data_3FN3
# 
_entry.id   3FN3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3FN3         
RCSB  RCSB050793   
WWPDB D_1000050793 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3FN3 
_pdbx_database_status.recvd_initial_deposition_date   2008-12-23 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chen, Y.'  1 
'Gao, F.'   2 
'Liu, P.'   3 
'Chu, F.'   4 
'Qi, J.'    5 
'Gao, G.F.' 6 
# 
_citation.id                        primary 
_citation.title                     'A dimeric structure of PD-L1: functional units or evolutionary relics?' 
_citation.journal_abbrev            'Protein Cell' 
_citation.journal_volume            1 
_citation.page_first                153 
_citation.page_last                 160 
_citation.year                      2010 
_citation.journal_id_ASTM           ? 
_citation.country                   CN 
_citation.journal_id_ISSN           1674-800X 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21203985 
_citation.pdbx_database_id_DOI      10.1007/s13238-010-0022-1 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chen, Y.'  1 
primary 'Liu, P.'   2 
primary 'Gao, F.'   3 
primary 'Cheng, H.' 4 
primary 'Qi, J.'    5 
primary 'Gao, G.F.' 6 
# 
_cell.entry_id           3FN3 
_cell.length_a           71.865 
_cell.length_b           91.373 
_cell.length_c           140.316 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3FN3 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Programmed cell death 1 ligand 1' 
_entity.formula_weight             25355.795 
_entity.pdbx_number_of_molecules   2 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'extracellular domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'B7-H1, PD-L1, Programmed death ligand 1, PDCD1 ligand 1, B7 homolog 1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNA
ALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSG
KTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNA
ALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSG
KTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PHE n 
1 3   THR n 
1 4   VAL n 
1 5   THR n 
1 6   VAL n 
1 7   PRO n 
1 8   LYS n 
1 9   ASP n 
1 10  LEU n 
1 11  TYR n 
1 12  VAL n 
1 13  VAL n 
1 14  GLU n 
1 15  TYR n 
1 16  GLY n 
1 17  SER n 
1 18  ASN n 
1 19  MET n 
1 20  THR n 
1 21  ILE n 
1 22  GLU n 
1 23  CYS n 
1 24  LYS n 
1 25  PHE n 
1 26  PRO n 
1 27  VAL n 
1 28  GLU n 
1 29  LYS n 
1 30  GLN n 
1 31  LEU n 
1 32  ASP n 
1 33  LEU n 
1 34  ALA n 
1 35  ALA n 
1 36  LEU n 
1 37  ILE n 
1 38  VAL n 
1 39  TYR n 
1 40  TRP n 
1 41  GLU n 
1 42  MET n 
1 43  GLU n 
1 44  ASP n 
1 45  LYS n 
1 46  ASN n 
1 47  ILE n 
1 48  ILE n 
1 49  GLN n 
1 50  PHE n 
1 51  VAL n 
1 52  HIS n 
1 53  GLY n 
1 54  GLU n 
1 55  GLU n 
1 56  ASP n 
1 57  LEU n 
1 58  LYS n 
1 59  VAL n 
1 60  GLN n 
1 61  HIS n 
1 62  SER n 
1 63  SER n 
1 64  TYR n 
1 65  ARG n 
1 66  GLN n 
1 67  ARG n 
1 68  ALA n 
1 69  ARG n 
1 70  LEU n 
1 71  LEU n 
1 72  LYS n 
1 73  ASP n 
1 74  GLN n 
1 75  LEU n 
1 76  SER n 
1 77  LEU n 
1 78  GLY n 
1 79  ASN n 
1 80  ALA n 
1 81  ALA n 
1 82  LEU n 
1 83  GLN n 
1 84  ILE n 
1 85  THR n 
1 86  ASP n 
1 87  VAL n 
1 88  LYS n 
1 89  LEU n 
1 90  GLN n 
1 91  ASP n 
1 92  ALA n 
1 93  GLY n 
1 94  VAL n 
1 95  TYR n 
1 96  ARG n 
1 97  CYS n 
1 98  MET n 
1 99  ILE n 
1 100 SER n 
1 101 TYR n 
1 102 GLY n 
1 103 GLY n 
1 104 ALA n 
1 105 ASP n 
1 106 TYR n 
1 107 LYS n 
1 108 ARG n 
1 109 ILE n 
1 110 THR n 
1 111 VAL n 
1 112 LYS n 
1 113 VAL n 
1 114 ASN n 
1 115 ALA n 
1 116 PRO n 
1 117 TYR n 
1 118 ASN n 
1 119 LYS n 
1 120 ILE n 
1 121 ASN n 
1 122 GLN n 
1 123 ARG n 
1 124 ILE n 
1 125 LEU n 
1 126 VAL n 
1 127 VAL n 
1 128 ASP n 
1 129 PRO n 
1 130 VAL n 
1 131 THR n 
1 132 SER n 
1 133 GLU n 
1 134 HIS n 
1 135 GLU n 
1 136 LEU n 
1 137 THR n 
1 138 CYS n 
1 139 GLN n 
1 140 ALA n 
1 141 GLU n 
1 142 GLY n 
1 143 TYR n 
1 144 PRO n 
1 145 LYS n 
1 146 ALA n 
1 147 GLU n 
1 148 VAL n 
1 149 ILE n 
1 150 TRP n 
1 151 THR n 
1 152 SER n 
1 153 SER n 
1 154 ASP n 
1 155 HIS n 
1 156 GLN n 
1 157 VAL n 
1 158 LEU n 
1 159 SER n 
1 160 GLY n 
1 161 LYS n 
1 162 THR n 
1 163 THR n 
1 164 THR n 
1 165 THR n 
1 166 ASN n 
1 167 SER n 
1 168 LYS n 
1 169 ARG n 
1 170 GLU n 
1 171 GLU n 
1 172 LYS n 
1 173 LEU n 
1 174 PHE n 
1 175 ASN n 
1 176 VAL n 
1 177 THR n 
1 178 SER n 
1 179 THR n 
1 180 LEU n 
1 181 ARG n 
1 182 ILE n 
1 183 ASN n 
1 184 THR n 
1 185 THR n 
1 186 THR n 
1 187 ASN n 
1 188 GLU n 
1 189 ILE n 
1 190 PHE n 
1 191 TYR n 
1 192 CYS n 
1 193 THR n 
1 194 PHE n 
1 195 ARG n 
1 196 ARG n 
1 197 LEU n 
1 198 ASP n 
1 199 PRO n 
1 200 GLU n 
1 201 GLU n 
1 202 ASN n 
1 203 HIS n 
1 204 THR n 
1 205 ALA n 
1 206 GLU n 
1 207 LEU n 
1 208 VAL n 
1 209 ILE n 
1 210 PRO n 
1 211 GLU n 
1 212 LEU n 
1 213 PRO n 
1 214 LEU n 
1 215 ALA n 
1 216 HIS n 
1 217 PRO n 
1 218 PRO n 
1 219 ASN n 
1 220 GLU n 
1 221 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'CD274, B7H1, PDCD1L1, PDCD1LG1, PDL1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET21a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PD1L1_HUMAN 
_struct_ref.pdbx_db_accession          Q9NZQ7 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAA
LQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGK
TTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
;
_struct_ref.pdbx_align_begin           19 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3FN3 A 2 ? 221 ? Q9NZQ7 19 ? 238 ? 19 238 
2 1 3FN3 B 2 ? 221 ? Q9NZQ7 19 ? 238 ? 19 238 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3FN3 MET A 1 ? UNP Q9NZQ7 ? ? 'INITIATING METHIONINE' 18 1 
2 3FN3 MET B 1 ? UNP Q9NZQ7 ? ? 'INITIATING METHIONINE' 18 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3FN3 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   8 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.27 
_exptl_crystal.density_percent_sol   45.84 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_details    
'15% PEG 3350 (w/v), 0.2M ammonium acetate (NH4Ac), 0.1M BIS-Tris pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           298.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV++' 
_diffrn_detector.pdbx_collection_date   2008-02-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Ni MIRROR + Ni FILTER' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU MICROMAX-007 HF' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     3FN3 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.60 
_reflns.number_obs                   19603 
_reflns.number_all                   36104 
_reflns.percent_possible_obs         91.1 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.60 
_reflns_shell.d_res_low              2.70 
_reflns_shell.percent_possible_all   98.1 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3FN3 
_refine.ls_number_reflns_obs                     12011 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             15.00 
_refine.ls_d_res_high                            2.70 
_refine.ls_percent_reflns_obs                    97.62 
_refine.ls_R_factor_obs                          0.22908 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.22567 
_refine.ls_R_factor_R_free                       0.29614 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  645 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.924 
_refine.correlation_coeff_Fo_to_Fc_free          0.864 
_refine.B_iso_mean                               58.811 
_refine.aniso_B[1][1]                            1.80 
_refine.aniso_B[2][2]                            -4.59 
_refine.aniso_B[3][3]                            2.79 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 3BIS' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.438 
_refine.overall_SU_ML                            0.342 
_refine.overall_SU_B                             16.827 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3428 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               3428 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        15.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.015  0.022  ? 3495 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.734  1.958  ? 4745 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       7.416  5.000  ? 424  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       39.277 24.819 ? 166  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       21.309 15.000 ? 632  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.326 15.000 ? 20   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.116  0.200  ? 550  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 2600 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.254  0.200  ? 1496 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.318  0.200  ? 2271 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.197  0.200  ? 137  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.256  0.200  ? 53   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.352  0.200  ? 5    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.742  1.500  ? 2189 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.316  2.000  ? 3478 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.686  3.000  ? 1480 'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.595  4.500  ? 1267 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.700 
_refine_ls_shell.d_res_low                        2.768 
_refine_ls_shell.number_reflns_R_work             878 
_refine_ls_shell.R_factor_R_work                  0.314 
_refine_ls_shell.percent_reflns_obs               97.29 
_refine_ls_shell.R_factor_R_free                  0.335 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             54 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3FN3 
_struct.title                     'Dimeric Structure of PD-L1' 
_struct.pdbx_descriptor           'Programmed cell death 1 ligand 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3FN3 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            
;B7-H1, PD-L1, Programmed cell death 1, Cell membrane, Glycoprotein, Immunoglobulin domain, Membrane, Receptor, Transmembrane, IMMUNE SYSTEM
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 32 ? ALA A 35 ? ASP A 49 ALA A 52 5 ? 4 
HELX_P HELX_P2 2 LEU A 57 ? GLN A 60 ? LEU A 74 GLN A 77 5 ? 4 
HELX_P HELX_P3 3 HIS A 61 ? ARG A 65 ? HIS A 78 ARG A 82 5 ? 5 
HELX_P HELX_P4 4 ASP A 73 ? LEU A 77 ? ASP A 90 LEU A 94 5 ? 5 
HELX_P HELX_P5 5 LEU B 57 ? GLN B 60 ? LEU B 74 GLN B 77 5 ? 4 
HELX_P HELX_P6 6 LEU B 71 ? SER B 76 ? LEU B 88 SER B 93 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 23  SG ? ? ? 1_555 A CYS 97  SG ? ? A CYS 40  A CYS 114 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf2 disulf ? ? A CYS 138 SG ? ? ? 1_555 A CYS 192 SG ? ? A CYS 155 A CYS 209 1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf3 disulf ? ? B CYS 23  SG ? ? ? 1_555 B CYS 97  SG ? ? B CYS 40  B CYS 114 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf4 disulf ? ? B CYS 138 SG ? ? ? 1_555 B CYS 192 SG ? ? B CYS 155 B CYS 209 1_555 ? ? ? ? ? ? ? 2.043 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 143 A . ? TYR 160 A PRO 144 A ? PRO 161 A 1 -5.06  
