATOM   2375 C CA  . ILE B 1 154 ? -1.557 43.918 -1.409  1.00 41.78  ? 1347 ILE B CA  1 
ATOM   2376 C C   . ILE B 1 154 ? -2.141 43.694 -2.794  1.00 49.93  ? 1347 ILE B C   1 
ATOM   2377 O O   . ILE B 1 154 ? -1.563 44.109 -3.793  1.00 49.84  ? 1347 ILE B O   1 
ATOM   2378 C CB  . ILE B 1 154 ? -1.512 45.415 -1.102  1.00 39.81  ? 1347 ILE B CB  1 
ATOM   2379 C CG1 . ILE B 1 154 ? -0.843 45.649 0.252   1.00 35.65  ? 1347 ILE B CG1 1 
ATOM   2380 C CG2 . ILE B 1 154 ? -2.913 45.999 -1.113  1.00 41.74  ? 1347 ILE B CG2 1 
ATOM   2381 C CD1 . ILE B 1 154 ? -0.598 47.108 0.564   1.00 41.96  ? 1347 ILE B CD1 1 
ATOM   2382 N N   . ASN B 1 155 ? -3.292 43.036 -2.846  1.00 52.00  ? 1348 ASN B N   1 
ATOM   2383 C CA  . ASN B 1 155 ? -3.892 42.633 -4.115  1.00 49.27  ? 1348 ASN B CA  1 
ATOM   2384 C C   . ASN B 1 155 ? -4.605 43.747 -4.873  1.00 37.22  ? 1348 ASN B C   1 
ATOM   2385 O O   . ASN B 1 155 ? -4.599 43.761 -6.095  1.00 57.05  ? 1348 ASN B O   1 
ATOM   2386 C CB  . ASN B 1 155 ? -4.833 41.440 -3.908  1.00 57.95  ? 1348 ASN B CB  1 
ATOM   2387 C CG  . ASN B 1 155 ? -4.082 40.146 -3.638  1.00 70.76  ? 1348 ASN B CG  1 
ATOM   2388 O OD1 . ASN B 1 155 ? -3.252 39.721 -4.442  1.00 47.24  ? 1348 ASN B OD1 1 
ATOM   2389 N ND2 . ASN B 1 155 ? -4.370 39.514 -2.501  1.00 67.28  ? 1348 ASN B ND2 1 
ATOM   2390 N N   . ASP B 1 156 ? -5.227 44.674 -4.157  1.00 40.89  ? 1349 ASP B N   1 
ATOM   2391 C CA  . ASP B 1 156 ? -5.970 45.743 -4.810  1.00 33.85  ? 1349 ASP B CA  1 
ATOM   2392 C C   . ASP B 1 156 ? -4.983 46.704 -5.430  1.00 49.00  ? 1349 ASP B C   1 
ATOM   2393 O O   . ASP B 1 156 ? -4.032 47.126 -4.776  1.00 48.17  ? 1349 ASP B O   1 
ATOM   2394 C CB  . ASP B 1 156 ? -6.849 46.477 -3.812  1.00 35.30  ? 1349 ASP B CB  1 
ATOM   2395 C CG  . ASP B 1 156 ? -7.581 47.645 -4.432  1.00 49.80  ? 1349 ASP B CG  1 
ATOM   2396 O OD1 . ASP B 1 156 ? -8.652 47.416 -5.036  1.00 51.93  ? 1349 ASP B OD1 1 
ATOM   2397 O OD2 . ASP B 1 156 ? -7.094 48.794 -4.302  1.00 41.64  ? 1349 ASP B OD2 1 
ATOM   2398 N N   . ARG B 1 157 ? -5.210 47.056 -6.692  1.00 51.20  ? 1350 ARG B N   1 
ATOM   2399 C CA  . ARG B 1 157 ? -4.198 47.762 -7.473  1.00 46.13  ? 1350 ARG B CA  1 
ATOM   2400 C C   . ARG B 1 157 ? -3.869 49.157 -6.938  1.00 41.95  ? 1350 ARG B C   1 
ATOM   2401 O O   . ARG B 1 157 ? -2.697 49.494 -6.755  1.00 35.83  ? 1350 ARG B O   1 
ATOM   2402 C CB  . ARG B 1 157 ? -4.586 47.817 -8.955  1.00 41.56  ? 1350 ARG B CB  1 
ATOM   2403 C CG  . ARG B 1 157 ? -3.514 48.415 -9.844  1.00 28.22  ? 1350 ARG B CG  1 
ATOM   2404 C CD  . ARG B 1 157 ? -2.188 47.720 -9.624  1.00 29.57  ? 1350 ARG B CD  1 
ATOM   2405 N NE  . ARG B 1 157 ? -2.213 46.369 -10.161 1.00 51.20  ? 1350 ARG B NE  1 
ATOM   2406 C CZ  . ARG B 1 157 ? -1.847 46.057 -11.398 1.00 38.91  ? 1350 ARG B CZ  1 
ATOM   2407 N NH1 . ARG B 1 157 ? -1.908 44.798 -11.815 1.00 20.35  ? 1350 ARG B NH1 1 
ATOM   2408 N NH2 . ARG B 1 157 ? -1.419 47.009 -12.213 1.00 33.48  ? 1350 ARG B NH2 1 
ATOM   2409 N N   . GLU B 1 158 ? -4.893 49.967 -6.687  1.00 39.08  ? 1351 GLU B N   1 
ATOM   2410 C CA  . GLU B 1 158 ? -4.655 51.296 -6.136  1.00 35.15  ? 1351 GLU B CA  1 
ATOM   2411 C C   . GLU B 1 158 ? -3.946 51.219 -4.775  1.00 49.27  ? 1351 GLU B C   1 
ATOM   2412 O O   . GLU B 1 158 ? -2.973 51.932 -4.536  1.00 46.30  ? 1351 GLU B O   1 
ATOM   2413 C CB  . GLU B 1 158 ? -5.951 52.092 -6.012  1.00 27.84  ? 1351 GLU B CB  1 
ATOM   2414 C CG  . GLU B 1 158 ? -5.715 53.480 -5.458  1.00 45.45  ? 1351 GLU B CG  1 
ATOM   2415 C CD  . GLU B 1 158 ? -6.991 54.253 -5.194  1.00 47.27  ? 1351 GLU B CD  1 
ATOM   2416 O OE1 . GLU B 1 158 ? -6.885 55.433 -4.797  1.00 53.15  ? 1351 GLU B OE1 1 
ATOM   2417 O OE2 . GLU B 1 158 ? -8.090 53.687 -5.373  1.00 36.39  ? 1351 GLU B OE2 1 
ATOM   2418 N N   . GLN B 1 159 ? -4.433 50.354 -3.887  1.00 52.65  ? 1352 GLN B N   1 
ATOM   2419 C CA  . GLN B 1 159 ? -3.798 50.157 -2.587  1.00 39.85  ? 1352 GLN B CA  1 
ATOM   2420 C C   . GLN B 1 159 ? -2.337 49.785 -2.772  1.00 42.38  ? 1352 GLN B C   1 
ATOM   2421 O O   . GLN B 1 159 ? -1.453 50.324 -2.109  1.00 51.30  ? 1352 GLN B O   1 
ATOM   2422 C CB  . GLN B 1 159 ? -4.498 49.048 -1.802  1.00 49.93  ? 1352 GLN B CB  1 
ATOM   2423 C CG  . GLN B 1 159 ? -5.817 49.456 -1.181  1.00 51.47  ? 1352 GLN B CG  1 
ATOM   2424 C CD  . GLN B 1 159 ? -5.649 50.585 -0.195  1.00 70.43  ? 1352 GLN B CD  1 
ATOM   2425 O OE1 . GLN B 1 159 ? -5.111 50.395 0.910   1.00 62.75  ? 1352 GLN B OE1 1 
ATOM   2426 N NE2 . GLN B 1 159 ? -6.103 51.780 -0.585  1.00 52.18  ? 1352 GLN B NE2 1 
ATOM   2427 N N   . LYS B 1 160 ? -2.092 48.851 -3.680  1.00 39.83  ? 1353 LYS B N   1 
ATOM   2428 C CA  . LYS B 1 160 ? -0.752 48.360 -3.941  1.00 35.11  ? 1353 LYS B CA  1 
ATOM   2429 C C   . LYS B 1 160 ? 0.151  49.511 -4.335  1.00 36.01  ? 1353 LYS B C   1 
ATOM   2430 O O   . LYS B 1 160 ? 1.281  49.638 -3.849  1.00 29.28  ? 1353 LYS B O   1 
ATOM   2431 C CB  . LYS B 1 160 ? -0.799 47.346 -5.077  1.00 32.48  ? 1353 LYS B CB  1 
ATOM   2432 C CG  . LYS B 1 160 ? 0.477  46.552 -5.294  1.00 31.59  ? 1353 LYS B CG  1 
ATOM   2433 C CD  . LYS B 1 160 ? 0.248  45.555 -6.428  1.00 38.89  ? 1353 LYS B CD  1 
ATOM   2434 C CE  . LYS B 1 160 ? 0.805  44.189 -6.088  1.00 50.45  ? 1353 LYS B CE  1 
ATOM   2435 N NZ  . LYS B 1 160 ? 0.114  43.105 -6.847  1.00 68.33  ? 1353 LYS B NZ  1 
ATOM   2436 N N   . LEU B 1 161 ? -0.346 50.355 -5.228  1.00 28.97  ? 1354 LEU B N   1 
ATOM   2437 C CA  . LEU B 1 161 ? 0.486  51.423 -5.744  1.00 27.24  ? 1354 LEU B CA  1 
ATOM   2438 C C   . LEU B 1 161 ? 0.818  52.429 -4.654  1.00 33.47  ? 1354 LEU B C   1 
ATOM   2439 O O   . LEU B 1 161 ? 1.954  52.912 -4.591  1.00 32.74  ? 1354 LEU B O   1 
ATOM   2440 C CB  . LEU B 1 161 ? -0.146 52.087 -6.969  1.00 37.88  ? 1354 LEU B CB  1 
ATOM   2441 C CG  . LEU B 1 161 ? -0.167 51.213 -8.230  1.00 27.57  ? 1354 LEU B CG  1 
ATOM   2442 C CD1 . LEU B 1 161 ? -0.951 51.892 -9.339  1.00 21.08  ? 1354 LEU B CD1 1 
ATOM   2443 C CD2 . LEU B 1 161 ? 1.247  50.884 -8.692  1.00 27.03  ? 1354 LEU B CD2 1 
ATOM   2444 N N   . HIS B 1 162 ? -0.148 52.732 -3.785  1.00 26.10  ? 1355 HIS B N   1 
ATOM   2445 C CA  . HIS B 1 162 ? 0.134  53.623 -2.655  1.00 31.45  ? 1355 HIS B CA  1 
ATOM   2446 C C   . HIS B 1 162 ? 1.221  53.038 -1.751  1.00 35.28  ? 1355 HIS B C   1 
ATOM   2447 O O   . HIS B 1 162 ? 2.215  53.706 -1.441  1.00 28.00  ? 1355 HIS B O   1 
ATOM   2448 C CB  . HIS B 1 162 ? -1.127 53.947 -1.854  1.00 30.13  ? 1355 HIS B CB  1 
ATOM   2449 C CG  . HIS B 1 162 ? -2.044 54.903 -2.546  1.00 48.84  ? 1355 HIS B CG  1 
ATOM   2450 N ND1 . HIS B 1 162 ? -3.328 54.564 -2.927  1.00 58.63  ? 1355 HIS B ND1 1 
ATOM   2451 C CD2 . HIS B 1 162 ? -1.858 56.182 -2.950  1.00 35.59  ? 1355 HIS B CD2 1 
ATOM   2452 C CE1 . HIS B 1 162 ? -3.893 55.594 -3.530  1.00 40.81  ? 1355 HIS B CE1 1 
ATOM   2453 N NE2 . HIS B 1 162 ? -3.022 56.586 -3.559  1.00 58.05  ? 1355 HIS B NE2 1 
ATOM   2454 N N   . ALA B 1 163 ? 1.023  51.785 -1.343  1.00 34.75  ? 1356 ALA B N   1 
ATOM   2455 C CA  . ALA B 1 163 ? 2.013  51.045 -0.572  1.00 25.98  ? 1356 ALA B CA  1 
ATOM   2456 C C   . ALA B 1 163 ? 3.395  51.187 -1.189  1.00 27.69  ? 1356 ALA B C   1 
ATOM   2457 O O   . ALA B 1 163 ? 4.372  51.452 -0.499  1.00 29.30  ? 1356 ALA B O   1 
ATOM   2458 C CB  . ALA B 1 163 ? 1.621  49.571 -0.491  1.00 25.06  ? 1356 ALA B CB  1 
ATOM   2459 N N   . LEU B 1 164 ? 3.466  50.995 -2.499  1.00 34.20  ? 1357 LEU B N   1 
ATOM   2460 C CA  . LEU B 1 164 ? 4.737  51.032 -3.197  1.00 30.93  ? 1357 LEU B CA  1 
ATOM   2461 C C   . LEU B 1 164 ? 5.318  52.428 -3.172  1.00 29.51  ? 1357 LEU B C   1 
ATOM   2462 O O   . LEU B 1 164 ? 6.516  52.603 -2.932  1.00 30.38  ? 1357 LEU B O   1 
ATOM   2463 C CB  . LEU B 1 164 ? 4.582  50.544 -4.640  1.00 30.02  ? 1357 LEU B CB  1 
ATOM   2464 C CG  . LEU B 1 164 ? 4.518  49.031 -4.818  1.00 21.75  ? 1357 LEU B CG  1 
ATOM   2465 C CD1 . LEU B 1 164 ? 3.910  48.670 -6.155  1.00 25.07  ? 1357 LEU B CD1 1 
ATOM   2466 C CD2 . LEU B 1 164 ? 5.909  48.442 -4.679  1.00 20.99  ? 1357 LEU B CD2 1 
ATOM   2467 N N   . LYS B 1 165 ? 4.476  53.427 -3.421  1.00 25.35  ? 1358 LYS B N   1 
ATOM   2468 C CA  . LYS B 1 165 ? 4.966  54.795 -3.439  1.00 26.95  ? 1358 LYS B CA  1 
ATOM   2469 C C   . LYS B 1 165 ? 5.495  55.160 -2.056  1.00 37.34  ? 1358 LYS B C   1 
ATOM   2470 O O   . LYS B 1 165 ? 6.465  55.904 -1.930  1.00 31.27  ? 1358 LYS B O   1 
ATOM   2471 C CB  . LYS B 1 165 ? 3.883  55.763 -3.895  1.00 25.09  ? 1358 LYS B CB  1 
ATOM   2472 C CG  . LYS B 1 165 ? 4.406  57.146 -4.217  1.00 26.99  ? 1358 LYS B CG  1 
ATOM   2473 C CD  . LYS B 1 165 ? 3.278  58.064 -4.641  1.00 34.00  ? 1358 LYS B CD  1 
ATOM   2474 C CE  . LYS B 1 165 ? 3.803  59.303 -5.339  1.00 38.97  ? 1358 LYS B CE  1 
ATOM   2475 N NZ  . LYS B 1 165 ? 2.670  60.084 -5.909  1.00 52.07  ? 1358 LYS B NZ  1 
ATOM   2476 N N   . GLU B 1 166 ? 4.870  54.609 -1.019  1.00 35.48  ? 1359 GLU B N   1 
ATOM   2477 C CA  . GLU B 1 166 ? 5.343  54.813 0.344   1.00 36.39  ? 1359 GLU B CA  1 
ATOM   2478 C C   . GLU B 1 166 ? 6.780  54.337 0.529   1.00 37.17  ? 1359 GLU B C   1 
ATOM   2479 O O   . GLU B 1 166 ? 7.595  55.050 1.101   1.00 58.05  ? 1359 GLU B O   1 
ATOM   2480 C CB  . GLU B 1 166 ? 4.426  54.132 1.365   1.00 42.40  ? 1359 GLU B CB  1 
ATOM   2481 C CG  . GLU B 1 166 ? 3.374  55.046 1.971   1.00 45.12  ? 1359 GLU B CG  1 
ATOM   2482 C CD  . GLU B 1 166 ? 3.991  56.215 2.721   1.00 63.10  ? 1359 GLU B CD  1 
ATOM   2483 O OE1 . GLU B 1 166 ? 3.668  57.378 2.385   1.00 66.77  ? 1359 GLU B OE1 1 
ATOM   2484 O OE2 . GLU B 1 166 ? 4.813  55.972 3.635   1.00 46.05  ? 1359 GLU B OE2 1 
ATOM   2485 N N   . VAL B 1 167 ? 7.094  53.135 0.059   1.00 33.91  ? 1360 VAL B N   1 
ATOM   2486 C CA  . VAL B 1 167 ? 8.456  52.643 0.164   1.00 34.20  ? 1360 VAL B CA  1 
ATOM   2487 C C   . VAL B 1 167 ? 9.338  53.595 -0.608  1.00 31.81  ? 1360 VAL B C   1 
ATOM   2488 O O   . VAL B 1 167 ? 10.440 53.935 -0.184  1.00 34.78  ? 1360 VAL B O   1 
ATOM   2489 C CB  . VAL B 1 167 ? 8.620  51.233 -0.426  1.00 25.49  ? 1360 VAL B CB  1 
ATOM   2490 C CG1 . VAL B 1 167 ? 10.088 50.819 -0.424  1.00 23.17  ? 1360 VAL B CG1 1 
ATOM   2491 C CG2 . VAL B 1 167 ? 7.785  50.243 0.341   1.00 25.68  ? 1360 VAL B CG2 1 
ATOM   2492 N N   . LEU B 1 168 ? 8.833  54.039 -1.747  1.00 31.70  ? 1361 LEU B N   1 
ATOM   2493 C CA  . LEU B 1 168 ? 9.614  54.888 -2.626  1.00 34.53  ? 1361 LEU B CA  1 
ATOM   2494 C C   . LEU B 1 168 ? 10.055 56.154 -1.896  1.00 39.23  ? 1361 LEU B C   1 
ATOM   2495 O O   . LEU B 1 168 ? 11.104 56.717 -2.199  1.00 42.27  ? 1361 LEU B O   1 
ATOM   2496 C CB  . LEU B 1 168 ? 8.808  55.218 -3.883  1.00 38.09  ? 1361 LEU B CB  1 
ATOM   2497 C CG  . LEU B 1 168 ? 9.576  55.899 -5.004  1.00 35.24  ? 1361 LEU B CG  1 
ATOM   2498 C CD1 . LEU B 1 168 ? 10.714 55.012 -5.427  1.00 35.47  ? 1361 LEU B CD1 1 
ATOM   2499 C CD2 . LEU B 1 168 ? 8.648  56.196 -6.157  1.00 34.89  ? 1361 LEU B CD2 1 
ATOM   2500 N N   . LYS B 1 169 ? 9.256  56.585 -0.922  1.00 43.46  ? 1362 LYS B N   1 
ATOM   2501 C CA  . LYS B 1 169 ? 9.566  57.759 -0.104  1.00 37.79  ? 1362 LYS B CA  1 
ATOM   2502 C C   . LYS B 1 169 ? 10.733 57.517 0.848   1.00 39.77  ? 1362 LYS B C   1 
ATOM   2503 O O   . LYS B 1 169 ? 11.376 58.455 1.312   1.00 37.72  ? 1362 LYS B O   1 
ATOM   2504 C CB  . LYS B 1 169 ? 8.345  58.169 0.715   1.00 32.36  ? 1362 LYS B CB  1 
ATOM   2505 C CG  . LYS B 1 169 ? 7.224  58.776 -0.092  1.00 55.55  ? 1362 LYS B CG  1 
ATOM   2506 C CD  . LYS B 1 169 ? 6.007  59.023 0.780   1.00 51.81  ? 1362 LYS B CD  1 
ATOM   2507 C CE  . LYS B 1 169 ? 4.875  59.630 -0.027  1.00 61.59  ? 1362 LYS B CE  1 
ATOM   2508 N NZ  . LYS B 1 169 ? 3.662  59.827 0.801   1.00 61.40  ? 1362 LYS B NZ  1 
ATOM   2509 N N   . LYS B 1 170 ? 10.991 56.252 1.158   1.00 37.87  ? 1363 LYS B N   1 
ATOM   2510 C CA  . LYS B 1 170 ? 12.031 55.903 2.120   1.00 38.35  ? 1363 LYS B CA  1 
ATOM   2511 C C   . LYS B 1 170 ? 13.381 55.636 1.461   1.00 41.62  ? 1363 LYS B C   1 
ATOM   2512 O O   . LYS B 1 170 ? 14.359 55.329 2.140   1.00 35.85  ? 1363 LYS B O   1 
ATOM   2513 C CB  . LYS B 1 170 ? 11.612 54.689 2.959   1.00 41.47  ? 1363 LYS B CB  1 
ATOM   2514 C CG  . LYS B 1 170 ? 10.524 54.973 3.989   1.00 55.21  ? 1363 LYS B CG  1 
ATOM   2515 C CD  . LYS B 1 170 ? 10.540 53.934 5.108   1.00 59.45  ? 1363 LYS B CD  1 
ATOM   2516 N N   . PHE B 1 171 ? 13.432 55.735 0.137   1.00 43.08  ? 1364 PHE B N   1 
ATOM   2517 C CA  . PHE B 1 171 ? 14.690 55.547 -0.572  1.00 37.95  ? 1364 PHE B CA  1 
ATOM   2518 C C   . PHE B 1 171 ? 15.690 56.606 -0.117  1.00 37.86  ? 1364 PHE B C   1 
ATOM   2519 O O   . PHE B 1 171 ? 15.327 57.763 0.082   1.00 38.93  ? 1364 PHE B O   1 
ATOM   2520 C CB  . PHE B 1 171 ? 14.487 55.685 -2.083  1.00 42.31  ? 1364 PHE B CB  1 
ATOM   2521 C CG  . PHE B 1 171 ? 14.116 54.409 -2.781  1.00 34.87  ? 1364 PHE B CG  1 
ATOM   2522 C CD1 . PHE B 1 171 ? 13.108 53.604 -2.295  1.00 26.79  ? 1364 PHE B CD1 1 
ATOM   2523 C CD2 . PHE B 1 171 ? 14.752 54.044 -3.962  1.00 33.29  ? 1364 PHE B CD2 1 
ATOM   2524 C CE1 . PHE B 1 171 ? 12.756 52.439 -2.960  1.00 34.82  ? 1364 PHE B CE1 1 
ATOM   2525 C CE2 . PHE B 1 171 ? 14.406 52.876 -4.632  1.00 30.86  ? 1364 PHE B CE2 1 
ATOM   2526 C CZ  . PHE B 1 171 ? 13.410 52.073 -4.132  1.00 30.21  ? 1364 PHE B CZ  1 
ATOM   2527 N N   . PRO B 1 172 ? 16.955 56.212 0.051   1.00 33.07  ? 1365 PRO B N   1 
ATOM   2528 C CA  . PRO B 1 172 ? 18.031 57.193 0.130   1.00 26.41  ? 1365 PRO B CA  1 
ATOM   2529 C C   . PRO B 1 172 ? 17.893 58.138 -1.060  1.00 44.64  ? 1365 PRO B C   1 
ATOM   2530 O O   . PRO B 1 172 ? 17.612 57.669 -2.161  1.00 51.11  ? 1365 PRO B O   1 
ATOM   2531 C CB  . PRO B 1 172 ? 19.281 56.336 -0.059  1.00 31.75  ? 1365 PRO B CB  1 
ATOM   2532 C CG  . PRO B 1 172 ? 18.891 54.999 0.418   1.00 42.33  ? 1365 PRO B CG  1 
ATOM   2533 C CD  . PRO B 1 172 ? 17.450 54.829 0.108   1.00 37.28  ? 1365 PRO B CD  1 
ATOM   2534 N N   . LYS B 1 173 ? 18.091 59.438 -0.862  1.00 46.99  ? 1366 LYS B N   1 
ATOM   2535 C CA  . LYS B 1 173 ? 17.817 60.401 -1.923  1.00 37.38  ? 1366 LYS B CA  1 
ATOM   2536 C C   . LYS B 1 173 ? 18.721 60.217 -3.136  1.00 39.37  ? 1366 LYS B C   1 
ATOM   2537 O O   . LYS B 1 173 ? 18.278 60.387 -4.271  1.00 32.69  ? 1366 LYS B O   1 
ATOM   2538 C CB  . LYS B 1 173 ? 17.890 61.841 -1.408  1.00 40.23  ? 1366 LYS B CB  1 
ATOM   2539 C CG  . LYS B 1 173 ? 17.428 62.872 -2.432  1.00 53.93  ? 1366 LYS B CG  1 
ATOM   2540 C CD  . LYS B 1 173 ? 16.877 64.118 -1.766  1.00 85.82  ? 1366 LYS B CD  1 
ATOM   2541 C CE  . LYS B 1 173 ? 16.120 64.993 -2.762  1.00 91.76  ? 1366 LYS B CE  1 
ATOM   2542 N NZ  . LYS B 1 173 ? 15.321 66.056 -2.069  1.00 90.87  ? 1366 LYS B NZ  1 
ATOM   2543 N N   . GLU B 1 174 ? 19.983 59.874 -2.895  1.00 33.57  ? 1367 GLU B N   1 
ATOM   2544 C CA  . GLU B 1 174 ? 20.913 59.640 -3.984  1.00 38.76  ? 1367 GLU B CA  1 
ATOM   2545 C C   . GLU B 1 174 ? 20.323 58.611 -4.947  1.00 48.54  ? 1367 GLU B C   1 
ATOM   2546 O O   . GLU B 1 174 ? 20.245 58.840 -6.163  1.00 44.35  ? 1367 GLU B O   1 
ATOM   2547 C CB  . GLU B 1 174 ? 22.267 59.160 -3.454  1.00 30.63  ? 1367 GLU B CB  1 
ATOM   2548 C CG  . GLU B 1 174 ? 23.020 60.196 -2.660  1.00 53.07  ? 1367 GLU B CG  1 
ATOM   2549 C CD  . GLU B 1 174 ? 22.451 60.387 -1.268  1.00 83.56  ? 1367 GLU B CD  1 
ATOM   2550 O OE1 . GLU B 1 174 ? 22.695 61.456 -0.668  1.00 84.48  ? 1367 GLU B OE1 1 
ATOM   2551 O OE2 . GLU B 1 174 ? 21.763 59.467 -0.772  1.00 69.30  ? 1367 GLU B OE2 1 
ATOM   2552 N N   . ASN B 1 175 ? 19.898 57.480 -4.394  1.00 32.94  ? 1368 ASN B N   1 
ATOM   2553 C CA  . ASN B 1 175 ? 19.342 56.405 -5.200  1.00 41.13  ? 1368 ASN B CA  1 
ATOM   2554 C C   . ASN B 1 175 ? 18.008 56.782 -5.818  1.00 38.16  ? 1368 ASN B C   1 
ATOM   2555 O O   . ASN B 1 175 ? 17.745 56.471 -6.976  1.00 38.84  ? 1368 ASN B O   1 
ATOM   2556 C CB  . ASN B 1 175 ? 19.182 55.133 -4.372  1.00 37.59  ? 1368 ASN B CB  1 
ATOM   2557 C CG  . ASN B 1 175 ? 20.438 54.778 -3.613  1.00 42.21  ? 1368 ASN B CG  1 
ATOM   2558 O OD1 . ASN B 1 175 ? 20.946 55.564 -2.821  1.00 52.31  ? 1368 ASN B OD1 1 
ATOM   2559 N ND2 . ASN B 1 175 ? 20.938 53.586 -3.843  1.00 46.94  ? 1368 ASN B ND2 1 
ATOM   2560 N N   . HIS B 1 176 ? 17.163 57.446 -5.039  1.00 44.67  ? 1369 HIS B N   1 
ATOM   2561 C CA  . HIS B 1 176 ? 15.829 57.791 -5.501  1.00 35.19  ? 1369 HIS B CA  1 
ATOM   2562 C C   . HIS B 1 176 ? 15.904 58.612 -6.775  1.00 37.33  ? 1369 HIS B C   1 
ATOM   2563 O O   . HIS B 1 176 ? 15.130 58.391 -7.709  1.00 37.66  ? 1369 HIS B O   1 
ATOM   2564 C CB  . HIS B 1 176 ? 15.046 58.546 -4.434  1.00 28.07  ? 1369 HIS B CB  1 
ATOM   2565 C CG  . HIS B 1 176 ? 13.695 59.001 -4.897  1.00 39.94  ? 1369 HIS B CG  1 
ATOM   2566 N ND1 . HIS B 1 176 ? 12.547 58.265 -4.688  1.00 39.83  ? 1369 HIS B ND1 1 
ATOM   2567 C CD2 . HIS B 1 176 ? 13.312 60.109 -5.578  1.00 30.59  ? 1369 HIS B CD2 1 
ATOM   2568 C CE1 . HIS B 1 176 ? 11.514 58.905 -5.208  1.00 36.11  ? 1369 HIS B CE1 1 
ATOM   2569 N NE2 . HIS B 1 176 ? 11.951 60.027 -5.753  1.00 33.12  ? 1369 HIS B NE2 1 
ATOM   2570 N N   . GLU B 1 177 ? 16.844 59.550 -6.812  1.00 35.76  ? 1370 GLU B N   1 
ATOM   2571 C CA  . GLU B 1 177 ? 17.075 60.364 -8.002  1.00 38.06  ? 1370 GLU B CA  1 
ATOM   2572 C C   . GLU B 1 177 ? 17.494 59.541 -9.218  1.00 34.20  ? 1370 GLU B C   1 
ATOM   2573 O O   . GLU B 1 177 ? 16.924 59.686 -10.298 1.00 32.57  ? 1370 GLU B O   1 
ATOM   2574 C CB  . GLU B 1 177 ? 18.110 61.455 -7.714  1.00 44.53  ? 1370 GLU B CB  1 
ATOM   2575 C CG  . GLU B 1 177 ? 17.562 62.582 -6.875  1.00 35.01  ? 1370 GLU B CG  1 
ATOM   2576 C CD  . GLU B 1 177 ? 16.184 62.993 -7.340  1.00 66.61  ? 1370 GLU B CD  1 
ATOM   2577 O OE1 . GLU B 1 177 ? 15.207 62.670 -6.626  1.00 66.31  ? 1370 GLU B OE1 1 
ATOM   2578 O OE2 . GLU B 1 177 ? 16.077 63.608 -8.430  1.00 63.87  ? 1370 GLU B OE2 1 
ATOM   2579 N N   . VAL B 1 178 ? 18.489 58.678 -9.045  1.00 32.13  ? 1371 VAL B N   1 
ATOM   2580 C CA  . VAL B 1 178 ? 18.950 57.850 -10.154 1.00 35.94  ? 1371 VAL B CA  1 
ATOM   2581 C C   . VAL B 1 178 ? 17.866 56.865 -10.579 1.00 33.22  ? 1371 VAL B C   1 
ATOM   2582 O O   . VAL B 1 178 ? 17.620 56.663 -11.770 1.00 38.51  ? 1371 VAL B O   1 
ATOM   2583 C CB  . VAL B 1 178 ? 20.231 57.086 -9.808  1.00 33.71  ? 1371 VAL B CB  1 
ATOM   2584 C CG1 . VAL B 1 178 ? 20.699 56.286 -11.010 1.00 27.58  ? 1371 VAL B CG1 1 
ATOM   2585 C CG2 . VAL B 1 178 ? 21.309 58.050 -9.356  1.00 34.26  ? 1371 VAL B CG2 1 
ATOM   2586 N N   . PHE B 1 179 ? 17.209 56.257 -9.604  1.00 28.75  ? 1372 PHE B N   1 
ATOM   2587 C CA  . PHE B 1 179 ? 16.082 55.395 -9.909  1.00 32.39  ? 1372 PHE B CA  1 
ATOM   2588 C C   . PHE B 1 179 ? 15.037 56.155 -10.731 1.00 32.37  ? 1372 PHE B C   1 
ATOM   2589 O O   . PHE B 1 179 ? 14.574 55.667 -11.757 1.00 31.34  ? 1372 PHE B O   1 
ATOM   2590 C CB  . PHE B 1 179 ? 15.462 54.815 -8.635  1.00 24.93  ? 1372 PHE B CB  1 
ATOM   2591 C CG  . PHE B 1 179 ? 14.531 53.667 -8.890  1.00 28.03  ? 1372 PHE B CG  1 
ATOM   2592 C CD1 . PHE B 1 179 ? 14.981 52.530 -9.545  1.00 35.47  ? 1372 PHE B CD1 1 
ATOM   2593 C CD2 . PHE B 1 179 ? 13.208 53.715 -8.479  1.00 29.98  ? 1372 PHE B CD2 1 
ATOM   2594 C CE1 . PHE B 1 179 ? 14.124 51.458 -9.792  1.00 34.56  ? 1372 PHE B CE1 1 
ATOM   2595 C CE2 . PHE B 1 179 ? 12.344 52.644 -8.716  1.00 34.08  ? 1372 PHE B CE2 1 
ATOM   2596 C CZ  . PHE B 1 179 ? 12.802 51.514 -9.371  1.00 25.53  ? 1372 PHE B CZ  1 
ATOM   2597 N N   . LYS B 1 180 ? 14.676 57.354 -10.282 1.00 34.14  ? 1373 LYS B N   1 
ATOM   2598 C CA  . LYS B 1 180 ? 13.685 58.161 -10.983 1.00 27.34  ? 1373 LYS B CA  1 
ATOM   2599 C C   . LYS B 1 180 ? 14.108 58.363 -12.426 1.00 26.73  ? 1373 LYS B C   1 
ATOM   2600 O O   . LYS B 1 180 ? 13.339 58.115 -13.336 1.00 33.03  ? 1373 LYS B O   1 
ATOM   2601 C CB  . LYS B 1 180 ? 13.515 59.513 -10.298 1.00 36.32  ? 1373 LYS B CB  1 
ATOM   2602 C CG  . LYS B 1 180 ? 12.403 60.380 -10.861 1.00 27.55  ? 1373 LYS B CG  1 
ATOM   2603 C CD  . LYS B 1 180 ? 12.691 61.844 -10.563 1.00 38.80  ? 1373 LYS B CD  1 
ATOM   2604 C CE  . LYS B 1 180 ? 11.474 62.724 -10.795 1.00 55.01  ? 1373 LYS B CE  1 
ATOM   2605 N NZ  . LYS B 1 180 ? 10.673 62.931 -9.545  1.00 62.69  ? 1373 LYS B NZ  1 
ATOM   2606 N N   . TYR B 1 181 ? 15.348 58.792 -12.625 1.00 33.79  ? 1374 TYR B N   1 
ATOM   2607 C CA  . TYR B 1 181 ? 15.890 59.061 -13.960 1.00 31.78  ? 1374 TYR B CA  1 
ATOM   2608 C C   . TYR B 1 181 ? 15.799 57.829 -14.859 1.00 37.47  ? 1374 TYR B C   1 
ATOM   2609 O O   . TYR B 1 181 ? 15.211 57.871 -15.945 1.00 34.63  ? 1374 TYR B O   1 
ATOM   2610 C CB  . TYR B 1 181 ? 17.347 59.520 -13.836 1.00 33.83  ? 1374 TYR B CB  1 
ATOM   2611 C CG  . TYR B 1 181 ? 17.980 60.058 -15.108 1.00 34.75  ? 1374 TYR B CG  1 
ATOM   2612 C CD1 . TYR B 1 181 ? 17.793 61.375 -15.497 1.00 29.89  ? 1374 TYR B CD1 1 
ATOM   2613 C CD2 . TYR B 1 181 ? 18.799 59.261 -15.889 1.00 26.45  ? 1374 TYR B CD2 1 
ATOM   2614 C CE1 . TYR B 1 181 ? 18.382 61.874 -16.630 1.00 23.57  ? 1374 TYR B CE1 1 
ATOM   2615 C CE2 . TYR B 1 181 ? 19.394 59.754 -17.027 1.00 38.67  ? 1374 TYR B CE2 1 
ATOM   2616 C CZ  . TYR B 1 181 ? 19.183 61.064 -17.397 1.00 44.74  ? 1374 TYR B CZ  1 
ATOM   2617 O OH  . TYR B 1 181 ? 19.774 61.561 -18.546 1.00 48.86  ? 1374 TYR B OH  1 
ATOM   2618 N N   . VAL B 1 182 ? 16.381 56.727 -14.400 1.00 37.97  ? 1375 VAL B N   1 
ATOM   2619 C CA  . VAL B 1 182 ? 16.367 55.496 -15.173 1.00 32.06  ? 1375 VAL B CA  1 
ATOM   2620 C C   . VAL B 1 182 ? 14.940 55.070 -15.508 1.00 30.47  ? 1375 VAL B C   1 
ATOM   2621 O O   . VAL B 1 182 ? 14.630 54.768 -16.656 1.00 22.69  ? 1375 VAL B O   1 
ATOM   2622 C CB  . VAL B 1 182 ? 17.096 54.373 -14.430 1.00 25.97  ? 1375 VAL B CB  1 
ATOM   2623 C CG1 . VAL B 1 182 ? 17.063 53.087 -15.243 1.00 28.93  ? 1375 VAL B CG1 1 
ATOM   2624 C CG2 . VAL B 1 182 ? 18.529 54.794 -14.140 1.00 30.95  ? 1375 VAL B CG2 1 
ATOM   2625 N N   . ILE B 1 183 ? 14.069 55.057 -14.506 1.00 30.29  ? 1376 ILE B N   1 
ATOM   2626 C CA  . ILE B 1 183 ? 12.715 54.573 -14.713 1.00 24.41  ? 1376 ILE B CA  1 
ATOM   2627 C C   . ILE B 1 183 ? 11.952 55.438 -15.711 1.00 28.20  ? 1376 ILE B C   1 
ATOM   2628 O O   . ILE B 1 183 ? 11.257 54.915 -16.580 1.00 27.47  ? 1376 ILE B O   1 
ATOM   2629 C CB  . ILE B 1 183 ? 11.916 54.438 -13.391 1.00 33.45  ? 1376 ILE B CB  1 
ATOM   2630 C CG1 . ILE B 1 183 ? 12.561 53.396 -12.471 1.00 26.28  ? 1376 ILE B CG1 1 
ATOM   2631 C CG2 . ILE B 1 183 ? 10.457 54.047 -13.681 1.00 27.88  ? 1376 ILE B CG2 1 
ATOM   2632 C CD1 . ILE B 1 183 ? 12.624 52.017 -13.074 1.00 28.93  ? 1376 ILE B CD1 1 
ATOM   2633 N N   . SER B 1 184 ? 12.067 56.756 -15.602 1.00 28.11  ? 1377 SER B N   1 
ATOM   2634 C CA  . SER B 1 184 ? 11.374 57.593 -16.577 1.00 27.11  ? 1377 SER B CA  1 
ATOM   2635 C C   . SER B 1 184 ? 11.914 57.328 -17.970 1.00 27.38  ? 1377 SER B C   1 
ATOM   2636 O O   . SER B 1 184 ? 11.144 57.207 -18.921 1.00 36.80  ? 1377 SER B O   1 
ATOM   2637 C CB  . SER B 1 184 ? 11.404 59.090 -16.240 1.00 22.37  ? 1377 SER B CB  1 
ATOM   2638 O OG  . SER B 1 184 ? 12.165 59.373 -15.089 1.00 42.33  ? 1377 SER B OG  1 
ATOM   2639 N N   . HIS B 1 185 ? 13.232 57.211 -18.089 1.00 27.56  ? 1378 HIS B N   1 
ATOM   2640 C CA  . HIS B 1 185 ? 13.835 56.843 -19.368 1.00 21.58  ? 1378 HIS B CA  1 
ATOM   2641 C C   . HIS B 1 185 ? 13.229 55.552 -19.924 1.00 26.47  ? 1378 HIS B C   1 
ATOM   2642 O O   . HIS B 1 185 ? 12.917 55.474 -21.109 1.00 28.08  ? 1378 HIS B O   1 
ATOM   2643 C CB  . HIS B 1 185 ? 15.347 56.702 -19.235 1.00 19.52  ? 1378 HIS B CB  1 
ATOM   2644 C CG  . HIS B 1 185 ? 15.995 56.056 -20.416 1.00 22.98  ? 1378 HIS B CG  1 
ATOM   2645 N ND1 . HIS B 1 185 ? 15.876 56.561 -21.690 1.00 34.19  ? 1378 HIS B ND1 1 
ATOM   2646 C CD2 . HIS B 1 185 ? 16.763 54.945 -20.519 1.00 28.70  ? 1378 HIS B CD2 1 
ATOM   2647 C CE1 . HIS B 1 185 ? 16.541 55.787 -22.532 1.00 31.34  ? 1378 HIS B CE1 1 
ATOM   2648 N NE2 . HIS B 1 185 ? 17.091 54.801 -21.846 1.00 29.63  ? 1378 HIS B NE2 1 
ATOM   2649 N N   . LEU B 1 186 ? 13.067 54.543 -19.072 1.00 25.22  ? 1379 LEU B N   1 
ATOM   2650 C CA  . LEU B 1 186 ? 12.482 53.282 -19.507 1.00 22.26  ? 1379 LEU B CA  1 
ATOM   2651 C C   . LEU B 1 186 ? 11.036 53.500 -19.867 1.00 22.29  ? 1379 LEU B C   1 
ATOM   2652 O O   . LEU B 1 186 ? 10.519 52.904 -20.805 1.00 32.87  ? 1379 LEU B O   1 
ATOM   2653 C CB  . LEU B 1 186 ? 12.579 52.211 -18.428 1.00 24.22  ? 1379 LEU B CB  1 
ATOM   2654 C CG  . LEU B 1 186 ? 13.985 51.723 -18.113 1.00 30.21  ? 1379 LEU B CG  1 
ATOM   2655 C CD1 . LEU B 1 186 ? 13.924 50.557 -17.135 1.00 26.62  ? 1379 LEU B CD1 1 
ATOM   2656 C CD2 . LEU B 1 186 ? 14.678 51.328 -19.409 1.00 32.13  ? 1379 LEU B CD2 1 
ATOM   2657 N N   . ASN B 1 187 ? 10.372 54.365 -19.126 1.00 20.77  ? 1380 ASN B N   1 
ATOM   2658 C CA  . ASN B 1 187 ? 8.990  54.655 -19.446 1.00 25.69  ? 1380 ASN B CA  1 
ATOM   2659 C C   . ASN B 1 187 ? 8.879  55.193 -20.869 1.00 31.98  ? 1380 ASN B C   1 
ATOM   2660 O O   . ASN B 1 187 ? 7.949  54.872 -21.615 1.00 29.67  ? 1380 ASN B O   1 
ATOM   2661 C CB  . ASN B 1 187 ? 8.417  55.667 -18.472 1.00 16.41  ? 1380 ASN B CB  1 
ATOM   2662 C CG  . ASN B 1 187 ? 7.023  56.076 -18.842 1.00 28.12  ? 1380 ASN B CG  1 
ATOM   2663 O OD1 . ASN B 1 187 ? 6.820  57.157 -19.402 1.00 30.30  ? 1380 ASN B OD1 1 
ATOM   2664 N ND2 . ASN B 1 187 ? 6.045  55.197 -18.576 1.00 20.68  ? 1380 ASN B ND2 1 
ATOM   2665 N N   . LYS B 1 188 ? 9.845  56.018 -21.241 1.00 26.10  ? 1381 LYS B N   1 
ATOM   2666 C CA  . LYS B 1 188 ? 9.871  56.599 -22.568 1.00 25.57  ? 1381 LYS B CA  1 
ATOM   2667 C C   . LYS B 1 188 ? 10.167 55.553 -23.651 1.00 28.41  ? 1381 LYS B C   1 
ATOM   2668 O O   . LYS B 1 188 ? 9.478  55.486 -24.664 1.00 24.95  ? 1381 LYS B O   1 
ATOM   2669 C CB  . LYS B 1 188 ? 10.870 57.757 -22.632 1.00 24.92  ? 1381 LYS B CB  1 
ATOM   2670 C CG  . LYS B 1 188 ? 10.793 58.529 -23.927 1.00 30.31  ? 1381 LYS B CG  1 
ATOM   2671 C CD  . LYS B 1 188 ? 11.888 59.549 -24.039 1.00 31.96  ? 1381 LYS B CD  1 
ATOM   2672 C CE  . LYS B 1 188 ? 11.615 60.757 -23.170 1.00 45.11  ? 1381 LYS B CE  1 
ATOM   2673 N NZ  . LYS B 1 188 ? 12.444 61.921 -23.611 1.00 64.52  ? 1381 LYS B NZ  1 
ATOM   2674 N N   . VAL B 1 189 ? 11.187 54.732 -23.439 1.00 30.49  ? 1382 VAL B N   1 
ATOM   2675 C CA  . VAL B 1 189 ? 11.481 53.677 -24.395 1.00 26.22  ? 1382 VAL B CA  1 
ATOM   2676 C C   . VAL B 1 189 ? 10.211 52.881 -24.653 1.00 25.63  ? 1382 VAL B C   1 
ATOM   2677 O O   . VAL B 1 189 ? 9.896  52.545 -25.796 1.00 23.26  ? 1382 VAL B O   1 
ATOM   2678 C CB  . VAL B 1 189 ? 12.577 52.742 -23.888 1.00 22.95  ? 1382 VAL B CB  1 
ATOM   2679 C CG1 . VAL B 1 189 ? 12.774 51.613 -24.862 1.00 21.35  ? 1382 VAL B CG1 1 
ATOM   2680 C CG2 . VAL B 1 189 ? 13.876 53.515 -23.693 1.00 23.02  ? 1382 VAL B CG2 1 
ATOM   2681 N N   . SER B 1 190 ? 9.463  52.617 -23.587 1.00 21.28  ? 1383 SER B N   1 
ATOM   2682 C CA  . SER B 1 190 ? 8.252  51.798 -23.684 1.00 24.79  ? 1383 SER B CA  1 
ATOM   2683 C C   . SER B 1 190 ? 7.139  52.452 -24.505 1.00 25.30  ? 1383 SER B C   1 
ATOM   2684 O O   . SER B 1 190 ? 6.231  51.768 -24.979 1.00 21.50  ? 1383 SER B O   1 
ATOM   2685 C CB  . SER B 1 190 ? 7.727  51.429 -22.293 1.00 23.09  ? 1383 SER B CB  1 
ATOM   2686 O OG  . SER B 1 190 ? 6.878  52.439 -21.783 1.00 23.61  ? 1383 SER B OG  1 
ATOM   2687 N N   . HIS B 1 191 ? 7.192  53.771 -24.666 1.00 24.74  ? 1384 HIS B N   1 
ATOM   2688 C CA  . HIS B 1 191 ? 6.171  54.444 -25.462 1.00 27.50  ? 1384 HIS B CA  1 
ATOM   2689 C C   . HIS B 1 191 ? 6.324  54.143 -26.955 1.00 34.66  ? 1384 HIS B C   1 
ATOM   2690 O O   . HIS B 1 191 ? 5.425  54.414 -27.748 1.00 33.55  ? 1384 HIS B O   1 
ATOM   2691 C CB  . HIS B 1 191 ? 6.167  55.955 -25.225 1.00 29.20  ? 1384 HIS B CB  1 
ATOM   2692 C CG  . HIS B 1 191 ? 5.686  56.352 -23.863 1.00 46.21  ? 1384 HIS B CG  1 
ATOM   2693 N ND1 . HIS B 1 191 ? 4.870  55.548 -23.098 1.00 30.94  ? 1384 HIS B ND1 1 
ATOM   2694 C CD2 . HIS B 1 191 ? 5.890  57.480 -23.140 1.00 47.20  ? 1384 HIS B CD2 1 
ATOM   2695 C CE1 . HIS B 1 191 ? 4.606  56.153 -21.954 1.00 42.91  ? 1384 HIS B CE1 1 
ATOM   2696 N NE2 . HIS B 1 191 ? 5.214  57.326 -21.953 1.00 54.71  ? 1384 HIS B NE2 1 
ATOM   2697 N N   . ASN B 1 192 ? 7.460  53.578 -27.341 1.00 25.31  ? 1385 ASN B N   1 
ATOM   2698 C CA  . ASN B 1 192 ? 7.665  53.233 -28.740 1.00 28.97  ? 1385 ASN B CA  1 
ATOM   2699 C C   . ASN B 1 192 ? 7.684  51.722 -28.961 1.00 35.92  ? 1385 ASN B C   1 
ATOM   2700 O O   . ASN B 1 192 ? 8.286  51.236 -29.914 1.00 26.70  ? 1385 ASN B O   1 
ATOM   2701 C CB  . ASN B 1 192 ? 8.952  53.872 -29.265 1.00 28.97  ? 1385 ASN B CB  1 
ATOM   2702 C CG  . ASN B 1 192 ? 8.954  54.040 -30.782 1.00 36.55  ? 1385 ASN B CG  1 
ATOM   2703 O OD1 . ASN B 1 192 ? 7.942  54.419 -31.389 1.00 33.18  ? 1385 ASN B OD1 1 
ATOM   2704 N ND2 . ASN B 1 192 ? 10.102 53.773 -31.400 1.00 24.19  ? 1385 ASN B ND2 1 
ATOM   2705 N N   . ASN B 1 193 ? 6.997  50.988 -28.086 1.00 40.90  ? 1386 ASN B N   1 
ATOM   2706 C CA  . ASN B 1 193 ? 7.029  49.522 -28.102 1.00 32.97  ? 1386 ASN B CA  1 
ATOM   2707 C C   . ASN B 1 193 ? 6.503  48.858 -29.382 1.00 32.83  ? 1386 ASN B C   1 
ATOM   2708 O O   . ASN B 1 193 ? 6.972  47.784 -29.742 1.00 32.78  ? 1386 ASN B O   1 
ATOM   2709 C CB  . ASN B 1 193 ? 6.354  48.927 -26.845 1.00 32.75  ? 1386 ASN B CB  1 
ATOM   2710 C CG  . ASN B 1 193 ? 4.849  49.084 -26.854 1.00 33.13  ? 1386 ASN B CG  1 
ATOM   2711 O OD1 . ASN B 1 193 ? 4.141  48.385 -27.589 1.00 31.80  ? 1386 ASN B OD1 1 
ATOM   2712 N ND2 . ASN B 1 193 ? 4.349  50.002 -26.032 1.00 34.10  ? 1386 ASN B ND2 1 
ATOM   2713 N N   . LYS B 1 194 ? 5.544  49.489 -30.062 1.00 33.60  ? 1387 LYS B N   1 
ATOM   2714 C CA  . LYS B 1 194 ? 5.061  48.987 -31.348 1.00 24.59  ? 1387 LYS B CA  1 
ATOM   2715 C C   . LYS B 1 194 ? 6.244  48.818 -32.284 1.00 33.85  ? 1387 LYS B C   1 
ATOM   2716 O O   . LYS B 1 194 ? 6.317  47.863 -33.053 1.00 35.26  ? 1387 LYS B O   1 
ATOM   2717 C CB  . LYS B 1 194 ? 4.083  49.956 -31.989 1.00 35.02  ? 1387 LYS B CB  1 
ATOM   2718 C CG  . LYS B 1 194 ? 2.908  50.343 -31.124 1.00 56.15  ? 1387 LYS B CG  1 
ATOM   2719 C CD  . LYS B 1 194 ? 1.708  49.451 -31.364 1.00 34.52  ? 1387 LYS B CD  1 
ATOM   2720 C CE  . LYS B 1 194 ? 0.428  50.266 -31.186 1.00 53.09  ? 1387 LYS B CE  1 
ATOM   2721 N NZ  . LYS B 1 194 ? -0.780 49.399 -31.145 1.00 69.11  ? 1387 LYS B NZ  1 
ATOM   2722 N N   . VAL B 1 195 ? 7.179  49.754 -32.209 1.00 34.72  ? 1388 VAL B N   1 
ATOM   2723 C CA  . VAL B 1 195 ? 8.370  49.694 -33.043 1.00 39.47  ? 1388 VAL B CA  1 
ATOM   2724 C C   . VAL B 1 195 ? 9.505  48.898 -32.399 1.00 38.23  ? 1388 VAL B C   1 
ATOM   2725 O O   . VAL B 1 195 ? 9.991  47.926 -32.978 1.00 48.56  ? 1388 VAL B O   1 
ATOM   2726 C CB  . VAL B 1 195 ? 8.874  51.109 -33.406 1.00 32.94  ? 1388 VAL B CB  1 
ATOM   2727 C CG1 . VAL B 1 195 ? 10.248 51.048 -34.049 1.00 19.49  ? 1388 VAL B CG1 1 
ATOM   2728 C CG2 . VAL B 1 195 ? 7.888  51.790 -34.325 1.00 38.08  ? 1388 VAL B CG2 1 
ATOM   2729 N N   . ASN B 1 196 ? 9.933  49.310 -31.211 1.00 28.13  ? 1389 ASN B N   1 
ATOM   2730 C CA  . ASN B 1 196 ? 11.129 48.727 -30.614 1.00 30.82  ? 1389 ASN B CA  1 
ATOM   2731 C C   . ASN B 1 196 ? 10.830 47.455 -29.843 1.00 26.71  ? 1389 ASN B C   1 
ATOM   2732 O O   . ASN B 1 196 ? 11.743 46.791 -29.376 1.00 25.19  ? 1389 ASN B O   1 
ATOM   2733 C CB  . ASN B 1 196 ? 11.872 49.746 -29.742 1.00 22.69  ? 1389 ASN B CB  1 
ATOM   2734 C CG  . ASN B 1 196 ? 11.052 50.208 -28.556 1.00 31.19  ? 1389 ASN B CG  1 
ATOM   2735 O OD1 . ASN B 1 196 ? 10.256 49.449 -27.987 1.00 30.75  ? 1389 ASN B OD1 1 
ATOM   2736 N ND2 . ASN B 1 196 ? 11.245 51.461 -28.169 1.00 27.63  ? 1389 ASN B ND2 1 
ATOM   2737 N N   . LEU B 1 197 ? 9.547  47.132 -29.712 1.00 26.45  ? 1390 LEU B N   1 
ATOM   2738 C CA  . LEU B 1 197 ? 9.112  45.847 -29.146 1.00 35.05  ? 1390 LEU B CA  1 
ATOM   2739 C C   . LEU B 1 197 ? 9.299  45.743 -27.642 1.00 35.66  ? 1390 LEU B C   1 
ATOM   2740 O O   . LEU B 1 197 ? 9.029  44.700 -27.044 1.00 37.36  ? 1390 LEU B O   1 
ATOM   2741 C CB  . LEU B 1 197 ? 9.841  44.669 -29.811 1.00 42.62  ? 1390 LEU B CB  1 
ATOM   2742 C CG  . LEU B 1 197 ? 9.769  44.522 -31.332 1.00 42.45  ? 1390 LEU B CG  1 
ATOM   2743 C CD1 . LEU B 1 197 ? 10.425 43.219 -31.734 1.00 33.44  ? 1390 LEU B CD1 1 
ATOM   2744 C CD2 . LEU B 1 197 ? 8.331  44.601 -31.845 1.00 22.37  ? 1390 LEU B CD2 1 
ATOM   2745 N N   . MET B 1 198 ? 9.775  46.818 -27.030 1.00 32.99  ? 1391 MET B N   1 
ATOM   2746 C CA  . MET B 1 198 ? 10.042 46.796 -25.600 1.00 31.29  ? 1391 MET B CA  1 
ATOM   2747 C C   . MET B 1 198 ? 8.920  47.438 -24.777 1.00 35.17  ? 1391 MET B C   1 
ATOM   2748 O O   . MET B 1 198 ? 8.988  48.618 -24.412 1.00 28.76  ? 1391 MET B O   1 
ATOM   2749 C CB  . MET B 1 198 ? 11.394 47.445 -25.307 1.00 24.67  ? 1391 MET B CB  1 
ATOM   2750 C CG  . MET B 1 198 ? 12.562 46.711 -25.958 1.00 33.29  ? 1391 MET B CG  1 
ATOM   2751 S SD  . MET B 1 198 ? 12.592 44.928 -25.613 1.00 34.23  ? 1391 MET B SD  1 
ATOM   2752 C CE  . MET B 1 198 ? 13.410 44.901 -24.035 1.00 20.14  ? 1391 MET B CE  1 
ATOM   2753 N N   . THR B 1 199 ? 7.878  46.654 -24.509 1.00 31.35  ? 1392 THR B N   1 
ATOM   2754 C CA  . THR B 1 199 ? 6.855  47.032 -23.535 1.00 37.69  ? 1392 THR B CA  1 
ATOM   2755 C C   . THR B 1 199 ? 7.458  47.185 -22.122 1.00 40.18  ? 1392 THR B C   1 
ATOM   2756 O O   . THR B 1 199 ? 8.579  46.732 -21.849 1.00 34.16  ? 1392 THR B O   1 
ATOM   2757 C CB  . THR B 1 199 ? 5.717  45.989 -23.482 1.00 38.98  ? 1392 THR B CB  1 
ATOM   2758 O OG1 . THR B 1 199 ? 6.265  44.676 -23.267 1.00 34.33  ? 1392 THR B OG1 1 
ATOM   2759 C CG2 . THR B 1 199 ? 4.927  45.999 -24.767 1.00 14.88  ? 1392 THR B CG2 1 
ATOM   2760 N N   . SER B 1 200 ? 6.721  47.825 -21.220 1.00 39.19  ? 1393 SER B N   1 
ATOM   2761 C CA  . SER B 1 200 ? 7.214  47.978 -19.856 1.00 38.38  ? 1393 SER B CA  1 
ATOM   2762 C C   . SER B 1 200 ? 7.482  46.616 -19.202 1.00 37.97  ? 1393 SER B C   1 
ATOM   2763 O O   . SER B 1 200 ? 8.434  46.468 -18.427 1.00 29.89  ? 1393 SER B O   1 
ATOM   2764 C CB  . SER B 1 200 ? 6.270  48.846 -19.020 1.00 27.46  ? 1393 SER B CB  1 
ATOM   2765 O OG  . SER B 1 200 ? 5.014  48.980 -19.664 1.00 60.60  ? 1393 SER B OG  1 
ATOM   2766 N N   . GLU B 1 201 ? 6.663  45.618 -19.525 1.00 37.78  ? 1394 GLU B N   1 
ATOM   2767 C CA  . GLU B 1 201 ? 6.934  44.267 -19.050 1.00 29.34  ? 1394 GLU B CA  1 
ATOM   2768 C C   . GLU B 1 201 ? 8.308  43.794 -19.516 1.00 37.03  ? 1394 GLU B C   1 
ATOM   2769 O O   . GLU B 1 201 ? 9.135  43.333 -18.712 1.00 30.56  ? 1394 GLU B O   1 
ATOM   2770 C CB  . GLU B 1 201 ? 5.882  43.291 -19.535 1.00 34.62  ? 1394 GLU B CB  1 
ATOM   2771 C CG  . GLU B 1 201 ? 6.218  41.829 -19.222 1.00 39.21  ? 1394 GLU B CG  1 
ATOM   2772 C CD  . GLU B 1 201 ? 5.109  40.880 -19.653 1.00 60.04  ? 1394 GLU B CD  1 
ATOM   2773 O OE1 . GLU B 1 201 ? 4.491  41.119 -20.717 1.00 69.08  ? 1394 GLU B OE1 1 
ATOM   2774 O OE2 . GLU B 1 201 ? 4.853  39.899 -18.927 1.00 56.54  ? 1394 GLU B OE2 1 
ATOM   2775 N N   . ASN B 1 202 ? 8.555  43.907 -20.818 1.00 33.62  ? 1395 ASN B N   1 
ATOM   2776 C CA  . ASN B 1 202 ? 9.861  43.531 -21.354 1.00 35.87  ? 1395 ASN B CA  1 
ATOM   2777 C C   . ASN B 1 202 ? 11.009 44.296 -20.694 1.00 35.67  ? 1395 ASN B C   1 
ATOM   2778 O O   . ASN B 1 202 ? 12.010 43.699 -20.277 1.00 35.15  ? 1395 ASN B O   1 
ATOM   2779 C CB  . ASN B 1 202 ? 9.902  43.695 -22.873 1.00 29.28  ? 1395 ASN B CB  1 
ATOM   2780 C CG  . ASN B 1 202 ? 9.050  42.670 -23.584 1.00 39.38  ? 1395 ASN B CG  1 
ATOM   2781 O OD1 . ASN B 1 202 ? 8.557  41.724 -22.962 1.00 37.33  ? 1395 ASN B OD1 1 
ATOM   2782 N ND2 . ASN B 1 202 ? 8.868  42.847 -24.893 1.00 36.35  ? 1395 ASN B ND2 1 
ATOM   2783 N N   . LEU B 1 203 ? 10.855 45.612 -20.583 1.00 31.89  ? 1396 LEU B N   1 
ATOM   2784 C CA  . LEU B 1 203 ? 11.903 46.436 -19.999 1.00 32.80  ? 1396 LEU B CA  1 
ATOM   2785 C C   . LEU B 1 203 ? 12.286 46.047 -18.564 1.00 36.81  ? 1396 LEU B C   1 
ATOM   2786 O O   . LEU B 1 203 ? 13.479 46.036 -18.224 1.00 35.00  ? 1396 LEU B O   1 
ATOM   2787 C CB  . LEU B 1 203 ? 11.535 47.907 -20.088 1.00 26.16  ? 1396 LEU B CB  1 
ATOM   2788 C CG  . LEU B 1 203 ? 11.687 48.404 -21.518 1.00 28.19  ? 1396 LEU B CG  1 
ATOM   2789 C CD1 . LEU B 1 203 ? 11.060 49.776 -21.670 1.00 31.81  ? 1396 LEU B CD1 1 
ATOM   2790 C CD2 . LEU B 1 203 ? 13.157 48.436 -21.908 1.00 24.59  ? 1396 LEU B CD2 1 
ATOM   2791 N N   . SER B 1 204 ? 11.299 45.726 -17.725 1.00 27.80  ? 1397 SER B N   1 
ATOM   2792 C CA  . SER B 1 204 ? 11.612 45.235 -16.375 1.00 39.15  ? 1397 SER B CA  1 
ATOM   2793 C C   . SER B 1 204 ? 12.331 43.884 -16.403 1.00 42.12  ? 1397 SER B C   1 
ATOM   2794 O O   . SER B 1 204 ? 13.190 43.620 -15.554 1.00 34.54  ? 1397 SER B O   1 
ATOM   2795 C CB  . SER B 1 204 ? 10.369 45.132 -15.499 1.00 28.36  ? 1397 SER B CB  1 
ATOM   2796 O OG  . SER B 1 204 ? 9.363  44.403 -16.168 1.00 52.38  ? 1397 SER B OG  1 
ATOM   2797 N N   . ILE B 1 205 ? 11.974 43.036 -17.370 1.00 33.33  ? 1398 ILE B N   1 
ATOM   2798 C CA  . ILE B 1 205 ? 12.672 41.769 -17.572 1.00 27.36  ? 1398 ILE B CA  1 
ATOM   2799 C C   . ILE B 1 205 ? 14.170 41.961 -17.842 1.00 33.30  ? 1398 ILE B C   1 
ATOM   2800 O O   . ILE B 1 205 ? 14.986 41.161 -17.387 1.00 39.77  ? 1398 ILE B O   1 
ATOM   2801 C CB  . ILE B 1 205 ? 12.044 40.953 -18.700 1.00 30.46  ? 1398 ILE B CB  1 
ATOM   2802 C CG1 . ILE B 1 205 ? 10.638 40.513 -18.297 1.00 26.07  ? 1398 ILE B CG1 1 
ATOM   2803 C CG2 . ILE B 1 205 ? 12.916 39.754 -19.045 1.00 21.17  ? 1398 ILE B CG2 1 
ATOM   2804 C CD1 . ILE B 1 205 ? 9.866  39.850 -19.399 1.00 26.12  ? 1398 ILE B CD1 1 
ATOM   2805 N N   . CYS B 1 206 ? 14.536 43.017 -18.566 1.00 24.34  ? 1399 CYS B N   1 
ATOM   2806 C CA  . CYS B 1 206 ? 15.951 43.333 -18.746 1.00 36.52  ? 1399 CYS B CA  1 
ATOM   2807 C C   . CYS B 1 206 ? 16.559 44.023 -17.527 1.00 42.76  ? 1399 CYS B C   1 
ATOM   2808 O O   . CYS B 1 206 ? 17.779 43.974 -17.325 1.00 40.73  ? 1399 CYS B O   1 
ATOM   2809 C CB  . CYS B 1 206 ? 16.164 44.249 -19.949 1.00 38.80  ? 1399 CYS B CB  1 
ATOM   2810 S SG  . CYS B 1 206 ? 15.230 43.796 -21.364 1.00 63.74  ? 1399 CYS B SG  1 
ATOM   2811 N N   . PHE B 1 207 ? 15.727 44.687 -16.727 1.00 29.95  ? 1400 PHE B N   1 
ATOM   2812 C CA  . PHE B 1 207 ? 16.275 45.588 -15.721 1.00 28.37  ? 1400 PHE B CA  1 
ATOM   2813 C C   . PHE B 1 207 ? 16.233 45.157 -14.256 1.00 34.80  ? 1400 PHE B C   1 
ATOM   2814 O O   . PHE B 1 207 ? 17.089 45.570 -13.472 1.00 33.47  ? 1400 PHE B O   1 
ATOM   2815 C CB  . PHE B 1 207 ? 15.714 46.996 -15.897 1.00 30.57  ? 1400 PHE B CB  1 
ATOM   2816 C CG  . PHE B 1 207 ? 16.540 47.849 -16.810 1.00 30.34  ? 1400 PHE B CG  1 
ATOM   2817 C CD1 . PHE B 1 207 ? 17.681 48.472 -16.344 1.00 33.27  ? 1400 PHE B CD1 1 
ATOM   2818 C CD2 . PHE B 1 207 ? 16.203 48.003 -18.135 1.00 26.23  ? 1400 PHE B CD2 1 
ATOM   2819 C CE1 . PHE B 1 207 ? 18.461 49.241 -17.178 1.00 23.96  ? 1400 PHE B CE1 1 
ATOM   2820 C CE2 . PHE B 1 207 ? 16.985 48.772 -18.969 1.00 28.30  ? 1400 PHE B CE2 1 
ATOM   2821 C CZ  . PHE B 1 207 ? 18.111 49.391 -18.484 1.00 27.25  ? 1400 PHE B CZ  1 
ATOM   2822 N N   . TRP B 1 208 ? 15.268 44.328 -13.872 1.00 31.55  ? 1401 TRP B N   1 
ATOM   2823 C CA  . TRP B 1 208 ? 15.118 44.050 -12.447 1.00 31.78  ? 1401 TRP B CA  1 
ATOM   2824 C C   . TRP B 1 208 ? 16.327 43.355 -11.832 1.00 29.52  ? 1401 TRP B C   1 
ATOM   2825 O O   . TRP B 1 208 ? 16.733 43.696 -10.728 1.00 35.95  ? 1401 TRP B O   1 
ATOM   2826 C CB  . TRP B 1 208 ? 13.788 43.365 -12.101 1.00 32.34  ? 1401 TRP B CB  1 
ATOM   2827 C CG  . TRP B 1 208 ? 13.669 41.950 -12.525 1.00 32.65  ? 1401 TRP B CG  1 
ATOM   2828 C CD1 . TRP B 1 208 ? 12.887 41.456 -13.531 1.00 34.02  ? 1401 TRP B CD1 1 
ATOM   2829 C CD2 . TRP B 1 208 ? 14.321 40.827 -11.934 1.00 33.76  ? 1401 TRP B CD2 1 
ATOM   2830 N NE1 . TRP B 1 208 ? 13.023 40.090 -13.610 1.00 38.58  ? 1401 TRP B NE1 1 
ATOM   2831 C CE2 . TRP B 1 208 ? 13.904 39.681 -12.642 1.00 39.25  ? 1401 TRP B CE2 1 
ATOM   2832 C CE3 . TRP B 1 208 ? 15.225 40.677 -10.880 1.00 33.35  ? 1401 TRP B CE3 1 
ATOM   2833 C CZ2 . TRP B 1 208 ? 14.370 38.411 -12.337 1.00 32.73  ? 1401 TRP B CZ2 1 
ATOM   2834 C CZ3 . TRP B 1 208 ? 15.681 39.417 -10.577 1.00 35.64  ? 1401 TRP B CZ3 1 
ATOM   2835 C CH2 . TRP B 1 208 ? 15.257 38.300 -11.305 1.00 38.85  ? 1401 TRP B CH2 1 
ATOM   2836 N N   . PRO B 1 209 ? 16.929 42.403 -12.550 1.00 30.48  ? 1402 PRO B N   1 
ATOM   2837 C CA  . PRO B 1 209 ? 18.153 41.805 -11.997 1.00 31.60  ? 1402 PRO B CA  1 
ATOM   2838 C C   . PRO B 1 209 ? 19.260 42.840 -11.816 1.00 32.16  ? 1402 PRO B C   1 
ATOM   2839 O O   . PRO B 1 209 ? 19.929 42.870 -10.788 1.00 42.71  ? 1402 PRO B O   1 
ATOM   2840 C CB  . PRO B 1 209 ? 18.568 40.798 -13.069 1.00 22.76  ? 1402 PRO B CB  1 
ATOM   2841 C CG  . PRO B 1 209 ? 17.288 40.481 -13.793 1.00 35.14  ? 1402 PRO B CG  1 
ATOM   2842 C CD  . PRO B 1 209 ? 16.536 41.781 -13.824 1.00 28.08  ? 1402 PRO B CD  1 
ATOM   2843 N N   . THR B 1 210 ? 19.447 43.690 -12.815 1.00 34.31  ? 1403 THR B N   1 
ATOM   2844 C CA  . THR B 1 210 ? 20.484 44.711 -12.756 1.00 35.34  ? 1403 THR B CA  1 
ATOM   2845 C C   . THR B 1 210 ? 20.258 45.721 -11.632 1.00 45.58  ? 1403 THR B C   1 
ATOM   2846 O O   . THR B 1 210 ? 21.203 46.090 -10.926 1.00 51.55  ? 1403 THR B O   1 
ATOM   2847 C CB  . THR B 1 210 ? 20.585 45.479 -14.083 1.00 44.87  ? 1403 THR B CB  1 
ATOM   2848 O OG1 . THR B 1 210 ? 20.766 44.554 -15.163 1.00 43.39  ? 1403 THR B OG1 1 
ATOM   2849 C CG2 . THR B 1 210 ? 21.748 46.439 -14.040 1.00 38.32  ? 1403 THR B CG2 1 
ATOM   2850 N N   . LEU B 1 211 ? 19.011 46.163 -11.467 1.00 37.34  ? 1404 LEU B N   1 
ATOM   2851 C CA  . LEU B 1 211 ? 18.686 47.198 -10.483 1.00 36.75  ? 1404 LEU B CA  1 
ATOM   2852 C C   . LEU B 1 211 ? 18.534 46.678 -9.048  1.00 38.79  ? 1404 LEU B C   1 
ATOM   2853 O O   . LEU B 1 211 ? 18.652 47.439 -8.078  1.00 40.35  ? 1404 LEU B O   1 
ATOM   2854 C CB  . LEU B 1 211 ? 17.433 47.965 -10.904 1.00 33.60  ? 1404 LEU B CB  1 
ATOM   2855 C CG  . LEU B 1 211 ? 17.544 48.705 -12.244 1.00 40.27  ? 1404 LEU B CG  1 
ATOM   2856 C CD1 . LEU B 1 211 ? 16.242 49.388 -12.594 1.00 22.94  ? 1404 LEU B CD1 1 
ATOM   2857 C CD2 . LEU B 1 211 ? 18.688 49.716 -12.224 1.00 35.03  ? 1404 LEU B CD2 1 
ATOM   2858 N N   . MET B 1 212 ? 18.295 45.381 -8.905  1.00 34.82  ? 1405 MET B N   1 
ATOM   2859 C CA  . MET B 1 212 ? 18.038 44.837 -7.581  1.00 31.75  ? 1405 MET B CA  1 
ATOM   2860 C C   . MET B 1 212 ? 19.014 43.761 -7.095  1.00 36.59  ? 1405 MET B C   1 
ATOM   2861 O O   . MET B 1 212 ? 19.232 43.643 -5.894  1.00 50.54  ? 1405 MET B O   1 
ATOM   2862 C CB  . MET B 1 212 ? 16.589 44.372 -7.481  1.00 28.45  ? 1405 MET B CB  1 
ATOM   2863 C CG  . MET B 1 212 ? 15.606 45.529 -7.591  1.00 31.04  ? 1405 MET B CG  1 
ATOM   2864 S SD  . MET B 1 212 ? 13.875 45.019 -7.658  1.00 34.34  ? 1405 MET B SD  1 
ATOM   2865 C CE  . MET B 1 212 ? 13.081 46.518 -7.109  1.00 56.02  ? 1405 MET B CE  1 
ATOM   2866 N N   . ARG B 1 213 ? 19.608 42.992 -8.004  1.00 31.91  ? 1406 ARG B N   1 
ATOM   2867 C CA  . ARG B 1 213 ? 20.600 41.992 -7.608  1.00 33.07  ? 1406 ARG B CA  1 
ATOM   2868 C C   . ARG B 1 213 ? 20.092 41.056 -6.524  1.00 52.63  ? 1406 ARG B C   1 
ATOM   2869 O O   . ARG B 1 213 ? 20.739 40.907 -5.485  1.00 51.47  ? 1406 ARG B O   1 
ATOM   2870 C CB  . ARG B 1 213 ? 21.850 42.671 -7.061  1.00 26.72  ? 1406 ARG B CB  1 
ATOM   2871 C CG  . ARG B 1 213 ? 22.931 42.856 -8.063  1.00 48.12  ? 1406 ARG B CG  1 
ATOM   2872 C CD  . ARG B 1 213 ? 24.275 42.661 -7.418  1.00 27.63  ? 1406 ARG B CD  1 
ATOM   2873 N NE  . ARG B 1 213 ? 24.737 43.847 -6.713  1.00 45.80  ? 1406 ARG B NE  1 
ATOM   2874 C CZ  . ARG B 1 213 ? 25.103 44.969 -7.320  1.00 43.60  ? 1406 ARG B CZ  1 
ATOM   2875 N NH1 . ARG B 1 213 ? 25.024 45.065 -8.639  1.00 43.49  ? 1406 ARG B NH1 1 
ATOM   2876 N NH2 . ARG B 1 213 ? 25.533 45.996 -6.609  1.00 44.54  ? 1406 ARG B NH2 1 
ATOM   2877 N N   . PRO B 1 214 ? 18.936 40.422 -6.747  1.00 48.07  ? 1407 PRO B N   1 
ATOM   2878 C CA  . PRO B 1 214 ? 18.381 39.546 -5.708  1.00 46.33  ? 1407 PRO B CA  1 
ATOM   2879 C C   . PRO B 1 214 ? 19.281 38.354 -5.423  1.00 56.79  ? 1407 PRO B C   1 
ATOM   2880 O O   . PRO B 1 214 ? 20.101 37.982 -6.277  1.00 62.55  ? 1407 PRO B O   1 
ATOM   2881 C CB  . PRO B 1 214 ? 17.079 39.043 -6.334  1.00 64.70  ? 1407 PRO B CB  1 
ATOM   2882 C CG  . PRO B 1 214 ? 16.770 40.008 -7.431  1.00 60.19  ? 1407 PRO B CG  1 
ATOM   2883 C CD  . PRO B 1 214 ? 18.101 40.447 -7.956  1.00 51.25  ? 1407 PRO B CD  1 
ATOM   2884 N N   . ASP B 1 215 ? 19.092 37.742 -4.253  1.00 56.52  ? 1408 ASP B N   1 
ATOM   2885 C CA  . ASP B 1 215 ? 19.857 36.551 -3.884  1.00 87.93  ? 1408 ASP B CA  1 
ATOM   2886 C C   . ASP B 1 215 ? 18.948 35.377 -3.520  1.00 74.92  ? 1408 ASP B C   1 
ATOM   2887 O O   . ASP B 1 215 ? 17.853 35.226 -4.064  1.00 54.55  ? 1408 ASP B O   1 
ATOM   2888 C CB  . ASP B 1 215 ? 20.817 36.859 -2.727  1.00 102.99 ? 1408 ASP B CB  1 
ATOM   2889 C CG  . ASP B 1 215 ? 22.096 36.032 -2.787  1.00 103.37 ? 1408 ASP B CG  1 
ATOM   2890 O OD1 . ASP B 1 215 ? 22.216 35.179 -3.697  1.00 98.34  ? 1408 ASP B OD1 1 
ATOM   2891 O OD2 . ASP B 1 215 ? 22.984 36.244 -1.929  1.00 66.76  ? 1408 ASP B OD2 1 
ATOM   2892 N N   . MET B 1 219 ? 13.161 33.045 -2.108  1.00 57.85  ? 1412 MET B N   1 
ATOM   2893 C CA  . MET B 1 219 ? 11.842 32.530 -2.460  1.00 63.33  ? 1412 MET B CA  1 
ATOM   2894 C C   . MET B 1 219 ? 11.958 31.403 -3.495  1.00 59.35  ? 1412 MET B C   1 
ATOM   2895 O O   . MET B 1 219 ? 13.006 30.770 -3.632  1.00 42.76  ? 1412 MET B O   1 
ATOM   2896 C CB  . MET B 1 219 ? 10.962 33.664 -3.001  1.00 42.53  ? 1412 MET B CB  1 
ATOM   2897 C CG  . MET B 1 219 ? 11.009 34.944 -2.167  1.00 65.56  ? 1412 MET B CG  1 
ATOM   2898 S SD  . MET B 1 219 ? 10.831 36.478 -3.129  1.00 84.75  ? 1412 MET B SD  1 
ATOM   2899 C CE  . MET B 1 219 ? 9.051  36.651 -3.284  1.00 27.21  ? 1412 MET B CE  1 
ATOM   2900 N N   . ASP B 1 220 ? 10.871 31.144 -4.212  1.00 57.02  ? 1413 ASP B N   1 
ATOM   2901 C CA  . ASP B 1 220 ? 10.926 30.285 -5.384  1.00 44.39  ? 1413 ASP B CA  1 
ATOM   2902 C C   . ASP B 1 220 ? 11.445 31.121 -6.560  1.00 57.92  ? 1413 ASP B C   1 
ATOM   2903 O O   . ASP B 1 220 ? 11.116 32.305 -6.675  1.00 45.87  ? 1413 ASP B O   1 
ATOM   2904 C CB  . ASP B 1 220 ? 9.530  29.735 -5.699  1.00 33.90  ? 1413 ASP B CB  1 
ATOM   2905 C CG  . ASP B 1 220 ? 9.529  28.757 -6.885  1.00 78.61  ? 1413 ASP B CG  1 
ATOM   2906 O OD1 . ASP B 1 220 ? 10.494 28.766 -7.684  1.00 81.18  ? 1413 ASP B OD1 1 
ATOM   2907 O OD2 . ASP B 1 220 ? 8.561  27.973 -7.025  1.00 64.49  ? 1413 ASP B OD2 1 
ATOM   2908 N N   . ALA B 1 221 ? 12.259 30.518 -7.425  1.00 45.86  ? 1414 ALA B N   1 
ATOM   2909 C CA  . ALA B 1 221 ? 12.700 31.200 -8.640  1.00 42.36  ? 1414 ALA B CA  1 
ATOM   2910 C C   . ALA B 1 221 ? 11.547 31.861 -9.413  1.00 46.32  ? 1414 ALA B C   1 
ATOM   2911 O O   . ALA B 1 221 ? 11.589 33.063 -9.669  1.00 42.05  ? 1414 ALA B O   1 
ATOM   2912 C CB  . ALA B 1 221 ? 13.474 30.255 -9.550  1.00 39.97  ? 1414 ALA B CB  1 
ATOM   2913 N N   . LEU B 1 222 ? 10.522 31.097 -9.792  1.00 39.67  ? 1415 LEU B N   1 
ATOM   2914 C CA  . LEU B 1 222 ? 9.447  31.688 -10.601 1.00 46.39  ? 1415 LEU B CA  1 
ATOM   2915 C C   . LEU B 1 222 ? 8.586  32.651 -9.787  1.00 37.84  ? 1415 LEU B C   1 
ATOM   2916 O O   . LEU B 1 222 ? 8.141  33.670 -10.303 1.00 40.92  ? 1415 LEU B O   1 
ATOM   2917 C CB  . LEU B 1 222 ? 8.593  30.639 -11.346 1.00 34.89  ? 1415 LEU B CB  1 
ATOM   2918 N N   . THR B 1 223 ? 8.363  32.345 -8.513  1.00 58.90  ? 1416 THR B N   1 
ATOM   2919 C CA  . THR B 1 223 ? 7.659  33.285 -7.645  1.00 65.68  ? 1416 THR B CA  1 
ATOM   2920 C C   . THR B 1 223 ? 8.435  34.610 -7.561  1.00 49.93  ? 1416 THR B C   1 
ATOM   2921 O O   . THR B 1 223 ? 7.908  35.668 -7.889  1.00 33.86  ? 1416 THR B O   1 
ATOM   2922 C CB  . THR B 1 223 ? 7.416  32.703 -6.232  1.00 43.45  ? 1416 THR B CB  1 
ATOM   2923 N N   . ALA B 1 224 ? 9.697  34.535 -7.149  1.00 53.86  ? 1417 ALA B N   1 
ATOM   2924 C CA  . ALA B 1 224 ? 10.534 35.721 -6.976  1.00 49.46  ? 1417 ALA B CA  1 
ATOM   2925 C C   . ALA B 1 224 ? 10.830 36.450 -8.291  1.00 56.34  ? 1417 ALA B C   1 
ATOM   2926 O O   . ALA B 1 224 ? 11.015 37.673 -8.314  1.00 44.29  ? 1417 ALA B O   1 
ATOM   2927 C CB  . ALA B 1 224 ? 11.826 35.341 -6.284  1.00 44.70  ? 1417 ALA B CB  1 
ATOM   2928 N N   . THR B 1 225 ? 10.905 35.693 -9.381  1.00 48.08  ? 1418 THR B N   1 
ATOM   2929 C CA  . THR B 1 225 ? 11.008 36.295 -10.698 1.00 44.16  ? 1418 THR B CA  1 
ATOM   2930 C C   . THR B 1 225 ? 9.731  37.091 -10.991 1.00 41.87  ? 1418 THR B C   1 
ATOM   2931 O O   . THR B 1 225 ? 9.782  38.284 -11.295 1.00 38.90  ? 1418 THR B O   1 
ATOM   2932 C CB  . THR B 1 225 ? 11.278 35.241 -11.794 1.00 34.93  ? 1418 THR B CB  1 
ATOM   2933 O OG1 . THR B 1 225 ? 12.609 34.723 -11.639 1.00 46.71  ? 1418 THR B OG1 1 