2 ASP 198 A . ? ASP 215 A PRO 199 A ? PRO 216 A 1 -0.03  
3 TYR 143 B . ? TYR 160 B PRO 144 B ? PRO 161 B 1 -10.11 
4 ASP 198 B . ? ASP 215 B PRO 199 B ? PRO 216 B 1 -11.88 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 8 ? 
D ? 4 ? 
E ? 6 ? 
F ? 3 ? 
G ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? parallel      
C 5 6 ? anti-parallel 
C 6 7 ? anti-parallel 
C 7 8 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
E 5 6 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 10  ? GLU A 14  ? LEU A 27  GLU A 31  
A 2 ALA A 104 ? ASN A 114 ? ALA A 121 ASN A 131 
A 3 GLY A 93  ? SER A 100 ? GLY A 110 SER A 117 
A 4 ILE A 37  ? MET A 42  ? ILE A 54  MET A 59  
A 5 LYS A 45  ? VAL A 51  ? LYS A 62  VAL A 68  
A 6 GLU A 54  ? GLU A 55  ? GLU A 71  GLU A 72  
B 1 MET A 19  ? LYS A 24  ? MET A 36  LYS A 41  
B 2 ASN A 79  ? ILE A 84  ? ASN A 96  ILE A 101 
B 3 ALA A 68  ? LEU A 70  ? ALA A 85  LEU A 87  
C 1 LYS A 161 ? ASN A 166 ? LYS A 178 ASN A 183 
C 2 PHE A 174 ? ASN A 183 ? PHE A 191 ASN A 200 
C 3 GLU A 133 ? GLY A 142 ? GLU A 150 GLY A 159 
C 4 ASN A 121 ? ASP A 128 ? ASN A 138 ASP A 145 
C 5 ILE B 120 ? ASP B 128 ? ILE B 137 ASP B 145 
C 6 GLU B 133 ? GLY B 142 ? GLU B 150 GLY B 159 
C 7 PHE B 174 ? ASN B 183 ? PHE B 191 ASN B 200 
C 8 LYS B 161 ? ASN B 166 ? LYS B 178 ASN B 183 
D 1 VAL A 157 ? LEU A 158 ? VAL A 174 LEU A 175 
D 2 GLU A 147 ? THR A 151 ? GLU A 164 THR A 168 
D 3 ILE A 189 ? ARG A 196 ? ILE A 206 ARG A 213 
D 4 GLU A 201 ? VAL A 208 ? GLU A 218 VAL A 225 
E 1 LEU B 10  ? GLU B 14  ? LEU B 27  GLU B 31  
E 2 ALA B 104 ? ASN B 114 ? ALA B 121 ASN B 131 
E 3 GLY B 93  ? SER B 100 ? GLY B 110 SER B 117 
E 4 ILE B 37  ? MET B 42  ? ILE B 54  MET B 59  
E 5 LYS B 45  ? VAL B 51  ? LYS B 62  VAL B 68  
E 6 GLU B 54  ? GLU B 55  ? GLU B 71  GLU B 72  
F 1 MET B 19  ? LYS B 24  ? MET B 36  LYS B 41  
F 2 ASN B 79  ? ILE B 84  ? ASN B 96  ILE B 101 
F 3 ALA B 68  ? LEU B 70  ? ALA B 85  LEU B 87  
G 1 GLU B 147 ? SER B 152 ? GLU B 164 SER B 169 
G 2 ILE B 189 ? ARG B 196 ? ILE B 206 ARG B 213 
G 3 GLU B 201 ? VAL B 208 ? GLU B 218 VAL B 225 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 13  ? N VAL A 30  O ASN A 114 ? O ASN A 131 
A 2 3 O ILE A 109 ? O ILE A 126 N TYR A 95  ? N TYR A 112 
A 3 4 O ARG A 96  ? O ARG A 113 N GLU A 41  ? N GLU A 58  
A 4 5 N VAL A 38  ? N VAL A 55  O PHE A 50  ? O PHE A 67  
A 5 6 N VAL A 51  ? N VAL A 68  O GLU A 54  ? O GLU A 71  
B 1 2 N CYS A 23  ? N CYS A 40  O ALA A 80  ? O ALA A 97  
B 2 3 O GLN A 83  ? O GLN A 100 N ARG A 69  ? N ARG A 86  
C 1 2 N THR A 165 ? N THR A 182 O ASN A 175 ? O ASN A 192 
C 2 3 O ILE A 182 ? O ILE A 199 N HIS A 134 ? N HIS A 151 
C 3 4 O THR A 137 ? O THR A 154 N ARG A 123 ? N ARG A 140 
C 4 5 N VAL A 126 ? N VAL A 143 O GLN B 122 ? O GLN B 139 
C 5 6 N LEU B 125 ? N LEU B 142 O GLU B 135 ? O GLU B 152 
C 6 7 N LEU B 136 ? N LEU B 153 O LEU B 180 ? O LEU B 197 
C 7 8 O THR B 177 ? O THR B 194 N THR B 163 ? N THR B 180 
D 1 2 O LEU A 158 ? O LEU A 175 N TRP A 150 ? N TRP A 167 
D 2 3 N ILE A 149 ? N ILE A 166 O THR A 193 ? O THR A 210 
D 3 4 N PHE A 194 ? N PHE A 211 O HIS A 203 ? O HIS A 220 
E 1 2 N TYR B 11  ? N TYR B 28  O LYS B 112 ? O LYS B 129 
E 2 3 O ILE B 109 ? O ILE B 126 N TYR B 95  ? N TYR B 112 
E 3 4 O MET B 98  ? O MET B 115 N TYR B 39  ? N TYR B 56  
E 4 5 N TRP B 40  ? N TRP B 57  O ILE B 48  ? O ILE B 65  
E 5 6 N VAL B 51  ? N VAL B 68  O GLU B 54  ? O GLU B 71  
F 1 2 N CYS B 23  ? N CYS B 40  O ALA B 80  ? O ALA B 97  
F 2 3 O GLN B 83  ? O GLN B 100 N ARG B 69  ? N ARG B 86  
G 1 2 N ILE B 149 ? N ILE B 166 O THR B 193 ? O THR B 210 
G 2 3 N PHE B 194 ? N PHE B 211 O HIS B 203 ? O HIS B 220 
# 
_database_PDB_matrix.entry_id          3FN3 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3FN3 
_atom_sites.fract_transf_matrix[1][1]   0.013915 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010944 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007127 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . MET A 1 1   ? 5.579   -84.692 -0.010  1.00 84.89 ? 18  MET A N   1 
ATOM 2    C CA  . MET A 1 1   ? 4.238   -84.460 -0.610  1.00 85.18 ? 18  MET A CA  1 
ATOM 3    C C   . MET A 1 1   ? 4.001   -82.980 -0.982  1.00 84.68 ? 18  MET A C   1 
ATOM 4    O O   . MET A 1 1   ? 3.036   -82.667 -1.704  1.00 84.67 ? 18  MET A O   1 
ATOM 5    C CB  . MET A 1 1   ? 3.151   -84.932 0.354   1.00 85.08 ? 18  MET A CB  1 
ATOM 6    C CG  . MET A 1 1   ? 2.832   -83.911 1.442   1.00 85.27 ? 18  MET A CG  1 
ATOM 7    S SD  . MET A 1 1   ? 1.057   -83.740 1.785   1.00 86.64 ? 18  MET A SD  1 
ATOM 8    C CE  . MET A 1 1   ? 0.350   -83.195 0.217   1.00 85.89 ? 18  MET A CE  1 
ATOM 9    N N   . PHE A 1 2   ? 4.875   -82.097 -0.464  1.00 83.93 ? 19  PHE A N   1 
ATOM 10   C CA  . PHE A 1 2   ? 4.871   -80.614 -0.665  1.00 82.89 ? 19  PHE A CA  1 
ATOM 11   C C   . PHE A 1 2   ? 3.963   -79.799 0.282   1.00 82.19 ? 19  PHE A C   1 
ATOM 12   O O   . PHE A 1 2   ? 2.729   -79.827 0.171   1.00 81.94 ? 19  PHE A O   1 
ATOM 13   C CB  . PHE A 1 2   ? 4.620   -80.197 -2.127  1.00 83.02 ? 19  PHE A CB  1 
ATOM 14   C CG  . PHE A 1 2   ? 4.804   -78.722 -2.370  1.00 82.65 ? 19  PHE A CG  1 
ATOM 15   C CD1 . PHE A 1 2   ? 5.948   -78.253 -3.018  1.00 82.63 ? 19  PHE A CD1 1 
ATOM 16   C CD2 . PHE A 1 2   ? 3.846   -77.801 -1.931  1.00 81.97 ? 19  PHE A CD2 1 
ATOM 17   C CE1 . PHE A 1 2   ? 6.133   -76.885 -3.236  1.00 83.27 ? 19  PHE A CE1 1 
ATOM 18   C CE2 . PHE A 1 2   ? 4.021   -76.433 -2.127  1.00 82.66 ? 19  PHE A CE2 1 
ATOM 19   C CZ  . PHE A 1 2   ? 5.164   -75.967 -2.791  1.00 83.00 ? 19  PHE A CZ  1 
ATOM 20   N N   . THR A 1 3   ? 4.598   -79.047 1.181   1.00 81.27 ? 20  THR A N   1 
ATOM 21   C CA  . THR A 1 3   ? 3.893   -78.232 2.185   1.00 80.43 ? 20  THR A CA  1 
ATOM 22   C C   . THR A 1 3   ? 4.602   -76.885 2.481   1.00 79.74 ? 20  THR A C   1 
ATOM 23   O O   . THR A 1 3   ? 5.844   -76.802 2.447   1.00 79.83 ? 20  THR A O   1 
ATOM 24   C CB  . THR A 1 3   ? 3.584   -79.042 3.509   1.00 80.70 ? 20  THR A CB  1 
ATOM 25   O OG1 . THR A 1 3   ? 4.706   -79.860 3.878   1.00 79.89 ? 20  THR A OG1 1 
ATOM 26   C CG2 . THR A 1 3   ? 2.338   -79.942 3.336   1.00 80.19 ? 20  THR A CG2 1 
ATOM 27   N N   . VAL A 1 4   ? 3.807   -75.836 2.731   1.00 78.58 ? 21  VAL A N   1 
ATOM 28   C CA  . VAL A 1 4   ? 4.338   -74.482 2.998   1.00 77.72 ? 21  VAL A CA  1 
ATOM 29   C C   . VAL A 1 4   ? 4.605   -74.294 4.473   1.00 77.08 ? 21  VAL A C   1 
ATOM 30   O O   . VAL A 1 4   ? 3.772   -74.601 5.313   1.00 76.66 ? 21  VAL A O   1 
ATOM 31   C CB  . VAL A 1 4   ? 3.418   -73.351 2.461   1.00 77.65 ? 21  VAL A CB  1 
ATOM 32   C CG1 . VAL A 1 4   ? 3.470   -72.096 3.335   1.00 77.09 ? 21  VAL A CG1 1 
ATOM 33   C CG2 . VAL A 1 4   ? 3.809   -73.018 1.053   1.00 78.03 ? 21  VAL A CG2 1 
ATOM 34   N N   . THR A 1 5   ? 5.781   -73.776 4.784   1.00 76.70 ? 22  THR A N   1 
ATOM 35   C CA  . THR A 1 5   ? 6.245   -73.782 6.163   1.00 75.88 ? 22  THR A CA  1 
ATOM 36   C C   . THR A 1 5   ? 6.702   -72.410 6.699   1.00 75.46 ? 22  THR A C   1 
ATOM 37   O O   . THR A 1 5   ? 7.344   -71.606 5.995   1.00 75.20 ? 22  THR A O   1 
ATOM 38   C CB  . THR A 1 5   ? 7.328   -74.867 6.359   1.00 75.87 ? 22  THR A CB  1 
ATOM 39   O OG1 . THR A 1 5   ? 7.537   -75.079 7.761   1.00 75.25 ? 22  THR A OG1 1 
ATOM 40   C CG2 . THR A 1 5   ? 8.653   -74.477 5.645   1.00 74.92 ? 22  THR A CG2 1 
ATOM 41   N N   . VAL A 1 6   ? 6.378   -72.167 7.966   1.00 74.52 ? 23  VAL A N   1 
ATOM 42   C CA  . VAL A 1 6   ? 6.511   -70.850 8.552   1.00 73.44 ? 23  VAL A CA  1 
ATOM 43   C C   . VAL A 1 6   ? 7.572   -70.858 9.651   1.00 72.92 ? 23  VAL A C   1 
ATOM 44   O O   . VAL A 1 6   ? 7.478   -71.642 10.570  1.00 72.92 ? 23  VAL A O   1 
ATOM 45   C CB  . VAL A 1 6   ? 5.105   -70.405 9.022   1.00 73.17 ? 23  VAL A CB  1 
ATOM 46   C CG1 . VAL A 1 6   ? 5.024   -70.205 10.499  1.00 73.72 ? 23  VAL A CG1 1 
ATOM 47   C CG2 . VAL A 1 6   ? 4.646   -69.198 8.242   1.00 72.96 ? 23  VAL A CG2 1 
ATOM 48   N N   . PRO A 1 7   ? 8.613   -70.010 9.543   1.00 72.87 ? 24  PRO A N   1 
ATOM 49   C CA  . PRO A 1 7   ? 9.608   -69.963 10.652  1.00 72.35 ? 24  PRO A CA  1 
ATOM 50   C C   . PRO A 1 7   ? 9.023   -69.615 12.034  1.00 71.99 ? 24  PRO A C   1 
ATOM 51   O O   . PRO A 1 7   ? 9.612   -70.002 13.049  1.00 71.89 ? 24  PRO A O   1 
ATOM 52   C CB  . PRO A 1 7   ? 10.629  -68.904 10.202  1.00 72.13 ? 24  PRO A CB  1 
ATOM 53   C CG  . PRO A 1 7   ? 10.423  -68.758 8.685   1.00 72.81 ? 24  PRO A CG  1 
ATOM 54   C CD  . PRO A 1 7   ? 8.957   -69.093 8.430   1.00 73.18 ? 24  PRO A CD  1 
ATOM 55   N N   . LYS A 1 8   ? 7.887   -68.903 12.080  1.00 71.41 ? 25  LYS A N   1 
ATOM 56   C CA  . LYS A 1 8   ? 7.163   -68.692 13.350  1.00 70.76 ? 25  LYS A CA  1 
ATOM 57   C C   . LYS A 1 8   ? 5.724   -68.213 13.173  1.00 69.51 ? 25  LYS A C   1 
ATOM 58   O O   . LYS A 1 8   ? 5.432   -67.423 12.286  1.00 68.73 ? 25  LYS A O   1 
ATOM 59   C CB  . LYS A 1 8   ? 7.932   -67.741 14.283  1.00 70.61 ? 25  LYS A CB  1 
ATOM 60   C CG  . LYS A 1 8   ? 7.804   -66.253 13.905  1.00 72.39 ? 25  LYS A CG  1 
ATOM 61   C CD  . LYS A 1 8   ? 8.816   -65.314 14.601  1.00 72.11 ? 25  LYS A CD  1 
ATOM 62   C CE  . LYS A 1 8   ? 10.220  -65.401 13.961  1.00 75.13 ? 25  LYS A CE  1 
ATOM 63   N NZ  . LYS A 1 8   ? 10.300  -65.153 12.460  1.00 75.00 ? 25  LYS A NZ  1 
ATOM 64   N N   . ASP A 1 9   ? 4.845   -68.714 14.039  1.00 68.97 ? 26  ASP A N   1 
ATOM 65   C CA  . ASP A 1 9   ? 3.469   -68.229 14.195  1.00 68.48 ? 26  ASP A CA  1 
ATOM 66   C C   . ASP A 1 9   ? 3.363   -66.722 14.474  1.00 67.47 ? 26  ASP A C   1 
ATOM 67   O O   . ASP A 1 9   ? 2.608   -66.018 13.826  1.00 67.97 ? 26  ASP A O   1 
ATOM 68   C CB  . ASP A 1 9   ? 2.793   -68.940 15.377  1.00 68.71 ? 26  ASP A CB  1 
ATOM 69   C CG  . ASP A 1 9   ? 2.413   -70.340 15.066  1.00 70.90 ? 26  ASP A CG  1 
ATOM 70   O OD1 . ASP A 1 9   ? 1.197   -70.643 15.003  1.00 71.86 ? 26  ASP A OD1 1 
ATOM 71   O OD2 . ASP A 1 9   ? 3.343   -71.148 14.871  1.00 75.19 ? 26  ASP A OD2 1 
ATOM 72   N N   . LEU A 1 10  ? 4.112   -66.251 15.467  1.00 66.17 ? 27  LEU A N   1 
ATOM 73   C CA  . LEU A 1 10  ? 3.918   -64.948 16.077  1.00 64.34 ? 27  LEU A CA  1 
ATOM 74   C C   . LEU A 1 10  ? 5.145   -64.064 15.901  1.00 63.44 ? 27  LEU A C   1 
ATOM 75   O O   . LEU A 1 10  ? 6.267   -64.500 16.175  1.00 63.61 ? 27  LEU A O   1 
ATOM 76   C CB  . LEU A 1 10  ? 3.634   -65.139 17.567  1.00 64.16 ? 27  LEU A CB  1 
ATOM 77   C CG  . LEU A 1 10  ? 3.449   -63.869 18.394  1.00 63.96 ? 27  LEU A CG  1 
ATOM 78   C CD1 . LEU A 1 10  ? 2.122   -63.176 18.051  1.00 62.11 ? 27  LEU A CD1 1 
ATOM 79   C CD2 . LEU A 1 10  ? 3.566   -64.160 19.906  1.00 64.23 ? 27  LEU A CD2 1 
ATOM 80   N N   . TYR A 1 11  ? 4.927   -62.836 15.425  1.00 61.91 ? 28  TYR A N   1 
ATOM 81   C CA  . TYR A 1 11  ? 5.954   -61.777 15.425  1.00 60.70 ? 28  TYR A CA  1 
ATOM 82   C C   . TYR A 1 11  ? 5.389   -60.595 16.191  1.00 59.52 ? 28  TYR A C   1 
ATOM 83   O O   . TYR A 1 11  ? 4.312   -60.110 15.842  1.00 59.12 ? 28  TYR A O   1 
ATOM 84   C CB  . TYR A 1 11  ? 6.273   -61.252 14.012  1.00 60.56 ? 28  TYR A CB  1 
ATOM 85   C CG  . TYR A 1 11  ? 6.880   -62.214 13.010  1.00 61.20 ? 28  TYR A CG  1 
ATOM 86   C CD1 . TYR A 1 11  ? 6.138   -63.273 12.464  1.00 61.72 ? 28  TYR A CD1 1 
ATOM 87   C CD2 . TYR A 1 11  ? 8.181   -62.026 12.544  1.00 62.71 ? 28  TYR A CD2 1 