ATOM   2934 C CG2 . THR B 1 225 ? 11.162 35.865 -13.178 1.00 42.22  ? 1418 THR B CG2 1 
ATOM   2935 N N   . ARG B 1 226 ? 8.579  36.446 -10.874 1.00 34.14  ? 1419 ARG B N   1 
ATOM   2936 C CA  . ARG B 1 226 ? 7.323  37.143 -11.146 1.00 34.70  ? 1419 ARG B CA  1 
ATOM   2937 C C   . ARG B 1 226 ? 7.185  38.394 -10.276 1.00 39.31  ? 1419 ARG B C   1 
ATOM   2938 O O   . ARG B 1 226 ? 6.689  39.429 -10.728 1.00 37.24  ? 1419 ARG B O   1 
ATOM   2939 C CB  . ARG B 1 226 ? 6.106  36.221 -10.964 1.00 22.26  ? 1419 ARG B CB  1 
ATOM   2940 N N   . THR B 1 227 ? 7.644  38.295 -9.032  1.00 42.85  ? 1420 THR B N   1 
ATOM   2941 C CA  . THR B 1 227 ? 7.449  39.359 -8.056  1.00 39.05  ? 1420 THR B CA  1 
ATOM   2942 C C   . THR B 1 227 ? 8.251  40.606 -8.411  1.00 45.11  ? 1420 THR B C   1 
ATOM   2943 O O   . THR B 1 227 ? 7.691  41.704 -8.485  1.00 42.39  ? 1420 THR B O   1 
ATOM   2944 C CB  . THR B 1 227 ? 7.797  38.889 -6.627  1.00 39.15  ? 1420 THR B CB  1 
ATOM   2945 O OG1 . THR B 1 227 ? 6.766  38.017 -6.156  1.00 49.06  ? 1420 THR B OG1 1 
ATOM   2946 C CG2 . THR B 1 227 ? 7.912  40.071 -5.677  1.00 26.86  ? 1420 THR B CG2 1 
ATOM   2947 N N   . TYR B 1 228 ? 9.555  40.439 -8.633  1.00 39.34  ? 1421 TYR B N   1 
ATOM   2948 C CA  . TYR B 1 228 ? 10.404 41.568 -8.994  1.00 34.29  ? 1421 TYR B CA  1 
ATOM   2949 C C   . TYR B 1 228 ? 10.044 42.127 -10.362 1.00 33.83  ? 1421 TYR B C   1 
ATOM   2950 O O   . TYR B 1 228 ? 10.033 43.344 -10.573 1.00 39.15  ? 1421 TYR B O   1 
ATOM   2951 C CB  . TYR B 1 228 ? 11.873 41.178 -8.964  1.00 35.01  ? 1421 TYR B CB  1 
ATOM   2952 C CG  . TYR B 1 228 ? 12.362 40.867 -7.577  1.00 41.98  ? 1421 TYR B CG  1 
ATOM   2953 C CD1 . TYR B 1 228 ? 12.914 39.629 -7.272  1.00 64.09  ? 1421 TYR B CD1 1 
ATOM   2954 C CD2 . TYR B 1 228 ? 12.261 41.803 -6.568  1.00 35.86  ? 1421 TYR B CD2 1 
ATOM   2955 C CE1 . TYR B 1 228 ? 13.361 39.336 -5.998  1.00 60.47  ? 1421 TYR B CE1 1 
ATOM   2956 C CE2 . TYR B 1 228 ? 12.703 41.524 -5.297  1.00 50.95  ? 1421 TYR B CE2 1 
ATOM   2957 C CZ  . TYR B 1 228 ? 13.250 40.285 -5.016  1.00 54.93  ? 1421 TYR B CZ  1 
ATOM   2958 O OH  . TYR B 1 228 ? 13.695 39.990 -3.751  1.00 62.51  ? 1421 TYR B OH  1 
ATOM   2959 N N   . GLN B 1 229 ? 9.739  41.238 -11.296 1.00 32.24  ? 1422 GLN B N   1 
ATOM   2960 C CA  . GLN B 1 229 ? 9.389  41.668 -12.639 1.00 36.70  ? 1422 GLN B CA  1 
ATOM   2961 C C   . GLN B 1 229 ? 8.205  42.630 -12.566 1.00 36.67  ? 1422 GLN B C   1 
ATOM   2962 O O   . GLN B 1 229 ? 8.269  43.746 -13.084 1.00 34.40  ? 1422 GLN B O   1 
ATOM   2963 C CB  . GLN B 1 229 ? 9.081  40.461 -13.520 1.00 36.88  ? 1422 GLN B CB  1 
ATOM   2964 C CG  . GLN B 1 229 ? 8.263  40.760 -14.763 1.00 35.72  ? 1422 GLN B CG  1 
ATOM   2965 C CD  . GLN B 1 229 ? 8.014  39.507 -15.599 1.00 67.53  ? 1422 GLN B CD  1 
ATOM   2966 O OE1 . GLN B 1 229 ? 8.642  38.453 -15.387 1.00 50.20  ? 1422 GLN B OE1 1 
ATOM   2967 N NE2 . GLN B 1 229 ? 7.095  39.617 -16.559 1.00 67.95  ? 1422 GLN B NE2 1 
ATOM   2968 N N   . THR B 1 230 ? 7.143  42.209 -11.884 1.00 30.28  ? 1423 THR B N   1 
ATOM   2969 C CA  . THR B 1 230 ? 5.945  43.034 -11.776 1.00 35.64  ? 1423 THR B CA  1 
ATOM   2970 C C   . THR B 1 230 ? 6.202  44.343 -11.037 1.00 35.91  ? 1423 THR B C   1 
ATOM   2971 O O   . THR B 1 230 ? 5.662  45.387 -11.406 1.00 40.41  ? 1423 THR B O   1 
ATOM   2972 C CB  . THR B 1 230 ? 4.779  42.289 -11.099 1.00 35.81  ? 1423 THR B CB  1 
ATOM   2973 O OG1 . THR B 1 230 ? 4.524  41.067 -11.798 1.00 38.24  ? 1423 THR B OG1 1 
ATOM   2974 C CG2 . THR B 1 230 ? 3.521  43.141 -11.149 1.00 40.05  ? 1423 THR B CG2 1 
ATOM   2975 N N   . ILE B 1 231 ? 7.024  44.299 -9.996  1.00 29.36  ? 1424 ILE B N   1 
ATOM   2976 C CA  . ILE B 1 231 ? 7.277  45.513 -9.237  1.00 32.87  ? 1424 ILE B CA  1 
ATOM   2977 C C   . ILE B 1 231 ? 7.888  46.565 -10.148 1.00 27.71  ? 1424 ILE B C   1 
ATOM   2978 O O   . ILE B 1 231 ? 7.376  47.671 -10.257 1.00 27.40  ? 1424 ILE B O   1 
ATOM   2979 C CB  . ILE B 1 231 ? 8.146  45.263 -7.986  1.00 41.51  ? 1424 ILE B CB  1 
ATOM   2980 C CG1 . ILE B 1 231 ? 7.358  44.448 -6.953  1.00 34.58  ? 1424 ILE B CG1 1 
ATOM   2981 C CG2 . ILE B 1 231 ? 8.602  46.583 -7.363  1.00 24.60  ? 1424 ILE B CG2 1 
ATOM   2982 C CD1 . ILE B 1 231 ? 8.140  44.113 -5.710  1.00 26.97  ? 1424 ILE B CD1 1 
ATOM   2983 N N   . ILE B 1 232 ? 8.959  46.206 -10.838 1.00 27.21  ? 1425 ILE B N   1 
ATOM   2984 C CA  . ILE B 1 232 ? 9.604  47.148 -11.747 1.00 27.13  ? 1425 ILE B CA  1 
ATOM   2985 C C   . ILE B 1 232 ? 8.676  47.563 -12.901 1.00 29.60  ? 1425 ILE B C   1 
ATOM   2986 O O   . ILE B 1 232 ? 8.702  48.718 -13.337 1.00 31.88  ? 1425 ILE B O   1 
ATOM   2987 C CB  . ILE B 1 232 ? 10.946 46.587 -12.278 1.00 29.41  ? 1425 ILE B CB  1 
ATOM   2988 C CG1 . ILE B 1 232 ? 11.923 46.395 -11.125 1.00 33.54  ? 1425 ILE B CG1 1 
ATOM   2989 C CG2 . ILE B 1 232 ? 11.594 47.536 -13.267 1.00 18.76  ? 1425 ILE B CG2 1 
ATOM   2990 C CD1 . ILE B 1 232 ? 12.400 47.704 -10.519 1.00 27.55  ? 1425 ILE B CD1 1 
ATOM   2991 N N   . GLU B 1 233 ? 7.848  46.630 -13.377 1.00 26.11  ? 1426 GLU B N   1 
ATOM   2992 C CA  . GLU B 1 233 ? 6.916  46.925 -14.462 1.00 26.35  ? 1426 GLU B CA  1 
ATOM   2993 C C   . GLU B 1 233 ? 5.970  48.034 -14.035 1.00 32.14  ? 1426 GLU B C   1 
ATOM   2994 O O   . GLU B 1 233 ? 5.635  48.915 -14.837 1.00 31.25  ? 1426 GLU B O   1 
ATOM   2995 C CB  . GLU B 1 233 ? 6.133  45.678 -14.883 1.00 24.73  ? 1426 GLU B CB  1 
ATOM   2996 C CG  . GLU B 1 233 ? 5.020  45.927 -15.906 1.00 38.44  ? 1426 GLU B CG  1 
ATOM   2997 C CD  . GLU B 1 233 ? 4.370  44.628 -16.396 1.00 62.98  ? 1426 GLU B CD  1 
ATOM   2998 O OE1 . GLU B 1 233 ? 3.320  44.690 -17.085 1.00 50.02  ? 1426 GLU B OE1 1 
ATOM   2999 O OE2 . GLU B 1 233 ? 4.919  43.539 -16.091 1.00 62.99  ? 1426 GLU B OE2 1 
ATOM   3000 N N   . LEU B 1 234 ? 5.558  47.994 -12.767 1.00 25.02  ? 1427 LEU B N   1 
ATOM   3001 C CA  . LEU B 1 234 ? 4.648  48.995 -12.226 1.00 25.15  ? 1427 LEU B CA  1 
ATOM   3002 C C   . LEU B 1 234 ? 5.332  50.353 -12.133 1.00 31.76  ? 1427 LEU B C   1 
ATOM   3003 O O   . LEU B 1 234 ? 4.737  51.389 -12.444 1.00 30.92  ? 1427 LEU B O   1 
ATOM   3004 C CB  . LEU B 1 234 ? 4.118  48.566 -10.862 1.00 20.38  ? 1427 LEU B CB  1 
ATOM   3005 C CG  . LEU B 1 234 ? 3.128  47.403 -10.914 1.00 23.60  ? 1427 LEU B CG  1 
ATOM   3006 C CD1 . LEU B 1 234 ? 2.844  46.853 -9.526  1.00 26.02  ? 1427 LEU B CD1 1 
ATOM   3007 C CD2 . LEU B 1 234 ? 1.844  47.838 -11.592 1.00 16.76  ? 1427 LEU B CD2 1 
ATOM   3008 N N   . PHE B 1 235 ? 6.589  50.352 -11.715 1.00 23.31  ? 1428 PHE B N   1 
ATOM   3009 C CA  . PHE B 1 235 ? 7.297  51.604 -11.574 1.00 25.52  ? 1428 PHE B CA  1 
ATOM   3010 C C   . PHE B 1 235 ? 7.463  52.228 -12.941 1.00 33.40  ? 1428 PHE B C   1 
ATOM   3011 O O   . PHE B 1 235 ? 7.447  53.456 -13.085 1.00 34.18  ? 1428 PHE B O   1 
ATOM   3012 C CB  . PHE B 1 235 ? 8.654  51.388 -10.923 1.00 30.41  ? 1428 PHE B CB  1 
ATOM   3013 C CG  . PHE B 1 235 ? 8.598  51.327 -9.432  1.00 34.36  ? 1428 PHE B CG  1 
ATOM   3014 C CD1 . PHE B 1 235 ? 8.949  50.171 -8.758  1.00 36.39  ? 1428 PHE B CD1 1 
ATOM   3015 C CD2 . PHE B 1 235 ? 8.185  52.422 -8.706  1.00 28.89  ? 1428 PHE B CD2 1 
ATOM   3016 C CE1 . PHE B 1 235 ? 8.887  50.110 -7.390  1.00 23.24  ? 1428 PHE B CE1 1 
ATOM   3017 C CE2 . PHE B 1 235 ? 8.122  52.364 -7.337  1.00 36.46  ? 1428 PHE B CE2 1 
ATOM   3018 C CZ  . PHE B 1 235 ? 8.474  51.199 -6.680  1.00 30.24  ? 1428 PHE B CZ  1 
ATOM   3019 N N   . ILE B 1 236 ? 7.624  51.378 -13.949 1.00 29.04  ? 1429 ILE B N   1 
ATOM   3020 C CA  . ILE B 1 236 ? 7.822  51.865 -15.303 1.00 25.21  ? 1429 ILE B CA  1 
ATOM   3021 C C   . ILE B 1 236 ? 6.505  52.368 -15.869 1.00 25.39  ? 1429 ILE B C   1 
ATOM   3022 O O   . ILE B 1 236 ? 6.438  53.451 -16.445 1.00 27.60  ? 1429 ILE B O   1 
ATOM   3023 C CB  . ILE B 1 236 ? 8.421  50.782 -16.214 1.00 23.78  ? 1429 ILE B CB  1 
ATOM   3024 C CG1 . ILE B 1 236 ? 9.865  50.487 -15.797 1.00 21.63  ? 1429 ILE B CG1 1 
ATOM   3025 C CG2 . ILE B 1 236 ? 8.360  51.210 -17.671 1.00 17.72  ? 1429 ILE B CG2 1 
ATOM   3026 C CD1 . ILE B 1 236 ? 10.518 49.395 -16.595 1.00 22.25  ? 1429 ILE B CD1 1 
ATOM   3027 N N   . GLN B 1 237 ? 5.446  51.592 -15.684 1.00 28.04  ? 1430 GLN B N   1 
ATOM   3028 C CA  . GLN B 1 237 ? 4.180  51.924 -16.321 1.00 23.06  ? 1430 GLN B CA  1 
ATOM   3029 C C   . GLN B 1 237 ? 3.481  53.027 -15.582 1.00 23.96  ? 1430 GLN B C   1 
ATOM   3030 O O   . GLN B 1 237 ? 2.770  53.818 -16.180 1.00 25.49  ? 1430 GLN B O   1 
ATOM   3031 C CB  . GLN B 1 237 ? 3.269  50.713 -16.399 1.00 24.65  ? 1430 GLN B CB  1 
ATOM   3032 C CG  . GLN B 1 237 ? 2.025  50.957 -17.213 1.00 43.56  ? 1430 GLN B CG  1 
ATOM   3033 C CD  . GLN B 1 237 ? 1.368  49.669 -17.644 1.00 80.78  ? 1430 GLN B CD  1 
ATOM   3034 O OE1 . GLN B 1 237 ? 1.543  48.620 -17.008 1.00 68.22  ? 1430 GLN B OE1 1 
ATOM   3035 N NE2 . GLN B 1 237 ? 0.609  49.733 -18.736 1.00 86.27  ? 1430 GLN B NE2 1 
ATOM   3036 N N   . GLN B 1 238 ? 3.669  53.068 -14.272 1.00 22.28  ? 1431 GLN B N   1 
ATOM   3037 C CA  . GLN B 1 238 ? 3.027  54.095 -13.474 1.00 25.04  ? 1431 GLN B CA  1 
ATOM   3038 C C   . GLN B 1 238 ? 4.014  55.191 -13.085 1.00 26.63  ? 1431 GLN B C   1 
ATOM   3039 O O   . GLN B 1 238 ? 3.832  55.905 -12.101 1.00 31.34  ? 1431 GLN B O   1 
ATOM   3040 C CB  . GLN B 1 238 ? 2.330  53.490 -12.261 1.00 18.99  ? 1431 GLN B CB  1 
ATOM   3041 C CG  . GLN B 1 238 ? 1.431  52.309 -12.596 1.00 21.14  ? 1431 GLN B CG  1 
ATOM   3042 C CD  . GLN B 1 238 ? 0.431  52.581 -13.719 1.00 20.45  ? 1431 GLN B CD  1 
ATOM   3043 O OE1 . GLN B 1 238 ? -0.011 51.653 -14.402 1.00 27.54  ? 1431 GLN B OE1 1 
ATOM   3044 N NE2 . GLN B 1 238 ? 0.060  53.848 -13.903 1.00 34.99  ? 1431 GLN B NE2 1 
ATOM   3045 N N   . CYS B 1 239 ? 5.053  55.316 -13.897 1.00 24.68  ? 1432 CYS B N   1 
ATOM   3046 C CA  . CYS B 1 239 ? 6.064  56.345 -13.731 1.00 26.18  ? 1432 CYS B CA  1 
ATOM   3047 C C   . CYS B 1 239 ? 5.472  57.694 -13.283 1.00 36.73  ? 1432 CYS B C   1 
ATOM   3048 O O   . CYS B 1 239 ? 5.953  58.280 -12.306 1.00 33.98  ? 1432 CYS B O   1 
ATOM   3049 C CB  . CYS B 1 239 ? 6.844  56.500 -15.044 1.00 24.66  ? 1432 CYS B CB  1 
ATOM   3050 S SG  . CYS B 1 239 ? 8.260  57.623 -15.000 1.00 31.01  ? 1432 CYS B SG  1 
ATOM   3051 N N   . PRO B 1 240 ? 4.433  58.199 -13.993 1.00 31.65  ? 1433 PRO B N   1 
ATOM   3052 C CA  . PRO B 1 240 ? 3.872  59.507 -13.616 1.00 33.35  ? 1433 PRO B CA  1 
ATOM   3053 C C   . PRO B 1 240 ? 3.350  59.547 -12.169 1.00 35.26  ? 1433 PRO B C   1 
ATOM   3054 O O   . PRO B 1 240 ? 3.568  60.512 -11.432 1.00 34.84  ? 1433 PRO B O   1 
ATOM   3055 C CB  . PRO B 1 240 ? 2.715  59.703 -14.610 1.00 24.73  ? 1433 PRO B CB  1 
ATOM   3056 C CG  . PRO B 1 240 ? 3.038  58.830 -15.769 1.00 29.98  ? 1433 PRO B CG  1 
ATOM   3057 C CD  . PRO B 1 240 ? 3.786  57.648 -15.203 1.00 32.02  ? 1433 PRO B CD  1 
ATOM   3058 N N   . PHE B 1 241 ? 2.667  58.487 -11.766 1.00 31.12  ? 1434 PHE B N   1 
ATOM   3059 C CA  . PHE B 1 241 ? 2.103  58.418 -10.434 1.00 25.21  ? 1434 PHE B CA  1 
ATOM   3060 C C   . PHE B 1 241 ? 3.210  58.380 -9.402  1.00 31.70  ? 1434 PHE B C   1 
ATOM   3061 O O   . PHE B 1 241 ? 3.110  58.995 -8.340  1.00 32.86  ? 1434 PHE B O   1 
ATOM   3062 C CB  . PHE B 1 241 ? 1.223  57.179 -10.315 1.00 33.98  ? 1434 PHE B CB  1 
ATOM   3063 C CG  . PHE B 1 241 ? 0.809  56.855 -8.916  1.00 35.72  ? 1434 PHE B CG  1 
ATOM   3064 C CD1 . PHE B 1 241 ? -0.249 57.522 -8.322  1.00 33.15  ? 1434 PHE B CD1 1 
ATOM   3065 C CD2 . PHE B 1 241 ? 1.466  55.865 -8.202  1.00 35.69  ? 1434 PHE B CD2 1 
ATOM   3066 C CE1 . PHE B 1 241 ? -0.630 57.225 -7.035  1.00 32.68  ? 1434 PHE B CE1 1 
ATOM   3067 C CE2 . PHE B 1 241 ? 1.085  55.553 -6.914  1.00 35.84  ? 1434 PHE B CE2 1 
ATOM   3068 C CZ  . PHE B 1 241 ? 0.037  56.235 -6.325  1.00 37.84  ? 1434 PHE B CZ  1 
ATOM   3069 N N   . PHE B 1 242 ? 4.278  57.664 -9.718  1.00 32.30  ? 1435 PHE B N   1 
ATOM   3070 C CA  . PHE B 1 242 ? 5.381  57.509 -8.778  1.00 30.33  ? 1435 PHE B CA  1 
ATOM   3071 C C   . PHE B 1 242 ? 6.347  58.685 -8.754  1.00 35.90  ? 1435 PHE B C   1 
ATOM   3072 O O   . PHE B 1 242 ? 7.006  58.896 -7.736  1.00 34.86  ? 1435 PHE B O   1 
ATOM   3073 C CB  . PHE B 1 242 ? 6.178  56.240 -9.069  1.00 25.46  ? 1435 PHE B CB  1 
ATOM   3074 C CG  . PHE B 1 242 ? 5.466  54.985 -8.707  1.00 28.89  ? 1435 PHE B CG  1 
ATOM   3075 C CD1 . PHE B 1 242 ? 5.065  54.092 -9.687  1.00 28.60  ? 1435 PHE B CD1 1 
ATOM   3076 C CD2 . PHE B 1 242 ? 5.210  54.683 -7.387  1.00 27.71  ? 1435 PHE B CD2 1 
ATOM   3077 C CE1 . PHE B 1 242 ? 4.417  52.929 -9.353  1.00 26.56  ? 1435 PHE B CE1 1 
ATOM   3078 C CE2 . PHE B 1 242 ? 4.564  53.513 -7.043  1.00 25.72  ? 1435 PHE B CE2 1 
ATOM   3079 C CZ  . PHE B 1 242 ? 4.160  52.641 -8.024  1.00 30.85  ? 1435 PHE B CZ  1 
ATOM   3080 N N   . PHE B 1 243 ? 6.444  59.440 -9.856  1.00 34.31  ? 1436 PHE B N   1 
ATOM   3081 C CA  . PHE B 1 243 ? 7.532  60.419 -9.991  1.00 29.98  ? 1436 PHE B CA  1 
ATOM   3082 C C   . PHE B 1 243 ? 7.203  61.849 -10.453 1.00 36.13  ? 1436 PHE B C   1 
ATOM   3083 O O   . PHE B 1 243 ? 8.114  62.656 -10.595 1.00 50.42  ? 1436 PHE B O   1 
ATOM   3084 C CB  . PHE B 1 243 ? 8.642  59.860 -10.895 1.00 30.15  ? 1436 PHE B CB  1 
ATOM   3085 C CG  . PHE B 1 243 ? 9.268  58.596 -10.388 1.00 26.00  ? 1436 PHE B CG  1 
ATOM   3086 C CD1 . PHE B 1 243 ? 9.044  57.394 -11.035 1.00 30.57  ? 1436 PHE B CD1 1 
ATOM   3087 C CD2 . PHE B 1 243 ? 10.084 58.609 -9.278  1.00 29.15  ? 1436 PHE B CD2 1 
ATOM   3088 C CE1 . PHE B 1 243 ? 9.612  56.225 -10.577 1.00 27.57  ? 1436 PHE B CE1 1 
ATOM   3089 C CE2 . PHE B 1 243 ? 10.660 57.442 -8.813  1.00 37.78  ? 1436 PHE B CE2 1 
ATOM   3090 C CZ  . PHE B 1 243 ? 10.420 56.246 -9.462  1.00 30.05  ? 1436 PHE B CZ  1 
ATOM   3091 N N   . TYR B 1 244 ? 5.939  62.179 -10.689 1.00 36.08  ? 1437 TYR B N   1 
ATOM   3092 C CA  . TYR B 1 244 ? 5.629  63.500 -11.246 1.00 39.19  ? 1437 TYR B CA  1 
ATOM   3093 C C   . TYR B 1 244 ? 5.368  64.590 -10.196 1.00 46.20  ? 1437 TYR B C   1 
ATOM   3094 O O   . TYR B 1 244 ? 4.467  64.480 -9.370  1.00 51.98  ? 1437 TYR B O   1 
ATOM   3095 C CB  . TYR B 1 244 ? 4.471  63.412 -12.240 1.00 38.45  ? 1437 TYR B CB  1 
ATOM   3096 C CG  . TYR B 1 244 ? 4.885  62.873 -13.587 1.00 41.85  ? 1437 TYR B CG  1 
ATOM   3097 C CD1 . TYR B 1 244 ? 6.169  62.394 -13.794 1.00 36.97  ? 1437 TYR B CD1 1 
ATOM   3098 C CD2 . TYR B 1 244 ? 3.981  62.809 -14.647 1.00 51.88  ? 1437 TYR B CD2 1 
ATOM   3099 C CE1 . TYR B 1 244 ? 6.551  61.881 -15.022 1.00 44.29  ? 1437 TYR B CE1 1 
ATOM   3100 C CE2 . TYR B 1 244 ? 4.354  62.294 -15.886 1.00 41.51  ? 1437 TYR B CE2 1 
ATOM   3101 C CZ  . TYR B 1 244 ? 5.642  61.832 -16.064 1.00 45.00  ? 1437 TYR B CZ  1 
ATOM   3102 O OH  . TYR B 1 244 ? 6.029  61.318 -17.285 1.00 42.34  ? 1437 TYR B OH  1 
ATOM   3103 N N   . SER C 1 51  ? 38.929 58.284 25.085  1.00 69.14  ? 1244 SER C N   1 
ATOM   3104 C CA  . SER C 1 51  ? 38.338 57.955 23.788  1.00 75.77  ? 1244 SER C CA  1 
ATOM   3105 C C   . SER C 1 51  ? 38.043 59.188 22.935  1.00 75.82  ? 1244 SER C C   1 
ATOM   3106 O O   . SER C 1 51  ? 37.751 60.269 23.452  1.00 71.63  ? 1244 SER C O   1 
ATOM   3107 C CB  . SER C 1 51  ? 37.057 57.131 23.964  1.00 70.08  ? 1244 SER C CB  1 
ATOM   3108 O OG  . SER C 1 51  ? 36.414 56.912 22.718  1.00 66.21  ? 1244 SER C OG  1 
ATOM   3109 N N   . ASN C 1 52  ? 38.122 59.005 21.621  1.00 70.03  ? 1245 ASN C N   1 
ATOM   3110 C CA  . ASN C 1 52  ? 37.765 60.037 20.656  1.00 70.63  ? 1245 ASN C CA  1 
ATOM   3111 C C   . ASN C 1 52  ? 36.289 59.937 20.285  1.00 75.68  ? 1245 ASN C C   1 
ATOM   3112 O O   . ASN C 1 52  ? 35.720 60.863 19.701  1.00 65.50  ? 1245 ASN C O   1 
ATOM   3113 C CB  . ASN C 1 52  ? 38.608 59.888 19.384  1.00 86.30  ? 1245 ASN C CB  1 
ATOM   3114 C CG  . ASN C 1 52  ? 38.318 58.579 18.629  1.00 104.88 ? 1245 ASN C CG  1 
ATOM   3115 O OD1 . ASN C 1 52  ? 37.810 58.590 17.499  1.00 84.45  ? 1245 ASN C OD1 1 
ATOM   3116 N ND2 . ASN C 1 52  ? 38.632 57.447 19.262  1.00 79.81  ? 1245 ASN C ND2 1 
ATOM   3117 N N   . TYR C 1 53  ? 35.676 58.802 20.621  1.00 73.67  ? 1246 TYR C N   1 
ATOM   3118 C CA  . TYR C 1 53  ? 34.312 58.504 20.186  1.00 71.46  ? 1246 TYR C CA  1 
ATOM   3119 C C   . TYR C 1 53  ? 33.289 58.582 21.316  1.00 64.99  ? 1246 TYR C C   1 
ATOM   3120 O O   . TYR C 1 53  ? 32.223 59.180 21.156  1.00 53.50  ? 1246 TYR C O   1 
ATOM   3121 C CB  . TYR C 1 53  ? 34.247 57.125 19.516  1.00 66.23  ? 1246 TYR C CB  1 
ATOM   3122 C CG  . TYR C 1 53  ? 33.018 56.942 18.650  1.00 68.26  ? 1246 TYR C CG  1 
ATOM   3123 C CD1 . TYR C 1 53  ? 31.913 56.237 19.115  1.00 63.00  ? 1246 TYR C CD1 1 
ATOM   3124 C CD2 . TYR C 1 53  ? 32.958 57.488 17.370  1.00 56.42  ? 1246 TYR C CD2 1 
ATOM   3125 C CE1 . TYR C 1 53  ? 30.786 56.073 18.323  1.00 56.37  ? 1246 TYR C CE1 1 
ATOM   3126 C CE2 . TYR C 1 53  ? 31.839 57.335 16.576  1.00 63.61  ? 1246 TYR C CE2 1 
ATOM   3127 C CZ  . TYR C 1 53  ? 30.754 56.630 17.052  1.00 68.92  ? 1246 TYR C CZ  1 
ATOM   3128 O OH  . TYR C 1 53  ? 29.640 56.482 16.249  1.00 60.79  ? 1246 TYR C OH  1 
ATOM   3129 N N   . PHE C 1 54  ? 33.618 57.969 22.451  1.00 65.94  ? 1247 PHE C N   1 
ATOM   3130 C CA  . PHE C 1 54  ? 32.739 57.979 23.618  1.00 56.60  ? 1247 PHE C CA  1 
ATOM   3131 C C   . PHE C 1 54  ? 33.079 59.117 24.568  1.00 57.63  ? 1247 PHE C C   1 
ATOM   3132 O O   . PHE C 1 54  ? 34.246 59.461 24.751  1.00 70.65  ? 1247 PHE C O   1 
ATOM   3133 C CB  . PHE C 1 54  ? 32.802 56.644 24.355  1.00 30.84  ? 1247 PHE C CB  1 
ATOM   3134 C CG  . PHE C 1 54  ? 32.452 55.473 23.493  1.00 49.54  ? 1247 PHE C CG  1 
ATOM   3135 C CD1 . PHE C 1 54  ? 33.444 54.730 22.879  1.00 60.58  ? 1247 PHE C CD1 1 
ATOM   3136 C CD2 . PHE C 1 54  ? 31.130 55.119 23.281  1.00 57.09  ? 1247 PHE C CD2 1 
ATOM   3137 C CE1 . PHE C 1 54  ? 33.127 53.649 22.081  1.00 63.45  ? 1247 PHE C CE1 1 
ATOM   3138 C CE2 . PHE C 1 54  ? 30.806 54.039 22.476  1.00 53.06  ? 1247 PHE C CE2 1 
ATOM   3139 C CZ  . PHE C 1 54  ? 31.806 53.302 21.880  1.00 55.76  ? 1247 PHE C CZ  1 
ATOM   3140 N N   . GLY C 1 55  ? 32.052 59.701 25.169  1.00 53.95  ? 1248 GLY C N   1 
ATOM   3141 C CA  . GLY C 1 55  ? 32.253 60.806 26.082  1.00 57.09  ? 1248 GLY C CA  1 
ATOM   3142 C C   . GLY C 1 55  ? 32.522 62.121 25.376  1.00 48.85  ? 1248 GLY C C   1 
ATOM   3143 O O   . GLY C 1 55  ? 32.902 63.101 26.014  1.00 48.61  ? 1248 GLY C O   1 
ATOM   3144 N N   . VAL C 1 56  ? 32.324 62.150 24.061  1.00 48.63  ? 1249 VAL C N   1 
ATOM   3145 C CA  . VAL C 1 56  ? 32.488 63.385 23.294  1.00 50.70  ? 1249 VAL C CA  1 
ATOM   3146 C C   . VAL C 1 56  ? 31.130 63.864 22.793  1.00 53.42  ? 1249 VAL C C   1 
ATOM   3147 O O   . VAL C 1 56  ? 30.211 63.056 22.632  1.00 55.44  ? 1249 VAL C O   1 
ATOM   3148 C CB  . VAL C 1 56  ? 33.456 63.200 22.104  1.00 49.07  ? 1249 VAL C CB  1 
ATOM   3149 C CG1 . VAL C 1 56  ? 34.679 62.403 22.542  1.00 45.96  ? 1249 VAL C CG1 1 
ATOM   3150 C CG2 . VAL C 1 56  ? 32.759 62.512 20.945  1.00 55.16  ? 1249 VAL C CG2 1 
ATOM   3151 N N   . PRO C 1 57  ? 30.993 65.181 22.563  1.00 52.78  ? 1250 PRO C N   1 
ATOM   3152 C CA  . PRO C 1 57  ? 29.742 65.796 22.092  1.00 61.85  ? 1250 PRO C CA  1 
ATOM   3153 C C   . PRO C 1 57  ? 29.081 65.008 20.966  1.00 52.63  ? 1250 PRO C C   1 
ATOM   3154 O O   . PRO C 1 57  ? 29.771 64.373 20.178  1.00 42.72  ? 1250 PRO C O   1 
ATOM   3155 C CB  . PRO C 1 57  ? 30.204 67.158 21.575  1.00 49.05  ? 1250 PRO C CB  1 
ATOM   3156 C CG  . PRO C 1 57  ? 31.352 67.491 22.458  1.00 55.61  ? 1250 PRO C CG  1 
ATOM   3157 C CD  . PRO C 1 57  ? 32.048 66.185 22.774  1.00 46.77  ? 1250 PRO C CD  1 
ATOM   3158 N N   . LEU C 1 58  ? 27.756 65.059 20.898  1.00 51.81  ? 1251 LEU C N   1 
ATOM   3159 C CA  . LEU C 1 58  ? 27.000 64.247 19.948  1.00 52.39  ? 1251 LEU C CA  1 
ATOM   3160 C C   . LEU C 1 58  ? 27.299 64.613 18.494  1.00 48.19  ? 1251 LEU C C   1 
ATOM   3161 O O   . LEU C 1 58  ? 27.428 63.740 17.642  1.00 43.89  ? 1251 LEU C O   1 
ATOM   3162 C CB  . LEU C 1 58  ? 25.496 64.353 20.229  1.00 50.75  ? 1251 LEU C CB  1 
ATOM   3163 C CG  . LEU C 1 58  ? 24.556 63.613 19.277  1.00 40.80  ? 1251 LEU C CG  1 
ATOM   3164 C CD1 . LEU C 1 58  ? 24.817 62.113 19.328  1.00 36.97  ? 1251 LEU C CD1 1 
ATOM   3165 C CD2 . LEU C 1 58  ? 23.102 63.936 19.604  1.00 36.03  ? 1251 LEU C CD2 1 
ATOM   3166 N N   . THR C 1 59  ? 27.416 65.906 18.221  1.00 46.40  ? 1252 THR C N   1 
ATOM   3167 C CA  . THR C 1 59  ? 27.708 66.391 16.874  1.00 45.97  ? 1252 THR C CA  1 
ATOM   3168 C C   . THR C 1 59  ? 29.056 65.906 16.328  1.00 55.61  ? 1252 THR C C   1 
ATOM   3169 O O   . THR C 1 59  ? 29.252 65.830 15.115  1.00 62.25  ? 1252 THR C O   1 
ATOM   3170 C CB  . THR C 1 59  ? 27.663 67.925 16.825  1.00 55.45  ? 1252 THR C CB  1 
ATOM   3171 O OG1 . THR C 1 59  ? 28.456 68.461 17.897  1.00 60.74  ? 1252 THR C OG1 1 
ATOM   3172 C CG2 . THR C 1 59  ? 26.223 68.414 16.968  1.00 51.72  ? 1252 THR C CG2 1 
ATOM   3173 N N   . THR C 1 60  ? 29.978 65.578 17.227  1.00 60.87  ? 1253 THR C N   1 
ATOM   3174 C CA  . THR C 1 60  ? 31.310 65.097 16.854  1.00 53.31  ? 1253 THR C CA  1 
ATOM   3175 C C   . THR C 1 60  ? 31.269 63.726 16.194  1.00 57.24  ? 1253 THR C C   1 
ATOM   3176 O O   . THR C 1 60  ? 32.147 63.392 15.396  1.00 60.55  ? 1253 THR C O   1 
ATOM   3177 C CB  . THR C 1 60  ? 32.251 65.037 18.093  1.00 64.97  ? 1253 THR C CB  1 
ATOM   3178 O OG1 . THR C 1 60  ? 32.746 66.351 18.386  1.00 73.09  ? 1253 THR C OG1 1 
ATOM   3179 C CG2 . THR C 1 60  ? 33.430 64.099 17.854  1.00 51.51  ? 1253 THR C CG2 1 
ATOM   3180 N N   . VAL C 1 61  ? 30.251 62.936 16.529  1.00 53.47  ? 1254 VAL C N   1 
ATOM   3181 C CA  . VAL C 1 61  ? 30.142 61.571 16.019  1.00 52.11  ? 1254 VAL C CA  1 
ATOM   3182 C C   . VAL C 1 61  ? 28.942 61.372 15.088  1.00 48.54  ? 1254 VAL C C   1 
ATOM   3183 O O   . VAL C 1 61  ? 28.501 60.241 14.866  1.00 42.97  ? 1254 VAL C O   1 
ATOM   3184 C CB  . VAL C 1 61  ? 30.085 60.530 17.166  1.00 47.67  ? 1254 VAL C CB  1 
ATOM   3185 C CG1 . VAL C 1 61  ? 31.389 60.503 17.934  1.00 54.22  ? 1254 VAL C CG1 1 
ATOM   3186 C CG2 . VAL C 1 61  ? 28.930 60.833 18.101  1.00 54.77  ? 1254 VAL C CG2 1 
ATOM   3187 N N   . VAL C 1 62  ? 28.410 62.469 14.558  1.00 43.31  ? 1255 VAL C N   1 
ATOM   3188 C CA  . VAL C 1 62  ? 27.349 62.398 13.557  1.00 52.75  ? 1255 VAL C CA  1 
ATOM   3189 C C   . VAL C 1 62  ? 27.489 63.516 12.538  1.00 68.04  ? 1255 VAL C C   1 
ATOM   3190 O O   . VAL C 1 62  ? 28.051 64.574 12.826  1.00 73.35  ? 1255 VAL C O   1 
ATOM   3191 C CB  . VAL C 1 62  ? 25.907 62.457 14.160  1.00 50.32  ? 1255 VAL C CB  1 
ATOM   3192 C CG1 . VAL C 1 62  ? 25.713 61.383 15.219  1.00 52.11  ? 1255 VAL C CG1 1 
ATOM   3193 C CG2 . VAL C 1 62  ? 25.590 63.843 14.706  1.00 29.55  ? 1255 VAL C CG2 1 
ATOM   3194 N N   . THR C 1 63  ? 26.968 63.265 11.344  1.00 66.84  ? 1256 THR C N   1 
ATOM   3195 C CA  . THR C 1 63  ? 26.933 64.256 10.277  1.00 66.27  ? 1256 THR C CA  1 
ATOM   3196 C C   . THR C 1 63  ? 25.474 64.435 9.870   1.00 73.15  ? 1256 THR C C   1 
ATOM   3197 O O   . THR C 1 63  ? 24.643 63.588 10.193  1.00 81.32  ? 1256 THR C O   1 
ATOM   3198 C CB  . THR C 1 63  ? 27.764 63.785 9.068   1.00 69.05  ? 1256 THR C CB  1 
ATOM   3199 O OG1 . THR C 1 63  ? 27.076 62.727 8.380   1.00 64.92  ? 1256 THR C OG1 1 
ATOM   3200 C CG2 . THR C 1 63  ? 29.116 63.273 9.532   1.00 48.31  ? 1256 THR C CG2 1 
ATOM   3201 N N   . PRO C 1 64  ? 25.141 65.538 9.178   1.00 75.40  ? 1257 PRO C N   1 
ATOM   3202 C CA  . PRO C 1 64  ? 23.733 65.680 8.787   1.00 71.74  ? 1257 PRO C CA  1 
ATOM   3203 C C   . PRO C 1 64  ? 23.333 64.630 7.758   1.00 66.49  ? 1257 PRO C C   1 
ATOM   3204 O O   . PRO C 1 64  ? 22.141 64.377 7.573   1.00 65.97  ? 1257 PRO C O   1 
ATOM   3205 C CB  . PRO C 1 64  ? 23.672 67.089 8.177   1.00 49.18  ? 1257 PRO C CB  1 
ATOM   3206 C CG  . PRO C 1 64  ? 24.848 67.807 8.760   1.00 57.15  ? 1257 PRO C CG  1 
ATOM   3207 C CD  . PRO C 1 64  ? 25.920 66.754 8.897   1.00 67.06  ? 1257 PRO C CD  1 
ATOM   3208 N N   . GLU C 1 65  ? 24.327 64.021 7.115   1.00 64.23  ? 1258 GLU C N   1 
ATOM   3209 C CA  . GLU C 1 65  ? 24.087 63.044 6.054   1.00 76.21  ? 1258 GLU C CA  1 
ATOM   3210 C C   . GLU C 1 65  ? 24.006 61.621 6.609   1.00 73.91  ? 1258 GLU C C   1 
ATOM   3211 O O   . GLU C 1 65  ? 23.352 60.747 6.029   1.00 66.20  ? 1258 GLU C O   1 
ATOM   3212 C CB  . GLU C 1 65  ? 25.179 63.139 4.976   1.00 72.82  ? 1258 GLU C CB  1 
ATOM   3213 N N   . LYS C 1 66  ? 24.686 61.402 7.731   1.00 66.98  ? 1259 LYS C N   1 
ATOM   3214 C CA  . LYS C 1 66  ? 24.664 60.122 8.435   1.00 69.17  ? 1259 LYS C CA  1 
ATOM   3215 C C   . LYS C 1 66  ? 24.478 60.391 9.931   1.00 65.60  ? 1259 LYS C C   1 
ATOM   3216 O O   . LYS C 1 66  ? 25.425 60.238 10.713  1.00 53.57  ? 1259 LYS C O   1 
ATOM   3217 C CB  . LYS C 1 66  ? 25.961 59.344 8.175   1.00 45.43  ? 1259 LYS C CB  1 
ATOM   3218 N N   . PRO C 1 67  ? 23.243 60.779 10.326  1.00 65.26  ? 1260 PRO C N   1 
ATOM   3219 C CA  . PRO C 1 67  ? 22.868 61.427 11.599  1.00 57.59  ? 1260 PRO C CA  1 
ATOM   3220 C C   . PRO C 1 67  ? 22.864 60.490 12.801  1.00 60.86  ? 1260 PRO C C   1 
ATOM   3221 O O   . PRO C 1 67  ? 22.885 60.960 13.939  1.00 64.33  ? 1260 PRO C O   1 
ATOM   3222 C CB  . PRO C 1 67  ? 21.436 61.928 11.344  1.00 44.66  ? 1260 PRO C CB  1 
ATOM   3223 C CG  . PRO C 1 67  ? 21.132 61.605 9.890   1.00 60.68  ? 1260 PRO C CG  1 
ATOM   3224 C CD  . PRO C 1 67  ? 22.056 60.491 9.510   1.00 49.54  ? 1260 PRO C CD  1 
ATOM   3225 N N   . ILE C 1 68  ? 22.825 59.188 12.547  1.00 51.38  ? 1261 ILE C N   1 
ATOM   3226 C CA  . ILE C 1 68  ? 22.884 58.204 13.610  1.00 43.02  ? 1261 ILE C CA  1 
ATOM   3227 C C   . ILE C 1 68  ? 24.338 57.782 13.850  1.00 44.95  ? 1261 ILE C C   1 
ATOM   3228 O O   . ILE C 1 68  ? 25.042 57.386 12.925  1.00 47.30  ? 1261 ILE C O   1 
ATOM   3229 C CB  . ILE C 1 68  ? 22.007 56.981 13.269  1.00 36.28  ? 1261 ILE C CB  1 
ATOM   3230 C CG1 . ILE C 1 68  ? 20.661 57.446 12.719  1.00 36.48  ? 1261 ILE C CG1 1 
ATOM   3231 C CG2 . ILE C 1 68  ? 21.788 56.101 14.492  1.00 40.56  ? 1261 ILE C CG2 1 
ATOM   3232 C CD1 . ILE C 1 68  ? 19.905 58.359 13.645  1.00 40.13  ? 1261 ILE C CD1 1 
ATOM   3233 N N   . PRO C 1 69  ? 24.801 57.890 15.101  1.00 45.35  ? 1262 PRO C N   1 
ATOM   3234 C CA  . PRO C 1 69  ? 26.139 57.400 15.427  1.00 45.04  ? 1262 PRO C CA  1 
ATOM   3235 C C   . PRO C 1 69  ? 26.301 55.962 14.972  1.00 45.73  ? 1262 PRO C C   1 
ATOM   3236 O O   . PRO C 1 69  ? 25.432 55.140 15.251  1.00 50.80  ? 1262 PRO C O   1 
ATOM   3237 C CB  . PRO C 1 69  ? 26.168 57.474 16.954  1.00 37.28  ? 1262 PRO C CB  1 
ATOM   3238 C CG  . PRO C 1 69  ? 25.256 58.597 17.275  1.00 46.01  ? 1262 PRO C CG  1 
ATOM   3239 C CD  . PRO C 1 69  ? 24.147 58.525 16.259  1.00 45.28  ? 1262 PRO C CD  1 
ATOM   3240 N N   . ILE C 1 70  ? 27.401 55.668 14.290  1.00 48.48  ? 1263 ILE C N   1 
ATOM   3241 C CA  . ILE C 1 70  ? 27.656 54.321 13.781  1.00 48.47  ? 1263 ILE C CA  1 
ATOM   3242 C C   . ILE C 1 70  ? 27.578 53.248 14.878  1.00 48.71  ? 1263 ILE C C   1 
ATOM   3243 O O   . ILE C 1 70  ? 27.049 52.153 14.654  1.00 47.48  ? 1263 ILE C O   1 
ATOM   3244 C CB  . ILE C 1 70  ? 29.005 54.249 13.014  1.00 52.19  ? 1263 ILE C CB  1 
ATOM   3245 C CG1 . ILE C 1 70  ? 28.826 54.769 11.583  1.00 55.03  ? 1263 ILE C CG1 1 
ATOM   3246 C CG2 . ILE C 1 70  ? 29.543 52.828 12.974  1.00 55.91  ? 1263 ILE C CG2 1 
ATOM   3247 C CD1 . ILE C 1 70  ? 28.456 56.246 11.491  1.00 69.54  ? 1263 ILE C CD1 1 
ATOM   3248 N N   . PHE C 1 71  ? 28.090 53.562 16.064  1.00 46.93  ? 1264 PHE C N   1 
ATOM   3249 C CA  . PHE C 1 71  ? 28.020 52.623 17.180  1.00 49.20  ? 1264 PHE C CA  1 
ATOM   3250 C C   . PHE C 1 71  ? 26.563 52.271 17.513  1.00 46.59  ? 1264 PHE C C   1 
ATOM   3251 O O   . PHE C 1 71  ? 26.231 51.117 17.800  1.00 42.60  ? 1264 PHE C O   1 
ATOM   3252 C CB  . PHE C 1 71  ? 28.740 53.182 18.414  1.00 42.16  ? 1264 PHE C CB  1 
ATOM   3253 C CG  . PHE C 1 71  ? 28.704 52.259 19.609  1.00 44.75  ? 1264 PHE C CG  1 
ATOM   3254 C CD1 . PHE C 1 71  ? 29.453 51.083 19.619  1.00 41.66  ? 1264 PHE C CD1 1 
ATOM   3255 C CD2 . PHE C 1 71  ? 27.927 52.565 20.720  1.00 40.59  ? 1264 PHE C CD2 1 
ATOM   3256 C CE1 . PHE C 1 71  ? 29.428 50.226 20.713  1.00 40.51  ? 1264 PHE C CE1 1 
ATOM   3257 C CE2 . PHE C 1 71  ? 27.896 51.714 21.819  1.00 43.84  ? 1264 PHE C CE2 1 
ATOM   3258 C CZ  . PHE C 1 71  ? 28.648 50.540 21.814  1.00 47.87  ? 1264 PHE C CZ  1 
ATOM   3259 N N   . ILE C 1 72  ? 25.694 53.271 17.464  1.00 36.17  ? 1265 ILE C N   1 
ATOM   3260 C CA  . ILE C 1 72  ? 24.298 53.062 17.800  1.00 42.13  ? 1265 ILE C CA  1 
ATOM   3261 C C   . ILE C 1 72  ? 23.654 52.167 16.748  1.00 51.22  ? 1265 ILE C C   1 
ATOM   3262 O O   . ILE C 1 72  ? 22.896 51.249 17.082  1.00 53.69  ? 1265 ILE C O   1 
ATOM   3263 C CB  . ILE C 1 72  ? 23.528 54.398 17.945  1.00 40.37  ? 1265 ILE C CB  1 
ATOM   3264 C CG1 . ILE C 1 72  ? 24.023 55.165 19.175  1.00 36.85  ? 1265 ILE C CG1 1 
ATOM   3265 C CG2 . ILE C 1 72  ? 22.046 54.144 18.081  1.00 39.67  ? 1265 ILE C CG2 1 
ATOM   3266 C CD1 . ILE C 1 72  ? 23.968 54.350 20.450  1.00 37.57  ? 1265 ILE C CD1 1 
ATOM   3267 N N   . GLU C 1 73  ? 23.969 52.420 15.480  1.00 49.53  ? 1266 GLU C N   1 
ATOM   3268 C CA  . GLU C 1 73  ? 23.491 51.560 14.400  1.00 47.91  ? 1266 GLU C CA  1 
ATOM   3269 C C   . GLU C 1 73  ? 23.902 50.097 14.589  1.00 51.17  ? 1266 GLU C C   1 
ATOM   3270 O O   . GLU C 1 73  ? 23.058 49.204 14.509  1.00 47.96  ? 1266 GLU C O   1 
ATOM   3271 C CB  . GLU C 1 73  ? 23.941 52.081 13.036  1.00 46.76  ? 1266 GLU C CB  1 
ATOM   3272 C CG  . GLU C 1 73  ? 22.855 52.837 12.298  1.00 71.75  ? 1266 GLU C CG  1 
ATOM   3273 C CD  . GLU C 1 73  ? 23.349 53.469 11.013  1.00 87.84  ? 1266 GLU C CD  1 
ATOM   3274 O OE1 . GLU C 1 73  ? 22.511 53.732 10.114  1.00 66.10  ? 1266 GLU C OE1 1 
ATOM   3275 O OE2 . GLU C 1 73  ? 24.576 53.707 10.908  1.00 83.06  ? 1266 GLU C OE2 1 
ATOM   3276 N N   . ARG C 1 74  ? 25.187 49.852 14.842  1.00 41.41  ? 1267 ARG C N   1 
ATOM   3277 C CA  . ARG C 1 74  ? 25.652 48.485 15.090  1.00 54.52  ? 1267 ARG C CA  1 
ATOM   3278 C C   . ARG C 1 74  ? 24.847 47.798 16.183  1.00 58.14  ? 1267 ARG C C   1 
ATOM   3279 O O   . ARG C 1 74  ? 24.346 46.683 15.995  1.00 58.03  ? 1267 ARG C O   1 
ATOM   3280 C CB  . ARG C 1 74  ? 27.126 48.454 15.496  1.00 55.03  ? 1267 ARG C CB  1 
ATOM   3281 C CG  . ARG C 1 74  ? 28.062 48.781 14.385  1.00 68.07  ? 1267 ARG C CG  1 
ATOM   3282 C CD  . ARG C 1 74  ? 27.770 47.970 13.144  1.00 55.83  ? 1267 ARG C CD  1 
ATOM   3283 N NE  . ARG C 1 74  ? 28.245 48.707 11.983  1.00 64.18  ? 1267 ARG C NE  1 
ATOM   3284 C CZ  . ARG C 1 74  ? 29.512 49.068 11.812  1.00 82.76  ? 1267 ARG C CZ  1 
ATOM   3285 N NH1 . ARG C 1 74  ? 30.424 48.747 12.726  1.00 60.77  ? 1267 ARG C NH1 1 
ATOM   3286 N NH2 . ARG C 1 74  ? 29.868 49.749 10.729  1.00 90.40  ? 1267 ARG C NH2 1 
ATOM   3287 N N   . CYS C 1 75  ? 24.744 48.463 17.330  1.00 44.43  ? 1268 CYS C N   1 
ATOM   3288 C CA  . CYS C 1 75  ? 24.131 47.857 18.497  1.00 42.50  ? 1268 CYS C CA  1 
ATOM   3289 C C   . CYS C 1 75  ? 22.643 47.606 18.293  1.00 47.54  ? 1268 CYS C C   1 
ATOM   3290 O O   . CYS C 1 75  ? 22.139 46.507 18.564  1.00 41.43  ? 1268 CYS C O   1 
ATOM   3291 C CB  . CYS C 1 75  ? 24.359 48.733 19.727  1.00 50.63  ? 1268 CYS C CB  1 
ATOM   3292 S SG  . CYS C 1 75  ? 26.085 48.841 20.228  1.00 46.07  ? 1268 CYS C SG  1 
ATOM   3293 N N   . ILE C 1 76  ? 21.938 48.627 17.821  1.00 40.27  ? 1269 ILE C N   1 
ATOM   3294 C CA  . ILE C 1 76  ? 20.501 48.498 17.632  1.00 43.94  ? 1269 ILE C CA  1 
ATOM   3295 C C   . ILE C 1 76  ? 20.178 47.465 16.558  1.00 49.44  ? 1269 ILE C C   1 
ATOM   3296 O O   . ILE C 1 76  ? 19.291 46.632 16.746  1.00 57.36  ? 1269 ILE C O   1 
ATOM   3297 C CB  . ILE C 1 76  ? 19.829 49.846 17.314  1.00 45.06  ? 1269 ILE C CB  1 
ATOM   3298 C CG1 . ILE C 1 76  ? 19.783 50.712 18.574  1.00 41.75  ? 1269 ILE C CG1 1 
ATOM   3299 C CG2 . ILE C 1 76  ? 18.421 49.629 16.769  1.00 28.99  ? 1269 ILE C CG2 1 
ATOM   3300 C CD1 . ILE C 1 76  ? 18.892 51.927 18.449  1.00 36.85  ? 1269 ILE C CD1 1 
ATOM   3301 N N   . GLU C 1 77  ? 20.909 47.506 15.446  1.00 46.45  ? 1270 GLU C N   1 
ATOM   3302 C CA  . GLU C 1 77  ? 20.690 46.550 14.367  1.00 39.39  ? 1270 GLU C CA  1 
ATOM   3303 C C   . GLU C 1 77  ? 21.015 45.120 14.799  1.00 48.20  ? 1270 GLU C C   1 
ATOM   3304 O O   . GLU C 1 77  ? 20.353 44.168 14.372  1.00 61.99  ? 1270 GLU C O   1 
ATOM   3305 C CB  . GLU C 1 77  ? 21.479 46.948 13.121  1.00 33.04  ? 1270 GLU C CB  1 
ATOM   3306 C CG  . GLU C 1 77  ? 20.857 48.109 12.367  1.00 44.41  ? 1270 GLU C CG  1 
ATOM   3307 C CD  . GLU C 1 77  ? 21.688 48.564 11.176  1.00 67.52  ? 1270 GLU C CD  1 
ATOM   3308 O OE1 . GLU C 1 77  ? 22.375 47.716 10.560  1.00 57.11  ? 1270 GLU C OE1 1 
ATOM   3309 O OE2 . GLU C 1 77  ? 21.651 49.776 10.856  1.00 66.84  ? 1270 GLU C OE2 1 
ATOM   3310 N N   . TYR C 1 78  ? 22.022 44.972 15.654  1.00 40.24  ? 1271 TYR C N   1 
ATOM   3311 C CA  . TYR C 1 78  ? 22.403 43.658 16.161  1.00 39.02  ? 1271 TYR C CA  1 
ATOM   3312 C C   . TYR C 1 78  ? 21.402 43.179 17.205  1.00 44.00  ? 1271 TYR C C   1 
ATOM   3313 O O   . TYR C 1 78  ? 21.069 41.999 17.258  1.00 48.90  ? 1271 TYR C O   1 
ATOM   3314 C CB  . TYR C 1 78  ? 23.806 43.712 16.760  1.00 38.94  ? 1271 TYR C CB  1 
ATOM   3315 C CG  . TYR C 1 78  ? 24.268 42.424 17.413  1.00 46.99  ? 1271 TYR C CG  1 
ATOM   3316 C CD1 . TYR C 1 78  ? 24.793 41.390 16.651  1.00 43.13  ? 1271 TYR C CD1 1 
ATOM   3317 C CD2 . TYR C 1 78  ? 24.207 42.253 18.789  1.00 39.24  ? 1271 TYR C CD2 1 
ATOM   3318 C CE1 . TYR C 1 78  ? 25.233 40.221 17.236  1.00 41.27  ? 1271 TYR C CE1 1 
ATOM   3319 C CE2 . TYR C 1 78  ? 24.647 41.085 19.382  1.00 49.31  ? 1271 TYR C CE2 1 
ATOM   3320 C CZ  . TYR C 1 78  ? 25.161 40.069 18.600  1.00 50.75  ? 1271 TYR C CZ  1 
ATOM   3321 O OH  . TYR C 1 78  ? 25.598 38.893 19.182  1.00 38.38  ? 1271 TYR C OH  1 
ATOM   3322 N N   . ILE C 1 79  ? 20.927 44.102 18.034  1.00 46.14  ? 1272 ILE C N   1 
ATOM   3323 C CA  . ILE C 1 79  ? 19.955 43.770 19.066  1.00 48.59  ? 1272 ILE C CA  1 
ATOM   3324 C C   . ILE C 1 79  ? 18.620 43.398 18.438  1.00 48.01  ? 1272 ILE C C   1 
ATOM   3325 O O   . ILE C 1 79  ? 17.906 42.523 18.937  1.00 47.01  ? 1272 ILE C O   1 
ATOM   3326 C CB  . ILE C 1 79  ? 19.766 44.929 20.075  1.00 49.28  ? 1272 ILE C CB  1 
ATOM   3327 C CG1 . ILE C 1 79  ? 20.937 44.968 21.067  1.00 43.75  ? 1272 ILE C CG1 1 
ATOM   3328 C CG2 . ILE C 1 79  ? 18.453 44.767 20.835  1.00 37.73  ? 1272 ILE C CG2 1 
ATOM   3329 C CD1 . ILE C 1 79  ? 21.164 46.325 21.687  1.00 38.31  ? 1272 ILE C CD1 1 
ATOM   3330 N N   . GLU C 1 80  ? 18.286 44.057 17.335  1.00 42.55  ? 1273 GLU C N   1 
ATOM   3331 C CA  . GLU C 1 80  ? 17.051 43.737 16.626  1.00 43.84  ? 1273 GLU C CA  1 
ATOM   3332 C C   . GLU C 1 80  ? 17.151 42.371 15.945  1.00 54.72  ? 1273 GLU C C   1 
ATOM   3333 O O   . GLU C 1 80  ? 16.148 41.666 15.800  1.00 62.01  ? 1273 GLU C O   1 
ATOM   3334 C CB  . GLU C 1 80  ? 16.676 44.838 15.628  1.00 34.01  ? 1273 GLU C CB  1 
ATOM   3335 C CG  . GLU C 1 80  ? 16.010 46.038 16.288  1.00 39.37  ? 1273 GLU C CG  1 
ATOM   3336 C CD  . GLU C 1 80  ? 15.533 47.081 15.288  1.00 52.00  ? 1273 GLU C CD  1 
ATOM   3337 O OE1 . GLU C 1 80  ? 15.599 46.793 14.074  1.00 45.33  ? 1273 GLU C OE1 1 
ATOM   3338 O OE2 . GLU C 1 80  ? 15.088 48.179 15.717  1.00 39.52  ? 1273 GLU C OE2 1 
ATOM   3339 N N   . ALA C 1 81  ? 18.364 41.986 15.556  1.00 49.44  ? 1274 ALA C N   1 
ATOM   3340 C CA  . ALA C 1 81  ? 18.566 40.705 14.887  1.00 48.79  ? 1274 ALA C CA  1 
ATOM   3341 C C   . ALA C 1 81  ? 18.897 39.569 15.853  1.00 48.62  ? 1274 ALA C C   1 
ATOM   3342 O O   . ALA C 1 81  ? 18.876 38.399 15.466  1.00 63.58  ? 1274 ALA C O   1 
ATOM   3343 C CB  . ALA C 1 81  ? 19.634 40.821 13.808  1.00 37.02  ? 1274 ALA C CB  1 
ATOM   3344 N N   . THR C 1 82  ? 19.182 39.900 17.108  1.00 44.90  ? 1275 THR C N   1 
ATOM   3345 C CA  . THR C 1 82  ? 19.636 38.887 18.055  1.00 48.03  ? 1275 THR C CA  1 
ATOM   3346 C C   . THR C 1 82  ? 18.836 38.833 19.369  1.00 56.49  ? 1275 THR C C   1 
ATOM   3347 O O   . THR C 1 82  ? 18.730 37.773 19.991  1.00 51.68  ? 1275 THR C O   1 
ATOM   3348 C CB  . THR C 1 82  ? 21.152 39.031 18.356  1.00 27.63  ? 1275 THR C CB  1 
ATOM   3349 N N   . GLY C 1 83  ? 18.251 39.955 19.781  1.00 59.25  ? 1276 GLY C N   1 
ATOM   3350 C CA  . GLY C 1 83  ? 17.703 40.044 21.127  1.00 56.11  ? 1276 GLY C CA  1 
ATOM   3351 C C   . GLY C 1 83  ? 16.263 40.483 21.373  1.00 58.17  ? 1276 GLY C C   1 
ATOM   3352 O O   . GLY C 1 83  ? 15.893 40.740 22.532  1.00 49.46  ? 1276 GLY C O   1 
ATOM   3353 N N   . LEU C 1 84  ? 15.444 40.552 20.321  1.00 41.44  ? 1277 LEU C N   1 
ATOM   3354 C CA  . LEU C 1 84  ? 14.045 40.966 20.467  1.00 27.16  ? 1277 LEU C CA  1 
ATOM   3355 C C   . LEU C 1 84  ? 13.193 40.030 21.331  1.00 38.08  ? 1277 LEU C C   1 
ATOM   3356 O O   . LEU C 1 84  ? 12.069 40.381 21.717  1.00 32.94  ? 1277 LEU C O   1 
ATOM   3357 C CB  . LEU C 1 84  ? 13.384 41.131 19.103  1.00 25.69  ? 1277 LEU C CB  1 
ATOM   3358 C CG  . LEU C 1 84  ? 13.751 42.392 18.333  1.00 40.16  ? 1277 LEU C CG  1 
ATOM   3359 C CD1 . LEU C 1 84  ? 12.782 42.556 17.192  1.00 47.44  ? 1277 LEU C CD1 1 
ATOM   3360 C CD2 . LEU C 1 84  ? 13.735 43.626 19.237  1.00 36.46  ? 1277 LEU C CD2 1 
ATOM   3361 N N   . SER C 1 85  ? 13.718 38.843 21.630  1.00 39.99  ? 1278 SER C N   1 
ATOM   3362 C CA  . SER C 1 85  ? 12.975 37.869 22.429  1.00 40.10  ? 1278 SER C CA  1 
ATOM   3363 C C   . SER C 1 85  ? 13.577 37.649 23.819  1.00 37.95  ? 1278 SER C C   1 
ATOM   3364 O O   . SER C 1 85  ? 13.067 36.854 24.609  1.00 35.57  ? 1278 SER C O   1 
ATOM   3365 C CB  . SER C 1 85  ? 12.855 36.533 21.681  1.00 43.50  ? 1278 SER C CB  1 
ATOM   3366 O OG  . SER C 1 85  ? 12.122 36.681 20.472  1.00 50.91  ? 1278 SER C OG  1 
ATOM   3367 N N   . THR C 1 86  ? 14.655 38.356 24.126  1.00 30.54  ? 1279 THR C N   1 
ATOM   3368 C CA  . THR C 1 86  ? 15.332 38.132 25.400  1.00 40.91  ? 1279 THR C CA  1 
ATOM   3369 C C   . THR C 1 86  ? 14.577 38.785 26.561  1.00 42.38  ? 1279 THR C C   1 
ATOM   3370 O O   . THR C 1 86  ? 14.284 39.986 26.536  1.00 43.81  ? 1279 THR C O   1 
ATOM   3371 C CB  . THR C 1 86  ? 16.816 38.586 25.354  1.00 37.57  ? 1279 THR C CB  1 
ATOM   3372 O OG1 . THR C 1 86  ? 16.924 39.963 25.712  1.00 53.02  ? 1279 THR C OG1 1 
ATOM   3373 C CG2 . THR C 1 86  ? 17.398 38.381 23.960  1.00 37.21  ? 1279 THR C CG2 1 
ATOM   3374 N N   . GLU C 1 87  ? 14.233 37.987 27.569  1.00 44.57  ? 1280 GLU C N   1 
ATOM   3375 C CA  . GLU C 1 87  ? 13.495 38.520 28.713  1.00 36.16  ? 1280 GLU C CA  1 
ATOM   3376 C C   . GLU C 1 87  ? 14.247 39.677 29.340  1.00 36.45  ? 1280 GLU C C   1 
ATOM   3377 O O   . GLU C 1 87  ? 15.462 39.603 29.550  1.00 41.98  ? 1280 GLU C O   1 
ATOM   3378 C CB  . GLU C 1 87  ? 13.221 37.445 29.763  1.00 28.42  ? 1280 GLU C CB  1 
ATOM   3379 C CG  . GLU C 1 87  ? 11.903 36.709 29.576  1.00 49.81  ? 1280 GLU C CG  1 
ATOM   3380 C CD  . GLU C 1 87  ? 11.557 35.807 30.758  1.00 70.17  ? 1280 GLU C CD  1 
ATOM   3381 O OE1 . GLU C 1 87  ? 10.461 35.197 30.752  1.00 62.27  ? 1280 GLU C OE1 1 
ATOM   3382 O OE2 . GLU C 1 87  ? 12.382 35.710 31.695  1.00 63.98  ? 1280 GLU C OE2 1 
ATOM   3383 N N   . GLY C 1 88  ? 13.516 40.752 29.615  1.00 40.26  ? 1281 GLY C N   1 
ATOM   3384 C CA  . GLY C 1 88  ? 14.051 41.903 30.317  1.00 39.43  ? 1281 GLY C CA  1 
ATOM   3385 C C   . GLY C 1 88  ? 15.162 42.665 29.616  1.00 37.80  ? 1281 GLY C C   1 
ATOM   3386 O O   . GLY C 1 88  ? 15.897 43.408 30.263  1.00 47.48  ? 1281 GLY C O   1 
ATOM   3387 N N   . ILE C 1 89  ? 15.299 42.496 28.307  1.00 30.30  ? 1282 ILE C N   1 
ATOM   3388 C CA  . ILE C 1 89  ? 16.291 43.273 27.573  1.00 34.71  ? 1282 ILE C CA  1 
ATOM   3389 C C   . ILE C 1 89  ? 16.230 44.761 27.952  1.00 42.19  ? 1282 ILE C C   1 
ATOM   3390 O O   . ILE C 1 89  ? 15.146 45.354 28.044  1.00 28.50  ? 1282 ILE C O   1 
ATOM   3391 C CB  . ILE C 1 89  ? 16.162 43.108 26.037  1.00 31.27  ? 1282 ILE C CB  1 
ATOM   3392 C CG1 . ILE C 1 89  ? 17.415 43.657 25.361  1.00 24.90  ? 1282 ILE C CG1 1 
ATOM   3393 C CG2 . ILE C 1 89  ? 14.895 43.781 25.491  1.00 15.19  ? 1282 ILE C CG2 1 
ATOM   3394 C CD1 . ILE C 1 89  ? 17.390 43.559 23.869  1.00 45.17  ? 1282 ILE C CD1 1 
ATOM   3395 N N   . TYR C 1 90  ? 17.409 45.343 28.171  1.00 43.83  ? 1283 TYR C N   1 
ATOM   3396 C CA  . TYR C 1 90  ? 17.575 46.743 28.590  1.00 34.48  ? 1283 TYR C CA  1 
ATOM   3397 C C   . TYR C 1 90  ? 17.330 46.970 30.076  1.00 45.18  ? 1283 TYR C C   1 
ATOM   3398 O O   . TYR C 1 90  ? 17.857 47.923 30.644  1.00 52.40  ? 1283 TYR C O   1 
ATOM   3399 C CB  . TYR C 1 90  ? 16.709 47.701 27.776  1.00 36.44  ? 1283 TYR C CB  1 
ATOM   3400 C CG  . TYR C 1 90  ? 17.162 47.873 26.346  1.00 39.08  ? 1283 TYR C CG  1 
ATOM   3401 C CD1 . TYR C 1 90  ? 16.296 47.623 25.296  1.00 29.00  ? 1283 TYR C CD1 1 
ATOM   3402 C CD2 . TYR C 1 90  ? 18.460 48.280 26.049  1.00 36.60  ? 1283 TYR C CD2 1 
ATOM   3403 C CE1 . TYR C 1 90  ? 16.705 47.777 23.991  1.00 42.13  ? 1283 TYR C CE1 1 
ATOM   3404 C CE2 . TYR C 1 90  ? 18.879 48.442 24.745  1.00 31.18  ? 1283 TYR C CE2 1 
ATOM   3405 C CZ  . TYR C 1 90  ? 17.995 48.186 23.718  1.00 36.60  ? 1283 TYR C CZ  1 
ATOM   3406 O OH  . TYR C 1 90  ? 18.382 48.335 22.406  1.00 33.01  ? 1283 TYR C OH  1 
ATOM   3407 N N   . ARG C 1 91  ? 16.532 46.104 30.697  1.00 36.88  ? 1284 ARG C N   1 
ATOM   3408 C CA  . ARG C 1 91  ? 16.264 46.211 32.126  1.00 37.52  ? 1284 ARG C CA  1 
ATOM   3409 C C   . ARG C 1 91  ? 17.372 45.523 32.898  1.00 43.48  ? 1284 ARG C C   1 
ATOM   3410 O O   . ARG C 1 91  ? 17.906 46.076 33.854  1.00 45.39  ? 1284 ARG C O   1 
ATOM   3411 C CB  . ARG C 1 91  ? 14.911 45.591 32.470  1.00 46.87  ? 1284 ARG C CB  1 
ATOM   3412 C CG  . ARG C 1 91  ? 14.566 45.576 33.963  1.00 39.08  ? 1284 ARG C CG  1 
ATOM   3413 C CD  . ARG C 1 91  ? 13.226 44.875 34.173  1.00 53.52  ? 1284 ARG C CD  1 
ATOM   3414 N NE  . ARG C 1 91  ? 13.305 43.437 33.913  1.00 66.54  ? 1284 ARG C NE  1 
ATOM   3415 C CZ  . ARG C 1 91  ? 12.254 42.655 33.671  1.00 79.60  ? 1284 ARG C CZ  1 
ATOM   3416 N NH1 . ARG C 1 91  ? 11.025 43.167 33.637  1.00 54.41  ? 1284 ARG C NH1 1 
ATOM   3417 N NH2 . ARG C 1 91  ? 12.433 41.355 33.455  1.00 68.44  ? 1284 ARG C NH2 1 
ATOM   3418 N N   . VAL C 1 92  ? 17.706 44.310 32.471  1.00 43.99  ? 1285 VAL C N   1 
ATOM   3419 C CA  . VAL C 1 92  ? 18.812 43.549 33.041  1.00 46.11  ? 1285 VAL C CA  1 
ATOM   3420 C C   . VAL C 1 92  ? 20.128 44.244 32.736  1.00 55.72  ? 1285 VAL C C   1 
ATOM   3421 O O   . VAL C 1 92  ? 20.378 44.649 31.597  1.00 57.16  ? 1285 VAL C O   1 
ATOM   3422 C CB  . VAL C 1 92  ? 18.870 42.122 32.452  1.00 43.18  ? 1285 VAL C CB  1 
ATOM   3423 C CG1 . VAL C 1 92  ? 20.134 41.414 32.900  1.00 44.10  ? 1285 VAL C CG1 1 
ATOM   3424 C CG2 . VAL C 1 92  ? 17.625 41.324 32.836  1.00 33.00  ? 1285 VAL C CG2 1 
ATOM   3425 N N   . SER C 1 93  ? 20.970 44.398 33.750  1.00 67.31  ? 1286 SER C N   1 
ATOM   3426 C CA  . SER C 1 93  ? 22.270 45.010 33.525  1.00 75.40  ? 1286 SER C CA  1 
ATOM   3427 C C   . SER C 1 93  ? 23.268 43.931 33.148  1.00 77.40  ? 1286 SER C C   1 
ATOM   3428 O O   . SER C 1 93  ? 23.168 42.788 33.606  1.00 70.00  ? 1286 SER C O   1 
ATOM   3429 C CB  . SER C 1 93  ? 22.750 45.785 34.752  1.00 84.20  ? 1286 SER C CB  1 
ATOM   3430 O OG  . SER C 1 93  ? 23.913 46.535 34.431  1.00 101.26 ? 1286 SER C OG  1 
ATOM   3431 N N   . GLY C 1 94  ? 24.228 44.295 32.307  1.00 75.29  ? 1287 GLY C N   1 
ATOM   3432 C CA  . GLY C 1 94  ? 25.185 43.328 31.812  1.00 79.58  ? 1287 GLY C CA  1 
ATOM   3433 C C   . GLY C 1 94  ? 26.549 43.459 32.449  1.00 66.32  ? 1287 GLY C C   1 
ATOM   3434 O O   . GLY C 1 94  ? 26.785 44.349 33.269  1.00 59.06  ? 1287 GLY C O   1 
ATOM   3435 N N   . ASN C 1 95  ? 27.449 42.562 32.063  1.00 56.56  ? 1288 ASN C N   1 
ATOM   3436 C CA  . ASN C 1 95  ? 28.817 42.594 32.554  1.00 74.41  ? 1288 ASN C CA  1 
ATOM   3437 C C   . ASN C 1 95  ? 29.498 43.925 32.217  1.00 69.07  ? 1288 ASN C C   1 
ATOM   3438 O O   . ASN C 1 95  ? 29.717 44.247 31.046  1.00 62.35  ? 1288 ASN C O   1 
ATOM   3439 C CB  . ASN C 1 95  ? 29.603 41.408 31.984  1.00 74.59  ? 1288 ASN C CB  1 
ATOM   3440 C CG  . ASN C 1 95  ? 30.924 41.186 32.694  1.00 82.95  ? 1288 ASN C CG  1 
ATOM   3441 O OD1 . ASN C 1 95  ? 31.904 41.892 32.451  1.00 90.59  ? 1288 ASN C OD1 1 
ATOM   3442 N ND2 . ASN C 1 95  ? 30.960 40.193 33.571  1.00 86.81  ? 1288 ASN C ND2 1 
ATOM   3443 N N   . LYS C 1 96  ? 29.816 44.703 33.247  1.00 70.65  ? 1289 LYS C N   1 
ATOM   3444 C CA  . LYS C 1 96  ? 30.459 45.996 33.046  1.00 66.70  ? 1289 LYS C CA  1 
ATOM   3445 C C   . LYS C 1 96  ? 31.792 45.842 32.322  1.00 61.90  ? 1289 LYS C C   1 
ATOM   3446 O O   . LYS C 1 96  ? 32.165 46.695 31.521  1.00 70.88  ? 1289 LYS C O   1 
ATOM   3447 C CB  . LYS C 1 96  ? 30.654 46.729 34.376  1.00 51.18  ? 1289 LYS C CB  1 
ATOM   3448 N N   . SER C 1 97  ? 32.505 44.756 32.600  1.00 58.35  ? 1290 SER C N   1 
ATOM   3449 C CA  . SER C 1 97  ? 33.767 44.488 31.916  1.00 65.03  ? 1290 SER C CA  1 
ATOM   3450 C C   . SER C 1 97  ? 33.548 44.254 30.420  1.00 66.83  ? 1290 SER C C   1 
ATOM   3451 O O   . SER C 1 97  ? 34.284 44.785 29.581  1.00 61.09  ? 1290 SER C O   1 
ATOM   3452 C CB  . SER C 1 97  ? 34.489 43.287 32.541  1.00 55.38  ? 1290 SER C CB  1 
ATOM   3453 N N   . GLU C 1 98  ? 32.529 43.464 30.091  1.00 60.29  ? 1291 GLU C N   1 
ATOM   3454 C CA  . GLU C 1 98  ? 32.248 43.120 28.701  1.00 57.41  ? 1291 GLU C CA  1 
ATOM   3455 C C   . GLU C 1 98  ? 31.803 44.331 27.870  1.00 63.63  ? 1291 GLU C C   1 
ATOM   3456 O O   . GLU C 1 98  ? 32.058 44.392 26.669  1.00 55.61  ? 1291 GLU C O   1 
ATOM   3457 C CB  . GLU C 1 98  ? 31.218 41.995 28.627  1.00 62.48  ? 1291 GLU C CB  1 
ATOM   3458 C CG  . GLU C 1 98  ? 31.759 40.646 29.083  1.00 68.00  ? 1291 GLU C CG  1 
ATOM   3459 N N   . MET C 1 99  ? 31.150 45.299 28.510  1.00 65.83  ? 1292 MET C N   1 
ATOM   3460 C CA  . MET C 1 99  ? 30.753 46.523 27.820  1.00 51.45  ? 1292 MET C CA  1 
ATOM   3461 C C   . MET C 1 99  ? 31.957 47.408 27.564  1.00 52.59  ? 1292 MET C C   1 
ATOM   3462 O O   . MET C 1 99  ? 32.153 47.881 26.446  1.00 59.19  ? 1292 MET C O   1 
ATOM   3463 C CB  . MET C 1 99  ? 29.723 47.308 28.628  1.00 53.53  ? 1292 MET C CB  1 
ATOM   3464 C CG  . MET C 1 99  ? 28.457 46.541 28.942  1.00 63.14  ? 1292 MET C CG  1 
ATOM   3465 S SD  . MET C 1 99  ? 27.257 47.599 29.769  1.00 57.16  ? 1292 MET C SD  1 
ATOM   3466 C CE  . MET C 1 99  ? 26.370 46.388 30.737  1.00 55.66  ? 1292 MET C CE  1 
ATOM   3467 N N   . GLU C 1 100 ? 32.747 47.647 28.608  0.50 41.98  ? 1293 GLU C N   1 
ATOM   3468 C CA  . GLU C 1 100 ? 33.951 48.453 28.481  0.50 39.12  ? 1293 GLU C CA  1 
ATOM   3469 C C   . GLU C 1 100 ? 34.792 47.865 27.359  0.50 50.66  ? 1293 GLU C C   1 
ATOM   3470 O O   . GLU C 1 100 ? 35.377 48.590 26.547  0.50 42.71  ? 1293 GLU C O   1 
ATOM   3471 C CB  . GLU C 1 100 ? 34.734 48.459 29.793  0.50 38.16  ? 1293 GLU C CB  1 
ATOM   3472 N N   . SER C 1 101 ? 34.825 46.535 27.314  1.00 53.10  ? 1294 SER C N   1 
ATOM   3473 C CA  . SER C 1 101 ? 35.519 45.805 26.259  1.00 49.09  ? 1294 SER C CA  1 
ATOM   3474 C C   . SER C 1 101 ? 34.936 46.131 24.879  1.00 57.99  ? 1294 SER C C   1 
ATOM   3475 O O   . SER C 1 101 ? 35.655 46.580 23.980  1.00 59.54  ? 1294 SER C O   1 
ATOM   3476 C CB  . SER C 1 101 ? 35.454 44.299 26.526  1.00 52.48  ? 1294 SER C CB  1 
ATOM   3477 O OG  . SER C 1 101 ? 36.003 43.559 25.448  1.00 61.77  ? 1294 SER C OG  1 
ATOM   3478 N N   . LEU C 1 102 ? 33.634 45.908 24.715  1.00 50.58  ? 1295 LEU C N   1 
ATOM   3479 C CA  . LEU C 1 102 ? 32.962 46.210 23.456  1.00 48.94  ? 1295 LEU C CA  1 
ATOM   3480 C C   . LEU C 1 102 ? 33.252 47.650 23.005  1.00 51.12  ? 1295 LEU C C   1 
ATOM   3481 O O   . LEU C 1 102 ? 33.547 47.901 21.827  1.00 47.12  ? 1295 LEU C O   1 
ATOM   3482 C CB  . LEU C 1 102 ? 31.447 45.942 23.563  1.00 46.82  ? 1295 LEU C CB  1 
ATOM   3483 C CG  . LEU C 1 102 ? 30.547 46.325 22.372  1.00 47.90  ? 1295 LEU C CG  1 
ATOM   3484 C CD1 . LEU C 1 102 ? 31.193 45.964 21.051  1.00 59.26  ? 1295 LEU C CD1 1 
ATOM   3485 C CD2 . LEU C 1 102 ? 29.175 45.685 22.462  1.00 44.41  ? 1295 LEU C CD2 1 
ATOM   3486 N N   . GLN C 1 103 ? 33.182 48.592 23.943  1.00 49.96  ? 1296 GLN C N   1 
ATOM   3487 C CA  . GLN C 1 103 ? 33.392 50.000 23.616  1.00 58.01  ? 1296 GLN C CA  1 
ATOM   3488 C C   . GLN C 1 103 ? 34.847 50.233 23.218  1.00 62.46  ? 1296 GLN C C   1 
ATOM   3489 O O   . GLN C 1 103 ? 35.134 50.926 22.237  1.00 60.20  ? 1296 GLN C O   1 
ATOM   3490 C CB  . GLN C 1 103 ? 32.990 50.904 24.789  1.00 53.24  ? 1296 GLN C CB  1 
ATOM   3491 N N   . ARG C 1 104 ? 35.763 49.642 23.981  1.00 55.07  ? 1297 ARG C N   1 