ATOM 88   C CE1 . TYR A 1 11  ? 6.700   -64.134 11.508  1.00 60.88 ? 28  TYR A CE1 1 
ATOM 89   C CE2 . TYR A 1 11  ? 8.744   -62.888 11.586  1.00 61.94 ? 28  TYR A CE2 1 
ATOM 90   C CZ  . TYR A 1 11  ? 7.999   -63.929 11.087  1.00 60.18 ? 28  TYR A CZ  1 
ATOM 91   O OH  . TYR A 1 11  ? 8.567   -64.754 10.171  1.00 60.09 ? 28  TYR A OH  1 
ATOM 92   N N   . VAL A 1 12  ? 6.108   -60.133 17.217  1.00 58.52 ? 29  VAL A N   1 
ATOM 93   C CA  . VAL A 1 12  ? 5.804   -58.862 17.875  1.00 57.53 ? 29  VAL A CA  1 
ATOM 94   C C   . VAL A 1 12  ? 6.677   -57.851 17.181  1.00 57.40 ? 29  VAL A C   1 
ATOM 95   O O   . VAL A 1 12  ? 7.911   -57.988 17.167  1.00 57.45 ? 29  VAL A O   1 
ATOM 96   C CB  . VAL A 1 12  ? 6.104   -58.870 19.389  1.00 57.54 ? 29  VAL A CB  1 
ATOM 97   C CG1 . VAL A 1 12  ? 5.913   -57.466 19.999  1.00 57.15 ? 29  VAL A CG1 1 
ATOM 98   C CG2 . VAL A 1 12  ? 5.216   -59.882 20.105  1.00 56.70 ? 29  VAL A CG2 1 
ATOM 99   N N   . VAL A 1 13  ? 6.044   -56.859 16.566  1.00 56.98 ? 30  VAL A N   1 
ATOM 100  C CA  . VAL A 1 13  ? 6.789   -55.879 15.777  1.00 56.86 ? 30  VAL A CA  1 
ATOM 101  C C   . VAL A 1 13  ? 6.748   -54.491 16.409  1.00 56.40 ? 30  VAL A C   1 
ATOM 102  O O   . VAL A 1 13  ? 5.892   -54.197 17.256  1.00 56.32 ? 30  VAL A O   1 
ATOM 103  C CB  . VAL A 1 13  ? 6.326   -55.792 14.315  1.00 56.86 ? 30  VAL A CB  1 
ATOM 104  C CG1 . VAL A 1 13  ? 7.471   -55.282 13.475  1.00 56.95 ? 30  VAL A CG1 1 
ATOM 105  C CG2 . VAL A 1 13  ? 5.862   -57.150 13.800  1.00 57.32 ? 30  VAL A CG2 1 
ATOM 106  N N   . GLU A 1 14  ? 7.674   -53.648 15.969  1.00 55.99 ? 31  GLU A N   1 
ATOM 107  C CA  . GLU A 1 14  ? 7.942   -52.369 16.613  1.00 55.87 ? 31  GLU A CA  1 
ATOM 108  C C   . GLU A 1 14  ? 7.276   -51.245 15.816  1.00 54.93 ? 31  GLU A C   1 
ATOM 109  O O   . GLU A 1 14  ? 7.493   -51.115 14.618  1.00 54.96 ? 31  GLU A O   1 
ATOM 110  C CB  . GLU A 1 14  ? 9.458   -52.184 16.686  1.00 56.46 ? 31  GLU A CB  1 
ATOM 111  C CG  . GLU A 1 14  ? 10.025  -51.841 18.047  1.00 57.03 ? 31  GLU A CG  1 
ATOM 112  C CD  . GLU A 1 14  ? 10.622  -50.474 18.026  1.00 59.69 ? 31  GLU A CD  1 
ATOM 113  O OE1 . GLU A 1 14  ? 10.133  -49.627 17.245  1.00 60.82 ? 31  GLU A OE1 1 
ATOM 114  O OE2 . GLU A 1 14  ? 11.589  -50.248 18.771  1.00 60.07 ? 31  GLU A OE2 1 
ATOM 115  N N   . TYR A 1 15  ? 6.436   -50.466 16.485  1.00 54.04 ? 32  TYR A N   1 
ATOM 116  C CA  . TYR A 1 15  ? 5.709   -49.370 15.851  1.00 53.48 ? 32  TYR A CA  1 
ATOM 117  C C   . TYR A 1 15  ? 6.608   -48.454 15.018  1.00 53.48 ? 32  TYR A C   1 
ATOM 118  O O   . TYR A 1 15  ? 7.774   -48.211 15.368  1.00 53.72 ? 32  TYR A O   1 
ATOM 119  C CB  . TYR A 1 15  ? 4.983   -48.548 16.908  1.00 52.85 ? 32  TYR A CB  1 
ATOM 120  C CG  . TYR A 1 15  ? 4.147   -47.437 16.347  1.00 51.99 ? 32  TYR A CG  1 
ATOM 121  C CD1 . TYR A 1 15  ? 2.866   -47.694 15.877  1.00 51.48 ? 32  TYR A CD1 1 
ATOM 122  C CD2 . TYR A 1 15  ? 4.625   -46.123 16.297  1.00 50.57 ? 32  TYR A CD2 1 
ATOM 123  C CE1 . TYR A 1 15  ? 2.067   -46.680 15.362  1.00 52.53 ? 32  TYR A CE1 1 
ATOM 124  C CE2 . TYR A 1 15  ? 3.833   -45.084 15.790  1.00 51.50 ? 32  TYR A CE2 1 
ATOM 125  C CZ  . TYR A 1 15  ? 2.549   -45.375 15.309  1.00 53.07 ? 32  TYR A CZ  1 
ATOM 126  O OH  . TYR A 1 15  ? 1.719   -44.385 14.796  1.00 53.34 ? 32  TYR A OH  1 
ATOM 127  N N   . GLY A 1 16  ? 6.060   -47.941 13.926  1.00 53.22 ? 33  GLY A N   1 
ATOM 128  C CA  . GLY A 1 16  ? 6.817   -47.088 13.028  1.00 53.86 ? 33  GLY A CA  1 
ATOM 129  C C   . GLY A 1 16  ? 8.079   -47.732 12.487  1.00 54.33 ? 33  GLY A C   1 
ATOM 130  O O   . GLY A 1 16  ? 8.876   -47.076 11.831  1.00 53.94 ? 33  GLY A O   1 
ATOM 131  N N   . SER A 1 17  ? 8.265   -49.020 12.759  1.00 55.33 ? 34  SER A N   1 
ATOM 132  C CA  . SER A 1 17  ? 9.413   -49.753 12.232  1.00 56.25 ? 34  SER A CA  1 
ATOM 133  C C   . SER A 1 17  ? 9.089   -50.463 10.917  1.00 56.86 ? 34  SER A C   1 
ATOM 134  O O   . SER A 1 17  ? 8.018   -50.241 10.346  1.00 57.38 ? 34  SER A O   1 
ATOM 135  C CB  . SER A 1 17  ? 9.913   -50.763 13.237  1.00 55.86 ? 34  SER A CB  1 
ATOM 136  O OG  . SER A 1 17  ? 11.198  -51.175 12.830  1.00 57.81 ? 34  SER A OG  1 
ATOM 137  N N   . ASN A 1 18  ? 10.018  -51.294 10.432  1.00 57.17 ? 35  ASN A N   1 
ATOM 138  C CA  . ASN A 1 18  ? 9.766   -52.134 9.251   1.00 57.37 ? 35  ASN A CA  1 
ATOM 139  C C   . ASN A 1 18  ? 9.592   -53.627 9.552   1.00 56.92 ? 35  ASN A C   1 
ATOM 140  O O   . ASN A 1 18  ? 10.279  -54.194 10.423  1.00 57.36 ? 35  ASN A O   1 
ATOM 141  C CB  . ASN A 1 18  ? 10.810  -51.882 8.160   1.00 57.71 ? 35  ASN A CB  1 
ATOM 142  C CG  . ASN A 1 18  ? 10.702  -50.474 7.565   1.00 58.74 ? 35  ASN A CG  1 
ATOM 143  O OD1 . ASN A 1 18  ? 9.774   -49.720 7.877   1.00 60.08 ? 35  ASN A OD1 1 
ATOM 144  N ND2 . ASN A 1 18  ? 11.652  -50.116 6.711   1.00 59.10 ? 35  ASN A ND2 1 
ATOM 145  N N   . MET A 1 19  ? 8.659   -54.245 8.827   1.00 55.95 ? 36  MET A N   1 
ATOM 146  C CA  . MET A 1 19  ? 8.212   -55.601 9.100   1.00 55.02 ? 36  MET A CA  1 
ATOM 147  C C   . MET A 1 19  ? 8.642   -56.575 8.035   1.00 54.50 ? 36  MET A C   1 
ATOM 148  O O   . MET A 1 19  ? 8.473   -56.308 6.832   1.00 54.17 ? 36  MET A O   1 
ATOM 149  C CB  . MET A 1 19  ? 6.708   -55.619 9.097   1.00 55.16 ? 36  MET A CB  1 
ATOM 150  C CG  . MET A 1 19  ? 6.125   -56.667 9.978   1.00 55.66 ? 36  MET A CG  1 
ATOM 151  S SD  . MET A 1 19  ? 4.332   -56.529 9.874   1.00 55.69 ? 36  MET A SD  1 
ATOM 152  C CE  . MET A 1 19  ? 4.008   -57.632 8.501   1.00 56.24 ? 36  MET A CE  1 
ATOM 153  N N   . THR A 1 20  ? 9.152   -57.721 8.485   1.00 53.71 ? 37  THR A N   1 