ATOM   3492 C CA  . ARG C 1 104 ? 37.183 49.752 23.676  1.00 55.56  ? 1297 ARG C CA  1 
ATOM   3493 C C   . ARG C 1 104 ? 37.469 49.189 22.291  1.00 54.45  ? 1297 ARG C C   1 
ATOM   3494 O O   . ARG C 1 104 ? 38.088 49.853 21.464  1.00 63.26  ? 1297 ARG C O   1 
ATOM   3495 C CB  . ARG C 1 104 ? 38.028 49.033 24.734  1.00 50.51  ? 1297 ARG C CB  1 
ATOM   3496 N N   . GLN C 1 105 ? 36.999 47.971 22.036  1.00 53.05  ? 1298 GLN C N   1 
ATOM   3497 C CA  . GLN C 1 105 ? 37.228 47.314 20.751  1.00 62.30  ? 1298 GLN C CA  1 
ATOM   3498 C C   . GLN C 1 105 ? 36.640 48.087 19.571  1.00 60.54  ? 1298 GLN C C   1 
ATOM   3499 O O   . GLN C 1 105 ? 37.230 48.135 18.491  1.00 67.19  ? 1298 GLN C O   1 
ATOM   3500 C CB  . GLN C 1 105 ? 36.669 45.895 20.765  1.00 61.02  ? 1298 GLN C CB  1 
ATOM   3501 C CG  . GLN C 1 105 ? 37.232 45.004 21.854  1.00 52.42  ? 1298 GLN C CG  1 
ATOM   3502 C CD  . GLN C 1 105 ? 37.030 43.533 21.537  1.00 67.89  ? 1298 GLN C CD  1 
ATOM   3503 O OE1 . GLN C 1 105 ? 37.201 43.107 20.389  1.00 53.99  ? 1298 GLN C OE1 1 
ATOM   3504 N NE2 . GLN C 1 105 ? 36.662 42.748 22.550  1.00 59.29  ? 1298 GLN C NE2 1 
ATOM   3505 N N   . PHE C 1 106 ? 35.469 48.677 19.772  1.00 58.22  ? 1299 PHE C N   1 
ATOM   3506 C CA  . PHE C 1 106 ? 34.875 49.492 18.728  1.00 61.72  ? 1299 PHE C CA  1 
ATOM   3507 C C   . PHE C 1 106 ? 35.727 50.729 18.519  1.00 63.20  ? 1299 PHE C C   1 
ATOM   3508 O O   . PHE C 1 106 ? 35.922 51.181 17.388  1.00 72.70  ? 1299 PHE C O   1 
ATOM   3509 C CB  . PHE C 1 106 ? 33.444 49.905 19.078  1.00 56.12  ? 1299 PHE C CB  1 
ATOM   3510 C CG  . PHE C 1 106 ? 32.810 50.798 18.041  1.00 58.11  ? 1299 PHE C CG  1 
ATOM   3511 C CD1 . PHE C 1 106 ? 32.991 52.171 18.085  1.00 46.51  ? 1299 PHE C CD1 1 
ATOM   3512 C CD2 . PHE C 1 106 ? 32.057 50.260 17.010  1.00 45.93  ? 1299 PHE C CD2 1 
ATOM   3513 C CE1 . PHE C 1 106 ? 32.424 52.992 17.134  1.00 48.70  ? 1299 PHE C CE1 1 
ATOM   3514 C CE2 . PHE C 1 106 ? 31.484 51.078 16.058  1.00 59.70  ? 1299 PHE C CE2 1 
ATOM   3515 C CZ  . PHE C 1 106 ? 31.668 52.449 16.119  1.00 60.80  ? 1299 PHE C CZ  1 
ATOM   3516 N N   . ASP C 1 107 ? 36.226 51.274 19.624  1.00 52.03  ? 1300 ASP C N   1 
ATOM   3517 C CA  . ASP C 1 107 ? 37.059 52.464 19.585  1.00 66.80  ? 1300 ASP C CA  1 
ATOM   3518 C C   . ASP C 1 107 ? 38.271 52.240 18.674  1.00 75.54  ? 1300 ASP C C   1 
ATOM   3519 O O   . ASP C 1 107 ? 38.704 53.152 17.959  1.00 81.13  ? 1300 ASP C O   1 
ATOM   3520 C CB  . ASP C 1 107 ? 37.507 52.839 21.001  1.00 57.81  ? 1300 ASP C CB  1 
ATOM   3521 C CG  . ASP C 1 107 ? 37.694 54.337 21.179  1.00 71.06  ? 1300 ASP C CG  1 
ATOM   3522 O OD1 . ASP C 1 107 ? 37.442 55.101 20.218  1.00 78.75  ? 1300 ASP C OD1 1 
ATOM   3523 O OD2 . ASP C 1 107 ? 38.088 54.753 22.287  1.00 78.46  ? 1300 ASP C OD2 1 
ATOM   3524 N N   . GLN C 1 108 ? 38.805 51.020 18.693  1.00 59.96  ? 1301 GLN C N   1 
ATOM   3525 C CA  . GLN C 1 108 ? 39.952 50.673 17.862  1.00 62.92  ? 1301 GLN C CA  1 
ATOM   3526 C C   . GLN C 1 108 ? 39.605 50.659 16.368  1.00 83.40  ? 1301 GLN C C   1 
ATOM   3527 O O   . GLN C 1 108 ? 40.238 51.368 15.583  1.00 101.83 ? 1301 GLN C O   1 
ATOM   3528 C CB  . GLN C 1 108 ? 40.561 49.346 18.306  1.00 68.44  ? 1301 GLN C CB  1 
ATOM   3529 C CG  . GLN C 1 108 ? 41.183 49.400 19.696  1.00 68.64  ? 1301 GLN C CG  1 
ATOM   3530 C CD  . GLN C 1 108 ? 41.941 48.130 20.051  1.00 88.68  ? 1301 GLN C CD  1 
ATOM   3531 O OE1 . GLN C 1 108 ? 42.666 47.570 19.221  1.00 83.73  ? 1301 GLN C OE1 1 
ATOM   3532 N NE2 . GLN C 1 108 ? 41.780 47.670 21.292  1.00 64.92  ? 1301 GLN C NE2 1 
ATOM   3533 N N   . ASP C 1 109 ? 38.611 49.866 15.965  1.00 69.58  ? 1302 ASP C N   1 
ATOM   3534 C CA  . ASP C 1 109 ? 38.086 50.010 14.603  1.00 86.59  ? 1302 ASP C CA  1 
ATOM   3535 C C   . ASP C 1 109 ? 36.552 50.013 14.538  1.00 75.06  ? 1302 ASP C C   1 
ATOM   3536 O O   . ASP C 1 109 ? 35.876 49.241 15.219  1.00 70.92  ? 1302 ASP C O   1 
ATOM   3537 C CB  . ASP C 1 109 ? 38.744 49.028 13.610  1.00 85.24  ? 1302 ASP C CB  1 
ATOM   3538 C CG  . ASP C 1 109 ? 37.892 47.805 13.321  1.00 83.04  ? 1302 ASP C CG  1 
ATOM   3539 O OD1 . ASP C 1 109 ? 37.888 46.858 14.142  1.00 64.67  ? 1302 ASP C OD1 1 
ATOM   3540 O OD2 . ASP C 1 109 ? 37.256 47.778 12.246  1.00 81.83  ? 1302 ASP C OD2 1 
ATOM   3541 N N   . HIS C 1 110 ? 36.021 50.920 13.725  1.00 75.91  ? 1303 HIS C N   1 
ATOM   3542 C CA  . HIS C 1 110 ? 34.592 51.212 13.689  1.00 72.75  ? 1303 HIS C CA  1 
ATOM   3543 C C   . HIS C 1 110 ? 33.805 50.233 12.827  1.00 75.83  ? 1303 HIS C C   1 
ATOM   3544 O O   . HIS C 1 110 ? 32.578 50.315 12.745  1.00 77.67  ? 1303 HIS C O   1 
ATOM   3545 C CB  . HIS C 1 110 ? 34.378 52.639 13.180  1.00 66.51  ? 1303 HIS C CB  1 
ATOM   3546 C CG  . HIS C 1 110 ? 34.896 53.690 14.107  1.00 67.43  ? 1303 HIS C CG  1 
ATOM   3547 N ND1 . HIS C 1 110 ? 35.674 53.391 15.207  1.00 68.24  ? 1303 HIS C ND1 1 
ATOM   3548 C CD2 . HIS C 1 110 ? 34.767 55.038 14.091  1.00 56.73  ? 1303 HIS C CD2 1 
ATOM   3549 C CE1 . HIS C 1 110 ? 35.989 54.510 15.836  1.00 73.95  ? 1303 HIS C CE1 1 
ATOM   3550 N NE2 . HIS C 1 110 ? 35.451 55.523 15.179  1.00 81.21  ? 1303 HIS C NE2 1 
ATOM   3551 N N   . ASN C 1 111 ? 34.512 49.318 12.176  1.00 75.59  ? 1304 ASN C N   1 
ATOM   3552 C CA  . ASN C 1 111 ? 33.858 48.299 11.368  1.00 85.41  ? 1304 ASN C CA  1 
ATOM   3553 C C   . ASN C 1 111 ? 33.629 47.019 12.165  1.00 79.32  ? 1304 ASN C C   1 
ATOM   3554 O O   . ASN C 1 111 ? 33.256 45.984 11.608  1.00 77.49  ? 1304 ASN C O   1 
ATOM   3555 C CB  . ASN C 1 111 ? 34.666 48.020 10.098  1.00 84.29  ? 1304 ASN C CB  1 
ATOM   3556 C CG  . ASN C 1 111 ? 34.386 49.031 8.999   1.00 99.92  ? 1304 ASN C CG  1 
ATOM   3557 O OD1 . ASN C 1 111 ? 35.273 49.794 8.598   1.00 72.79  ? 1304 ASN C OD1 1 
ATOM   3558 N ND2 . ASN C 1 111 ? 33.144 49.048 8.511   1.00 96.75  ? 1304 ASN C ND2 1 
ATOM   3559 N N   . LEU C 1 112 ? 33.850 47.108 13.475  1.00 69.44  ? 1305 LEU C N   1 
ATOM   3560 C CA  . LEU C 1 112 ? 33.684 45.970 14.366  1.00 66.87  ? 1305 LEU C CA  1 
ATOM   3561 C C   . LEU C 1 112 ? 32.392 45.240 14.044  1.00 71.86  ? 1305 LEU C C   1 
ATOM   3562 O O   . LEU C 1 112 ? 31.350 45.872 13.842  1.00 73.35  ? 1305 LEU C O   1 
ATOM   3563 C CB  . LEU C 1 112 ? 33.663 46.432 15.824  1.00 61.12  ? 1305 LEU C CB  1 
ATOM   3564 C CG  . LEU C 1 112 ? 33.540 45.314 16.865  1.00 67.38  ? 1305 LEU C CG  1 
ATOM   3565 C CD1 . LEU C 1 112 ? 34.852 44.568 16.995  1.00 78.65  ? 1305 LEU C CD1 1 
ATOM   3566 C CD2 . LEU C 1 112 ? 33.115 45.852 18.219  1.00 55.00  ? 1305 LEU C CD2 1 
ATOM   3567 N N   . ASP C 1 113 ? 32.465 43.913 13.988  1.00 61.68  ? 1306 ASP C N   1 
ATOM   3568 C CA  . ASP C 1 113 ? 31.281 43.091 13.727  1.00 84.95  ? 1306 ASP C CA  1 
ATOM   3569 C C   . ASP C 1 113 ? 30.867 42.317 14.975  1.00 77.04  ? 1306 ASP C C   1 
ATOM   3570 O O   . ASP C 1 113 ? 31.555 41.387 15.395  1.00 75.79  ? 1306 ASP C O   1 
ATOM   3571 C CB  . ASP C 1 113 ? 31.524 42.129 12.559  1.00 78.12  ? 1306 ASP C CB  1 
ATOM   3572 N N   . LEU C 1 114 ? 29.740 42.705 15.565  1.00 72.36  ? 1307 LEU C N   1 
ATOM   3573 C CA  . LEU C 1 114 ? 29.306 42.113 16.827  1.00 86.56  ? 1307 LEU C CA  1 
ATOM   3574 C C   . LEU C 1 114 ? 28.972 40.630 16.654  1.00 80.39  ? 1307 LEU C C   1 
ATOM   3575 O O   . LEU C 1 114 ? 29.017 39.852 17.615  1.00 78.19  ? 1307 LEU C O   1 
ATOM   3576 C CB  . LEU C 1 114 ? 28.124 42.891 17.427  1.00 61.09  ? 1307 LEU C CB  1 
ATOM   3577 N N   . ALA C 1 115 ? 28.646 40.247 15.423  1.00 77.28  ? 1308 ALA C N   1 
ATOM   3578 C CA  . ALA C 1 115 ? 28.386 38.852 15.107  1.00 84.89  ? 1308 ALA C CA  1 
ATOM   3579 C C   . ALA C 1 115 ? 29.646 38.031 15.358  1.00 91.74  ? 1308 ALA C C   1 
ATOM   3580 O O   . ALA C 1 115 ? 29.628 37.042 16.100  1.00 80.14  ? 1308 ALA C O   1 
ATOM   3581 C CB  . ALA C 1 115 ? 27.934 38.714 13.659  1.00 70.91  ? 1308 ALA C CB  1 
ATOM   3582 N N   . GLU C 1 116 ? 30.746 38.471 14.752  1.00 89.52  ? 1309 GLU C N   1 
ATOM   3583 C CA  . GLU C 1 116 ? 32.013 37.747 14.818  1.00 92.00  ? 1309 GLU C CA  1 
ATOM   3584 C C   . GLU C 1 116 ? 32.714 37.857 16.178  1.00 83.22  ? 1309 GLU C C   1 
ATOM   3585 O O   . GLU C 1 116 ? 33.872 37.459 16.308  1.00 90.90  ? 1309 GLU C O   1 
ATOM   3586 C CB  . GLU C 1 116 ? 32.955 38.223 13.699  1.00 62.16  ? 1309 GLU C CB  1 
ATOM   3587 N N   . LYS C 1 117 ? 32.023 38.376 17.189  1.00 68.61  ? 1310 LYS C N   1 
ATOM   3588 C CA  . LYS C 1 117 ? 32.692 38.678 18.453  1.00 71.58  ? 1310 LYS C CA  1 
ATOM   3589 C C   . LYS C 1 117 ? 32.022 38.055 19.689  1.00 76.12  ? 1310 LYS C C   1 
ATOM   3590 O O   . LYS C 1 117 ? 32.495 38.230 20.820  1.00 67.69  ? 1310 LYS C O   1 
ATOM   3591 C CB  . LYS C 1 117 ? 32.874 40.196 18.612  1.00 42.97  ? 1310 LYS C CB  1 
ATOM   3592 N N   . ASP C 1 118 ? 30.929 37.329 19.464  1.00 70.49  ? 1311 ASP C N   1 
ATOM   3593 C CA  . ASP C 1 118 ? 30.260 36.562 20.525  1.00 89.37  ? 1311 ASP C CA  1 
ATOM   3594 C C   . ASP C 1 118 ? 29.952 37.356 21.804  1.00 79.34  ? 1311 ASP C C   1 
ATOM   3595 O O   . ASP C 1 118 ? 30.255 36.905 22.912  1.00 64.99  ? 1311 ASP C O   1 
ATOM   3596 C CB  . ASP C 1 118 ? 31.065 35.301 20.874  1.00 66.44  ? 1311 ASP C CB  1 
ATOM   3597 N N   . PHE C 1 119 ? 29.341 38.527 21.647  1.00 67.51  ? 1312 PHE C N   1 
ATOM   3598 C CA  . PHE C 1 119 ? 28.934 39.334 22.793  1.00 55.89  ? 1312 PHE C CA  1 
ATOM   3599 C C   . PHE C 1 119 ? 27.514 38.982 23.233  1.00 61.71  ? 1312 PHE C C   1 
ATOM   3600 O O   . PHE C 1 119 ? 26.630 38.783 22.400  1.00 63.01  ? 1312 PHE C O   1 
ATOM   3601 C CB  . PHE C 1 119 ? 28.986 40.826 22.449  1.00 61.06  ? 1312 PHE C CB  1 
ATOM   3602 C CG  . PHE C 1 119 ? 30.345 41.457 22.606  1.00 53.45  ? 1312 PHE C CG  1 
ATOM   3603 C CD1 . PHE C 1 119 ? 30.995 41.999 21.513  1.00 46.60  ? 1312 PHE C CD1 1 
ATOM   3604 C CD2 . PHE C 1 119 ? 30.956 41.535 23.848  1.00 50.47  ? 1312 PHE C CD2 1 
ATOM   3605 C CE1 . PHE C 1 119 ? 32.230 42.593 21.645  1.00 40.70  ? 1312 PHE C CE1 1 
ATOM   3606 C CE2 . PHE C 1 119 ? 32.199 42.125 23.986  1.00 47.26  ? 1312 PHE C CE2 1 
ATOM   3607 C CZ  . PHE C 1 119 ? 32.835 42.655 22.883  1.00 46.09  ? 1312 PHE C CZ  1 
ATOM   3608 N N   . THR C 1 120 ? 27.298 38.911 24.543  1.00 61.57  ? 1313 THR C N   1 
ATOM   3609 C CA  . THR C 1 120 ? 25.961 38.731 25.095  1.00 55.04  ? 1313 THR C CA  1 
ATOM   3610 C C   . THR C 1 120 ? 25.055 39.817 24.526  1.00 58.62  ? 1313 THR C C   1 
ATOM   3611 O O   . THR C 1 120 ? 25.504 40.936 24.275  1.00 59.42  ? 1313 THR C O   1 
ATOM   3612 C CB  . THR C 1 120 ? 25.969 38.874 26.646  1.00 67.22  ? 1313 THR C CB  1 
ATOM   3613 O OG1 . THR C 1 120 ? 27.166 38.300 27.191  1.00 72.90  ? 1313 THR C OG1 1 
ATOM   3614 C CG2 . THR C 1 120 ? 24.742 38.205 27.277  1.00 74.12  ? 1313 THR C CG2 1 
ATOM   3615 N N   . VAL C 1 121 ? 23.782 39.498 24.324  1.00 64.92  ? 1314 VAL C N   1 
ATOM   3616 C CA  . VAL C 1 121 ? 22.823 40.501 23.853  1.00 57.95  ? 1314 VAL C CA  1 
ATOM   3617 C C   . VAL C 1 121 ? 22.674 41.624 24.887  1.00 49.65  ? 1314 VAL C C   1 
ATOM   3618 O O   . VAL C 1 121 ? 22.604 42.802 24.535  1.00 40.63  ? 1314 VAL C O   1 
ATOM   3619 C CB  . VAL C 1 121 ? 21.441 39.868 23.508  1.00 51.93  ? 1314 VAL C CB  1 
ATOM   3620 C CG1 . VAL C 1 121 ? 20.847 39.182 24.726  1.00 72.32  ? 1314 VAL C CG1 1 
ATOM   3621 C CG2 . VAL C 1 121 ? 20.490 40.906 22.970  1.00 45.63  ? 1314 VAL C CG2 1 
ATOM   3622 N N   . ASN C 1 122 ? 22.641 41.246 26.163  1.00 49.34  ? 1315 ASN C N   1 
ATOM   3623 C CA  . ASN C 1 122 ? 22.590 42.210 27.260  1.00 48.72  ? 1315 ASN C CA  1 
ATOM   3624 C C   . ASN C 1 122 ? 23.821 43.111 27.317  1.00 50.94  ? 1315 ASN C C   1 
ATOM   3625 O O   . ASN C 1 122 ? 23.734 44.279 27.705  1.00 47.52  ? 1315 ASN C O   1 
ATOM   3626 C CB  . ASN C 1 122 ? 22.411 41.492 28.598  1.00 43.74  ? 1315 ASN C CB  1 
ATOM   3627 C CG  . ASN C 1 122 ? 20.970 41.152 28.879  1.00 50.74  ? 1315 ASN C CG  1 
ATOM   3628 O OD1 . ASN C 1 122 ? 20.085 41.988 28.700  1.00 57.17  ? 1315 ASN C OD1 1 
ATOM   3629 N ND2 . ASN C 1 122 ? 20.722 39.925 29.325  1.00 39.52  ? 1315 ASN C ND2 1 
ATOM   3630 N N   . THR C 1 123 ? 24.970 42.559 26.942  1.00 53.99  ? 1316 THR C N   1 
ATOM   3631 C CA  . THR C 1 123 ? 26.203 43.330 26.896  1.00 47.54  ? 1316 THR C CA  1 
ATOM   3632 C C   . THR C 1 123 ? 26.115 44.417 25.820  1.00 47.65  ? 1316 THR C C   1 
ATOM   3633 O O   . THR C 1 123 ? 26.489 45.568 26.051  1.00 43.31  ? 1316 THR C O   1 
ATOM   3634 C CB  . THR C 1 123 ? 27.418 42.417 26.658  1.00 50.08  ? 1316 THR C CB  1 
ATOM   3635 O OG1 . THR C 1 123 ? 27.575 41.543 27.784  1.00 60.77  ? 1316 THR C OG1 1 
ATOM   3636 C CG2 . THR C 1 123 ? 28.687 43.238 26.476  1.00 37.79  ? 1316 THR C CG2 1 
ATOM   3637 N N   . VAL C 1 124 ? 25.597 44.055 24.651  1.00 42.81  ? 1317 VAL C N   1 
ATOM   3638 C CA  . VAL C 1 124 ? 25.408 45.025 23.577  1.00 40.41  ? 1317 VAL C CA  1 
ATOM   3639 C C   . VAL C 1 124 ? 24.317 46.036 23.898  1.00 41.26  ? 1317 VAL C C   1 
ATOM   3640 O O   . VAL C 1 124 ? 24.412 47.203 23.529  1.00 43.23  ? 1317 VAL C O   1 
ATOM   3641 C CB  . VAL C 1 124 ? 25.050 44.345 22.256  1.00 43.70  ? 1317 VAL C CB  1 
ATOM   3642 C CG1 . VAL C 1 124 ? 24.834 45.396 21.164  1.00 36.51  ? 1317 VAL C CG1 1 
ATOM   3643 C CG2 . VAL C 1 124 ? 26.140 43.357 21.867  1.00 42.42  ? 1317 VAL C CG2 1 
ATOM   3644 N N   . ALA C 1 125 ? 23.271 45.581 24.576  1.00 49.49  ? 1318 ALA C N   1 
ATOM   3645 C CA  . ALA C 1 125 ? 22.194 46.469 24.986  1.00 39.62  ? 1318 ALA C CA  1 
ATOM   3646 C C   . ALA C 1 125 ? 22.711 47.495 25.984  1.00 37.05  ? 1318 ALA C C   1 
ATOM   3647 O O   . ALA C 1 125 ? 22.504 48.697 25.813  1.00 36.18  ? 1318 ALA C O   1 
ATOM   3648 C CB  . ALA C 1 125 ? 21.048 45.676 25.574  1.00 38.83  ? 1318 ALA C CB  1 
ATOM   3649 N N   . GLY C 1 126 ? 23.389 47.010 27.021  1.00 43.12  ? 1319 GLY C N   1 
ATOM   3650 C CA  . GLY C 1 126 ? 23.981 47.873 28.029  1.00 42.80  ? 1319 GLY C CA  1 
ATOM   3651 C C   . GLY C 1 126 ? 25.041 48.816 27.479  1.00 46.79  ? 1319 GLY C C   1 
ATOM   3652 O O   . GLY C 1 126 ? 25.196 49.939 27.963  1.00 46.87  ? 1319 GLY C O   1 
ATOM   3653 N N   . ALA C 1 127 ? 25.774 48.364 26.467  1.00 44.76  ? 1320 ALA C N   1 
ATOM   3654 C CA  . ALA C 1 127 ? 26.819 49.183 25.878  1.00 40.23  ? 1320 ALA C CA  1 
ATOM   3655 C C   . ALA C 1 127 ? 26.199 50.273 25.029  1.00 40.49  ? 1320 ALA C C   1 
ATOM   3656 O O   . ALA C 1 127 ? 26.787 51.337 24.845  1.00 42.72  ? 1320 ALA C O   1 
ATOM   3657 C CB  . ALA C 1 127 ? 27.764 48.333 25.051  1.00 48.61  ? 1320 ALA C CB  1 
ATOM   3658 N N   . MET C 1 128 ? 25.001 50.006 24.517  1.00 36.47  ? 1321 MET C N   1 
ATOM   3659 C CA  . MET C 1 128 ? 24.285 50.998 23.719  1.00 38.42  ? 1321 MET C CA  1 
ATOM   3660 C C   . MET C 1 128 ? 23.739 52.123 24.610  1.00 40.11  ? 1321 MET C C   1 
ATOM   3661 O O   . MET C 1 128 ? 23.859 53.297 24.276  1.00 37.81  ? 1321 MET C O   1 
ATOM   3662 C CB  . MET C 1 128 ? 23.185 50.329 22.891  1.00 31.81  ? 1321 MET C CB  1 
ATOM   3663 C CG  . MET C 1 128 ? 22.377 51.274 22.019  1.00 33.25  ? 1321 MET C CG  1 
ATOM   3664 S SD  . MET C 1 128 ? 20.854 51.883 22.801  1.00 41.95  ? 1321 MET C SD  1 
ATOM   3665 C CE  . MET C 1 128 ? 20.257 52.965 21.510  1.00 61.38  ? 1321 MET C CE  1 
ATOM   3666 N N   . LYS C 1 129 ? 23.159 51.762 25.752  1.00 39.71  ? 1322 LYS C N   1 
ATOM   3667 C CA  . LYS C 1 129 ? 22.755 52.753 26.750  1.00 42.40  ? 1322 LYS C CA  1 
ATOM   3668 C C   . LYS C 1 129 ? 23.960 53.546 27.256  1.00 46.75  ? 1322 LYS C C   1 
ATOM   3669 O O   . LYS C 1 129 ? 23.886 54.759 27.454  1.00 43.97  ? 1322 LYS C O   1 
ATOM   3670 C CB  . LYS C 1 129 ? 22.060 52.091 27.947  1.00 35.24  ? 1322 LYS C CB  1 
ATOM   3671 C CG  . LYS C 1 129 ? 20.569 51.919 27.795  1.00 40.15  ? 1322 LYS C CG  1 
ATOM   3672 C CD  . LYS C 1 129 ? 19.863 52.023 29.133  1.00 33.82  ? 1322 LYS C CD  1 
ATOM   3673 C CE  . LYS C 1 129 ? 20.085 50.783 29.976  1.00 50.10  ? 1322 LYS C CE  1 
ATOM   3674 N NZ  . LYS C 1 129 ? 19.637 50.981 31.391  1.00 41.42  ? 1322 LYS C NZ  1 
ATOM   3675 N N   . SER C 1 130 ? 25.069 52.850 27.475  1.00 38.56  ? 1323 SER C N   1 
ATOM   3676 C CA  . SER C 1 130 ? 26.260 53.486 28.012  1.00 42.94  ? 1323 SER C CA  1 
ATOM   3677 C C   . SER C 1 130 ? 26.717 54.650 27.135  1.00 42.98  ? 1323 SER C C   1 
ATOM   3678 O O   . SER C 1 130 ? 27.172 55.679 27.634  1.00 38.35  ? 1323 SER C O   1 
ATOM   3679 C CB  . SER C 1 130 ? 27.392 52.467 28.165  1.00 43.10  ? 1323 SER C CB  1 
ATOM   3680 O OG  . SER C 1 130 ? 28.478 53.023 28.891  1.00 51.67  ? 1323 SER C OG  1 
ATOM   3681 N N   . PHE C 1 131 ? 26.600 54.489 25.824  1.00 39.63  ? 1324 PHE C N   1 
ATOM   3682 C CA  . PHE C 1 131 ? 27.004 55.557 24.930  1.00 40.66  ? 1324 PHE C CA  1 
ATOM   3683 C C   . PHE C 1 131 ? 26.252 56.828 25.286  1.00 43.93  ? 1324 PHE C C   1 
ATOM   3684 O O   . PHE C 1 131 ? 26.825 57.921 25.312  1.00 44.86  ? 1324 PHE C O   1 
ATOM   3685 C CB  . PHE C 1 131 ? 26.745 55.185 23.472  1.00 37.91  ? 1324 PHE C CB  1 
ATOM   3686 C CG  . PHE C 1 131 ? 26.866 56.343 22.527  1.00 36.82  ? 1324 PHE C CG  1 
ATOM   3687 C CD1 . PHE C 1 131 ? 28.093 56.685 21.982  1.00 31.82  ? 1324 PHE C CD1 1 
ATOM   3688 C CD2 . PHE C 1 131 ? 25.754 57.098 22.193  1.00 31.52  ? 1324 PHE C CD2 1 
ATOM   3689 C CE1 . PHE C 1 131 ? 28.208 57.755 21.110  1.00 35.63  ? 1324 PHE C CE1 1 
ATOM   3690 C CE2 . PHE C 1 131 ? 25.864 58.166 21.327  1.00 37.91  ? 1324 PHE C CE2 1 
ATOM   3691 C CZ  . PHE C 1 131 ? 27.098 58.497 20.784  1.00 35.42  ? 1324 PHE C CZ  1 
ATOM   3692 N N   . PHE C 1 132 ? 24.966 56.676 25.573  1.00 39.67  ? 1325 PHE C N   1 
ATOM   3693 C CA  . PHE C 1 132 ? 24.122 57.827 25.844  1.00 38.97  ? 1325 PHE C CA  1 
ATOM   3694 C C   . PHE C 1 132 ? 24.382 58.446 27.204  1.00 40.72  ? 1325 PHE C C   1 
ATOM   3695 O O   . PHE C 1 132 ? 24.329 59.667 27.349  1.00 48.28  ? 1325 PHE C O   1 
ATOM   3696 C CB  . PHE C 1 132 ? 22.644 57.478 25.666  1.00 35.87  ? 1325 PHE C CB  1 
ATOM   3697 C CG  . PHE C 1 132 ? 22.239 57.348 24.228  1.00 41.69  ? 1325 PHE C CG  1 
ATOM   3698 C CD1 . PHE C 1 132 ? 22.290 58.450 23.379  1.00 36.04  ? 1325 PHE C CD1 1 
ATOM   3699 C CD2 . PHE C 1 132 ? 21.831 56.128 23.713  1.00 39.47  ? 1325 PHE C CD2 1 
ATOM   3700 C CE1 . PHE C 1 132 ? 21.933 58.336 22.050  1.00 37.40  ? 1325 PHE C CE1 1 
ATOM   3701 C CE2 . PHE C 1 132 ? 21.469 56.009 22.383  1.00 32.03  ? 1325 PHE C CE2 1 
ATOM   3702 C CZ  . PHE C 1 132 ? 21.525 57.115 21.551  1.00 45.99  ? 1325 PHE C CZ  1 
ATOM   3703 N N   . SER C 1 133 ? 24.668 57.614 28.198  1.00 41.30  ? 1326 SER C N   1 
ATOM   3704 C CA  . SER C 1 133 ? 24.985 58.134 29.523  1.00 44.97  ? 1326 SER C CA  1 
ATOM   3705 C C   . SER C 1 133 ? 26.392 58.722 29.568  1.00 39.85  ? 1326 SER C C   1 
ATOM   3706 O O   . SER C 1 133 ? 26.740 59.435 30.513  1.00 44.42  ? 1326 SER C O   1 
ATOM   3707 C CB  . SER C 1 133 ? 24.799 57.072 30.603  1.00 35.45  ? 1326 SER C CB  1 
ATOM   3708 O OG  . SER C 1 133 ? 25.257 55.815 30.153  1.00 53.20  ? 1326 SER C OG  1 
ATOM   3709 N N   . GLU C 1 134 ? 27.188 58.446 28.537  1.00 43.65  ? 1327 GLU C N   1 
ATOM   3710 C CA  . GLU C 1 134 ? 28.552 58.977 28.465  1.00 46.28  ? 1327 GLU C CA  1 
ATOM   3711 C C   . GLU C 1 134 ? 28.623 60.298 27.700  1.00 51.02  ? 1327 GLU C C   1 
ATOM   3712 O O   . GLU C 1 134 ? 29.627 61.010 27.773  1.00 46.09  ? 1327 GLU C O   1 
ATOM   3713 C CB  . GLU C 1 134 ? 29.516 57.960 27.851  1.00 39.53  ? 1327 GLU C CB  1 
ATOM   3714 C CG  . GLU C 1 134 ? 29.951 56.866 28.815  1.00 59.17  ? 1327 GLU C CG  1 
ATOM   3715 C CD  . GLU C 1 134 ? 30.505 55.640 28.107  1.00 63.70  ? 1327 GLU C CD  1 
ATOM   3716 O OE1 . GLU C 1 134 ? 30.519 55.634 26.857  1.00 55.86  ? 1327 GLU C OE1 1 
ATOM   3717 O OE2 . GLU C 1 134 ? 30.922 54.682 28.803  1.00 65.58  ? 1327 GLU C OE2 1 
ATOM   3718 N N   . LEU C 1 135 ? 27.560 60.625 26.971  1.00 43.75  ? 1328 LEU C N   1 
ATOM   3719 C CA  . LEU C 1 135 ? 27.501 61.894 26.259  1.00 33.22  ? 1328 LEU C CA  1 
ATOM   3720 C C   . LEU C 1 135 ? 27.586 63.022 27.252  1.00 37.64  ? 1328 LEU C C   1 
ATOM   3721 O O   . LEU C 1 135 ? 26.937 62.979 28.293  1.00 39.87  ? 1328 LEU C O   1 
ATOM   3722 C CB  . LEU C 1 135 ? 26.192 62.030 25.487  1.00 41.25  ? 1328 LEU C CB  1 
ATOM   3723 C CG  . LEU C 1 135 ? 25.996 61.265 24.181  1.00 36.32  ? 1328 LEU C CG  1 
ATOM   3724 C CD1 . LEU C 1 135 ? 24.606 61.533 23.651  1.00 36.23  ? 1328 LEU C CD1 1 
ATOM   3725 C CD2 . LEU C 1 135 ? 27.054 61.655 23.158  1.00 40.03  ? 1328 LEU C CD2 1 
ATOM   3726 N N   . PRO C 1 136 ? 28.386 64.045 26.929  1.00 50.75  ? 1329 PRO C N   1 
ATOM   3727 C CA  . PRO C 1 136 ? 28.554 65.243 27.765  1.00 44.86  ? 1329 PRO C CA  1 
ATOM   3728 C C   . PRO C 1 136 ? 27.207 65.867 28.124  1.00 39.62  ? 1329 PRO C C   1 
ATOM   3729 O O   . PRO C 1 136 ? 27.009 66.277 29.263  1.00 43.67  ? 1329 PRO C O   1 
ATOM   3730 C CB  . PRO C 1 136 ? 29.352 66.183 26.863  1.00 42.23  ? 1329 PRO C CB  1 
ATOM   3731 C CG  . PRO C 1 136 ? 30.121 65.270 25.967  1.00 51.18  ? 1329 PRO C CG  1 
ATOM   3732 C CD  . PRO C 1 136 ? 29.214 64.095 25.711  1.00 45.33  ? 1329 PRO C CD  1 
ATOM   3733 N N   . ASP C 1 137 ? 26.295 65.926 27.159  1.00 42.55  ? 1330 ASP C N   1 
ATOM   3734 C CA  . ASP C 1 137 ? 24.934 66.391 27.418  1.00 45.98  ? 1330 ASP C CA  1 
ATOM   3735 C C   . ASP C 1 137 ? 23.903 65.303 27.072  1.00 43.66  ? 1330 ASP C C   1 
ATOM   3736 O O   . ASP C 1 137 ? 24.077 64.546 26.114  1.00 41.33  ? 1330 ASP C O   1 
ATOM   3737 C CB  . ASP C 1 137 ? 24.656 67.678 26.642  1.00 42.93  ? 1330 ASP C CB  1 
ATOM   3738 C CG  . ASP C 1 137 ? 25.762 68.708 26.809  1.00 58.69  ? 1330 ASP C CG  1 
ATOM   3739 O OD1 . ASP C 1 137 ? 26.068 69.062 27.971  1.00 50.92  ? 1330 ASP C OD1 1 
ATOM   3740 O OD2 . ASP C 1 137 ? 26.320 69.162 25.779  1.00 47.37  ? 1330 ASP C OD2 1 
ATOM   3741 N N   . PRO C 1 138 ? 22.829 65.213 27.867  1.00 37.25  ? 1331 PRO C N   1 
ATOM   3742 C CA  . PRO C 1 138 ? 21.811 64.180 27.657  1.00 41.67  ? 1331 PRO C CA  1 
ATOM   3743 C C   . PRO C 1 138 ? 21.203 64.279 26.254  1.00 41.45  ? 1331 PRO C C   1 
ATOM   3744 O O   . PRO C 1 138 ? 21.117 65.377 25.697  1.00 42.07  ? 1331 PRO C O   1 
ATOM   3745 C CB  . PRO C 1 138 ? 20.757 64.524 28.717  1.00 37.29  ? 1331 PRO C CB  1 
ATOM   3746 C CG  . PRO C 1 138 ? 20.975 65.990 28.986  1.00 34.61  ? 1331 PRO C CG  1 
ATOM   3747 C CD  . PRO C 1 138 ? 22.465 66.109 28.974  1.00 32.81  ? 1331 PRO C CD  1 
ATOM   3748 N N   . LEU C 1 139 ? 20.793 63.152 25.686  1.00 29.19  ? 1332 LEU C N   1 
ATOM   3749 C CA  . LEU C 1 139 ? 20.237 63.168 24.343  1.00 34.78  ? 1332 LEU C CA  1 
ATOM   3750 C C   . LEU C 1 139 ? 19.077 64.155 24.255  1.00 35.28  ? 1332 LEU C C   1 
ATOM   3751 O O   . LEU C 1 139 ? 18.976 64.931 23.310  1.00 37.84  ? 1332 LEU C O   1 
ATOM   3752 C CB  . LEU C 1 139 ? 19.778 61.772 23.922  1.00 33.18  ? 1332 LEU C CB  1 
ATOM   3753 C CG  . LEU C 1 139 ? 19.267 61.686 22.484  1.00 30.24  ? 1332 LEU C CG  1 
ATOM   3754 C CD1 . LEU C 1 139 ? 20.345 62.166 21.527  1.00 30.35  ? 1332 LEU C CD1 1 
ATOM   3755 C CD2 . LEU C 1 139 ? 18.838 60.268 22.156  1.00 41.03  ? 1332 LEU C CD2 1 
ATOM   3756 N N   . VAL C 1 140 ? 18.199 64.111 25.246  1.00 32.03  ? 1333 VAL C N   1 
ATOM   3757 C CA  . VAL C 1 140 ? 17.108 65.059 25.330  1.00 33.29  ? 1333 VAL C CA  1 
ATOM   3758 C C   . VAL C 1 140 ? 17.608 66.238 26.145  1.00 38.70  ? 1333 VAL C C   1 
ATOM   3759 O O   . VAL C 1 140 ? 17.772 66.121 27.361  1.00 39.76  ? 1333 VAL C O   1 
ATOM   3760 C CB  . VAL C 1 140 ? 15.890 64.420 26.009  1.00 34.67  ? 1333 VAL C CB  1 
ATOM   3761 C CG1 . VAL C 1 140 ? 14.726 65.405 26.100  1.00 34.61  ? 1333 VAL C CG1 1 
ATOM   3762 C CG2 . VAL C 1 140 ? 15.485 63.190 25.241  1.00 36.84  ? 1333 VAL C CG2 1 
ATOM   3763 N N   . PRO C 1 141 ? 17.871 67.374 25.472  1.00 35.03  ? 1334 PRO C N   1 
ATOM   3764 C CA  . PRO C 1 141 ? 18.513 68.536 26.093  1.00 38.78  ? 1334 PRO C CA  1 
ATOM   3765 C C   . PRO C 1 141 ? 17.675 69.120 27.220  1.00 36.94  ? 1334 PRO C C   1 
ATOM   3766 O O   . PRO C 1 141 ? 16.446 69.093 27.137  1.00 34.86  ? 1334 PRO C O   1 
ATOM   3767 C CB  . PRO C 1 141 ? 18.632 69.526 24.929  1.00 37.92  ? 1334 PRO C CB  1 
ATOM   3768 C CG  . PRO C 1 141 ? 18.628 68.663 23.709  1.00 26.92  ? 1334 PRO C CG  1 
ATOM   3769 C CD  . PRO C 1 141 ? 17.621 67.606 24.040  1.00 36.30  ? 1334 PRO C CD  1 
ATOM   3770 N N   . TYR C 1 142 ? 18.337 69.632 28.255  1.00 35.07  ? 1335 TYR C N   1 
ATOM   3771 C CA  . TYR C 1 142 ? 17.643 70.109 29.447  1.00 40.34  ? 1335 TYR C CA  1 
ATOM   3772 C C   . TYR C 1 142 ? 16.573 71.169 29.163  1.00 41.33  ? 1335 TYR C C   1 
ATOM   3773 O O   . TYR C 1 142 ? 15.486 71.128 29.748  1.00 43.06  ? 1335 TYR C O   1 
ATOM   3774 C CB  . TYR C 1 142 ? 18.639 70.608 30.493  1.00 29.29  ? 1335 TYR C CB  1 
ATOM   3775 C CG  . TYR C 1 142 ? 19.445 69.501 31.113  1.00 36.82  ? 1335 TYR C CG  1 
ATOM   3776 C CD1 . TYR C 1 142 ? 18.834 68.538 31.911  1.00 32.50  ? 1335 TYR C CD1 1 
ATOM   3777 C CD2 . TYR C 1 142 ? 20.819 69.415 30.906  1.00 37.12  ? 1335 TYR C CD2 1 
ATOM   3778 C CE1 . TYR C 1 142 ? 19.569 67.514 32.491  1.00 34.14  ? 1335 TYR C CE1 1 
ATOM   3779 C CE2 . TYR C 1 142 ? 21.566 68.395 31.477  1.00 36.68  ? 1335 TYR C CE2 1 
ATOM   3780 C CZ  . TYR C 1 142 ? 20.934 67.446 32.270  1.00 41.13  ? 1335 TYR C CZ  1 
ATOM   3781 O OH  . TYR C 1 142 ? 21.664 66.427 32.848  1.00 41.95  ? 1335 TYR C OH  1 
ATOM   3782 N N   . ASN C 1 143 ? 16.873 72.109 28.269  1.00 37.38  ? 1336 ASN C N   1 
ATOM   3783 C CA  . ASN C 1 143 ? 15.901 73.136 27.896  1.00 43.19  ? 1336 ASN C CA  1 
ATOM   3784 C C   . ASN C 1 143 ? 14.627 72.533 27.317  1.00 45.54  ? 1336 ASN C C   1 
ATOM   3785 O O   . ASN C 1 143 ? 13.521 72.953 27.669  1.00 50.34  ? 1336 ASN C O   1 
ATOM   3786 C CB  . ASN C 1 143 ? 16.502 74.147 26.921  1.00 29.25  ? 1336 ASN C CB  1 
ATOM   3787 C CG  . ASN C 1 143 ? 17.333 73.491 25.864  1.00 50.64  ? 1336 ASN C CG  1 
ATOM   3788 O OD1 . ASN C 1 143 ? 18.295 72.785 26.173  1.00 72.54  ? 1336 ASN C OD1 1 
ATOM   3789 N ND2 . ASN C 1 143 ? 16.977 73.710 24.604  1.00 47.57  ? 1336 ASN C ND2 1 
ATOM   3790 N N   . MET C 1 144 ? 14.778 71.546 26.435  1.00 38.96  ? 1337 MET C N   1 
ATOM   3791 C CA  . MET C 1 144 ? 13.625 70.799 25.927  1.00 36.03  ? 1337 MET C CA  1 
ATOM   3792 C C   . MET C 1 144 ? 12.873 70.078 27.047  1.00 41.11  ? 1337 MET C C   1 
ATOM   3793 O O   . MET C 1 144 ? 11.654 69.899 26.986  1.00 44.80  ? 1337 MET C O   1 
ATOM   3794 C CB  . MET C 1 144 ? 14.055 69.786 24.868  1.00 34.99  ? 1337 MET C CB  1 
ATOM   3795 C CG  . MET C 1 144 ? 14.619 70.401 23.572  1.00 51.38  ? 1337 MET C CG  1 
ATOM   3796 S SD  . MET C 1 144 ? 13.536 71.569 22.690  1.00 44.56  ? 1337 MET C SD  1 
ATOM   3797 C CE  . MET C 1 144 ? 13.794 73.067 23.637  1.00 47.69  ? 1337 MET C CE  1 
ATOM   3798 N N   . GLN C 1 145 ? 13.602 69.663 28.075  1.00 39.69  ? 1338 GLN C N   1 
ATOM   3799 C CA  . GLN C 1 145 ? 12.993 68.913 29.156  1.00 34.12  ? 1338 GLN C CA  1 
ATOM   3800 C C   . GLN C 1 145 ? 11.970 69.758 29.864  1.00 36.02  ? 1338 GLN C C   1 
ATOM   3801 O O   . GLN C 1 145 ? 10.888 69.287 30.208  1.00 37.41  ? 1338 GLN C O   1 
ATOM   3802 C CB  . GLN C 1 145 ? 14.053 68.436 30.137  1.00 25.84  ? 1338 GLN C CB  1 
ATOM   3803 C CG  . GLN C 1 145 ? 14.975 67.402 29.539  1.00 34.68  ? 1338 GLN C CG  1 
ATOM   3804 C CD  . GLN C 1 145 ? 15.737 66.660 30.587  1.00 33.42  ? 1338 GLN C CD  1 
ATOM   3805 O OE1 . GLN C 1 145 ? 15.297 66.552 31.726  1.00 38.36  ? 1338 GLN C OE1 1 
ATOM   3806 N NE2 . GLN C 1 145 ? 16.894 66.145 30.216  1.00 35.16  ? 1338 GLN C NE2 1 
ATOM   3807 N N   . ILE C 1 146 ? 12.320 71.017 30.077  1.00 42.10  ? 1339 ILE C N   1 
ATOM   3808 C CA  . ILE C 1 146 ? 11.444 71.929 30.789  1.00 46.10  ? 1339 ILE C CA  1 
ATOM   3809 C C   . ILE C 1 146 ? 10.110 72.003 30.054  1.00 45.32  ? 1339 ILE C C   1 
ATOM   3810 O O   . ILE C 1 146 ? 9.050  71.825 30.657  1.00 39.38  ? 1339 ILE C O   1 
ATOM   3811 C CB  . ILE C 1 146 ? 12.075 73.338 30.924  1.00 53.55  ? 1339 ILE C CB  1 
ATOM   3812 C CG1 . ILE C 1 146 ? 13.530 73.230 31.402  1.00 59.68  ? 1339 ILE C CG1 1 
ATOM   3813 C CG2 . ILE C 1 146 ? 11.268 74.186 31.891  1.00 51.21  ? 1339 ILE C CG2 1 
ATOM   3814 C CD1 . ILE C 1 146 ? 14.376 74.481 31.165  1.00 48.39  ? 1339 ILE C CD1 1 
ATOM   3815 N N   . ASP C 1 147 ? 10.176 72.245 28.746  1.00 32.36  ? 1340 ASP C N   1 
ATOM   3816 C CA  . ASP C 1 147 ? 8.981  72.338 27.920  1.00 36.53  ? 1340 ASP C CA  1 
ATOM   3817 C C   . ASP C 1 147 ? 8.201  71.021 27.928  1.00 48.88  ? 1340 ASP C C   1 
ATOM   3818 O O   . ASP C 1 147 ? 6.968  71.015 28.006  1.00 43.60  ? 1340 ASP C O   1 
ATOM   3819 C CB  . ASP C 1 147 ? 9.359  72.712 26.485  1.00 44.26  ? 1340 ASP C CB  1 
ATOM   3820 C CG  . ASP C 1 147 ? 10.042 74.068 26.393  1.00 59.43  ? 1340 ASP C CG  1 
ATOM   3821 O OD1 . ASP C 1 147 ? 9.864  74.889 27.323  1.00 58.49  ? 1340 ASP C OD1 1 
ATOM   3822 O OD2 . ASP C 1 147 ? 10.752 74.313 25.390  1.00 53.71  ? 1340 ASP C OD2 1 
ATOM   3823 N N   . LEU C 1 148 ? 8.924  69.906 27.838  1.00 44.87  ? 1341 LEU C N   1 
ATOM   3824 C CA  . LEU C 1 148 ? 8.300  68.586 27.880  1.00 36.78  ? 1341 LEU C CA  1 
ATOM   3825 C C   . LEU C 1 148 ? 7.482  68.432 29.149  1.00 37.40  ? 1341 LEU C C   1 
ATOM   3826 O O   . LEU C 1 148 ? 6.324  68.018 29.107  1.00 41.68  ? 1341 LEU C O   1 
ATOM   3827 C CB  . LEU C 1 148 ? 9.342  67.470 27.784  1.00 30.04  ? 1341 LEU C CB  1 
ATOM   3828 C CG  . LEU C 1 148 ? 9.932  67.210 26.394  1.00 36.34  ? 1341 LEU C CG  1 
ATOM   3829 C CD1 . LEU C 1 148 ? 10.999 66.125 26.481  1.00 31.77  ? 1341 LEU C CD1 1 
ATOM   3830 C CD2 . LEU C 1 148 ? 8.848  66.837 25.376  1.00 16.99  ? 1341 LEU C CD2 1 
ATOM   3831 N N   . VAL C 1 149 ? 8.077  68.787 30.279  1.00 32.13  ? 1342 VAL C N   1 
ATOM   3832 C CA  . VAL C 1 149 ? 7.389  68.653 31.552  1.00 29.95  ? 1342 VAL C CA  1 
ATOM   3833 C C   . VAL C 1 149 ? 6.155  69.550 31.610  1.00 42.75  ? 1342 VAL C C   1 
ATOM   3834 O O   . VAL C 1 149 ? 5.127  69.159 32.159  1.00 52.79  ? 1342 VAL C O   1 
ATOM   3835 C CB  . VAL C 1 149 ? 8.337  68.925 32.746  1.00 35.81  ? 1342 VAL C CB  1 
ATOM   3836 C CG1 . VAL C 1 149 ? 7.572  68.949 34.071  1.00 26.27  ? 1342 VAL C CG1 1 
ATOM   3837 C CG2 . VAL C 1 149 ? 9.424  67.876 32.796  1.00 28.05  ? 1342 VAL C CG2 1 
ATOM   3838 N N   . GLU C 1 150 ? 6.255  70.745 31.032  1.00 44.27  ? 1343 GLU C N   1 
ATOM   3839 C CA  . GLU C 1 150 ? 5.138  71.692 31.020  1.00 43.72  ? 1343 GLU C CA  1 
ATOM   3840 C C   . GLU C 1 150 ? 3.951  71.124 30.249  1.00 42.74  ? 1343 GLU C C   1 
ATOM   3841 O O   . GLU C 1 150 ? 2.833  71.103 30.757  1.00 36.46  ? 1343 GLU C O   1 
ATOM   3842 C CB  . GLU C 1 150 ? 5.566  73.038 30.414  1.00 59.74  ? 1343 GLU C CB  1 
ATOM   3843 C CG  . GLU C 1 150 ? 6.411  73.907 31.331  1.00 58.71  ? 1343 GLU C CG  1 
ATOM   3844 C CD  . GLU C 1 150 ? 5.636  74.387 32.542  1.00 68.85  ? 1343 GLU C CD  1 
ATOM   3845 O OE1 . GLU C 1 150 ? 4.597  75.059 32.363  1.00 64.07  ? 1343 GLU C OE1 1 
ATOM   3846 O OE2 . GLU C 1 150 ? 6.070  74.094 33.676  1.00 78.46  ? 1343 GLU C OE2 1 
ATOM   3847 N N   . ALA C 1 151 ? 4.205  70.674 29.019  1.00 42.58  ? 1344 ALA C N   1 
ATOM   3848 C CA  . ALA C 1 151 ? 3.165  70.122 28.158  1.00 33.86  ? 1344 ALA C CA  1 
ATOM   3849 C C   . ALA C 1 151 ? 2.444  69.003 28.882  1.00 38.57  ? 1344 ALA C C   1 
ATOM   3850 O O   . ALA C 1 151 ? 1.220  68.908 28.841  1.00 39.17  ? 1344 ALA C O   1 
ATOM   3851 C CB  . ALA C 1 151 ? 3.770  69.602 26.871  1.00 29.94  ? 1344 ALA C CB  1 
ATOM   3852 N N   . HIS C 1 152 ? 3.222  68.160 29.550  1.00 39.94  ? 1345 HIS C N   1 
ATOM   3853 C CA  . HIS C 1 152 ? 2.691  67.028 30.304  1.00 44.24  ? 1345 HIS C CA  1 
ATOM   3854 C C   . HIS C 1 152 ? 1.618  67.423 31.334  1.00 47.83  ? 1345 HIS C C   1 
ATOM   3855 O O   . HIS C 1 152 ? 0.831  66.587 31.774  1.00 44.81  ? 1345 HIS C O   1 
ATOM   3856 C CB  . HIS C 1 152 ? 3.839  66.283 30.983  1.00 46.38  ? 1345 HIS C CB  1 
ATOM   3857 C CG  . HIS C 1 152 ? 3.412  65.067 31.741  1.00 49.39  ? 1345 HIS C CG  1 
ATOM   3858 N ND1 . HIS C 1 152 ? 2.898  63.946 31.124  1.00 45.15  ? 1345 HIS C ND1 1 
ATOM   3859 C CD2 . HIS C 1 152 ? 3.444  64.787 33.065  1.00 53.87  ? 1345 HIS C CD2 1 
ATOM   3860 C CE1 . HIS C 1 152 ? 2.618  63.034 32.036  1.00 49.17  ? 1345 HIS C CE1 1 
ATOM   3861 N NE2 . HIS C 1 152 ? 2.940  63.519 33.222  1.00 73.35  ? 1345 HIS C NE2 1 
ATOM   3862 N N   . LYS C 1 153 ? 1.586  68.695 31.717  1.00 46.92  ? 1346 LYS C N   1 
ATOM   3863 C CA  . LYS C 1 153 ? 0.589  69.163 32.672  1.00 41.28  ? 1346 LYS C CA  1 
ATOM   3864 C C   . LYS C 1 153 ? -0.809 69.057 32.069  1.00 52.02  ? 1346 LYS C C   1 
ATOM   3865 O O   . LYS C 1 153 ? -1.786 68.825 32.789  1.00 52.11  ? 1346 LYS C O   1 
ATOM   3866 C CB  . LYS C 1 153 ? 0.864  70.608 33.093  1.00 52.57  ? 1346 LYS C CB  1 
ATOM   3867 C CG  . LYS C 1 153 ? 2.133  70.820 33.909  1.00 49.77  ? 1346 LYS C CG  1 
ATOM   3868 C CD  . LYS C 1 153 ? 2.195  72.270 34.353  1.00 58.30  ? 1346 LYS C CD  1 
ATOM   3869 C CE  . LYS C 1 153 ? 3.599  72.713 34.709  1.00 68.52  ? 1346 LYS C CE  1 
ATOM   3870 N NZ  . LYS C 1 153 ? 3.635  74.189 34.931  1.00 69.28  ? 1346 LYS C NZ  1 
ATOM   3871 N N   . ILE C 1 154 ? -0.899 69.235 30.751  1.00 41.37  ? 1347 ILE C N   1 
ATOM   3872 C CA  . ILE C 1 154 ? -2.176 69.156 30.050  1.00 41.79  ? 1347 ILE C CA  1 
ATOM   3873 C C   . ILE C 1 154 ? -2.791 67.776 30.233  1.00 48.86  ? 1347 ILE C C   1 
ATOM   3874 O O   . ILE C 1 154 ? -2.214 66.773 29.815  1.00 45.47  ? 1347 ILE C O   1 
ATOM   3875 C CB  . ILE C 1 154 ? -2.025 69.435 28.549  1.00 35.96  ? 1347 ILE C CB  1 
ATOM   3876 C CG1 . ILE C 1 154 ? -1.314 70.765 28.327  1.00 38.94  ? 1347 ILE C CG1 1 
ATOM   3877 C CG2 . ILE C 1 154 ? -3.378 69.465 27.881  1.00 38.13  ? 1347 ILE C CG2 1 
ATOM   3878 C CD1 . ILE C 1 154 ? -1.036 71.072 26.875  1.00 37.00  ? 1347 ILE C CD1 1 
ATOM   3879 N N   . ASN C 1 155 ? -3.970 67.744 30.849  1.00 52.00  ? 1348 ASN C N   1 
ATOM   3880 C CA  . ASN C 1 155 ? -4.617 66.503 31.254  1.00 47.91  ? 1348 ASN C CA  1 
ATOM   3881 C C   . ASN C 1 155 ? -5.294 65.737 30.117  1.00 41.49  ? 1348 ASN C C   1 
ATOM   3882 O O   . ASN C 1 155 ? -5.322 64.511 30.124  1.00 62.46  ? 1348 ASN C O   1 
ATOM   3883 C CB  . ASN C 1 155 ? -5.620 66.775 32.382  1.00 55.95  ? 1348 ASN C CB  1 
ATOM   3884 N N   . ASP C 1 156 ? -5.849 66.451 29.149  1.00 45.56  ? 1349 ASP C N   1 
ATOM   3885 C CA  . ASP C 1 156 ? -6.516 65.802 28.026  1.00 35.08  ? 1349 ASP C CA  1 
ATOM   3886 C C   . ASP C 1 156 ? -5.468 65.148 27.139  1.00 45.77  ? 1349 ASP C C   1 
ATOM   3887 O O   . ASP C 1 156 ? -4.453 65.756 26.806  1.00 44.10  ? 1349 ASP C O   1 
ATOM   3888 C CB  . ASP C 1 156 ? -7.324 66.817 27.233  1.00 34.23  ? 1349 ASP C CB  1 
ATOM   3889 C CG  . ASP C 1 156 ? -7.969 66.220 26.019  1.00 52.01  ? 1349 ASP C CG  1 
ATOM   3890 O OD1 . ASP C 1 156 ? -9.033 65.586 26.182  1.00 60.39  ? 1349 ASP C OD1 1 
ATOM   3891 O OD2 . ASP C 1 156 ? -7.420 66.402 24.903  1.00 43.24  ? 1349 ASP C OD2 1 
ATOM   3892 N N   . ARG C 1 157 ? -5.715 63.903 26.754  1.00 48.96  ? 1350 ARG C N   1 
ATOM   3893 C CA  . ARG C 1 157 ? -4.689 63.109 26.099  1.00 45.81  ? 1350 ARG C CA  1 
ATOM   3894 C C   . ARG C 1 157 ? -4.289 63.633 24.723  1.00 38.50  ? 1350 ARG C C   1 
ATOM   3895 O O   . ARG C 1 157 ? -3.097 63.760 24.423  1.00 37.29  ? 1350 ARG C O   1 
ATOM   3896 C CB  . ARG C 1 157 ? -5.096 61.634 26.025  1.00 43.84  ? 1350 ARG C CB  1 
ATOM   3897 C CG  . ARG C 1 157 ? -3.986 60.738 25.500  1.00 36.09  ? 1350 ARG C CG  1 
ATOM   3898 C CD  . ARG C 1 157 ? -2.697 60.943 26.293  1.00 35.33  ? 1350 ARG C CD  1 
ATOM   3899 N NE  . ARG C 1 157 ? -2.840 60.393 27.632  1.00 43.52  ? 1350 ARG C NE  1 
ATOM   3900 C CZ  . ARG C 1 157 ? -2.476 59.161 27.959  1.00 42.38  ? 1350 ARG C CZ  1 
ATOM   3901 N NH1 . ARG C 1 157 ? -2.664 58.717 29.201  1.00 22.46  ? 1350 ARG C NH1 1 
ATOM   3902 N NH2 . ARG C 1 157 ? -1.924 58.377 27.037  1.00 34.73  ? 1350 ARG C NH2 1 
ATOM   3903 N N   . GLU C 1 158 ? -5.268 63.935 23.882  1.00 37.30  ? 1351 GLU C N   1 
ATOM   3904 C CA  . GLU C 1 158 ? -4.932 64.466 22.564  1.00 40.33  ? 1351 GLU C CA  1 
ATOM   3905 C C   . GLU C 1 158 ? -4.214 65.814 22.671  1.00 48.33  ? 1351 GLU C C   1 
ATOM   3906 O O   . GLU C 1 158 ? -3.199 66.047 22.014  1.00 45.52  ? 1351 GLU C O   1 
ATOM   3907 C CB  . GLU C 1 158 ? -6.168 64.601 21.678  1.00 34.53  ? 1351 GLU C CB  1 
ATOM   3908 C CG  . GLU C 1 158 ? -5.830 65.148 20.306  1.00 46.36  ? 1351 GLU C CG  1 
ATOM   3909 C CD  . GLU C 1 158 ? -7.042 65.381 19.446  1.00 51.30  ? 1351 GLU C CD  1 
ATOM   3910 O OE1 . GLU C 1 158 ? -6.848 65.718 18.258  1.00 56.49  ? 1351 GLU C OE1 1 
ATOM   3911 O OE2 . GLU C 1 158 ? -8.177 65.228 19.955  1.00 42.01  ? 1351 GLU C OE2 1 
ATOM   3912 N N   . GLN C 1 159 ? -4.752 66.702 23.499  1.00 50.17  ? 1352 GLN C N   1 
ATOM   3913 C CA  . GLN C 1 159 ? -4.131 67.998 23.731  1.00 49.00  ? 1352 GLN C CA  1 
ATOM   3914 C C   . GLN C 1 159 ? -2.674 67.823 24.162  1.00 50.92  ? 1352 GLN C C   1 
ATOM   3915 O O   . GLN C 1 159 ? -1.768 68.486 23.637  1.00 46.38  ? 1352 GLN C O   1 
ATOM   3916 C CB  . GLN C 1 159 ? -4.901 68.760 24.813  1.00 49.82  ? 1352 GLN C CB  1 
ATOM   3917 C CG  . GLN C 1 159 ? -6.192 69.388 24.335  1.00 42.33  ? 1352 GLN C CG  1 
ATOM   3918 C CD  . GLN C 1 159 ? -5.955 70.401 23.246  1.00 64.20  ? 1352 GLN C CD  1 
ATOM   3919 O OE1 . GLN C 1 159 ? -5.461 71.511 23.496  1.00 70.04  ? 1352 GLN C OE1 1 
ATOM   3920 N NE2 . GLN C 1 159 ? -6.298 70.026 22.019  1.00 58.60  ? 1352 GLN C NE2 1 
ATOM   3921 N N   . LYS C 1 160 ? -2.472 66.927 25.126  1.00 35.25  ? 1353 LYS C N   1 
ATOM   3922 C CA  . LYS C 1 160 ? -1.166 66.647 25.691  1.00 27.18  ? 1353 LYS C CA  1 
ATOM   3923 C C   . LYS C 1 160 ? -0.204 66.213 24.598  1.00 36.47  ? 1353 LYS C C   1 
ATOM   3924 O O   . LYS C 1 160 ? 0.950  66.657 24.545  1.00 32.36  ? 1353 LYS C O   1 
ATOM   3925 C CB  . LYS C 1 160 ? -1.301 65.539 26.731  1.00 35.38  ? 1353 LYS C CB  1 
ATOM   3926 C CG  . LYS C 1 160 ? -0.074 65.266 27.574  1.00 33.51  ? 1353 LYS C CG  1 
ATOM   3927 C CD  . LYS C 1 160 ? -0.383 64.144 28.544  1.00 34.60  ? 1353 LYS C CD  1 
ATOM   3928 C CE  . LYS C 1 160 ? 0.127  64.460 29.925  1.00 49.57  ? 1353 LYS C CE  1 
ATOM   3929 N NZ  . LYS C 1 160 ? -0.619 63.711 30.973  1.00 60.61  ? 1353 LYS C NZ  1 
ATOM   3930 N N   . LEU C 1 161 ? -0.672 65.335 23.720  1.00 25.94  ? 1354 LEU C N   1 
ATOM   3931 C CA  . LEU C 1 161 ? 0.223  64.795 22.715  1.00 30.89  ? 1354 LEU C CA  1 
ATOM   3932 C C   . LEU C 1 161 ? 0.634  65.862 21.705  1.00 36.33  ? 1354 LEU C C   1 
ATOM   3933 O O   . LEU C 1 161 ? 1.778  65.882 21.249  1.00 32.13  ? 1354 LEU C O   1 
ATOM   3934 C CB  . LEU C 1 161 ? -0.382 63.561 22.042  1.00 43.99  ? 1354 LEU C CB  1 
ATOM   3935 C CG  . LEU C 1 161 ? -0.422 62.318 22.944  1.00 29.40  ? 1354 LEU C CG  1 
ATOM   3936 C CD1 . LEU C 1 161 ? -1.210 61.185 22.302  1.00 25.24  ? 1354 LEU C CD1 1 
ATOM   3937 C CD2 . LEU C 1 161 ? 0.990  61.871 23.264  1.00 24.56  ? 1354 LEU C CD2 1 
ATOM   3938 N N   . HIS C 1 162 ? -0.287 66.762 21.371  1.00 39.40  ? 1355 HIS C N   1 
ATOM   3939 C CA  . HIS C 1 162 ? 0.053  67.874 20.482  1.00 37.14  ? 1355 HIS C CA  1 
ATOM   3940 C C   . HIS C 1 162 ? 1.091  68.756 21.150  1.00 27.23  ? 1355 HIS C C   1 
ATOM   3941 O O   . HIS C 1 162 ? 2.113  69.089 20.556  1.00 29.43  ? 1355 HIS C O   1 
ATOM   3942 C CB  . HIS C 1 162 ? -1.186 68.684 20.068  1.00 28.49  ? 1355 HIS C CB  1 
ATOM   3943 C CG  . HIS C 1 162 ? -2.057 67.976 19.080  1.00 56.71  ? 1355 HIS C CG  1 
ATOM   3944 N ND1 . HIS C 1 162 ? -3.372 67.654 19.344  1.00 65.82  ? 1355 HIS C ND1 1 
ATOM   3945 C CD2 . HIS C 1 162 ? -1.790 67.493 17.842  1.00 46.04  ? 1355 HIS C CD2 1 
ATOM   3946 C CE1 . HIS C 1 162 ? -3.884 67.018 18.303  1.00 56.38  ? 1355 HIS C CE1 1 
ATOM   3947 N NE2 . HIS C 1 162 ? -2.944 66.908 17.378  1.00 61.37  ? 1355 HIS C NE2 1 
ATOM   3948 N N   . ALA C 1 163 ? 0.829  69.120 22.396  1.00 23.54  ? 1356 ALA C N   1 
ATOM   3949 C CA  . ALA C 1 163 ? 1.754  69.940 23.146  1.00 20.69  ? 1356 ALA C CA  1 
ATOM   3950 C C   . ALA C 1 163 ? 3.142  69.328 23.088  1.00 26.99  ? 1356 ALA C C   1 
ATOM   3951 O O   . ALA C 1 163 ? 4.124  70.015 22.826  1.00 35.67  ? 1356 ALA C O   1 
ATOM   3952 C CB  . ALA C 1 163 ? 1.289  70.079 24.575  1.00 20.43  ? 1356 ALA C CB  1 
ATOM   3953 N N   . LEU C 1 164 ? 3.211  68.023 23.321  1.00 36.73  ? 1357 LEU C N   1 
ATOM   3954 C CA  . LEU C 1 164 ? 4.481  67.303 23.309  1.00 33.51  ? 1357 LEU C CA  1 
ATOM   3955 C C   . LEU C 1 164 ? 5.135  67.307 21.936  1.00 24.46  ? 1357 LEU C C   1 
ATOM   3956 O O   . LEU C 1 164 ? 6.327  67.551 21.806  1.00 27.87  ? 1357 LEU C O   1 
ATOM   3957 C CB  . LEU C 1 164 ? 4.281  65.873 23.802  1.00 34.35  ? 1357 LEU C CB  1 
ATOM   3958 C CG  . LEU C 1 164 ? 4.093  65.737 25.315  1.00 25.87  ? 1357 LEU C CG  1 
ATOM   3959 C CD1 . LEU C 1 164 ? 3.417  64.420 25.663  1.00 25.41  ? 1357 LEU C CD1 1 
ATOM   3960 C CD2 . LEU C 1 164 ? 5.443  65.862 26.004  1.00 20.54  ? 1357 LEU C CD2 1 
ATOM   3961 N N   . LYS C 1 165 ? 4.355  67.047 20.903  1.00 27.70  ? 1358 LYS C N   1 
ATOM   3962 C CA  . LYS C 1 165 ? 4.915  67.047 19.562  1.00 35.28  ? 1358 LYS C CA  1 
ATOM   3963 C C   . LYS C 1 165 ? 5.468  68.424 19.226  1.00 41.12  ? 1358 LYS C C   1 
ATOM   3964 O O   . LYS C 1 165 ? 6.436  68.543 18.466  1.00 37.21  ? 1358 LYS C O   1 
ATOM   3965 C CB  . LYS C 1 165 ? 3.875  66.623 18.527  1.00 31.44  ? 1358 LYS C CB  1 
ATOM   3966 C CG  . LYS C 1 165 ? 4.484  66.172 17.216  1.00 28.05  ? 1358 LYS C CG  1 
ATOM   3967 C CD  . LYS C 1 165 ? 3.398  65.765 16.252  1.00 41.55  ? 1358 LYS C CD  1 
ATOM   3968 C CE  . LYS C 1 165 ? 3.971  65.079 15.021  1.00 49.78  ? 1358 LYS C CE  1 
ATOM   3969 N NZ  . LYS C 1 165 ? 2.864  64.563 14.157  1.00 48.09  ? 1358 LYS C NZ  1 
ATOM   3970 N N   . GLU C 1 166 ? 4.852  69.460 19.797  1.00 39.15  ? 1359 GLU C N   1 
ATOM   3971 C CA  . GLU C 1 166 ? 5.313  70.835 19.589  1.00 41.24  ? 1359 GLU C CA  1 
ATOM   3972 C C   . GLU C 1 166 ? 6.721  71.047 20.131  1.00 44.26  ? 1359 GLU C C   1 
ATOM   3973 O O   . GLU C 1 166 ? 7.575  71.608 19.442  1.00 55.68  ? 1359 GLU C O   1 
ATOM   3974 C CB  . GLU C 1 166 ? 4.348  71.851 20.197  1.00 39.87  ? 1359 GLU C CB  1 
ATOM   3975 C CG  . GLU C 1 166 ? 3.325  72.385 19.208  1.00 42.77  ? 1359 GLU C CG  1 
ATOM   3976 C CD  . GLU C 1 166 ? 3.966  73.158 18.070  1.00 66.96  ? 1359 GLU C CD  1 
ATOM   3977 O OE1 . GLU C 1 166 ? 3.725  72.791 16.899  1.00 60.47  ? 1359 GLU C OE1 1 
ATOM   3978 O OE2 . GLU C 1 166 ? 4.717  74.124 18.348  1.00 71.12  ? 1359 GLU C OE2 1 
ATOM   3979 N N   . VAL C 1 167 ? 6.963  70.601 21.362  1.00 37.83  ? 1360 VAL C N   1 
ATOM   3980 C CA  . VAL C 1 167 ? 8.309  70.635 21.917  1.00 34.89  ? 1360 VAL C CA  1 
ATOM   3981 C C   . VAL C 1 167 ? 9.225  69.833 21.008  1.00 30.97  ? 1360 VAL C C   1 
ATOM   3982 O O   . VAL C 1 167 ? 10.347 70.235 20.724  1.00 34.26  ? 1360 VAL C O   1 
ATOM   3983 C CB  . VAL C 1 167 ? 8.386  70.019 23.332  1.00 28.45  ? 1360 VAL C CB  1 
ATOM   3984 C CG1 . VAL C 1 167 ? 9.821  69.998 23.811  1.00 30.44  ? 1360 VAL C CG1 1 
ATOM   3985 C CG2 . VAL C 1 167 ? 7.507  70.780 24.305  1.00 31.27  ? 1360 VAL C CG2 1 
ATOM   3986 N N   . LEU C 1 168 ? 8.729  68.694 20.544  1.00 34.66  ? 1361 LEU C N   1 
ATOM   3987 C CA  . LEU C 1 168 ? 9.541  67.797 19.742  1.00 35.35  ? 1361 LEU C CA  1 
ATOM   3988 C C   . LEU C 1 168 ? 10.060 68.513 18.494  1.00 41.75  ? 1361 LEU C C   1 
ATOM   3989 O O   . LEU C 1 168 ? 11.144 68.209 17.999  1.00 44.36  ? 1361 LEU C O   1 
ATOM   3990 C CB  . LEU C 1 168 ? 8.745  66.542 19.377  1.00 31.57  ? 1361 LEU C CB  1 
ATOM   3991 C CG  . LEU C 1 168 ? 9.570  65.438 18.711  1.00 41.12  ? 1361 LEU C CG  1 
ATOM   3992 C CD1 . LEU C 1 168 ? 10.715 65.006 19.614  1.00 36.81  ? 1361 LEU C CD1 1 
ATOM   3993 C CD2 . LEU C 1 168 ? 8.690  64.249 18.339  1.00 46.86  ? 1361 LEU C CD2 1 
ATOM   3994 N N   . LYS C 1 169 ? 9.287  69.478 18.002  1.00 44.49  ? 1362 LYS C N   1 
ATOM   3995 C CA  . LYS C 1 169 ? 9.687  70.280 16.846  1.00 45.24  ? 1362 LYS C CA  1 
ATOM   3996 C C   . LYS C 1 169 ? 10.853 71.217 17.161  1.00 46.30  ? 1362 LYS C C   1 
ATOM   3997 O O   . LYS C 1 169 ? 11.590 71.615 16.265  1.00 45.13  ? 1362 LYS C O   1 
ATOM   3998 C CB  . LYS C 1 169 ? 8.507  71.109 16.339  1.00 44.49  ? 1362 LYS C CB  1 
ATOM   3999 C CG  . LYS C 1 169 ? 7.429  70.313 15.632  1.00 60.94  ? 1362 LYS C CG  1 
ATOM   4000 C CD  . LYS C 1 169 ? 6.280  71.216 15.231  1.00 61.28  ? 1362 LYS C CD  1 
ATOM   4001 C CE  . LYS C 1 169 ? 5.124  70.420 14.667  1.00 67.60  ? 1362 LYS C CE  1 
ATOM   4002 N NZ  . LYS C 1 169 ? 3.918  71.280 14.493  1.00 62.94  ? 1362 LYS C NZ  1 
ATOM   4003 N N   . LYS C 1 170 ? 11.008 71.574 18.431  1.00 33.54  ? 1363 LYS C N   1 
ATOM   4004 C CA  . LYS C 1 170 ? 12.038 72.513 18.836  1.00 30.87  ? 1363 LYS C CA  1 
ATOM   4005 C C   . LYS C 1 170 ? 13.371 71.839 19.177  1.00 40.81  ? 1363 LYS C C   1 
ATOM   4006 O O   . LYS C 1 170 ? 14.345 72.511 19.521  1.00 47.39  ? 1363 LYS C O   1 
ATOM   4007 C CB  . LYS C 1 170 ? 11.552 73.358 20.019  1.00 39.19  ? 1363 LYS C CB  1 
ATOM   4008 C CG  . LYS C 1 170 ? 10.489 74.392 19.659  1.00 51.01  ? 1363 LYS C CG  1 
ATOM   4009 C CD  . LYS C 1 170 ? 10.482 75.552 20.650  1.00 62.85  ? 1363 LYS C CD  1 
ATOM   4010 N N   . PHE C 1 171 ? 13.420 70.515 19.090  1.00 39.75  ? 1364 PHE C N   1 
ATOM   4011 C CA  . PHE C 1 171 ? 14.667 69.790 19.335  1.00 43.06  ? 1364 PHE C CA  1 
ATOM   4012 C C   . PHE C 1 171 ? 15.751 70.221 18.347  1.00 43.15  ? 1364 PHE C C   1 
ATOM   4013 O O   . PHE C 1 171 ? 15.476 70.426 17.165  1.00 51.47  ? 1364 PHE C O   1 
ATOM   4014 C CB  . PHE C 1 171 ? 14.449 68.279 19.183  1.00 45.75  ? 1364 PHE C CB  1 
ATOM   4015 C CG  . PHE C 1 171 ? 13.992 67.588 20.439  1.00 43.05  ? 1364 PHE C CG  1 
ATOM   4016 C CD1 . PHE C 1 171 ? 12.963 68.108 21.208  1.00 35.95  ? 1364 PHE C CD1 1 
ATOM   4017 C CD2 . PHE C 1 171 ? 14.575 66.390 20.832  1.00 39.83  ? 1364 PHE C CD2 1 
ATOM   4018 C CE1 . PHE C 1 171 ? 12.538 67.459 22.357  1.00 36.21  ? 1364 PHE C CE1 1 
ATOM   4019 C CE2 . PHE C 1 171 ? 14.156 65.733 21.978  1.00 34.61  ? 1364 PHE C CE2 1 
ATOM   4020 C CZ  . PHE C 1 171 ? 13.139 66.270 22.742  1.00 33.88  ? 1364 PHE C CZ  1 
ATOM   4021 N N   . PRO C 1 172 ? 16.991 70.360 18.826  1.00 42.15  ? 1365 PRO C N   1 
ATOM   4022 C CA  . PRO C 1 172 ? 18.126 70.428 17.902  1.00 35.97  ? 1365 PRO C CA  1 
ATOM   4023 C C   . PRO C 1 172 ? 18.031 69.252 16.936  1.00 47.24  ? 1365 PRO C C   1 
ATOM   4024 O O   . PRO C 1 172 ? 17.728 68.141 17.372  1.00 51.76  ? 1365 PRO C O   1 
ATOM   4025 C CB  . PRO C 1 172 ? 19.330 70.231 18.828  1.00 33.30  ? 1365 PRO C CB  1 
ATOM   4026 C CG  . PRO C 1 172 ? 18.883 70.775 20.142  1.00 45.28  ? 1365 PRO C CG  1 
ATOM   4027 C CD  . PRO C 1 172 ? 17.397 70.516 20.232  1.00 44.83  ? 1365 PRO C CD  1 
ATOM   4028 N N   . LYS C 1 173 ? 18.283 69.478 15.654  1.00 45.02  ? 1366 LYS C N   1 
ATOM   4029 C CA  . LYS C 1 173 ? 18.075 68.422 14.669  1.00 44.58  ? 1366 LYS C CA  1 
ATOM   4030 C C   . LYS C 1 173 ? 18.959 67.206 14.898  1.00 44.56  ? 1366 LYS C C   1 
ATOM   4031 O O   . LYS C 1 173 ? 18.525 66.076 14.692  1.00 51.95  ? 1366 LYS C O   1 
ATOM   4032 C CB  . LYS C 1 173 ? 18.230 68.940 13.232  1.00 50.27  ? 1366 LYS C CB  1 
ATOM   4033 C CG  . LYS C 1 173 ? 17.846 67.912 12.173  1.00 53.49  ? 1366 LYS C CG  1 
ATOM   4034 C CD  . LYS C 1 173 ? 17.353 68.580 10.901  1.00 79.05  ? 1366 LYS C CD  1 
ATOM   4035 C CE  . LYS C 1 173 ? 16.668 67.576 9.991   1.00 81.93  ? 1366 LYS C CE  1 
ATOM   4036 N NZ  . LYS C 1 173 ? 15.887 68.263 8.926   1.00 87.10  ? 1366 LYS C NZ  1 
ATOM   4037 N N   . GLU C 1 174 ? 20.197 67.430 15.312  1.00 44.63  ? 1367 GLU C N   1 
ATOM   4038 C CA  . GLU C 1 174 ? 21.092 66.307 15.574  1.00 52.81  ? 1367 GLU C CA  1 
ATOM   4039 C C   . GLU C 1 174 ? 20.437 65.374 16.590  1.00 54.91  ? 1367 GLU C C   1 
ATOM   4040 O O   . GLU C 1 174 ? 20.378 64.160 16.385  1.00 57.67  ? 1367 GLU C O   1 
ATOM   4041 C CB  . GLU C 1 174 ? 22.462 66.779 16.087  1.00 48.89  ? 1367 GLU C CB  1 
ATOM   4042 C CG  . GLU C 1 174 ? 23.259 67.640 15.107  1.00 58.08  ? 1367 GLU C CG  1 
ATOM   4043 C CD  . GLU C 1 174 ? 22.679 69.044 14.922  1.00 85.22  ? 1367 GLU C CD  1 
ATOM   4044 O OE1 . GLU C 1 174 ? 22.961 69.667 13.874  1.00 77.09  ? 1367 GLU C OE1 1 
ATOM   4045 O OE2 . GLU C 1 174 ? 21.948 69.530 15.816  1.00 65.32  ? 1367 GLU C OE2 1 
ATOM   4046 N N   . ASN C 1 175 ? 19.932 65.946 17.679  1.00 41.20  ? 1368 ASN C N   1 
ATOM   4047 C CA  . ASN C 1 175 ? 19.335 65.149 18.741  1.00 50.31  ? 1368 ASN C CA  1 
ATOM   4048 C C   . ASN C 1 175 ? 18.031 64.522 18.285  1.00 48.32  ? 1368 ASN C C   1 
ATOM   4049 O O   . ASN C 1 175 ? 17.760 63.352 18.564  1.00 44.91  ? 1368 ASN C O   1 
ATOM   4050 C CB  . ASN C 1 175 ? 19.076 65.994 19.991  1.00 44.42  ? 1368 ASN C CB  1 