ATOM 154  C CA  . THR A 1 20  ? 9.516   -58.829 7.582   1.00 53.17 ? 37  THR A CA  1 
ATOM 155  C C   . THR A 1 20  ? 8.987   -60.212 8.028   1.00 52.79 ? 37  THR A C   1 
ATOM 156  O O   . THR A 1 20  ? 9.521   -60.839 8.956   1.00 52.44 ? 37  THR A O   1 
ATOM 157  C CB  . THR A 1 20  ? 11.044  -58.866 7.326   1.00 53.05 ? 37  THR A CB  1 
ATOM 158  O OG1 . THR A 1 20  ? 11.427  -57.637 6.706   1.00 53.05 ? 37  THR A OG1 1 
ATOM 159  C CG2 . THR A 1 20  ? 11.407  -60.010 6.415   1.00 51.79 ? 37  THR A CG2 1 
ATOM 160  N N   . ILE A 1 21  ? 7.931   -60.674 7.362   1.00 52.48 ? 38  ILE A N   1 
ATOM 161  C CA  . ILE A 1 21  ? 7.374   -62.003 7.636   1.00 52.50 ? 38  ILE A CA  1 
ATOM 162  C C   . ILE A 1 21  ? 7.651   -63.000 6.515   1.00 53.45 ? 38  ILE A C   1 
ATOM 163  O O   . ILE A 1 21  ? 7.716   -62.623 5.325   1.00 53.54 ? 38  ILE A O   1 
ATOM 164  C CB  . ILE A 1 21  ? 5.893   -61.964 8.004   1.00 51.76 ? 38  ILE A CB  1 
ATOM 165  C CG1 . ILE A 1 21  ? 5.033   -61.448 6.859   1.00 50.42 ? 38  ILE A CG1 1 
ATOM 166  C CG2 . ILE A 1 21  ? 5.700   -61.122 9.248   1.00 51.80 ? 38  ILE A CG2 1 
ATOM 167  C CD1 . ILE A 1 21  ? 3.608   -61.256 7.300   1.00 49.90 ? 38  ILE A CD1 1 
ATOM 168  N N   . GLU A 1 22  ? 7.818   -64.266 6.917   1.00 54.47 ? 39  GLU A N   1 
ATOM 169  C CA  . GLU A 1 22  ? 8.291   -65.341 6.010   1.00 55.50 ? 39  GLU A CA  1 
ATOM 170  C C   . GLU A 1 22  ? 7.389   -66.566 5.800   1.00 55.94 ? 39  GLU A C   1 
ATOM 171  O O   . GLU A 1 22  ? 6.838   -67.168 6.738   1.00 55.52 ? 39  GLU A O   1 
ATOM 172  C CB  . GLU A 1 22  ? 9.730   -65.761 6.352   1.00 54.96 ? 39  GLU A CB  1 
ATOM 173  C CG  . GLU A 1 22  ? 10.746  -64.823 5.739   1.00 55.32 ? 39  GLU A CG  1 
ATOM 174  C CD  . GLU A 1 22  ? 12.153  -64.909 6.337   1.00 55.71 ? 39  GLU A CD  1 
ATOM 175  O OE1 . GLU A 1 22  ? 12.985  -64.018 6.026   1.00 53.36 ? 39  GLU A OE1 1 
ATOM 176  O OE2 . GLU A 1 22  ? 12.431  -65.855 7.114   1.00 59.56 ? 39  GLU A OE2 1 
ATOM 177  N N   . CYS A 1 23  ? 7.249   -66.914 4.528   1.00 57.17 ? 40  CYS A N   1 
ATOM 178  C CA  . CYS A 1 23  ? 6.770   -68.239 4.152   1.00 58.44 ? 40  CYS A CA  1 
ATOM 179  C C   . CYS A 1 23  ? 7.857   -69.019 3.381   1.00 59.56 ? 40  CYS A C   1 
ATOM 180  O O   . CYS A 1 23  ? 8.524   -68.494 2.459   1.00 58.91 ? 40  CYS A O   1 
ATOM 181  C CB  . CYS A 1 23  ? 5.411   -68.183 3.444   1.00 57.88 ? 40  CYS A CB  1 
ATOM 182  S SG  . CYS A 1 23  ? 4.126   -67.977 4.680   1.00 58.16 ? 40  CYS A SG  1 
ATOM 183  N N   . LYS A 1 24  ? 8.075   -70.252 3.840   1.00 60.90 ? 41  LYS A N   1 
ATOM 184  C CA  . LYS A 1 24  ? 9.020   -71.158 3.193   1.00 62.47 ? 41  LYS A CA  1 
ATOM 185  C C   . LYS A 1 24  ? 8.350   -72.360 2.500   1.00 63.01 ? 41  LYS A C   1 
ATOM 186  O O   . LYS A 1 24  ? 7.323   -72.901 2.932   1.00 62.44 ? 41  LYS A O   1 
ATOM 187  C CB  . LYS A 1 24  ? 10.152  -71.605 4.148   1.00 62.53 ? 41  LYS A CB  1 
ATOM 188  C CG  . LYS A 1 24  ? 11.001  -70.487 4.766   1.00 63.01 ? 41  LYS A CG  1 
ATOM 189  C CD  . LYS A 1 24  ? 12.538  -70.789 4.733   1.00 64.48 ? 41  LYS A CD  1 
ATOM 190  C CE  . LYS A 1 24  ? 12.931  -72.247 5.082   1.00 65.52 ? 41  LYS A CE  1 
ATOM 191  N NZ  . LYS A 1 24  ? 12.373  -72.792 6.396   1.00 64.68 ? 41  LYS A NZ  1 
ATOM 192  N N   . PHE A 1 25  ? 8.993   -72.762 1.414   1.00 64.46 ? 42  PHE A N   1 
ATOM 193  C CA  . PHE A 1 25  ? 8.479   -73.749 0.477   1.00 66.00 ? 42  PHE A CA  1 
ATOM 194  C C   . PHE A 1 25  ? 9.714   -74.347 -0.234  1.00 66.81 ? 42  PHE A C   1 
ATOM 195  O O   . PHE A 1 25  ? 10.752  -73.650 -0.347  1.00 67.21 ? 42  PHE A O   1 
ATOM 196  C CB  . PHE A 1 25  ? 7.522   -73.060 -0.523  1.00 65.26 ? 42  PHE A CB  1 
ATOM 197  C CG  . PHE A 1 25  ? 8.175   -71.958 -1.348  1.00 64.48 ? 42  PHE A CG  1 
ATOM 198  C CD1 . PHE A 1 25  ? 8.287   -72.084 -2.734  1.00 63.73 ? 42  PHE A CD1 1 
ATOM 199  C CD2 . PHE A 1 25  ? 8.681   -70.804 -0.738  1.00 62.16 ? 42  PHE A CD2 1 
ATOM 200  C CE1 . PHE A 1 25  ? 8.883   -71.075 -3.496  1.00 63.93 ? 42  PHE A CE1 1 
ATOM 201  C CE2 . PHE A 1 25  ? 9.264   -69.800 -1.480  1.00 62.14 ? 42  PHE A CE2 1 
ATOM 202  C CZ  . PHE A 1 25  ? 9.375   -69.927 -2.864  1.00 64.59 ? 42  PHE A CZ  1 
ATOM 203  N N   . PRO A 1 26  ? 9.621   -75.632 -0.691  1.00 67.23 ? 43  PRO A N   1 
ATOM 204  C CA  . PRO A 1 26  ? 10.700  -76.357 -1.399  1.00 67.44 ? 43  PRO A CA  1 
ATOM 205  C C   . PRO A 1 26  ? 11.144  -75.781 -2.771  1.00 68.60 ? 43  PRO A C   1 
ATOM 206  O O   . PRO A 1 26  ? 10.333  -75.645 -3.690  1.00 68.70 ? 43  PRO A O   1 
ATOM 207  C CB  . PRO A 1 26  ? 10.105  -77.759 -1.583  1.00 67.28 ? 43  PRO A CB  1 
ATOM 208  C CG  . PRO A 1 26  ? 8.987   -77.850 -0.592  1.00 66.59 ? 43  PRO A CG  1 
ATOM 209  C CD  . PRO A 1 26  ? 8.433   -76.490 -0.502  1.00 67.03 ? 43  PRO A CD  1 
ATOM 210  N N   . VAL A 1 27  ? 12.424  -75.450 -2.905  1.00 69.92 ? 44  VAL A N   1 
ATOM 211  C CA  . VAL A 1 27  ? 12.975  -75.089 -4.216  1.00 71.96 ? 44  VAL A CA  1 
ATOM 212  C C   . VAL A 1 27  ? 14.108  -76.057 -4.639  1.00 73.35 ? 44  VAL A C   1 
ATOM 213  O O   . VAL A 1 27  ? 15.248  -75.952 -4.148  1.00 73.42 ? 44  VAL A O   1 
ATOM 214  C CB  . VAL A 1 27  ? 13.422  -73.586 -4.294  1.00 72.02 ? 44  VAL A CB  1 
ATOM 215  C CG1 . VAL A 1 27  ? 14.208  -73.294 -5.598  1.00 71.79 ? 44  VAL A CG1 1 
ATOM 216  C CG2 . VAL A 1 27  ? 12.217  -72.665 -4.185  1.00 71.92 ? 44  VAL A CG2 1 
ATOM 217  N N   . GLU A 1 28  ? 13.774  -76.999 -5.535  1.00 74.71 ? 45  GLU A N   1 
ATOM 218  C CA  . GLU A 1 28  ? 14.737  -77.988 -6.037  1.00 75.85 ? 45  GLU A CA  1 
ATOM 219  C C   . GLU A 1 28  ? 15.664  -77.347 -7.043  1.00 76.51 ? 45  GLU A C   1 
ATOM 220  O O   . GLU A 1 28  ? 15.222  -76.822 -8.080  1.00 76.67 ? 45  GLU A O   1 