ATOM   4051 C CG  . ASN C 1 175 ? 20.294 66.755 20.445  1.00 40.97  ? 1368 ASN C CG  1 
ATOM   4052 O OD1 . ASN C 1 175 ? 20.839 67.575 19.705  1.00 50.95  ? 1368 ASN C OD1 1 
ATOM   4053 N ND2 . ASN C 1 175 ? 20.717 66.506 21.677  1.00 36.29  ? 1368 ASN C ND2 1 
ATOM   4054 N N   . HIS C 1 176 ? 17.220 65.312 17.589  1.00 47.51  ? 1369 HIS C N   1 
ATOM   4055 C CA  . HIS C 1 176 ? 15.900 64.859 17.180  1.00 39.30  ? 1369 HIS C CA  1 
ATOM   4056 C C   . HIS C 1 176 ? 16.015 63.583 16.374  1.00 38.10  ? 1369 HIS C C   1 
ATOM   4057 O O   . HIS C 1 176 ? 15.233 62.661 16.551  1.00 40.66  ? 1369 HIS C O   1 
ATOM   4058 C CB  . HIS C 1 176 ? 15.183 65.923 16.361  1.00 31.40  ? 1369 HIS C CB  1 
ATOM   4059 C CG  . HIS C 1 176 ? 13.856 65.478 15.841  1.00 36.04  ? 1369 HIS C CG  1 
ATOM   4060 N ND1 . HIS C 1 176 ? 12.671 65.757 16.488  1.00 38.16  ? 1369 HIS C ND1 1 
ATOM   4061 C CD2 . HIS C 1 176 ? 13.526 64.755 14.745  1.00 30.24  ? 1369 HIS C CD2 1 
ATOM   4062 C CE1 . HIS C 1 176 ? 11.666 65.241 15.804  1.00 38.61  ? 1369 HIS C CE1 1 
ATOM   4063 N NE2 . HIS C 1 176 ? 12.158 64.625 14.744  1.00 35.46  ? 1369 HIS C NE2 1 
ATOM   4064 N N   . GLU C 1 177 ? 17.003 63.535 15.493  1.00 38.01  ? 1370 GLU C N   1 
ATOM   4065 C CA  . GLU C 1 177 ? 17.254 62.349 14.689  1.00 40.07  ? 1370 GLU C CA  1 
ATOM   4066 C C   . GLU C 1 177 ? 17.626 61.132 15.538  1.00 44.64  ? 1370 GLU C C   1 
ATOM   4067 O O   . GLU C 1 177 ? 17.036 60.056 15.382  1.00 41.39  ? 1370 GLU C O   1 
ATOM   4068 C CB  . GLU C 1 177 ? 18.343 62.628 13.650  1.00 46.80  ? 1370 GLU C CB  1 
ATOM   4069 C CG  . GLU C 1 177 ? 17.851 63.469 12.503  1.00 33.73  ? 1370 GLU C CG  1 
ATOM   4070 C CD  . GLU C 1 177 ? 16.493 63.003 12.027  1.00 58.73  ? 1370 GLU C CD  1 
ATOM   4071 O OE1 . GLU C 1 177 ? 15.502 63.734 12.250  1.00 58.39  ? 1370 GLU C OE1 1 
ATOM   4072 O OE2 . GLU C 1 177 ? 16.412 61.890 11.457  1.00 58.82  ? 1370 GLU C OE2 1 
ATOM   4073 N N   . VAL C 1 178 ? 18.602 61.291 16.427  1.00 33.96  ? 1371 VAL C N   1 
ATOM   4074 C CA  . VAL C 1 178 ? 18.984 60.179 17.279  1.00 39.31  ? 1371 VAL C CA  1 
ATOM   4075 C C   . VAL C 1 178 ? 17.814 59.765 18.174  1.00 40.88  ? 1371 VAL C C   1 
ATOM   4076 O O   . VAL C 1 178 ? 17.536 58.572 18.347  1.00 39.18  ? 1371 VAL C O   1 
ATOM   4077 C CB  . VAL C 1 178 ? 20.221 60.503 18.128  1.00 39.63  ? 1371 VAL C CB  1 
ATOM   4078 C CG1 . VAL C 1 178 ? 20.665 59.265 18.927  1.00 28.35  ? 1371 VAL C CG1 1 
ATOM   4079 C CG2 . VAL C 1 178 ? 21.338 60.972 17.232  1.00 45.13  ? 1371 VAL C CG2 1 
ATOM   4080 N N   . PHE C 1 179 ? 17.123 60.751 18.736  1.00 38.20  ? 1372 PHE C N   1 
ATOM   4081 C CA  . PHE C 1 179 ? 15.967 60.463 19.575  1.00 39.57  ? 1372 PHE C CA  1 
ATOM   4082 C C   . PHE C 1 179 ? 14.958 59.653 18.780  1.00 35.21  ? 1372 PHE C C   1 
ATOM   4083 O O   . PHE C 1 179 ? 14.454 58.640 19.257  1.00 35.38  ? 1372 PHE C O   1 
ATOM   4084 C CB  . PHE C 1 179 ? 15.322 61.749 20.108  1.00 31.20  ? 1372 PHE C CB  1 
ATOM   4085 C CG  . PHE C 1 179 ? 14.345 61.520 21.227  1.00 29.36  ? 1372 PHE C CG  1 
ATOM   4086 C CD1 . PHE C 1 179 ? 14.745 60.892 22.399  1.00 35.54  ? 1372 PHE C CD1 1 
ATOM   4087 C CD2 . PHE C 1 179 ? 13.031 61.935 21.117  1.00 30.81  ? 1372 PHE C CD2 1 
ATOM   4088 C CE1 . PHE C 1 179 ? 13.843 60.674 23.432  1.00 29.69  ? 1372 PHE C CE1 1 
ATOM   4089 C CE2 . PHE C 1 179 ? 12.131 61.728 22.148  1.00 29.80  ? 1372 PHE C CE2 1 
ATOM   4090 C CZ  . PHE C 1 179 ? 12.539 61.096 23.303  1.00 22.97  ? 1372 PHE C CZ  1 
ATOM   4091 N N   . LYS C 1 180 ? 14.674 60.098 17.561  1.00 40.11  ? 1373 LYS C N   1 
ATOM   4092 C CA  . LYS C 1 180 ? 13.730 59.404 16.691  1.00 33.20  ? 1373 LYS C CA  1 
ATOM   4093 C C   . LYS C 1 180 ? 14.155 57.952 16.535  1.00 31.88  ? 1373 LYS C C   1 
ATOM   4094 O O   . LYS C 1 180 ? 13.368 57.038 16.769  1.00 34.96  ? 1373 LYS C O   1 
ATOM   4095 C CB  . LYS C 1 180 ? 13.671 60.082 15.326  1.00 36.31  ? 1373 LYS C CB  1 
ATOM   4096 C CG  . LYS C 1 180 ? 12.575 59.586 14.405  1.00 32.62  ? 1373 LYS C CG  1 
ATOM   4097 C CD  . LYS C 1 180 ? 12.950 59.886 12.954  1.00 44.99  ? 1373 LYS C CD  1 
ATOM   4098 C CE  . LYS C 1 180 ? 11.810 59.611 11.984  1.00 53.20  ? 1373 LYS C CE  1 
ATOM   4099 N NZ  . LYS C 1 180 ? 10.975 60.825 11.730  1.00 63.04  ? 1373 LYS C NZ  1 
ATOM   4100 N N   . TYR C 1 181 ? 15.414 57.747 16.165  1.00 32.49  ? 1374 TYR C N   1 
ATOM   4101 C CA  . TYR C 1 181 ? 15.954 56.410 15.931  1.00 28.94  ? 1374 TYR C CA  1 
ATOM   4102 C C   . TYR C 1 181 ? 15.804 55.520 17.162  1.00 33.56  ? 1374 TYR C C   1 
ATOM   4103 O O   . TYR C 1 181 ? 15.249 54.417 17.086  1.00 33.40  ? 1374 TYR C O   1 
ATOM   4104 C CB  . TYR C 1 181 ? 17.424 56.522 15.530  1.00 33.78  ? 1374 TYR C CB  1 
ATOM   4105 C CG  . TYR C 1 181 ? 18.083 55.245 15.038  1.00 32.67  ? 1374 TYR C CG  1 
ATOM   4106 C CD1 . TYR C 1 181 ? 17.993 54.866 13.707  1.00 31.02  ? 1374 TYR C CD1 1 
ATOM   4107 C CD2 . TYR C 1 181 ? 18.834 54.447 15.893  1.00 32.88  ? 1374 TYR C CD2 1 
ATOM   4108 C CE1 . TYR C 1 181 ? 18.606 53.726 13.244  1.00 23.97  ? 1374 TYR C CE1 1 
ATOM   4109 C CE2 . TYR C 1 181 ? 19.454 53.299 15.439  1.00 41.98  ? 1374 TYR C CE2 1 
ATOM   4110 C CZ  . TYR C 1 181 ? 19.336 52.942 14.110  1.00 44.21  ? 1374 TYR C CZ  1 
ATOM   4111 O OH  . TYR C 1 181 ? 19.949 51.794 13.647  1.00 47.30  ? 1374 TYR C OH  1 
ATOM   4112 N N   . VAL C 1 182 ? 16.296 55.999 18.299  1.00 32.52  ? 1375 VAL C N   1 
ATOM   4113 C CA  . VAL C 1 182 ? 16.221 55.219 19.529  1.00 36.81  ? 1375 VAL C CA  1 
ATOM   4114 C C   . VAL C 1 182 ? 14.778 54.893 19.905  1.00 37.26  ? 1375 VAL C C   1 
ATOM   4115 O O   . VAL C 1 182 ? 14.450 53.745 20.202  1.00 30.66  ? 1375 VAL C O   1 
ATOM   4116 C CB  . VAL C 1 182 ? 16.902 55.937 20.695  1.00 35.07  ? 1375 VAL C CB  1 
ATOM   4117 C CG1 . VAL C 1 182 ? 16.765 55.114 21.970  1.00 35.01  ? 1375 VAL C CG1 1 
ATOM   4118 C CG2 . VAL C 1 182 ? 18.363 56.179 20.365  1.00 40.77  ? 1375 VAL C CG2 1 
ATOM   4119 N N   . ILE C 1 183 ? 13.917 55.906 19.881  1.00 38.01  ? 1376 ILE C N   1 
ATOM   4120 C CA  . ILE C 1 183 ? 12.524 55.719 20.261  1.00 26.95  ? 1376 ILE C CA  1 
ATOM   4121 C C   . ILE C 1 183 ? 11.814 54.714 19.369  1.00 28.51  ? 1376 ILE C C   1 
ATOM   4122 O O   . ILE C 1 183 ? 11.130 53.831 19.876  1.00 34.63  ? 1376 ILE C O   1 
ATOM   4123 C CB  . ILE C 1 183 ? 11.737 57.047 20.301  1.00 26.71  ? 1376 ILE C CB  1 
ATOM   4124 C CG1 . ILE C 1 183 ? 12.278 57.945 21.413  1.00 24.66  ? 1376 ILE C CG1 1 
ATOM   4125 C CG2 . ILE C 1 183 ? 10.264 56.777 20.546  1.00 25.08  ? 1376 ILE C CG2 1 
ATOM   4126 C CD1 . ILE C 1 183 ? 12.267 57.290 22.769  1.00 25.97  ? 1376 ILE C CD1 1 
ATOM   4127 N N   . SER C 1 184 ? 11.963 54.825 18.052  1.00 29.33  ? 1377 SER C N   1 
ATOM   4128 C CA  . SER C 1 184 ? 11.311 53.845 17.184  1.00 29.11  ? 1377 SER C CA  1 
ATOM   4129 C C   . SER C 1 184 ? 11.840 52.450 17.464  1.00 29.96  ? 1377 SER C C   1 
ATOM   4130 O O   . SER C 1 184 ? 11.069 51.492 17.530  1.00 37.08  ? 1377 SER C O   1 
ATOM   4131 C CB  . SER C 1 184 ? 11.425 54.198 15.706  1.00 21.18  ? 1377 SER C CB  1 
ATOM   4132 O OG  . SER C 1 184 ? 12.202 55.356 15.532  1.00 41.27  ? 1377 SER C OG  1 
ATOM   4133 N N   . HIS C 1 185 ? 13.147 52.337 17.664  1.00 25.20  ? 1378 HIS C N   1 
ATOM   4134 C CA  . HIS C 1 185 ? 13.722 51.057 18.067  1.00 24.41  ? 1378 HIS C CA  1 
ATOM   4135 C C   . HIS C 1 185 ? 12.991 50.497 19.283  1.00 28.76  ? 1378 HIS C C   1 
ATOM   4136 O O   . HIS C 1 185 ? 12.557 49.341 19.279  1.00 26.78  ? 1378 HIS C O   1 
ATOM   4137 C CB  . HIS C 1 185 ? 15.216 51.192 18.357  1.00 22.76  ? 1378 HIS C CB  1 
ATOM   4138 C CG  . HIS C 1 185 ? 15.807 49.988 19.006  1.00 20.56  ? 1378 HIS C CG  1 
ATOM   4139 N ND1 . HIS C 1 185 ? 15.739 48.733 18.443  1.00 30.33  ? 1378 HIS C ND1 1 
ATOM   4140 C CD2 . HIS C 1 185 ? 16.465 49.842 20.179  1.00 27.45  ? 1378 HIS C CD2 1 
ATOM   4141 C CE1 . HIS C 1 185 ? 16.331 47.863 19.242  1.00 31.76  ? 1378 HIS C CE1 1 
ATOM   4142 N NE2 . HIS C 1 185 ? 16.776 48.511 20.304  1.00 36.49  ? 1378 HIS C NE2 1 
ATOM   4143 N N   . LEU C 1 186 ? 12.843 51.329 20.314  1.00 29.50  ? 1379 LEU C N   1 
ATOM   4144 C CA  . LEU C 1 186 ? 12.187 50.918 21.549  1.00 22.75  ? 1379 LEU C CA  1 
ATOM   4145 C C   . LEU C 1 186 ? 10.744 50.551 21.282  1.00 26.50  ? 1379 LEU C C   1 
ATOM   4146 O O   . LEU C 1 186 ? 10.210 49.599 21.857  1.00 29.09  ? 1379 LEU C O   1 
ATOM   4147 C CB  . LEU C 1 186 ? 12.259 52.014 22.604  1.00 24.45  ? 1379 LEU C CB  1 
ATOM   4148 C CG  . LEU C 1 186 ? 13.638 52.292 23.211  1.00 34.00  ? 1379 LEU C CG  1 
ATOM   4149 C CD1 . LEU C 1 186 ? 13.508 53.270 24.364  1.00 31.31  ? 1379 LEU C CD1 1 
ATOM   4150 C CD2 . LEU C 1 186 ? 14.294 51.012 23.681  1.00 26.67  ? 1379 LEU C CD2 1 
ATOM   4151 N N   . ASN C 1 187 ? 10.112 51.305 20.398  1.00 26.37  ? 1380 ASN C N   1 
ATOM   4152 C CA  . ASN C 1 187 ? 8.744  51.004 20.031  1.00 24.21  ? 1380 ASN C CA  1 
ATOM   4153 C C   . ASN C 1 187 ? 8.671  49.595 19.486  1.00 32.00  ? 1380 ASN C C   1 
ATOM   4154 O O   . ASN C 1 187 ? 7.735  48.853 19.783  1.00 30.24  ? 1380 ASN C O   1 
ATOM   4155 C CB  . ASN C 1 187 ? 8.250  51.975 18.984  1.00 21.23  ? 1380 ASN C CB  1 
ATOM   4156 C CG  . ASN C 1 187 ? 6.877  51.649 18.519  1.00 27.66  ? 1380 ASN C CG  1 
ATOM   4157 O OD1 . ASN C 1 187 ? 6.685  51.141 17.406  1.00 34.58  ? 1380 ASN C OD1 1 
ATOM   4158 N ND2 . ASN C 1 187 ? 5.898  51.910 19.370  1.00 18.59  ? 1380 ASN C ND2 1 
ATOM   4159 N N   . LYS C 1 188 ? 9.673  49.225 18.693  1.00 29.09  ? 1381 LYS C N   1 
ATOM   4160 C CA  . LYS C 1 188 ? 9.715  47.887 18.123  1.00 28.85  ? 1381 LYS C CA  1 
ATOM   4161 C C   . LYS C 1 188 ? 9.925  46.822 19.210  1.00 33.07  ? 1381 LYS C C   1 
ATOM   4162 O O   . LYS C 1 188 ? 9.174  45.842 19.299  1.00 29.35  ? 1381 LYS C O   1 
ATOM   4163 C CB  . LYS C 1 188 ? 10.785 47.786 17.034  1.00 26.76  ? 1381 LYS C CB  1 
ATOM   4164 C CG  . LYS C 1 188 ? 10.696 46.493 16.229  1.00 34.77  ? 1381 LYS C CG  1 
ATOM   4165 C CD  . LYS C 1 188 ? 11.851 46.350 15.251  1.00 45.29  ? 1381 LYS C CD  1 
ATOM   4166 C CE  . LYS C 1 188 ? 11.677 47.251 14.040  1.00 44.18  ? 1381 LYS C CE  1 
ATOM   4167 N NZ  . LYS C 1 188 ? 12.543 46.765 12.926  1.00 57.64  ? 1381 LYS C NZ  1 
ATOM   4168 N N   . VAL C 1 189 ? 10.934 47.016 20.050  1.00 28.24  ? 1382 VAL C N   1 
ATOM   4169 C CA  . VAL C 1 189 ? 11.176 46.059 21.115  1.00 27.60  ? 1382 VAL C CA  1 
ATOM   4170 C C   . VAL C 1 189 ? 9.856  45.806 21.824  1.00 26.49  ? 1382 VAL C C   1 
ATOM   4171 O O   . VAL C 1 189 ? 9.533  44.669 22.179  1.00 27.76  ? 1382 VAL C O   1 
ATOM   4172 C CB  . VAL C 1 189 ? 12.230 46.562 22.124  1.00 23.20  ? 1382 VAL C CB  1 
ATOM   4173 C CG1 . VAL C 1 189 ? 12.323 45.619 23.295  1.00 16.61  ? 1382 VAL C CG1 1 
ATOM   4174 C CG2 . VAL C 1 189 ? 13.593 46.727 21.445  1.00 18.63  ? 1382 VAL C CG2 1 
ATOM   4175 N N   . SER C 1 190 ? 9.079  46.870 21.996  1.00 23.66  ? 1383 SER C N   1 
ATOM   4176 C CA  . SER C 1 190 ? 7.850  46.788 22.779  1.00 26.24  ? 1383 SER C CA  1 
ATOM   4177 C C   . SER C 1 190 ? 6.786  45.940 22.085  1.00 26.73  ? 1383 SER C C   1 
ATOM   4178 O O   . SER C 1 190 ? 5.893  45.410 22.737  1.00 23.64  ? 1383 SER C O   1 
ATOM   4179 C CB  . SER C 1 190 ? 7.297  48.189 23.086  1.00 25.73  ? 1383 SER C CB  1 
ATOM   4180 O OG  . SER C 1 190 ? 6.411  48.633 22.067  1.00 28.80  ? 1383 SER C OG  1 
ATOM   4181 N N   . HIS C 1 191 ? 6.871  45.812 20.765  1.00 26.52  ? 1384 HIS C N   1 
ATOM   4182 C CA  . HIS C 1 191 ? 5.870  45.039 20.048  1.00 21.78  ? 1384 HIS C CA  1 
ATOM   4183 C C   . HIS C 1 191 ? 5.989  43.549 20.330  1.00 29.28  ? 1384 HIS C C   1 
ATOM   4184 O O   . HIS C 1 191 ? 5.116  42.776 19.965  1.00 24.27  ? 1384 HIS C O   1 
ATOM   4185 C CB  . HIS C 1 191 ? 5.964  45.271 18.553  1.00 30.81  ? 1384 HIS C CB  1 
ATOM   4186 C CG  . HIS C 1 191 ? 5.550  46.640 18.121  1.00 46.00  ? 1384 HIS C CG  1 
ATOM   4187 N ND1 . HIS C 1 191 ? 4.738  47.449 18.886  1.00 41.50  ? 1384 HIS C ND1 1 
ATOM   4188 C CD2 . HIS C 1 191 ? 5.809  47.329 16.984  1.00 42.56  ? 1384 HIS C CD2 1 
ATOM   4189 C CE1 . HIS C 1 191 ? 4.528  48.587 18.249  1.00 46.04  ? 1384 HIS C CE1 1 
ATOM   4190 N NE2 . HIS C 1 191 ? 5.167  48.540 17.093  1.00 56.84  ? 1384 HIS C NE2 1 
ATOM   4191 N N   . ASN C 1 192 ? 7.079  43.147 20.966  1.00 25.13  ? 1385 ASN C N   1 
ATOM   4192 C CA  . ASN C 1 192 ? 7.249  41.754 21.340  1.00 30.99  ? 1385 ASN C CA  1 
ATOM   4193 C C   . ASN C 1 192 ? 7.191  41.547 22.867  1.00 43.62  ? 1385 ASN C C   1 
ATOM   4194 O O   . ASN C 1 192 ? 7.818  40.624 23.410  1.00 38.76  ? 1385 ASN C O   1 
ATOM   4195 C CB  . ASN C 1 192 ? 8.567  41.225 20.767  1.00 30.09  ? 1385 ASN C CB  1 
ATOM   4196 C CG  . ASN C 1 192 ? 8.580  39.715 20.635  1.00 37.07  ? 1385 ASN C CG  1 
ATOM   4197 O OD1 . ASN C 1 192 ? 7.586  39.110 20.231  1.00 30.25  ? 1385 ASN C OD1 1 
ATOM   4198 N ND2 . ASN C 1 192 ? 9.711  39.099 20.974  1.00 30.82  ? 1385 ASN C ND2 1 
ATOM   4199 N N   . ASN C 1 193 ? 6.433  42.401 23.554  1.00 37.06  ? 1386 ASN C N   1 
ATOM   4200 C CA  . ASN C 1 193 ? 6.412  42.398 25.019  1.00 30.24  ? 1386 ASN C CA  1 
ATOM   4201 C C   . ASN C 1 193 ? 5.857  41.115 25.653  1.00 37.72  ? 1386 ASN C C   1 
ATOM   4202 O O   . ASN C 1 193 ? 6.264  40.744 26.752  1.00 36.77  ? 1386 ASN C O   1 
ATOM   4203 C CB  . ASN C 1 193 ? 5.712  43.655 25.579  1.00 28.95  ? 1386 ASN C CB  1 
ATOM   4204 C CG  . ASN C 1 193 ? 4.205  43.679 25.311  1.00 31.70  ? 1386 ASN C CG  1 
ATOM   4205 O OD1 . ASN C 1 193 ? 3.422  43.007 25.991  1.00 25.16  ? 1386 ASN C OD1 1 
ATOM   4206 N ND2 . ASN C 1 193 ? 3.793  44.482 24.333  1.00 26.34  ? 1386 ASN C ND2 1 
ATOM   4207 N N   . LYS C 1 194 ? 4.936  40.443 24.963  1.00 29.21  ? 1387 LYS C N   1 
ATOM   4208 C CA  . LYS C 1 194 ? 4.408  39.179 25.451  1.00 26.30  ? 1387 LYS C CA  1 
ATOM   4209 C C   . LYS C 1 194 ? 5.556  38.215 25.702  1.00 31.93  ? 1387 LYS C C   1 
ATOM   4210 O O   . LYS C 1 194 ? 5.501  37.400 26.617  1.00 37.97  ? 1387 LYS C O   1 
ATOM   4211 C CB  . LYS C 1 194 ? 3.475  38.550 24.428  1.00 40.14  ? 1387 LYS C CB  1 
ATOM   4212 C CG  . LYS C 1 194 ? 2.339  39.413 23.975  1.00 46.09  ? 1387 LYS C CG  1 
ATOM   4213 C CD  . LYS C 1 194 ? 1.090  39.096 24.735  1.00 35.87  ? 1387 LYS C CD  1 
ATOM   4214 C CE  . LYS C 1 194 ? -0.133 39.337 23.853  1.00 52.12  ? 1387 LYS C CE  1 
ATOM   4215 N NZ  . LYS C 1 194 ? -1.392 39.388 24.658  1.00 72.96  ? 1387 LYS C NZ  1 
ATOM   4216 N N   . VAL C 1 195 ? 6.586  38.307 24.871  1.00 29.14  ? 1388 VAL C N   1 
ATOM   4217 C CA  . VAL C 1 195 ? 7.744  37.431 24.980  1.00 35.97  ? 1388 VAL C CA  1 
ATOM   4218 C C   . VAL C 1 195 ? 8.864  38.066 25.794  1.00 35.44  ? 1388 VAL C C   1 
ATOM   4219 O O   . VAL C 1 195 ? 9.314  37.485 26.786  1.00 43.63  ? 1388 VAL C O   1 
ATOM   4220 C CB  . VAL C 1 195 ? 8.294  37.025 23.592  1.00 38.66  ? 1388 VAL C CB  1 
ATOM   4221 C CG1 . VAL C 1 195 ? 9.661  36.340 23.718  1.00 18.87  ? 1388 VAL C CG1 1 
ATOM   4222 C CG2 . VAL C 1 195 ? 7.305  36.136 22.885  1.00 36.66  ? 1388 VAL C CG2 1 
ATOM   4223 N N   . ASN C 1 196 ? 9.314  39.252 25.384  1.00 30.07  ? 1389 ASN C N   1 
ATOM   4224 C CA  . ASN C 1 196 ? 10.471 39.877 26.036  1.00 35.96  ? 1389 ASN C CA  1 
ATOM   4225 C C   . ASN C 1 196 ? 10.112 40.649 27.301  1.00 32.88  ? 1389 ASN C C   1 
ATOM   4226 O O   . ASN C 1 196 ? 10.990 41.083 28.038  1.00 30.03  ? 1389 ASN C O   1 
ATOM   4227 C CB  . ASN C 1 196 ? 11.281 40.746 25.066  1.00 29.27  ? 1389 ASN C CB  1 
ATOM   4228 C CG  . ASN C 1 196 ? 10.505 41.948 24.567  1.00 35.14  ? 1389 ASN C CG  1 
ATOM   4229 O OD1 . ASN C 1 196 ? 9.633  42.472 25.266  1.00 34.45  ? 1389 ASN C OD1 1 
ATOM   4230 N ND2 . ASN C 1 196 ? 10.826 42.402 23.353  1.00 24.66  ? 1389 ASN C ND2 1 
ATOM   4231 N N   . LEU C 1 197 ? 8.814  40.808 27.537  1.00 30.45  ? 1390 LEU C N   1 
ATOM   4232 C CA  . LEU C 1 197 ? 8.314  41.334 28.800  1.00 34.79  ? 1390 LEU C CA  1 
ATOM   4233 C C   . LEU C 1 197 ? 8.508  42.840 28.926  1.00 40.67  ? 1390 LEU C C   1 
ATOM   4234 O O   . LEU C 1 197 ? 8.194  43.439 29.960  1.00 35.92  ? 1390 LEU C O   1 
ATOM   4235 C CB  . LEU C 1 197 ? 8.988  40.626 29.982  1.00 45.04  ? 1390 LEU C CB  1 
ATOM   4236 C CG  . LEU C 1 197 ? 8.894  39.102 30.072  1.00 39.79  ? 1390 LEU C CG  1 
ATOM   4237 C CD1 . LEU C 1 197 ? 9.513  38.666 31.386  1.00 39.91  ? 1390 LEU C CD1 1 
ATOM   4238 C CD2 . LEU C 1 197 ? 7.437  38.627 29.947  1.00 25.48  ? 1390 LEU C CD2 1 
ATOM   4239 N N   . MET C 1 198 ? 9.024  43.456 27.872  1.00 33.27  ? 1391 MET C N   1 
ATOM   4240 C CA  . MET C 1 198 ? 9.305  44.881 27.924  1.00 31.16  ? 1391 MET C CA  1 
ATOM   4241 C C   . MET C 1 198 ? 8.233  45.706 27.213  1.00 31.51  ? 1391 MET C C   1 
ATOM   4242 O O   . MET C 1 198 ? 8.345  46.027 26.029  1.00 33.71  ? 1391 MET C O   1 
ATOM   4243 C CB  . MET C 1 198 ? 10.711 45.174 27.377  1.00 30.12  ? 1391 MET C CB  1 
ATOM   4244 C CG  . MET C 1 198 ? 11.839 44.500 28.181  1.00 33.93  ? 1391 MET C CG  1 
ATOM   4245 S SD  . MET C 1 198 ? 11.762 44.790 29.984  1.00 40.42  ? 1391 MET C SD  1 
ATOM   4246 C CE  . MET C 1 198 ? 12.430 46.439 30.093  1.00 23.68  ? 1391 MET C CE  1 
ATOM   4247 N N   . THR C 1 199 ? 7.177  46.027 27.946  1.00 27.73  ? 1392 THR C N   1 
ATOM   4248 C CA  . THR C 1 199 ? 6.175  46.969 27.476  1.00 30.59  ? 1392 THR C CA  1 
ATOM   4249 C C   . THR C 1 199 ? 6.803  48.362 27.349  1.00 36.08  ? 1392 THR C C   1 
ATOM   4250 O O   . THR C 1 199 ? 7.898  48.607 27.853  1.00 32.86  ? 1392 THR C O   1 
ATOM   4251 C CB  . THR C 1 199 ? 4.962  47.033 28.442  1.00 35.10  ? 1392 THR C CB  1 
ATOM   4252 O OG1 . THR C 1 199 ? 5.413  47.229 29.795  1.00 34.59  ? 1392 THR C OG1 1 
ATOM   4253 C CG2 . THR C 1 199 ? 4.154  45.758 28.367  1.00 15.80  ? 1392 THR C CG2 1 
ATOM   4254 N N   . SER C 1 200 ? 6.119  49.279 26.673  1.00 40.49  ? 1393 SER C N   1 
ATOM   4255 C CA  . SER C 1 200 ? 6.641  50.638 26.551  1.00 35.85  ? 1393 SER C CA  1 
ATOM   4256 C C   . SER C 1 200 ? 6.854  51.288 27.923  1.00 36.66  ? 1393 SER C C   1 
ATOM   4257 O O   . SER C 1 200 ? 7.812  52.046 28.123  1.00 28.44  ? 1393 SER C O   1 
ATOM   4258 C CB  . SER C 1 200 ? 5.750  51.494 25.645  1.00 27.38  ? 1393 SER C CB  1 
ATOM   4259 O OG  . SER C 1 200 ? 4.475  50.900 25.489  1.00 62.83  ? 1393 SER C OG  1 
ATOM   4260 N N   . GLU C 1 201 ? 5.972  50.984 28.871  1.00 36.38  ? 1394 GLU C N   1 
ATOM   4261 C CA  . GLU C 1 201 ? 6.158  51.474 30.231  1.00 32.58  ? 1394 GLU C CA  1 
ATOM   4262 C C   . GLU C 1 201 ? 7.504  51.003 30.777  1.00 37.19  ? 1394 GLU C C   1 
ATOM   4263 O O   . GLU C 1 201 ? 8.312  51.798 31.263  1.00 31.68  ? 1394 GLU C O   1 
ATOM   4264 C CB  . GLU C 1 201 ? 5.042  50.987 31.140  1.00 34.25  ? 1394 GLU C CB  1 
ATOM   4265 C CG  . GLU C 1 201 ? 5.278  51.304 32.606  1.00 39.96  ? 1394 GLU C CG  1 
ATOM   4266 C CD  . GLU C 1 201 ? 4.113  50.883 33.489  1.00 60.80  ? 1394 GLU C CD  1 
ATOM   4267 O OE1 . GLU C 1 201 ? 3.485  49.833 33.202  1.00 62.78  ? 1394 GLU C OE1 1 
ATOM   4268 O OE2 . GLU C 1 201 ? 3.830  51.604 34.471  1.00 53.85  ? 1394 GLU C OE2 1 
ATOM   4269 N N   . ASN C 1 202 ? 7.743  49.702 30.686  1.00 28.86  ? 1395 ASN C N   1 
ATOM   4270 C CA  . ASN C 1 202 ? 8.996  49.149 31.161  1.00 29.62  ? 1395 ASN C CA  1 
ATOM   4271 C C   . ASN C 1 202 ? 10.200 49.767 30.466  1.00 32.76  ? 1395 ASN C C   1 
ATOM   4272 O O   . ASN C 1 202 ? 11.200 50.087 31.105  1.00 30.88  ? 1395 ASN C O   1 
ATOM   4273 C CB  . ASN C 1 202 ? 9.005  47.635 30.984  1.00 32.20  ? 1395 ASN C CB  1 
ATOM   4274 C CG  . ASN C 1 202 ? 8.092  46.933 31.957  1.00 35.64  ? 1395 ASN C CG  1 
ATOM   4275 O OD1 . ASN C 1 202 ? 7.541  47.542 32.876  1.00 34.21  ? 1395 ASN C OD1 1 
ATOM   4276 N ND2 . ASN C 1 202 ? 7.928  45.637 31.762  1.00 48.91  ? 1395 ASN C ND2 1 
ATOM   4277 N N   . LEU C 1 203 ? 10.099 49.932 29.154  1.00 33.67  ? 1396 LEU C N   1 
ATOM   4278 C CA  . LEU C 1 203 ? 11.216 50.437 28.385  1.00 24.42  ? 1396 LEU C CA  1 
ATOM   4279 C C   . LEU C 1 203 ? 11.604 51.862 28.789  1.00 30.41  ? 1396 LEU C C   1 
ATOM   4280 O O   . LEU C 1 203 ? 12.800 52.165 28.880  1.00 27.84  ? 1396 LEU C O   1 
ATOM   4281 C CB  . LEU C 1 203 ? 10.922 50.329 26.895  1.00 26.03  ? 1396 LEU C CB  1 
ATOM   4282 C CG  . LEU C 1 203 ? 11.075 48.901 26.387  1.00 27.67  ? 1396 LEU C CG  1 
ATOM   4283 C CD1 . LEU C 1 203 ? 10.517 48.756 24.985  1.00 28.41  ? 1396 LEU C CD1 1 
ATOM   4284 C CD2 . LEU C 1 203 ? 12.540 48.486 26.435  1.00 29.57  ? 1396 LEU C CD2 1 
ATOM   4285 N N   . SER C 1 204 ? 10.616 52.727 29.047  1.00 25.34  ? 1397 SER C N   1 
ATOM   4286 C CA  . SER C 1 204 ? 10.919 54.084 29.551  1.00 39.38  ? 1397 SER C CA  1 
ATOM   4287 C C   . SER C 1 204 ? 11.570 54.049 30.929  1.00 42.28  ? 1397 SER C C   1 
ATOM   4288 O O   . SER C 1 204 ? 12.418 54.887 31.244  1.00 38.86  ? 1397 SER C O   1 
ATOM   4289 C CB  . SER C 1 204 ? 9.684  54.985 29.616  1.00 30.74  ? 1397 SER C CB  1 
ATOM   4290 O OG  . SER C 1 204 ? 8.598  54.312 30.229  1.00 49.13  ? 1397 SER C OG  1 
ATOM   4291 N N   . ILE C 1 205 ? 11.161 53.087 31.753  1.00 31.38  ? 1398 ILE C N   1 
ATOM   4292 C CA  . ILE C 1 205 ? 11.784 52.907 33.055  1.00 27.04  ? 1398 ILE C CA  1 
ATOM   4293 C C   . ILE C 1 205 ? 13.290 52.665 32.905  1.00 25.95  ? 1398 ILE C C   1 
ATOM   4294 O O   . ILE C 1 205 ? 14.081 53.168 33.687  1.00 32.61  ? 1398 ILE C O   1 
ATOM   4295 C CB  . ILE C 1 205 ? 11.106 51.772 33.854  1.00 30.42  ? 1398 ILE C CB  1 
ATOM   4296 C CG1 . ILE C 1 205 ? 9.675  52.159 34.226  1.00 25.71  ? 1398 ILE C CG1 1 
ATOM   4297 C CG2 . ILE C 1 205 ? 11.880 51.451 35.103  1.00 17.89  ? 1398 ILE C CG2 1 
ATOM   4298 C CD1 . ILE C 1 205 ? 8.894  51.041 34.878  1.00 18.62  ? 1398 ILE C CD1 1 
ATOM   4299 N N   . CYS C 1 206 ? 13.692 51.915 31.887  1.00 29.25  ? 1399 CYS C N   1 
ATOM   4300 C CA  . CYS C 1 206 ? 15.115 51.686 31.639  1.00 39.22  ? 1399 CYS C CA  1 
ATOM   4301 C C   . CYS C 1 206 ? 15.786 52.877 30.982  1.00 39.73  ? 1399 CYS C C   1 
ATOM   4302 O O   . CYS C 1 206 ? 17.011 53.034 31.061  1.00 35.82  ? 1399 CYS C O   1 
ATOM   4303 C CB  . CYS C 1 206 ? 15.323 50.472 30.732  1.00 36.12  ? 1399 CYS C CB  1 
ATOM   4304 S SG  . CYS C 1 206 ? 14.425 49.046 31.263  1.00 48.70  ? 1399 CYS C SG  1 
ATOM   4305 N N   . PHE C 1 207 ? 14.995 53.713 30.316  1.00 30.27  ? 1400 PHE C N   1 
ATOM   4306 C CA  . PHE C 1 207 ? 15.594 54.707 29.438  1.00 31.15  ? 1400 PHE C CA  1 
ATOM   4307 C C   . PHE C 1 207 ? 15.557 56.161 29.882  1.00 31.48  ? 1400 PHE C C   1 
ATOM   4308 O O   . PHE C 1 207 ? 16.481 56.922 29.574  1.00 36.97  ? 1400 PHE C O   1 
ATOM   4309 C CB  . PHE C 1 207 ? 15.103 54.540 27.991  1.00 34.35  ? 1400 PHE C CB  1 
ATOM   4310 C CG  . PHE C 1 207 ? 15.968 53.614 27.175  1.00 29.37  ? 1400 PHE C CG  1 
ATOM   4311 C CD1 . PHE C 1 207 ? 17.132 54.083 26.588  1.00 27.11  ? 1400 PHE C CD1 1 
ATOM   4312 C CD2 . PHE C 1 207 ? 15.639 52.271 27.031  1.00 28.05  ? 1400 PHE C CD2 1 
ATOM   4313 C CE1 . PHE C 1 207 ? 17.952 53.237 25.857  1.00 27.08  ? 1400 PHE C CE1 1 
ATOM   4314 C CE2 . PHE C 1 207 ? 16.448 51.418 26.297  1.00 30.42  ? 1400 PHE C CE2 1 
ATOM   4315 C CZ  . PHE C 1 207 ? 17.610 51.902 25.709  1.00 31.97  ? 1400 PHE C CZ  1 
ATOM   4316 N N   . TRP C 1 208 ? 14.521 56.563 30.604  1.00 28.88  ? 1401 TRP C N   1 
ATOM   4317 C CA  . TRP C 1 208 ? 14.372 57.992 30.875  1.00 33.27  ? 1401 TRP C CA  1 
ATOM   4318 C C   . TRP C 1 208 ? 15.539 58.598 31.661  1.00 32.94  ? 1401 TRP C C   1 
ATOM   4319 O O   . TRP C 1 208 ? 15.949 59.722 31.381  1.00 34.20  ? 1401 TRP C O   1 
ATOM   4320 C CB  . TRP C 1 208 ? 13.008 58.343 31.478  1.00 28.21  ? 1401 TRP C CB  1 
ATOM   4321 C CG  . TRP C 1 208 ? 12.827 57.918 32.877  1.00 30.11  ? 1401 TRP C CG  1 
ATOM   4322 C CD1 . TRP C 1 208 ? 12.077 56.870 33.325  1.00 32.75  ? 1401 TRP C CD1 1 
ATOM   4323 C CD2 . TRP C 1 208 ? 13.394 58.537 34.035  1.00 32.45  ? 1401 TRP C CD2 1 
ATOM   4324 N NE1 . TRP C 1 208 ? 12.152 56.788 34.698  1.00 40.94  ? 1401 TRP C NE1 1 
ATOM   4325 C CE2 . TRP C 1 208 ? 12.954 57.800 35.158  1.00 37.79  ? 1401 TRP C CE2 1 
ATOM   4326 C CE3 . TRP C 1 208 ? 14.236 59.633 34.232  1.00 25.20  ? 1401 TRP C CE3 1 
ATOM   4327 C CZ2 . TRP C 1 208 ? 13.329 58.126 36.457  1.00 34.79  ? 1401 TRP C CZ2 1 
ATOM   4328 C CZ3 . TRP C 1 208 ? 14.607 59.955 35.519  1.00 41.25  ? 1401 TRP C CZ3 1 
ATOM   4329 C CH2 . TRP C 1 208 ? 14.154 59.203 36.620  1.00 43.16  ? 1401 TRP C CH2 1 
ATOM   4330 N N   . PRO C 1 209 ? 16.091 57.860 32.636  1.00 33.77  ? 1402 PRO C N   1 
ATOM   4331 C CA  . PRO C 1 209 ? 17.266 58.436 33.302  1.00 29.78  ? 1402 PRO C CA  1 
ATOM   4332 C C   . PRO C 1 209 ? 18.415 58.604 32.318  1.00 28.94  ? 1402 PRO C C   1 
ATOM   4333 O O   . PRO C 1 209 ? 19.073 59.643 32.298  1.00 37.03  ? 1402 PRO C O   1 
ATOM   4334 C CB  . PRO C 1 209 ? 17.616 57.394 34.366  1.00 18.91  ? 1402 PRO C CB  1 
ATOM   4335 C CG  . PRO C 1 209 ? 16.314 56.689 34.632  1.00 25.47  ? 1402 PRO C CG  1 
ATOM   4336 C CD  . PRO C 1 209 ? 15.653 56.612 33.280  1.00 30.09  ? 1402 PRO C CD  1 
ATOM   4337 N N   . THR C 1 210 ? 18.632 57.597 31.487  1.00 31.10  ? 1403 THR C N   1 
ATOM   4338 C CA  . THR C 1 210 ? 19.730 57.628 30.539  1.00 35.68  ? 1403 THR C CA  1 
ATOM   4339 C C   . THR C 1 210 ? 19.579 58.772 29.539  1.00 43.40  ? 1403 THR C C   1 
ATOM   4340 O O   . THR C 1 210 ? 20.528 59.527 29.293  1.00 47.72  ? 1403 THR C O   1 
ATOM   4341 C CB  . THR C 1 210 ? 19.830 56.293 29.794  1.00 43.47  ? 1403 THR C CB  1 
ATOM   4342 O OG1 . THR C 1 210 ? 19.934 55.230 30.751  1.00 37.73  ? 1403 THR C OG1 1 
ATOM   4343 C CG2 . THR C 1 210 ? 21.036 56.278 28.859  1.00 40.62  ? 1403 THR C CG2 1 
ATOM   4344 N N   . LEU C 1 211 ? 18.384 58.904 28.974  1.00 28.24  ? 1404 LEU C N   1 
ATOM   4345 C CA  . LEU C 1 211 ? 18.149 59.894 27.928  1.00 32.19  ? 1404 LEU C CA  1 
ATOM   4346 C C   . LEU C 1 211 ? 17.986 61.334 28.439  1.00 36.17  ? 1404 LEU C C   1 
ATOM   4347 O O   . LEU C 1 211 ? 18.137 62.291 27.684  1.00 41.48  ? 1404 LEU C O   1 
ATOM   4348 C CB  . LEU C 1 211 ? 16.930 59.493 27.098  1.00 35.61  ? 1404 LEU C CB  1 
ATOM   4349 C CG  . LEU C 1 211 ? 17.049 58.148 26.379  1.00 44.31  ? 1404 LEU C CG  1 
ATOM   4350 C CD1 . LEU C 1 211 ? 15.757 57.771 25.643  1.00 25.46  ? 1404 LEU C CD1 1 
ATOM   4351 C CD2 . LEU C 1 211 ? 18.228 58.194 25.418  1.00 42.19  ? 1404 LEU C CD2 1 
ATOM   4352 N N   . MET C 1 212 ? 17.687 61.496 29.719  1.00 37.93  ? 1405 MET C N   1 
ATOM   4353 C CA  . MET C 1 212 ? 17.395 62.821 30.233  1.00 32.03  ? 1405 MET C CA  1 
ATOM   4354 C C   . MET C 1 212 ? 18.309 63.310 31.365  1.00 39.92  ? 1405 MET C C   1 
ATOM   4355 O O   . MET C 1 212 ? 18.515 64.513 31.502  1.00 42.67  ? 1405 MET C O   1 
ATOM   4356 C CB  . MET C 1 212 ? 15.921 62.909 30.610  1.00 27.95  ? 1405 MET C CB  1 
ATOM   4357 C CG  . MET C 1 212 ? 15.022 62.778 29.394  1.00 25.62  ? 1405 MET C CG  1 
ATOM   4358 S SD  . MET C 1 212 ? 13.296 62.948 29.851  1.00 47.47  ? 1405 MET C SD  1 
ATOM   4359 C CE  . MET C 1 212 ? 12.538 63.337 28.283  1.00 53.20  ? 1405 MET C CE  1 
ATOM   4360 N N   . ARG C 1 213 ? 18.868 62.398 32.162  1.00 34.05  ? 1406 ARG C N   1 
ATOM   4361 C CA  . ARG C 1 213 ? 19.793 62.794 33.227  1.00 35.15  ? 1406 ARG C CA  1 
ATOM   4362 C C   . ARG C 1 213 ? 19.234 63.878 34.133  1.00 49.99  ? 1406 ARG C C   1 
ATOM   4363 O O   . ARG C 1 213 ? 19.846 64.934 34.273  1.00 45.21  ? 1406 ARG C O   1 
ATOM   4364 C CB  . ARG C 1 213 ? 21.082 63.343 32.636  1.00 26.10  ? 1406 ARG C CB  1 
ATOM   4365 C CG  . ARG C 1 213 ? 22.166 62.328 32.516  1.00 52.78  ? 1406 ARG C CG  1 
ATOM   4366 C CD  . ARG C 1 213 ? 23.517 62.947 32.766  1.00 36.22  ? 1406 ARG C CD  1 
ATOM   4367 N NE  . ARG C 1 213 ? 24.035 63.642 31.593  1.00 41.02  ? 1406 ARG C NE  1 
ATOM   4368 C CZ  . ARG C 1 213 ? 24.427 63.026 30.488  1.00 43.47  ? 1406 ARG C CZ  1 
ATOM   4369 N NH1 . ARG C 1 213 ? 24.332 61.707 30.398  1.00 47.08  ? 1406 ARG C NH1 1 
ATOM   4370 N NH2 . ARG C 1 213 ? 24.901 63.727 29.474  1.00 48.04  ? 1406 ARG C NH2 1 
ATOM   4371 N N   . PRO C 1 214 ? 18.074 63.631 34.752  1.00 45.12  ? 1407 PRO C N   1 
ATOM   4372 C CA  . PRO C 1 214 ? 17.504 64.685 35.590  1.00 44.23  ? 1407 PRO C CA  1 
ATOM   4373 C C   . PRO C 1 214 ? 18.442 65.005 36.745  1.00 44.80  ? 1407 PRO C C   1 
ATOM   4374 O O   . PRO C 1 214 ? 19.107 64.101 37.228  1.00 60.97  ? 1407 PRO C O   1 
ATOM   4375 C CB  . PRO C 1 214 ? 16.213 64.046 36.114  1.00 59.97  ? 1407 PRO C CB  1 
ATOM   4376 C CG  . PRO C 1 214 ? 15.915 62.936 35.158  1.00 55.68  ? 1407 PRO C CG  1 
ATOM   4377 C CD  . PRO C 1 214 ? 17.248 62.414 34.752  1.00 47.58  ? 1407 PRO C CD  1 
ATOM   4378 N N   . ASP C 1 215 ? 18.512 66.260 37.175  1.00 44.98  ? 1408 ASP C N   1 
ATOM   4379 C CA  . ASP C 1 215 ? 19.267 66.584 38.376  1.00 50.75  ? 1408 ASP C CA  1 
ATOM   4380 C C   . ASP C 1 215 ? 18.324 66.595 39.576  1.00 65.94  ? 1408 ASP C C   1 
ATOM   4381 O O   . ASP C 1 215 ? 17.373 67.366 39.620  1.00 65.96  ? 1408 ASP C O   1 
ATOM   4382 C CB  . ASP C 1 215 ? 19.984 67.922 38.229  1.00 54.49  ? 1408 ASP C CB  1 
ATOM   4383 C CG  . ASP C 1 215 ? 20.984 68.174 39.348  1.00 76.23  ? 1408 ASP C CG  1 
ATOM   4384 O OD1 . ASP C 1 215 ? 20.988 67.398 40.329  1.00 68.35  ? 1408 ASP C OD1 1 
ATOM   4385 O OD2 . ASP C 1 215 ? 21.766 69.148 39.244  1.00 71.87  ? 1408 ASP C OD2 1 
ATOM   4386 N N   . PHE C 1 216 ? 18.587 65.728 40.548  1.00 70.41  ? 1409 PHE C N   1 
ATOM   4387 C CA  . PHE C 1 216 ? 17.645 65.523 41.648  1.00 72.67  ? 1409 PHE C CA  1 
ATOM   4388 C C   . PHE C 1 216 ? 17.898 66.356 42.904  1.00 86.71  ? 1409 PHE C C   1 
ATOM   4389 O O   . PHE C 1 216 ? 17.409 66.035 43.991  1.00 78.86  ? 1409 PHE C O   1 
ATOM   4390 C CB  . PHE C 1 216 ? 17.501 64.038 41.981  1.00 77.16  ? 1409 PHE C CB  1 
ATOM   4391 C CG  . PHE C 1 216 ? 16.595 63.313 41.044  1.00 65.70  ? 1409 PHE C CG  1 
ATOM   4392 C CD1 . PHE C 1 216 ? 15.416 63.900 40.629  1.00 64.04  ? 1409 PHE C CD1 1 
ATOM   4393 C CD2 . PHE C 1 216 ? 16.915 62.057 40.570  1.00 71.71  ? 1409 PHE C CD2 1 
ATOM   4394 C CE1 . PHE C 1 216 ? 14.570 63.247 39.756  1.00 63.65  ? 1409 PHE C CE1 1 
ATOM   4395 C CE2 . PHE C 1 216 ? 16.068 61.396 39.699  1.00 67.46  ? 1409 PHE C CE2 1 
ATOM   4396 C CZ  . PHE C 1 216 ? 14.891 61.995 39.292  1.00 57.73  ? 1409 PHE C CZ  1 
ATOM   4397 N N   . SER C 1 217 ? 18.662 67.427 42.740  1.00 92.11  ? 1410 SER C N   1 
ATOM   4398 C CA  . SER C 1 217 ? 18.656 68.518 43.695  1.00 76.01  ? 1410 SER C CA  1 
ATOM   4399 C C   . SER C 1 217 ? 17.933 69.683 43.010  1.00 97.53  ? 1410 SER C C   1 
ATOM   4400 O O   . SER C 1 217 ? 18.367 70.829 43.087  1.00 120.01 ? 1410 SER C O   1 
ATOM   4401 C CB  . SER C 1 217 ? 20.087 68.895 44.071  1.00 57.90  ? 1410 SER C CB  1 
ATOM   4402 N N   . THR C 1 218 ? 16.839 69.368 42.315  1.00 88.06  ? 1411 THR C N   1 
ATOM   4403 C CA  . THR C 1 218 ? 16.095 70.343 41.514  1.00 77.39  ? 1411 THR C CA  1 
ATOM   4404 C C   . THR C 1 218 ? 14.615 69.964 41.412  1.00 88.17  ? 1411 THR C C   1 
ATOM   4405 O O   . THR C 1 218 ? 13.812 70.684 40.813  1.00 83.88  ? 1411 THR C O   1 
ATOM   4406 C CB  . THR C 1 218 ? 16.678 70.472 40.091  1.00 49.06  ? 1411 THR C CB  1 
ATOM   4407 N N   . MET C 1 219 ? 14.272 68.825 42.007  1.00 85.03  ? 1412 MET C N   1 
ATOM   4408 C CA  . MET C 1 219 ? 12.917 68.283 41.990  1.00 73.39  ? 1412 MET C CA  1 
ATOM   4409 C C   . MET C 1 219 ? 12.870 67.081 42.922  1.00 68.79  ? 1412 MET C C   1 
ATOM   4410 O O   . MET C 1 219 ? 13.895 66.454 43.188  1.00 63.40  ? 1412 MET C O   1 
ATOM   4411 C CB  . MET C 1 219 ? 12.529 67.853 40.573  1.00 49.23  ? 1412 MET C CB  1 
ATOM   4412 C CG  . MET C 1 219 ? 13.606 67.017 39.884  1.00 70.45  ? 1412 MET C CG  1 
ATOM   4413 S SD  . MET C 1 219 ? 13.616 67.153 38.092  1.00 111.18 ? 1412 MET C SD  1 
ATOM   4414 C CE  . MET C 1 219 ? 13.594 68.930 37.895  1.00 69.23  ? 1412 MET C CE  1 
ATOM   4415 N N   . ASP C 1 220 ? 11.681 66.767 43.422  1.00 62.83  ? 1413 ASP C N   1 
ATOM   4416 C CA  . ASP C 1 220 ? 11.483 65.570 44.229  1.00 51.89  ? 1413 ASP C CA  1 
ATOM   4417 C C   . ASP C 1 220 ? 11.715 64.330 43.373  1.00 56.40  ? 1413 ASP C C   1 
ATOM   4418 O O   . ASP C 1 220 ? 11.128 64.199 42.299  1.00 51.77  ? 1413 ASP C O   1 
ATOM   4419 C CB  . ASP C 1 220 ? 10.067 65.546 44.791  1.00 49.32  ? 1413 ASP C CB  1 
ATOM   4420 C CG  . ASP C 1 220 ? 9.756  64.267 45.531  1.00 68.44  ? 1413 ASP C CG  1 
ATOM   4421 O OD1 . ASP C 1 220 ? 10.666 63.722 46.199  1.00 77.71  ? 1413 ASP C OD1 1 
ATOM   4422 O OD2 . ASP C 1 220 ? 8.594  63.816 45.450  1.00 64.72  ? 1413 ASP C OD2 1 
ATOM   4423 N N   . ALA C 1 221 ? 12.565 63.423 43.850  1.00 53.50  ? 1414 ALA C N   1 
ATOM   4424 C CA  . ALA C 1 221 ? 12.954 62.255 43.064  1.00 50.13  ? 1414 ALA C CA  1 
ATOM   4425 C C   . ALA C 1 221 ? 11.759 61.402 42.631  1.00 48.64  ? 1414 ALA C C   1 
ATOM   4426 O O   . ALA C 1 221 ? 11.675 60.976 41.474  1.00 34.74  ? 1414 ALA C O   1 
ATOM   4427 C CB  . ALA C 1 221 ? 13.979 61.416 43.811  1.00 40.37  ? 1414 ALA C CB  1 
ATOM   4428 N N   . LEU C 1 222 ? 10.828 61.156 43.548  1.00 45.83  ? 1415 LEU C N   1 
ATOM   4429 C CA  . LEU C 1 222 ? 9.663  60.338 43.204  1.00 56.10  ? 1415 LEU C CA  1 
ATOM   4430 C C   . LEU C 1 222 ? 8.707  60.983 42.198  1.00 43.80  ? 1415 LEU C C   1 
ATOM   4431 O O   . LEU C 1 222 ? 8.274  60.327 41.262  1.00 47.26  ? 1415 LEU C O   1 
ATOM   4432 C CB  . LEU C 1 222 ? 8.910  59.849 44.445  1.00 48.14  ? 1415 LEU C CB  1 
ATOM   4433 C CG  . LEU C 1 222 ? 9.235  58.404 44.835  1.00 57.00  ? 1415 LEU C CG  1 
ATOM   4434 C CD1 . LEU C 1 222 ? 8.314  57.935 45.944  1.00 59.55  ? 1415 LEU C CD1 1 
ATOM   4435 C CD2 . LEU C 1 222 ? 9.133  57.472 43.627  1.00 42.77  ? 1415 LEU C CD2 1 
ATOM   4436 N N   . THR C 1 223 ? 8.375  62.256 42.368  1.00 41.90  ? 1416 THR C N   1 
ATOM   4437 C CA  . THR C 1 223 ? 7.478  62.886 41.406  1.00 48.28  ? 1416 THR C CA  1 
ATOM   4438 C C   . THR C 1 223 ? 8.156  63.098 40.053  1.00 46.36  ? 1416 THR C C   1 
ATOM   4439 O O   . THR C 1 223 ? 7.537  62.918 39.003  1.00 40.44  ? 1416 THR C O   1 
ATOM   4440 C CB  . THR C 1 223 ? 6.833  64.203 41.914  1.00 45.47  ? 1416 THR C CB  1 
ATOM   4441 O OG1 . THR C 1 223 ? 7.799  65.253 41.950  1.00 54.15  ? 1416 THR C OG1 1 
ATOM   4442 C CG2 . THR C 1 223 ? 6.176  63.999 43.274  1.00 39.41  ? 1416 THR C CG2 1 
ATOM   4443 N N   . ALA C 1 224 ? 9.430  63.470 40.066  1.00 49.29  ? 1417 ALA C N   1 
ATOM   4444 C CA  . ALA C 1 224 ? 10.163 63.613 38.814  1.00 48.21  ? 1417 ALA C CA  1 
ATOM   4445 C C   . ALA C 1 224 ? 10.237 62.260 38.118  1.00 46.56  ? 1417 ALA C C   1 
ATOM   4446 O O   . ALA C 1 224 ? 10.288 62.175 36.893  1.00 43.02  ? 1417 ALA C O   1 
ATOM   4447 C CB  . ALA C 1 224 ? 11.551 64.159 39.063  1.00 49.12  ? 1417 ALA C CB  1 
ATOM   4448 N N   . THR C 1 225 ? 10.231 61.194 38.910  1.00 44.88  ? 1418 THR C N   1 
ATOM   4449 C CA  . THR C 1 225 ? 10.277 59.859 38.341  1.00 34.94  ? 1418 THR C CA  1 
ATOM   4450 C C   . THR C 1 225 ? 9.024  59.557 37.531  1.00 33.63  ? 1418 THR C C   1 
ATOM   4451 O O   . THR C 1 225 ? 9.123  59.155 36.374  1.00 33.00  ? 1418 THR C O   1 
ATOM   4452 C CB  . THR C 1 225 ? 10.505 58.786 39.403  1.00 30.64  ? 1418 THR C CB  1 
ATOM   4453 O OG1 . THR C 1 225 ? 11.829 58.920 39.933  1.00 42.38  ? 1418 THR C OG1 1 
ATOM   4454 C CG2 . THR C 1 225 ? 10.374 57.415 38.795  1.00 33.06  ? 1418 THR C CG2 1 
ATOM   4455 N N   . ARG C 1 226 ? 7.851  59.770 38.121  1.00 28.17  ? 1419 ARG C N   1 
ATOM   4456 C CA  . ARG C 1 226 ? 6.597  59.461 37.436  1.00 25.42  ? 1419 ARG C CA  1 
ATOM   4457 C C   . ARG C 1 226 ? 6.459  60.323 36.194  1.00 35.83  ? 1419 ARG C C   1 
ATOM   4458 O O   . ARG C 1 226 ? 5.958  59.867 35.167  1.00 43.32  ? 1419 ARG C O   1 
ATOM   4459 C CB  . ARG C 1 226 ? 5.386  59.643 38.360  1.00 19.11  ? 1419 ARG C CB  1 
ATOM   4460 N N   . THR C 1 227 ? 6.934  61.562 36.285  1.00 35.69  ? 1420 THR C N   1 
ATOM   4461 C CA  . THR C 1 227 ? 6.801  62.513 35.192  1.00 38.10  ? 1420 THR C CA  1 
ATOM   4462 C C   . THR C 1 227 ? 7.655  62.148 33.982  1.00 31.48  ? 1420 THR C C   1 
ATOM   4463 O O   . THR C 1 227 ? 7.152  62.051 32.863  1.00 39.77  ? 1420 THR C O   1 
ATOM   4464 C CB  . THR C 1 227 ? 7.131  63.937 35.660  1.00 44.65  ? 1420 THR C CB  1 
ATOM   4465 O OG1 . THR C 1 227 ? 6.106  64.380 36.558  1.00 42.44  ? 1420 THR C OG1 1 
ATOM   4466 C CG2 . THR C 1 227 ? 7.234  64.898 34.466  1.00 33.94  ? 1420 THR C CG2 1 
ATOM   4467 N N   . TYR C 1 228 ? 8.947  61.961 34.197  1.00 28.08  ? 1421 TYR C N   1 
ATOM   4468 C CA  . TYR C 1 228 ? 9.819  61.580 33.097  1.00 37.10  ? 1421 TYR C CA  1 
ATOM   4469 C C   . TYR C 1 228 ? 9.450  60.218 32.528  1.00 34.38  ? 1421 TYR C C   1 
ATOM   4470 O O   . TYR C 1 228 ? 9.451  60.036 31.313  1.00 38.37  ? 1421 TYR C O   1 
ATOM   4471 C CB  . TYR C 1 228 ? 11.276 61.593 33.532  1.00 37.89  ? 1421 TYR C CB  1 
ATOM   4472 C CG  . TYR C 1 228 ? 11.783 62.977 33.815  1.00 35.85  ? 1421 TYR C CG  1 
ATOM   4473 C CD1 . TYR C 1 228 ? 12.304 63.308 35.051  1.00 55.35  ? 1421 TYR C CD1 1 
ATOM   4474 C CD2 . TYR C 1 228 ? 11.726 63.957 32.851  1.00 37.23  ? 1421 TYR C CD2 1 
ATOM   4475 C CE1 . TYR C 1 228 ? 12.764 64.573 35.307  1.00 49.91  ? 1421 TYR C CE1 1 
ATOM   4476 C CE2 . TYR C 1 228 ? 12.180 65.222 33.097  1.00 43.15  ? 1421 TYR C CE2 1 
ATOM   4477 C CZ  . TYR C 1 228 ? 12.698 65.526 34.324  1.00 41.20  ? 1421 TYR C CZ  1 
ATOM   4478 O OH  . TYR C 1 228 ? 13.152 66.802 34.559  1.00 51.90  ? 1421 TYR C OH  1 
ATOM   4479 N N   . GLN C 1 229 ? 9.130  59.269 33.404  1.00 24.95  ? 1422 GLN C N   1 
ATOM   4480 C CA  . GLN C 1 229 ? 8.787  57.921 32.969  1.00 32.91  ? 1422 GLN C CA  1 
ATOM   4481 C C   . GLN C 1 229 ? 7.640  57.957 31.974  1.00 29.24  ? 1422 GLN C C   1 
ATOM   4482 O O   . GLN C 1 229 ? 7.759  57.413 30.878  1.00 32.54  ? 1422 GLN C O   1 
ATOM   4483 C CB  . GLN C 1 229 ? 8.444  57.031 34.166  1.00 37.41  ? 1422 GLN C CB  1 
ATOM   4484 C CG  . GLN C 1 229 ? 7.688  55.753 33.839  1.00 27.74  ? 1422 GLN C CG  1 
ATOM   4485 C CD  . GLN C 1 229 ? 7.372  54.944 35.084  1.00 56.48  ? 1422 GLN C CD  1 
ATOM   4486 O OE1 . GLN C 1 229 ? 7.949  55.175 36.154  1.00 51.42  ? 1422 GLN C OE1 1 
ATOM   4487 N NE2 . GLN C 1 229 ? 6.453  53.986 34.954  1.00 58.05  ? 1422 GLN C NE2 1 
ATOM   4488 N N   . THR C 1 230 ? 6.545  58.616 32.351  1.00 21.49  ? 1423 THR C N   1 
ATOM   4489 C CA  . THR C 1 230 ? 5.378  58.755 31.476  1.00 28.72  ? 1423 THR C CA  1 
ATOM   4490 C C   . THR C 1 230 ? 5.683  59.480 30.152  1.00 38.04  ? 1423 THR C C   1 
ATOM   4491 O O   . THR C 1 230 ? 5.190  59.101 29.082  1.00 36.27  ? 1423 THR C O   1 
ATOM   4492 C CB  . THR C 1 230 ? 4.235  59.508 32.174  1.00 24.48  ? 1423 THR C CB  1 
ATOM   4493 O OG1 . THR C 1 230 ? 3.920  58.861 33.404  1.00 28.45  ? 1423 THR C OG1 1 
ATOM   4494 C CG2 . THR C 1 230 ? 3.005  59.516 31.302  1.00 33.66  ? 1423 THR C CG2 1 
ATOM   4495 N N   . ILE C 1 231 ? 6.482  60.535 30.222  1.00 28.03  ? 1424 ILE C N   1 
ATOM   4496 C CA  . ILE C 1 231 ? 6.788  61.280 29.019  1.00 30.70  ? 1424 ILE C CA  1 
ATOM   4497 C C   . ILE C 1 231 ? 7.414  60.330 28.009  1.00 28.53  ? 1424 ILE C C   1 
ATOM   4498 O O   . ILE C 1 231 ? 6.938  60.221 26.882  1.00 27.55  ? 1424 ILE C O   1 
ATOM   4499 C CB  . ILE C 1 231 ? 7.688  62.512 29.311  1.00 37.86  ? 1424 ILE C CB  1 
ATOM   4500 C CG1 . ILE C 1 231 ? 6.916  63.540 30.142  1.00 31.13  ? 1424 ILE C CG1 1 
ATOM   4501 C CG2 . ILE C 1 231 ? 8.160  63.160 28.017  1.00 31.88  ? 1424 ILE C CG2 1 
ATOM   4502 C CD1 . ILE C 1 231 ? 7.696  64.771 30.472  1.00 24.53  ? 1424 ILE C CD1 1 
ATOM   4503 N N   . ILE C 1 232 ? 8.462  59.624 28.424  1.00 25.45  ? 1425 ILE C N   1 
ATOM   4504 C CA  . ILE C 1 232 ? 9.170  58.728 27.525  1.00 23.67  ? 1425 ILE C CA  1 
ATOM   4505 C C   . ILE C 1 232 ? 8.266  57.568 27.104  1.00 25.67  ? 1425 ILE C C   1 
ATOM   4506 O O   . ILE C 1 232 ? 8.306  57.104 25.965  1.00 34.71  ? 1425 ILE C O   1 
ATOM   4507 C CB  . ILE C 1 232 ? 10.478 58.228 28.145  1.00 24.94  ? 1425 ILE C CB  1 
ATOM   4508 C CG1 . ILE C 1 232 ? 11.428 59.403 28.336  1.00 25.51  ? 1425 ILE C CG1 1 
ATOM   4509 C CG2 . ILE C 1 232 ? 11.155 57.211 27.242  1.00 22.23  ? 1425 ILE C CG2 1 
ATOM   4510 C CD1 . ILE C 1 232 ? 11.946 59.951 27.043  1.00 26.84  ? 1425 ILE C CD1 1 
ATOM   4511 N N   . GLU C 1 233 ? 7.420  57.113 28.007  1.00 19.74  ? 1426 GLU C N   1 
ATOM   4512 C CA  . GLU C 1 233 ? 6.503  56.050 27.646  1.00 25.30  ? 1426 GLU C CA  1 
ATOM   4513 C C   . GLU C 1 233 ? 5.619  56.496 26.485  1.00 27.49  ? 1426 GLU C C   1 
ATOM   4514 O O   . GLU C 1 233 ? 5.347  55.707 25.587  1.00 31.91  ? 1426 GLU C O   1 
ATOM   4515 C CB  . GLU C 1 233 ? 5.677  55.595 28.857  1.00 26.52  ? 1426 GLU C CB  1 
ATOM   4516 C CG  . GLU C 1 233 ? 4.534  54.623 28.567  1.00 28.21  ? 1426 GLU C CG  1 
ATOM   4517 C CD  . GLU C 1 233 ? 3.852  54.137 29.848  1.00 53.05  ? 1426 GLU C CD  1 
ATOM   4518 O OE1 . GLU C 1 233 ? 2.791  53.475 29.758  1.00 40.96  ? 1426 GLU C OE1 1 
ATOM   4519 O OE2 . GLU C 1 233 ? 4.378  54.422 30.951  1.00 55.73  ? 1426 GLU C OE2 1 
ATOM   4520 N N   . LEU C 1 234 ? 5.185  57.754 26.498  1.00 23.59  ? 1427 LEU C N   1 
ATOM   4521 C CA  . LEU C 1 234 ? 4.306  58.275 25.445  1.00 25.37  ? 1427 LEU C CA  1 
ATOM   4522 C C   . LEU C 1 234 ? 5.032  58.395 24.120  1.00 29.30  ? 1427 LEU C C   1 
ATOM   4523 O O   . LEU C 1 234 ? 4.461  58.119 23.060  1.00 24.98  ? 1427 LEU C O   1 
ATOM   4524 C CB  . LEU C 1 234 ? 3.713  59.631 25.819  1.00 22.84  ? 1427 LEU C CB  1 
ATOM   4525 C CG  . LEU C 1 234 ? 2.758  59.601 27.002  1.00 24.00  ? 1427 LEU C CG  1 
ATOM   4526 C CD1 . LEU C 1 234 ? 2.546  61.005 27.533  1.00 25.00  ? 1427 LEU C CD1 1 
ATOM   4527 C CD2 . LEU C 1 234 ? 1.445  58.965 26.600  1.00 20.25  ? 1427 LEU C CD2 1 
ATOM   4528 N N   . PHE C 1 235 ? 6.292  58.808 24.174  1.00 23.24  ? 1428 PHE C N   1 
ATOM   4529 C CA  . PHE C 1 235 ? 7.075  58.893 22.951  1.00 34.09  ? 1428 PHE C CA  1 
ATOM   4530 C C   . PHE C 1 235 ? 7.252  57.511 22.342  1.00 31.62  ? 1428 PHE C C   1 
ATOM   4531 O O   . PHE C 1 235 ? 7.236  57.352 21.121  1.00 31.83  ? 1428 PHE C O   1 
ATOM   4532 C CB  . PHE C 1 235 ? 8.426  59.537 23.213  1.00 28.66  ? 1428 PHE C CB  1 
ATOM   4533 C CG  . PHE C 1 235 ? 8.371  61.019 23.268  1.00 33.49  ? 1428 PHE C CG  1 
ATOM   4534 C CD1 . PHE C 1 235 ? 8.610  61.693 24.455  1.00 34.61  ? 1428 PHE C CD1 1 
ATOM   4535 C CD2 . PHE C 1 235 ? 8.054  61.744 22.136  1.00 27.15  ? 1428 PHE C CD2 1 
ATOM   4536 C CE1 . PHE C 1 235 ? 8.548  63.070 24.503  1.00 26.72  ? 1428 PHE C CE1 1 
ATOM   4537 C CE2 . PHE C 1 235 ? 7.996  63.110 22.175  1.00 32.59  ? 1428 PHE C CE2 1 
ATOM   4538 C CZ  . PHE C 1 235 ? 8.243  63.778 23.361  1.00 30.36  ? 1428 PHE C CZ  1 
ATOM   4539 N N   . ILE C 1 236 ? 7.411  56.514 23.205  1.00 26.85  ? 1429 ILE C N   1 
ATOM   4540 C CA  . ILE C 1 236 ? 7.603  55.152 22.751  1.00 23.62  ? 1429 ILE C CA  1 
ATOM   4541 C C   . ILE C 1 236 ? 6.308  54.574 22.209  1.00 23.86  ? 1429 ILE C C   1 
ATOM   4542 O O   . ILE C 1 236 ? 6.285  54.027 21.115  1.00 34.69  ? 1429 ILE C O   1 
ATOM   4543 C CB  . ILE C 1 236 ? 8.138  54.258 23.870  1.00 26.57  ? 1429 ILE C CB  1 
ATOM   4544 C CG1 . ILE C 1 236 ? 9.557  54.694 24.260  1.00 22.94  ? 1429 ILE C CG1 1 
ATOM   4545 C CG2 . ILE C 1 236 ? 8.096  52.794 23.433  1.00 22.23  ? 1429 ILE C CG2 1 
ATOM   4546 C CD1 . ILE C 1 236 ? 10.168 53.883 25.398  1.00 20.47  ? 1429 ILE C CD1 1 
ATOM   4547 N N   . GLN C 1 237 ? 5.227  54.704 22.965  1.00 23.38  ? 1430 GLN C N   1 
ATOM   4548 C CA  . GLN C 1 237 ? 3.955  54.120 22.570  1.00 19.17  ? 1430 GLN C CA  1 
ATOM   4549 C C   . GLN C 1 237 ? 3.314  54.880 21.424  1.00 26.93  ? 1430 GLN C C   1 
ATOM   4550 O O   . GLN C 1 237 ? 2.664  54.281 20.566  1.00 27.44  ? 1430 GLN C O   1 
ATOM   4551 C CB  . GLN C 1 237 ? 2.990  54.079 23.743  1.00 21.00  ? 1430 GLN C CB  1 
ATOM   4552 C CG  . GLN C 1 237 ? 1.734  53.303 23.449  1.00 43.11  ? 1430 GLN C CG  1 
ATOM   4553 C CD  . GLN C 1 237 ? 1.023  52.859 24.713  1.00 84.84  ? 1430 GLN C CD  1 
ATOM   4554 O OE1 . GLN C 1 237 ? 1.108  53.513 25.763  1.00 70.88  ? 1430 GLN C OE1 1 
ATOM   4555 N NE2 . GLN C 1 237 ? 0.317  51.735 24.621  1.00 77.54  ? 1430 GLN C NE2 1 
ATOM   4556 N N   . GLN C 1 238 ? 3.476  56.200 21.410  1.00 23.65  ? 1431 GLN C N   1 
ATOM   4557 C CA  . GLN C 1 238 ? 2.882  56.994 20.344  1.00 24.94  ? 1431 GLN C CA  1 
ATOM   4558 C C   . GLN C 1 238 ? 3.921  57.362 19.290  1.00 25.39  ? 1431 GLN C C   1 
ATOM   4559 O O   . GLN C 1 238 ? 3.791  58.353 18.570  1.00 32.55  ? 1431 GLN C O   1 
ATOM   4560 C CB  . GLN C 1 238 ? 2.180  58.226 20.898  1.00 25.25  ? 1431 GLN C CB  1 
ATOM   4561 C CG  . GLN C 1 238 ? 1.220  57.930 22.028  1.00 21.71  ? 1431 GLN C CG  1 
ATOM   4562 C CD  . GLN C 1 238 ? 0.245  56.820 21.718  1.00 21.10  ? 1431 GLN C CD  1 
ATOM   4563 O OE1 . GLN C 1 238 ? -0.234 56.147 22.629  1.00 41.20  ? 1431 GLN C OE1 1 
ATOM   4564 N NE2 . GLN C 1 238 ? -0.061 56.619 20.439  1.00 29.35  ? 1431 GLN C NE2 1 
ATOM   4565 N N   . CYS C 1 239 ? 4.947  56.528 19.204  1.00 21.48  ? 1432 CYS C N   1 
ATOM   4566 C CA  . CYS C 1 239 ? 5.992  56.686 18.213  1.00 29.82  ? 1432 CYS C CA  1 
ATOM   4567 C C   . CYS C 1 239 ? 5.470  57.123 16.832  1.00 34.29  ? 1432 CYS C C   1 
ATOM   4568 O O   . CYS C 1 239 ? 5.982  58.082 16.271  1.00 29.80  ? 1432 CYS C O   1 
ATOM   4569 C CB  . CYS C 1 239 ? 6.790  55.388 18.105  1.00 25.82  ? 1432 CYS C CB  1 
ATOM   4570 S SG  . CYS C 1 239 ? 8.246  55.512 17.087  1.00 34.76  ? 1432 CYS C SG  1 
ATOM   4571 N N   . PRO C 1 240 ? 4.458  56.417 16.281  1.00 30.20  ? 1433 PRO C N   1 
ATOM   4572 C CA  . PRO C 1 240 ? 3.945  56.772 14.953  1.00 31.27  ? 1433 PRO C CA  1 
ATOM   4573 C C   . PRO C 1 240 ? 3.438  58.210 14.881  1.00 34.73  ? 1433 PRO C C   1 
ATOM   4574 O O   . PRO C 1 240 ? 3.757  58.928 13.937  1.00 42.41  ? 1433 PRO C O   1 
ATOM   4575 C CB  . PRO C 1 240 ? 2.786  55.784 14.745  1.00 28.86  ? 1433 PRO C CB  1 
ATOM   4576 C CG  . PRO C 1 240 ? 3.132  54.620 15.587  1.00 29.74  ? 1433 PRO C CG  1 
ATOM   4577 C CD  . PRO C 1 240 ? 3.826  55.188 16.798  1.00 32.10  ? 1433 PRO C CD  1 
ATOM   4578 N N   . PHE C 1 241 ? 2.658  58.621 15.869  1.00 30.05  ? 1434 PHE C N   1 
ATOM   4579 C CA  . PHE C 1 241 ? 2.141  59.979 15.927  1.00 26.06  ? 1434 PHE C CA  1 
ATOM   4580 C C   . PHE C 1 241 ? 3.267  60.999 16.006  1.00 30.98  ? 1434 PHE C C   1 
ATOM   4581 O O   . PHE C 1 241 ? 3.189  62.069 15.417  1.00 35.14  ? 1434 PHE C O   1 
ATOM   4582 C CB  . PHE C 1 241 ? 1.236  60.127 17.145  1.00 35.93  ? 1434 PHE C CB  1 
ATOM   4583 C CG  . PHE C 1 241 ? 0.822  61.534 17.432  1.00 40.07  ? 1434 PHE C CG  1 
ATOM   4584 C CD1 . PHE C 1 241 ? -0.215 62.122 16.728  1.00 35.97  ? 1434 PHE C CD1 1 
ATOM   4585 C CD2 . PHE C 1 241 ? 1.456  62.263 18.426  1.00 38.84  ? 1434 PHE C CD2 1 
ATOM   4586 C CE1 . PHE C 1 241 ? -0.606 63.419 17.004  1.00 35.39  ? 1434 PHE C CE1 1 
ATOM   4587 C CE2 . PHE C 1 241 ? 1.070  63.563 18.710  1.00 34.09  ? 1434 PHE C CE2 1 
ATOM   4588 C CZ  . PHE C 1 241 ? 0.039  64.143 17.999  1.00 43.00  ? 1434 PHE C CZ  1 
ATOM   4589 N N   . PHE C 1 242 ? 4.316  60.667 16.742  1.00 31.72  ? 1435 PHE C N   1 
ATOM   4590 C CA  . PHE C 1 242 ? 5.414  61.607 16.932  1.00 35.44  ? 1435 PHE C CA  1 
ATOM   4591 C C   . PHE C 1 242 ? 6.424  61.621 15.793  1.00 36.59  ? 1435 PHE C C   1 
ATOM   4592 O O   . PHE C 1 242 ? 7.140  62.600 15.630  1.00 41.22  ? 1435 PHE C O   1 
ATOM   4593 C CB  . PHE C 1 242 ? 6.164  61.325 18.238  1.00 31.28  ? 1435 PHE C CB  1 
ATOM   4594 C CG  . PHE C 1 242 ? 5.417  61.730 19.480  1.00 36.70  ? 1435 PHE C CG  1 
ATOM   4595 C CD1 . PHE C 1 242 ? 4.990  60.772 20.389  1.00 32.16  ? 1435 PHE C CD1 1 
ATOM   4596 C CD2 . PHE C 1 242 ? 5.161  63.064 19.750  1.00 26.98  ? 1435 PHE C CD2 1 
ATOM   4597 C CE1 . PHE C 1 242 ? 4.318  61.135 21.529  1.00 30.87  ? 1435 PHE C CE1 1 
ATOM   4598 C CE2 . PHE C 1 242 ? 4.485  63.434 20.892  1.00 24.12  ? 1435 PHE C CE2 1 
ATOM   4599 C CZ  . PHE C 1 242 ? 4.061  62.471 21.781  1.00 36.26  ? 1435 PHE C CZ  1 
ATOM   4600 N N   . PHE C 1 243 ? 6.509  60.543 15.018  1.00 32.78  ? 1436 PHE C N   1 
ATOM   4601 C CA  . PHE C 1 243 ? 7.645  60.392 14.108  1.00 27.04  ? 1436 PHE C CA  1 
ATOM   4602 C C   . PHE C 1 243 ? 7.364  59.895 12.682  1.00 38.83  ? 1436 PHE C C   1 
ATOM   4603 O O   . PHE C 1 243 ? 8.313  59.684 11.922  1.00 44.31  ? 1436 PHE C O   1 
ATOM   4604 C CB  . PHE C 1 243 ? 8.706  59.477 14.725  1.00 26.17  ? 1436 PHE C CB  1 
ATOM   4605 C CG  . PHE C 1 243 ? 9.293  59.988 16.008  1.00 34.29  ? 1436 PHE C CG  1 
ATOM   4606 C CD1 . PHE C 1 243 ? 9.011  59.359 17.213  1.00 31.54  ? 1436 PHE C CD1 1 
ATOM   4607 C CD2 . PHE C 1 243 ? 10.141 61.078 16.012  1.00 36.59  ? 1436 PHE C CD2 1 
ATOM   4608 C CE1 . PHE C 1 243 ? 9.557  59.815 18.396  1.00 25.65  ? 1436 PHE C CE1 1 
ATOM   4609 C CE2 . PHE C 1 243 ? 10.690 61.535 17.197  1.00 43.44  ? 1436 PHE C CE2 1 
ATOM   4610 C CZ  . PHE C 1 243 ? 10.393 60.902 18.390  1.00 31.76  ? 1436 PHE C CZ  1 
ATOM   4611 N N   . TYR C 1 244 ? 6.103  59.702 12.303  1.00 34.38  ? 1437 TYR C N   1 
ATOM   4612 C CA  . TYR C 1 244 ? 5.820  59.115 10.987  1.00 47.16  ? 1437 TYR C CA  1 
ATOM   4613 C C   . TYR C 1 244 ? 5.492  60.144 9.908   1.00 55.54  ? 1437 TYR C C   1 
ATOM   4614 O O   . TYR C 1 244 ? 4.813  61.129 10.175  1.00 46.42  ? 1437 TYR C O   1 
ATOM   4615 C CB  . TYR C 1 244 ? 4.672  58.102 11.064  1.00 44.18  ? 1437 TYR C CB  1 
ATOM   4616 C CG  . TYR C 1 244 ? 5.062  56.766 11.616  1.00 35.22  ? 1437 TYR C CG  1 
ATOM   4617 C CD1 . TYR C 1 244 ? 6.318  56.566 12.168  1.00 36.11  ? 1437 TYR C CD1 1 
ATOM   4618 C CD2 . TYR C 1 244 ? 4.168  55.707 11.616  1.00 43.73  ? 1437 TYR C CD2 1 
ATOM   4619 C CE1 . TYR C 1 244 ? 6.682  55.340 12.698  1.00 38.52  ? 1437 TYR C CE1 1 
ATOM   4620 C CE2 . TYR C 1 244 ? 4.521  54.468 12.147  1.00 40.85  ? 1437 TYR C CE2 1 
ATOM   4621 C CZ  . TYR C 1 244 ? 5.780  54.297 12.686  1.00 38.78  ? 1437 TYR C CZ  1 
ATOM   4622 O OH  . TYR C 1 244 ? 6.146  53.086 13.214  1.00 34.94  ? 1437 TYR C OH  1 
ATOM   4623 N N   . ASN C 1 245 ? 5.932  59.870 8.680   1.00 76.08  ? 1438 ASN C N   1 
ATOM   4624 C CA  . ASN C 1 245 ? 5.585  60.680 7.511   1.00 67.91  ? 1438 ASN C CA  1 
ATOM   4625 C C   . ASN C 1 245 ? 4.069  60.830 7.316   1.00 75.43  ? 1438 ASN C C   1 
ATOM   4626 O O   . ASN C 1 245 ? 3.350  61.334 8.189   1.00 45.08  ? 1438 ASN C O   1 
ATOM   4627 C CB  . ASN C 1 245 ? 6.213  60.074 6.244   1.00 56.49  ? 1438 ASN C CB  1 
ATOM   4628 N N   . TRP D 1 49  ? 39.098 19.990 -26.886 1.00 54.53  ? 1242 TRP D N   1 
ATOM   4629 C CA  . TRP D 1 49  ? 39.143 19.707 -25.445 1.00 112.35 ? 1242 TRP D CA  1 
ATOM   4630 C C   . TRP D 1 49  ? 39.219 18.200 -25.125 1.00 107.78 ? 1242 TRP D C   1 
ATOM   4631 O O   . TRP D 1 49  ? 38.761 17.363 -25.904 1.00 100.43 ? 1242 TRP D O   1 
ATOM   4632 C CB  . TRP D 1 49  ? 37.950 20.358 -24.719 1.00 62.67  ? 1242 TRP D CB  1 
ATOM   4633 N N   . GLU D 1 50  ? 39.819 17.874 -23.980 1.00 103.73 ? 1243 GLU D N   1 
ATOM   4634 C CA  . GLU D 1 50  ? 39.881 16.502 -23.468 1.00 94.41  ? 1243 GLU D CA  1 
ATOM   4635 C C   . GLU D 1 50  ? 39.537 16.527 -21.980 1.00 97.13  ? 1243 GLU D C   1 
ATOM   4636 O O   . GLU D 1 50  ? 40.336 16.990 -21.165 1.00 82.76  ? 1243 GLU D O   1 
ATOM   4637 C CB  . GLU D 1 50  ? 41.278 15.910 -23.665 1.00 67.96  ? 1243 GLU D CB  1 
ATOM   4638 N N   . SER D 1 51  ? 38.355 16.024 -21.628 1.00 77.02  ? 1244 SER D N   1 
ATOM   4639 C CA  . SER D 1 51  ? 37.781 16.288 -20.306 1.00 77.18  ? 1244 SER D CA  1 
ATOM   4640 C C   . SER D 1 51  ? 37.553 15.047 -19.440 1.00 79.07  ? 1244 SER D C   1 
ATOM   4641 O O   . SER D 1 51  ? 37.283 13.952 -19.946 1.00 72.91  ? 1244 SER D O   1 
ATOM   4642 C CB  . SER D 1 51  ? 36.468 17.068 -20.455 1.00 70.18  ? 1244 SER D CB  1 
ATOM   4643 O OG  . SER D 1 51  ? 35.827 17.261 -19.203 1.00 64.89  ? 1244 SER D OG  1 
ATOM   4644 N N   . ASN D 1 52  ? 37.663 15.242 -18.127 1.00 72.15  ? 1245 ASN D N   1 
ATOM   4645 C CA  . ASN D 1 52  ? 37.367 14.203 -17.145 1.00 73.00  ? 1245 ASN D CA  1 
ATOM   4646 C C   . ASN D 1 52  ? 35.890 14.234 -16.755 1.00 76.95  ? 1245 ASN D C   1 
ATOM   4647 O O   . ASN D 1 52  ? 35.368 13.281 -16.171 1.00 66.85  ? 1245 ASN D O   1 
ATOM   4648 C CB  . ASN D 1 52  ? 38.228 14.394 -15.889 1.00 79.18  ? 1245 ASN D CB  1 
ATOM   4649 C CG  . ASN D 1 52  ? 37.896 15.685 -15.138 1.00 102.76 ? 1245 ASN D CG  1 
ATOM   4650 O OD1 . ASN D 1 52  ? 37.420 15.651 -13.997 1.00 88.04  ? 1245 ASN D OD1 1 
ATOM   4651 N ND2 . ASN D 1 52  ? 38.138 16.828 -15.782 1.00 82.66  ? 1245 ASN D ND2 1 
ATOM   4652 N N   . TYR D 1 53  ? 35.224 15.340 -17.085 1.00 76.42  ? 1246 TYR D N   1 
ATOM   4653 C CA  . TYR D 1 53  ? 33.854 15.579 -16.635 1.00 71.27  ? 1246 TYR D CA  1 
ATOM   4654 C C   . TYR D 1 53  ? 32.818 15.467 -17.754 1.00 64.21  ? 1246 TYR D C   1 
ATOM   4655 O O   . TYR D 1 53  ? 31.767 14.835 -17.579 1.00 54.37  ? 1246 TYR D O   1 
ATOM   4656 C CB  . TYR D 1 53  ? 33.745 16.945 -15.958 1.00 68.01  ? 1246 TYR D CB  1 
ATOM   4657 C CG  . TYR D 1 53  ? 32.521 17.085 -15.083 1.00 66.17  ? 1246 TYR D CG  1 
ATOM   4658 C CD1 . TYR D 1 53  ? 31.376 17.723 -15.547 1.00 62.13  ? 1246 TYR D CD1 1 
ATOM   4659 C CD2 . TYR D 1 53  ? 32.506 16.567 -13.799 1.00 56.28  ? 1246 TYR D CD2 1 
ATOM   4660 C CE1 . TYR D 1 53  ? 30.249 17.849 -14.748 1.00 56.05  ? 1246 TYR D CE1 1 
ATOM   4661 C CE2 . TYR D 1 53  ? 31.389 16.680 -12.996 1.00 71.83  ? 1246 TYR D CE2 1 
ATOM   4662 C CZ  . TYR D 1 53  ? 30.261 17.326 -13.473 1.00 72.75  ? 1246 TYR D CZ  1 
ATOM   4663 O OH  . TYR D 1 53  ? 29.143 17.447 -12.669 1.00 68.09  ? 1246 TYR D OH  1 
ATOM   4664 N N   . PHE D 1 54  ? 33.109 16.086 -18.894 1.00 59.49  ? 1247 PHE D N   1 
ATOM   4665 C CA  . PHE D 1 54  ? 32.208 16.019 -20.040 1.00 52.52  ? 1247 PHE D CA  1 
ATOM   4666 C C   . PHE D 1 54  ? 32.588 14.892 -20.989 1.00 54.00  ? 1247 PHE D C   1 
ATOM   4667 O O   . PHE D 1 54  ? 33.765 14.592 -21.172 1.00 65.04  ? 1247 PHE D O   1 
ATOM   4668 C CB  . PHE D 1 54  ? 32.191 17.344 -20.786 1.00 33.41  ? 1247 PHE D CB  1 
ATOM   4669 C CG  . PHE D 1 54  ? 31.809 18.508 -19.929 1.00 48.80  ? 1247 PHE D CG  1 
ATOM   4670 C CD1 . PHE D 1 54  ? 32.777 19.291 -19.330 1.00 60.30  ? 1247 PHE D CD1 1 
ATOM   4671 C CD2 . PHE D 1 54  ? 30.477 18.819 -19.717 1.00 59.50  ? 1247 PHE D CD2 1 
ATOM   4672 C CE1 . PHE D 1 54  ? 32.423 20.368 -18.541 1.00 65.16  ? 1247 PHE D CE1 1 
ATOM   4673 C CE2 . PHE D 1 54  ? 30.115 19.892 -18.923 1.00 51.56  ? 1247 PHE D CE2 1 
ATOM   4674 C CZ  . PHE D 1 54  ? 31.088 20.666 -18.337 1.00 55.98  ? 1247 PHE D CZ  1 
ATOM   4675 N N   . GLY D 1 55  ? 31.582 14.268 -21.590 1.00 57.67  ? 1248 GLY D N   1 
ATOM   4676 C CA  . GLY D 1 55  ? 31.812 13.153 -22.488 1.00 57.45  ? 1248 GLY D CA  1 
ATOM   4677 C C   . GLY D 1 55  ? 32.151 11.856 -21.769 1.00 49.94  ? 1248 GLY D C   1 
ATOM   4678 O O   . GLY D 1 55  ? 32.572 10.887 -22.404 1.00 52.75  ? 1248 GLY D O   1 
ATOM   4679 N N   . VAL D 1 56  ? 31.974 11.830 -20.450 1.00 41.94  ? 1249 VAL D N   1 
ATOM   4680 C CA  . VAL D 1 56  ? 32.205 10.610 -19.681 1.00 51.35  ? 1249 VAL D CA  1 
ATOM   4681 C C   . VAL D 1 56  ? 30.881 10.061 -19.155 1.00 52.51  ? 1249 VAL D C   1 
ATOM   4682 O O   . VAL D 1 56  ? 29.929 10.817 -18.978 1.00 56.11  ? 1249 VAL D O   1 
ATOM   4683 C CB  . VAL D 1 56  ? 33.175 10.849 -18.505 1.00 52.21  ? 1249 VAL D CB  1 
ATOM   4684 C CG1 . VAL D 1 56  ? 34.361 11.678 -18.961 1.00 48.75  ? 1249 VAL D CG1 1 
ATOM   4685 C CG2 . VAL D 1 56  ? 32.460 11.528 -17.346 1.00 54.47  ? 1249 VAL D CG2 1 
ATOM   4686 N N   . PRO D 1 57  ? 30.814 8.741  -18.911 1.00 55.17  ? 1250 PRO D N   1 
ATOM   4687 C CA  . PRO D 1 57  ? 29.589 8.080  -18.433 1.00 59.87  ? 1250 PRO D CA  1 
ATOM   4688 C C   . PRO D 1 57  ? 28.917 8.857  -17.307 1.00 57.56  ? 1250 PRO D C   1 
ATOM   4689 O O   . PRO D 1 57  ? 29.596 9.558  -16.547 1.00 46.38  ? 1250 PRO D O   1 
ATOM   4690 C CB  . PRO D 1 57  ? 30.099 6.733  -17.925 1.00 43.31  ? 1250 PRO D CB  1 
ATOM   4691 C CG  . PRO D 1 57  ? 31.258 6.447  -18.801 1.00 53.92  ? 1250 PRO D CG  1 
ATOM   4692 C CD  . PRO D 1 57  ? 31.911 7.779  -19.106 1.00 48.62  ? 1250 PRO D CD  1 
ATOM   4693 N N   . LEU D 1 58  ? 27.595 8.740  -17.213 1.00 54.00  ? 1251 LEU D N   1 
ATOM   4694 C CA  . LEU D 1 58  ? 26.826 9.526  -16.250 1.00 51.33  ? 1251 LEU D CA  1 
ATOM   4695 C C   . LEU D 1 58  ? 27.179 9.189  -14.796 1.00 53.07  ? 1251 LEU D C   1 
ATOM   4696 O O   . LEU D 1 58  ? 27.303 10.087 -13.954 1.00 42.86  ? 1251 LEU D O   1 
ATOM   4697 C CB  . LEU D 1 58  ? 25.325 9.353  -16.499 1.00 50.96  ? 1251 LEU D CB  1 
ATOM   4698 C CG  . LEU D 1 58  ? 24.360 10.051 -15.536 1.00 47.53  ? 1251 LEU D CG  1 
ATOM   4699 C CD1 . LEU D 1 58  ? 24.536 11.571 -15.581 1.00 33.96  ? 1251 LEU D CD1 1 
ATOM   4700 C CD2 . LEU D 1 58  ? 22.918 9.644  -15.849 1.00 42.50  ? 1251 LEU D CD2 1 
ATOM   4701 N N   . THR D 1 59  ? 27.351 7.896  -14.514 1.00 51.31  ? 1252 THR D N   1 
ATOM   4702 C CA  . THR D 1 59  ? 27.671 7.430  -13.165 1.00 51.28  ? 1252 THR D CA  1 
ATOM   4703 C C   . THR D 1 59  ? 29.004 7.984  -12.637 1.00 58.65  ? 1252 THR D C   1 
ATOM   4704 O O   . THR D 1 59  ? 29.213 8.084  -11.427 1.00 64.40  ? 1252 THR D O   1 
ATOM   4705 C CB  . THR D 1 59  ? 27.690 5.899  -13.107 1.00 51.95  ? 1252 THR D CB  1 
ATOM   4706 O OG1 . THR D 1 59  ? 28.472 5.396  -14.199 1.00 61.43  ? 1252 THR D OG1 1 
ATOM   4707 C CG2 . THR D 1 59  ? 26.276 5.354  -13.221 1.00 47.52  ? 1252 THR D CG2 1 
ATOM   4708 N N   . THR D 1 60  ? 29.895 8.348  -13.553 1.00 63.66  ? 1253 THR D N   1 
ATOM   4709 C CA  . THR D 1 60  ? 31.210 8.886  -13.208 1.00 52.76  ? 1253 THR D CA  1 
ATOM   4710 C C   . THR D 1 60  ? 31.118 10.268 -12.567 1.00 62.29  ? 1253 THR D C   1 
ATOM   4711 O O   . THR D 1 60  ? 32.000 10.664 -11.801 1.00 66.93  ? 1253 THR D O   1 
ATOM   4712 C CB  . THR D 1 60  ? 32.118 8.977  -14.459 1.00 59.23  ? 1253 THR D CB  1 
ATOM   4713 O OG1 . THR D 1 60  ? 32.662 7.685  -14.756 1.00 65.66  ? 1253 THR D OG1 1 
ATOM   4714 C CG2 . THR D 1 60  ? 33.253 9.955  -14.236 1.00 55.46  ? 1253 THR D CG2 1 
ATOM   4715 N N   . VAL D 1 61  ? 30.054 11.005 -12.880 1.00 62.49  ? 1254 VAL D N   1 
ATOM   4716 C CA  . VAL D 1 61  ? 29.903 12.372 -12.375 1.00 51.82  ? 1254 VAL D CA  1 
ATOM   4717 C C   . VAL D 1 61  ? 28.711 12.528 -11.434 1.00 50.93  ? 1254 VAL D C   1 
ATOM   4718 O O   . VAL D 1 61  ? 28.261 13.650 -11.194 1.00 48.47  ? 1254 VAL D O   1 
ATOM   4719 C CB  . VAL D 1 61  ? 29.782 13.403 -13.520 1.00 48.15  ? 1254 VAL D CB  1 
ATOM   4720 C CG1 . VAL D 1 61  ? 31.082 13.486 -14.297 1.00 56.09  ? 1254 VAL D CG1 1 
ATOM   4721 C CG2 . VAL D 1 61  ? 28.626 13.041 -14.449 1.00 52.45  ? 1254 VAL D CG2 1 
ATOM   4722 N N   . VAL D 1 62  ? 28.196 11.407 -10.924 1.00 48.44  ? 1255 VAL D N   1 
ATOM   4723 C CA  . VAL D 1 62  ? 27.159 11.432 -9.891  1.00 54.71  ? 1255 VAL D CA  1 
ATOM   4724 C C   . VAL D 1 62  ? 27.364 10.324 -8.855  1.00 73.37  ? 1255 VAL D C   1 
ATOM   4725 O O   . VAL D 1 62  ? 27.950 9.272  -9.150  1.00 74.79  ? 1255 VAL D O   1 
ATOM   4726 C CB  . VAL D 1 62  ? 25.722 11.300 -10.472 1.00 52.19  ? 1255 VAL D CB  1 
ATOM   4727 C CG1 . VAL D 1 62  ? 25.457 12.367 -11.522 1.00 49.84  ? 1255 VAL D CG1 1 
ATOM   4728 C CG2 . VAL D 1 62  ? 25.475 9.891  -11.024 1.00 31.58  ? 1255 VAL D CG2 1 
ATOM   4729 N N   . THR D 1 63  ? 26.869 10.571 -7.645  1.00 68.19  ? 1256 THR D N   1 
ATOM   4730 C CA  . THR D 1 63  ? 26.890 9.586  -6.572  1.00 64.59  ? 1256 THR D CA  1 
ATOM   4731 C C   . THR D 1 63  ? 25.449 9.351  -6.142  1.00 70.49  ? 1256 THR D C   1 
ATOM   4732 O O   . THR D 1 63  ? 24.583 10.169 -6.452  1.00 75.86  ? 1256 THR D O   1 
ATOM   4733 C CB  . THR D 1 63  ? 27.707 10.101 -5.379  1.00 64.89  ? 1256 THR D CB  1 
ATOM   4734 O OG1 . THR D 1 63  ? 26.964 11.113 -4.690  1.00 58.85  ? 1256 THR D OG1 1 
ATOM   4735 C CG2 . THR D 1 63  ? 29.035 10.682 -5.857  1.00 50.47  ? 1256 THR D CG2 1 
ATOM   4736 N N   . PRO D 1 64  ? 25.171 8.234  -5.446  1.00 76.51  ? 1257 PRO D N   1 
ATOM   4737 C CA  . PRO D 1 64  ? 23.780 8.029  -5.023  1.00 70.50  ? 1257 PRO D CA  1 
ATOM   4738 C C   . PRO D 1 64  ? 23.355 9.052  -3.981  1.00 68.17  ? 1257 PRO D C   1 
ATOM   4739 O O   . PRO D 1 64  ? 22.154 9.244  -3.766  1.00 66.75  ? 1257 PRO D O   1 
ATOM   4740 C CB  . PRO D 1 64  ? 23.794 6.622  -4.418  1.00 51.09  ? 1257 PRO D CB  1 
ATOM   4741 C CG  . PRO D 1 64  ? 24.982 5.950  -5.033  1.00 57.84  ? 1257 PRO D CG  1 
ATOM   4742 C CD  . PRO D 1 64  ? 26.004 7.049  -5.184  1.00 70.48  ? 1257 PRO D CD  1 
ATOM   4743 N N   . GLU D 1 65  ? 24.331 9.707  -3.356  1.00 65.15  ? 1258 GLU D N   1 
ATOM   4744 C CA  . GLU D 1 65  ? 24.060 10.690 -2.306  1.00 75.10  ? 1258 GLU D CA  1 
ATOM   4745 C C   . GLU D 1 65  ? 23.917 12.109 -2.866  1.00 72.32  ? 1258 GLU D C   1 
ATOM   4746 O O   . GLU D 1 65  ? 23.239 12.955 -2.276  1.00 63.61  ? 1258 GLU D O   1 
ATOM   4747 C CB  . GLU D 1 65  ? 25.159 10.643 -1.235  1.00 73.71  ? 1258 GLU D CB  1 
ATOM   4748 N N   . LYS D 1 66  ? 24.575 12.354 -3.998  1.00 69.29  ? 1259 LYS D N   1 
ATOM   4749 C CA  . LYS D 1 66  ? 24.482 13.622 -4.720  1.00 69.99  ? 1259 LYS D CA  1 
ATOM   4750 C C   . LYS D 1 66  ? 24.282 13.324 -6.214  1.00 67.64  ? 1259 LYS D C   1 
ATOM   4751 O O   . LYS D 1 66  ? 25.208 13.496 -7.016  1.00 55.55  ? 1259 LYS D O   1 
ATOM   4752 C CB  . LYS D 1 66  ? 25.746 14.458 -4.489  1.00 43.55  ? 1259 LYS D CB  1 
ATOM   4753 N N   . PRO D 1 67  ? 23.056 12.887 -6.584  1.00 69.07  ? 1260 PRO D N   1 
ATOM   4754 C CA  . PRO D 1 67  ? 22.701 12.213 -7.846  1.00 57.18  ? 1260 PRO D CA  1 
ATOM   4755 C C   . PRO D 1 67  ? 22.647 13.144 -9.059  1.00 55.81  ? 1260 PRO D C   1 
ATOM   4756 O O   . PRO D 1 67  ? 22.688 12.681 -10.201 1.00 49.56  ? 1260 PRO D O   1 
ATOM   4757 C CB  . PRO D 1 67  ? 21.297 11.649 -7.569  1.00 44.56  ? 1260 PRO D CB  1 
ATOM   4758 C CG  . PRO D 1 67  ? 20.982 11.995 -6.126  1.00 61.76  ? 1260 PRO D CG  1 
ATOM   4759 C CD  . PRO D 1 67  ? 21.861 13.144 -5.766  1.00 54.72  ? 1260 PRO D CD  1 
ATOM   4760 N N   . ILE D 1 68  ? 22.544 14.443 -8.808  1.00 46.87  ? 1261 ILE D N   1 
ATOM   4761 C CA  . ILE D 1 68  ? 22.528 15.415 -9.884  1.00 43.79  ? 1261 ILE D CA  1 
ATOM   4762 C C   . ILE D 1 68  ? 23.949 15.895 -10.145 1.00 47.81  ? 1261 ILE D C   1 
ATOM   4763 O O   . ILE D 1 68  ? 24.642 16.313 -9.218  1.00 59.26  ? 1261 ILE D O   1 
ATOM   4764 C CB  . ILE D 1 68  ? 21.614 16.608 -9.543  1.00 35.20  ? 1261 ILE D CB  1 
ATOM   4765 C CG1 . ILE D 1 68  ? 20.274 16.108 -8.998  1.00 40.81  ? 1261 ILE D CG1 1 
ATOM   4766 C CG2 . ILE D 1 68  ? 21.369 17.464 -10.763 1.00 41.00  ? 1261 ILE D CG2 1 
ATOM   4767 C CD1 . ILE D 1 68  ? 19.541 15.151 -9.924  1.00 38.28  ? 1261 ILE D CD1 1 
ATOM   4768 N N   . PRO D 1 69  ? 24.401 15.814 -11.406 1.00 43.78  ? 1262 PRO D N   1 
ATOM   4769 C CA  . PRO D 1 69  ? 25.714 16.355 -11.756 1.00 42.74  ? 1262 PRO D CA  1 
ATOM   4770 C C   . PRO D 1 69  ? 25.820 17.809 -11.323 1.00 46.78  ? 1262 PRO D C   1 
ATOM   4771 O O   . PRO D 1 69  ? 24.908 18.596 -11.584 1.00 48.74  ? 1262 PRO D O   1 
ATOM   4772 C CB  . PRO D 1 69  ? 25.731 16.252 -13.284 1.00 42.74  ? 1262 PRO D CB  1 
ATOM   4773 C CG  . PRO D 1 69  ? 24.858 15.098 -13.581 1.00 45.93  ? 1262 PRO D CG  1 
ATOM   4774 C CD  . PRO D 1 69  ? 23.754 15.159 -12.555 1.00 47.49  ? 1262 PRO D CD  1 
ATOM   4775 N N   . ILE D 1 70  ? 26.921 18.154 -10.663 1.00 52.33  ? 1263 ILE D N   1 
ATOM   4776 C CA  . ILE D 1 70  ? 27.118 19.509 -10.156 1.00 46.75  ? 1263 ILE D CA  1 
ATOM   4777 C C   . ILE D 1 70  ? 26.973 20.557 -11.262 1.00 49.34  ? 1263 ILE D C   1 
ATOM   4778 O O   . ILE D 1 70  ? 26.386 21.623 -11.042 1.00 53.87  ? 1263 ILE D O   1 
ATOM   4779 C CB  . ILE D 1 70  ? 28.477 19.655 -9.410  1.00 52.50  ? 1263 ILE D CB  1 
ATOM   4780 C CG1 . ILE D 1 70  ? 28.362 19.119 -7.979  1.00 51.92  ? 1263 ILE D CG1 1 
ATOM   4781 C CG2 . ILE D 1 70  ? 28.938 21.107 -9.371  1.00 53.03  ? 1263 ILE D CG2 1 
ATOM   4782 C CD1 . ILE D 1 70  ? 28.057 17.623 -7.884  1.00 66.30  ? 1263 ILE D CD1 1 
ATOM   4783 N N   . PHE D 1 71  ? 27.493 20.259 -12.451 1.00 47.05  ? 1264 PHE D N   1 
ATOM   4784 C CA  . PHE D 1 71  ? 27.370 21.194 -13.571 1.00 50.13  ? 1264 PHE D CA  1 
ATOM   4785 C C   . PHE D 1 71  ? 25.900 21.480 -13.887 1.00 47.68  ? 1264 PHE D C   1 
ATOM   4786 O O   . PHE D 1 71  ? 25.519 22.623 -14.165 1.00 39.42  ? 1264 PHE D O   1 
ATOM   4787 C CB  . PHE D 1 71  ? 28.095 20.663 -14.816 1.00 44.45  ? 1264 PHE D CB  1 
ATOM   4788 C CG  . PHE D 1 71  ? 28.000 21.578 -16.013 1.00 41.18  ? 1264 PHE D CG  1 
ATOM   4789 C CD1 . PHE D 1 71  ? 28.682 22.784 -16.036 1.00 42.85  ? 1264 PHE D CD1 1 
ATOM   4790 C CD2 . PHE D 1 71  ? 27.228 21.233 -17.111 1.00 44.46  ? 1264 PHE D CD2 1 
ATOM   4791 C CE1 . PHE D 1 71  ? 28.597 23.636 -17.128 1.00 41.76  ? 1264 PHE D CE1 1 
ATOM   4792 C CE2 . PHE D 1 71  ? 27.137 22.075 -18.210 1.00 47.58  ? 1264 PHE D CE2 1 
ATOM   4793 C CZ  . PHE D 1 71  ? 27.824 23.280 -18.216 1.00 51.95  ? 1264 PHE D CZ  1 
ATOM   4794 N N   . ILE D 1 72  ? 25.078 20.435 -13.842 1.00 39.13  ? 1265 ILE D N   1 
ATOM   4795 C CA  . ILE D 1 72  ? 23.654 20.587 -14.123 1.00 48.32  ? 1265 ILE D CA  1 
ATOM   4796 C C   . ILE D 1 72  ? 22.971 21.469 -13.065 1.00 51.23  ? 1265 ILE D C   1 
ATOM   4797 O O   . ILE D 1 72  ? 22.151 22.335 -13.388 1.00 46.91  ? 1265 ILE D O   1 
ATOM   4798 C CB  . ILE D 1 72  ? 22.945 19.223 -14.242 1.00 37.56  ? 1265 ILE D CB  1 
ATOM   4799 C CG1 . ILE D 1 72  ? 23.443 18.480 -15.480 1.00 34.76  ? 1265 ILE D CG1 1 
ATOM   4800 C CG2 . ILE D 1 72  ? 21.443 19.417 -14.329 1.00 42.11  ? 1265 ILE D CG2 1 
ATOM   4801 C CD1 . ILE D 1 72  ? 23.330 19.291 -16.756 1.00 33.36  ? 1265 ILE D CD1 1 
ATOM   4802 N N   . GLU D 1 73  ? 23.325 21.255 -11.803 1.00 47.41  ? 1266 GLU D N   1 
ATOM   4803 C CA  . GLU D 1 73  ? 22.814 22.090 -10.728 1.00 42.88  ? 1266 GLU D CA  1 
ATOM   4804 C C   . GLU D 1 73  ? 23.164 23.561 -10.917 1.00 49.97  ? 1266 GLU D C   1 
ATOM   4805 O O   . GLU D 1 73  ? 22.292 24.419 -10.792 1.00 50.59  ? 1266 GLU D O   1 
ATOM   4806 C CB  . GLU D 1 73  ? 23.307 21.596 -9.370  1.00 53.39  ? 1266 GLU D CB  1 
ATOM   4807 C CG  . GLU D 1 73  ? 22.274 20.792 -8.602  1.00 74.01  ? 1266 GLU D CG  1 
ATOM   4808 C CD  . GLU D 1 73  ? 22.827 20.197 -7.320  1.00 86.49  ? 1266 GLU D CD  1 
ATOM   4809 O OE1 . GLU D 1 73  ? 22.023 19.925 -6.397  1.00 67.25  ? 1266 GLU D OE1 1 
ATOM   4810 O OE2 . GLU D 1 73  ? 24.063 20.002 -7.240  1.00 79.49  ? 1266 GLU D OE2 1 
ATOM   4811 N N   . ARG D 1 74  ? 24.431 23.863 -11.203 1.00 42.78  ? 1267 ARG D N   1 
ATOM   4812 C CA  . ARG D 1 74  ? 24.830 25.252 -11.463 1.00 48.07  ? 1267 ARG D CA  1 
ATOM   4813 C C   . ARG D 1 74  ? 23.985 25.898 -12.548 1.00 57.44  ? 1267 ARG D C   1 
ATOM   4814 O O   . ARG D 1 74  ? 23.415 26.974 -12.348 1.00 58.78  ? 1267 ARG D O   1 
ATOM   4815 C CB  . ARG D 1 74  ? 26.290 25.349 -11.893 1.00 54.78  ? 1267 ARG D CB  1 
ATOM   4816 C CG  . ARG D 1 74  ? 27.267 25.059 -10.801 1.00 70.05  ? 1267 ARG D CG  1 
ATOM   4817 C CD  . ARG D 1 74  ? 26.991 25.885 -9.563  1.00 61.61  ? 1267 ARG D CD  1 
ATOM   4818 N NE  . ARG D 1 74  ? 27.503 25.176 -8.400  1.00 62.52  ? 1267 ARG D NE  1 
ATOM   4819 C CZ  . ARG D 1 74  ? 28.782 24.857 -8.250  1.00 79.19  ? 1267 ARG D CZ  1 
ATOM   4820 N NH1 . ARG D 1 74  ? 29.664 25.203 -9.182  1.00 59.52  ? 1267 ARG D NH1 1 
ATOM   4821 N NH2 . ARG D 1 74  ? 29.180 24.199 -7.171  1.00 88.93  ? 1267 ARG D NH2 1 
ATOM   4822 N N   . CYS D 1 75  ? 23.920 25.240 -13.703 1.00 47.26  ? 1268 CYS D N   1 
ATOM   4823 C CA  . CYS D 1 75  ? 23.245 25.803 -14.860 1.00 40.15  ? 1268 CYS D CA  1 
ATOM   4824 C C   . CYS D 1 75  ? 21.749 25.973 -14.634 1.00 47.58  ? 1268 CYS D C   1 
ATOM   4825 O O   . CYS D 1 75  ? 21.196 27.045 -14.896 1.00 46.21  ? 1268 CYS D O   1 
ATOM   4826 C CB  . CYS D 1 75  ? 23.506 24.940 -16.085 1.00 51.41  ? 1268 CYS D CB  1 
ATOM   4827 S SG  . CYS D 1 75  ? 25.249 24.887 -16.545 1.00 49.03  ? 1268 CYS D SG  1 
ATOM   4828 N N   . ILE D 1 76  ? 21.096 24.921 -14.147 1.00 39.27  ? 1269 ILE D N   1 
ATOM   4829 C CA  . ILE D 1 76  ? 19.657 24.988 -13.930 1.00 43.93  ? 1269 ILE D CA  1 
ATOM   4830 C C   . ILE D 1 76  ? 19.304 26.009 -12.850 1.00 45.85  ? 1269 ILE D C   1 
ATOM   4831 O O   . ILE D 1 76  ? 18.354 26.777 -13.000 1.00 51.78  ? 1269 ILE D O   1 
ATOM   4832 C CB  . ILE D 1 76  ? 19.054 23.615 -13.595 1.00 43.40  ? 1269 ILE D CB  1 
ATOM   4833 C CG1 . ILE D 1 76  ? 19.040 22.732 -14.847 1.00 42.24  ? 1269 ILE D CG1 1 
ATOM   4834 C CG2 . ILE D 1 76  ? 17.647 23.783 -13.038 1.00 32.58  ? 1269 ILE D CG2 1 
ATOM   4835 C CD1 . ILE D 1 76  ? 18.213 21.467 -14.711 1.00 38.08  ? 1269 ILE D CD1 1 
ATOM   4836 N N   . GLU D 1 77  ? 20.079 26.031 -11.772 1.00 43.26  ? 1270 GLU D N   1 
ATOM   4837 C CA  . GLU D 1 77  ? 19.820 26.964 -10.686 1.00 41.80  ? 1270 GLU D CA  1 
ATOM   4838 C C   . GLU D 1 77  ? 20.070 28.404 -11.124 1.00 51.91  ? 1270 GLU D C   1 
ATOM   4839 O O   . GLU D 1 77  ? 19.377 29.330 -10.684 1.00 58.44  ? 1270 GLU D O   1 
ATOM   4840 C CB  . GLU D 1 77  ? 20.649 26.605 -9.454  1.00 36.23  ? 1270 GLU D CB  1 
ATOM   4841 C CG  . GLU D 1 77  ? 20.088 25.418 -8.681  1.00 46.66  ? 1270 GLU D CG  1 
ATOM   4842 C CD  . GLU D 1 77  ? 20.934 25.012 -7.487  1.00 64.46  ? 1270 GLU D CD  1 
ATOM   4843 O OE1 . GLU D 1 77  ? 21.576 25.890 -6.865  1.00 51.82  ? 1270 GLU D OE1 1 
ATOM   4844 O OE2 . GLU D 1 77  ? 20.943 23.803 -7.166  1.00 67.15  ? 1270 GLU D OE2 1 
ATOM   4845 N N   . TYR D 1 78  ? 21.048 28.585 -12.009 1.00 44.82  ? 1271 TYR D N   1 
ATOM   4846 C CA  . TYR D 1 78  ? 21.365 29.907 -12.538 1.00 37.90  ? 1271 TYR D CA  1 
ATOM   4847 C C   . TYR D 1 78  ? 20.321 30.349 -13.557 1.00 45.50  ? 1271 TYR D C   1 
ATOM   4848 O O   . TYR D 1 78  ? 19.912 31.512 -13.574 1.00 47.76  ? 1271 TYR D O   1 
ATOM   4849 C CB  . TYR D 1 78  ? 22.755 29.902 -13.167 1.00 38.13  ? 1271 TYR D CB  1 
ATOM   4850 C CG  . TYR D 1 78  ? 23.154 31.206 -13.820 1.00 48.38  ? 1271 TYR D CG  1 
ATOM   4851 C CD1 . TYR D 1 78  ? 23.662 32.254 -13.070 1.00 40.89  ? 1271 TYR D CD1 1 
ATOM   4852 C CD2 . TYR D 1 78  ? 23.040 31.379 -15.195 1.00 46.84  ? 1271 TYR D CD2 1 
ATOM   4853 C CE1 . TYR D 1 78  ? 24.029 33.450 -13.663 1.00 44.87  ? 1271 TYR D CE1 1 
ATOM   4854 C CE2 . TYR D 1 78  ? 23.411 32.566 -15.801 1.00 55.37  ? 1271 TYR D CE2 1 
ATOM   4855 C CZ  . TYR D 1 78  ? 23.906 33.605 -15.030 1.00 57.28  ? 1271 TYR D CZ  1 
ATOM   4856 O OH  . TYR D 1 78  ? 24.285 34.796 -15.632 1.00 43.35  ? 1271 TYR D OH  1 
ATOM   4857 N N   . ILE D 1 79  ? 19.896 29.413 -14.403 1.00 44.65  ? 1272 ILE D N   1 
ATOM   4858 C CA  . ILE D 1 79  ? 18.877 29.687 -15.408 1.00 43.40  ? 1272 ILE D CA  1 
ATOM   4859 C C   . ILE D 1 79  ? 17.539 30.003 -14.743 1.00 51.08  ? 1272 ILE D C   1 
ATOM   4860 O O   . ILE D 1 79  ? 16.777 30.851 -15.226 1.00 47.39  ? 1272 ILE D O   1 
ATOM   4861 C CB  . ILE D 1 79  ? 18.719 28.513 -16.387 1.00 41.57  ? 1272 ILE D CB  1 
ATOM   4862 C CG1 . ILE D 1 79  ? 19.876 28.494 -17.383 1.00 42.31  ? 1272 ILE D CG1 1 
ATOM   4863 C CG2 . ILE D 1 79  ? 17.411 28.615 -17.134 1.00 31.24  ? 1272 ILE D CG2 1 
ATOM   4864 C CD1 . ILE D 1 79  ? 20.173 27.117 -17.950 1.00 34.28  ? 1272 ILE D CD1 1 
ATOM   4865 N N   . GLU D 1 80  ? 17.260 29.331 -13.627 1.00 42.98  ? 1273 GLU D N   1 
ATOM   4866 C CA  . GLU D 1 80  ? 16.026 29.581 -12.895 1.00 43.89  ? 1273 GLU D CA  1 
ATOM   4867 C C   . GLU D 1 80  ? 16.063 30.941 -12.206 1.00 50.82  ? 1273 GLU D C   1 
ATOM   4868 O O   . GLU D 1 80  ? 15.027 31.581 -12.022 1.00 61.22  ? 1273 GLU D O   1 
ATOM   4869 C CB  . GLU D 1 80  ? 15.743 28.462 -11.894 1.00 37.04  ? 1273 GLU D CB  1 
ATOM   4870 C CG  . GLU D 1 80  ? 15.095 27.240 -12.534 1.00 38.29  ? 1273 GLU D CG  1 
ATOM   4871 C CD  . GLU D 1 80  ? 14.701 26.178 -11.523 1.00 49.78  ? 1273 GLU D CD  1 
ATOM   4872 O OE1 . GLU D 1 80  ? 14.722 26.485 -10.304 1.00 40.29  ? 1273 GLU D OE1 1 
ATOM   4873 O OE2 . GLU D 1 80  ? 14.370 25.045 -11.957 1.00 36.06  ? 1273 GLU D OE2 1 
ATOM   4874 N N   . ALA D 1 81  ? 17.261 31.393 -11.854 1.00 45.91  ? 1274 ALA D N   1 
ATOM   4875 C CA  . ALA D 1 81  ? 17.413 32.686 -11.196 1.00 49.82  ? 1274 ALA D CA  1 
ATOM   4876 C C   . ALA D 1 81  ? 17.663 33.843 -12.168 1.00 50.70  ? 1274 ALA D C   1 
ATOM   4877 O O   . ALA D 1 81  ? 17.588 35.013 -11.785 1.00 57.13  ? 1274 ALA D O   1 
ATOM   4878 C CB  . ALA D 1 81  ? 18.518 32.621 -10.151 1.00 42.17  ? 1274 ALA D CB  1 
ATOM   4879 N N   . THR D 1 82  ? 17.950 33.522 -13.425 1.00 53.80  ? 1275 THR D N   1 
ATOM   4880 C CA  . THR D 1 82  ? 18.334 34.557 -14.382 1.00 55.72  ? 1275 THR D CA  1 
ATOM   4881 C C   . THR D 1 82  ? 17.508 34.566 -15.677 1.00 61.76  ? 1275 THR D C   1 
ATOM   4882 O O   . THR D 1 82  ? 17.326 35.625 -16.276 1.00 61.15  ? 1275 THR D O   1 
ATOM   4883 C CB  . THR D 1 82  ? 19.858 34.479 -14.714 1.00 41.50  ? 1275 THR D CB  1 
ATOM   4884 N N   . GLY D 1 83  ? 16.992 33.408 -16.098 1.00 64.68  ? 1276 GLY D N   1 
ATOM   4885 C CA  . GLY D 1 83  ? 16.421 33.292 -17.434 1.00 60.52  ? 1276 GLY D CA  1 
ATOM   4886 C C   . GLY D 1 83  ? 14.994 32.800 -17.652 1.00 55.47  ? 1276 GLY D C   1 
ATOM   4887 O O   . GLY D 1 83  ? 14.605 32.542 -18.795 1.00 55.60  ? 1276 GLY D O   1 
ATOM   4888 N N   . LEU D 1 84  ? 14.206 32.675 -16.590 1.00 41.20  ? 1277 LEU D N   1 
ATOM   4889 C CA  . LEU D 1 84  ? 12.831 32.182 -16.725 1.00 30.17  ? 1277 LEU D CA  1 
ATOM   4890 C C   . LEU D 1 84  ? 11.927 33.077 -17.567 1.00 35.88  ? 1277 LEU D C   1 
ATOM   4891 O O   . LEU D 1 84  ? 10.810 32.684 -17.898 1.00 34.88  ? 1277 LEU D O   1 
ATOM   4892 C CB  . LEU D 1 84  ? 12.184 31.981 -15.353 1.00 30.28  ? 1277 LEU D CB  1 
ATOM   4893 C CG  . LEU D 1 84  ? 12.628 30.756 -14.553 1.00 45.93  ? 1277 LEU D CG  1 
ATOM   4894 C CD1 . LEU D 1 84  ? 11.688 30.542 -13.370 1.00 41.18  ? 1277 LEU D CD1 1 
ATOM   4895 C CD2 . LEU D 1 84  ? 12.704 29.510 -15.439 1.00 34.47  ? 1277 LEU D CD2 1 
ATOM   4896 N N   . SER D 1 85  ? 12.394 34.277 -17.899 1.00 36.54  ? 1278 SER D N   1 
ATOM   4897 C CA  . SER D 1 85  ? 11.577 35.204 -18.676 1.00 35.12  ? 1278 SER D CA  1 
ATOM   4898 C C   . SER D 1 85  ? 12.135 35.446 -20.072 1.00 40.23  ? 1278 SER D C   1 
ATOM   4899 O O   . SER D 1 85  ? 11.563 36.220 -20.840 1.00 44.55  ? 1278 SER D O   1 
ATOM   4900 C CB  . SER D 1 85  ? 11.419 36.539 -17.944 1.00 44.33  ? 1278 SER D CB  1 
ATOM   4901 O OG  . SER D 1 85  ? 10.675 36.390 -16.744 1.00 57.51  ? 1278 SER D OG  1 
ATOM   4902 N N   . THR D 1 86  ? 13.245 34.791 -20.402 1.00 30.87  ? 1279 THR D N   1 
ATOM   4903 C CA  . THR D 1 86  ? 13.896 35.038 -21.683 1.00 37.84  ? 1279 THR D CA  1 
ATOM   4904 C C   . THR D 1 86  ? 13.156 34.337 -22.820 1.00 44.49  ? 1279 THR D C   1 
ATOM   4905 O O   . THR D 1 86  ? 12.933 33.120 -22.779 1.00 46.08  ? 1279 THR D O   1 
ATOM   4906 C CB  . THR D 1 86  ? 15.391 34.632 -21.665 1.00 39.28  ? 1279 THR D CB  1 
ATOM   4907 O OG1 . THR D 1 86  ? 15.537 33.252 -22.014 1.00 46.46  ? 1279 THR D OG1 1 
ATOM   4908 C CG2 . THR D 1 86  ? 15.993 34.874 -20.293 1.00 43.53  ? 1279 THR D CG2 1 
ATOM   4909 N N   . GLU D 1 87  ? 12.759 35.110 -23.829 1.00 42.51  ? 1280 GLU D N   1 
ATOM   4910 C CA  . GLU D 1 87  ? 12.030 34.544 -24.953 1.00 38.69  ? 1280 GLU D CA  1 
ATOM   4911 C C   . GLU D 1 87  ? 12.830 33.411 -25.576 1.00 40.87  ? 1280 GLU D C   1 
ATOM   4912 O O   . GLU D 1 87  ? 14.042 33.525 -25.774 1.00 42.59  ? 1280 GLU D O   1 
ATOM   4913 C CB  . GLU D 1 87  ? 11.703 35.607 -26.001 1.00 35.89  ? 1280 GLU D CB  1 
ATOM   4914 C CG  . GLU D 1 87  ? 10.345 36.282 -25.812 1.00 54.42  ? 1280 GLU D CG  1 
ATOM   4915 C CD  . GLU D 1 87  ? 9.950  37.163 -26.998 1.00 73.85  ? 1280 GLU D CD  1 
ATOM   4916 O OE1 . GLU D 1 87  ? 8.834  37.730 -26.973 1.00 69.84  ? 1280 GLU D OE1 1 
ATOM   4917 O OE2 . GLU D 1 87  ? 10.753 37.290 -27.955 1.00 65.91  ? 1280 GLU D OE2 1 
ATOM   4918 N N   . GLY D 1 88  ? 12.140 32.312 -25.854 1.00 39.93  ? 1281 GLY D N   1 
ATOM   4919 C CA  . GLY D 1 88  ? 12.719 31.192 -26.567 1.00 40.60  ? 1281 GLY D CA  1 
ATOM   4920 C C   . GLY D 1 88  ? 13.867 30.479 -25.872 1.00 41.04  ? 1281 GLY D C   1 
ATOM   4921 O O   . GLY D 1 88  ? 14.633 29.767 -26.521 1.00 48.57  ? 1281 GLY D O   1 
ATOM   4922 N N   . ILE D 1 89  ? 14.002 30.652 -24.562 1.00 36.91  ? 1282 ILE D N   1 
ATOM   4923 C CA  . ILE D 1 89  ? 15.045 29.924 -23.841 1.00 40.42  ? 1282 ILE D CA  1 
ATOM   4924 C C   . ILE D 1 89  ? 15.046 28.439 -24.215 1.00 43.28  ? 1282 ILE D C   1 
ATOM   4925 O O   . ILE D 1 89  ? 13.982 27.807 -24.300 1.00 29.82  ? 1282 ILE D O   1 
ATOM   4926 C CB  . ILE D 1 89  ? 14.932 30.074 -22.301 1.00 36.83  ? 1282 ILE D CB  1 
ATOM   4927 C CG1 . ILE D 1 89  ? 16.222 29.579 -21.641 1.00 26.79  ? 1282 ILE D CG1 1 
ATOM   4928 C CG2 . ILE D 1 89  ? 13.708 29.331 -21.762 1.00 17.38  ? 1282 ILE D CG2 1 
ATOM   4929 C CD1 . ILE D 1 89  ? 16.239 29.750 -20.164 1.00 46.90  ? 1282 ILE D CD1 1 
ATOM   4930 N N   . TYR D 1 90  ? 16.250 27.909 -24.442 1.00 42.95  ? 1283 TYR D N   1 
ATOM   4931 C CA  . TYR D 1 90  ? 16.470 26.515 -24.862 1.00 34.42  ? 1283 TYR D CA  1 
ATOM   4932 C C   . TYR D 1 90  ? 16.225 26.264 -26.348 1.00 42.50  ? 1283 TYR D C   1 
ATOM   4933 O O   . TYR D 1 90  ? 16.797 25.339 -26.927 1.00 50.77  ? 1283 TYR D O   1 
ATOM   4934 C CB  . TYR D 1 90  ? 15.663 25.517 -24.031 1.00 32.70  ? 1283 TYR D CB  1 
ATOM   4935 C CG  . TYR D 1 90  ? 16.145 25.374 -22.614 1.00 37.59  ? 1283 TYR D CG  1 
ATOM   4936 C CD1 . TYR D 1 90  ? 15.281 25.607 -21.547 1.00 33.78  ? 1283 TYR D CD1 1 
ATOM   4937 C CD2 . TYR D 1 90  ? 17.466 25.026 -22.337 1.00 33.56  ? 1283 TYR D CD2 1 
ATOM   4938 C CE1 . TYR D 1 90  ? 15.712 25.490 -20.241 1.00 42.95  ? 1283 TYR D CE1 1 
ATOM   4939 C CE2 . TYR D 1 90  ? 17.908 24.898 -21.030 1.00 37.38  ? 1283 TYR D CE2 1 
ATOM   4940 C CZ  . TYR D 1 90  ? 17.020 25.138 -19.985 1.00 38.19  ? 1283 TYR D CZ  1 
ATOM   4941 O OH  . TYR D 1 90  ? 17.406 25.028 -18.672 1.00 36.41  ? 1283 TYR D OH  1 
ATOM   4942 N N   . ARG D 1 91  ? 15.369 27.078 -26.954 1.00 39.73  ? 1284 ARG D N   1 
ATOM   4943 C CA  . ARG D 1 91  ? 15.079 26.966 -28.377 1.00 40.26  ? 1284 ARG D CA  1 
ATOM   4944 C C   . ARG D 1 91  ? 16.130 27.707 -29.184 1.00 47.50  ? 1284 ARG D C   1 
ATOM   4945 O O   . ARG D 1 91  ? 16.668 27.178 -30.162 1.00 51.66  ? 1284 ARG D O   1 
ATOM   4946 C CB  . ARG D 1 91  ? 13.696 27.535 -28.680 1.00 43.74  ? 1284 ARG D CB  1 
ATOM   4947 C CG  . ARG D 1 91  ? 13.318 27.510 -30.148 1.00 42.27  ? 1284 ARG D CG  1 
ATOM   4948 C CD  . ARG D 1 91  ? 11.950 28.148 -30.343 1.00 53.75  ? 1284 ARG D CD  1 
ATOM   4949 N NE  . ARG D 1 91  ? 11.972 29.590 -30.106 1.00 62.86  ? 1284 ARG D NE  1 
ATOM   4950 C CZ  . ARG D 1 91  ? 10.888 30.327 -29.876 1.00 78.70  ? 1284 ARG D CZ  1 
ATOM   4951 N NH1 . ARG D 1 91  ? 9.681  29.759 -29.839 1.00 48.97  ? 1284 ARG D NH1 1 
ATOM   4952 N NH2 . ARG D 1 91  ? 11.013 31.634 -29.671 1.00 70.10  ? 1284 ARG D NH2 1 
ATOM   4953 N N   . VAL D 1 92  ? 16.409 28.939 -28.766 1.00 42.88  ? 1285 VAL D N   1 
ATOM   4954 C CA  . VAL D 1 92  ? 17.497 29.734 -29.328 1.00 52.32  ? 1285 VAL D CA  1 
ATOM   4955 C C   . VAL D 1 92  ? 18.859 29.085 -29.039 1.00 61.05  ? 1285 VAL D C   1 
ATOM   4956 O O   . VAL D 1 92  ? 19.156 28.703 -27.900 1.00 57.04  ? 1285 VAL D O   1 
ATOM   4957 C CB  . VAL D 1 92  ? 17.498 31.172 -28.753 1.00 44.25  ? 1285 VAL D CB  1 
ATOM   4958 C CG1 . VAL D 1 92  ? 18.723 31.921 -29.217 1.00 45.79  ? 1285 VAL D CG1 1 
ATOM   4959 C CG2 . VAL D 1 92  ? 16.219 31.913 -29.138 1.00 33.23  ? 1285 VAL D CG2 1 
ATOM   4960 N N   . SER D 1 93  ? 19.685 28.949 -30.071 1.00 75.39  ? 1286 SER D N   1 
ATOM   4961 C CA  . SER D 1 93  ? 21.025 28.410 -29.876 1.00 79.03  ? 1286 SER D CA  1 
ATOM   4962 C C   . SER D 1 93  ? 21.966 29.548 -29.518 1.00 81.98  ? 1286 SER D C   1 
ATOM   4963 O O   . SER D 1 93  ? 21.800 30.675 -29.990 1.00 73.45  ? 1286 SER D O   1 
ATOM   4964 C CB  . SER D 1 93  ? 21.516 27.678 -31.126 1.00 80.88  ? 1286 SER D CB  1 
ATOM   4965 N N   . GLY D 1 94  ? 22.950 29.252 -28.680 1.00 79.70  ? 1287 GLY D N   1 
ATOM   4966 C CA  . GLY D 1 94  ? 23.870 30.273 -28.223 1.00 82.02  ? 1287 GLY D CA  1 
ATOM   4967 C C   . GLY D 1 94  ? 25.233 30.198 -28.881 1.00 71.53  ? 1287 GLY D C   1 
ATOM   4968 O O   . GLY D 1 94  ? 25.501 29.316 -29.704 1.00 62.42  ? 1287 GLY D O   1 
ATOM   4969 N N   . ASN D 1 95  ? 26.098 31.134 -28.509 1.00 52.18  ? 1288 ASN D N   1 
ATOM   4970 C CA  . ASN D 1 95  ? 27.460 31.147 -29.007 1.00 75.23  ? 1288 ASN D CA  1 
ATOM   4971 C C   . ASN D 1 95  ? 28.190 29.834 -28.676 1.00 72.95  ? 1288 ASN D C   1 
ATOM   4972 O O   . ASN D 1 95  ? 28.433 29.518 -27.507 1.00 63.30  ? 1288 ASN D O   1 
ATOM   4973 C CB  . ASN D 1 95  ? 28.209 32.364 -28.445 1.00 69.90  ? 1288 ASN D CB  1 
ATOM   4974 C CG  . ASN D 1 95  ? 29.510 32.642 -29.175 1.00 79.48  ? 1288 ASN D CG  1 
ATOM   4975 O OD1 . ASN D 1 95  ? 30.524 31.988 -28.934 1.00 79.72  ? 1288 ASN D OD1 1 
ATOM   4976 N ND2 . ASN D 1 95  ? 29.487 33.622 -30.069 1.00 91.52  ? 1288 ASN D ND2 1 
ATOM   4977 N N   . LYS D 1 96  ? 28.525 29.065 -29.709 1.00 68.75  ? 1289 LYS D N   1 
ATOM   4978 C CA  . LYS D 1 96  ? 29.232 27.804 -29.510 1.00 67.23  ? 1289 LYS D CA  1 
ATOM   4979 C C   . LYS D 1 96  ? 30.571 28.022 -28.802 1.00 70.94  ? 1289 LYS D C   1 
ATOM   4980 O O   . LYS D 1 96  ? 30.993 27.185 -28.000 1.00 73.74  ? 1289 LYS D O   1 
ATOM   4981 C CB  . LYS D 1 96  ? 29.439 27.066 -30.839 1.00 52.17  ? 1289 LYS D CB  1 
ATOM   4982 N N   . SER D 1 97  ? 31.235 29.140 -29.098 1.00 61.10  ? 1290 SER D N   1 
ATOM   4983 C CA  . SER D 1 97  ? 32.500 29.458 -28.447 1.00 62.33  ? 1290 SER D CA  1 
ATOM   4984 C C   . SER D 1 97  ? 32.284 29.709 -26.951 1.00 69.68  ? 1290 SER D C   1 
ATOM   4985 O O   . SER D 1 97  ? 33.048 29.222 -26.110 1.00 66.19  ? 1290 SER D O   1 
ATOM   4986 C CB  . SER D 1 97  ? 33.171 30.664 -29.109 1.00 55.69  ? 1290 SER D CB  1 
ATOM   4987 N N   . GLU D 1 98  ? 31.229 30.450 -26.622 1.00 60.20  ? 1291 GLU D N   1 
ATOM   4988 C CA  . GLU D 1 98  ? 30.955 30.800 -25.232 1.00 59.92  ? 1291 GLU D CA  1 
ATOM   4989 C C   . GLU D 1 98  ? 30.583 29.585 -24.381 1.00 66.27  ? 1291 GLU D C   1 
ATOM   4990 O O   . GLU D 1 98  ? 30.841 29.562 -23.175 1.00 58.39  ? 1291 GLU D O   1 
ATOM   4991 C CB  . GLU D 1 98  ? 29.865 31.874 -25.150 1.00 61.54  ? 1291 GLU D CB  1 
ATOM   4992 C CG  . GLU D 1 98  ? 30.304 33.245 -25.650 1.00 69.31  ? 1291 GLU D CG  1 
ATOM   4993 C CD  . GLU D 1 98  ? 31.515 33.800 -24.910 1.00 108.48 ? 1291 GLU D CD  1 
ATOM   4994 O OE1 . GLU D 1 98  ? 31.320 34.424 -23.840 1.00 96.99  ? 1291 GLU D OE1 1 
ATOM   4995 O OE2 . GLU D 1 98  ? 32.657 33.628 -25.412 1.00 97.56  ? 1291 GLU D OE2 1 
ATOM   4996 N N   . MET D 1 99  ? 29.983 28.576 -25.007 1.00 66.12  ? 1292 MET D N   1 
ATOM   4997 C CA  . MET D 1 99  ? 29.654 27.344 -24.299 1.00 54.60  ? 1292 MET D CA  1 
ATOM   4998 C C   . MET D 1 99  ? 30.901 26.507 -24.056 1.00 54.77  ? 1292 MET D C   1 
ATOM   4999 O O   . MET D 1 99  ? 31.135 26.038 -22.940 1.00 59.82  ? 1292 MET D O   1 
ATOM   5000 C CB  . MET D 1 99  ? 28.634 26.513 -25.076 1.00 58.70  ? 1292 MET D CB  1 
ATOM   5001 C CG  . MET D 1 99  ? 27.327 27.220 -25.365 1.00 58.47  ? 1292 MET D CG  1 
ATOM   5002 S SD  . MET D 1 99  ? 26.187 26.093 -26.195 1.00 68.85  ? 1292 MET D SD  1 
ATOM   5003 C CE  . MET D 1 99  ? 25.204 27.257 -27.138 1.00 55.37  ? 1292 MET D CE  1 
ATOM   5004 N N   . GLU D 1 100 ? 31.688 26.304 -25.108 0.50 43.32  ? 1293 GLU D N   1 
ATOM   5005 C CA  . GLU D 1 100 ? 32.919 25.541 -24.991 0.50 40.82  ? 1293 GLU D CA  1 
ATOM   5006 C C   . GLU D 1 100 ? 33.751 26.181 -23.890 0.50 51.31  ? 1293 GLU D C   1 
ATOM   5007 O O   . GLU D 1 100 ? 34.403 25.499 -23.092 0.50 44.81  ? 1293 GLU D O   1 
ATOM   5008 C CB  . GLU D 1 100 ? 33.680 25.549 -26.315 0.50 39.34  ? 1293 GLU D CB  1 
ATOM   5009 N N   . SER D 1 101 ? 33.702 27.507 -23.849 1.00 49.42  ? 1294 SER D N   1 
ATOM   5010 C CA  . SER D 1 101 ? 34.385 28.276 -22.819 1.00 53.18  ? 1294 SER D CA  1 
ATOM   5011 C C   . SER D 1 101 ? 33.853 27.929 -21.429 1.00 58.34  ? 1294 SER D C   1 
ATOM   5012 O O   . SER D 1 101 ? 34.620 27.522 -20.553 1.00 58.97  ? 1294 SER D O   1 
ATOM   5013 C CB  . SER D 1 101 ? 34.235 29.779 -23.089 1.00 56.37  ? 1294 SER D CB  1 
ATOM   5014 O OG  . SER D 1 101 ? 34.782 30.545 -22.027 1.00 70.28  ? 1294 SER D OG  1 
ATOM   5015 N N   . LEU D 1 102 ? 32.543 28.092 -21.235 1.00 50.55  ? 1295 LEU D N   1 
ATOM   5016 C CA  . LEU D 1 102 ? 31.904 27.771 -19.958 1.00 52.50  ? 1295 LEU D CA  1 
ATOM   5017 C C   . LEU D 1 102 ? 32.247 26.350 -19.497 1.00 51.31  ? 1295 LEU D C   1 
ATOM   5018 O O   . LEU D 1 102 ? 32.544 26.120 -18.324 1.00 42.64  ? 1295 LEU D O   1 
ATOM   5019 C CB  . LEU D 1 102 ? 30.380 27.966 -20.044 1.00 51.69  ? 1295 LEU D CB  1 
ATOM   5020 C CG  . LEU D 1 102 ? 29.512 27.559 -18.835 1.00 50.12  ? 1295 LEU D CG  1 
ATOM   5021 C CD1 . LEU D 1 102 ? 30.170 27.965 -17.543 1.00 60.61  ? 1295 LEU D CD1 1 
ATOM   5022 C CD2 . LEU D 1 102 ? 28.096 28.142 -18.901 1.00 41.16  ? 1295 LEU D CD2 1 
ATOM   5023 N N   . GLN D 1 103 ? 32.212 25.403 -20.429 1.00 50.88  ? 1296 GLN D N   1 
ATOM   5024 C CA  . GLN D 1 103 ? 32.505 24.016 -20.107 1.00 55.32  ? 1296 GLN D CA  1 
ATOM   5025 C C   . GLN D 1 103 ? 33.964 23.861 -19.724 1.00 60.24  ? 1296 GLN D C   1 
ATOM   5026 O O   . GLN D 1 103 ? 34.284 23.203 -18.731 1.00 64.20  ? 1296 GLN D O   1 
ATOM   5027 C CB  . GLN D 1 103 ? 32.152 23.094 -21.278 1.00 54.78  ? 1296 GLN D CB  1 
ATOM   5028 C CG  . GLN D 1 103 ? 30.670 22.763 -21.390 1.00 64.81  ? 1296 GLN D CG  1 
ATOM   5029 C CD  . GLN D 1 103 ? 30.337 21.981 -22.646 1.00 69.82  ? 1296 GLN D CD  1 
ATOM   5030 O OE1 . GLN D 1 103 ? 30.540 22.462 -23.764 1.00 71.64  ? 1296 GLN D OE1 1 
ATOM   5031 N NE2 . GLN D 1 103 ? 29.813 20.773 -22.469 1.00 52.30  ? 1296 GLN D NE2 1 
ATOM   5032 N N   . ARG D 1 104 ? 34.847 24.471 -20.510 1.00 55.77  ? 1297 ARG D N   1 
ATOM   5033 C CA  . ARG D 1 104 ? 36.278 24.422 -20.223 1.00 58.85  ? 1297 ARG D CA  1 
ATOM   5034 C C   . ARG D 1 104 ? 36.575 25.015 -18.840 1.00 57.32  ? 1297 ARG D C   1 
ATOM   5035 O O   . ARG D 1 104 ? 37.243 24.389 -18.015 1.00 60.42  ? 1297 ARG D O   1 
ATOM   5036 C CB  . ARG D 1 104 ? 37.081 25.144 -21.314 1.00 51.82  ? 1297 ARG D CB  1 
ATOM   5037 N N   . GLN D 1 105 ? 36.059 26.214 -18.587 1.00 54.45  ? 1298 GLN D N   1 
ATOM   5038 C CA  . GLN D 1 105 ? 36.282 26.890 -17.312 1.00 61.56  ? 1298 GLN D CA  1 
ATOM   5039 C C   . GLN D 1 105 ? 35.744 26.096 -16.121 1.00 66.13  ? 1298 GLN D C   1 
ATOM   5040 O O   . GLN D 1 105 ? 36.350 26.092 -15.046 1.00 71.11  ? 1298 GLN D O   1 
ATOM   5041 C CB  . GLN D 1 105 ? 35.659 28.286 -17.321 1.00 55.95  ? 1298 GLN D CB  1 
ATOM   5042 C CG  . GLN D 1 105 ? 36.164 29.191 -18.431 1.00 54.76  ? 1298 GLN D CG  1 
ATOM   5043 C CD  . GLN D 1 105 ? 35.910 30.651 -18.128 1.00 66.53  ? 1298 GLN D CD  1 
ATOM   5044 O OE1 . GLN D 1 105 ? 36.110 31.097 -16.996 1.00 52.26  ? 1298 GLN D OE1 1 
ATOM   5045 N NE2 . GLN D 1 105 ? 35.466 31.405 -19.133 1.00 56.27  ? 1298 GLN D NE2 1 
ATOM   5046 N N   . PHE D 1 106 ? 34.600 25.441 -16.303 1.00 64.97  ? 1299 PHE D N   1 
ATOM   5047 C CA  . PHE D 1 106 ? 34.047 24.614 -15.242 1.00 60.58  ? 1299 PHE D CA  1 
ATOM   5048 C C   . PHE D 1 106 ? 34.953 23.410 -15.041 1.00 64.11  ? 1299 PHE D C   1 
ATOM   5049 O O   . PHE D 1 106 ? 35.193 22.971 -13.913 1.00 75.02  ? 1299 PHE D O   1 
ATOM   5050 C CB  . PHE D 1 106 ? 32.627 24.146 -15.567 1.00 55.32  ? 1299 PHE D CB  1 
ATOM   5051 C CG  . PHE D 1 106 ? 32.050 23.235 -14.519 1.00 59.54  ? 1299 PHE D CG  1 
ATOM   5052 C CD1 . PHE D 1 106 ? 32.293 21.867 -14.559 1.00 52.76  ? 1299 PHE D CD1 1 
ATOM   5053 C CD2 . PHE D 1 106 ? 31.296 23.748 -13.472 1.00 43.09  ? 1299 PHE D CD2 1 
ATOM   5054 C CE1 . PHE D 1 106 ? 31.781 21.027 -13.584 1.00 54.90  ? 1299 PHE D CE1 1 
ATOM   5055 C CE2 . PHE D 1 106 ? 30.778 22.915 -12.503 1.00 54.46  ? 1299 PHE D CE2 1 
ATOM   5056 C CZ  . PHE D 1 106 ? 31.021 21.551 -12.556 1.00 57.16  ? 1299 PHE D CZ  1 
ATOM   5057 N N   . ASP D 1 107 ? 35.457 22.884 -16.149 1.00 54.24  ? 1300 ASP D N   1 
ATOM   5058 C CA  . ASP D 1 107 ? 36.346 21.741 -16.113 1.00 64.04  ? 1300 ASP D CA  1 
ATOM   5059 C C   . ASP D 1 107 ? 37.548 22.036 -15.221 1.00 68.12  ? 1300 ASP D C   1 
ATOM   5060 O O   . ASP D 1 107 ? 38.037 21.156 -14.513 1.00 72.70  ? 1300 ASP D O   1 
ATOM   5061 C CB  . ASP D 1 107 ? 36.806 21.390 -17.528 1.00 56.92  ? 1300 ASP D CB  1 
ATOM   5062 C CG  . ASP D 1 107 ? 37.027 19.905 -17.713 1.00 75.20  ? 1300 ASP D CG  1 
ATOM   5063 O OD1 . ASP D 1 107 ? 36.805 19.138 -16.747 1.00 79.08  ? 1300 ASP D OD1 1 
ATOM   5064 O OD2 . ASP D 1 107 ? 37.419 19.506 -18.831 1.00 83.22  ? 1300 ASP D OD2 1 
ATOM   5065 N N   . GLN D 1 108 ? 38.017 23.279 -15.251 1.00 57.39  ? 1301 GLN D N   1 
ATOM   5066 C CA  . GLN D 1 108 ? 39.166 23.677 -14.443 1.00 60.54  ? 1301 GLN D CA  1 
ATOM   5067 C C   . GLN D 1 108 ? 38.847 23.678 -12.948 1.00 83.09  ? 1301 GLN D C   1 
ATOM   5068 O O   . GLN D 1 108 ? 39.524 23.001 -12.173 1.00 97.39  ? 1301 GLN D O   1 
ATOM   5069 C CB  . GLN D 1 108 ? 39.710 25.030 -14.896 1.00 67.28  ? 1301 GLN D CB  1 
ATOM   5070 C CG  . GLN D 1 108 ? 40.326 24.991 -16.287 1.00 72.86  ? 1301 GLN D CG  1 
ATOM   5071 C CD  . GLN D 1 108 ? 41.004 26.295 -16.667 1.00 91.48  ? 1301 GLN D CD  1 
ATOM   5072 O OE1 . GLN D 1 108 ? 41.712 26.900 -15.856 1.00 83.95  ? 1301 GLN D OE1 1 
ATOM   5073 N NE2 . GLN D 1 108 ? 40.796 26.731 -17.911 1.00 74.83  ? 1301 GLN D NE2 1 
ATOM   5074 N N   . ASP D 1 109 ? 37.829 24.428 -12.532 1.00 74.33  ? 1302 ASP D N   1 
ATOM   5075 C CA  . ASP D 1 109 ? 37.331 24.274 -11.162 1.00 84.24  ? 1302 ASP D CA  1 
ATOM   5076 C C   . ASP D 1 109 ? 35.799 24.204 -11.084 1.00 75.74  ? 1302 ASP D C   1 
ATOM   5077 O O   . ASP D 1 109 ? 35.083 24.942 -11.767 1.00 67.14  ? 1302 ASP D O   1 
ATOM   5078 C CB  . ASP D 1 109 ? 37.963 25.291 -10.184 1.00 85.17  ? 1302 ASP D CB  1 
ATOM   5079 C CG  . ASP D 1 109 ? 37.072 26.492 -9.896  1.00 81.41  ? 1302 ASP D CG  1 
ATOM   5080 O OD1 . ASP D 1 109 ? 37.043 27.438 -10.714 1.00 52.98  ? 1302 ASP D OD1 1 
ATOM   5081 O OD2 . ASP D 1 109 ? 36.437 26.506 -8.817  1.00 82.05  ? 1302 ASP D OD2 1 
ATOM   5082 N N   . HIS D 1 110 ? 35.320 23.284 -10.254 1.00 77.21  ? 1303 HIS D N   1 
ATOM   5083 C CA  . HIS D 1 110 ? 33.909 22.928 -10.185 1.00 70.75  ? 1303 HIS D CA  1 
ATOM   5084 C C   . HIS D 1 110 ? 33.093 23.881 -9.323  1.00 72.21  ? 1303 HIS D C   1 
ATOM   5085 O O   . HIS D 1 110 ? 31.871 23.749 -9.223  1.00 77.03  ? 1303 HIS D O   1 
ATOM   5086 C CB  . HIS D 1 110 ? 33.779 21.500 -9.654  1.00 66.24  ? 1303 HIS D CB  1 
ATOM   5087 C CG  . HIS D 1 110 ? 34.341 20.469 -10.581 1.00 71.91  ? 1303 HIS D CG  1 
ATOM   5088 N ND1 . HIS D 1 110 ? 35.067 20.801 -11.708 1.00 68.80  ? 1303 HIS D ND1 1 
ATOM   5089 C CD2 . HIS D 1 110 ? 34.299 19.117 -10.542 1.00 59.93  ? 1303 HIS D CD2 1 
ATOM   5090 C CE1 . HIS D 1 110 ? 35.429 19.696 -12.335 1.00 74.23  ? 1303 HIS D CE1 1 
ATOM   5091 N NE2 . HIS D 1 110 ? 34.978 18.660 -11.647 1.00 84.60  ? 1303 HIS D NE2 1 
ATOM   5092 N N   . ASN D 1 111 ? 33.773 24.837 -8.700  1.00 73.08  ? 1304 ASN D N   1 
ATOM   5093 C CA  . ASN D 1 111 ? 33.096 25.829 -7.876  1.00 85.20  ? 1304 ASN D CA  1 
ATOM   5094 C C   . ASN D 1 111 ? 32.799 27.089 -8.680  1.00 74.67  ? 1304 ASN D C   1 
ATOM   5095 O O   . ASN D 1 111 ? 32.387 28.112 -8.127  1.00 75.98  ? 1304 ASN D O   1 
ATOM   5096 C CB  . ASN D 1 111 ? 33.918 26.154 -6.625  1.00 76.13  ? 1304 ASN D CB  1 
ATOM   5097 N N   . LEU D 1 112 ? 33.002 26.999 -9.992  1.00 67.23  ? 1305 LEU D N   1 
ATOM   5098 C CA  . LEU D 1 112 ? 32.751 28.120 -10.893 1.00 69.70  ? 1305 LEU D CA  1 
ATOM   5099 C C   . LEU D 1 112 ? 31.432 28.803 -10.566 1.00 72.22  ? 1305 LEU D C   1 
ATOM   5100 O O   . LEU D 1 112 ? 30.418 28.136 -10.355 1.00 85.31  ? 1305 LEU D O   1 
ATOM   5101 C CB  . LEU D 1 112 ? 32.728 27.647 -12.346 1.00 60.86  ? 1305 LEU D CB  1 
ATOM   5102 C CG  . LEU D 1 112 ? 32.529 28.756 -13.380 1.00 65.36  ? 1305 LEU D CG  1 
ATOM   5103 C CD1 . LEU D 1 112 ? 33.803 29.565 -13.528 1.00 77.60  ? 1305 LEU D CD1 1 
ATOM   5104 C CD2 . LEU D 1 112 ? 32.118 28.180 -14.717 1.00 54.43  ? 1305 LEU D CD2 1 
ATOM   5105 N N   . ASP D 1 113 ? 31.449 30.130 -10.519 1.00 58.87  ? 1306 ASP D N   1 
ATOM   5106 C CA  . ASP D 1 113 ? 30.236 30.890 -10.238 1.00 80.63  ? 1306 ASP D CA  1 
ATOM   5107 C C   . ASP D 1 113 ? 29.782 31.631 -11.489 1.00 75.55  ? 1306 ASP D C   1 
ATOM   5108 O O   . ASP D 1 113 ? 30.429 32.579 -11.929 1.00 76.66  ? 1306 ASP D O   1 
ATOM   5109 C CB  . ASP D 1 113 ? 30.463 31.864 -9.076  1.00 81.29  ? 1306 ASP D CB  1 
ATOM   5110 C CG  . ASP D 1 113 ? 29.164 32.350 -8.452  1.00 86.65  ? 1306 ASP D CG  1 
ATOM   5111 O OD1 . ASP D 1 113 ? 28.251 32.751 -9.200  1.00 101.58 ? 1306 ASP D OD1 1 
ATOM   5112 O OD2 . ASP D 1 113 ? 29.057 32.339 -7.208  1.00 78.64  ? 1306 ASP D OD2 1 
ATOM   5113 N N   . LEU D 1 114 ? 28.668 31.188 -12.063 1.00 74.82  ? 1307 LEU D N   1 
ATOM   5114 C CA  . LEU D 1 114 ? 28.174 31.763 -13.313 1.00 82.08  ? 1307 LEU D CA  1 
ATOM   5115 C C   . LEU D 1 114 ? 27.780 33.227 -13.142 1.00 75.75  ? 1307 LEU D C   1 
ATOM   5116 O O   . LEU D 1 114 ? 27.784 33.995 -14.108 1.00 79.22  ? 1307 LEU D O   1 
ATOM   5117 C CB  . LEU D 1 114 ? 26.997 30.948 -13.861 1.00 65.78  ? 1307 LEU D CB  1 
ATOM   5118 C CG  . LEU D 1 114 ? 27.200 29.431 -13.884 1.00 58.65  ? 1307 LEU D CG  1 
ATOM   5119 C CD1 . LEU D 1 114 ? 25.928 28.731 -14.315 1.00 37.60  ? 1307 LEU D CD1 1 
ATOM   5120 C CD2 . LEU D 1 114 ? 28.360 29.066 -14.786 1.00 35.04  ? 1307 LEU D CD2 1 
ATOM   5121 N N   . ALA D 1 115 ? 27.437 33.605 -11.913 1.00 77.04  ? 1308 ALA D N   1 
ATOM   5122 C CA  . ALA D 1 115 ? 27.132 34.997 -11.596 1.00 84.72  ? 1308 ALA D CA  1 
ATOM   5123 C C   . ALA D 1 115 ? 28.355 35.876 -11.857 1.00 88.74  ? 1308 ALA D C   1 
ATOM   5124 O O   . ALA D 1 115 ? 28.288 36.857 -12.601 1.00 82.46  ? 1308 ALA D O   1 
ATOM   5125 C CB  . ALA D 1 115 ? 26.673 35.130 -10.143 1.00 62.40  ? 1308 ALA D CB  1 
ATOM   5126 N N   . GLU D 1 116 ? 29.479 35.497 -11.258 1.00 81.91  ? 1309 GLU D N   1 
ATOM   5127 C CA  . GLU D 1 116 ? 30.715 36.266 -11.365 1.00 86.06  ? 1309 GLU D CA  1 
ATOM   5128 C C   . GLU D 1 116 ? 31.395 36.177 -12.738 1.00 78.45  ? 1309 GLU D C   1 
ATOM   5129 O O   . GLU D 1 116 ? 32.529 36.631 -12.892 1.00 83.50  ? 1309 GLU D O   1 
ATOM   5130 C CB  . GLU D 1 116 ? 31.701 35.837 -10.263 1.00 61.28  ? 1309 GLU D CB  1 
ATOM   5131 N N   . LYS D 1 117 ? 30.719 35.605 -13.732 1.00 67.89  ? 1310 LYS D N   1 
ATOM   5132 C CA  . LYS D 1 117 ? 31.381 35.322 -15.010 1.00 72.35  ? 1310 LYS D CA  1 
ATOM   5133 C C   . LYS D 1 117 ? 30.677 35.918 -16.241 1.00 76.54  ? 1310 LYS D C   1 
ATOM   5134 O O   . LYS D 1 117 ? 31.158 35.770 -17.374 1.00 66.47  ? 1310 LYS D O   1 
ATOM   5135 C CB  . LYS D 1 117 ? 31.626 33.812 -15.175 1.00 37.41  ? 1310 LYS D CB  1 
ATOM   5136 N N   . ASP D 1 118 ? 29.553 36.598 -16.008 1.00 72.89  ? 1311 ASP D N   1 
ATOM   5137 C CA  . ASP D 1 118 ? 28.831 37.327 -17.064 1.00 91.99  ? 1311 ASP D CA  1 
ATOM   5138 C C   . ASP D 1 118 ? 28.521 36.509 -18.332 1.00 83.97  ? 1311 ASP D C   1 
ATOM   5139 O O   . ASP D 1 118 ? 28.764 36.975 -19.450 1.00 67.09  ? 1311 ASP D O   1 
ATOM   5140 C CB  . ASP D 1 118 ? 29.575 38.623 -17.438 1.00 61.75  ? 1311 ASP D CB  1 
ATOM   5141 N N   . PHE D 1 119 ? 27.975 35.305 -18.156 1.00 71.15  ? 1312 PHE D N   1 
ATOM   5142 C CA  . PHE D 1 119 ? 27.586 34.471 -19.287 1.00 51.30  ? 1312 PHE D CA  1 
ATOM   5143 C C   . PHE D 1 119 ? 26.145 34.761 -19.700 1.00 63.65  ? 1312 PHE D C   1 
ATOM   5144 O O   . PHE D 1 119 ? 25.270 34.935 -18.844 1.00 61.57  ? 1312 PHE D O   1 
ATOM   5145 C CB  . PHE D 1 119 ? 27.712 32.994 -18.933 1.00 52.44  ? 1312 PHE D CB  1 
ATOM   5146 C CG  . PHE D 1 119 ? 29.094 32.431 -19.107 1.00 49.92  ? 1312 PHE D CG  1 
ATOM   5147 C CD1 . PHE D 1 119 ? 29.794 31.937 -18.018 1.00 52.26  ? 1312 PHE D CD1 1 
ATOM   5148 C CD2 . PHE D 1 119 ? 29.684 32.370 -20.354 1.00 49.64  ? 1312 PHE D CD2 1 
ATOM   5149 C CE1 . PHE D 1 119 ? 31.068 31.400 -18.163 1.00 41.35  ? 1312 PHE D CE1 1 
ATOM   5150 C CE2 . PHE D 1 119 ? 30.961 31.839 -20.507 1.00 52.51  ? 1312 PHE D CE2 1 
ATOM   5151 C CZ  . PHE D 1 119 ? 31.651 31.348 -19.405 1.00 45.38  ? 1312 PHE D CZ  1 
ATOM   5152 N N   . THR D 1 120 ? 25.903 34.811 -21.010 1.00 63.66  ? 1313 THR D N   1 
ATOM   5153 C CA  . THR D 1 120 ? 24.549 34.926 -21.546 1.00 55.49  ? 1313 THR D CA  1 
ATOM   5154 C C   . THR D 1 120 ? 23.701 33.798 -20.962 1.00 64.51  ? 1313 THR D C   1 
ATOM   5155 O O   . THR D 1 120 ? 24.202 32.689 -20.745 1.00 64.56  ? 1313 THR D O   1 
ATOM   5156 C CB  . THR D 1 120 ? 24.542 34.785 -23.089 1.00 68.66  ? 1313 THR D CB  1 
ATOM   5157 O OG1 . THR D 1 120 ? 25.705 35.412 -23.646 1.00 82.15  ? 1313 THR D OG1 1 
ATOM   5158 C CG2 . THR D 1 120 ? 23.279 35.403 -23.703 1.00 76.27  ? 1313 THR D CG2 1 
ATOM   5159 N N   . VAL D 1 121 ? 22.425 34.071 -20.704 1.00 66.41  ? 1314 VAL D N   1 
ATOM   5160 C CA  . VAL D 1 121 ? 21.513 33.031 -20.221 1.00 52.58  ? 1314 VAL D CA  1 
ATOM   5161 C C   . VAL D 1 121 ? 21.401 31.894 -21.251 1.00 51.23  ? 1314 VAL D C   1 
ATOM   5162 O O   . VAL D 1 121 ? 21.402 30.715 -20.890 1.00 45.77  ? 1314 VAL D O   1 
ATOM   5163 C CB  . VAL D 1 121 ? 20.117 33.617 -19.866 1.00 52.00  ? 1314 VAL D CB  1 
ATOM   5164 C CG1 . VAL D 1 121 ? 19.486 34.282 -21.083 1.00 71.81  ? 1314 VAL D CG1 1 
ATOM   5165 C CG2 . VAL D 1 121 ? 19.200 32.549 -19.299 1.00 50.08  ? 1314 VAL D CG2 1 
ATOM   5166 N N   . ASN D 1 122 ? 21.327 32.260 -22.532 1.00 55.33  ? 1315 ASN D N   1 
ATOM   5167 C CA  . ASN D 1 122 ? 21.307 31.288 -23.626 1.00 49.06  ? 1315 ASN D CA  1 