ATOM 221  C CB  . GLU A 1 28  ? 14.044  -79.208 -6.665  1.00 76.22 ? 45  GLU A CB  1 
ATOM 222  C CG  . GLU A 1 28  ? 13.334  -80.151 -5.667  1.00 77.29 ? 45  GLU A CG  1 
ATOM 223  C CD  . GLU A 1 28  ? 14.274  -81.005 -4.801  1.00 78.54 ? 45  GLU A CD  1 
ATOM 224  O OE1 . GLU A 1 28  ? 13.727  -81.807 -4.011  1.00 78.14 ? 45  GLU A OE1 1 
ATOM 225  O OE2 . GLU A 1 28  ? 15.532  -80.894 -4.897  1.00 78.94 ? 45  GLU A OE2 1 
ATOM 226  N N   . LYS A 1 29  ? 16.955  -77.411 -6.719  1.00 77.19 ? 46  LYS A N   1 
ATOM 227  C CA  . LYS A 1 29  ? 18.030  -76.739 -7.462  1.00 77.74 ? 46  LYS A CA  1 
ATOM 228  C C   . LYS A 1 29  ? 17.703  -75.325 -7.994  1.00 77.70 ? 46  LYS A C   1 
ATOM 229  O O   . LYS A 1 29  ? 18.293  -74.355 -7.506  1.00 78.17 ? 46  LYS A O   1 
ATOM 230  C CB  . LYS A 1 29  ? 18.623  -77.645 -8.549  1.00 77.98 ? 46  LYS A CB  1 
ATOM 231  C CG  . LYS A 1 29  ? 20.121  -77.405 -8.778  1.00 78.48 ? 46  LYS A CG  1 
ATOM 232  C CD  . LYS A 1 29  ? 20.576  -77.949 -10.134 1.00 78.66 ? 46  LYS A CD  1 
ATOM 233  C CE  . LYS A 1 29  ? 21.891  -77.299 -10.544 1.00 78.60 ? 46  LYS A CE  1 
ATOM 234  N NZ  . LYS A 1 29  ? 22.132  -77.540 -11.985 1.00 78.71 ? 46  LYS A NZ  1 
ATOM 235  N N   . GLN A 1 30  ? 16.792  -75.200 -8.967  1.00 77.33 ? 47  GLN A N   1 
ATOM 236  C CA  . GLN A 1 30  ? 16.418  -73.867 -9.479  1.00 77.61 ? 47  GLN A CA  1 
ATOM 237  C C   . GLN A 1 30  ? 14.984  -73.424 -9.272  1.00 77.68 ? 47  GLN A C   1 
ATOM 238  O O   . GLN A 1 30  ? 14.052  -74.232 -9.200  1.00 77.68 ? 47  GLN A O   1 
ATOM 239  C CB  . GLN A 1 30  ? 16.745  -73.688 -10.963 1.00 77.53 ? 47  GLN A CB  1 
ATOM 240  C CG  . GLN A 1 30  ? 18.080  -73.038 -11.208 1.00 78.43 ? 47  GLN A CG  1 
ATOM 241  C CD  . GLN A 1 30  ? 19.208  -74.058 -11.152 1.00 80.20 ? 47  GLN A CD  1 
ATOM 242  O OE1 . GLN A 1 30  ? 19.391  -74.841 -12.082 1.00 79.46 ? 47  GLN A OE1 1 
ATOM 243  N NE2 . GLN A 1 30  ? 19.959  -74.065 -10.045 1.00 81.88 ? 47  GLN A NE2 1 
ATOM 244  N N   . LEU A 1 31  ? 14.835  -72.105 -9.214  1.00 77.61 ? 48  LEU A N   1 
ATOM 245  C CA  . LEU A 1 31  ? 13.540  -71.455 -9.219  1.00 77.09 ? 48  LEU A CA  1 
ATOM 246  C C   . LEU A 1 31  ? 13.199  -71.029 -10.636 1.00 76.73 ? 48  LEU A C   1 
ATOM 247  O O   . LEU A 1 31  ? 13.998  -70.344 -11.276 1.00 76.49 ? 48  LEU A O   1 
ATOM 248  C CB  . LEU A 1 31  ? 13.596  -70.212 -8.329  1.00 77.08 ? 48  LEU A CB  1 
ATOM 249  C CG  . LEU A 1 31  ? 12.356  -69.310 -8.276  1.00 76.78 ? 48  LEU A CG  1 
ATOM 250  C CD1 . LEU A 1 31  ? 11.516  -69.595 -7.025  1.00 77.01 ? 48  LEU A CD1 1 
ATOM 251  C CD2 . LEU A 1 31  ? 12.749  -67.845 -8.334  1.00 76.38 ? 48  LEU A CD2 1 
ATOM 252  N N   . ASP A 1 32  ? 12.029  -71.436 -11.132 1.00 76.45 ? 49  ASP A N   1 
ATOM 253  C CA  . ASP A 1 32  ? 11.445  -70.735 -12.290 1.00 76.30 ? 49  ASP A CA  1 
ATOM 254  C C   . ASP A 1 32  ? 10.025  -70.219 -12.030 1.00 75.39 ? 49  ASP A C   1 
ATOM 255  O O   . ASP A 1 32  ? 9.169   -70.912 -11.447 1.00 75.12 ? 49  ASP A O   1 
ATOM 256  C CB  . ASP A 1 32  ? 11.584  -71.477 -13.637 1.00 76.85 ? 49  ASP A CB  1 
ATOM 257  C CG  . ASP A 1 32  ? 11.615  -70.505 -14.859 1.00 78.54 ? 49  ASP A CG  1 
ATOM 258  O OD1 . ASP A 1 32  ? 11.309  -70.975 -15.989 1.00 79.19 ? 49  ASP A OD1 1 
ATOM 259  O OD2 . ASP A 1 32  ? 11.941  -69.283 -14.691 1.00 78.63 ? 49  ASP A OD2 1 
ATOM 260  N N   . LEU A 1 33  ? 9.826   -68.988 -12.505 1.00 74.33 ? 50  LEU A N   1 
ATOM 261  C CA  . LEU A 1 33  ? 8.834   -68.042 -12.007 1.00 73.11 ? 50  LEU A CA  1 
ATOM 262  C C   . LEU A 1 33  ? 7.475   -68.317 -12.582 1.00 72.29 ? 50  LEU A C   1 
ATOM 263  O O   . LEU A 1 33  ? 6.446   -68.077 -11.927 1.00 72.39 ? 50  LEU A O   1 
ATOM 264  C CB  . LEU A 1 33  ? 9.263   -66.617 -12.380 1.00 73.32 ? 50  LEU A CB  1 
ATOM 265  C CG  . LEU A 1 33  ? 10.716  -66.233 -12.053 1.00 73.18 ? 50  LEU A CG  1 
ATOM 266  C CD1 . LEU A 1 33  ? 11.358  -65.429 -13.191 1.00 73.70 ? 50  LEU A CD1 1 
ATOM 267  C CD2 . LEU A 1 33  ? 10.828  -65.516 -10.709 1.00 71.43 ? 50  LEU A CD2 1 
ATOM 268  N N   . ALA A 1 34  ? 7.491   -68.824 -13.811 1.00 71.09 ? 51  ALA A N   1 
ATOM 269  C CA  . ALA A 1 34  ? 6.300   -69.117 -14.560 1.00 69.97 ? 51  ALA A CA  1 
ATOM 270  C C   . ALA A 1 34  ? 5.331   -69.914 -13.688 1.00 69.34 ? 51  ALA A C   1 
ATOM 271  O O   . ALA A 1 34  ? 4.142   -69.603 -13.627 1.00 69.38 ? 51  ALA A O   1 
ATOM 272  C CB  . ALA A 1 34  ? 6.669   -69.882 -15.781 1.00 70.16 ? 51  ALA A CB  1 
ATOM 273  N N   . ALA A 1 35  ? 5.861   -70.902 -12.972 1.00 68.19 ? 52  ALA A N   1 
ATOM 274  C CA  . ALA A 1 35  ? 5.067   -71.794 -12.103 1.00 66.95 ? 52  ALA A CA  1 
ATOM 275  C C   . ALA A 1 35  ? 4.396   -71.145 -10.880 1.00 65.99 ? 52  ALA A C   1 
ATOM 276  O O   . ALA A 1 35  ? 3.386   -71.655 -10.363 1.00 65.76 ? 52  ALA A O   1 
ATOM 277  C CB  . ALA A 1 35  ? 5.949   -72.957 -11.638 1.00 67.05 ? 52  ALA A CB  1 
ATOM 278  N N   . LEU A 1 36  ? 4.960   -70.019 -10.443 1.00 64.66 ? 53  LEU A N   1 
ATOM 279  C CA  . LEU A 1 36  ? 4.811   -69.560 -9.069  1.00 63.10 ? 53  LEU A CA  1 
ATOM 280  C C   . LEU A 1 36  ? 3.674   -68.605 -8.835  1.00 62.02 ? 53  LEU A C   1 
ATOM 281  O O   . LEU A 1 36  ? 3.537   -67.621 -9.548  1.00 62.70 ? 53  LEU A O   1 
ATOM 282  C CB  . LEU A 1 36  ? 6.100   -68.886 -8.617  1.00 63.27 ? 53  LEU A CB  1 
ATOM 283  C CG  . LEU A 1 36  ? 6.325   -68.472 -7.160  1.00 62.22 ? 53  LEU A CG  1 
ATOM 284  C CD1 . LEU A 1 36  ? 6.335   -69.661 -6.197  1.00 59.61 ? 53  LEU A CD1 1 
ATOM 285  C CD2 . LEU A 1 36  ? 7.647   -67.722 -7.130  1.00 60.97 ? 53  LEU A CD2 1 
ATOM 286  N N   . ILE A 1 37  ? 2.884   -68.915 -7.814  1.00 60.27 ? 54  ILE A N   1 