ATOM   5168 C C   . ASN D 1 122 ? 22.576 30.450 -23.688 1.00 48.04  ? 1315 ASN D C   1 
ATOM   5169 O O   . ASN D 1 122 ? 22.544 29.272 -24.047 1.00 51.76  ? 1315 ASN D O   1 
ATOM   5170 C CB  . ASN D 1 122 ? 21.080 31.989 -24.964 1.00 43.11  ? 1315 ASN D CB  1 
ATOM   5171 C CG  . ASN D 1 122 ? 19.621 32.277 -25.223 1.00 55.61  ? 1315 ASN D CG  1 
ATOM   5172 O OD1 . ASN D 1 122 ? 18.756 31.420 -24.998 1.00 63.89  ? 1315 ASN D OD1 1 
ATOM   5173 N ND2 . ASN D 1 122 ? 19.332 33.483 -25.702 1.00 39.80  ? 1315 ASN D ND2 1 
ATOM   5174 N N   . THR D 1 123 ? 23.698 31.063 -23.341 1.00 51.88  ? 1316 THR D N   1 
ATOM   5175 C CA  . THR D 1 123 ? 24.962 30.344 -23.321 1.00 52.61  ? 1316 THR D CA  1 
ATOM   5176 C C   . THR D 1 123 ? 24.927 29.250 -22.257 1.00 48.37  ? 1316 THR D C   1 
ATOM   5177 O O   . THR D 1 123 ? 25.349 28.118 -22.509 1.00 42.77  ? 1316 THR D O   1 
ATOM   5178 C CB  . THR D 1 123 ? 26.148 31.307 -23.098 1.00 50.98  ? 1316 THR D CB  1 
ATOM   5179 O OG1 . THR D 1 123 ? 26.260 32.178 -24.232 1.00 59.53  ? 1316 THR D OG1 1 
ATOM   5180 C CG2 . THR D 1 123 ? 27.452 30.536 -22.923 1.00 37.03  ? 1316 THR D CG2 1 
ATOM   5181 N N   . VAL D 1 124 ? 24.405 29.591 -21.079 1.00 44.14  ? 1317 VAL D N   1 
ATOM   5182 C CA  . VAL D 1 124 ? 24.306 28.635 -19.983 1.00 39.78  ? 1317 VAL D CA  1 
ATOM   5183 C C   . VAL D 1 124 ? 23.269 27.562 -20.277 1.00 46.01  ? 1317 VAL D C   1 
ATOM   5184 O O   . VAL D 1 124 ? 23.456 26.396 -19.916 1.00 41.57  ? 1317 VAL D O   1 
ATOM   5185 C CB  . VAL D 1 124 ? 23.927 29.316 -18.674 1.00 42.83  ? 1317 VAL D CB  1 
ATOM   5186 C CG1 . VAL D 1 124 ? 23.769 28.269 -17.567 1.00 42.48  ? 1317 VAL D CG1 1 
ATOM   5187 C CG2 . VAL D 1 124 ? 24.966 30.361 -18.306 1.00 39.15  ? 1317 VAL D CG2 1 
ATOM   5188 N N   . ALA D 1 125 ? 22.177 27.960 -20.930 1.00 47.77  ? 1318 ALA D N   1 
ATOM   5189 C CA  . ALA D 1 125 ? 21.133 27.017 -21.314 1.00 32.83  ? 1318 ALA D CA  1 
ATOM   5190 C C   . ALA D 1 125 ? 21.674 26.016 -22.322 1.00 38.86  ? 1318 ALA D C   1 
ATOM   5191 O O   . ALA D 1 125 ? 21.507 24.804 -22.150 1.00 41.92  ? 1318 ALA D O   1 
ATOM   5192 C CB  . ALA D 1 125 ? 19.940 27.747 -21.871 1.00 38.24  ? 1318 ALA D CB  1 
ATOM   5193 N N   . GLY D 1 126 ? 22.337 26.526 -23.362 1.00 40.92  ? 1319 GLY D N   1 
ATOM   5194 C CA  . GLY D 1 126 ? 22.935 25.688 -24.388 1.00 40.58  ? 1319 GLY D CA  1 
ATOM   5195 C C   . GLY D 1 126 ? 24.040 24.791 -23.850 1.00 46.23  ? 1319 GLY D C   1 
ATOM   5196 O O   . GLY D 1 126 ? 24.240 23.675 -24.340 1.00 47.36  ? 1319 GLY D O   1 
ATOM   5197 N N   . ALA D 1 127 ? 24.760 25.281 -22.843 1.00 44.72  ? 1320 ALA D N   1 
ATOM   5198 C CA  . ALA D 1 127 ? 25.859 24.529 -22.247 1.00 46.73  ? 1320 ALA D CA  1 
ATOM   5199 C C   . ALA D 1 127 ? 25.316 23.397 -21.381 1.00 46.38  ? 1320 ALA D C   1 
ATOM   5200 O O   . ALA D 1 127 ? 25.959 22.355 -21.205 1.00 37.17  ? 1320 ALA D O   1 
ATOM   5201 C CB  . ALA D 1 127 ? 26.758 25.453 -21.432 1.00 41.84  ? 1320 ALA D CB  1 
ATOM   5202 N N   . MET D 1 128 ? 24.120 23.610 -20.846 1.00 41.76  ? 1321 MET D N   1 
ATOM   5203 C CA  . MET D 1 128 ? 23.465 22.597 -20.039 1.00 37.90  ? 1321 MET D CA  1 
ATOM   5204 C C   . MET D 1 128 ? 22.964 21.455 -20.940 1.00 42.84  ? 1321 MET D C   1 
ATOM   5205 O O   . MET D 1 128 ? 23.147 20.280 -20.618 1.00 36.78  ? 1321 MET D O   1 
ATOM   5206 C CB  . MET D 1 128 ? 22.344 23.235 -19.210 1.00 33.22  ? 1321 MET D CB  1 
ATOM   5207 C CG  . MET D 1 128 ? 21.597 22.289 -18.287 1.00 34.16  ? 1321 MET D CG  1 
ATOM   5208 S SD  . MET D 1 128 ? 20.087 21.638 -19.022 1.00 55.37  ? 1321 MET D SD  1 
ATOM   5209 C CE  . MET D 1 128 ? 19.578 20.472 -17.761 1.00 62.91  ? 1321 MET D CE  1 
ATOM   5210 N N   . LYS D 1 129 ? 22.351 21.796 -22.075 1.00 36.65  ? 1322 LYS D N   1 
ATOM   5211 C CA  . LYS D 1 129 ? 21.963 20.773 -23.050 1.00 41.45  ? 1322 LYS D CA  1 
ATOM   5212 C C   . LYS D 1 129 ? 23.188 20.018 -23.568 1.00 46.38  ? 1322 LYS D C   1 
ATOM   5213 O O   . LYS D 1 129 ? 23.161 18.792 -23.750 1.00 42.41  ? 1322 LYS D O   1 
ATOM   5214 C CB  . LYS D 1 129 ? 21.207 21.381 -24.239 1.00 36.71  ? 1322 LYS D CB  1 
ATOM   5215 C CG  . LYS D 1 129 ? 19.708 21.455 -24.059 1.00 38.66  ? 1322 LYS D CG  1 
ATOM   5216 C CD  . LYS D 1 129 ? 18.975 21.320 -25.381 1.00 34.38  ? 1322 LYS D CD  1 
ATOM   5217 C CE  . LYS D 1 129 ? 19.119 22.579 -26.238 1.00 54.05  ? 1322 LYS D CE  1 
ATOM   5218 N NZ  . LYS D 1 129 ? 18.673 22.357 -27.653 1.00 49.57  ? 1322 LYS D NZ  1 
ATOM   5219 N N   . SER D 1 130 ? 24.261 20.762 -23.811 1.00 39.68  ? 1323 SER D N   1 
ATOM   5220 C CA  . SER D 1 130 ? 25.470 20.178 -24.365 1.00 41.16  ? 1323 SER D CA  1 
ATOM   5221 C C   . SER D 1 130 ? 25.981 19.032 -23.493 1.00 42.73  ? 1323 SER D C   1 
ATOM   5222 O O   . SER D 1 130 ? 26.446 18.007 -23.999 1.00 35.85  ? 1323 SER D O   1 
ATOM   5223 C CB  . SER D 1 130 ? 26.545 21.248 -24.543 1.00 38.56  ? 1323 SER D CB  1 
ATOM   5224 O OG  . SER D 1 130 ? 27.625 20.750 -25.308 1.00 46.61  ? 1323 SER D OG  1 
ATOM   5225 N N   . PHE D 1 131 ? 25.888 19.201 -22.179 1.00 41.88  ? 1324 PHE D N   1 
ATOM   5226 C CA  . PHE D 1 131 ? 26.362 18.161 -21.280 1.00 39.94  ? 1324 PHE D CA  1 
ATOM   5227 C C   . PHE D 1 131 ? 25.668 16.848 -21.614 1.00 46.97  ? 1324 PHE D C   1 
ATOM   5228 O O   . PHE D 1 131 ? 26.293 15.782 -21.613 1.00 45.38  ? 1324 PHE D O   1 
ATOM   5229 C CB  . PHE D 1 131 ? 26.113 18.532 -19.818 1.00 38.37  ? 1324 PHE D CB  1 
ATOM   5230 C CG  . PHE D 1 131 ? 26.302 17.383 -18.873 1.00 34.70  ? 1324 PHE D CG  1 
ATOM   5231 C CD1 . PHE D 1 131 ? 27.544 17.101 -18.353 1.00 33.95  ? 1324 PHE D CD1 1 
ATOM   5232 C CD2 . PHE D 1 131 ? 25.239 16.575 -18.522 1.00 30.64  ? 1324 PHE D CD2 1 
ATOM   5233 C CE1 . PHE D 1 131 ? 27.721 16.033 -17.495 1.00 43.55  ? 1324 PHE D CE1 1 
ATOM   5234 C CE2 . PHE D 1 131 ? 25.409 15.509 -17.671 1.00 33.56  ? 1324 PHE D CE2 1 
ATOM   5235 C CZ  . PHE D 1 131 ? 26.647 15.237 -17.154 1.00 37.77  ? 1324 PHE D CZ  1 
ATOM   5236 N N   . PHE D 1 132 ? 24.372 16.935 -21.906 1.00 44.35  ? 1325 PHE D N   1 
ATOM   5237 C CA  . PHE D 1 132 ? 23.565 15.746 -22.133 1.00 37.24  ? 1325 PHE D CA  1 
ATOM   5238 C C   . PHE D 1 132 ? 23.821 15.130 -23.494 1.00 43.81  ? 1325 PHE D C   1 
ATOM   5239 O O   . PHE D 1 132 ? 23.820 13.903 -23.633 1.00 49.28  ? 1325 PHE D O   1 
ATOM   5240 C CB  . PHE D 1 132 ? 22.077 16.044 -21.930 1.00 36.63  ? 1325 PHE D CB  1 
ATOM   5241 C CG  . PHE D 1 132 ? 21.694 16.174 -20.487 1.00 37.08  ? 1325 PHE D CG  1 
ATOM   5242 C CD1 . PHE D 1 132 ? 21.814 15.090 -19.630 1.00 37.89  ? 1325 PHE D CD1 1 
ATOM   5243 C CD2 . PHE D 1 132 ? 21.248 17.380 -19.976 1.00 38.34  ? 1325 PHE D CD2 1 
ATOM   5244 C CE1 . PHE D 1 132 ? 21.483 15.197 -18.291 1.00 36.56  ? 1325 PHE D CE1 1 
ATOM   5245 C CE2 . PHE D 1 132 ? 20.912 17.497 -18.641 1.00 33.45  ? 1325 PHE D CE2 1 
ATOM   5246 C CZ  . PHE D 1 132 ? 21.032 16.403 -17.796 1.00 45.87  ? 1325 PHE D CZ  1 
ATOM   5247 N N   . SER D 1 133 ? 24.051 15.971 -24.498 1.00 47.27  ? 1326 SER D N   1 
ATOM   5248 C CA  . SER D 1 133 ? 24.364 15.453 -25.831 1.00 49.45  ? 1326 SER D CA  1 
ATOM   5249 C C   . SER D 1 133 ? 25.802 14.949 -25.906 1.00 37.08  ? 1326 SER D C   1 
ATOM   5250 O O   . SER D 1 133 ? 26.172 14.269 -26.850 1.00 45.90  ? 1326 SER D O   1 
ATOM   5251 C CB  . SER D 1 133 ? 24.089 16.499 -26.918 1.00 39.36  ? 1326 SER D CB  1 
ATOM   5252 O OG  . SER D 1 133 ? 24.490 17.789 -26.492 1.00 52.68  ? 1326 SER D OG  1 
ATOM   5253 N N   . GLU D 1 134 ? 26.604 15.275 -24.899 1.00 42.12  ? 1327 GLU D N   1 
ATOM   5254 C CA  . GLU D 1 134 ? 27.983 14.804 -24.847 1.00 47.18  ? 1327 GLU D CA  1 
ATOM   5255 C C   . GLU D 1 134 ? 28.121 13.493 -24.072 1.00 52.99  ? 1327 GLU D C   1 
ATOM   5256 O O   . GLU D 1 134 ? 29.155 12.827 -24.156 1.00 53.03  ? 1327 GLU D O   1 
ATOM   5257 C CB  . GLU D 1 134 ? 28.896 15.872 -24.242 1.00 45.11  ? 1327 GLU D CB  1 
ATOM   5258 C CG  . GLU D 1 134 ? 29.276 16.978 -25.209 1.00 58.05  ? 1327 GLU D CG  1 
ATOM   5259 C CD  . GLU D 1 134 ? 29.816 18.214 -24.503 1.00 68.11  ? 1327 GLU D CD  1 
ATOM   5260 O OE1 . GLU D 1 134 ? 29.853 18.219 -23.251 1.00 58.36  ? 1327 GLU D OE1 1 
ATOM   5261 O OE2 . GLU D 1 134 ? 30.197 19.184 -25.200 1.00 71.19  ? 1327 GLU D OE2 1 
ATOM   5262 N N   . LEU D 1 135 ? 27.089 13.130 -23.311 1.00 44.71  ? 1328 LEU D N   1 
ATOM   5263 C CA  . LEU D 1 135 ? 27.104 11.864 -22.591 1.00 40.19  ? 1328 LEU D CA  1 
ATOM   5264 C C   . LEU D 1 135 ? 27.240 10.716 -23.582 1.00 43.28  ? 1328 LEU D C   1 
ATOM   5265 O O   . LEU D 1 135 ? 26.603 10.725 -24.640 1.00 40.71  ? 1328 LEU D O   1 
ATOM   5266 C CB  . LEU D 1 135 ? 25.824 11.678 -21.778 1.00 43.31  ? 1328 LEU D CB  1 
ATOM   5267 C CG  . LEU D 1 135 ? 25.621 12.430 -20.461 1.00 40.73  ? 1328 LEU D CG  1 
ATOM   5268 C CD1 . LEU D 1 135 ? 24.247 12.085 -19.903 1.00 36.70  ? 1328 LEU D CD1 1 
ATOM   5269 C CD2 . LEU D 1 135 ? 26.702 12.104 -19.446 1.00 37.13  ? 1328 LEU D CD2 1 
ATOM   5270 N N   . PRO D 1 136 ? 28.079 9.727  -23.241 1.00 44.91  ? 1329 PRO D N   1 
ATOM   5271 C CA  . PRO D 1 136 ? 28.281 8.528  -24.064 1.00 42.60  ? 1329 PRO D CA  1 
ATOM   5272 C C   . PRO D 1 136 ? 26.960 7.857  -24.393 1.00 39.11  ? 1329 PRO D C   1 
ATOM   5273 O O   . PRO D 1 136 ? 26.757 7.426  -25.522 1.00 50.60  ? 1329 PRO D O   1 
ATOM   5274 C CB  . PRO D 1 136 ? 29.123 7.629  -23.165 1.00 41.42  ? 1329 PRO D CB  1 
ATOM   5275 C CG  . PRO D 1 136 ? 29.892 8.598  -22.303 1.00 54.50  ? 1329 PRO D CG  1 
ATOM   5276 C CD  . PRO D 1 136 ? 28.942 9.738  -22.047 1.00 41.87  ? 1329 PRO D CD  1 
ATOM   5277 N N   . ASP D 1 137 ? 26.063 7.777  -23.418 1.00 44.96  ? 1330 ASP D N   1 
ATOM   5278 C CA  . ASP D 1 137 ? 24.727 7.229  -23.657 1.00 45.06  ? 1330 ASP D CA  1 
ATOM   5279 C C   . ASP D 1 137 ? 23.667 8.264  -23.307 1.00 38.54  ? 1330 ASP D C   1 
ATOM   5280 O O   . ASP D 1 137 ? 23.835 9.032  -22.364 1.00 42.56  ? 1330 ASP D O   1 
ATOM   5281 C CB  . ASP D 1 137 ? 24.511 5.940  -22.854 1.00 44.45  ? 1330 ASP D CB  1 
ATOM   5282 C CG  . ASP D 1 137 ? 25.646 4.938  -23.036 1.00 59.34  ? 1330 ASP D CG  1 
ATOM   5283 O OD1 . ASP D 1 137 ? 25.946 4.599  -24.201 1.00 53.21  ? 1330 ASP D OD1 1 
ATOM   5284 O OD2 . ASP D 1 137 ? 26.233 4.495  -22.017 1.00 45.14  ? 1330 ASP D OD2 1 
ATOM   5285 N N   . PRO D 1 138 ? 22.570 8.293  -24.072 1.00 38.30  ? 1331 PRO D N   1 
ATOM   5286 C CA  . PRO D 1 138 ? 21.510 9.286  -23.865 1.00 40.29  ? 1331 PRO D CA  1 
ATOM   5287 C C   . PRO D 1 138 ? 20.903 9.163  -22.467 1.00 40.65  ? 1331 PRO D C   1 
ATOM   5288 O O   . PRO D 1 138 ? 20.853 8.062  -21.919 1.00 39.62  ? 1331 PRO D O   1 
ATOM   5289 C CB  . PRO D 1 138 ? 20.472 8.896  -24.923 1.00 39.88  ? 1331 PRO D CB  1 
ATOM   5290 C CG  . PRO D 1 138 ? 20.733 7.421  -25.154 1.00 34.48  ? 1331 PRO D CG  1 
ATOM   5291 C CD  . PRO D 1 138 ? 22.228 7.361  -25.157 1.00 35.80  ? 1331 PRO D CD  1 
ATOM   5292 N N   . LEU D 1 139 ? 20.451 10.277 -21.898 1.00 31.59  ? 1332 LEU D N   1 
ATOM   5293 C CA  . LEU D 1 139 ? 19.932 10.256 -20.539 1.00 33.74  ? 1332 LEU D CA  1 
ATOM   5294 C C   . LEU D 1 139 ? 18.835 9.211  -20.423 1.00 35.89  ? 1332 LEU D C   1 
ATOM   5295 O O   . LEU D 1 139 ? 18.795 8.428  -19.476 1.00 38.14  ? 1332 LEU D O   1 
ATOM   5296 C CB  . LEU D 1 139 ? 19.404 11.631 -20.127 1.00 30.94  ? 1332 LEU D CB  1 
ATOM   5297 C CG  . LEU D 1 139 ? 18.941 11.718 -18.671 1.00 30.55  ? 1332 LEU D CG  1 
ATOM   5298 C CD1 . LEU D 1 139 ? 20.055 11.294 -17.722 1.00 29.51  ? 1332 LEU D CD1 1 
ATOM   5299 C CD2 . LEU D 1 139 ? 18.465 13.123 -18.346 1.00 39.14  ? 1332 LEU D CD2 1 
ATOM   5300 N N   . VAL D 1 140 ? 17.936 9.208  -21.394 1.00 33.11  ? 1333 VAL D N   1 
ATOM   5301 C CA  . VAL D 1 140 ? 16.889 8.203  -21.446 1.00 33.49  ? 1333 VAL D CA  1 
ATOM   5302 C C   . VAL D 1 140 ? 17.422 7.044  -22.266 1.00 37.45  ? 1333 VAL D C   1 
ATOM   5303 O O   . VAL D 1 140 ? 17.549 7.157  -23.483 1.00 39.53  ? 1333 VAL D O   1 
ATOM   5304 C CB  . VAL D 1 140 ? 15.627 8.774  -22.100 1.00 36.51  ? 1333 VAL D CB  1 
ATOM   5305 C CG1 . VAL D 1 140 ? 14.516 7.738  -22.151 1.00 32.48  ? 1333 VAL D CG1 1 
ATOM   5306 C CG2 . VAL D 1 140 ? 15.181 10.007 -21.339 1.00 40.02  ? 1333 VAL D CG2 1 
ATOM   5307 N N   . PRO D 1 141 ? 17.753 5.930  -21.595 1.00 35.13  ? 1334 PRO D N   1 
ATOM   5308 C CA  . PRO D 1 141 ? 18.436 4.798  -22.219 1.00 37.58  ? 1334 PRO D CA  1 
ATOM   5309 C C   . PRO D 1 141 ? 17.606 4.187  -23.343 1.00 39.13  ? 1334 PRO D C   1 
ATOM   5310 O O   . PRO D 1 141 ? 16.378 4.183  -23.265 1.00 35.99  ? 1334 PRO D O   1 
ATOM   5311 C CB  . PRO D 1 141 ? 18.604 3.816  -21.054 1.00 36.22  ? 1334 PRO D CB  1 
ATOM   5312 C CG  . PRO D 1 141 ? 18.592 4.672  -19.847 1.00 22.69  ? 1334 PRO D CG  1 
ATOM   5313 C CD  . PRO D 1 141 ? 17.535 5.688  -20.161 1.00 36.02  ? 1334 PRO D CD  1 
ATOM   5314 N N   . TYR D 1 142 ? 18.275 3.694  -24.383 1.00 38.50  ? 1335 TYR D N   1 
ATOM   5315 C CA  . TYR D 1 142 ? 17.577 3.183  -25.558 1.00 41.00  ? 1335 TYR D CA  1 
ATOM   5316 C C   . TYR D 1 142 ? 16.553 2.088  -25.249 1.00 41.04  ? 1335 TYR D C   1 
ATOM   5317 O O   . TYR D 1 142 ? 15.450 2.103  -25.804 1.00 39.34  ? 1335 TYR D O   1 
ATOM   5318 C CB  . TYR D 1 142 ? 18.571 2.712  -26.615 1.00 31.66  ? 1335 TYR D CB  1 
ATOM   5319 C CG  . TYR D 1 142 ? 19.325 3.846  -27.261 1.00 39.82  ? 1335 TYR D CG  1 
ATOM   5320 C CD1 . TYR D 1 142 ? 18.665 4.763  -28.074 1.00 31.77  ? 1335 TYR D CD1 1 
ATOM   5321 C CD2 . TYR D 1 142 ? 20.699 4.002  -27.065 1.00 39.01  ? 1335 TYR D CD2 1 
ATOM   5322 C CE1 . TYR D 1 142 ? 19.349 5.808  -28.677 1.00 33.17  ? 1335 TYR D CE1 1 
ATOM   5323 C CE2 . TYR D 1 142 ? 21.393 5.044  -27.669 1.00 37.01  ? 1335 TYR D CE2 1 
ATOM   5324 C CZ  . TYR D 1 142 ? 20.708 5.943  -28.474 1.00 37.91  ? 1335 TYR D CZ  1 
ATOM   5325 O OH  . TYR D 1 142 ? 21.373 6.986  -29.078 1.00 38.13  ? 1335 TYR D OH  1 
ATOM   5326 N N   . ASN D 1 143 ? 16.911 1.151  -24.370 1.00 40.97  ? 1336 ASN D N   1 
ATOM   5327 C CA  . ASN D 1 143 ? 15.989 0.079  -23.953 1.00 45.05  ? 1336 ASN D CA  1 
ATOM   5328 C C   . ASN D 1 143 ? 14.701 0.621  -23.342 1.00 43.57  ? 1336 ASN D C   1 
ATOM   5329 O O   . ASN D 1 143 ? 13.606 0.163  -23.669 1.00 46.99  ? 1336 ASN D O   1 
ATOM   5330 C CB  . ASN D 1 143 ? 16.659 -0.889 -22.975 1.00 33.06  ? 1336 ASN D CB  1 
ATOM   5331 C CG  . ASN D 1 143 ? 17.492 -0.167 -21.931 1.00 55.34  ? 1336 ASN D CG  1 
ATOM   5332 O OD1 . ASN D 1 143 ? 18.417 0.583  -22.261 1.00 66.75  ? 1336 ASN D OD1 1 
ATOM   5333 N ND2 . ASN D 1 143 ? 17.167 -0.384 -20.666 1.00 51.57  ? 1336 ASN D ND2 1 
ATOM   5334 N N   . MET D 1 144 ? 14.831 1.601  -22.454 1.00 37.53  ? 1337 MET D N   1 
ATOM   5335 C CA  . MET D 1 144 ? 13.657 2.312  -21.953 1.00 40.05  ? 1337 MET D CA  1 
ATOM   5336 C C   . MET D 1 144 ? 12.865 2.990  -23.074 1.00 39.31  ? 1337 MET D C   1 
ATOM   5337 O O   . MET D 1 144 ? 11.643 3.089  -23.006 1.00 44.47  ? 1337 MET D O   1 
ATOM   5338 C CB  . MET D 1 144 ? 14.052 3.350  -20.902 1.00 37.81  ? 1337 MET D CB  1 
ATOM   5339 C CG  . MET D 1 144 ? 14.682 2.779  -19.634 1.00 49.93  ? 1337 MET D CG  1 
ATOM   5340 S SD  . MET D 1 144 ? 13.642 1.598  -18.747 1.00 48.16  ? 1337 MET D SD  1 
ATOM   5341 C CE  . MET D 1 144 ? 13.968 0.093  -19.674 1.00 49.19  ? 1337 MET D CE  1 
ATOM   5342 N N   . GLN D 1 145 ? 13.562 3.458  -24.102 1.00 39.27  ? 1338 GLN D N   1 
ATOM   5343 C CA  . GLN D 1 145 ? 12.898 4.156  -25.191 1.00 42.78  ? 1338 GLN D CA  1 
ATOM   5344 C C   . GLN D 1 145 ? 11.907 3.256  -25.890 1.00 37.90  ? 1338 GLN D C   1 
ATOM   5345 O O   . GLN D 1 145 ? 10.809 3.688  -26.266 1.00 37.57  ? 1338 GLN D O   1 
ATOM   5346 C CB  . GLN D 1 145 ? 13.916 4.682  -26.197 1.00 31.73  ? 1338 GLN D CB  1 
ATOM   5347 C CG  . GLN D 1 145 ? 14.774 5.785  -25.630 1.00 39.96  ? 1338 GLN D CG  1 
ATOM   5348 C CD  . GLN D 1 145 ? 15.513 6.514  -26.704 1.00 38.69  ? 1338 GLN D CD  1 
ATOM   5349 O OE1 . GLN D 1 145 ? 15.064 6.553  -27.854 1.00 41.16  ? 1338 GLN D OE1 1 
ATOM   5350 N NE2 . GLN D 1 145 ? 16.661 7.094  -26.353 1.00 34.50  ? 1338 GLN D NE2 1 
ATOM   5351 N N   . ILE D 1 146 ? 12.303 2.002  -26.067 1.00 37.22  ? 1339 ILE D N   1 
ATOM   5352 C CA  . ILE D 1 146 ? 11.461 1.048  -26.772 1.00 44.07  ? 1339 ILE D CA  1 
ATOM   5353 C C   . ILE D 1 146 ? 10.142 0.915  -26.028 1.00 44.19  ? 1339 ILE D C   1 
ATOM   5354 O O   . ILE D 1 146 ? 9.068  1.037  -26.622 1.00 38.16  ? 1339 ILE D O   1 
ATOM   5355 C CB  . ILE D 1 146 ? 12.144 -0.323 -26.911 1.00 46.71  ? 1339 ILE D CB  1 
ATOM   5356 C CG1 . ILE D 1 146 ? 13.586 -0.148 -27.403 1.00 55.63  ? 1339 ILE D CG1 1 
ATOM   5357 C CG2 . ILE D 1 146 ? 11.367 -1.192 -27.875 1.00 47.49  ? 1339 ILE D CG2 1 
ATOM   5358 C CD1 . ILE D 1 146 ? 14.495 -1.355 -27.181 1.00 46.60  ? 1339 ILE D CD1 1 
ATOM   5359 N N   . ASP D 1 147 ? 10.237 0.696  -24.719 1.00 32.61  ? 1340 ASP D N   1 
ATOM   5360 C CA  . ASP D 1 147 ? 9.055  0.564  -23.876 1.00 36.91  ? 1340 ASP D CA  1 
ATOM   5361 C C   . ASP D 1 147 ? 8.216  1.840  -23.889 1.00 48.40  ? 1340 ASP D C   1 
ATOM   5362 O O   . ASP D 1 147 ? 6.979  1.781  -23.970 1.00 46.29  ? 1340 ASP D O   1 
ATOM   5363 C CB  . ASP D 1 147 ? 9.455  0.208  -22.441 1.00 41.70  ? 1340 ASP D CB  1 
ATOM   5364 C CG  . ASP D 1 147 ? 10.222 -1.105 -22.356 1.00 56.72  ? 1340 ASP D CG  1 
ATOM   5365 O OD1 . ASP D 1 147 ? 10.069 -1.952 -23.262 1.00 54.52  ? 1340 ASP D OD1 1 
ATOM   5366 O OD2 . ASP D 1 147 ? 10.978 -1.292 -21.378 1.00 54.74  ? 1340 ASP D OD2 1 
ATOM   5367 N N   . LEU D 1 148 ? 8.889  2.988  -23.803 1.00 37.58  ? 1341 LEU D N   1 
ATOM   5368 C CA  . LEU D 1 148 ? 8.205  4.273  -23.836 1.00 33.89  ? 1341 LEU D CA  1 
ATOM   5369 C C   . LEU D 1 148 ? 7.363  4.374  -25.103 1.00 37.79  ? 1341 LEU D C   1 
ATOM   5370 O O   . LEU D 1 148 ? 6.183  4.750  -25.051 1.00 35.62  ? 1341 LEU D O   1 
ATOM   5371 C CB  . LEU D 1 148 ? 9.195  5.442  -23.752 1.00 26.96  ? 1341 LEU D CB  1 
ATOM   5372 C CG  . LEU D 1 148 ? 9.795  5.757  -22.379 1.00 32.63  ? 1341 LEU D CG  1 
ATOM   5373 C CD1 . LEU D 1 148 ? 10.800 6.901  -22.469 1.00 28.96  ? 1341 LEU D CD1 1 
ATOM   5374 C CD2 . LEU D 1 148 ? 8.719  6.066  -21.350 1.00 16.24  ? 1341 LEU D CD2 1 
ATOM   5375 N N   . VAL D 1 149 ? 7.961  4.018  -26.238 1.00 31.40  ? 1342 VAL D N   1 
ATOM   5376 C CA  . VAL D 1 149 ? 7.260  4.130  -27.509 1.00 29.13  ? 1342 VAL D CA  1 
ATOM   5377 C C   . VAL D 1 149 ? 6.064  3.179  -27.547 1.00 45.83  ? 1342 VAL D C   1 
ATOM   5378 O O   . VAL D 1 149 ? 5.002  3.525  -28.076 1.00 54.03  ? 1342 VAL D O   1 
ATOM   5379 C CB  . VAL D 1 149 ? 8.201  3.890  -28.699 1.00 34.29  ? 1342 VAL D CB  1 
ATOM   5380 C CG1 . VAL D 1 149 ? 7.419  3.802  -30.022 1.00 24.84  ? 1342 VAL D CG1 1 
ATOM   5381 C CG2 . VAL D 1 149 ? 9.249  4.985  -28.765 1.00 26.13  ? 1342 VAL D CG2 1 
ATOM   5382 N N   . GLU D 1 150 ? 6.229  1.994  -26.961 1.00 42.30  ? 1343 GLU D N   1 
ATOM   5383 C CA  . GLU D 1 150 ? 5.151  1.006  -26.906 1.00 43.70  ? 1343 GLU D CA  1 
ATOM   5384 C C   . GLU D 1 150 ? 3.946  1.507  -26.120 1.00 43.03  ? 1343 GLU D C   1 
ATOM   5385 O O   . GLU D 1 150 ? 2.810  1.452  -26.609 1.00 34.67  ? 1343 GLU D O   1 
ATOM   5386 C CB  . GLU D 1 150 ? 5.649  -0.313 -26.304 1.00 61.86  ? 1343 GLU D CB  1 
ATOM   5387 C CG  . GLU D 1 150 ? 6.510  -1.154 -27.238 1.00 58.42  ? 1343 GLU D CG  1 
ATOM   5388 C CD  . GLU D 1 150 ? 5.735  -1.662 -28.435 1.00 68.00  ? 1343 GLU D CD  1 
ATOM   5389 O OE1 . GLU D 1 150 ? 4.735  -2.387 -28.229 1.00 65.58  ? 1343 GLU D OE1 1 
ATOM   5390 O OE2 . GLU D 1 150 ? 6.127  -1.340 -29.579 1.00 74.02  ? 1343 GLU D OE2 1 
ATOM   5391 N N   . ALA D 1 151 ? 4.200  1.979  -24.899 1.00 38.52  ? 1344 ALA D N   1 
ATOM   5392 C CA  . ALA D 1 151 ? 3.136  2.501  -24.040 1.00 37.26  ? 1344 ALA D CA  1 
ATOM   5393 C C   . ALA D 1 151 ? 2.349  3.592  -24.768 1.00 41.85  ? 1344 ALA D C   1 
ATOM   5394 O O   . ALA D 1 151 ? 1.115  3.644  -24.714 1.00 36.60  ? 1344 ALA D O   1 
ATOM   5395 C CB  . ALA D 1 151 ? 3.721  3.041  -22.750 1.00 31.85  ? 1344 ALA D CB  1 
ATOM   5396 N N   . HIS D 1 152 ? 3.083  4.452  -25.467 1.00 38.68  ? 1345 HIS D N   1 
ATOM   5397 C CA  . HIS D 1 152 ? 2.499  5.564  -26.195 1.00 42.50  ? 1345 HIS D CA  1 
ATOM   5398 C C   . HIS D 1 152 ? 1.428  5.120  -27.195 1.00 47.95  ? 1345 HIS D C   1 
ATOM   5399 O O   . HIS D 1 152 ? 0.607  5.928  -27.633 1.00 47.81  ? 1345 HIS D O   1 
ATOM   5400 C CB  . HIS D 1 152 ? 3.606  6.352  -26.900 1.00 45.08  ? 1345 HIS D CB  1 
ATOM   5401 C CG  . HIS D 1 152 ? 3.113  7.543  -27.661 1.00 49.86  ? 1345 HIS D CG  1 
ATOM   5402 N ND1 . HIS D 1 152 ? 2.565  8.647  -27.043 1.00 43.32  ? 1345 HIS D ND1 1 
ATOM   5403 C CD2 . HIS D 1 152 ? 3.098  7.808  -28.989 1.00 53.01  ? 1345 HIS D CD2 1 
ATOM   5404 C CE1 . HIS D 1 152 ? 2.226  9.537  -27.957 1.00 50.16  ? 1345 HIS D CE1 1 
ATOM   5405 N NE2 . HIS D 1 152 ? 2.542  9.054  -29.146 1.00 76.10  ? 1345 HIS D NE2 1 
ATOM   5406 N N   . LYS D 1 153 ? 1.440  3.840  -27.563 1.00 51.05  ? 1346 LYS D N   1 
ATOM   5407 C CA  . LYS D 1 153 ? 0.458  3.312  -28.509 1.00 40.18  ? 1346 LYS D CA  1 
ATOM   5408 C C   . LYS D 1 153 ? -0.933 3.357  -27.894 1.00 49.61  ? 1346 LYS D C   1 
ATOM   5409 O O   . LYS D 1 153 ? -1.923 3.541  -28.602 1.00 50.18  ? 1346 LYS D O   1 
ATOM   5410 C CB  . LYS D 1 153 ? 0.806  1.876  -28.912 1.00 53.50  ? 1346 LYS D CB  1 
ATOM   5411 C CG  . LYS D 1 153 ? 2.084  1.728  -29.745 1.00 54.13  ? 1346 LYS D CG  1 
ATOM   5412 N N   . ILE D 1 154 ? -0.999 3.190  -26.572 1.00 41.81  ? 1347 ILE D N   1 
ATOM   5413 C CA  . ILE D 1 154 ? -2.271 3.217  -25.858 1.00 38.09  ? 1347 ILE D CA  1 
ATOM   5414 C C   . ILE D 1 154 ? -2.960 4.559  -26.044 1.00 46.87  ? 1347 ILE D C   1 
ATOM   5415 O O   . ILE D 1 154 ? -2.430 5.597  -25.653 1.00 52.01  ? 1347 ILE D O   1 
ATOM   5416 C CB  . ILE D 1 154 ? -2.081 2.969  -24.364 1.00 36.42  ? 1347 ILE D CB  1 
ATOM   5417 C CG1 . ILE D 1 154 ? -1.286 1.689  -24.141 1.00 39.25  ? 1347 ILE D CG1 1 
ATOM   5418 C CG2 . ILE D 1 154 ? -3.427 2.867  -23.675 1.00 40.27  ? 1347 ILE D CG2 1 
ATOM   5419 C CD1 . ILE D 1 154 ? -1.007 1.396  -22.682 1.00 42.37  ? 1347 ILE D CD1 1 
ATOM   5420 N N   . ASN D 1 155 ? -4.149 4.529  -26.633 1.00 49.10  ? 1348 ASN D N   1 
ATOM   5421 C CA  . ASN D 1 155 ? -4.857 5.745  -27.022 1.00 49.07  ? 1348 ASN D CA  1 
ATOM   5422 C C   . ASN D 1 155 ? -5.549 6.489  -25.891 1.00 40.47  ? 1348 ASN D C   1 
ATOM   5423 O O   . ASN D 1 155 ? -5.640 7.712  -25.916 1.00 63.09  ? 1348 ASN D O   1 
ATOM   5424 C CB  . ASN D 1 155 ? -5.881 5.425  -28.103 1.00 56.97  ? 1348 ASN D CB  1 
ATOM   5425 C CG  . ASN D 1 155 ? -5.242 5.112  -29.418 1.00 67.27  ? 1348 ASN D CG  1 
ATOM   5426 O OD1 . ASN D 1 155 ? -4.309 5.797  -29.837 1.00 95.31  ? 1348 ASN D OD1 1 
ATOM   5427 N ND2 . ASN D 1 155 ? -5.735 4.078  -30.087 1.00 54.84  ? 1348 ASN D ND2 1 
ATOM   5428 N N   . ASP D 1 156 ? -6.056 5.754  -24.911 1.00 39.74  ? 1349 ASP D N   1 
ATOM   5429 C CA  . ASP D 1 156 ? -6.720 6.381  -23.781 1.00 35.83  ? 1349 ASP D CA  1 
ATOM   5430 C C   . ASP D 1 156 ? -5.692 7.096  -22.910 1.00 52.86  ? 1349 ASP D C   1 
ATOM   5431 O O   . ASP D 1 156 ? -4.651 6.532  -22.569 1.00 48.91  ? 1349 ASP D O   1 
ATOM   5432 C CB  . ASP D 1 156 ? -7.462 5.343  -22.959 1.00 36.49  ? 1349 ASP D CB  1 
ATOM   5433 C CG  . ASP D 1 156 ? -8.119 5.941  -21.738 1.00 55.84  ? 1349 ASP D CG  1 
ATOM   5434 O OD1 . ASP D 1 156 ? -9.201 6.552  -21.900 1.00 57.98  ? 1349 ASP D OD1 1 
ATOM   5435 O OD2 . ASP D 1 156 ? -7.550 5.797  -20.626 1.00 44.05  ? 1349 ASP D OD2 1 
ATOM   5436 N N   . ARG D 1 157 ? -5.985 8.341  -22.548 1.00 54.82  ? 1350 ARG D N   1 
ATOM   5437 C CA  . ARG D 1 157 ? -4.978 9.180  -21.908 1.00 50.34  ? 1350 ARG D CA  1 
ATOM   5438 C C   . ARG D 1 157 ? -4.538 8.679  -20.534 1.00 41.19  ? 1350 ARG D C   1 
ATOM   5439 O O   . ARG D 1 157 ? -3.341 8.590  -20.263 1.00 37.67  ? 1350 ARG D O   1 
ATOM   5440 C CB  . ARG D 1 157 ? -5.433 10.636 -21.833 1.00 42.64  ? 1350 ARG D CB  1 
ATOM   5441 C CG  . ARG D 1 157 ? -4.349 11.559 -21.315 1.00 35.52  ? 1350 ARG D CG  1 
ATOM   5442 C CD  . ARG D 1 157 ? -3.087 11.417 -22.131 1.00 27.43  ? 1350 ARG D CD  1 
ATOM   5443 N NE  . ARG D 1 157 ? -3.276 11.950 -23.470 1.00 40.78  ? 1350 ARG D NE  1 
ATOM   5444 C CZ  . ARG D 1 157 ? -2.987 13.198 -23.816 1.00 35.94  ? 1350 ARG D CZ  1 
ATOM   5445 N NH1 . ARG D 1 157 ? -3.199 13.608 -25.059 1.00 19.38  ? 1350 ARG D NH1 1 
ATOM   5446 N NH2 . ARG D 1 157 ? -2.487 14.029 -22.916 1.00 33.18  ? 1350 ARG D NH2 1 
ATOM   5447 N N   . GLU D 1 158 ? -5.488 8.352  -19.666 1.00 39.96  ? 1351 GLU D N   1 
ATOM   5448 C CA  . GLU D 1 158 ? -5.110 7.852  -18.352 1.00 41.75  ? 1351 GLU D CA  1 
ATOM   5449 C C   . GLU D 1 158 ? -4.336 6.533  -18.469 1.00 53.66  ? 1351 GLU D C   1 
ATOM   5450 O O   . GLU D 1 158 ? -3.306 6.344  -17.811 1.00 49.35  ? 1351 GLU D O   1 
ATOM   5451 C CB  . GLU D 1 158 ? -6.325 7.677  -17.446 1.00 33.56  ? 1351 GLU D CB  1 
ATOM   5452 C CG  . GLU D 1 158 ? -5.940 7.169  -16.070 1.00 42.69  ? 1351 GLU D CG  1 
ATOM   5453 C CD  . GLU D 1 158 ? -7.129 6.900  -15.185 1.00 52.71  ? 1351 GLU D CD  1 
ATOM   5454 O OE1 . GLU D 1 158 ? -6.907 6.528  -14.007 1.00 59.83  ? 1351 GLU D OE1 1 
ATOM   5455 O OE2 . GLU D 1 158 ? -8.279 7.062  -15.662 1.00 42.66  ? 1351 GLU D OE2 1 
ATOM   5456 N N   . GLN D 1 159 ? -4.830 5.625  -19.309 1.00 53.98  ? 1352 GLN D N   1 
ATOM   5457 C CA  . GLN D 1 159 ? -4.159 4.345  -19.523 1.00 47.56  ? 1352 GLN D CA  1 
ATOM   5458 C C   . GLN D 1 159 ? -2.725 4.578  -19.975 1.00 48.41  ? 1352 GLN D C   1 
ATOM   5459 O O   . GLN D 1 159 ? -1.786 3.993  -19.431 1.00 50.44  ? 1352 GLN D O   1 
ATOM   5460 C CB  . GLN D 1 159 ? -4.898 3.518  -20.576 1.00 48.90  ? 1352 GLN D CB  1 
ATOM   5461 C CG  . GLN D 1 159 ? -6.157 2.848  -20.069 1.00 42.85  ? 1352 GLN D CG  1 
ATOM   5462 C CD  . GLN D 1 159 ? -5.868 1.852  -18.974 1.00 72.08  ? 1352 GLN D CD  1 
ATOM   5463 O OE1 . GLN D 1 159 ? -5.324 0.770  -19.231 1.00 81.71  ? 1352 GLN D OE1 1 
ATOM   5464 N NE2 . GLN D 1 159 ? -6.224 2.206  -17.737 1.00 62.87  ? 1352 GLN D NE2 1 
ATOM   5465 N N   . LYS D 1 160 ? -2.580 5.441  -20.977 1.00 35.67  ? 1353 LYS D N   1 
ATOM   5466 C CA  . LYS D 1 160 ? -1.294 5.796  -21.547 1.00 28.12  ? 1353 LYS D CA  1 
ATOM   5467 C C   . LYS D 1 160 ? -0.325 6.283  -20.471 1.00 35.51  ? 1353 LYS D C   1 
ATOM   5468 O O   . LYS D 1 160 ? 0.841  5.883  -20.439 1.00 27.89  ? 1353 LYS D O   1 
ATOM   5469 C CB  . LYS D 1 160 ? -1.503 6.896  -22.587 1.00 37.29  ? 1353 LYS D CB  1 
ATOM   5470 C CG  . LYS D 1 160 ? -0.287 7.243  -23.439 1.00 36.58  ? 1353 LYS D CG  1 
ATOM   5471 C CD  . LYS D 1 160 ? -0.642 8.352  -24.408 1.00 29.55  ? 1353 LYS D CD  1 
ATOM   5472 C CE  . LYS D 1 160 ? -0.144 8.031  -25.784 1.00 45.23  ? 1353 LYS D CE  1 
ATOM   5473 N NZ  . LYS D 1 160 ? -0.947 8.711  -26.830 1.00 59.25  ? 1353 LYS D NZ  1 
ATOM   5474 N N   . LEU D 1 161 ? -0.807 7.151  -19.589 1.00 28.34  ? 1354 LEU D N   1 
ATOM   5475 C CA  . LEU D 1 161 ? 0.065  7.742  -18.593 1.00 29.29  ? 1354 LEU D CA  1 
ATOM   5476 C C   . LEU D 1 161 ? 0.516  6.701  -17.571 1.00 36.63  ? 1354 LEU D C   1 
ATOM   5477 O O   . LEU D 1 161 ? 1.660  6.744  -17.107 1.00 34.48  ? 1354 LEU D O   1 
ATOM   5478 C CB  . LEU D 1 161 ? -0.598 8.949  -17.924 1.00 41.86  ? 1354 LEU D CB  1 
ATOM   5479 C CG  . LEU D 1 161 ? -0.702 10.181 -18.828 1.00 25.63  ? 1354 LEU D CG  1 
ATOM   5480 C CD1 . LEU D 1 161 ? -1.498 11.292 -18.147 1.00 24.36  ? 1354 LEU D CD1 1 
ATOM   5481 C CD2 . LEU D 1 161 ? 0.677  10.659 -19.212 1.00 24.20  ? 1354 LEU D CD2 1 
ATOM   5482 N N   . HIS D 1 162 ? -0.364 5.761  -17.227 1.00 36.66  ? 1355 HIS D N   1 
ATOM   5483 C CA  . HIS D 1 162 ? 0.036  4.673  -16.333 1.00 35.40  ? 1355 HIS D CA  1 
ATOM   5484 C C   . HIS D 1 162 ? 1.108  3.826  -17.002 1.00 33.10  ? 1355 HIS D C   1 
ATOM   5485 O O   . HIS D 1 162 ? 2.162  3.556  -16.415 1.00 30.41  ? 1355 HIS D O   1 
ATOM   5486 C CB  . HIS D 1 162 ? -1.157 3.817  -15.898 1.00 26.99  ? 1355 HIS D CB  1 
ATOM   5487 C CG  . HIS D 1 162 ? -2.042 4.497  -14.901 1.00 58.99  ? 1355 HIS D CG  1 
ATOM   5488 N ND1 . HIS D 1 162 ? -3.372 4.766  -15.145 1.00 67.55  ? 1355 HIS D ND1 1 
ATOM   5489 C CD2 . HIS D 1 162 ? -1.777 4.999  -13.670 1.00 50.82  ? 1355 HIS D CD2 1 
ATOM   5490 C CE1 . HIS D 1 162 ? -3.891 5.392  -14.102 1.00 56.31  ? 1355 HIS D CE1 1 
ATOM   5491 N NE2 . HIS D 1 162 ? -2.944 5.547  -13.195 1.00 58.50  ? 1355 HIS D NE2 1 
ATOM   5492 N N   . ALA D 1 163 ? 0.840  3.432  -18.243 1.00 26.22  ? 1356 ALA D N   1 
ATOM   5493 C CA  . ALA D 1 163 ? 1.794  2.661  -19.006 1.00 21.38  ? 1356 ALA D CA  1 
ATOM   5494 C C   . ALA D 1 163 ? 3.151  3.344  -18.956 1.00 30.16  ? 1356 ALA D C   1 
ATOM   5495 O O   . ALA D 1 163 ? 4.162  2.702  -18.655 1.00 39.11  ? 1356 ALA D O   1 
ATOM   5496 C CB  . ALA D 1 163 ? 1.320  2.498  -20.429 1.00 21.07  ? 1356 ALA D CB  1 
ATOM   5497 N N   . LEU D 1 164 ? 3.164  4.647  -19.227 1.00 31.36  ? 1357 LEU D N   1 
ATOM   5498 C CA  . LEU D 1 164 ? 4.401  5.418  -19.232 1.00 31.99  ? 1357 LEU D CA  1 
ATOM   5499 C C   . LEU D 1 164 ? 5.071  5.442  -17.865 1.00 26.08  ? 1357 LEU D C   1 
ATOM   5500 O O   . LEU D 1 164 ? 6.277  5.248  -17.756 1.00 31.08  ? 1357 LEU D O   1 
ATOM   5501 C CB  . LEU D 1 164 ? 4.159  6.841  -19.740 1.00 33.15  ? 1357 LEU D CB  1 
ATOM   5502 C CG  . LEU D 1 164 ? 3.927  6.952  -21.250 1.00 25.24  ? 1357 LEU D CG  1 
ATOM   5503 C CD1 . LEU D 1 164 ? 3.211  8.246  -21.585 1.00 26.55  ? 1357 LEU D CD1 1 
ATOM   5504 C CD2 . LEU D 1 164 ? 5.244  6.833  -22.000 1.00 18.58  ? 1357 LEU D CD2 1 
ATOM   5505 N N   . LYS D 1 165 ? 4.294  5.668  -16.818 1.00 25.70  ? 1358 LYS D N   1 
ATOM   5506 C CA  . LYS D 1 165 ? 4.882  5.731  -15.491 1.00 32.97  ? 1358 LYS D CA  1 
ATOM   5507 C C   . LYS D 1 165 ? 5.505  4.391  -15.153 1.00 37.55  ? 1358 LYS D C   1 
ATOM   5508 O O   . LYS D 1 165 ? 6.498  4.327  -14.429 1.00 35.13  ? 1358 LYS D O   1 
ATOM   5509 C CB  . LYS D 1 165 ? 3.843  6.115  -14.443 1.00 31.36  ? 1358 LYS D CB  1 
ATOM   5510 C CG  . LYS D 1 165 ? 4.444  6.569  -13.136 1.00 29.45  ? 1358 LYS D CG  1 
ATOM   5511 C CD  . LYS D 1 165 ? 3.359  6.915  -12.133 1.00 39.10  ? 1358 LYS D CD  1 
ATOM   5512 C CE  . LYS D 1 165 ? 3.925  7.675  -10.943 1.00 44.37  ? 1358 LYS D CE  1 
ATOM   5513 N NZ  . LYS D 1 165 ? 2.811  8.164  -10.096 1.00 48.87  ? 1358 LYS D NZ  1 
ATOM   5514 N N   . GLU D 1 166 ? 4.923  3.321  -15.689 1.00 36.95  ? 1359 GLU D N   1 
ATOM   5515 C CA  . GLU D 1 166 ? 5.458  1.980  -15.481 1.00 37.35  ? 1359 GLU D CA  1 
ATOM   5516 C C   . GLU D 1 166 ? 6.857  1.855  -16.050 1.00 45.89  ? 1359 GLU D C   1 
ATOM   5517 O O   . GLU D 1 166 ? 7.764  1.384  -15.360 1.00 59.53  ? 1359 GLU D O   1 
ATOM   5518 C CB  . GLU D 1 166 ? 4.542  0.912  -16.079 1.00 46.30  ? 1359 GLU D CB  1 
ATOM   5519 C CG  . GLU D 1 166 ? 3.554  0.328  -15.069 1.00 45.49  ? 1359 GLU D CG  1 
ATOM   5520 C CD  . GLU D 1 166 ? 4.251  -0.404 -13.939 1.00 68.99  ? 1359 GLU D CD  1 
ATOM   5521 O OE1 . GLU D 1 166 ? 4.065  0.010  -12.772 1.00 61.74  ? 1359 GLU D OE1 1 
ATOM   5522 O OE2 . GLU D 1 166 ? 4.993  -1.380 -14.219 1.00 70.82  ? 1359 GLU D OE2 1 
ATOM   5523 N N   . VAL D 1 167 ? 7.043  2.275  -17.302 1.00 41.33  ? 1360 VAL D N   1 
ATOM   5524 C CA  . VAL D 1 167 ? 8.380  2.290  -17.873 1.00 34.12  ? 1360 VAL D CA  1 
ATOM   5525 C C   . VAL D 1 167 ? 9.273  3.125  -16.979 1.00 28.58  ? 1360 VAL D C   1 
ATOM   5526 O O   . VAL D 1 167 ? 10.400 2.750  -16.689 1.00 40.64  ? 1360 VAL D O   1 
ATOM   5527 C CB  . VAL D 1 167 ? 8.416  2.874  -19.289 1.00 30.82  ? 1360 VAL D CB  1 
ATOM   5528 C CG1 . VAL D 1 167 ? 9.862  2.944  -19.790 1.00 37.56  ? 1360 VAL D CG1 1 
ATOM   5529 C CG2 . VAL D 1 167 ? 7.578  2.039  -20.232 1.00 30.37  ? 1360 VAL D CG2 1 
ATOM   5530 N N   . LEU D 1 168 ? 8.756  4.260  -16.533 1.00 34.77  ? 1361 LEU D N   1 
ATOM   5531 C CA  . LEU D 1 168 ? 9.543  5.190  -15.736 1.00 35.04  ? 1361 LEU D CA  1 
ATOM   5532 C C   . LEU D 1 168 ? 10.091 4.514  -14.485 1.00 42.77  ? 1361 LEU D C   1 
ATOM   5533 O O   . LEU D 1 168 ? 11.145 4.892  -13.989 1.00 49.35  ? 1361 LEU D O   1 
ATOM   5534 C CB  . LEU D 1 168 ? 8.710  6.415  -15.367 1.00 31.94  ? 1361 LEU D CB  1 
ATOM   5535 C CG  . LEU D 1 168 ? 9.484  7.556  -14.720 1.00 36.04  ? 1361 LEU D CG  1 
ATOM   5536 C CD1 . LEU D 1 168 ? 10.567 8.010  -15.650 1.00 34.94  ? 1361 LEU D CD1 1 
ATOM   5537 C CD2 . LEU D 1 168 ? 8.557  8.709  -14.357 1.00 40.55  ? 1361 LEU D CD2 1 
ATOM   5538 N N   . LYS D 1 169 ? 9.380  3.504  -13.989 1.00 46.14  ? 1362 LYS D N   1 
ATOM   5539 C CA  . LYS D 1 169 ? 9.830  2.741  -12.824 1.00 47.28  ? 1362 LYS D CA  1 
ATOM   5540 C C   . LYS D 1 169 ? 11.018 1.837  -13.152 1.00 49.41  ? 1362 LYS D C   1 
ATOM   5541 O O   . LYS D 1 169 ? 11.774 1.462  -12.258 1.00 50.27  ? 1362 LYS D O   1 
ATOM   5542 C CB  . LYS D 1 169 ? 8.688  1.892  -12.261 1.00 43.82  ? 1362 LYS D CB  1 
ATOM   5543 N N   . LYS D 1 170 ? 11.175 1.481  -14.424 1.00 32.37  ? 1363 LYS D N   1 
ATOM   5544 C CA  . LYS D 1 170 ? 12.257 0.591  -14.828 1.00 32.14  ? 1363 LYS D CA  1 
ATOM   5545 C C   . LYS D 1 170 ? 13.548 1.324  -15.199 1.00 42.48  ? 1363 LYS D C   1 
ATOM   5546 O O   . LYS D 1 170 ? 14.542 0.686  -15.563 1.00 48.64  ? 1363 LYS D O   1 
ATOM   5547 C CB  . LYS D 1 170 ? 11.821 -0.309 -15.984 1.00 36.14  ? 1363 LYS D CB  1 
ATOM   5548 C CG  . LYS D 1 170 ? 10.783 -1.358 -15.617 1.00 47.52  ? 1363 LYS D CG  1 
ATOM   5549 C CD  . LYS D 1 170 ? 10.818 -2.528 -16.599 1.00 62.42  ? 1363 LYS D CD  1 
ATOM   5550 N N   . PHE D 1 171 ? 13.539 2.654  -15.122 1.00 36.85  ? 1364 PHE D N   1 
ATOM   5551 C CA  . PHE D 1 171 ? 14.751 3.431  -15.403 1.00 43.07  ? 1364 PHE D CA  1 
ATOM   5552 C C   . PHE D 1 171 ? 15.862 3.083  -14.421 1.00 38.98  ? 1364 PHE D C   1 
ATOM   5553 O O   . PHE D 1 171 ? 15.599 2.894  -13.234 1.00 41.12  ? 1364 PHE D O   1 
ATOM   5554 C CB  . PHE D 1 171 ? 14.478 4.927  -15.267 1.00 50.02  ? 1364 PHE D CB  1 
ATOM   5555 C CG  . PHE D 1 171 ? 13.966 5.587  -16.517 1.00 44.78  ? 1364 PHE D CG  1 
ATOM   5556 C CD1 . PHE D 1 171 ? 12.956 5.013  -17.261 1.00 35.74  ? 1364 PHE D CD1 1 
ATOM   5557 C CD2 . PHE D 1 171 ? 14.469 6.821  -16.914 1.00 39.79  ? 1364 PHE D CD2 1 
ATOM   5558 C CE1 . PHE D 1 171 ? 12.478 5.645  -18.403 1.00 38.65  ? 1364 PHE D CE1 1 
ATOM   5559 C CE2 . PHE D 1 171 ? 13.999 7.450  -18.045 1.00 33.86  ? 1364 PHE D CE2 1 
ATOM   5560 C CZ  . PHE D 1 171 ? 13.005 6.859  -18.793 1.00 32.38  ? 1364 PHE D CZ  1 
ATOM   5561 N N   . PRO D 1 172 ? 17.108 2.998  -14.914 1.00 40.61  ? 1365 PRO D N   1 
ATOM   5562 C CA  . PRO D 1 172 ? 18.265 2.980  -14.017 1.00 38.66  ? 1365 PRO D CA  1 
ATOM   5563 C C   . PRO D 1 172 ? 18.129 4.151  -13.061 1.00 48.85  ? 1365 PRO D C   1 
ATOM   5564 O O   . PRO D 1 172 ? 17.751 5.231  -13.515 1.00 50.37  ? 1365 PRO D O   1 
ATOM   5565 C CB  . PRO D 1 172 ? 19.440 3.220  -14.963 1.00 30.32  ? 1365 PRO D CB  1 
ATOM   5566 C CG  . PRO D 1 172 ? 18.996 2.636  -16.254 1.00 46.47  ? 1365 PRO D CG  1 
ATOM   5567 C CD  . PRO D 1 172 ? 17.494 2.800  -16.320 1.00 45.31  ? 1365 PRO D CD  1 
ATOM   5568 N N   . LYS D 1 173 ? 18.421 3.953  -11.778 1.00 43.34  ? 1366 LYS D N   1 
ATOM   5569 C CA  . LYS D 1 173 ? 18.164 4.994  -10.795 1.00 39.12  ? 1366 LYS D CA  1 
ATOM   5570 C C   . LYS D 1 173 ? 18.985 6.252  -11.045 1.00 49.54  ? 1366 LYS D C   1 
ATOM   5571 O O   . LYS D 1 173 ? 18.499 7.364  -10.841 1.00 53.96  ? 1366 LYS D O   1 
ATOM   5572 C CB  . LYS D 1 173 ? 18.364 4.493  -9.365  1.00 45.88  ? 1366 LYS D CB  1 
ATOM   5573 C CG  . LYS D 1 173 ? 17.932 5.507  -8.314  1.00 54.10  ? 1366 LYS D CG  1 
ATOM   5574 C CD  . LYS D 1 173 ? 17.502 4.828  -7.023  1.00 85.01  ? 1366 LYS D CD  1 
ATOM   5575 C CE  . LYS D 1 173 ? 16.790 5.807  -6.095  1.00 87.63  ? 1366 LYS D CE  1 
ATOM   5576 N NZ  . LYS D 1 173 ? 16.063 5.093  -5.003  1.00 90.12  ? 1366 LYS D NZ  1 
ATOM   5577 N N   . GLU D 1 174 ? 20.224 6.085  -11.492 1.00 49.34  ? 1367 GLU D N   1 
ATOM   5578 C CA  . GLU D 1 174 ? 21.070 7.241  -11.766 1.00 48.43  ? 1367 GLU D CA  1 
ATOM   5579 C C   . GLU D 1 174 ? 20.367 8.139  -12.776 1.00 48.57  ? 1367 GLU D C   1 
ATOM   5580 O O   . GLU D 1 174 ? 20.261 9.350  -12.575 1.00 46.48  ? 1367 GLU D O   1 
ATOM   5581 C CB  . GLU D 1 174 ? 22.450 6.813  -12.297 1.00 51.40  ? 1367 GLU D CB  1 
ATOM   5582 C CG  . GLU D 1 174 ? 23.308 5.993  -11.322 1.00 59.81  ? 1367 GLU D CG  1 
ATOM   5583 C CD  . GLU D 1 174 ? 22.796 4.559  -11.110 1.00 87.11  ? 1367 GLU D CD  1 
ATOM   5584 O OE1 . GLU D 1 174 ? 23.126 3.962  -10.059 1.00 73.24  ? 1367 GLU D OE1 1 
ATOM   5585 O OE2 . GLU D 1 174 ? 22.069 4.028  -11.985 1.00 65.18  ? 1367 GLU D OE2 1 
ATOM   5586 N N   . ASN D 1 175 ? 19.877 7.537  -13.857 1.00 41.73  ? 1368 ASN D N   1 
ATOM   5587 C CA  . ASN D 1 175 ? 19.208 8.292  -14.921 1.00 52.14  ? 1368 ASN D CA  1 
ATOM   5588 C C   . ASN D 1 175 ? 17.873 8.854  -14.461 1.00 48.05  ? 1368 ASN D C   1 
ATOM   5589 O O   . ASN D 1 175 ? 17.524 10.000 -14.766 1.00 38.16  ? 1368 ASN D O   1 
ATOM   5590 C CB  . ASN D 1 175 ? 18.966 7.424  -16.161 1.00 40.74  ? 1368 ASN D CB  1 
ATOM   5591 C CG  . ASN D 1 175 ? 20.204 6.714  -16.623 1.00 41.88  ? 1368 ASN D CG  1 
ATOM   5592 O OD1 . ASN D 1 175 ? 20.792 5.922  -15.887 1.00 54.72  ? 1368 ASN D OD1 1 
ATOM   5593 N ND2 . ASN D 1 175 ? 20.607 6.979  -17.855 1.00 43.25  ? 1368 ASN D ND2 1 
ATOM   5594 N N   . HIS D 1 176 ? 17.121 8.031  -13.734 1.00 47.12  ? 1369 HIS D N   1 
ATOM   5595 C CA  . HIS D 1 176 ? 15.797 8.426  -13.294 1.00 41.50  ? 1369 HIS D CA  1 
ATOM   5596 C C   . HIS D 1 176 ? 15.863 9.721  -12.503 1.00 42.77  ? 1369 HIS D C   1 
ATOM   5597 O O   . HIS D 1 176 ? 15.024 10.612 -12.670 1.00 37.32  ? 1369 HIS D O   1 
ATOM   5598 C CB  . HIS D 1 176 ? 15.149 7.346  -12.451 1.00 28.94  ? 1369 HIS D CB  1 
ATOM   5599 C CG  . HIS D 1 176 ? 13.805 7.736  -11.928 1.00 35.22  ? 1369 HIS D CG  1 
ATOM   5600 N ND1 . HIS D 1 176 ? 12.630 7.389  -12.558 1.00 34.65  ? 1369 HIS D ND1 1 
ATOM   5601 C CD2 . HIS D 1 176 ? 13.451 8.470  -10.848 1.00 32.23  ? 1369 HIS D CD2 1 
ATOM   5602 C CE1 . HIS D 1 176 ? 11.609 7.873  -11.874 1.00 38.67  ? 1369 HIS D CE1 1 
ATOM   5603 N NE2 . HIS D 1 176 ? 12.080 8.537  -10.834 1.00 33.88  ? 1369 HIS D NE2 1 
ATOM   5604 N N   . GLU D 1 177 ? 16.878 9.821  -11.652 1.00 39.94  ? 1370 GLU D N   1 
ATOM   5605 C CA  . GLU D 1 177 ? 17.085 11.014 -10.848 1.00 42.48  ? 1370 GLU D CA  1 
ATOM   5606 C C   . GLU D 1 177 ? 17.365 12.248 -11.694 1.00 41.85  ? 1370 GLU D C   1 
ATOM   5607 O O   . GLU D 1 177 ? 16.722 13.288 -11.519 1.00 40.15  ? 1370 GLU D O   1 
ATOM   5608 C CB  . GLU D 1 177 ? 18.203 10.787 -9.829  1.00 46.35  ? 1370 GLU D CB  1 
ATOM   5609 C CG  . GLU D 1 177 ? 17.760 9.949  -8.663  1.00 31.58  ? 1370 GLU D CG  1 
ATOM   5610 C CD  . GLU D 1 177 ? 16.387 10.360 -8.175  1.00 53.88  ? 1370 GLU D CD  1 
ATOM   5611 O OE1 . GLU D 1 177 ? 15.425 9.592  -8.400  1.00 49.49  ? 1370 GLU D OE1 1 
ATOM   5612 O OE2 . GLU D 1 177 ? 16.269 11.461 -7.588  1.00 48.93  ? 1370 GLU D OE2 1 
ATOM   5613 N N   . VAL D 1 178 ? 18.324 12.135 -12.608 1.00 40.02  ? 1371 VAL D N   1 
ATOM   5614 C CA  . VAL D 1 178 ? 18.662 13.265 -13.468 1.00 43.14  ? 1371 VAL D CA  1 
ATOM   5615 C C   . VAL D 1 178 ? 17.464 13.608 -14.348 1.00 40.64  ? 1371 VAL D C   1 
ATOM   5616 O O   . VAL D 1 178 ? 17.126 14.785 -14.524 1.00 34.37  ? 1371 VAL D O   1 
ATOM   5617 C CB  . VAL D 1 178 ? 19.909 12.986 -14.334 1.00 40.60  ? 1371 VAL D CB  1 
ATOM   5618 C CG1 . VAL D 1 178 ? 20.297 14.224 -15.132 1.00 28.35  ? 1371 VAL D CG1 1 
ATOM   5619 C CG2 . VAL D 1 178 ? 21.060 12.550 -13.454 1.00 44.33  ? 1371 VAL D CG2 1 
ATOM   5620 N N   . PHE D 1 179 ? 16.811 12.577 -14.883 1.00 36.76  ? 1372 PHE D N   1 
ATOM   5621 C CA  . PHE D 1 179 ? 15.635 12.802 -15.711 1.00 39.10  ? 1372 PHE D CA  1 
ATOM   5622 C C   . PHE D 1 179 ? 14.602 13.581 -14.911 1.00 36.47  ? 1372 PHE D C   1 
ATOM   5623 O O   . PHE D 1 179 ? 14.056 14.575 -15.384 1.00 31.47  ? 1372 PHE D O   1 
ATOM   5624 C CB  . PHE D 1 179 ? 15.042 11.486 -16.233 1.00 30.90  ? 1372 PHE D CB  1 
ATOM   5625 C CG  . PHE D 1 179 ? 14.029 11.678 -17.333 1.00 31.87  ? 1372 PHE D CG  1 
ATOM   5626 C CD1 . PHE D 1 179 ? 14.371 12.355 -18.498 1.00 33.21  ? 1372 PHE D CD1 1 
ATOM   5627 C CD2 . PHE D 1 179 ? 12.733 11.194 -17.202 1.00 31.28  ? 1372 PHE D CD2 1 
ATOM   5628 C CE1 . PHE D 1 179 ? 13.434 12.540 -19.516 1.00 31.67  ? 1372 PHE D CE1 1 
ATOM   5629 C CE2 . PHE D 1 179 ? 11.795 11.366 -18.217 1.00 30.21  ? 1372 PHE D CE2 1 
ATOM   5630 C CZ  . PHE D 1 179 ? 12.147 12.040 -19.375 1.00 26.35  ? 1372 PHE D CZ  1 
ATOM   5631 N N   . LYS D 1 180 ? 14.350 13.126 -13.688 1.00 39.04  ? 1373 LYS D N   1 
ATOM   5632 C CA  . LYS D 1 180 ? 13.398 13.788 -12.810 1.00 31.53  ? 1373 LYS D CA  1 
ATOM   5633 C C   . LYS D 1 180 ? 13.763 15.260 -12.696 1.00 32.72  ? 1373 LYS D C   1 
ATOM   5634 O O   . LYS D 1 180 ? 12.936 16.139 -12.950 1.00 33.27  ? 1373 LYS D O   1 
ATOM   5635 C CB  . LYS D 1 180 ? 13.416 13.132 -11.429 1.00 38.28  ? 1373 LYS D CB  1 
ATOM   5636 C CG  . LYS D 1 180 ? 12.302 13.566 -10.491 1.00 32.99  ? 1373 LYS D CG  1 
ATOM   5637 C CD  . LYS D 1 180 ? 12.701 13.274 -9.045  1.00 47.26  ? 1373 LYS D CD  1 
ATOM   5638 C CE  . LYS D 1 180 ? 11.569 13.528 -8.051  1.00 53.57  ? 1373 LYS D CE  1 
ATOM   5639 N NZ  . LYS D 1 180 ? 10.808 12.283 -7.773  1.00 67.88  ? 1373 LYS D NZ  1 
ATOM   5640 N N   . TYR D 1 181 ? 15.017 15.520 -12.335 1.00 33.02  ? 1374 TYR D N   1 
ATOM   5641 C CA  . TYR D 1 181 ? 15.510 16.882 -12.113 1.00 30.87  ? 1374 TYR D CA  1 
ATOM   5642 C C   . TYR D 1 181 ? 15.292 17.767 -13.340 1.00 36.42  ? 1374 TYR D C   1 
ATOM   5643 O O   . TYR D 1 181 ? 14.680 18.838 -13.258 1.00 31.42  ? 1374 TYR D O   1 
ATOM   5644 C CB  . TYR D 1 181 ? 16.994 16.829 -11.748 1.00 27.81  ? 1374 TYR D CB  1 
ATOM   5645 C CG  . TYR D 1 181 ? 17.597 18.121 -11.262 1.00 28.22  ? 1374 TYR D CG  1 
ATOM   5646 C CD1 . TYR D 1 181 ? 17.519 18.485 -9.924  1.00 29.10  ? 1374 TYR D CD1 1 
ATOM   5647 C CD2 . TYR D 1 181 ? 18.285 18.964 -12.134 1.00 33.49  ? 1374 TYR D CD2 1 
ATOM   5648 C CE1 . TYR D 1 181 ? 18.085 19.666 -9.466  1.00 28.32  ? 1374 TYR D CE1 1 
ATOM   5649 C CE2 . TYR D 1 181 ? 18.862 20.146 -11.688 1.00 40.26  ? 1374 TYR D CE2 1 
ATOM   5650 C CZ  . TYR D 1 181 ? 18.754 20.493 -10.349 1.00 47.44  ? 1374 TYR D CZ  1 
ATOM   5651 O OH  . TYR D 1 181 ? 19.312 21.664 -9.881  1.00 55.12  ? 1374 TYR D OH  1 
ATOM   5652 N N   . VAL D 1 182 ? 15.794 17.309 -14.484 1.00 38.71  ? 1375 VAL D N   1 
ATOM   5653 C CA  . VAL D 1 182 ? 15.652 18.062 -15.725 1.00 36.63  ? 1375 VAL D CA  1 
ATOM   5654 C C   . VAL D 1 182 ? 14.189 18.305 -16.076 1.00 34.32  ? 1375 VAL D C   1 
ATOM   5655 O O   . VAL D 1 182 ? 13.795 19.432 -16.359 1.00 32.50  ? 1375 VAL D O   1 
ATOM   5656 C CB  . VAL D 1 182 ? 16.358 17.364 -16.897 1.00 37.72  ? 1375 VAL D CB  1 
ATOM   5657 C CG1 . VAL D 1 182 ? 16.183 18.167 -18.180 1.00 33.63  ? 1375 VAL D CG1 1 
ATOM   5658 C CG2 . VAL D 1 182 ? 17.833 17.178 -16.577 1.00 39.64  ? 1375 VAL D CG2 1 
ATOM   5659 N N   . ILE D 1 183 ? 13.380 17.253 -16.044 1.00 34.42  ? 1376 ILE D N   1 
ATOM   5660 C CA  . ILE D 1 183 ? 11.977 17.397 -16.400 1.00 28.92  ? 1376 ILE D CA  1 
ATOM   5661 C C   . ILE D 1 183 ? 11.250 18.387 -15.495 1.00 30.81  ? 1376 ILE D C   1 
ATOM   5662 O O   . ILE D 1 183 ? 10.519 19.247 -15.990 1.00 31.31  ? 1376 ILE D O   1 
ATOM   5663 C CB  . ILE D 1 183 ? 11.225 16.055 -16.430 1.00 27.67  ? 1376 ILE D CB  1 
ATOM   5664 C CG1 . ILE D 1 183 ? 11.791 15.171 -17.531 1.00 31.71  ? 1376 ILE D CG1 1 
ATOM   5665 C CG2 . ILE D 1 183 ? 9.745  16.289 -16.708 1.00 24.19  ? 1376 ILE D CG2 1 
ATOM   5666 C CD1 . ILE D 1 183 ? 11.759 15.831 -18.888 1.00 28.52  ? 1376 ILE D CD1 1 
ATOM   5667 N N   . SER D 1 184 ? 11.435 18.285 -14.180 1.00 26.46  ? 1377 SER D N   1 
ATOM   5668 C CA  . SER D 1 184 ? 10.734 19.223 -13.304 1.00 30.08  ? 1377 SER D CA  1 
ATOM   5669 C C   . SER D 1 184 ? 11.174 20.650 -13.600 1.00 34.16  ? 1377 SER D C   1 
ATOM   5670 O O   . SER D 1 184 ? 10.342 21.564 -13.655 1.00 34.87  ? 1377 SER D O   1 
ATOM   5671 C CB  . SER D 1 184 ? 10.883 18.879 -11.823 1.00 20.27  ? 1377 SER D CB  1 
ATOM   5672 O OG  . SER D 1 184 ? 11.731 17.772 -11.646 1.00 39.87  ? 1377 SER D OG  1 
ATOM   5673 N N   . HIS D 1 185 ? 12.475 20.828 -13.827 1.00 27.72  ? 1378 HIS D N   1 
ATOM   5674 C CA  . HIS D 1 185 ? 12.990 22.122 -14.249 1.00 22.58  ? 1378 HIS D CA  1 
ATOM   5675 C C   . HIS D 1 185 ? 12.228 22.637 -15.473 1.00 29.24  ? 1378 HIS D C   1 
ATOM   5676 O O   . HIS D 1 185 ? 11.772 23.779 -15.498 1.00 29.89  ? 1378 HIS D O   1 
ATOM   5677 C CB  . HIS D 1 185 ? 14.483 22.046 -14.551 1.00 20.41  ? 1378 HIS D CB  1 
ATOM   5678 C CG  . HIS D 1 185 ? 15.016 23.271 -15.225 1.00 28.22  ? 1378 HIS D CG  1 
ATOM   5679 N ND1 . HIS D 1 185 ? 14.916 24.528 -14.668 1.00 33.75  ? 1378 HIS D ND1 1 
ATOM   5680 C CD2 . HIS D 1 185 ? 15.639 23.436 -16.417 1.00 31.37  ? 1378 HIS D CD2 1 
ATOM   5681 C CE1 . HIS D 1 185 ? 15.458 25.413 -15.486 1.00 32.12  ? 1378 HIS D CE1 1 
ATOM   5682 N NE2 . HIS D 1 185 ? 15.902 24.777 -16.556 1.00 33.27  ? 1378 HIS D NE2 1 
ATOM   5683 N N   . LEU D 1 186 ? 12.091 21.786 -16.486 1.00 29.74  ? 1379 LEU D N   1 
ATOM   5684 C CA  . LEU D 1 186 ? 11.399 22.161 -17.706 1.00 23.41  ? 1379 LEU D CA  1 
ATOM   5685 C C   . LEU D 1 186 ? 9.938  22.471 -17.405 1.00 29.23  ? 1379 LEU D C   1 
ATOM   5686 O O   . LEU D 1 186 ? 9.344  23.392 -17.973 1.00 29.25  ? 1379 LEU D O   1 
ATOM   5687 C CB  . LEU D 1 186 ? 11.503 21.042 -18.740 1.00 24.77  ? 1379 LEU D CB  1 
ATOM   5688 C CG  . LEU D 1 186 ? 12.890 20.818 -19.356 1.00 33.59  ? 1379 LEU D CG  1 
ATOM   5689 C CD1 . LEU D 1 186 ? 12.794 19.845 -20.504 1.00 29.79  ? 1379 LEU D CD1 1 
ATOM   5690 C CD2 . LEU D 1 186 ? 13.497 22.124 -19.837 1.00 29.84  ? 1379 LEU D CD2 1 
ATOM   5691 N N   . ASN D 1 187 ? 9.357  21.695 -16.500 1.00 30.96  ? 1380 ASN D N   1 
ATOM   5692 C CA  . ASN D 1 187 ? 7.983  21.924 -16.113 1.00 24.53  ? 1380 ASN D CA  1 
ATOM   5693 C C   . ASN D 1 187 ? 7.857  23.337 -15.570 1.00 33.54  ? 1380 ASN D C   1 
ATOM   5694 O O   . ASN D 1 187 ? 6.870  24.031 -15.818 1.00 33.66  ? 1380 ASN D O   1 
ATOM   5695 C CB  . ASN D 1 187 ? 7.555  20.929 -15.045 1.00 19.89  ? 1380 ASN D CB  1 
ATOM   5696 C CG  . ASN D 1 187 ? 6.161  21.200 -14.547 1.00 26.10  ? 1380 ASN D CG  1 
ATOM   5697 O OD1 . ASN D 1 187 ? 5.960  21.743 -13.457 1.00 23.32  ? 1380 ASN D OD1 1 
ATOM   5698 N ND2 . ASN D 1 187 ? 5.179  20.862 -15.368 1.00 24.77  ? 1380 ASN D ND2 1 
ATOM   5699 N N   . LYS D 1 188 ? 8.871  23.764 -14.824 1.00 26.75  ? 1381 LYS D N   1 
ATOM   5700 C CA  . LYS D 1 188 ? 8.862  25.103 -14.257 1.00 30.98  ? 1381 LYS D CA  1 
ATOM   5701 C C   . LYS D 1 188 ? 9.001  26.175 -15.343 1.00 30.56  ? 1381 LYS D C   1 
ATOM   5702 O O   . LYS D 1 188 ? 8.201  27.110 -15.419 1.00 25.78  ? 1381 LYS D O   1 
ATOM   5703 C CB  . LYS D 1 188 ? 9.948  25.256 -13.183 1.00 29.11  ? 1381 LYS D CB  1 
ATOM   5704 C CG  . LYS D 1 188 ? 9.808  26.537 -12.373 1.00 34.81  ? 1381 LYS D CG  1 
ATOM   5705 C CD  . LYS D 1 188 ? 10.969 26.726 -11.425 1.00 41.94  ? 1381 LYS D CD  1 
ATOM   5706 C CE  . LYS D 1 188 ? 10.891 25.786 -10.236 1.00 40.39  ? 1381 LYS D CE  1 
ATOM   5707 N NZ  . LYS D 1 188 ? 11.748 26.314 -9.131  1.00 55.94  ? 1381 LYS D NZ  1 
ATOM   5708 N N   . VAL D 1 189 ? 10.007 26.035 -16.193 1.00 25.60  ? 1382 VAL D N   1 
ATOM   5709 C CA  . VAL D 1 189 ? 10.171 26.992 -17.268 1.00 25.86  ? 1382 VAL D CA  1 
ATOM   5710 C C   . VAL D 1 189 ? 8.832  27.160 -17.979 1.00 28.82  ? 1382 VAL D C   1 
ATOM   5711 O O   . VAL D 1 189 ? 8.454  28.269 -18.377 1.00 27.77  ? 1382 VAL D O   1 
ATOM   5712 C CB  . VAL D 1 189 ? 11.238 26.547 -18.275 1.00 26.48  ? 1382 VAL D CB  1 
ATOM   5713 C CG1 . VAL D 1 189 ? 11.271 27.500 -19.448 1.00 18.61  ? 1382 VAL D CG1 1 
ATOM   5714 C CG2 . VAL D 1 189 ? 12.614 26.441 -17.599 1.00 20.28  ? 1382 VAL D CG2 1 
ATOM   5715 N N   . SER D 1 190 ? 8.099  26.057 -18.113 1.00 24.33  ? 1383 SER D N   1 
ATOM   5716 C CA  . SER D 1 190 ? 6.859  26.074 -18.882 1.00 26.05  ? 1383 SER D CA  1 
ATOM   5717 C C   . SER D 1 190 ? 5.757  26.869 -18.200 1.00 26.65  ? 1383 SER D C   1 
ATOM   5718 O O   . SER D 1 190 ? 4.827  27.336 -18.866 1.00 22.30  ? 1383 SER D O   1 
ATOM   5719 C CB  . SER D 1 190 ? 6.370  24.660 -19.154 1.00 23.72  ? 1383 SER D CB  1 
ATOM   5720 O OG  . SER D 1 190 ? 5.501  24.240 -18.115 1.00 30.19  ? 1383 SER D OG  1 
ATOM   5721 N N   . HIS D 1 191 ? 5.852  27.016 -16.879 1.00 26.34  ? 1384 HIS D N   1 
ATOM   5722 C CA  . HIS D 1 191 ? 4.833  27.755 -16.135 1.00 23.02  ? 1384 HIS D CA  1 
ATOM   5723 C C   . HIS D 1 191 ? 4.861  29.249 -16.434 1.00 32.78  ? 1384 HIS D C   1 
ATOM   5724 O O   . HIS D 1 191 ? 3.934  29.970 -16.077 1.00 29.23  ? 1384 HIS D O   1 
ATOM   5725 C CB  . HIS D 1 191 ? 4.971  27.540 -14.636 1.00 30.16  ? 1384 HIS D CB  1 
ATOM   5726 C CG  . HIS D 1 191 ? 4.640  26.152 -14.189 1.00 49.27  ? 1384 HIS D CG  1 
ATOM   5727 N ND1 . HIS D 1 191 ? 3.844  25.303 -14.929 1.00 44.62  ? 1384 HIS D ND1 1 
ATOM   5728 C CD2 . HIS D 1 191 ? 4.971  25.476 -13.062 1.00 43.62  ? 1384 HIS D CD2 1 
ATOM   5729 C CE1 . HIS D 1 191 ? 3.715  24.155 -14.287 1.00 49.06  ? 1384 HIS D CE1 1 
ATOM   5730 N NE2 . HIS D 1 191 ? 4.388  24.234 -13.151 1.00 54.81  ? 1384 HIS D NE2 1 
ATOM   5731 N N   . ASN D 1 192 ? 5.931  29.708 -17.076 1.00 30.23  ? 1385 ASN D N   1 
ATOM   5732 C CA  . ASN D 1 192 ? 6.043  31.103 -17.476 1.00 33.07  ? 1385 ASN D CA  1 
ATOM   5733 C C   . ASN D 1 192 ? 5.955  31.290 -19.010 1.00 44.40  ? 1385 ASN D C   1 
ATOM   5734 O O   . ASN D 1 192 ? 6.554  32.214 -19.579 1.00 39.58  ? 1385 ASN D O   1 
ATOM   5735 C CB  . ASN D 1 192 ? 7.350  31.694 -16.938 1.00 31.12  ? 1385 ASN D CB  1 
ATOM   5736 C CG  . ASN D 1 192 ? 7.292  33.202 -16.812 1.00 38.20  ? 1385 ASN D CG  1 
ATOM   5737 O OD1 . ASN D 1 192 ? 6.264  33.755 -16.412 1.00 29.27  ? 1385 ASN D OD1 1 
ATOM   5738 N ND2 . ASN D 1 192 ? 8.389  33.879 -17.162 1.00 27.47  ? 1385 ASN D ND2 1 
ATOM   5739 N N   . ASN D 1 193 ? 5.201  30.417 -19.676 1.00 38.72  ? 1386 ASN D N   1 
ATOM   5740 C CA  . ASN D 1 193 ? 5.193  30.397 -21.138 1.00 32.50  ? 1386 ASN D CA  1 
ATOM   5741 C C   . ASN D 1 193 ? 4.583  31.651 -21.759 1.00 34.67  ? 1386 ASN D C   1 
ATOM   5742 O O   . ASN D 1 193 ? 4.970  32.049 -22.849 1.00 39.34  ? 1386 ASN D O   1 
ATOM   5743 C CB  . ASN D 1 193 ? 4.532  29.114 -21.686 1.00 30.55  ? 1386 ASN D CB  1 
ATOM   5744 C CG  . ASN D 1 193 ? 3.038  29.020 -21.350 1.00 34.94  ? 1386 ASN D CG  1 
ATOM   5745 O OD1 . ASN D 1 193 ? 2.188  29.654 -21.990 1.00 26.11  ? 1386 ASN D OD1 1 
ATOM   5746 N ND2 . ASN D 1 193 ? 2.718  28.213 -20.349 1.00 28.17  ? 1386 ASN D ND2 1 
ATOM   5747 N N   . LYS D 1 194 ? 3.637  32.275 -21.065 1.00 29.95  ? 1387 LYS D N   1 
ATOM   5748 C CA  . LYS D 1 194 ? 3.039  33.517 -21.551 1.00 30.62  ? 1387 LYS D CA  1 
ATOM   5749 C C   . LYS D 1 194 ? 4.146  34.527 -21.835 1.00 40.38  ? 1387 LYS D C   1 
ATOM   5750 O O   . LYS D 1 194 ? 4.057  35.334 -22.760 1.00 40.70  ? 1387 LYS D O   1 
ATOM   5751 C CB  . LYS D 1 194 ? 2.101  34.126 -20.509 1.00 38.26  ? 1387 LYS D CB  1 
ATOM   5752 C CG  . LYS D 1 194 ? 0.992  33.237 -20.021 1.00 49.97  ? 1387 LYS D CG  1 
ATOM   5753 C CD  . LYS D 1 194 ? -0.292 33.497 -20.775 1.00 37.78  ? 1387 LYS D CD  1 
ATOM   5754 C CE  . LYS D 1 194 ? -1.498 33.211 -19.884 1.00 45.54  ? 1387 LYS D CE  1 
ATOM   5755 N NZ  . LYS D 1 194 ? -2.752 33.060 -20.673 1.00 57.31  ? 1387 LYS D NZ  1 
ATOM   5756 N N   . VAL D 1 195 ? 5.187  34.487 -21.014 1.00 37.11  ? 1388 VAL D N   1 
ATOM   5757 C CA  . VAL D 1 195 ? 6.289  35.422 -21.154 1.00 35.56  ? 1388 VAL D CA  1 
ATOM   5758 C C   . VAL D 1 195 ? 7.422  34.832 -21.977 1.00 34.32  ? 1388 VAL D C   1 
ATOM   5759 O O   . VAL D 1 195 ? 7.823  35.425 -22.976 1.00 48.77  ? 1388 VAL D O   1 
ATOM   5760 C CB  . VAL D 1 195 ? 6.833  35.861 -19.780 1.00 45.91  ? 1388 VAL D CB  1 
ATOM   5761 C CG1 . VAL D 1 195 ? 8.163  36.610 -19.938 1.00 27.61  ? 1388 VAL D CG1 1 
ATOM   5762 C CG2 . VAL D 1 195 ? 5.794  36.703 -19.042 1.00 37.84  ? 1388 VAL D CG2 1 
ATOM   5763 N N   . ASN D 1 196 ? 7.940  33.675 -21.563 1.00 29.39  ? 1389 ASN D N   1 
ATOM   5764 C CA  . ASN D 1 196 ? 9.109  33.100 -22.230 1.00 35.79  ? 1389 ASN D CA  1 
ATOM   5765 C C   . ASN D 1 196 ? 8.763  32.317 -23.496 1.00 36.27  ? 1389 ASN D C   1 
ATOM   5766 O O   . ASN D 1 196 ? 9.659  31.914 -24.245 1.00 35.84  ? 1389 ASN D O   1 
ATOM   5767 C CB  . ASN D 1 196 ? 9.959  32.259 -21.269 1.00 29.13  ? 1389 ASN D CB  1 
ATOM   5768 C CG  . ASN D 1 196 ? 9.220  31.048 -20.739 1.00 33.49  ? 1389 ASN D CG  1 
ATOM   5769 O OD1 . ASN D 1 196 ? 8.373  30.473 -21.417 1.00 36.08  ? 1389 ASN D OD1 1 
ATOM   5770 N ND2 . ASN D 1 196 ? 9.543  30.649 -19.521 1.00 31.65  ? 1389 ASN D ND2 1 
ATOM   5771 N N   . LEU D 1 197 ? 7.466  32.106 -23.716 1.00 29.03  ? 1390 LEU D N   1 
ATOM   5772 C CA  . LEU D 1 197 ? 6.961  31.526 -24.959 1.00 34.08  ? 1390 LEU D CA  1 
ATOM   5773 C C   . LEU D 1 197 ? 7.216  30.028 -25.083 1.00 43.27  ? 1390 LEU D C   1 
ATOM   5774 O O   . LEU D 1 197 ? 6.901  29.422 -26.118 1.00 39.77  ? 1390 LEU D O   1 
ATOM   5775 C CB  . LEU D 1 197 ? 7.569  32.228 -26.166 1.00 41.25  ? 1390 LEU D CB  1 
ATOM   5776 C CG  . LEU D 1 197 ? 7.419  33.737 -26.261 1.00 42.84  ? 1390 LEU D CG  1 
ATOM   5777 C CD1 . LEU D 1 197 ? 8.019  34.214 -27.590 1.00 43.95  ? 1390 LEU D CD1 1 
ATOM   5778 C CD2 . LEU D 1 197 ? 5.940  34.124 -26.117 1.00 25.02  ? 1390 LEU D CD2 1 
ATOM   5779 N N   . MET D 1 198 ? 7.788  29.435 -24.042 1.00 34.57  ? 1391 MET D N   1 
ATOM   5780 C CA  . MET D 1 198 ? 8.138  28.027 -24.103 1.00 34.94  ? 1391 MET D CA  1 
ATOM   5781 C C   . MET D 1 198 ? 7.122  27.179 -23.355 1.00 33.66  ? 1391 MET D C   1 
ATOM   5782 O O   . MET D 1 198 ? 7.278  26.909 -22.167 1.00 37.52  ? 1391 MET D O   1 
ATOM   5783 C CB  . MET D 1 198 ? 9.554  27.804 -23.573 1.00 32.36  ? 1391 MET D CB  1 
ATOM   5784 C CG  . MET D 1 198 ? 10.606 28.554 -24.367 1.00 31.26  ? 1391 MET D CG  1 
ATOM   5785 S SD  . MET D 1 198 ? 10.440 28.198 -26.129 1.00 42.06  ? 1391 MET D SD  1 
ATOM   5786 C CE  . MET D 1 198 ? 11.297 26.605 -26.253 1.00 24.75  ? 1391 MET D CE  1 
ATOM   5787 N N   . THR D 1 199 ? 6.064  26.793 -24.060 1.00 29.78  ? 1392 THR D N   1 
ATOM   5788 C CA  . THR D 1 199 ? 5.122  25.791 -23.568 1.00 32.53  ? 1392 THR D CA  1 
ATOM   5789 C C   . THR D 1 199 ? 5.816  24.422 -23.425 1.00 38.36  ? 1392 THR D C   1 
ATOM   5790 O O   . THR D 1 199 ? 6.937  24.221 -23.910 1.00 32.49  ? 1392 THR D O   1 
ATOM   5791 C CB  . THR D 1 199 ? 3.894  25.674 -24.501 1.00 37.62  ? 1392 THR D CB  1 
ATOM   5792 O OG1 . THR D 1 199 ? 4.318  25.469 -25.863 1.00 33.56  ? 1392 THR D OG1 1 
ATOM   5793 C CG2 . THR D 1 199 ? 3.042  26.946 -24.417 1.00 16.48  ? 1392 THR D CG2 1 
ATOM   5794 N N   . SER D 1 200 ? 5.175  23.486 -22.738 1.00 40.00  ? 1393 SER D N   1 
ATOM   5795 C CA  . SER D 1 200 ? 5.767  22.163 -22.606 1.00 34.81  ? 1393 SER D CA  1 
ATOM   5796 C C   . SER D 1 200 ? 5.985  21.520 -23.979 1.00 37.75  ? 1393 SER D C   1 
ATOM   5797 O O   . SER D 1 200 ? 6.979  20.818 -24.195 1.00 31.95  ? 1393 SER D O   1 
ATOM   5798 C CB  . SER D 1 200 ? 4.933  21.273 -21.686 1.00 28.37  ? 1393 SER D CB  1 
ATOM   5799 O OG  . SER D 1 200 ? 3.647  21.821 -21.477 1.00 61.73  ? 1393 SER D OG  1 
ATOM   5800 N N   . GLU D 1 201 ? 5.075  21.780 -24.914 1.00 36.36  ? 1394 GLU D N   1 
ATOM   5801 C CA  . GLU D 1 201 ? 5.258  21.282 -26.272 1.00 32.31  ? 1394 GLU D CA  1 
ATOM   5802 C C   . GLU D 1 201 ? 6.576  21.792 -26.839 1.00 35.90  ? 1394 GLU D C   1 
ATOM   5803 O O   . GLU D 1 201 ? 7.409  21.012 -27.315 1.00 31.92  ? 1394 GLU D O   1 
ATOM   5804 C CB  . GLU D 1 201 ? 4.104  21.703 -27.174 1.00 34.69  ? 1394 GLU D CB  1 
ATOM   5805 C CG  . GLU D 1 201 ? 4.331  21.375 -28.643 1.00 42.77  ? 1394 GLU D CG  1 
ATOM   5806 C CD  . GLU D 1 201 ? 3.154  21.765 -29.522 1.00 59.22  ? 1394 GLU D CD  1 
ATOM   5807 O OE1 . GLU D 1 201 ? 2.500  22.788 -29.224 1.00 60.94  ? 1394 GLU D OE1 1 
ATOM   5808 O OE2 . GLU D 1 201 ? 2.885  21.048 -30.511 1.00 55.78  ? 1394 GLU D OE2 1 
ATOM   5809 N N   . ASN D 1 202 ? 6.766  23.106 -26.782 1.00 27.04  ? 1395 ASN D N   1 
ATOM   5810 C CA  . ASN D 1 202 ? 7.994  23.704 -27.280 1.00 26.22  ? 1395 ASN D CA  1 
ATOM   5811 C C   . ASN D 1 202 ? 9.225  23.140 -26.589 1.00 32.34  ? 1395 ASN D C   1 
ATOM   5812 O O   . ASN D 1 202 ? 10.220 22.829 -27.238 1.00 33.77  ? 1395 ASN D O   1 
ATOM   5813 C CB  . ASN D 1 202 ? 7.957  25.220 -27.124 1.00 32.82  ? 1395 ASN D CB  1 
ATOM   5814 C CG  . ASN D 1 202 ? 6.971  25.875 -28.069 1.00 39.27  ? 1395 ASN D CG  1 
ATOM   5815 O OD1 . ASN D 1 202 ? 6.444  25.235 -28.985 1.00 38.09  ? 1395 ASN D OD1 1 
ATOM   5816 N ND2 . ASN D 1 202 ? 6.713  27.157 -27.851 1.00 50.00  ? 1395 ASN D ND2 1 
ATOM   5817 N N   . LEU D 1 203 ? 9.156  22.994 -25.272 1.00 33.32  ? 1396 LEU D N   1 
ATOM   5818 C CA  . LEU D 1 203 ? 10.307 22.526 -24.520 1.00 24.57  ? 1396 LEU D CA  1 
ATOM   5819 C C   . LEU D 1 203 ? 10.741 21.121 -24.919 1.00 31.65  ? 1396 LEU D C   1 
ATOM   5820 O O   . LEU D 1 203 ? 11.945 20.855 -25.015 1.00 33.72  ? 1396 LEU D O   1 
ATOM   5821 C CB  . LEU D 1 203 ? 10.056 22.633 -23.023 1.00 27.32  ? 1396 LEU D CB  1 
ATOM   5822 C CG  . LEU D 1 203 ? 10.131 24.077 -22.542 1.00 27.69  ? 1396 LEU D CG  1 
ATOM   5823 C CD1 . LEU D 1 203 ? 9.543  24.254 -21.150 1.00 26.88  ? 1396 LEU D CD1 1 
ATOM   5824 C CD2 . LEU D 1 203 ? 11.580 24.531 -22.587 1.00 30.05  ? 1396 LEU D CD2 1 
ATOM   5825 N N   . SER D 1 204 ? 9.784  20.221 -25.158 1.00 26.32  ? 1397 SER D N   1 
ATOM   5826 C CA  . SER D 1 204 ? 10.143 18.879 -25.649 1.00 37.47  ? 1397 SER D CA  1 
ATOM   5827 C C   . SER D 1 204 ? 10.786 18.947 -27.025 1.00 39.72  ? 1397 SER D C   1 
ATOM   5828 O O   . SER D 1 204 ? 11.684 18.164 -27.332 1.00 38.45  ? 1397 SER D O   1 
ATOM   5829 C CB  . SER D 1 204 ? 8.952  17.916 -25.687 1.00 29.66  ? 1397 SER D CB  1 
ATOM   5830 O OG  . SER D 1 204 ? 7.821  18.513 -26.295 1.00 48.37  ? 1397 SER D OG  1 
ATOM   5831 N N   . ILE D 1 205 ? 10.322 19.884 -27.849 1.00 30.71  ? 1398 ILE D N   1 
ATOM   5832 C CA  . ILE D 1 205 ? 10.903 20.079 -29.169 1.00 28.12  ? 1398 ILE D CA  1 
ATOM   5833 C C   . ILE D 1 205 ? 12.398 20.381 -29.056 1.00 28.82  ? 1398 ILE D C   1 
ATOM   5834 O O   . ILE D 1 205 ? 13.193 19.895 -29.850 1.00 32.24  ? 1398 ILE D O   1 
ATOM   5835 C CB  . ILE D 1 205 ? 10.167 21.181 -29.957 1.00 29.24  ? 1398 ILE D CB  1 
ATOM   5836 C CG1 . ILE D 1 205 ? 8.746  20.723 -30.303 1.00 28.61  ? 1398 ILE D CG1 1 
ATOM   5837 C CG2 . ILE D 1 205 ? 10.922 21.541 -31.218 1.00 19.39  ? 1398 ILE D CG2 1 
ATOM   5838 C CD1 . ILE D 1 205 ? 7.900  21.784 -30.983 1.00 21.16  ? 1398 ILE D CD1 1 
ATOM   5839 N N   . CYS D 1 206 ? 12.786 21.158 -28.052 1.00 28.71  ? 1399 CYS D N   1 
ATOM   5840 C CA  . CYS D 1 206 ? 14.203 21.451 -27.846 1.00 37.59  ? 1399 CYS D CA  1 
ATOM   5841 C C   . CYS D 1 206 ? 14.931 20.295 -27.183 1.00 39.89  ? 1399 CYS D C   1 
ATOM   5842 O O   . CYS D 1 206 ? 16.159 20.201 -27.260 1.00 37.56  ? 1399 CYS D O   1 
ATOM   5843 C CB  . CYS D 1 206 ? 14.388 22.682 -26.962 1.00 33.60  ? 1399 CYS D CB  1 
ATOM   5844 S SG  . CYS D 1 206 ? 13.362 24.054 -27.416 1.00 52.97  ? 1399 CYS D SG  1 
ATOM   5845 N N   . PHE D 1 207 ? 14.187 19.425 -26.510 1.00 28.43  ? 1400 PHE D N   1 
ATOM   5846 C CA  . PHE D 1 207 ? 14.848 18.481 -25.630 1.00 33.72  ? 1400 PHE D CA  1 
ATOM   5847 C C   . PHE D 1 207 ? 14.863 17.013 -26.054 1.00 33.74  ? 1400 PHE D C   1 
ATOM   5848 O O   . PHE D 1 207 ? 15.823 16.303 -25.758 1.00 36.41  ? 1400 PHE D O   1 
ATOM   5849 C CB  . PHE D 1 207 ? 14.365 18.656 -24.186 1.00 32.17  ? 1400 PHE D CB  1 
ATOM   5850 C CG  . PHE D 1 207 ? 15.206 19.604 -23.390 1.00 26.95  ? 1400 PHE D CG  1 
ATOM   5851 C CD1 . PHE D 1 207 ? 16.411 19.188 -22.837 1.00 27.27  ? 1400 PHE D CD1 1 
ATOM   5852 C CD2 . PHE D 1 207 ? 14.810 20.916 -23.212 1.00 29.22  ? 1400 PHE D CD2 1 
ATOM   5853 C CE1 . PHE D 1 207 ? 17.199 20.068 -22.104 1.00 26.90  ? 1400 PHE D CE1 1 
ATOM   5854 C CE2 . PHE D 1 207 ? 15.602 21.809 -22.478 1.00 33.09  ? 1400 PHE D CE2 1 
ATOM   5855 C CZ  . PHE D 1 207 ? 16.795 21.383 -21.924 1.00 28.57  ? 1400 PHE D CZ  1 
ATOM   5856 N N   . TRP D 1 208 ? 13.828 16.544 -26.740 1.00 29.32  ? 1401 TRP D N   1 
ATOM   5857 C CA  . TRP D 1 208 ? 13.750 15.102 -26.998 1.00 36.00  ? 1401 TRP D CA  1 
ATOM   5858 C C   . TRP D 1 208 ? 14.936 14.548 -27.806 1.00 35.83  ? 1401 TRP D C   1 
ATOM   5859 O O   . TRP D 1 208 ? 15.406 13.439 -27.532 1.00 35.59  ? 1401 TRP D O   1 
ATOM   5860 C CB  . TRP D 1 208 ? 12.395 14.668 -27.584 1.00 31.92  ? 1401 TRP D CB  1 
ATOM   5861 C CG  . TRP D 1 208 ? 12.167 15.071 -28.997 1.00 30.18  ? 1401 TRP D CG  1 
ATOM   5862 C CD1 . TRP D 1 208 ? 11.357 16.073 -29.441 1.00 35.43  ? 1401 TRP D CD1 1 
ATOM   5863 C CD2 . TRP D 1 208 ? 12.752 14.482 -30.156 1.00 31.77  ? 1401 TRP D CD2 1 
ATOM   5864 N NE1 . TRP D 1 208 ? 11.408 16.150 -30.810 1.00 42.64  ? 1401 TRP D NE1 1 
ATOM   5865 C CE2 . TRP D 1 208 ? 12.260 15.184 -31.273 1.00 36.82  ? 1401 TRP D CE2 1 
ATOM   5866 C CE3 . TRP D 1 208 ? 13.655 13.436 -30.359 1.00 27.58  ? 1401 TRP D CE3 1 
ATOM   5867 C CZ2 . TRP D 1 208 ? 12.632 14.868 -32.576 1.00 41.49  ? 1401 TRP D CZ2 1 
ATOM   5868 C CZ3 . TRP D 1 208 ? 14.024 13.125 -31.651 1.00 37.00  ? 1401 TRP D CZ3 1 
ATOM   5869 C CH2 . TRP D 1 208 ? 13.515 13.836 -32.745 1.00 42.62  ? 1401 TRP D CH2 1 
ATOM   5870 N N   . PRO D 1 209 ? 15.437 15.314 -28.789 1.00 35.44  ? 1402 PRO D N   1 
ATOM   5871 C CA  . PRO D 1 209 ? 16.613 14.772 -29.473 1.00 30.14  ? 1402 PRO D CA  1 
ATOM   5872 C C   . PRO D 1 209 ? 17.790 14.675 -28.511 1.00 26.07  ? 1402 PRO D C   1 
ATOM   5873 O O   . PRO D 1 209 ? 18.521 13.696 -28.520 1.00 33.82  ? 1402 PRO D O   1 
ATOM   5874 C CB  . PRO D 1 209 ? 16.879 15.798 -30.577 1.00 21.19  ? 1402 PRO D CB  1 
ATOM   5875 C CG  . PRO D 1 209 ? 15.545 16.456 -30.807 1.00 24.44  ? 1402 PRO D CG  1 
ATOM   5876 C CD  . PRO D 1 209 ? 14.942 16.542 -29.437 1.00 33.50  ? 1402 PRO D CD  1 
ATOM   5877 N N   . THR D 1 210 ? 17.950 15.678 -27.667 1.00 27.40  ? 1403 THR D N   1 
ATOM   5878 C CA  . THR D 1 210 ? 19.084 15.705 -26.766 1.00 35.87  ? 1403 THR D CA  1 
ATOM   5879 C C   . THR D 1 210 ? 19.002 14.546 -25.767 1.00 44.77  ? 1403 THR D C   1 
ATOM   5880 O O   . THR D 1 210 ? 19.987 13.827 -25.533 1.00 46.15  ? 1403 THR D O   1 
ATOM   5881 C CB  . THR D 1 210 ? 19.165 17.060 -26.031 1.00 43.14  ? 1403 THR D CB  1 
ATOM   5882 O OG1 . THR D 1 210 ? 19.216 18.122 -26.995 1.00 34.27  ? 1403 THR D OG1 1 
ATOM   5883 C CG2 . THR D 1 210 ? 20.394 17.120 -25.125 1.00 40.00  ? 1403 THR D CG2 1 
ATOM   5884 N N   . LEU D 1 211 ? 17.816 14.354 -25.200 1.00 32.85  ? 1404 LEU D N   1 
ATOM   5885 C CA  . LEU D 1 211 ? 17.635 13.391 -24.122 1.00 37.19  ? 1404 LEU D CA  1 
ATOM   5886 C C   . LEU D 1 211 ? 17.539 11.956 -24.626 1.00 36.76  ? 1404 LEU D C   1 
ATOM   5887 O O   . LEU D 1 211 ? 17.743 11.012 -23.868 1.00 40.96  ? 1404 LEU D O   1 
ATOM   5888 C CB  . LEU D 1 211 ? 16.403 13.743 -23.272 1.00 33.79  ? 1404 LEU D CB  1 
ATOM   5889 C CG  . LEU D 1 211 ? 16.488 15.096 -22.559 1.00 42.76  ? 1404 LEU D CG  1 
ATOM   5890 C CD1 . LEU D 1 211 ? 15.232 15.414 -21.758 1.00 23.63  ? 1404 LEU D CD1 1 
ATOM   5891 C CD2 . LEU D 1 211 ? 17.717 15.120 -21.667 1.00 46.03  ? 1404 LEU D CD2 1 
ATOM   5892 N N   . MET D 1 212 ? 17.238 11.782 -25.904 1.00 37.08  ? 1405 MET D N   1 
ATOM   5893 C CA  . MET D 1 212 ? 16.998 10.435 -26.407 1.00 37.24  ? 1405 MET D CA  1 
ATOM   5894 C C   . MET D 1 212 ? 17.910 9.970  -27.541 1.00 41.92  ? 1405 MET D C   1 
ATOM   5895 O O   . MET D 1 212 ? 18.157 8.768  -27.671 1.00 43.01  ? 1405 MET D O   1 
ATOM   5896 C CB  . MET D 1 212 ? 15.523 10.259 -26.770 1.00 30.72  ? 1405 MET D CB  1 
ATOM   5897 C CG  . MET D 1 212 ? 14.626 10.294 -25.537 1.00 31.66  ? 1405 MET D CG  1 
ATOM   5898 S SD  . MET D 1 212 ? 12.906 10.071 -25.974 1.00 50.03  ? 1405 MET D SD  1 
ATOM   5899 C CE  . MET D 1 212 ? 12.206 9.702  -24.373 1.00 54.53  ? 1405 MET D CE  1 
ATOM   5900 N N   . ARG D 1 213 ? 18.408 10.900 -28.356 1.00 34.38  ? 1406 ARG D N   1 
ATOM   5901 C CA  . ARG D 1 213 ? 19.343 10.537 -29.424 1.00 39.85  ? 1406 ARG D CA  1 
ATOM   5902 C C   . ARG D 1 213 ? 18.814 9.420  -30.314 1.00 47.85  ? 1406 ARG D C   1 
ATOM   5903 O O   . ARG D 1 213 ? 19.454 8.382  -30.453 1.00 41.52  ? 1406 ARG D O   1 
ATOM   5904 C CB  . ARG D 1 213 ? 20.669 10.057 -28.831 1.00 31.06  ? 1406 ARG D CB  1 
ATOM   5905 C CG  . ARG D 1 213 ? 21.709 11.119 -28.724 1.00 54.22  ? 1406 ARG D CG  1 
ATOM   5906 C CD  . ARG D 1 213 ? 23.075 10.551 -29.010 1.00 34.07  ? 1406 ARG D CD  1 
ATOM   5907 N NE  . ARG D 1 213 ? 23.649 9.890  -27.851 1.00 39.09  ? 1406 ARG D NE  1 
ATOM   5908 C CZ  . ARG D 1 213 ? 24.046 10.534 -26.761 1.00 48.67  ? 1406 ARG D CZ  1 
ATOM   5909 N NH1 . ARG D 1 213 ? 23.897 11.854 -26.677 1.00 49.20  ? 1406 ARG D NH1 1 
ATOM   5910 N NH2 . ARG D 1 213 ? 24.575 9.856  -25.750 1.00 52.73  ? 1406 ARG D NH2 1 
ATOM   5911 N N   . PRO D 1 214 ? 17.645 9.617  -30.917 1.00 42.71  ? 1407 PRO D N   1 
ATOM   5912 C CA  . PRO D 1 214 ? 17.104 8.538  -31.741 1.00 48.02  ? 1407 PRO D CA  1 
ATOM   5913 C C   . PRO D 1 214 ? 18.034 8.269  -32.906 1.00 52.77  ? 1407 PRO D C   1 
ATOM   5914 O O   . PRO D 1 214 ? 18.615 9.215  -33.423 1.00 63.91  ? 1407 PRO D O   1 
ATOM   5915 C CB  . PRO D 1 214 ? 15.784 9.121  -32.257 1.00 56.86  ? 1407 PRO D CB  1 
ATOM   5916 C CG  . PRO D 1 214 ? 15.448 10.210 -31.298 1.00 60.02  ? 1407 PRO D CG  1 
ATOM   5917 C CD  . PRO D 1 214 ? 16.769 10.795 -30.904 1.00 52.30  ? 1407 PRO D CD  1 
ATOM   5918 N N   . ASP D 1 215 ? 18.186 7.009  -33.307 1.00 59.09  ? 1408 ASP D N   1 
ATOM   5919 C CA  . ASP D 1 215 ? 18.931 6.703  -34.520 1.00 54.67  ? 1408 ASP D CA  1 
ATOM   5920 C C   . ASP D 1 215 ? 17.965 6.629  -35.711 1.00 72.75  ? 1408 ASP D C   1 
ATOM   5921 O O   . ASP D 1 215 ? 17.041 5.808  -35.736 1.00 64.39  ? 1408 ASP D O   1 
ATOM   5922 C CB  . ASP D 1 215 ? 19.719 5.409  -34.362 1.00 53.52  ? 1408 ASP D CB  1 
ATOM   5923 C CG  . ASP D 1 215 ? 20.693 5.180  -35.508 1.00 81.64  ? 1408 ASP D CG  1 
ATOM   5924 O OD1 . ASP D 1 215 ? 20.643 5.957  -36.490 1.00 70.18  ? 1408 ASP D OD1 1 
ATOM   5925 O OD2 . ASP D 1 215 ? 21.509 4.230  -35.425 1.00 76.78  ? 1408 ASP D OD2 1 
ATOM   5926 N N   . PHE D 1 216 ? 18.175 7.501  -36.692 1.00 77.75  ? 1409 PHE D N   1 
ATOM   5927 C CA  . PHE D 1 216 ? 17.211 7.657  -37.784 1.00 80.91  ? 1409 PHE D CA  1 
ATOM   5928 C C   . PHE D 1 216 ? 17.483 6.829  -39.042 1.00 90.01  ? 1409 PHE D C   1 
ATOM   5929 O O   . PHE D 1 216 ? 16.970 7.117  -40.120 1.00 79.89  ? 1409 PHE D O   1 
ATOM   5930 C CB  . PHE D 1 216 ? 16.996 9.130  -38.115 1.00 80.85  ? 1409 PHE D CB  1 
ATOM   5931 C CG  . PHE D 1 216 ? 16.073 9.814  -37.165 1.00 63.95  ? 1409 PHE D CG  1 
ATOM   5932 C CD1 . PHE D 1 216 ? 14.925 9.178  -36.739 1.00 59.20  ? 1409 PHE D CD1 1 
ATOM   5933 C CD2 . PHE D 1 216 ? 16.344 11.086 -36.703 1.00 70.25  ? 1409 PHE D CD2 1 
ATOM   5934 C CE1 . PHE D 1 216 ? 14.064 9.792  -35.864 1.00 64.65  ? 1409 PHE D CE1 1 
ATOM   5935 C CE2 . PHE D 1 216 ? 15.483 11.716 -35.830 1.00 67.37  ? 1409 PHE D CE2 1 
ATOM   5936 C CZ  . PHE D 1 216 ? 14.339 11.065 -35.408 1.00 69.12  ? 1409 PHE D CZ  1 
ATOM   5937 N N   . SER D 1 217 ? 18.295 5.794  -38.885 1.00 98.88  ? 1410 SER D N   1 
ATOM   5938 C CA  . SER D 1 217 ? 18.311 4.691  -39.828 1.00 78.83  ? 1410 SER D CA  1 
ATOM   5939 C C   . SER D 1 217 ? 17.655 3.509  -39.107 1.00 99.50  ? 1410 SER D C   1 
ATOM   5940 O O   . SER D 1 217 ? 18.145 2.380  -39.172 1.00 114.41 ? 1410 SER D O   1 
ATOM   5941 C CB  . SER D 1 217 ? 19.744 4.360  -40.240 1.00 58.94  ? 1410 SER D CB  1 
ATOM   5942 N N   . THR D 1 218 ? 16.556 3.789  -38.399 1.00 86.85  ? 1411 THR D N   1 
ATOM   5943 C CA  . THR D 1 218 ? 15.864 2.785  -37.585 1.00 82.87  ? 1411 THR D CA  1 
ATOM   5944 C C   . THR D 1 218 ? 14.369 3.096  -37.453 1.00 89.96  ? 1411 THR D C   1 
ATOM   5945 O O   . THR D 1 218 ? 13.610 2.349  -36.819 1.00 80.02  ? 1411 THR D O   1 
ATOM   5946 C CB  . THR D 1 218 ? 16.476 2.681  -36.172 1.00 60.00  ? 1411 THR D CB  1 
ATOM   5947 N N   . MET D 1 219 ? 13.965 4.211  -38.058 1.00 84.46  ? 1412 MET D N   1 
ATOM   5948 C CA  . MET D 1 219 ? 12.584 4.687  -38.028 1.00 73.73  ? 1412 MET D CA  1 
ATOM   5949 C C   . MET D 1 219 ? 12.468 5.887  -38.956 1.00 70.96  ? 1412 MET D C   1 
ATOM   5950 O O   . MET D 1 219 ? 13.454 6.574  -39.220 1.00 75.62  ? 1412 MET D O   1 
ATOM   5951 C CB  . MET D 1 219 ? 12.197 5.103  -36.611 1.00 51.62  ? 1412 MET D CB  1 
ATOM   5952 C CG  . MET D 1 219 ? 13.250 5.992  -35.949 1.00 83.02  ? 1412 MET D CG  1 
ATOM   5953 S SD  . MET D 1 219 ? 13.341 5.865  -34.144 1.00 107.93 ? 1412 MET D SD  1 
ATOM   5954 C CE  . MET D 1 219 ? 13.394 4.088  -33.939 1.00 69.93  ? 1412 MET D CE  1 
ATOM   5955 N N   . ASP D 1 220 ? 11.266 6.134  -39.457 1.00 59.79  ? 1413 ASP D N   1 
ATOM   5956 C CA  . ASP D 1 220 ? 11.015 7.311  -40.274 1.00 50.94  ? 1413 ASP D CA  1 
ATOM   5957 C C   . ASP D 1 220 ? 11.212 8.560  -39.418 1.00 60.81  ? 1413 ASP D C   1 
ATOM   5958 O O   . ASP D 1 220 ? 10.641 8.670  -38.333 1.00 57.55  ? 1413 ASP D O   1 
ATOM   5959 C CB  . ASP D 1 220 ? 9.594  7.266  -40.822 1.00 50.87  ? 1413 ASP D CB  1 
ATOM   5960 C CG  . ASP D 1 220 ? 9.212  8.526  -41.553 1.00 71.78  ? 1413 ASP D CG  1 
ATOM   5961 O OD1 . ASP D 1 220 ? 10.081 9.103  -42.250 1.00 81.52  ? 1413 ASP D OD1 1 
ATOM   5962 O OD2 . ASP D 1 220 ? 8.034  8.929  -41.435 1.00 73.17  ? 1413 ASP D OD2 1 
ATOM   5963 N N   . ALA D 1 221 ? 12.021 9.497  -39.906 1.00 61.28  ? 1414 ALA D N   1 
ATOM   5964 C CA  . ALA D 1 221 ? 12.361 10.692 -39.137 1.00 53.78  ? 1414 ALA D CA  1 
ATOM   5965 C C   . ALA D 1 221 ? 11.133 11.496 -38.696 1.00 54.34  ? 1414 ALA D C   1 
ATOM   5966 O O   . ALA D 1 221 ? 11.045 11.909 -37.533 1.00 43.05  ? 1414 ALA D O   1 
ATOM   5967 C CB  . ALA D 1 221 ? 13.337 11.569 -39.906 1.00 40.18  ? 1414 ALA D CB  1 
ATOM   5968 N N   . LEU D 1 222 ? 10.183 11.702 -39.606 1.00 46.33  ? 1415 LEU D N   1 
ATOM   5969 C CA  . LEU D 1 222 ? 8.994  12.480 -39.264 1.00 59.82  ? 1415 LEU D CA  1 
ATOM   5970 C C   . LEU D 1 222 ? 8.092  11.792 -38.215 1.00 45.88  ? 1415 LEU D C   1 
ATOM   5971 O O   . LEU D 1 222 ? 7.644  12.438 -37.268 1.00 46.98  ? 1415 LEU D O   1 
ATOM   5972 C CB  . LEU D 1 222 ? 8.209  12.909 -40.520 1.00 47.27  ? 1415 LEU D CB  1 
ATOM   5973 N N   . THR D 1 223 ? 7.831  10.498 -38.369 1.00 43.84  ? 1416 THR D N   1 
ATOM   5974 C CA  . THR D 1 223 ? 6.969  9.793  -37.416 1.00 56.99  ? 1416 THR D CA  1 
ATOM   5975 C C   . THR D 1 223 ? 7.658  9.635  -36.058 1.00 47.23  ? 1416 THR D C   1 
ATOM   5976 O O   . THR D 1 223 ? 7.042  9.789  -35.000 1.00 40.73  ? 1416 THR D O   1 
ATOM   5977 C CB  . THR D 1 223 ? 6.501  8.409  -37.946 1.00 47.05  ? 1416 THR D CB  1 
ATOM   5978 N N   . ALA D 1 224 ? 8.947  9.338  -36.085 1.00 46.54  ? 1417 ALA D N   1 
ATOM   5979 C CA  . ALA D 1 224 ? 9.696  9.241  -34.840 1.00 47.83  ? 1417 ALA D CA  1 
ATOM   5980 C C   . ALA D 1 224 ? 9.728  10.597 -34.153 1.00 50.85  ? 1417 ALA D C   1 
ATOM   5981 O O   . ALA D 1 224 ? 9.797  10.683 -32.928 1.00 49.67  ? 1417 ALA D O   1 
ATOM   5982 C CB  . ALA D 1 224 ? 11.103 8.746  -35.090 1.00 48.78  ? 1417 ALA D CB  1 
ATOM   5983 N N   . THR D 1 225 ? 9.681  11.661 -34.946 1.00 47.08  ? 1418 THR D N   1 
ATOM   5984 C CA  . THR D 1 225 ? 9.653  12.995 -34.380 1.00 33.21  ? 1418 THR D CA  1 
ATOM   5985 C C   . THR D 1 225 ? 8.388  13.243 -33.561 1.00 33.40  ? 1418 THR D C   1 
ATOM   5986 O O   . THR D 1 225 ? 8.478  13.687 -32.417 1.00 33.05  ? 1418 THR D O   1 
ATOM   5987 C CB  . THR D 1 225 ? 9.828  14.065 -35.455 1.00 36.72  ? 1418 THR D CB  1 
ATOM   5988 O OG1 . THR D 1 225 ? 11.158 13.979 -35.975 1.00 44.86  ? 1418 THR D OG1 1 
ATOM   5989 C CG2 . THR D 1 225 ? 9.624  15.454 -34.873 1.00 44.37  ? 1418 THR D CG2 1 
ATOM   5990 N N   . ARG D 1 226 ? 7.221  12.946 -34.127 1.00 23.60  ? 1419 ARG D N   1 
ATOM   5991 C CA  . ARG D 1 226 ? 5.970  13.227 -33.440 1.00 24.85  ? 1419 ARG D CA  1 
ATOM   5992 C C   . ARG D 1 226 ? 5.882  12.384 -32.192 1.00 33.21  ? 1419 ARG D C   1 
ATOM   5993 O O   . ARG D 1 226 ? 5.378  12.830 -31.158 1.00 42.92  ? 1419 ARG D O   1 
ATOM   5994 C CB  . ARG D 1 226 ? 4.755  12.985 -34.349 1.00 23.71  ? 1419 ARG D CB  1 
ATOM   5995 N N   . THR D 1 227 ? 6.403  11.166 -32.282 1.00 36.11  ? 1420 THR D N   1 
ATOM   5996 C CA  . THR D 1 227 ? 6.328  10.224 -31.169 1.00 41.17  ? 1420 THR D CA  1 
ATOM   5997 C C   . THR D 1 227 ? 7.180  10.648 -29.972 1.00 36.17  ? 1420 THR D C   1 
ATOM   5998 O O   . THR D 1 227 ? 6.685  10.758 -28.843 1.00 41.28  ? 1420 THR D O   1 
ATOM   5999 C CB  . THR D 1 227 ? 6.713  8.810  -31.619 1.00 43.52  ? 1420 THR D CB  1 
ATOM   6000 O OG1 . THR D 1 227 ? 5.680  8.303  -32.469 1.00 49.34  ? 1420 THR D OG1 1 
ATOM   6001 C CG2 . THR D 1 227 ? 6.880  7.881  -30.414 1.00 30.25  ? 1420 THR D CG2 1 
ATOM   6002 N N   . TYR D 1 228 ? 8.463  10.876 -30.210 1.00 29.00  ? 1421 TYR D N   1 
ATOM   6003 C CA  . TYR D 1 228 ? 9.327  11.310 -29.134 1.00 35.09  ? 1421 TYR D CA  1 
ATOM   6004 C C   . TYR D 1 228 ? 8.889  12.652 -28.577 1.00 33.86  ? 1421 TYR D C   1 
ATOM   6005 O O   . TYR D 1 228 ? 8.866  12.839 -27.362 1.00 45.92  ? 1421 TYR D O   1 
ATOM   6006 C CB  . TYR D 1 228 ? 10.772 11.366 -29.596 1.00 39.28  ? 1421 TYR D CB  1 
ATOM   6007 C CG  . TYR D 1 228 ? 11.337 10.004 -29.871 1.00 38.16  ? 1421 TYR D CG  1 
ATOM   6008 C CD1 . TYR D 1 228 ? 11.865 9.690  -31.111 1.00 57.53  ? 1421 TYR D CD1 1 
ATOM   6009 C CD2 . TYR D 1 228 ? 11.332 9.030  -28.896 1.00 31.16  ? 1421 TYR D CD2 1 
ATOM   6010 C CE1 . TYR D 1 228 ? 12.382 8.446  -31.364 1.00 57.59  ? 1421 TYR D CE1 1 
ATOM   6011 C CE2 . TYR D 1 228 ? 11.842 7.787  -29.139 1.00 43.40  ? 1421 TYR D CE2 1 
ATOM   6012 C CZ  . TYR D 1 228 ? 12.367 7.497  -30.371 1.00 44.47  ? 1421 TYR D CZ  1 
ATOM   6013 O OH  . TYR D 1 228 ? 12.875 6.246  -30.608 1.00 57.04  ? 1421 TYR D OH  1 
ATOM   6014 N N   . GLN D 1 229 ? 8.537  13.580 -29.460 1.00 26.68  ? 1422 GLN D N   1 
ATOM   6015 C CA  . GLN D 1 229 ? 8.137  14.914 -29.032 1.00 36.67  ? 1422 GLN D CA  1 
ATOM   6016 C C   . GLN D 1 229 ? 7.006  14.837 -28.012 1.00 29.97  ? 1422 GLN D C   1 
ATOM   6017 O O   . GLN D 1 229 ? 7.105  15.405 -26.922 1.00 32.78  ? 1422 GLN D O   1 
ATOM   6018 C CB  . GLN D 1 229 ? 7.729  15.769 -30.235 1.00 37.29  ? 1422 GLN D CB  1 
ATOM   6019 C CG  . GLN D 1 229 ? 6.938  17.027 -29.894 1.00 31.96  ? 1422 GLN D CG  1 
ATOM   6020 C CD  . GLN D 1 229 ? 6.548  17.813 -31.135 1.00 59.84  ? 1422 GLN D CD  1 
ATOM   6021 O OE1 . GLN D 1 229 ? 7.075  17.572 -32.233 1.00 55.77  ? 1422 GLN D OE1 1 
ATOM   6022 N NE2 . GLN D 1 229 ? 5.623  18.759 -30.971 1.00 54.41  ? 1422 GLN D NE2 1 
ATOM   6023 N N   . THR D 1 230 ? 5.946  14.121 -28.367 1.00 20.11  ? 1423 THR D N   1 
ATOM   6024 C CA  . THR D 1 230 ? 4.795  13.945 -27.478 1.00 32.19  ? 1423 THR D CA  1 
ATOM   6025 C C   . THR D 1 230 ? 5.143  13.251 -26.154 1.00 37.61  ? 1423 THR D C   1 
ATOM   6026 O O   . THR D 1 230 ? 4.654  13.642 -25.088 1.00 36.46  ? 1423 THR D O   1 
ATOM   6027 C CB  . THR D 1 230 ? 3.656  13.134 -28.156 1.00 30.89  ? 1423 THR D CB  1 
ATOM   6028 O OG1 . THR D 1 230 ? 3.288  13.745 -29.397 1.00 30.80  ? 1423 THR D OG1 1 
ATOM   6029 C CG2 . THR D 1 230 ? 2.441  13.086 -27.253 1.00 32.79  ? 1423 THR D CG2 1 
ATOM   6030 N N   . ILE D 1 231 ? 5.967  12.208 -26.223 1.00 31.00  ? 1424 ILE D N   1 
ATOM   6031 C CA  . ILE D 1 231 ? 6.343  11.498 -25.011 1.00 32.82  ? 1424 ILE D CA  1 
ATOM   6032 C C   . ILE D 1 231 ? 6.954  12.487 -24.019 1.00 31.53  ? 1424 ILE D C   1 
ATOM   6033 O O   . ILE D 1 231 ? 6.473  12.615 -22.890 1.00 29.37  ? 1424 ILE D O   1 
ATOM   6034 C CB  . ILE D 1 231 ? 7.292  10.310 -25.306 1.00 42.99  ? 1424 ILE D CB  1 
ATOM   6035 C CG1 . ILE D 1 231 ? 6.558  9.238  -26.119 1.00 35.60  ? 1424 ILE D CG1 1 
ATOM   6036 C CG2 . ILE D 1 231 ? 7.826  9.702  -24.013 1.00 31.43  ? 1424 ILE D CG2 1 
ATOM   6037 C CD1 . ILE D 1 231 ? 7.410  8.026  -26.451 1.00 23.71  ? 1424 ILE D CD1 1 
ATOM   6038 N N   . ILE D 1 232 ? 7.983  13.213 -24.454 1.00 24.10  ? 1425 ILE D N   1 
ATOM   6039 C CA  . ILE D 1 232 ? 8.651  14.164 -23.578 1.00 25.10  ? 1425 ILE D CA  1 
ATOM   6040 C C   . ILE D 1 232 ? 7.712  15.289 -23.136 1.00 28.74  ? 1425 ILE D C   1 
ATOM   6041 O O   . ILE D 1 232 ? 7.784  15.765 -21.996 1.00 37.22  ? 1425 ILE D O   1 
ATOM   6042 C CB  . ILE D 1 232 ? 9.932  14.719 -24.216 1.00 29.62  ? 1425 ILE D CB  1 
ATOM   6043 C CG1 . ILE D 1 232 ? 10.920 13.577 -24.430 1.00 30.10  ? 1425 ILE D CG1 1 
ATOM   6044 C CG2 . ILE D 1 232 ? 10.578 15.777 -23.309 1.00 23.32  ? 1425 ILE D CG2 1 
ATOM   6045 C CD1 . ILE D 1 232 ? 11.477 13.026 -23.120 1.00 28.95  ? 1425 ILE D CD1 1 
ATOM   6046 N N   . GLU D 1 233 ? 6.813  15.700 -24.021 1.00 24.74  ? 1426 GLU D N   1 
ATOM   6047 C CA  . GLU D 1 233 ? 5.850  16.735 -23.660 1.00 26.95  ? 1426 GLU D CA  1 
ATOM   6048 C C   . GLU D 1 233 ? 4.995  16.256 -22.488 1.00 29.09  ? 1426 GLU D C   1 
ATOM   6049 O O   . GLU D 1 233 ? 4.680  17.040 -21.597 1.00 31.45  ? 1426 GLU D O   1 
ATOM   6050 C CB  . GLU D 1 233 ? 4.983  17.122 -24.863 1.00 30.84  ? 1426 GLU D CB  1 
ATOM   6051 C CG  . GLU D 1 233 ? 3.790  18.035 -24.559 1.00 33.84  ? 1426 GLU D CG  1 
ATOM   6052 C CD  . GLU D 1 233 ? 3.081  18.499 -25.838 1.00 55.53  ? 1426 GLU D CD  1 
ATOM   6053 O OE1 . GLU D 1 233 ? 1.998  19.122 -25.737 1.00 40.26  ? 1426 GLU D OE1 1 
ATOM   6054 O OE2 . GLU D 1 233 ? 3.613  18.242 -26.947 1.00 56.39  ? 1426 GLU D OE2 1 
ATOM   6055 N N   . LEU D 1 234 ? 4.645  14.969 -22.479 1.00 24.61  ? 1427 LEU D N   1 
ATOM   6056 C CA  . LEU D 1 234 ? 3.801  14.414 -21.422 1.00 22.75  ? 1427 LEU D CA  1 
ATOM   6057 C C   . LEU D 1 234 ? 4.553  14.364 -20.114 1.00 33.65  ? 1427 LEU D C   1 
ATOM   6058 O O   . LEU D 1 234 ? 3.994  14.656 -19.048 1.00 29.18  ? 1427 LEU D O   1 
ATOM   6059 C CB  . LEU D 1 234 ? 3.291  13.020 -21.776 1.00 20.75  ? 1427 LEU D CB  1 
ATOM   6060 C CG  . LEU D 1 234 ? 2.281  12.972 -22.922 1.00 28.13  ? 1427 LEU D CG  1 
ATOM   6061 C CD1 . LEU D 1 234 ? 2.129  11.565 -23.453 1.00 22.82  ? 1427 LEU D CD1 1 
ATOM   6062 C CD2 . LEU D 1 234 ? 0.932  13.531 -22.483 1.00 24.75  ? 1427 LEU D CD2 1 
ATOM   6063 N N   . PHE D 1 235 ? 5.827  13.993 -20.188 1.00 28.28  ? 1428 PHE D N   1 
ATOM   6064 C CA  . PHE D 1 235 ? 6.633  13.956 -18.978 1.00 34.22  ? 1428 PHE D CA  1 
ATOM   6065 C C   . PHE D 1 235 ? 6.748  15.348 -18.391 1.00 28.70  ? 1428 PHE D C   1 
ATOM   6066 O O   . PHE D 1 235 ? 6.731  15.527 -17.171 1.00 34.20  ? 1428 PHE D O   1 
ATOM   6067 C CB  . PHE D 1 235 ? 8.010  13.366 -19.250 1.00 29.99  ? 1428 PHE D CB  1 
ATOM   6068 C CG  . PHE D 1 235 ? 8.015  11.875 -19.293 1.00 34.57  ? 1428 PHE D CG  1 
ATOM   6069 C CD1 . PHE D 1 235 ? 8.284  11.202 -20.471 1.00 35.23  ? 1428 PHE D CD1 1 
ATOM   6070 C CD2 . PHE D 1 235 ? 7.720  11.145 -18.163 1.00 27.08  ? 1428 PHE D CD2 1 
ATOM   6071 C CE1 . PHE D 1 235 ? 8.268  9.827  -20.509 1.00 23.81  ? 1428 PHE D CE1 1 
ATOM   6072 C CE2 . PHE D 1 235 ? 7.718  9.772  -18.200 1.00 33.69  ? 1428 PHE D CE2 1 
ATOM   6073 C CZ  . PHE D 1 235 ? 7.989  9.113  -19.373 1.00 26.41  ? 1428 PHE D CZ  1 
ATOM   6074 N N   . ILE D 1 236 ? 6.848  16.334 -19.269 1.00 22.77  ? 1429 ILE D N   1 
ATOM   6075 C CA  . ILE D 1 236 ? 6.976  17.712 -18.831 1.00 27.21  ? 1429 ILE D CA  1 
ATOM   6076 C C   . ILE D 1 236 ? 5.662  18.245 -18.260 1.00 25.75  ? 1429 ILE D C   1 
ATOM   6077 O O   . ILE D 1 236 ? 5.629  18.815 -17.163 1.00 27.59  ? 1429 ILE D O   1 
ATOM   6078 C CB  . ILE D 1 236 ? 7.457  18.614 -19.976 1.00 25.74  ? 1429 ILE D CB  1 
ATOM   6079 C CG1 . ILE D 1 236 ? 8.887  18.228 -20.369 1.00 24.86  ? 1429 ILE D CG1 1 
ATOM   6080 C CG2 . ILE D 1 236 ? 7.369  20.082 -19.573 1.00 22.62  ? 1429 ILE D CG2 1 
ATOM   6081 C CD1 . ILE D 1 236 ? 9.457  19.065 -21.486 1.00 23.41  ? 1429 ILE D CD1 1 
ATOM   6082 N N   . GLN D 1 237 ? 4.577  18.039 -18.995 1.00 25.51  ? 1430 GLN D N   1 
ATOM   6083 C CA  . GLN D 1 237 ? 3.284  18.564 -18.585 1.00 22.67  ? 1430 GLN D CA  1 
ATOM   6084 C C   . GLN D 1 237 ? 2.693  17.803 -17.417 1.00 25.47  ? 1430 GLN D C   1 
ATOM   6085 O O   . GLN D 1 237 ? 2.028  18.380 -16.563 1.00 23.44  ? 1430 GLN D O   1 
ATOM   6086 C CB  . GLN D 1 237 ? 2.301  18.539 -19.742 1.00 21.66  ? 1430 GLN D CB  1 
ATOM   6087 C CG  . GLN D 1 237 ? 1.015  19.271 -19.436 1.00 44.91  ? 1430 GLN D CG  1 
ATOM   6088 C CD  . GLN D 1 237 ? 0.282  19.695 -20.692 1.00 83.06  ? 1430 GLN D CD  1 
ATOM   6089 O OE1 . GLN D 1 237 ? 0.389  19.053 -21.744 1.00 70.10  ? 1430 GLN D OE1 1 
ATOM   6090 N NE2 . GLN D 1 237 ? -0.467 20.786 -20.591 1.00 79.10  ? 1430 GLN D NE2 1 
ATOM   6091 N N   . GLN D 1 238 ? 2.928  16.499 -17.389 1.00 24.20  ? 1431 GLN D N   1 
ATOM   6092 C CA  . GLN D 1 238 ? 2.402  15.676 -16.313 1.00 28.31  ? 1431 GLN D CA  1 
ATOM   6093 C C   . GLN D 1 238 ? 3.478  15.368 -15.274 1.00 25.98  ? 1431 GLN D C   1 
ATOM   6094 O O   . GLN D 1 238 ? 3.404  14.380 -14.539 1.00 34.79  ? 1431 GLN D O   1 
ATOM   6095 C CB  . GLN D 1 238 ? 1.769  14.398 -16.867 1.00 27.90  ? 1431 GLN D CB  1 
ATOM   6096 C CG  . GLN D 1 238 ? 0.749  14.643 -17.972 1.00 21.86  ? 1431 GLN D CG  1 
ATOM   6097 C CD  . GLN D 1 238 ? -0.249 15.745 -17.652 1.00 22.12  ? 1431 GLN D CD  1 
ATOM   6098 O OE1 . GLN D 1 238 ? -0.721 16.424 -18.559 1.00 42.18  ? 1431 GLN D OE1 1 
ATOM   6099 N NE2 . GLN D 1 238 ? -0.582 15.925 -16.366 1.00 33.07  ? 1431 GLN D NE2 1 
ATOM   6100 N N   . CYS D 1 239 ? 4.471  16.241 -15.219 1.00 21.17  ? 1432 CYS D N   1 
ATOM   6101 C CA  . CYS D 1 239 ? 5.527  16.144 -14.232 1.00 31.04  ? 1432 CYS D CA  1 
ATOM   6102 C C   . CYS D 1 239 ? 5.034  15.701 -12.838 1.00 34.13  ? 1432 CYS D C   1 
ATOM   6103 O O   . CYS D 1 239 ? 5.576  14.753 -12.273 1.00 30.01  ? 1432 CYS D O   1 
ATOM   6104 C CB  . CYS D 1 239 ? 6.275  17.473 -14.147 1.00 25.66  ? 1432 CYS D CB  1 
ATOM   6105 S SG  . CYS D 1 239 ? 7.741  17.404 -13.121 1.00 38.92  ? 1432 CYS D SG  1 
ATOM   6106 N N   . PRO D 1 240 ? 4.010  16.381 -12.282 1.00 27.58  ? 1433 PRO D N   1 
ATOM   6107 C CA  . PRO D 1 240 ? 3.515  15.998 -10.952 1.00 31.98  ? 1433 PRO D CA  1 
ATOM   6108 C C   . PRO D 1 240 ? 3.079  14.538 -10.860 1.00 32.10  ? 1433 PRO D C   1 
ATOM   6109 O O   . PRO D 1 240 ? 3.437  13.852 -9.909  1.00 41.83  ? 1433 PRO D O   1 
ATOM   6110 C CB  . PRO D 1 240 ? 2.311  16.927 -10.738 1.00 29.80  ? 1433 PRO D CB  1 
ATOM   6111 C CG  . PRO D 1 240 ? 2.598  18.116 -11.595 1.00 29.79  ? 1433 PRO D CG  1 
ATOM   6112 C CD  . PRO D 1 240 ? 3.329  17.585 -12.797 1.00 26.36  ? 1433 PRO D CD  1 
ATOM   6113 N N   . PHE D 1 241 ? 2.318  14.074 -11.839 1.00 31.49  ? 1434 PHE D N   1 
ATOM   6114 C CA  . PHE D 1 241 ? 1.851  12.693 -11.871 1.00 28.18  ? 1434 PHE D CA  1 
ATOM   6115 C C   . PHE D 1 241 ? 3.012  11.720 -11.956 1.00 33.00  ? 1434 PHE D C   1 
ATOM   6116 O O   . PHE D 1 241 ? 2.989  10.655 -11.340 1.00 36.54  ? 1434 PHE D O   1 
ATOM   6117 C CB  . PHE D 1 241 ? 0.929  12.497 -13.069 1.00 33.76  ? 1434 PHE D CB  1 
ATOM   6118 C CG  . PHE D 1 241 ? 0.571  11.070 -13.344 1.00 38.59  ? 1434 PHE D CG  1 
ATOM   6119 C CD1 . PHE D 1 241 ? -0.425 10.440 -12.623 1.00 35.58  ? 1434 PHE D CD1 1 
ATOM   6120 C CD2 . PHE D 1 241 ? 1.210  10.366 -14.355 1.00 40.55  ? 1434 PHE D CD2 1 
ATOM   6121 C CE1 . PHE D 1 241 ? -0.761 9.127  -12.887 1.00 36.02  ? 1434 PHE D CE1 1 
ATOM   6122 C CE2 . PHE D 1 241 ? 0.878  9.051  -14.628 1.00 30.74  ? 1434 PHE D CE2 1 
ATOM   6123 C CZ  . PHE D 1 241 ? -0.107 8.433  -13.897 1.00 41.34  ? 1434 PHE D CZ  1 
ATOM   6124 N N   . PHE D 1 242 ? 4.031  12.086 -12.721 1.00 31.66  ? 1435 PHE D N   1 
ATOM   6125 C CA  . PHE D 1 242 ? 5.170  11.201 -12.913 1.00 34.22  ? 1435 PHE D CA  1 
ATOM   6126 C C   . PHE D 1 242 ? 6.184  11.241 -11.771 1.00 35.40  ? 1435 PHE D C   1 
ATOM   6127 O O   . PHE D 1 242 ? 6.909  10.272 -11.577 1.00 42.12  ? 1435 PHE D O   1 
ATOM   6128 C CB  . PHE D 1 242 ? 5.892  11.505 -14.231 1.00 29.95  ? 1435 PHE D CB  1 
ATOM   6129 C CG  . PHE D 1 242 ? 5.147  11.065 -15.453 1.00 34.95  ? 1435 PHE D CG  1 
ATOM   6130 C CD1 . PHE D 1 242 ? 4.688  11.996 -16.372 1.00 33.49  ? 1435 PHE D CD1 1 
ATOM   6131 C CD2 . PHE D 1 242 ? 4.912  9.723  -15.692 1.00 30.87  ? 1435 PHE D CD2 1 
ATOM   6132 C CE1 . PHE D 1 242 ? 4.008  11.600 -17.500 1.00 31.45  ? 1435 PHE D CE1 1 
ATOM   6133 C CE2 . PHE D 1 242 ? 4.225  9.315  -16.824 1.00 25.12  ? 1435 PHE D CE2 1 
ATOM   6134 C CZ  . PHE D 1 242 ? 3.773  10.252 -17.726 1.00 36.83  ? 1435 PHE D CZ  1 
ATOM   6135 N N   . PHE D 1 243 ? 6.253  12.345 -11.026 1.00 29.42  ? 1436 PHE D N   1 
ATOM   6136 C CA  . PHE D 1 243 ? 7.398  12.547 -10.133 1.00 25.86  ? 1436 PHE D CA  1 
ATOM   6137 C C   . PHE D 1 243 ? 7.128  13.063 -8.720  1.00 35.13  ? 1436 PHE D C   1 
ATOM   6138 O O   . PHE D 1 243 ? 8.079  13.327 -7.992  1.00 44.70  ? 1436 PHE D O   1 
ATOM   6139 C CB  . PHE D 1 243 ? 8.416  13.495 -10.776 1.00 29.23  ? 1436 PHE D CB  1 
ATOM   6140 C CG  . PHE D 1 243 ? 9.003  12.999 -12.066 1.00 31.56  ? 1436 PHE D CG  1 
ATOM   6141 C CD1 . PHE D 1 243 ? 8.680  13.607 -13.264 1.00 29.64  ? 1436 PHE D CD1 1 
ATOM   6142 C CD2 . PHE D 1 243 ? 9.900  11.948 -12.080 1.00 34.62  ? 1436 PHE D CD2 1 
ATOM   6143 C CE1 . PHE D 1 243 ? 9.223  13.161 -14.448 1.00 25.14  ? 1436 PHE D CE1 1 
ATOM   6144 C CE2 . PHE D 1 243 ? 10.449 11.504 -13.266 1.00 34.76  ? 1436 PHE D CE2 1 
ATOM   6145 C CZ  . PHE D 1 243 ? 10.109 12.111 -14.447 1.00 29.42  ? 1436 PHE D CZ  1 
ATOM   6146 N N   . TYR D 1 244 ? 5.871  13.228 -8.323  1.00 35.34  ? 1437 TYR D N   1 
ATOM   6147 C CA  . TYR D 1 244 ? 5.578  13.779 -6.992  1.00 45.29  ? 1437 TYR D CA  1 
ATOM   6148 C C   . TYR D 1 244 ? 5.365  12.720 -5.904  1.00 54.33  ? 1437 TYR D C   1 
ATOM   6149 O O   . TYR D 1 244 ? 4.617  11.761 -6.090  1.00 47.72  ? 1437 TYR D O   1 
ATOM   6150 C CB  . TYR D 1 244 ? 4.372  14.713 -7.050  1.00 40.63  ? 1437 TYR D CB  1 
ATOM   6151 C CG  . TYR D 1 244 ? 4.692  16.063 -7.618  1.00 37.78  ? 1437 TYR D CG  1 
ATOM   6152 C CD1 . TYR D 1 244 ? 5.922  16.310 -8.205  1.00 35.13  ? 1437 TYR D CD1 1 
ATOM   6153 C CD2 . TYR D 1 244 ? 3.756  17.091 -7.590  1.00 43.04  ? 1437 TYR D CD2 1 
ATOM   6154 C CE1 . TYR D 1 244 ? 6.221  17.550 -8.741  1.00 38.97  ? 1437 TYR D CE1 1 
ATOM   6155 C CE2 . TYR D 1 244 ? 4.044  18.335 -8.131  1.00 41.81  ? 1437 TYR D CE2 1 
ATOM   6156 C CZ  . TYR D 1 244 ? 5.281  18.559 -8.703  1.00 39.60  ? 1437 TYR D CZ  1 
ATOM   6157 O OH  . TYR D 1 244 ? 5.582  19.792 -9.239  1.00 37.61  ? 1437 TYR D OH  1 
HETATM 6158 X UNK . UNX E 2 .   ? 25.294 27.874 36.325  0.01 38.27  ? 1    UNX A UNK 1 
HETATM 6159 X UNK . UNX F 2 .   ? -1.317 15.963 17.986  0.01 27.59  ? 5    UNX A UNK 1 
HETATM 6160 X UNK . UNX G 2 .   ? 26.198 45.164 -32.011 0.01 37.26  ? 2    UNX B UNK 1 
HETATM 6161 X UNK . UNX H 2 .   ? -0.778 56.805 -13.918 0.01 28.15  ? 6    UNX B UNK 1 
HETATM 6162 X UNK . UNX I 2 .   ? 24.392 38.459 30.280  0.01 38.28  ? 3    UNX C UNK 1 
HETATM 6163 X UNK . UNX J 2 .   ? -0.873 57.180 17.401  0.01 29.24  ? 7    UNX C UNK 1 
HETATM 6164 X UNK . UNX K 2 .   ? 23.143 35.077 -26.828 0.01 39.38  ? 4    UNX D UNK 1 
HETATM 6165 X UNK . UNX L 2 .   ? -1.381 15.963 -13.107 0.01 28.30  ? 8    UNX D UNK 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1194 ?    ?   ?   A . n 
A 1 2   HIS 2   1195 ?    ?   ?   A . n 
A 1 3   HIS 3   1196 ?    ?   ?   A . n 
A 1 4   HIS 4   1197 ?    ?   ?   A . n 
A 1 5   HIS 5   1198 ?    ?   ?   A . n 
A 1 6   HIS 6   1199 ?    ?   ?   A . n 
A 1 7   HIS 7   1200 ?    ?   ?   A . n 
A 1 8   SER 8   1201 ?    ?   ?   A . n 
A 1 9   SER 9   1202 ?    ?   ?   A . n 
A 1 10  GLY 10  1203 ?    ?   ?   A . n 
A 1 11  ARG 11  1204 ?    ?   ?   A . n 
A 1 12  GLU 12  1205 ?    ?   ?   A . n 
A 1 13  ASN 13  1206 ?    ?   ?   A . n 
A 1 14  LEU 14  1207 ?    ?   ?   A . n 
A 1 15  TYR 15  1208 ?    ?   ?   A . n 
A 1 16  PHE 16  1209 ?    ?   ?   A . n 
A 1 17  GLN 17  1210 ?    ?   ?   A . n 
A 1 18  GLY 18  1211 ?    ?   ?   A . n 
A 1 19  ASP 19  1212 ?    ?   ?   A . n 
A 1 20  PRO 20  1213 ?    ?   ?   A . n 
A 1 21  ARG 21  1214 ?    ?   ?   A . n 
A 1 22  ARG 22  1215 ?    ?   ?   A . n 
A 1 23  ARG 23  1216 ?    ?   ?   A . n 
A 1 24  ASN 24  1217 ?    ?   ?   A . n 
A 1 25  ILE 25  1218 ?    ?   ?   A . n 
A 1 26  LEU 26  1219 ?    ?   ?   A . n 
A 1 27  ARG 27  1220 ?    ?   ?   A . n 
A 1 28  SER 28  1221 ?    ?   ?   A . n 
A 1 29  LEU 29  1222 ?    ?   ?   A . n 
A 1 30  ARG 30  1223 ?    ?   ?   A . n 
A 1 31  ARG 31  1224 ?    ?   ?   A . n 
A 1 32  ASN 32  1225 ?    ?   ?   A . n 
A 1 33  THR 33  1226 ?    ?   ?   A . n 
A 1 34  LYS 34  1227 ?    ?   ?   A . n 
A 1 35  LYS 35  1228 ?    ?   ?   A . n 
A 1 36  PRO 36  1229 ?    ?   ?   A . n 
A 1 37  LYS 37  1230 ?    ?   ?   A . n 
A 1 38  PRO 38  1231 ?    ?   ?   A . n 
A 1 39  LYS 39  1232 ?    ?   ?   A . n 
A 1 40  PRO 40  1233 ?    ?   ?   A . n 
A 1 41  ARG 41  1234 ?    ?   ?   A . n 
A 1 42  PRO 42  1235 ?    ?   ?   A . n 
A 1 43  SER 43  1236 ?    ?   ?   A . n 
A 1 44  ILE 44  1237 ?    ?   ?   A . n 
A 1 45  THR 45  1238 ?    ?   ?   A . n 
A 1 46  LYS 46  1239 ?    ?   ?   A . n 
A 1 47  ALA 47  1240 ?    ?   ?   A . n 
A 1 48  THR 48  1241 ?    ?   ?   A . n 
A 1 49  TRP 49  1242 1242 TRP TRP A . n 
A 1 50  GLU 50  1243 1243 GLU GLU A . n 
A 1 51  SER 51  1244 1244 SER SER A . n 
A 1 52  ASN 52  1245 1245 ASN ASN A . n 
A 1 53  TYR 53  1246 1246 TYR TYR A . n 
A 1 54  PHE 54  1247 1247 PHE PHE A . n 
A 1 55  GLY 55  1248 1248 GLY GLY A . n 
A 1 56  VAL 56  1249 1249 VAL VAL A . n 
A 1 57  PRO 57  1250 1250 PRO PRO A . n 
A 1 58  LEU 58  1251 1251 LEU LEU A . n 
A 1 59  THR 59  1252 1252 THR THR A . n 
A 1 60  THR 60  1253 1253 THR THR A . n 
A 1 61  VAL 61  1254 1254 VAL VAL A . n 
A 1 62  VAL 62  1255 1255 VAL VAL A . n 
A 1 63  THR 63  1256 1256 THR THR A . n 
A 1 64  PRO 64  1257 1257 PRO PRO A . n 
A 1 65  GLU 65  1258 1258 GLU GLU A . n 
A 1 66  LYS 66  1259 1259 LYS LYS A . n 
A 1 67  PRO 67  1260 1260 PRO PRO A . n 
A 1 68  ILE 68  1261 1261 ILE ILE A . n 
A 1 69  PRO 69  1262 1262 PRO PRO A . n 
A 1 70  ILE 70  1263 1263 ILE ILE A . n 
A 1 71  PHE 71  1264 1264 PHE PHE A . n 
A 1 72  ILE 72  1265 1265 ILE ILE A . n 
A 1 73  GLU 73  1266 1266 GLU GLU A . n 
A 1 74  ARG 74  1267 1267 ARG ARG A . n 
A 1 75  CYS 75  1268 1268 CYS CYS A . n 
A 1 76  ILE 76  1269 1269 ILE ILE A . n 
A 1 77  GLU 77  1270 1270 GLU GLU A . n 
A 1 78  TYR 78  1271 1271 TYR TYR A . n 
A 1 79  ILE 79  1272 1272 ILE ILE A . n 
A 1 80  GLU 80  1273 1273 GLU GLU A . n 
A 1 81  ALA 81  1274 1274 ALA ALA A . n 
A 1 82  THR 82  1275 1275 THR THR A . n 
A 1 83  GLY 83  1276 1276 GLY GLY A . n 
A 1 84  LEU 84  1277 1277 LEU LEU A . n 
A 1 85  SER 85  1278 1278 SER SER A . n 
A 1 86  THR 86  1279 1279 THR THR A . n 
A 1 87  GLU 87  1280 1280 GLU GLU A . n 
A 1 88  GLY 88  1281 1281 GLY GLY A . n 
A 1 89  ILE 89  1282 1282 ILE ILE A . n 
A 1 90  TYR 90  1283 1283 TYR TYR A . n 
A 1 91  ARG 91  1284 1284 ARG ARG A . n 
A 1 92  VAL 92  1285 1285 VAL VAL A . n 
A 1 93  SER 93  1286 1286 SER SER A . n 
A 1 94  GLY 94  1287 1287 GLY GLY A . n 
A 1 95  ASN 95  1288 1288 ASN ASN A . n 
A 1 96  LYS 96  1289 1289 LYS LYS A . n 
A 1 97  SER 97  1290 1290 SER SER A . n 
A 1 98  GLU 98  1291 1291 GLU GLU A . n 
A 1 99  MET 99  1292 1292 MET MET A . n 
A 1 100 GLU 100 1293 1293 GLU GLU A . n 
A 1 101 SER 101 1294 1294 SER SER A . n 
A 1 102 LEU 102 1295 1295 LEU LEU A . n 
A 1 103 GLN 103 1296 1296 GLN GLN A . n 
A 1 104 ARG 104 1297 1297 ARG ARG A . n 
A 1 105 GLN 105 1298 1298 GLN GLN A . n 
A 1 106 PHE 106 1299 1299 PHE PHE A . n 
A 1 107 ASP 107 1300 1300 ASP ASP A . n 
A 1 108 GLN 108 1301 1301 GLN GLN A . n 
A 1 109 ASP 109 1302 1302 ASP ASP A . n 
A 1 110 HIS 110 1303 1303 HIS HIS A . n 
A 1 111 ASN 111 1304 1304 ASN ASN A . n 
A 1 112 LEU 112 1305 1305 LEU LEU A . n 
A 1 113 ASP 113 1306 1306 ASP ASP A . n 
A 1 114 LEU 114 1307 1307 LEU LEU A . n 
A 1 115 ALA 115 1308 1308 ALA ALA A . n 
A 1 116 GLU 116 1309 1309 GLU GLU A . n 
A 1 117 LYS 117 1310 1310 LYS LYS A . n 
A 1 118 ASP 118 1311 1311 ASP ASP A . n 
A 1 119 PHE 119 1312 1312 PHE PHE A . n 
A 1 120 THR 120 1313 1313 THR THR A . n 
A 1 121 VAL 121 1314 1314 VAL VAL A . n 
A 1 122 ASN 122 1315 1315 ASN ASN A . n 
A 1 123 THR 123 1316 1316 THR THR A . n 
A 1 124 VAL 124 1317 1317 VAL VAL A . n 
A 1 125 ALA 125 1318 1318 ALA ALA A . n 
A 1 126 GLY 126 1319 1319 GLY GLY A . n 
A 1 127 ALA 127 1320 1320 ALA ALA A . n 
A 1 128 MET 128 1321 1321 MET MET A . n 
A 1 129 LYS 129 1322 1322 LYS LYS A . n 
A 1 130 SER 130 1323 1323 SER SER A . n 
A 1 131 PHE 131 1324 1324 PHE PHE A . n 
A 1 132 PHE 132 1325 1325 PHE PHE A . n 
A 1 133 SER 133 1326 1326 SER SER A . n 
A 1 134 GLU 134 1327 1327 GLU GLU A . n 
A 1 135 LEU 135 1328 1328 LEU LEU A . n 
A 1 136 PRO 136 1329 1329 PRO PRO A . n 
A 1 137 ASP 137 1330 1330 ASP ASP A . n 
A 1 138 PRO 138 1331 1331 PRO PRO A . n 
A 1 139 LEU 139 1332 1332 LEU LEU A . n 
A 1 140 VAL 140 1333 1333 VAL VAL A . n 
A 1 141 PRO 141 1334 1334 PRO PRO A . n 
A 1 142 TYR 142 1335 1335 TYR TYR A . n 
A 1 143 ASN 143 1336 1336 ASN ASN A . n 
A 1 144 MET 144 1337 1337 MET MET A . n 
A 1 145 GLN 145 1338 1338 GLN GLN A . n 
A 1 146 ILE 146 1339 1339 ILE ILE A . n 
A 1 147 ASP 147 1340 1340 ASP ASP A . n 
A 1 148 LEU 148 1341 1341 LEU LEU A . n 
A 1 149 VAL 149 1342 1342 VAL VAL A . n 
A 1 150 GLU 150 1343 1343 GLU GLU A . n 
A 1 151 ALA 151 1344 1344 ALA ALA A . n 
A 1 152 HIS 152 1345 1345 HIS HIS A . n 
A 1 153 LYS 153 1346 1346 LYS LYS A . n 
A 1 154 ILE 154 1347 1347 ILE ILE A . n 
A 1 155 ASN 155 1348 1348 ASN ASN A . n 
A 1 156 ASP 156 1349 1349 ASP ASP A . n 
A 1 157 ARG 157 1350 1350 ARG ARG A . n 
A 1 158 GLU 158 1351 1351 GLU GLU A . n 
A 1 159 GLN 159 1352 1352 GLN GLN A . n 
A 1 160 LYS 160 1353 1353 LYS LYS A . n 
A 1 161 LEU 161 1354 1354 LEU LEU A . n 
A 1 162 HIS 162 1355 1355 HIS HIS A . n 
A 1 163 ALA 163 1356 1356 ALA ALA A . n 
A 1 164 LEU 164 1357 1357 LEU LEU A . n 
A 1 165 LYS 165 1358 1358 LYS LYS A . n 
A 1 166 GLU 166 1359 1359 GLU GLU A . n 
A 1 167 VAL 167 1360 1360 VAL VAL A . n 
A 1 168 LEU 168 1361 1361 LEU LEU A . n 
A 1 169 LYS 169 1362 1362 LYS LYS A . n 
A 1 170 LYS 170 1363 1363 LYS LYS A . n 
A 1 171 PHE 171 1364 1364 PHE PHE A . n 
A 1 172 PRO 172 1365 1365 PRO PRO A . n 
A 1 173 LYS 173 1366 1366 LYS LYS A . n 
A 1 174 GLU 174 1367 1367 GLU GLU A . n 
A 1 175 ASN 175 1368 1368 ASN ASN A . n 
A 1 176 HIS 176 1369 1369 HIS HIS A . n 
A 1 177 GLU 177 1370 1370 GLU GLU A . n 
A 1 178 VAL 178 1371 1371 VAL VAL A . n 
A 1 179 PHE 179 1372 1372 PHE PHE A . n 
A 1 180 LYS 180 1373 1373 LYS LYS A . n 
A 1 181 TYR 181 1374 1374 TYR TYR A . n 
A 1 182 VAL 182 1375 1375 VAL VAL A . n 
A 1 183 ILE 183 1376 1376 ILE ILE A . n 
A 1 184 SER 184 1377 1377 SER SER A . n 
A 1 185 HIS 185 1378 1378 HIS HIS A . n 
A 1 186 LEU 186 1379 1379 LEU LEU A . n 
A 1 187 ASN 187 1380 1380 ASN ASN A . n 
A 1 188 LYS 188 1381 1381 LYS LYS A . n 
A 1 189 VAL 189 1382 1382 VAL VAL A . n 
A 1 190 SER 190 1383 1383 SER SER A . n 
A 1 191 HIS 191 1384 1384 HIS HIS A . n 
A 1 192 ASN 192 1385 1385 ASN ASN A . n 
A 1 193 ASN 193 1386 1386 ASN ASN A . n 
A 1 194 LYS 194 1387 1387 LYS LYS A . n 
A 1 195 VAL 195 1388 1388 VAL VAL A . n 
A 1 196 ASN 196 1389 1389 ASN ASN A . n 
A 1 197 LEU 197 1390 1390 LEU LEU A . n 
A 1 198 MET 198 1391 1391 MET MET A . n 
A 1 199 THR 199 1392 1392 THR THR A . n 
A 1 200 SER 200 1393 1393 SER SER A . n 
A 1 201 GLU 201 1394 1394 GLU GLU A . n 
A 1 202 ASN 202 1395 1395 ASN ASN A . n 
A 1 203 LEU 203 1396 1396 LEU LEU A . n 
A 1 204 SER 204 1397 1397 SER SER A . n 
A 1 205 ILE 205 1398 1398 ILE ILE A . n 
A 1 206 CYS 206 1399 1399 CYS CYS A . n 
A 1 207 PHE 207 1400 1400 PHE PHE A . n 
A 1 208 TRP 208 1401 1401 TRP TRP A . n 
A 1 209 PRO 209 1402 1402 PRO PRO A . n 
A 1 210 THR 210 1403 1403 THR THR A . n 
A 1 211 LEU 211 1404 1404 LEU LEU A . n 
A 1 212 MET 212 1405 1405 MET MET A . n 
A 1 213 ARG 213 1406 1406 ARG ARG A . n 
A 1 214 PRO 214 1407 1407 PRO PRO A . n 
A 1 215 ASP 215 1408 1408 ASP ASP A . n 
A 1 216 PHE 216 1409 1409 PHE PHE A . n 
A 1 217 SER 217 1410 1410 SER SER A . n 
A 1 218 THR 218 1411 1411 THR THR A . n 
A 1 219 MET 219 1412 1412 MET MET A . n 
A 1 220 ASP 220 1413 1413 ASP ASP A . n 
A 1 221 ALA 221 1414 1414 ALA ALA A . n 
A 1 222 LEU 222 1415 1415 LEU LEU A . n 
A 1 223 THR 223 1416 1416 THR THR A . n 
A 1 224 ALA 224 1417 1417 ALA ALA A . n 
A 1 225 THR 225 1418 1418 THR THR A . n 
A 1 226 ARG 226 1419 1419 ARG ARG A . n 
A 1 227 THR 227 1420 1420 THR THR A . n 
A 1 228 TYR 228 1421 1421 TYR TYR A . n 
A 1 229 GLN 229 1422 1422 GLN GLN A . n 
A 1 230 THR 230 1423 1423 THR THR A . n 
A 1 231 ILE 231 1424 1424 ILE ILE A . n 
A 1 232 ILE 232 1425 1425 ILE ILE A . n 
A 1 233 GLU 233 1426 1426 GLU GLU A . n 
A 1 234 LEU 234 1427 1427 LEU LEU A . n 
A 1 235 PHE 235 1428 1428 PHE PHE A . n 
A 1 236 ILE 236 1429 1429 ILE ILE A . n 
A 1 237 GLN 237 1430 1430 GLN GLN A . n 
A 1 238 GLN 238 1431 1431 GLN GLN A . n 
A 1 239 CYS 239 1432 1432 CYS CYS A . n 
A 1 240 PRO 240 1433 1433 PRO PRO A . n 
A 1 241 PHE 241 1434 1434 PHE PHE A . n 
A 1 242 PHE 242 1435 1435 PHE PHE A . n 
A 1 243 PHE 243 1436 1436 PHE PHE A . n 
A 1 244 TYR 244 1437 1437 TYR TYR A . n 
A 1 245 ASN 245 1438 ?    ?   ?   A . n 
A 1 246 ARG 246 1439 ?    ?   ?   A . n 
B 1 1   MET 1   1194 ?    ?   ?   B . n 
B 1 2   HIS 2   1195 ?    ?   ?   B . n 
B 1 3   HIS 3   1196 ?    ?   ?   B . n 
B 1 4   HIS 4   1197 ?    ?   ?   B . n 
B 1 5   HIS 5   1198 ?    ?   ?   B . n 
B 1 6   HIS 6   1199 ?    ?   ?   B . n 
B 1 7   HIS 7   1200 ?    ?   ?   B . n 
B 1 8   SER 8   1201 ?    ?   ?   B . n 
B 1 9   SER 9   1202 ?    ?   ?   B . n 
B 1 10  GLY 10  1203 ?    ?   ?   B . n 