ATOM 287  C CA  . ILE A 1 37  ? 1.925   -68.001 -7.245  1.00 58.88 ? 54  ILE A CA  1 
ATOM 288  C C   . ILE A 1 37  ? 2.363   -67.699 -5.819  1.00 58.26 ? 54  ILE A C   1 
ATOM 289  O O   . ILE A 1 37  ? 2.326   -68.592 -4.935  1.00 58.35 ? 54  ILE A O   1 
ATOM 290  C CB  . ILE A 1 37  ? 0.486   -68.599 -7.146  1.00 59.03 ? 54  ILE A CB  1 
ATOM 291  C CG1 . ILE A 1 37  ? 0.054   -69.302 -8.444  1.00 58.97 ? 54  ILE A CG1 1 
ATOM 292  C CG2 . ILE A 1 37  ? -0.523  -67.496 -6.704  1.00 58.38 ? 54  ILE A CG2 1 
ATOM 293  C CD1 . ILE A 1 37  ? -0.396  -68.340 -9.546  1.00 59.50 ? 54  ILE A CD1 1 
ATOM 294  N N   . VAL A 1 38  ? 2.765   -66.446 -5.586  1.00 56.77 ? 55  VAL A N   1 
ATOM 295  C CA  . VAL A 1 38  ? 2.869   -65.924 -4.219  1.00 54.85 ? 55  VAL A CA  1 
ATOM 296  C C   . VAL A 1 38  ? 1.773   -64.919 -4.054  1.00 53.04 ? 55  VAL A C   1 
ATOM 297  O O   . VAL A 1 38  ? 1.584   -64.074 -4.913  1.00 52.44 ? 55  VAL A O   1 
ATOM 298  C CB  . VAL A 1 38  ? 4.238   -65.273 -3.884  1.00 55.17 ? 55  VAL A CB  1 
ATOM 299  C CG1 . VAL A 1 38  ? 4.422   -65.206 -2.380  1.00 54.73 ? 55  VAL A CG1 1 
ATOM 300  C CG2 . VAL A 1 38  ? 5.378   -66.082 -4.484  1.00 55.93 ? 55  VAL A CG2 1 
ATOM 301  N N   . TYR A 1 39  ? 1.047   -65.040 -2.949  1.00 51.77 ? 56  TYR A N   1 
ATOM 302  C CA  . TYR A 1 39  ? -0.123  -64.217 -2.662  1.00 50.39 ? 56  TYR A CA  1 
ATOM 303  C C   . TYR A 1 39  ? -0.174  -64.011 -1.173  1.00 49.58 ? 56  TYR A C   1 
ATOM 304  O O   . TYR A 1 39  ? -0.330  -64.947 -0.422  1.00 49.40 ? 56  TYR A O   1 
ATOM 305  C CB  . TYR A 1 39  ? -1.394  -64.922 -3.119  1.00 50.09 ? 56  TYR A CB  1 
ATOM 306  C CG  . TYR A 1 39  ? -2.655  -64.151 -2.901  1.00 49.89 ? 56  TYR A CG  1 
ATOM 307  C CD1 . TYR A 1 39  ? -3.333  -63.592 -3.973  1.00 50.85 ? 56  TYR A CD1 1 
ATOM 308  C CD2 . TYR A 1 39  ? -3.200  -63.995 -1.621  1.00 50.06 ? 56  TYR A CD2 1 
ATOM 309  C CE1 . TYR A 1 39  ? -4.532  -62.862 -3.786  1.00 50.61 ? 56  TYR A CE1 1 
ATOM 310  C CE2 . TYR A 1 39  ? -4.391  -63.268 -1.413  1.00 50.36 ? 56  TYR A CE2 1 
ATOM 311  C CZ  . TYR A 1 39  ? -5.048  -62.703 -2.510  1.00 51.20 ? 56  TYR A CZ  1 
ATOM 312  O OH  . TYR A 1 39  ? -6.234  -62.003 -2.339  1.00 51.32 ? 56  TYR A OH  1 
ATOM 313  N N   . TRP A 1 40  ? -0.024  -62.776 -0.739  1.00 49.28 ? 57  TRP A N   1 
ATOM 314  C CA  . TRP A 1 40  ? -0.153  -62.456 0.671   1.00 48.67 ? 57  TRP A CA  1 
ATOM 315  C C   . TRP A 1 40  ? -1.401  -61.651 0.864   1.00 49.44 ? 57  TRP A C   1 
ATOM 316  O O   . TRP A 1 40  ? -1.815  -60.926 -0.035  1.00 48.84 ? 57  TRP A O   1 
ATOM 317  C CB  . TRP A 1 40  ? 0.989   -61.597 1.114   1.00 47.25 ? 57  TRP A CB  1 
ATOM 318  C CG  . TRP A 1 40  ? 2.232   -62.264 1.296   1.00 45.07 ? 57  TRP A CG  1 
ATOM 319  C CD1 . TRP A 1 40  ? 3.252   -62.314 0.418   1.00 44.81 ? 57  TRP A CD1 1 
ATOM 320  C CD2 . TRP A 1 40  ? 2.672   -62.926 2.480   1.00 42.89 ? 57  TRP A CD2 1 
ATOM 321  N NE1 . TRP A 1 40  ? 4.315   -63.000 0.969   1.00 45.09 ? 57  TRP A NE1 1 
ATOM 322  C CE2 . TRP A 1 40  ? 3.979   -63.385 2.238   1.00 42.92 ? 57  TRP A CE2 1 
ATOM 323  C CE3 . TRP A 1 40  ? 2.088   -63.171 3.719   1.00 42.82 ? 57  TRP A CE3 1 
ATOM 324  C CZ2 . TRP A 1 40  ? 4.721   -64.071 3.187   1.00 44.52 ? 57  TRP A CZ2 1 
ATOM 325  C CZ3 . TRP A 1 40  ? 2.819   -63.869 4.673   1.00 45.19 ? 57  TRP A CZ3 1 
ATOM 326  C CH2 . TRP A 1 40  ? 4.131   -64.303 4.403   1.00 45.62 ? 57  TRP A CH2 1 
ATOM 327  N N   . GLU A 1 41  ? -1.967  -61.754 2.062   1.00 51.07 ? 58  GLU A N   1 
ATOM 328  C CA  . GLU A 1 41  ? -3.283  -61.244 2.335   1.00 52.77 ? 58  GLU A CA  1 
ATOM 329  C C   . GLU A 1 41  ? -3.424  -61.268 3.810   1.00 53.27 ? 58  GLU A C   1 
ATOM 330  O O   . GLU A 1 41  ? -2.988  -62.198 4.412   1.00 53.70 ? 58  GLU A O   1 
ATOM 331  C CB  . GLU A 1 41  ? -4.277  -62.213 1.741   1.00 53.55 ? 58  GLU A CB  1 
ATOM 332  C CG  . GLU A 1 41  ? -5.699  -61.858 1.865   1.00 56.39 ? 58  GLU A CG  1 
ATOM 333  C CD  . GLU A 1 41  ? -6.526  -63.089 2.025   1.00 59.90 ? 58  GLU A CD  1 
ATOM 334  O OE1 . GLU A 1 41  ? -6.142  -63.890 2.906   1.00 59.67 ? 58  GLU A OE1 1 
ATOM 335  O OE2 . GLU A 1 41  ? -7.538  -63.254 1.281   1.00 63.09 ? 58  GLU A OE2 1 
ATOM 336  N N   . MET A 1 42  ? -3.999  -60.213 4.377   1.00 55.01 ? 59  MET A N   1 
ATOM 337  C CA  . MET A 1 42  ? -4.352  -60.090 5.801   1.00 56.47 ? 59  MET A CA  1 
ATOM 338  C C   . MET A 1 42  ? -5.777  -59.623 5.807   1.00 56.41 ? 59  MET A C   1 
ATOM 339  O O   . MET A 1 42  ? -6.146  -58.782 4.992   1.00 56.60 ? 59  MET A O   1 
ATOM 340  C CB  . MET A 1 42  ? -3.523  -59.003 6.516   1.00 56.40 ? 59  MET A CB  1 
ATOM 341  C CG  . MET A 1 42  ? -3.985  -58.751 7.961   1.00 57.32 ? 59  MET A CG  1 
ATOM 342  S SD  . MET A 1 42  ? -4.156  -57.025 8.476   1.00 58.91 ? 59  MET A SD  1 
ATOM 343  C CE  . MET A 1 42  ? -5.319  -56.405 7.238   1.00 57.94 ? 59  MET A CE  1 
ATOM 344  N N   . GLU A 1 43  ? -6.568  -60.125 6.741   1.00 57.12 ? 60  GLU A N   1 
ATOM 345  C CA  . GLU A 1 43  ? -7.989  -59.818 6.789   1.00 58.13 ? 60  GLU A CA  1 
ATOM 346  C C   . GLU A 1 43  ? -8.582  -59.505 5.414   1.00 58.49 ? 60  GLU A C   1 
ATOM 347  O O   . GLU A 1 43  ? -9.118  -58.424 5.176   1.00 59.25 ? 60  GLU A O   1 
ATOM 348  C CB  . GLU A 1 43  ? -8.243  -58.710 7.790   1.00 58.24 ? 60  GLU A CB  1 
ATOM 349  C CG  . GLU A 1 43  ? -8.041  -59.197 9.223   1.00 61.00 ? 60  GLU A CG  1 
ATOM 350  C CD  . GLU A 1 43  ? -7.667  -58.067 10.154  1.00 63.43 ? 60  GLU A CD  1 
ATOM 351  O OE1 . GLU A 1 43  ? -7.893  -56.904 9.753   1.00 64.99 ? 60  GLU A OE1 1 
ATOM 352  O OE2 . GLU A 1 43  ? -7.153  -58.341 11.265  1.00 63.49 ? 60  GLU A OE2 1 