B 1 11  ARG 11  1204 ?    ?   ?   B . n 
B 1 12  GLU 12  1205 ?    ?   ?   B . n 
B 1 13  ASN 13  1206 ?    ?   ?   B . n 
B 1 14  LEU 14  1207 ?    ?   ?   B . n 
B 1 15  TYR 15  1208 ?    ?   ?   B . n 
B 1 16  PHE 16  1209 ?    ?   ?   B . n 
B 1 17  GLN 17  1210 ?    ?   ?   B . n 
B 1 18  GLY 18  1211 ?    ?   ?   B . n 
B 1 19  ASP 19  1212 ?    ?   ?   B . n 
B 1 20  PRO 20  1213 ?    ?   ?   B . n 
B 1 21  ARG 21  1214 ?    ?   ?   B . n 
B 1 22  ARG 22  1215 ?    ?   ?   B . n 
B 1 23  ARG 23  1216 ?    ?   ?   B . n 
B 1 24  ASN 24  1217 ?    ?   ?   B . n 
B 1 25  ILE 25  1218 ?    ?   ?   B . n 
B 1 26  LEU 26  1219 ?    ?   ?   B . n 
B 1 27  ARG 27  1220 ?    ?   ?   B . n 
B 1 28  SER 28  1221 ?    ?   ?   B . n 
B 1 29  LEU 29  1222 ?    ?   ?   B . n 
B 1 30  ARG 30  1223 ?    ?   ?   B . n 
B 1 31  ARG 31  1224 ?    ?   ?   B . n 
B 1 32  ASN 32  1225 ?    ?   ?   B . n 
B 1 33  THR 33  1226 ?    ?   ?   B . n 
B 1 34  LYS 34  1227 ?    ?   ?   B . n 
B 1 35  LYS 35  1228 ?    ?   ?   B . n 
B 1 36  PRO 36  1229 ?    ?   ?   B . n 
B 1 37  LYS 37  1230 ?    ?   ?   B . n 
B 1 38  PRO 38  1231 ?    ?   ?   B . n 
B 1 39  LYS 39  1232 ?    ?   ?   B . n 
B 1 40  PRO 40  1233 ?    ?   ?   B . n 
B 1 41  ARG 41  1234 ?    ?   ?   B . n 
B 1 42  PRO 42  1235 ?    ?   ?   B . n 
B 1 43  SER 43  1236 ?    ?   ?   B . n 
B 1 44  ILE 44  1237 ?    ?   ?   B . n 
B 1 45  THR 45  1238 ?    ?   ?   B . n 
B 1 46  LYS 46  1239 ?    ?   ?   B . n 
B 1 47  ALA 47  1240 ?    ?   ?   B . n 
B 1 48  THR 48  1241 ?    ?   ?   B . n 
B 1 49  TRP 49  1242 1242 TRP TRP B . n 
B 1 50  GLU 50  1243 1243 GLU GLU B . n 
B 1 51  SER 51  1244 1244 SER SER B . n 
B 1 52  ASN 52  1245 1245 ASN ASN B . n 
B 1 53  TYR 53  1246 1246 TYR TYR B . n 
B 1 54  PHE 54  1247 1247 PHE PHE B . n 
B 1 55  GLY 55  1248 1248 GLY GLY B . n 
B 1 56  VAL 56  1249 1249 VAL VAL B . n 
B 1 57  PRO 57  1250 1250 PRO PRO B . n 
B 1 58  LEU 58  1251 1251 LEU LEU B . n 
B 1 59  THR 59  1252 1252 THR THR B . n 
B 1 60  THR 60  1253 1253 THR THR B . n 
B 1 61  VAL 61  1254 1254 VAL VAL B . n 
B 1 62  VAL 62  1255 1255 VAL VAL B . n 
B 1 63  THR 63  1256 1256 THR THR B . n 
B 1 64  PRO 64  1257 1257 PRO PRO B . n 
B 1 65  GLU 65  1258 1258 GLU GLU B . n 
B 1 66  LYS 66  1259 1259 LYS LYS B . n 
B 1 67  PRO 67  1260 1260 PRO PRO B . n 
B 1 68  ILE 68  1261 1261 ILE ILE B . n 
B 1 69  PRO 69  1262 1262 PRO PRO B . n 
B 1 70  ILE 70  1263 1263 ILE ILE B . n 
B 1 71  PHE 71  1264 1264 PHE PHE B . n 
B 1 72  ILE 72  1265 1265 ILE ILE B . n 
B 1 73  GLU 73  1266 1266 GLU GLU B . n 
B 1 74  ARG 74  1267 1267 ARG ARG B . n 
B 1 75  CYS 75  1268 1268 CYS CYS B . n 
B 1 76  ILE 76  1269 1269 ILE ILE B . n 
B 1 77  GLU 77  1270 1270 GLU GLU B . n 
B 1 78  TYR 78  1271 1271 TYR TYR B . n 
B 1 79  ILE 79  1272 1272 ILE ILE B . n 
B 1 80  GLU 80  1273 1273 GLU GLU B . n 
B 1 81  ALA 81  1274 1274 ALA ALA B . n 
B 1 82  THR 82  1275 1275 THR THR B . n 
B 1 83  GLY 83  1276 1276 GLY GLY B . n 
B 1 84  LEU 84  1277 1277 LEU LEU B . n 
B 1 85  SER 85  1278 1278 SER SER B . n 
B 1 86  THR 86  1279 1279 THR THR B . n 
B 1 87  GLU 87  1280 1280 GLU GLU B . n 
B 1 88  GLY 88  1281 1281 GLY GLY B . n 
B 1 89  ILE 89  1282 1282 ILE ILE B . n 
B 1 90  TYR 90  1283 1283 TYR TYR B . n 
B 1 91  ARG 91  1284 1284 ARG ARG B . n 
B 1 92  VAL 92  1285 1285 VAL VAL B . n 
B 1 93  SER 93  1286 1286 SER SER B . n 
B 1 94  GLY 94  1287 1287 GLY GLY B . n 
B 1 95  ASN 95  1288 1288 ASN ASN B . n 
B 1 96  LYS 96  1289 1289 LYS LYS B . n 
B 1 97  SER 97  1290 1290 SER SER B . n 
B 1 98  GLU 98  1291 1291 GLU GLU B . n 
B 1 99  MET 99  1292 1292 MET MET B . n 
B 1 100 GLU 100 1293 1293 GLU GLU B . n 
B 1 101 SER 101 1294 1294 SER SER B . n 
B 1 102 LEU 102 1295 1295 LEU LEU B . n 
B 1 103 GLN 103 1296 1296 GLN GLN B . n 
B 1 104 ARG 104 1297 1297 ARG ARG B . n 
B 1 105 GLN 105 1298 1298 GLN GLN B . n 
B 1 106 PHE 106 1299 1299 PHE PHE B . n 
B 1 107 ASP 107 1300 1300 ASP ASP B . n 
B 1 108 GLN 108 1301 1301 GLN GLN B . n 
B 1 109 ASP 109 1302 1302 ASP ASP B . n 
B 1 110 HIS 110 1303 1303 HIS HIS B . n 
B 1 111 ASN 111 1304 1304 ASN ASN B . n 
B 1 112 LEU 112 1305 1305 LEU LEU B . n 
B 1 113 ASP 113 1306 1306 ASP ASP B . n 
B 1 114 LEU 114 1307 1307 LEU LEU B . n 
B 1 115 ALA 115 1308 1308 ALA ALA B . n 
B 1 116 GLU 116 1309 1309 GLU GLU B . n 
B 1 117 LYS 117 1310 1310 LYS LYS B . n 
B 1 118 ASP 118 1311 1311 ASP ASP B . n 
B 1 119 PHE 119 1312 1312 PHE PHE B . n 
B 1 120 THR 120 1313 1313 THR THR B . n 
B 1 121 VAL 121 1314 1314 VAL VAL B . n 
B 1 122 ASN 122 1315 1315 ASN ASN B . n 
B 1 123 THR 123 1316 1316 THR THR B . n 
B 1 124 VAL 124 1317 1317 VAL VAL B . n 
B 1 125 ALA 125 1318 1318 ALA ALA B . n 
B 1 126 GLY 126 1319 1319 GLY GLY B . n 
B 1 127 ALA 127 1320 1320 ALA ALA B . n 
B 1 128 MET 128 1321 1321 MET MET B . n 
B 1 129 LYS 129 1322 1322 LYS LYS B . n 
B 1 130 SER 130 1323 1323 SER SER B . n 
B 1 131 PHE 131 1324 1324 PHE PHE B . n 
B 1 132 PHE 132 1325 1325 PHE PHE B . n 
B 1 133 SER 133 1326 1326 SER SER B . n 
B 1 134 GLU 134 1327 1327 GLU GLU B . n 
B 1 135 LEU 135 1328 1328 LEU LEU B . n 
B 1 136 PRO 136 1329 1329 PRO PRO B . n 
B 1 137 ASP 137 1330 1330 ASP ASP B . n 
B 1 138 PRO 138 1331 1331 PRO PRO B . n 
B 1 139 LEU 139 1332 1332 LEU LEU B . n 
B 1 140 VAL 140 1333 1333 VAL VAL B . n 
B 1 141 PRO 141 1334 1334 PRO PRO B . n 
B 1 142 TYR 142 1335 1335 TYR TYR B . n 
B 1 143 ASN 143 1336 1336 ASN ASN B . n 
B 1 144 MET 144 1337 1337 MET MET B . n 
B 1 145 GLN 145 1338 1338 GLN GLN B . n 
B 1 146 ILE 146 1339 1339 ILE ILE B . n 
B 1 147 ASP 147 1340 1340 ASP ASP B . n 
B 1 148 LEU 148 1341 1341 LEU LEU B . n 
B 1 149 VAL 149 1342 1342 VAL VAL B . n 
B 1 150 GLU 150 1343 1343 GLU GLU B . n 
B 1 151 ALA 151 1344 1344 ALA ALA B . n 
B 1 152 HIS 152 1345 1345 HIS HIS B . n 
B 1 153 LYS 153 1346 1346 LYS LYS B . n 
B 1 154 ILE 154 1347 1347 ILE ILE B . n 
B 1 155 ASN 155 1348 1348 ASN ASN B . n 
B 1 156 ASP 156 1349 1349 ASP ASP B . n 
B 1 157 ARG 157 1350 1350 ARG ARG B . n 
B 1 158 GLU 158 1351 1351 GLU GLU B . n 
B 1 159 GLN 159 1352 1352 GLN GLN B . n 
B 1 160 LYS 160 1353 1353 LYS LYS B . n 
B 1 161 LEU 161 1354 1354 LEU LEU B . n 
B 1 162 HIS 162 1355 1355 HIS HIS B . n 
B 1 163 ALA 163 1356 1356 ALA ALA B . n 
B 1 164 LEU 164 1357 1357 LEU LEU B . n 
B 1 165 LYS 165 1358 1358 LYS LYS B . n 
B 1 166 GLU 166 1359 1359 GLU GLU B . n 
B 1 167 VAL 167 1360 1360 VAL VAL B . n 
B 1 168 LEU 168 1361 1361 LEU LEU B . n 
B 1 169 LYS 169 1362 1362 LYS LYS B . n 
B 1 170 LYS 170 1363 1363 LYS LYS B . n 
B 1 171 PHE 171 1364 1364 PHE PHE B . n 
B 1 172 PRO 172 1365 1365 PRO PRO B . n 
B 1 173 LYS 173 1366 1366 LYS LYS B . n 
B 1 174 GLU 174 1367 1367 GLU GLU B . n 
B 1 175 ASN 175 1368 1368 ASN ASN B . n 
B 1 176 HIS 176 1369 1369 HIS HIS B . n 
B 1 177 GLU 177 1370 1370 GLU GLU B . n 
B 1 178 VAL 178 1371 1371 VAL VAL B . n 
B 1 179 PHE 179 1372 1372 PHE PHE B . n 
B 1 180 LYS 180 1373 1373 LYS LYS B . n 
B 1 181 TYR 181 1374 1374 TYR TYR B . n 
B 1 182 VAL 182 1375 1375 VAL VAL B . n 
B 1 183 ILE 183 1376 1376 ILE ILE B . n 
B 1 184 SER 184 1377 1377 SER SER B . n 
B 1 185 HIS 185 1378 1378 HIS HIS B . n 
B 1 186 LEU 186 1379 1379 LEU LEU B . n 
B 1 187 ASN 187 1380 1380 ASN ASN B . n 
B 1 188 LYS 188 1381 1381 LYS LYS B . n 
B 1 189 VAL 189 1382 1382 VAL VAL B . n 
B 1 190 SER 190 1383 1383 SER SER B . n 
B 1 191 HIS 191 1384 1384 HIS HIS B . n 
B 1 192 ASN 192 1385 1385 ASN ASN B . n 
B 1 193 ASN 193 1386 1386 ASN ASN B . n 
B 1 194 LYS 194 1387 1387 LYS LYS B . n 
B 1 195 VAL 195 1388 1388 VAL VAL B . n 
B 1 196 ASN 196 1389 1389 ASN ASN B . n 
B 1 197 LEU 197 1390 1390 LEU LEU B . n 
B 1 198 MET 198 1391 1391 MET MET B . n 
B 1 199 THR 199 1392 1392 THR THR B . n 
B 1 200 SER 200 1393 1393 SER SER B . n 
B 1 201 GLU 201 1394 1394 GLU GLU B . n 
B 1 202 ASN 202 1395 1395 ASN ASN B . n 
B 1 203 LEU 203 1396 1396 LEU LEU B . n 
B 1 204 SER 204 1397 1397 SER SER B . n 
B 1 205 ILE 205 1398 1398 ILE ILE B . n 
B 1 206 CYS 206 1399 1399 CYS CYS B . n 
B 1 207 PHE 207 1400 1400 PHE PHE B . n 
B 1 208 TRP 208 1401 1401 TRP TRP B . n 
B 1 209 PRO 209 1402 1402 PRO PRO B . n 
B 1 210 THR 210 1403 1403 THR THR B . n 
B 1 211 LEU 211 1404 1404 LEU LEU B . n 
B 1 212 MET 212 1405 1405 MET MET B . n 
B 1 213 ARG 213 1406 1406 ARG ARG B . n 
B 1 214 PRO 214 1407 1407 PRO PRO B . n 
B 1 215 ASP 215 1408 1408 ASP ASP B . n 
B 1 216 PHE 216 1409 ?    ?   ?   B . n 
B 1 217 SER 217 1410 ?    ?   ?   B . n 
B 1 218 THR 218 1411 ?    ?   ?   B . n 
B 1 219 MET 219 1412 1412 MET MET B . n 
B 1 220 ASP 220 1413 1413 ASP ASP B . n 
B 1 221 ALA 221 1414 1414 ALA ALA B . n 
B 1 222 LEU 222 1415 1415 LEU LEU B . n 
B 1 223 THR 223 1416 1416 THR THR B . n 
B 1 224 ALA 224 1417 1417 ALA ALA B . n 
B 1 225 THR 225 1418 1418 THR THR B . n 
B 1 226 ARG 226 1419 1419 ARG ARG B . n 
B 1 227 THR 227 1420 1420 THR THR B . n 
B 1 228 TYR 228 1421 1421 TYR TYR B . n 
B 1 229 GLN 229 1422 1422 GLN GLN B . n 
B 1 230 THR 230 1423 1423 THR THR B . n 
B 1 231 ILE 231 1424 1424 ILE ILE B . n 
B 1 232 ILE 232 1425 1425 ILE ILE B . n 
B 1 233 GLU 233 1426 1426 GLU GLU B . n 
B 1 234 LEU 234 1427 1427 LEU LEU B . n 
B 1 235 PHE 235 1428 1428 PHE PHE B . n 
B 1 236 ILE 236 1429 1429 ILE ILE B . n 
B 1 237 GLN 237 1430 1430 GLN GLN B . n 
B 1 238 GLN 238 1431 1431 GLN GLN B . n 
B 1 239 CYS 239 1432 1432 CYS CYS B . n 
B 1 240 PRO 240 1433 1433 PRO PRO B . n 
B 1 241 PHE 241 1434 1434 PHE PHE B . n 
B 1 242 PHE 242 1435 1435 PHE PHE B . n 
B 1 243 PHE 243 1436 1436 PHE PHE B . n 
B 1 244 TYR 244 1437 1437 TYR TYR B . n 
B 1 245 ASN 245 1438 ?    ?   ?   B . n 
B 1 246 ARG 246 1439 ?    ?   ?   B . n 
C 1 1   MET 1   1194 ?    ?   ?   C . n 
C 1 2   HIS 2   1195 ?    ?   ?   C . n 
C 1 3   HIS 3   1196 ?    ?   ?   C . n 
C 1 4   HIS 4   1197 ?    ?   ?   C . n 
C 1 5   HIS 5   1198 ?    ?   ?   C . n 
C 1 6   HIS 6   1199 ?    ?   ?   C . n 
C 1 7   HIS 7   1200 ?    ?   ?   C . n 
C 1 8   SER 8   1201 ?    ?   ?   C . n 
C 1 9   SER 9   1202 ?    ?   ?   C . n 
C 1 10  GLY 10  1203 ?    ?   ?   C . n 
C 1 11  ARG 11  1204 ?    ?   ?   C . n 
C 1 12  GLU 12  1205 ?    ?   ?   C . n 
C 1 13  ASN 13  1206 ?    ?   ?   C . n 
C 1 14  LEU 14  1207 ?    ?   ?   C . n 
C 1 15  TYR 15  1208 ?    ?   ?   C . n 
C 1 16  PHE 16  1209 ?    ?   ?   C . n 
C 1 17  GLN 17  1210 ?    ?   ?   C . n 
C 1 18  GLY 18  1211 ?    ?   ?   C . n 
C 1 19  ASP 19  1212 ?    ?   ?   C . n 
C 1 20  PRO 20  1213 ?    ?   ?   C . n 
C 1 21  ARG 21  1214 ?    ?   ?   C . n 
C 1 22  ARG 22  1215 ?    ?   ?   C . n 
C 1 23  ARG 23  1216 ?    ?   ?   C . n 
C 1 24  ASN 24  1217 ?    ?   ?   C . n 
C 1 25  ILE 25  1218 ?    ?   ?   C . n 
C 1 26  LEU 26  1219 ?    ?   ?   C . n 
C 1 27  ARG 27  1220 ?    ?   ?   C . n 
C 1 28  SER 28  1221 ?    ?   ?   C . n 
C 1 29  LEU 29  1222 ?    ?   ?   C . n 
C 1 30  ARG 30  1223 ?    ?   ?   C . n 
C 1 31  ARG 31  1224 ?    ?   ?   C . n 
C 1 32  ASN 32  1225 ?    ?   ?   C . n 
C 1 33  THR 33  1226 ?    ?   ?   C . n 
C 1 34  LYS 34  1227 ?    ?   ?   C . n 
C 1 35  LYS 35  1228 ?    ?   ?   C . n 
C 1 36  PRO 36  1229 ?    ?   ?   C . n 
C 1 37  LYS 37  1230 ?    ?   ?   C . n 
C 1 38  PRO 38  1231 ?    ?   ?   C . n 
C 1 39  LYS 39  1232 ?    ?   ?   C . n 
C 1 40  PRO 40  1233 ?    ?   ?   C . n 
C 1 41  ARG 41  1234 ?    ?   ?   C . n 
C 1 42  PRO 42  1235 ?    ?   ?   C . n 
C 1 43  SER 43  1236 ?    ?   ?   C . n 
C 1 44  ILE 44  1237 ?    ?   ?   C . n 
C 1 45  THR 45  1238 ?    ?   ?   C . n 
C 1 46  LYS 46  1239 ?    ?   ?   C . n 
C 1 47  ALA 47  1240 ?    ?   ?   C . n 
C 1 48  THR 48  1241 ?    ?   ?   C . n 
C 1 49  TRP 49  1242 ?    ?   ?   C . n 
C 1 50  GLU 50  1243 ?    ?   ?   C . n 
C 1 51  SER 51  1244 1244 SER SER C . n 
C 1 52  ASN 52  1245 1245 ASN ASN C . n 
C 1 53  TYR 53  1246 1246 TYR TYR C . n 
C 1 54  PHE 54  1247 1247 PHE PHE C . n 
C 1 55  GLY 55  1248 1248 GLY GLY C . n 
C 1 56  VAL 56  1249 1249 VAL VAL C . n 
C 1 57  PRO 57  1250 1250 PRO PRO C . n 
C 1 58  LEU 58  1251 1251 LEU LEU C . n 
C 1 59  THR 59  1252 1252 THR THR C . n 
C 1 60  THR 60  1253 1253 THR THR C . n 
C 1 61  VAL 61  1254 1254 VAL VAL C . n 
C 1 62  VAL 62  1255 1255 VAL VAL C . n 
C 1 63  THR 63  1256 1256 THR THR C . n 
C 1 64  PRO 64  1257 1257 PRO PRO C . n 
C 1 65  GLU 65  1258 1258 GLU GLU C . n 
C 1 66  LYS 66  1259 1259 LYS LYS C . n 
C 1 67  PRO 67  1260 1260 PRO PRO C . n 
C 1 68  ILE 68  1261 1261 ILE ILE C . n 
C 1 69  PRO 69  1262 1262 PRO PRO C . n 
C 1 70  ILE 70  1263 1263 ILE ILE C . n 
C 1 71  PHE 71  1264 1264 PHE PHE C . n 
C 1 72  ILE 72  1265 1265 ILE ILE C . n 
C 1 73  GLU 73  1266 1266 GLU GLU C . n 
C 1 74  ARG 74  1267 1267 ARG ARG C . n 
C 1 75  CYS 75  1268 1268 CYS CYS C . n 
C 1 76  ILE 76  1269 1269 ILE ILE C . n 
C 1 77  GLU 77  1270 1270 GLU GLU C . n 
C 1 78  TYR 78  1271 1271 TYR TYR C . n 
C 1 79  ILE 79  1272 1272 ILE ILE C . n 
C 1 80  GLU 80  1273 1273 GLU GLU C . n 
C 1 81  ALA 81  1274 1274 ALA ALA C . n 
C 1 82  THR 82  1275 1275 THR THR C . n 
C 1 83  GLY 83  1276 1276 GLY GLY C . n 
C 1 84  LEU 84  1277 1277 LEU LEU C . n 
C 1 85  SER 85  1278 1278 SER SER C . n 
C 1 86  THR 86  1279 1279 THR THR C . n 
C 1 87  GLU 87  1280 1280 GLU GLU C . n 
C 1 88  GLY 88  1281 1281 GLY GLY C . n 
C 1 89  ILE 89  1282 1282 ILE ILE C . n 
C 1 90  TYR 90  1283 1283 TYR TYR C . n 
C 1 91  ARG 91  1284 1284 ARG ARG C . n 
C 1 92  VAL 92  1285 1285 VAL VAL C . n 
C 1 93  SER 93  1286 1286 SER SER C . n 
C 1 94  GLY 94  1287 1287 GLY GLY C . n 
C 1 95  ASN 95  1288 1288 ASN ASN C . n 
C 1 96  LYS 96  1289 1289 LYS LYS C . n 
C 1 97  SER 97  1290 1290 SER SER C . n 
C 1 98  GLU 98  1291 1291 GLU GLU C . n 
C 1 99  MET 99  1292 1292 MET MET C . n 
C 1 100 GLU 100 1293 1293 GLU GLU C . n 
C 1 101 SER 101 1294 1294 SER SER C . n 
C 1 102 LEU 102 1295 1295 LEU LEU C . n 
C 1 103 GLN 103 1296 1296 GLN GLN C . n 
C 1 104 ARG 104 1297 1297 ARG ARG C . n 
C 1 105 GLN 105 1298 1298 GLN GLN C . n 
C 1 106 PHE 106 1299 1299 PHE PHE C . n 
C 1 107 ASP 107 1300 1300 ASP ASP C . n 
C 1 108 GLN 108 1301 1301 GLN GLN C . n 
C 1 109 ASP 109 1302 1302 ASP ASP C . n 
C 1 110 HIS 110 1303 1303 HIS HIS C . n 
C 1 111 ASN 111 1304 1304 ASN ASN C . n 
C 1 112 LEU 112 1305 1305 LEU LEU C . n 
C 1 113 ASP 113 1306 1306 ASP ASP C . n 
C 1 114 LEU 114 1307 1307 LEU LEU C . n 
C 1 115 ALA 115 1308 1308 ALA ALA C . n 
C 1 116 GLU 116 1309 1309 GLU GLU C . n 
C 1 117 LYS 117 1310 1310 LYS LYS C . n 
C 1 118 ASP 118 1311 1311 ASP ASP C . n 
C 1 119 PHE 119 1312 1312 PHE PHE C . n 
C 1 120 THR 120 1313 1313 THR THR C . n 
C 1 121 VAL 121 1314 1314 VAL VAL C . n 
C 1 122 ASN 122 1315 1315 ASN ASN C . n 
C 1 123 THR 123 1316 1316 THR THR C . n 
C 1 124 VAL 124 1317 1317 VAL VAL C . n 
C 1 125 ALA 125 1318 1318 ALA ALA C . n 
C 1 126 GLY 126 1319 1319 GLY GLY C . n 
C 1 127 ALA 127 1320 1320 ALA ALA C . n 
C 1 128 MET 128 1321 1321 MET MET C . n 
C 1 129 LYS 129 1322 1322 LYS LYS C . n 
C 1 130 SER 130 1323 1323 SER SER C . n 
C 1 131 PHE 131 1324 1324 PHE PHE C . n 
C 1 132 PHE 132 1325 1325 PHE PHE C . n 
C 1 133 SER 133 1326 1326 SER SER C . n 
C 1 134 GLU 134 1327 1327 GLU GLU C . n 
C 1 135 LEU 135 1328 1328 LEU LEU C . n 
C 1 136 PRO 136 1329 1329 PRO PRO C . n 
C 1 137 ASP 137 1330 1330 ASP ASP C . n 
C 1 138 PRO 138 1331 1331 PRO PRO C . n 
C 1 139 LEU 139 1332 1332 LEU LEU C . n 
C 1 140 VAL 140 1333 1333 VAL VAL C . n 
C 1 141 PRO 141 1334 1334 PRO PRO C . n 
C 1 142 TYR 142 1335 1335 TYR TYR C . n 
C 1 143 ASN 143 1336 1336 ASN ASN C . n 
C 1 144 MET 144 1337 1337 MET MET C . n 
C 1 145 GLN 145 1338 1338 GLN GLN C . n 
C 1 146 ILE 146 1339 1339 ILE ILE C . n 
C 1 147 ASP 147 1340 1340 ASP ASP C . n 
C 1 148 LEU 148 1341 1341 LEU LEU C . n 
C 1 149 VAL 149 1342 1342 VAL VAL C . n 
C 1 150 GLU 150 1343 1343 GLU GLU C . n 
C 1 151 ALA 151 1344 1344 ALA ALA C . n 
C 1 152 HIS 152 1345 1345 HIS HIS C . n 
C 1 153 LYS 153 1346 1346 LYS LYS C . n 
C 1 154 ILE 154 1347 1347 ILE ILE C . n 
C 1 155 ASN 155 1348 1348 ASN ASN C . n 
C 1 156 ASP 156 1349 1349 ASP ASP C . n 
C 1 157 ARG 157 1350 1350 ARG ARG C . n 
C 1 158 GLU 158 1351 1351 GLU GLU C . n 
C 1 159 GLN 159 1352 1352 GLN GLN C . n 
C 1 160 LYS 160 1353 1353 LYS LYS C . n 
C 1 161 LEU 161 1354 1354 LEU LEU C . n 
C 1 162 HIS 162 1355 1355 HIS HIS C . n 
C 1 163 ALA 163 1356 1356 ALA ALA C . n 
C 1 164 LEU 164 1357 1357 LEU LEU C . n 
C 1 165 LYS 165 1358 1358 LYS LYS C . n 
C 1 166 GLU 166 1359 1359 GLU GLU C . n 
C 1 167 VAL 167 1360 1360 VAL VAL C . n 
C 1 168 LEU 168 1361 1361 LEU LEU C . n 
C 1 169 LYS 169 1362 1362 LYS LYS C . n 
C 1 170 LYS 170 1363 1363 LYS LYS C . n 
C 1 171 PHE 171 1364 1364 PHE PHE C . n 
C 1 172 PRO 172 1365 1365 PRO PRO C . n 
C 1 173 LYS 173 1366 1366 LYS LYS C . n 
C 1 174 GLU 174 1367 1367 GLU GLU C . n 
C 1 175 ASN 175 1368 1368 ASN ASN C . n 
C 1 176 HIS 176 1369 1369 HIS HIS C . n 
C 1 177 GLU 177 1370 1370 GLU GLU C . n 
C 1 178 VAL 178 1371 1371 VAL VAL C . n 
C 1 179 PHE 179 1372 1372 PHE PHE C . n 
C 1 180 LYS 180 1373 1373 LYS LYS C . n 
C 1 181 TYR 181 1374 1374 TYR TYR C . n 
C 1 182 VAL 182 1375 1375 VAL VAL C . n 
C 1 183 ILE 183 1376 1376 ILE ILE C . n 
C 1 184 SER 184 1377 1377 SER SER C . n 
C 1 185 HIS 185 1378 1378 HIS HIS C . n 
C 1 186 LEU 186 1379 1379 LEU LEU C . n 
C 1 187 ASN 187 1380 1380 ASN ASN C . n 
C 1 188 LYS 188 1381 1381 LYS LYS C . n 
C 1 189 VAL 189 1382 1382 VAL VAL C . n 
C 1 190 SER 190 1383 1383 SER SER C . n 
C 1 191 HIS 191 1384 1384 HIS HIS C . n 
C 1 192 ASN 192 1385 1385 ASN ASN C . n 
C 1 193 ASN 193 1386 1386 ASN ASN C . n 
C 1 194 LYS 194 1387 1387 LYS LYS C . n 
C 1 195 VAL 195 1388 1388 VAL VAL C . n 
C 1 196 ASN 196 1389 1389 ASN ASN C . n 
C 1 197 LEU 197 1390 1390 LEU LEU C . n 
C 1 198 MET 198 1391 1391 MET MET C . n 
C 1 199 THR 199 1392 1392 THR THR C . n 
C 1 200 SER 200 1393 1393 SER SER C . n 
C 1 201 GLU 201 1394 1394 GLU GLU C . n 
C 1 202 ASN 202 1395 1395 ASN ASN C . n 
C 1 203 LEU 203 1396 1396 LEU LEU C . n 
C 1 204 SER 204 1397 1397 SER SER C . n 
C 1 205 ILE 205 1398 1398 ILE ILE C . n 
C 1 206 CYS 206 1399 1399 CYS CYS C . n 
C 1 207 PHE 207 1400 1400 PHE PHE C . n 
C 1 208 TRP 208 1401 1401 TRP TRP C . n 
C 1 209 PRO 209 1402 1402 PRO PRO C . n 
C 1 210 THR 210 1403 1403 THR THR C . n 
C 1 211 LEU 211 1404 1404 LEU LEU C . n 
C 1 212 MET 212 1405 1405 MET MET C . n 
C 1 213 ARG 213 1406 1406 ARG ARG C . n 
C 1 214 PRO 214 1407 1407 PRO PRO C . n 
C 1 215 ASP 215 1408 1408 ASP ASP C . n 
C 1 216 PHE 216 1409 1409 PHE PHE C . n 
C 1 217 SER 217 1410 1410 SER SER C . n 
C 1 218 THR 218 1411 1411 THR THR C . n 
C 1 219 MET 219 1412 1412 MET MET C . n 
C 1 220 ASP 220 1413 1413 ASP ASP C . n 
C 1 221 ALA 221 1414 1414 ALA ALA C . n 
C 1 222 LEU 222 1415 1415 LEU LEU C . n 
C 1 223 THR 223 1416 1416 THR THR C . n 
C 1 224 ALA 224 1417 1417 ALA ALA C . n 
C 1 225 THR 225 1418 1418 THR THR C . n 
C 1 226 ARG 226 1419 1419 ARG ARG C . n 
C 1 227 THR 227 1420 1420 THR THR C . n 
C 1 228 TYR 228 1421 1421 TYR TYR C . n 
C 1 229 GLN 229 1422 1422 GLN GLN C . n 
C 1 230 THR 230 1423 1423 THR THR C . n 
C 1 231 ILE 231 1424 1424 ILE ILE C . n 
C 1 232 ILE 232 1425 1425 ILE ILE C . n 
C 1 233 GLU 233 1426 1426 GLU GLU C . n 
C 1 234 LEU 234 1427 1427 LEU LEU C . n 
C 1 235 PHE 235 1428 1428 PHE PHE C . n 
C 1 236 ILE 236 1429 1429 ILE ILE C . n 
C 1 237 GLN 237 1430 1430 GLN GLN C . n 
C 1 238 GLN 238 1431 1431 GLN GLN C . n 
C 1 239 CYS 239 1432 1432 CYS CYS C . n 
C 1 240 PRO 240 1433 1433 PRO PRO C . n 
C 1 241 PHE 241 1434 1434 PHE PHE C . n 
C 1 242 PHE 242 1435 1435 PHE PHE C . n 
C 1 243 PHE 243 1436 1436 PHE PHE C . n 
C 1 244 TYR 244 1437 1437 TYR TYR C . n 
C 1 245 ASN 245 1438 1438 ASN ASN C . n 
C 1 246 ARG 246 1439 ?    ?   ?   C . n 
D 1 1   MET 1   1194 ?    ?   ?   D . n 
D 1 2   HIS 2   1195 ?    ?   ?   D . n 
D 1 3   HIS 3   1196 ?    ?   ?   D . n 
D 1 4   HIS 4   1197 ?    ?   ?   D . n 
D 1 5   HIS 5   1198 ?    ?   ?   D . n 
D 1 6   HIS 6   1199 ?    ?   ?   D . n 
D 1 7   HIS 7   1200 ?    ?   ?   D . n 
D 1 8   SER 8   1201 ?    ?   ?   D . n 
D 1 9   SER 9   1202 ?    ?   ?   D . n 
D 1 10  GLY 10  1203 ?    ?   ?   D . n 
D 1 11  ARG 11  1204 ?    ?   ?   D . n 
D 1 12  GLU 12  1205 ?    ?   ?   D . n 
D 1 13  ASN 13  1206 ?    ?   ?   D . n 
D 1 14  LEU 14  1207 ?    ?   ?   D . n 
D 1 15  TYR 15  1208 ?    ?   ?   D . n 
D 1 16  PHE 16  1209 ?    ?   ?   D . n 
D 1 17  GLN 17  1210 ?    ?   ?   D . n 
D 1 18  GLY 18  1211 ?    ?   ?   D . n 
D 1 19  ASP 19  1212 ?    ?   ?   D . n 
D 1 20  PRO 20  1213 ?    ?   ?   D . n 
D 1 21  ARG 21  1214 ?    ?   ?   D . n 
D 1 22  ARG 22  1215 ?    ?   ?   D . n 
D 1 23  ARG 23  1216 ?    ?   ?   D . n 
D 1 24  ASN 24  1217 ?    ?   ?   D . n 
D 1 25  ILE 25  1218 ?    ?   ?   D . n 
D 1 26  LEU 26  1219 ?    ?   ?   D . n 
D 1 27  ARG 27  1220 ?    ?   ?   D . n 
D 1 28  SER 28  1221 ?    ?   ?   D . n 
D 1 29  LEU 29  1222 ?    ?   ?   D . n 
D 1 30  ARG 30  1223 ?    ?   ?   D . n 
D 1 31  ARG 31  1224 ?    ?   ?   D . n 
D 1 32  ASN 32  1225 ?    ?   ?   D . n 
D 1 33  THR 33  1226 ?    ?   ?   D . n 
D 1 34  LYS 34  1227 ?    ?   ?   D . n 
D 1 35  LYS 35  1228 ?    ?   ?   D . n 
D 1 36  PRO 36  1229 ?    ?   ?   D . n 
D 1 37  LYS 37  1230 ?    ?   ?   D . n 
D 1 38  PRO 38  1231 ?    ?   ?   D . n 
D 1 39  LYS 39  1232 ?    ?   ?   D . n 
D 1 40  PRO 40  1233 ?    ?   ?   D . n 
D 1 41  ARG 41  1234 ?    ?   ?   D . n 
D 1 42  PRO 42  1235 ?    ?   ?   D . n 
D 1 43  SER 43  1236 ?    ?   ?   D . n 
D 1 44  ILE 44  1237 ?    ?   ?   D . n 
D 1 45  THR 45  1238 ?    ?   ?   D . n 
D 1 46  LYS 46  1239 ?    ?   ?   D . n 
D 1 47  ALA 47  1240 ?    ?   ?   D . n 
D 1 48  THR 48  1241 ?    ?   ?   D . n 
D 1 49  TRP 49  1242 1242 TRP TRP D . n 
D 1 50  GLU 50  1243 1243 GLU GLU D . n 
D 1 51  SER 51  1244 1244 SER SER D . n 
D 1 52  ASN 52  1245 1245 ASN ASN D . n 
D 1 53  TYR 53  1246 1246 TYR TYR D . n 
D 1 54  PHE 54  1247 1247 PHE PHE D . n 
D 1 55  GLY 55  1248 1248 GLY GLY D . n 
D 1 56  VAL 56  1249 1249 VAL VAL D . n 
D 1 57  PRO 57  1250 1250 PRO PRO D . n 
D 1 58  LEU 58  1251 1251 LEU LEU D . n 
D 1 59  THR 59  1252 1252 THR THR D . n 
D 1 60  THR 60  1253 1253 THR THR D . n 
D 1 61  VAL 61  1254 1254 VAL VAL D . n 
D 1 62  VAL 62  1255 1255 VAL VAL D . n 
D 1 63  THR 63  1256 1256 THR THR D . n 
D 1 64  PRO 64  1257 1257 PRO PRO D . n 
D 1 65  GLU 65  1258 1258 GLU GLU D . n 
D 1 66  LYS 66  1259 1259 LYS LYS D . n 
D 1 67  PRO 67  1260 1260 PRO PRO D . n 
D 1 68  ILE 68  1261 1261 ILE ILE D . n 
D 1 69  PRO 69  1262 1262 PRO PRO D . n 
D 1 70  ILE 70  1263 1263 ILE ILE D . n 
D 1 71  PHE 71  1264 1264 PHE PHE D . n 
D 1 72  ILE 72  1265 1265 ILE ILE D . n 
D 1 73  GLU 73  1266 1266 GLU GLU D . n 
D 1 74  ARG 74  1267 1267 ARG ARG D . n 
D 1 75  CYS 75  1268 1268 CYS CYS D . n 
D 1 76  ILE 76  1269 1269 ILE ILE D . n 
D 1 77  GLU 77  1270 1270 GLU GLU D . n 
D 1 78  TYR 78  1271 1271 TYR TYR D . n 
D 1 79  ILE 79  1272 1272 ILE ILE D . n 
D 1 80  GLU 80  1273 1273 GLU GLU D . n 
D 1 81  ALA 81  1274 1274 ALA ALA D . n 
D 1 82  THR 82  1275 1275 THR THR D . n 
D 1 83  GLY 83  1276 1276 GLY GLY D . n 
D 1 84  LEU 84  1277 1277 LEU LEU D . n 
D 1 85  SER 85  1278 1278 SER SER D . n 
D 1 86  THR 86  1279 1279 THR THR D . n 
D 1 87  GLU 87  1280 1280 GLU GLU D . n 
D 1 88  GLY 88  1281 1281 GLY GLY D . n 
D 1 89  ILE 89  1282 1282 ILE ILE D . n 
D 1 90  TYR 90  1283 1283 TYR TYR D . n 
D 1 91  ARG 91  1284 1284 ARG ARG D . n 
D 1 92  VAL 92  1285 1285 VAL VAL D . n 
D 1 93  SER 93  1286 1286 SER SER D . n 
D 1 94  GLY 94  1287 1287 GLY GLY D . n 
D 1 95  ASN 95  1288 1288 ASN ASN D . n 
D 1 96  LYS 96  1289 1289 LYS LYS D . n 
D 1 97  SER 97  1290 1290 SER SER D . n 
D 1 98  GLU 98  1291 1291 GLU GLU D . n 
D 1 99  MET 99  1292 1292 MET MET D . n 
D 1 100 GLU 100 1293 1293 GLU GLU D . n 
D 1 101 SER 101 1294 1294 SER SER D . n 
D 1 102 LEU 102 1295 1295 LEU LEU D . n 
D 1 103 GLN 103 1296 1296 GLN GLN D . n 
D 1 104 ARG 104 1297 1297 ARG ARG D . n 
D 1 105 GLN 105 1298 1298 GLN GLN D . n 
D 1 106 PHE 106 1299 1299 PHE PHE D . n 
D 1 107 ASP 107 1300 1300 ASP ASP D . n 
D 1 108 GLN 108 1301 1301 GLN GLN D . n 
D 1 109 ASP 109 1302 1302 ASP ASP D . n 
D 1 110 HIS 110 1303 1303 HIS HIS D . n 
D 1 111 ASN 111 1304 1304 ASN ASN D . n 
D 1 112 LEU 112 1305 1305 LEU LEU D . n 
D 1 113 ASP 113 1306 1306 ASP ASP D . n 
D 1 114 LEU 114 1307 1307 LEU LEU D . n 
D 1 115 ALA 115 1308 1308 ALA ALA D . n 
D 1 116 GLU 116 1309 1309 GLU GLU D . n 
D 1 117 LYS 117 1310 1310 LYS LYS D . n 
D 1 118 ASP 118 1311 1311 ASP ASP D . n 
D 1 119 PHE 119 1312 1312 PHE PHE D . n 
D 1 120 THR 120 1313 1313 THR THR D . n 
D 1 121 VAL 121 1314 1314 VAL VAL D . n 
D 1 122 ASN 122 1315 1315 ASN ASN D . n 
D 1 123 THR 123 1316 1316 THR THR D . n 
D 1 124 VAL 124 1317 1317 VAL VAL D . n 
D 1 125 ALA 125 1318 1318 ALA ALA D . n 
D 1 126 GLY 126 1319 1319 GLY GLY D . n 
D 1 127 ALA 127 1320 1320 ALA ALA D . n 
D 1 128 MET 128 1321 1321 MET MET D . n 
D 1 129 LYS 129 1322 1322 LYS LYS D . n 
D 1 130 SER 130 1323 1323 SER SER D . n 
D 1 131 PHE 131 1324 1324 PHE PHE D . n 
D 1 132 PHE 132 1325 1325 PHE PHE D . n 
D 1 133 SER 133 1326 1326 SER SER D . n 
D 1 134 GLU 134 1327 1327 GLU GLU D . n 
D 1 135 LEU 135 1328 1328 LEU LEU D . n 
D 1 136 PRO 136 1329 1329 PRO PRO D . n 
D 1 137 ASP 137 1330 1330 ASP ASP D . n 
D 1 138 PRO 138 1331 1331 PRO PRO D . n 
D 1 139 LEU 139 1332 1332 LEU LEU D . n 
D 1 140 VAL 140 1333 1333 VAL VAL D . n 
D 1 141 PRO 141 1334 1334 PRO PRO D . n 
D 1 142 TYR 142 1335 1335 TYR TYR D . n 
D 1 143 ASN 143 1336 1336 ASN ASN D . n 
D 1 144 MET 144 1337 1337 MET MET D . n 
D 1 145 GLN 145 1338 1338 GLN GLN D . n 
D 1 146 ILE 146 1339 1339 ILE ILE D . n 
D 1 147 ASP 147 1340 1340 ASP ASP D . n 
D 1 148 LEU 148 1341 1341 LEU LEU D . n 
D 1 149 VAL 149 1342 1342 VAL VAL D . n 
D 1 150 GLU 150 1343 1343 GLU GLU D . n 
D 1 151 ALA 151 1344 1344 ALA ALA D . n 
D 1 152 HIS 152 1345 1345 HIS HIS D . n 
D 1 153 LYS 153 1346 1346 LYS LYS D . n 
D 1 154 ILE 154 1347 1347 ILE ILE D . n 
D 1 155 ASN 155 1348 1348 ASN ASN D . n 
D 1 156 ASP 156 1349 1349 ASP ASP D . n 
D 1 157 ARG 157 1350 1350 ARG ARG D . n 
D 1 158 GLU 158 1351 1351 GLU GLU D . n 
D 1 159 GLN 159 1352 1352 GLN GLN D . n 
D 1 160 LYS 160 1353 1353 LYS LYS D . n 
D 1 161 LEU 161 1354 1354 LEU LEU D . n 
D 1 162 HIS 162 1355 1355 HIS HIS D . n 
D 1 163 ALA 163 1356 1356 ALA ALA D . n 
D 1 164 LEU 164 1357 1357 LEU LEU D . n 
D 1 165 LYS 165 1358 1358 LYS LYS D . n 
D 1 166 GLU 166 1359 1359 GLU GLU D . n 
D 1 167 VAL 167 1360 1360 VAL VAL D . n 
D 1 168 LEU 168 1361 1361 LEU LEU D . n 
D 1 169 LYS 169 1362 1362 LYS LYS D . n 
D 1 170 LYS 170 1363 1363 LYS LYS D . n 
D 1 171 PHE 171 1364 1364 PHE PHE D . n 
D 1 172 PRO 172 1365 1365 PRO PRO D . n 
D 1 173 LYS 173 1366 1366 LYS LYS D . n 
D 1 174 GLU 174 1367 1367 GLU GLU D . n 
D 1 175 ASN 175 1368 1368 ASN ASN D . n 
D 1 176 HIS 176 1369 1369 HIS HIS D . n 
D 1 177 GLU 177 1370 1370 GLU GLU D . n 
D 1 178 VAL 178 1371 1371 VAL VAL D . n 
D 1 179 PHE 179 1372 1372 PHE PHE D . n 
D 1 180 LYS 180 1373 1373 LYS LYS D . n 
D 1 181 TYR 181 1374 1374 TYR TYR D . n 
D 1 182 VAL 182 1375 1375 VAL VAL D . n 
D 1 183 ILE 183 1376 1376 ILE ILE D . n 
D 1 184 SER 184 1377 1377 SER SER D . n 
D 1 185 HIS 185 1378 1378 HIS HIS D . n 
D 1 186 LEU 186 1379 1379 LEU LEU D . n 
D 1 187 ASN 187 1380 1380 ASN ASN D . n 
D 1 188 LYS 188 1381 1381 LYS LYS D . n 
D 1 189 VAL 189 1382 1382 VAL VAL D . n 
D 1 190 SER 190 1383 1383 SER SER D . n 
D 1 191 HIS 191 1384 1384 HIS HIS D . n 
D 1 192 ASN 192 1385 1385 ASN ASN D . n 
D 1 193 ASN 193 1386 1386 ASN ASN D . n 
D 1 194 LYS 194 1387 1387 LYS LYS D . n 
D 1 195 VAL 195 1388 1388 VAL VAL D . n 
D 1 196 ASN 196 1389 1389 ASN ASN D . n 
D 1 197 LEU 197 1390 1390 LEU LEU D . n 
D 1 198 MET 198 1391 1391 MET MET D . n 
D 1 199 THR 199 1392 1392 THR THR D . n 
D 1 200 SER 200 1393 1393 SER SER D . n 
D 1 201 GLU 201 1394 1394 GLU GLU D . n 
D 1 202 ASN 202 1395 1395 ASN ASN D . n 
D 1 203 LEU 203 1396 1396 LEU LEU D . n 
D 1 204 SER 204 1397 1397 SER SER D . n 
D 1 205 ILE 205 1398 1398 ILE ILE D . n 
D 1 206 CYS 206 1399 1399 CYS CYS D . n 
D 1 207 PHE 207 1400 1400 PHE PHE D . n 
D 1 208 TRP 208 1401 1401 TRP TRP D . n 
D 1 209 PRO 209 1402 1402 PRO PRO D . n 
D 1 210 THR 210 1403 1403 THR THR D . n 
D 1 211 LEU 211 1404 1404 LEU LEU D . n 
D 1 212 MET 212 1405 1405 MET MET D . n 
D 1 213 ARG 213 1406 1406 ARG ARG D . n 
D 1 214 PRO 214 1407 1407 PRO PRO D . n 
D 1 215 ASP 215 1408 1408 ASP ASP D . n 
D 1 216 PHE 216 1409 1409 PHE PHE D . n 
D 1 217 SER 217 1410 1410 SER SER D . n 
D 1 218 THR 218 1411 1411 THR THR D . n 
D 1 219 MET 219 1412 1412 MET MET D . n 
D 1 220 ASP 220 1413 1413 ASP ASP D . n 
D 1 221 ALA 221 1414 1414 ALA ALA D . n 
D 1 222 LEU 222 1415 1415 LEU LEU D . n 
D 1 223 THR 223 1416 1416 THR THR D . n 
D 1 224 ALA 224 1417 1417 ALA ALA D . n 
D 1 225 THR 225 1418 1418 THR THR D . n 
D 1 226 ARG 226 1419 1419 ARG ARG D . n 
D 1 227 THR 227 1420 1420 THR THR D . n 
D 1 228 TYR 228 1421 1421 TYR TYR D . n 
D 1 229 GLN 229 1422 1422 GLN GLN D . n 
D 1 230 THR 230 1423 1423 THR THR D . n 
D 1 231 ILE 231 1424 1424 ILE ILE D . n 
D 1 232 ILE 232 1425 1425 ILE ILE D . n 
D 1 233 GLU 233 1426 1426 GLU GLU D . n 
D 1 234 LEU 234 1427 1427 LEU LEU D . n 
D 1 235 PHE 235 1428 1428 PHE PHE D . n 
D 1 236 ILE 236 1429 1429 ILE ILE D . n 
D 1 237 GLN 237 1430 1430 GLN GLN D . n 
D 1 238 GLN 238 1431 1431 GLN GLN D . n 
D 1 239 CYS 239 1432 1432 CYS CYS D . n 
D 1 240 PRO 240 1433 1433 PRO PRO D . n 
D 1 241 PHE 241 1434 1434 PHE PHE D . n 
D 1 242 PHE 242 1435 1435 PHE PHE D . n 
D 1 243 PHE 243 1436 1436 PHE PHE D . n 
D 1 244 TYR 244 1437 1437 TYR TYR D . n 
D 1 245 ASN 245 1438 ?    ?   ?   D . n 
D 1 246 ARG 246 1439 ?    ?   ?   D . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 2 UNX 1 1 1 UNX UNX A . 
F 2 UNX 1 5 5 UNX UNX A . 
G 2 UNX 1 2 2 UNX UNX B . 
H 2 UNX 1 6 6 UNX UNX B . 
I 2 UNX 1 3 3 UNX UNX C . 
J 2 UNX 1 7 7 UNX UNX C . 
K 2 UNX 1 4 4 UNX UNX D . 
L 2 UNX 1 8 8 UNX UNX D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 software_defined_assembly PISA monomeric 1 
2 software_defined_assembly PISA monomeric 1 
3 software_defined_assembly PISA monomeric 1 
4 software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,E,F 
2 1 B,G,H 
3 1 C,I,J 
4 1 D,K,L 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-12-23 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-11-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_phasing.method   MR 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .     ?                    package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu       'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?   ? 1 
SCALEPACK   .     ?                    package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu       'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?   ? 2 
PHASER      .     ?                    other   'R. J. Read'         cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/      ?   ? 3 
PHENIX      .     ?                    package 'P.D. Adams'         PDAdams@lbl.gov             refinement        
http://www.phenix-online.org/                    C++ ? 4 
PDB_EXTRACT 3.005 'September 10, 2007' package PDB                  sw-help@rcsb.rutgers.edu    'data extraction' 
http://pdb.rutgers.edu/software/                 C++ ? 5 
HKL-2000    .     ?                    ?       ?                    ?                           'data scaling'    ? ?   ? 6 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR A 1283 ? ? 79.21   -25.58 
2  1 SER A 1410 ? ? -108.65 42.77  
3  1 THR A 1411 ? ? -151.91 -1.61  
4  1 TYR B 1283 ? ? 79.52   -25.35 
5  1 TYR C 1283 ? ? 79.14   -25.45 
6  1 SER C 1410 ? ? -107.88 42.01  
7  1 THR C 1411 ? ? -151.74 -2.27  
8  1 PRO D 1250 ? ? -45.11  150.46 
9  1 TYR D 1283 ? ? 79.12   -26.65 
10 1 SER D 1410 ? ? -107.89 42.79  
11 1 THR D 1411 ? ? -151.95 -1.39  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A GLU 1243 ? CG  ? A GLU 50  CG  
2   1 Y 1 A GLU 1243 ? CD  ? A GLU 50  CD  
3   1 Y 1 A GLU 1243 ? OE1 ? A GLU 50  OE1 
4   1 Y 1 A GLU 1243 ? OE2 ? A GLU 50  OE2 
5   1 Y 1 A LYS 1259 ? CG  ? A LYS 66  CG  
6   1 Y 1 A LYS 1259 ? CD  ? A LYS 66  CD  
7   1 Y 1 A LYS 1259 ? CE  ? A LYS 66  CE  
8   1 Y 1 A LYS 1259 ? NZ  ? A LYS 66  NZ  
9   1 Y 1 A THR 1275 ? OG1 ? A THR 82  OG1 
10  1 Y 1 A THR 1275 ? CG2 ? A THR 82  CG2 
11  1 Y 1 A LYS 1289 ? CG  ? A LYS 96  CG  
12  1 Y 1 A LYS 1289 ? CD  ? A LYS 96  CD  
13  1 Y 1 A LYS 1289 ? CE  ? A LYS 96  CE  
14  1 Y 1 A LYS 1289 ? NZ  ? A LYS 96  NZ  
15  1 Y 1 A SER 1290 ? OG  ? A SER 97  OG  
16  1 Y 1 A GLU 1309 ? CG  ? A GLU 116 CG  
17  1 Y 1 A GLU 1309 ? CD  ? A GLU 116 CD  
18  1 Y 1 A GLU 1309 ? OE1 ? A GLU 116 OE1 
19  1 Y 1 A GLU 1309 ? OE2 ? A GLU 116 OE2 
20  1 Y 1 A LYS 1310 ? CG  ? A LYS 117 CG  
21  1 Y 1 A LYS 1310 ? CD  ? A LYS 117 CD  
22  1 Y 1 A LYS 1310 ? CE  ? A LYS 117 CE  
23  1 Y 1 A LYS 1310 ? NZ  ? A LYS 117 NZ  
24  1 Y 1 A ASP 1311 ? CG  ? A ASP 118 CG  
25  1 Y 1 A ASP 1311 ? OD1 ? A ASP 118 OD1 
26  1 Y 1 A ASP 1311 ? OD2 ? A ASP 118 OD2 
27  1 Y 1 A LYS 1363 ? CE  ? A LYS 170 CE  
28  1 Y 1 A LYS 1363 ? NZ  ? A LYS 170 NZ  
29  1 Y 1 A SER 1410 ? OG  ? A SER 217 OG  
30  1 Y 1 A THR 1411 ? OG1 ? A THR 218 OG1 
31  1 Y 1 A THR 1411 ? CG2 ? A THR 218 CG2 
32  1 Y 1 A LEU 1415 ? CG  ? A LEU 222 CG  
33  1 Y 1 A LEU 1415 ? CD1 ? A LEU 222 CD1 
34  1 Y 1 A LEU 1415 ? CD2 ? A LEU 222 CD2 
35  1 Y 1 A THR 1416 ? OG1 ? A THR 223 OG1 
36  1 Y 1 A THR 1416 ? CG2 ? A THR 223 CG2 
37  1 Y 1 A ARG 1419 ? CG  ? A ARG 226 CG  
38  1 Y 1 A ARG 1419 ? CD  ? A ARG 226 CD  
39  1 Y 1 A ARG 1419 ? NE  ? A ARG 226 NE  
40  1 Y 1 A ARG 1419 ? CZ  ? A ARG 226 CZ  
41  1 Y 1 A ARG 1419 ? NH1 ? A ARG 226 NH1 
42  1 Y 1 A ARG 1419 ? NH2 ? A ARG 226 NH2 
43  1 Y 1 B GLU 1243 ? OE1 ? B GLU 50  OE1 
44  1 Y 1 B GLU 1243 ? OE2 ? B GLU 50  OE2 
45  1 Y 1 B SER 1244 ? OG  ? B SER 51  OG  
46  1 Y 1 B ASN 1245 ? CG  ? B ASN 52  CG  
47  1 Y 1 B ASN 1245 ? OD1 ? B ASN 52  OD1 
48  1 Y 1 B ASN 1245 ? ND2 ? B ASN 52  ND2 
49  1 Y 1 B LYS 1259 ? CD  ? B LYS 66  CD  
50  1 Y 1 B LYS 1259 ? CE  ? B LYS 66  CE  
51  1 Y 1 B LYS 1259 ? NZ  ? B LYS 66  NZ  
52  1 Y 1 B THR 1275 ? OG1 ? B THR 82  OG1 
53  1 Y 1 B THR 1275 ? CG2 ? B THR 82  CG2 
54  1 Y 1 B LYS 1289 ? CG  ? B LYS 96  CG  
55  1 Y 1 B LYS 1289 ? CD  ? B LYS 96  CD  
56  1 Y 1 B LYS 1289 ? CE  ? B LYS 96  CE  
57  1 Y 1 B LYS 1289 ? NZ  ? B LYS 96  NZ  
58  1 Y 1 B SER 1290 ? OG  ? B SER 97  OG  
59  1 Y 1 B GLU 1293 ? CG  ? B GLU 100 CG  
60  1 Y 1 B GLU 1293 ? CD  ? B GLU 100 CD  
61  1 Y 1 B GLU 1293 ? OE1 ? B GLU 100 OE1 
62  1 Y 1 B GLU 1293 ? OE2 ? B GLU 100 OE2 
63  1 Y 1 B GLU 1309 ? CG  ? B GLU 116 CG  
64  1 Y 1 B GLU 1309 ? CD  ? B GLU 116 CD  
65  1 Y 1 B GLU 1309 ? OE1 ? B GLU 116 OE1 
66  1 Y 1 B GLU 1309 ? OE2 ? B GLU 116 OE2 
67  1 Y 1 B LYS 1310 ? CG  ? B LYS 117 CG  
68  1 Y 1 B LYS 1310 ? CD  ? B LYS 117 CD  
69  1 Y 1 B LYS 1310 ? CE  ? B LYS 117 CE  
70  1 Y 1 B LYS 1310 ? NZ  ? B LYS 117 NZ  
71  1 Y 1 B ASP 1311 ? CG  ? B ASP 118 CG  
72  1 Y 1 B ASP 1311 ? OD1 ? B ASP 118 OD1 
73  1 Y 1 B ASP 1311 ? OD2 ? B ASP 118 OD2 
74  1 Y 1 B LYS 1363 ? CE  ? B LYS 170 CE  
75  1 Y 1 B LYS 1363 ? NZ  ? B LYS 170 NZ  
76  1 Y 1 B LEU 1415 ? CG  ? B LEU 222 CG  
77  1 Y 1 B LEU 1415 ? CD1 ? B LEU 222 CD1 
78  1 Y 1 B LEU 1415 ? CD2 ? B LEU 222 CD2 
79  1 Y 1 B THR 1416 ? OG1 ? B THR 223 OG1 
80  1 Y 1 B THR 1416 ? CG2 ? B THR 223 CG2 
81  1 Y 1 B ARG 1419 ? CG  ? B ARG 226 CG  
82  1 Y 1 B ARG 1419 ? CD  ? B ARG 226 CD  
83  1 Y 1 B ARG 1419 ? NE  ? B ARG 226 NE  
84  1 Y 1 B ARG 1419 ? CZ  ? B ARG 226 CZ  
85  1 Y 1 B ARG 1419 ? NH1 ? B ARG 226 NH1 
86  1 Y 1 B ARG 1419 ? NH2 ? B ARG 226 NH2 
87  1 Y 1 C GLU 1258 ? CG  ? C GLU 65  CG  
88  1 Y 1 C GLU 1258 ? CD  ? C GLU 65  CD  
89  1 Y 1 C GLU 1258 ? OE1 ? C GLU 65  OE1 
90  1 Y 1 C GLU 1258 ? OE2 ? C GLU 65  OE2 
91  1 Y 1 C LYS 1259 ? CG  ? C LYS 66  CG  
92  1 Y 1 C LYS 1259 ? CD  ? C LYS 66  CD  
93  1 Y 1 C LYS 1259 ? CE  ? C LYS 66  CE  
94  1 Y 1 C LYS 1259 ? NZ  ? C LYS 66  NZ  
95  1 Y 1 C THR 1275 ? OG1 ? C THR 82  OG1 
96  1 Y 1 C THR 1275 ? CG2 ? C THR 82  CG2 
97  1 Y 1 C LYS 1289 ? CG  ? C LYS 96  CG  
98  1 Y 1 C LYS 1289 ? CD  ? C LYS 96  CD  
99  1 Y 1 C LYS 1289 ? CE  ? C LYS 96  CE  
100 1 Y 1 C LYS 1289 ? NZ  ? C LYS 96  NZ  
101 1 Y 1 C SER 1290 ? OG  ? C SER 97  OG  
102 1 Y 1 C GLU 1291 ? CD  ? C GLU 98  CD  
103 1 Y 1 C GLU 1291 ? OE1 ? C GLU 98  OE1 
104 1 Y 1 C GLU 1291 ? OE2 ? C GLU 98  OE2 
105 1 Y 1 C GLU 1293 ? CG  ? C GLU 100 CG  
106 1 Y 1 C GLU 1293 ? CD  ? C GLU 100 CD  
107 1 Y 1 C GLU 1293 ? OE1 ? C GLU 100 OE1 
108 1 Y 1 C GLU 1293 ? OE2 ? C GLU 100 OE2 
109 1 Y 1 C GLN 1296 ? CG  ? C GLN 103 CG  
110 1 Y 1 C GLN 1296 ? CD  ? C GLN 103 CD  
111 1 Y 1 C GLN 1296 ? OE1 ? C GLN 103 OE1 
112 1 Y 1 C GLN 1296 ? NE2 ? C GLN 103 NE2 
113 1 Y 1 C ARG 1297 ? CG  ? C ARG 104 CG  
114 1 Y 1 C ARG 1297 ? CD  ? C ARG 104 CD  
115 1 Y 1 C ARG 1297 ? NE  ? C ARG 104 NE  
116 1 Y 1 C ARG 1297 ? CZ  ? C ARG 104 CZ  
117 1 Y 1 C ARG 1297 ? NH1 ? C ARG 104 NH1 
118 1 Y 1 C ARG 1297 ? NH2 ? C ARG 104 NH2 
119 1 Y 1 C ASP 1306 ? CG  ? C ASP 113 CG  
120 1 Y 1 C ASP 1306 ? OD1 ? C ASP 113 OD1 
121 1 Y 1 C ASP 1306 ? OD2 ? C ASP 113 OD2 
122 1 Y 1 C LEU 1307 ? CG  ? C LEU 114 CG  
123 1 Y 1 C LEU 1307 ? CD1 ? C LEU 114 CD1 
124 1 Y 1 C LEU 1307 ? CD2 ? C LEU 114 CD2 
125 1 Y 1 C GLU 1309 ? CG  ? C GLU 116 CG  
126 1 Y 1 C GLU 1309 ? CD  ? C GLU 116 CD  
127 1 Y 1 C GLU 1309 ? OE1 ? C GLU 116 OE1 
128 1 Y 1 C GLU 1309 ? OE2 ? C GLU 116 OE2 
129 1 Y 1 C LYS 1310 ? CG  ? C LYS 117 CG  
130 1 Y 1 C LYS 1310 ? CD  ? C LYS 117 CD  
131 1 Y 1 C LYS 1310 ? CE  ? C LYS 117 CE  
132 1 Y 1 C LYS 1310 ? NZ  ? C LYS 117 NZ  
133 1 Y 1 C ASP 1311 ? CG  ? C ASP 118 CG  
134 1 Y 1 C ASP 1311 ? OD1 ? C ASP 118 OD1 
135 1 Y 1 C ASP 1311 ? OD2 ? C ASP 118 OD2 
136 1 Y 1 C ASN 1348 ? CG  ? C ASN 155 CG  
137 1 Y 1 C ASN 1348 ? OD1 ? C ASN 155 OD1 
138 1 Y 1 C ASN 1348 ? ND2 ? C ASN 155 ND2 
139 1 Y 1 C LYS 1363 ? CE  ? C LYS 170 CE  
140 1 Y 1 C LYS 1363 ? NZ  ? C LYS 170 NZ  
141 1 Y 1 C SER 1410 ? OG  ? C SER 217 OG  
142 1 Y 1 C THR 1411 ? OG1 ? C THR 218 OG1 
143 1 Y 1 C THR 1411 ? CG2 ? C THR 218 CG2 
144 1 Y 1 C ARG 1419 ? CG  ? C ARG 226 CG  
145 1 Y 1 C ARG 1419 ? CD  ? C ARG 226 CD  
146 1 Y 1 C ARG 1419 ? NE  ? C ARG 226 NE  
147 1 Y 1 C ARG 1419 ? CZ  ? C ARG 226 CZ  
148 1 Y 1 C ARG 1419 ? NH1 ? C ARG 226 NH1 
149 1 Y 1 C ARG 1419 ? NH2 ? C ARG 226 NH2 
150 1 Y 1 C ASN 1438 ? CG  ? C ASN 245 CG  
151 1 Y 1 C ASN 1438 ? OD1 ? C ASN 245 OD1 
152 1 Y 1 C ASN 1438 ? ND2 ? C ASN 245 ND2 
153 1 Y 1 D TRP 1242 ? CG  ? D TRP 49  CG  
154 1 Y 1 D TRP 1242 ? CD1 ? D TRP 49  CD1 
155 1 Y 1 D TRP 1242 ? CD2 ? D TRP 49  CD2 
156 1 Y 1 D TRP 1242 ? NE1 ? D TRP 49  NE1 
157 1 Y 1 D TRP 1242 ? CE2 ? D TRP 49  CE2 
158 1 Y 1 D TRP 1242 ? CE3 ? D TRP 49  CE3 
159 1 Y 1 D TRP 1242 ? CZ2 ? D TRP 49  CZ2 
160 1 Y 1 D TRP 1242 ? CZ3 ? D TRP 49  CZ3 
161 1 Y 1 D TRP 1242 ? CH2 ? D TRP 49  CH2 
162 1 Y 1 D GLU 1243 ? CG  ? D GLU 50  CG  
163 1 Y 1 D GLU 1243 ? CD  ? D GLU 50  CD  
164 1 Y 1 D GLU 1243 ? OE1 ? D GLU 50  OE1 
165 1 Y 1 D GLU 1243 ? OE2 ? D GLU 50  OE2 
166 1 Y 1 D GLU 1258 ? CG  ? D GLU 65  CG  
167 1 Y 1 D GLU 1258 ? CD  ? D GLU 65  CD  
168 1 Y 1 D GLU 1258 ? OE1 ? D GLU 65  OE1 
169 1 Y 1 D GLU 1258 ? OE2 ? D GLU 65  OE2 
170 1 Y 1 D LYS 1259 ? CG  ? D LYS 66  CG  
171 1 Y 1 D LYS 1259 ? CD  ? D LYS 66  CD  
172 1 Y 1 D LYS 1259 ? CE  ? D LYS 66  CE  
173 1 Y 1 D LYS 1259 ? NZ  ? D LYS 66  NZ  
174 1 Y 1 D THR 1275 ? OG1 ? D THR 82  OG1 
175 1 Y 1 D THR 1275 ? CG2 ? D THR 82  CG2 
176 1 Y 1 D SER 1286 ? OG  ? D SER 93  OG  
177 1 Y 1 D LYS 1289 ? CG  ? D LYS 96  CG  
178 1 Y 1 D LYS 1289 ? CD  ? D LYS 96  CD  
179 1 Y 1 D LYS 1289 ? CE  ? D LYS 96  CE  
180 1 Y 1 D LYS 1289 ? NZ  ? D LYS 96  NZ  
181 1 Y 1 D SER 1290 ? OG  ? D SER 97  OG  
182 1 Y 1 D GLU 1293 ? CG  ? D GLU 100 CG  
183 1 Y 1 D GLU 1293 ? CD  ? D GLU 100 CD  
184 1 Y 1 D GLU 1293 ? OE1 ? D GLU 100 OE1 
185 1 Y 1 D GLU 1293 ? OE2 ? D GLU 100 OE2 
186 1 Y 1 D ARG 1297 ? CG  ? D ARG 104 CG  
187 1 Y 1 D ARG 1297 ? CD  ? D ARG 104 CD  
188 1 Y 1 D ARG 1297 ? NE  ? D ARG 104 NE  
189 1 Y 1 D ARG 1297 ? CZ  ? D ARG 104 CZ  
190 1 Y 1 D ARG 1297 ? NH1 ? D ARG 104 NH1 
191 1 Y 1 D ARG 1297 ? NH2 ? D ARG 104 NH2 
192 1 Y 1 D ASN 1304 ? CG  ? D ASN 111 CG  
193 1 Y 1 D ASN 1304 ? OD1 ? D ASN 111 OD1 
194 1 Y 1 D ASN 1304 ? ND2 ? D ASN 111 ND2 
195 1 Y 1 D GLU 1309 ? CG  ? D GLU 116 CG  
196 1 Y 1 D GLU 1309 ? CD  ? D GLU 116 CD  
197 1 Y 1 D GLU 1309 ? OE1 ? D GLU 116 OE1 
198 1 Y 1 D GLU 1309 ? OE2 ? D GLU 116 OE2 
199 1 Y 1 D LYS 1310 ? CG  ? D LYS 117 CG  
200 1 Y 1 D LYS 1310 ? CD  ? D LYS 117 CD  
201 1 Y 1 D LYS 1310 ? CE  ? D LYS 117 CE  
202 1 Y 1 D LYS 1310 ? NZ  ? D LYS 117 NZ  
203 1 Y 1 D ASP 1311 ? CG  ? D ASP 118 CG  
204 1 Y 1 D ASP 1311 ? OD1 ? D ASP 118 OD1 
205 1 Y 1 D ASP 1311 ? OD2 ? D ASP 118 OD2 
206 1 Y 1 D LYS 1346 ? CD  ? D LYS 153 CD  
207 1 Y 1 D LYS 1346 ? CE  ? D LYS 153 CE  
208 1 Y 1 D LYS 1346 ? NZ  ? D LYS 153 NZ  
209 1 Y 1 D LYS 1362 ? CG  ? D LYS 169 CG  
210 1 Y 1 D LYS 1362 ? CD  ? D LYS 169 CD  
211 1 Y 1 D LYS 1362 ? CE  ? D LYS 169 CE  
212 1 Y 1 D LYS 1362 ? NZ  ? D LYS 169 NZ  
213 1 Y 1 D LYS 1363 ? CE  ? D LYS 170 CE  
214 1 Y 1 D LYS 1363 ? NZ  ? D LYS 170 NZ  
215 1 Y 1 D SER 1410 ? OG  ? D SER 217 OG  
216 1 Y 1 D THR 1411 ? OG1 ? D THR 218 OG1 
217 1 Y 1 D THR 1411 ? CG2 ? D THR 218 CG2 
218 1 Y 1 D LEU 1415 ? CG  ? D LEU 222 CG  
219 1 Y 1 D LEU 1415 ? CD1 ? D LEU 222 CD1 
220 1 Y 1 D LEU 1415 ? CD2 ? D LEU 222 CD2 
221 1 Y 1 D THR 1416 ? OG1 ? D THR 223 OG1 
222 1 Y 1 D THR 1416 ? CG2 ? D THR 223 CG2 
223 1 Y 1 D ARG 1419 ? CG  ? D ARG 226 CG  
224 1 Y 1 D ARG 1419 ? CD  ? D ARG 226 CD  
225 1 Y 1 D ARG 1419 ? NE  ? D ARG 226 NE  
226 1 Y 1 D ARG 1419 ? CZ  ? D ARG 226 CZ  
227 1 Y 1 D ARG 1419 ? NH1 ? D ARG 226 NH1 
228 1 Y 1 D ARG 1419 ? NH2 ? D ARG 226 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 1194 ? A MET 1   
2   1 Y 1 A HIS 1195 ? A HIS 2   
3   1 Y 1 A HIS 1196 ? A HIS 3   
4   1 Y 1 A HIS 1197 ? A HIS 4   
5   1 Y 1 A HIS 1198 ? A HIS 5   
6   1 Y 1 A HIS 1199 ? A HIS 6   
7   1 Y 1 A HIS 1200 ? A HIS 7   
8   1 Y 1 A SER 1201 ? A SER 8   
9   1 Y 1 A SER 1202 ? A SER 9   
10  1 Y 1 A GLY 1203 ? A GLY 10  
11  1 Y 1 A ARG 1204 ? A ARG 11  
12  1 Y 1 A GLU 1205 ? A GLU 12  
13  1 Y 1 A ASN 1206 ? A ASN 13  
14  1 Y 1 A LEU 1207 ? A LEU 14  
15  1 Y 1 A TYR 1208 ? A TYR 15  
16  1 Y 1 A PHE 1209 ? A PHE 16  
17  1 Y 1 A GLN 1210 ? A GLN 17  
18  1 Y 1 A GLY 1211 ? A GLY 18  
19  1 Y 1 A ASP 1212 ? A ASP 19  
20  1 Y 1 A PRO 1213 ? A PRO 20  
21  1 Y 1 A ARG 1214 ? A ARG 21  
22  1 Y 1 A ARG 1215 ? A ARG 22  
23  1 Y 1 A ARG 1216 ? A ARG 23  
24  1 Y 1 A ASN 1217 ? A ASN 24  
25  1 Y 1 A ILE 1218 ? A ILE 25  
26  1 Y 1 A LEU 1219 ? A LEU 26  
27  1 Y 1 A ARG 1220 ? A ARG 27  
28  1 Y 1 A SER 1221 ? A SER 28  
29  1 Y 1 A LEU 1222 ? A LEU 29  
30  1 Y 1 A ARG 1223 ? A ARG 30  
31  1 Y 1 A ARG 1224 ? A ARG 31  
32  1 Y 1 A ASN 1225 ? A ASN 32  
33  1 Y 1 A THR 1226 ? A THR 33  
34  1 Y 1 A LYS 1227 ? A LYS 34  
35  1 Y 1 A LYS 1228 ? A LYS 35  
36  1 Y 1 A PRO 1229 ? A PRO 36  
37  1 Y 1 A LYS 1230 ? A LYS 37  
38  1 Y 1 A PRO 1231 ? A PRO 38  
39  1 Y 1 A LYS 1232 ? A LYS 39  
40  1 Y 1 A PRO 1233 ? A PRO 40  
41  1 Y 1 A ARG 1234 ? A ARG 41  
42  1 Y 1 A PRO 1235 ? A PRO 42  
43  1 Y 1 A SER 1236 ? A SER 43  
44  1 Y 1 A ILE 1237 ? A ILE 44  
45  1 Y 1 A THR 1238 ? A THR 45  
46  1 Y 1 A LYS 1239 ? A LYS 46  
47  1 Y 1 A ALA 1240 ? A ALA 47  
48  1 Y 1 A THR 1241 ? A THR 48  
49  1 Y 1 A ASN 1438 ? A ASN 245 
50  1 Y 1 A ARG 1439 ? A ARG 246 
51  1 Y 1 B MET 1194 ? B MET 1   
52  1 Y 1 B HIS 1195 ? B HIS 2   
53  1 Y 1 B HIS 1196 ? B HIS 3   
54  1 Y 1 B HIS 1197 ? B HIS 4   
55  1 Y 1 B HIS 1198 ? B HIS 5   
56  1 Y 1 B HIS 1199 ? B HIS 6   
57  1 Y 1 B HIS 1200 ? B HIS 7   
58  1 Y 1 B SER 1201 ? B SER 8   
59  1 Y 1 B SER 1202 ? B SER 9   
60  1 Y 1 B GLY 1203 ? B GLY 10  
61  1 Y 1 B ARG 1204 ? B ARG 11  
62  1 Y 1 B GLU 1205 ? B GLU 12  
63  1 Y 1 B ASN 1206 ? B ASN 13  
64  1 Y 1 B LEU 1207 ? B LEU 14  
65  1 Y 1 B TYR 1208 ? B TYR 15  
66  1 Y 1 B PHE 1209 ? B PHE 16  
67  1 Y 1 B GLN 1210 ? B GLN 17  
68  1 Y 1 B GLY 1211 ? B GLY 18  
69  1 Y 1 B ASP 1212 ? B ASP 19  
70  1 Y 1 B PRO 1213 ? B PRO 20  
71  1 Y 1 B ARG 1214 ? B ARG 21  
72  1 Y 1 B ARG 1215 ? B ARG 22  
73  1 Y 1 B ARG 1216 ? B ARG 23  
74  1 Y 1 B ASN 1217 ? B ASN 24  
75  1 Y 1 B ILE 1218 ? B ILE 25  
76  1 Y 1 B LEU 1219 ? B LEU 26  
77  1 Y 1 B ARG 1220 ? B ARG 27  
78  1 Y 1 B SER 1221 ? B SER 28  
79  1 Y 1 B LEU 1222 ? B LEU 29  
80  1 Y 1 B ARG 1223 ? B ARG 30  
81  1 Y 1 B ARG 1224 ? B ARG 31  
82  1 Y 1 B ASN 1225 ? B ASN 32  
83  1 Y 1 B THR 1226 ? B THR 33  
84  1 Y 1 B LYS 1227 ? B LYS 34  
85  1 Y 1 B LYS 1228 ? B LYS 35  
86  1 Y 1 B PRO 1229 ? B PRO 36  
87  1 Y 1 B LYS 1230 ? B LYS 37  
88  1 Y 1 B PRO 1231 ? B PRO 38  
89  1 Y 1 B LYS 1232 ? B LYS 39  
90  1 Y 1 B PRO 1233 ? B PRO 40  
91  1 Y 1 B ARG 1234 ? B ARG 41  
92  1 Y 1 B PRO 1235 ? B PRO 42  
93  1 Y 1 B SER 1236 ? B SER 43  
94  1 Y 1 B ILE 1237 ? B ILE 44  
95  1 Y 1 B THR 1238 ? B THR 45  
96  1 Y 1 B LYS 1239 ? B LYS 46  
97  1 Y 1 B ALA 1240 ? B ALA 47  
98  1 Y 1 B THR 1241 ? B THR 48  
99  1 Y 1 B PHE 1409 ? B PHE 216 
100 1 Y 1 B SER 1410 ? B SER 217 
101 1 Y 1 B THR 1411 ? B THR 218 
102 1 Y 1 B ASN 1438 ? B ASN 245 
103 1 Y 1 B ARG 1439 ? B ARG 246 
104 1 Y 1 C MET 1194 ? C MET 1   
105 1 Y 1 C HIS 1195 ? C HIS 2   
106 1 Y 1 C HIS 1196 ? C HIS 3   
107 1 Y 1 C HIS 1197 ? C HIS 4   
108 1 Y 1 C HIS 1198 ? C HIS 5   
109 1 Y 1 C HIS 1199 ? C HIS 6   
110 1 Y 1 C HIS 1200 ? C HIS 7   
111 1 Y 1 C SER 1201 ? C SER 8   
112 1 Y 1 C SER 1202 ? C SER 9   
113 1 Y 1 C GLY 1203 ? C GLY 10  
114 1 Y 1 C ARG 1204 ? C ARG 11  
115 1 Y 1 C GLU 1205 ? C GLU 12  
116 1 Y 1 C ASN 1206 ? C ASN 13  
117 1 Y 1 C LEU 1207 ? C LEU 14  
118 1 Y 1 C TYR 1208 ? C TYR 15  
119 1 Y 1 C PHE 1209 ? C PHE 16  
120 1 Y 1 C GLN 1210 ? C GLN 17  
121 1 Y 1 C GLY 1211 ? C GLY 18  
122 1 Y 1 C ASP 1212 ? C ASP 19  
123 1 Y 1 C PRO 1213 ? C PRO 20  
124 1 Y 1 C ARG 1214 ? C ARG 21  
125 1 Y 1 C ARG 1215 ? C ARG 22  
126 1 Y 1 C ARG 1216 ? C ARG 23  
127 1 Y 1 C ASN 1217 ? C ASN 24  
128 1 Y 1 C ILE 1218 ? C ILE 25  
129 1 Y 1 C LEU 1219 ? C LEU 26  
130 1 Y 1 C ARG 1220 ? C ARG 27  
131 1 Y 1 C SER 1221 ? C SER 28  
132 1 Y 1 C LEU 1222 ? C LEU 29  
133 1 Y 1 C ARG 1223 ? C ARG 30  
134 1 Y 1 C ARG 1224 ? C ARG 31  
135 1 Y 1 C ASN 1225 ? C ASN 32  
136 1 Y 1 C THR 1226 ? C THR 33  
137 1 Y 1 C LYS 1227 ? C LYS 34  
138 1 Y 1 C LYS 1228 ? C LYS 35  
139 1 Y 1 C PRO 1229 ? C PRO 36  
140 1 Y 1 C LYS 1230 ? C LYS 37  
141 1 Y 1 C PRO 1231 ? C PRO 38  
142 1 Y 1 C LYS 1232 ? C LYS 39  
143 1 Y 1 C PRO 1233 ? C PRO 40  
144 1 Y 1 C ARG 1234 ? C ARG 41  
145 1 Y 1 C PRO 1235 ? C PRO 42  
146 1 Y 1 C SER 1236 ? C SER 43  
147 1 Y 1 C ILE 1237 ? C ILE 44  
148 1 Y 1 C THR 1238 ? C THR 45  
149 1 Y 1 C LYS 1239 ? C LYS 46  
150 1 Y 1 C ALA 1240 ? C ALA 47  
151 1 Y 1 C THR 1241 ? C THR 48  
152 1 Y 1 C TRP 1242 ? C TRP 49  
153 1 Y 1 C GLU 1243 ? C GLU 50  
154 1 Y 1 C ARG 1439 ? C ARG 246 
155 1 Y 1 D MET 1194 ? D MET 1   
156 1 Y 1 D HIS 1195 ? D HIS 2   
157 1 Y 1 D HIS 1196 ? D HIS 3   
158 1 Y 1 D HIS 1197 ? D HIS 4   
159 1 Y 1 D HIS 1198 ? D HIS 5   
160 1 Y 1 D HIS 1199 ? D HIS 6   
161 1 Y 1 D HIS 1200 ? D HIS 7   
162 1 Y 1 D SER 1201 ? D SER 8   
163 1 Y 1 D SER 1202 ? D SER 9   
164 1 Y 1 D GLY 1203 ? D GLY 10  
165 1 Y 1 D ARG 1204 ? D ARG 11  
166 1 Y 1 D GLU 1205 ? D GLU 12  
167 1 Y 1 D ASN 1206 ? D ASN 13  
168 1 Y 1 D LEU 1207 ? D LEU 14  
169 1 Y 1 D TYR 1208 ? D TYR 15  
170 1 Y 1 D PHE 1209 ? D PHE 16  
171 1 Y 1 D GLN 1210 ? D GLN 17  
172 1 Y 1 D GLY 1211 ? D GLY 18  
173 1 Y 1 D ASP 1212 ? D ASP 19  
174 1 Y 1 D PRO 1213 ? D PRO 20  
175 1 Y 1 D ARG 1214 ? D ARG 21  
176 1 Y 1 D ARG 1215 ? D ARG 22  
177 1 Y 1 D ARG 1216 ? D ARG 23  
178 1 Y 1 D ASN 1217 ? D ASN 24  
179 1 Y 1 D ILE 1218 ? D ILE 25  
180 1 Y 1 D LEU 1219 ? D LEU 26  
181 1 Y 1 D ARG 1220 ? D ARG 27  
182 1 Y 1 D SER 1221 ? D SER 28  
183 1 Y 1 D LEU 1222 ? D LEU 29  
184 1 Y 1 D ARG 1223 ? D ARG 30  
185 1 Y 1 D ARG 1224 ? D ARG 31  
186 1 Y 1 D ASN 1225 ? D ASN 32  
187 1 Y 1 D THR 1226 ? D THR 33  
188 1 Y 1 D LYS 1227 ? D LYS 34  
189 1 Y 1 D LYS 1228 ? D LYS 35  
190 1 Y 1 D PRO 1229 ? D PRO 36  
191 1 Y 1 D LYS 1230 ? D LYS 37  
192 1 Y 1 D PRO 1231 ? D PRO 38  
193 1 Y 1 D LYS 1232 ? D LYS 39  
194 1 Y 1 D PRO 1233 ? D PRO 40  
195 1 Y 1 D ARG 1234 ? D ARG 41  
196 1 Y 1 D PRO 1235 ? D PRO 42  
197 1 Y 1 D SER 1236 ? D SER 43  
198 1 Y 1 D ILE 1237 ? D ILE 44  
199 1 Y 1 D THR 1238 ? D THR 45  
200 1 Y 1 D LYS 1239 ? D LYS 46  
201 1 Y 1 D ALA 1240 ? D ALA 47  
202 1 Y 1 D THR 1241 ? D THR 48  
203 1 Y 1 D ASN 1438 ? D ASN 245 
204 1 Y 1 D ARG 1439 ? D ARG 246 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'UNKNOWN ATOM OR ION' 
_pdbx_entity_nonpoly.comp_id     UNX 
#