ATOM 353  N N   . ASP A 1 44  ? -8.441  -60.460 4.500   1.00 58.86 ? 61  ASP A N   1 
ATOM 354  C CA  . ASP A 1 44  ? -9.055  -60.411 3.165   1.00 59.19 ? 61  ASP A CA  1 
ATOM 355  C C   . ASP A 1 44  ? -8.555  -59.345 2.204   1.00 58.69 ? 61  ASP A C   1 
ATOM 356  O O   . ASP A 1 44  ? -8.868  -59.372 1.015   1.00 59.40 ? 61  ASP A O   1 
ATOM 357  C CB  . ASP A 1 44  ? -10.594 -60.489 3.244   1.00 59.45 ? 61  ASP A CB  1 
ATOM 358  C CG  . ASP A 1 44  ? -11.094 -61.945 3.451   1.00 62.34 ? 61  ASP A CG  1 
ATOM 359  O OD1 . ASP A 1 44  ? -10.521 -62.886 2.807   1.00 64.63 ? 61  ASP A OD1 1 
ATOM 360  O OD2 . ASP A 1 44  ? -12.041 -62.152 4.255   1.00 62.83 ? 61  ASP A OD2 1 
ATOM 361  N N   . LYS A 1 45  ? -7.737  -58.432 2.694   1.00 58.14 ? 62  LYS A N   1 
ATOM 362  C CA  . LYS A 1 45  ? -7.127  -57.416 1.827   1.00 57.86 ? 62  LYS A CA  1 
ATOM 363  C C   . LYS A 1 45  ? -5.846  -57.926 1.122   1.00 57.20 ? 62  LYS A C   1 
ATOM 364  O O   . LYS A 1 45  ? -4.924  -58.443 1.768   1.00 56.91 ? 62  LYS A O   1 
ATOM 365  C CB  . LYS A 1 45  ? -6.858  -56.140 2.644   1.00 57.58 ? 62  LYS A CB  1 
ATOM 366  C CG  . LYS A 1 45  ? -8.130  -55.449 3.129   1.00 58.19 ? 62  LYS A CG  1 
ATOM 367  C CD  . LYS A 1 45  ? -8.187  -55.185 4.650   1.00 58.60 ? 62  LYS A CD  1 
ATOM 368  C CE  . LYS A 1 45  ? -7.379  -53.976 5.113   1.00 57.52 ? 62  LYS A CE  1 
ATOM 369  N NZ  . LYS A 1 45  ? -6.968  -54.126 6.551   1.00 56.89 ? 62  LYS A NZ  1 
ATOM 370  N N   . ASN A 1 46  ? -5.775  -57.787 -0.193  1.00 56.49 ? 63  ASN A N   1 
ATOM 371  C CA  . ASN A 1 46  ? -4.547  -58.197 -0.862  1.00 56.78 ? 63  ASN A CA  1 
ATOM 372  C C   . ASN A 1 46  ? -3.317  -57.309 -0.550  1.00 57.21 ? 63  ASN A C   1 
ATOM 373  O O   . ASN A 1 46  ? -3.284  -56.116 -0.859  1.00 57.86 ? 63  ASN A O   1 
ATOM 374  C CB  . ASN A 1 46  ? -4.724  -58.325 -2.368  1.00 56.04 ? 63  ASN A CB  1 
ATOM 375  C CG  . ASN A 1 46  ? -3.450  -58.796 -3.041  1.00 57.29 ? 63  ASN A CG  1 
ATOM 376  O OD1 . ASN A 1 46  ? -2.797  -58.050 -3.785  1.00 56.55 ? 63  ASN A OD1 1 
ATOM 377  N ND2 . ASN A 1 46  ? -3.061  -60.049 -2.750  1.00 58.46 ? 63  ASN A ND2 1 
ATOM 378  N N   . ILE A 1 47  ? -2.291  -57.885 0.054   1.00 57.50 ? 64  ILE A N   1 
ATOM 379  C CA  . ILE A 1 47  ? -1.064  -57.144 0.239   1.00 57.30 ? 64  ILE A CA  1 
ATOM 380  C C   . ILE A 1 47  ? -0.208  -57.323 -1.015  1.00 58.07 ? 64  ILE A C   1 
ATOM 381  O O   . ILE A 1 47  ? 0.334   -56.362 -1.539  1.00 57.80 ? 64  ILE A O   1 
ATOM 382  C CB  . ILE A 1 47  ? -0.322  -57.602 1.497   1.00 57.28 ? 64  ILE A CB  1 
ATOM 383  C CG1 . ILE A 1 47  ? -1.264  -57.624 2.704   1.00 57.34 ? 64  ILE A CG1 1 
ATOM 384  C CG2 . ILE A 1 47  ? 0.878   -56.729 1.771   1.00 55.86 ? 64  ILE A CG2 1 
ATOM 385  C CD1 . ILE A 1 47  ? -0.769  -58.530 3.855   1.00 59.22 ? 64  ILE A CD1 1 
ATOM 386  N N   . ILE A 1 48  ? -0.123  -58.552 -1.517  1.00 59.09 ? 65  ILE A N   1 
ATOM 387  C CA  . ILE A 1 48  ? 0.830   -58.890 -2.572  1.00 60.31 ? 65  ILE A CA  1 
ATOM 388  C C   . ILE A 1 48  ? 0.329   -60.050 -3.415  1.00 61.12 ? 65  ILE A C   1 
ATOM 389  O O   . ILE A 1 48  ? -0.186  -61.018 -2.871  1.00 61.66 ? 65  ILE A O   1 
ATOM 390  C CB  . ILE A 1 48  ? 2.207   -59.317 -1.969  1.00 60.32 ? 65  ILE A CB  1 
ATOM 391  C CG1 . ILE A 1 48  ? 3.071   -58.098 -1.566  1.00 59.24 ? 65  ILE A CG1 1 
ATOM 392  C CG2 . ILE A 1 48  ? 2.963   -60.227 -2.948  1.00 61.02 ? 65  ILE A CG2 1 
ATOM 393  C CD1 . ILE A 1 48  ? 3.484   -57.168 -2.716  1.00 56.50 ? 65  ILE A CD1 1 
ATOM 394  N N   . GLN A 1 49  ? 0.499   -59.957 -4.732  1.00 61.95 ? 66  GLN A N   1 
ATOM 395  C CA  . GLN A 1 49  ? 0.163   -61.055 -5.655  1.00 62.70 ? 66  GLN A CA  1 
ATOM 396  C C   . GLN A 1 49  ? 1.281   -61.328 -6.657  1.00 63.33 ? 66  GLN A C   1 
ATOM 397  O O   . GLN A 1 49  ? 1.422   -60.612 -7.650  1.00 63.72 ? 66  GLN A O   1 
ATOM 398  C CB  . GLN A 1 49  ? -1.126  -60.741 -6.401  1.00 62.65 ? 66  GLN A CB  1 
ATOM 399  C CG  . GLN A 1 49  ? -1.339  -61.533 -7.659  1.00 62.87 ? 66  GLN A CG  1 
ATOM 400  C CD  . GLN A 1 49  ? -2.786  -61.513 -8.102  1.00 64.38 ? 66  GLN A CD  1 
ATOM 401  O OE1 . GLN A 1 49  ? -3.559  -62.389 -7.718  1.00 66.00 ? 66  GLN A OE1 1 
ATOM 402  N NE2 . GLN A 1 49  ? -3.168  -60.507 -8.896  1.00 61.72 ? 66  GLN A NE2 1 
ATOM 403  N N   . PHE A 1 50  ? 2.064   -62.371 -6.406  1.00 63.88 ? 67  PHE A N   1 
ATOM 404  C CA  . PHE A 1 50  ? 3.186   -62.693 -7.273  1.00 64.74 ? 67  PHE A CA  1 
ATOM 405  C C   . PHE A 1 50  ? 2.873   -63.762 -8.328  1.00 65.64 ? 67  PHE A C   1 
ATOM 406  O O   . PHE A 1 50  ? 2.636   -64.936 -8.018  1.00 65.60 ? 67  PHE A O   1 
ATOM 407  C CB  . PHE A 1 50  ? 4.373   -63.112 -6.435  1.00 64.49 ? 67  PHE A CB  1 
ATOM 408  C CG  . PHE A 1 50  ? 5.672   -62.946 -7.128  1.00 63.75 ? 67  PHE A CG  1 
ATOM 409  C CD1 . PHE A 1 50  ? 6.015   -61.726 -7.676  1.00 62.93 ? 67  PHE A CD1 1 
ATOM 410  C CD2 . PHE A 1 50  ? 6.558   -64.003 -7.220  1.00 62.83 ? 67  PHE A CD2 1 
ATOM 411  C CE1 . PHE A 1 50  ? 7.203   -61.566 -8.307  1.00 62.88 ? 67  PHE A CE1 1 
ATOM 412  C CE2 . PHE A 1 50  ? 7.752   -63.855 -7.847  1.00 62.54 ? 67  PHE A CE2 1 
ATOM 413  C CZ  . PHE A 1 50  ? 8.082   -62.632 -8.390  1.00 63.77 ? 67  PHE A CZ  1 
ATOM 414  N N   . VAL A 1 51  ? 2.890   -63.331 -9.585  1.00 66.71 ? 68  VAL A N   1 
ATOM 415  C CA  . VAL A 1 51  ? 2.489   -64.154 -10.724 1.00 67.38 ? 68  VAL A CA  1 
ATOM 416  C C   . VAL A 1 51  ? 3.421   -63.839 -11.892 1.00 68.08 ? 68  VAL A C   1 
ATOM 417  O O   . VAL A 1 51  ? 3.660   -62.667 -12.204 1.00 67.92 ? 68  VAL A O   1 
ATOM 418  C CB  . VAL A 1 51  ? 0.991   -63.891 -11.076 1.00 67.06 ? 68  VAL A CB  1 
ATOM 419  C CG1 . VAL A 1 51  ? 0.716   -64.033 -12.550 1.00 67.40 ? 68  VAL A CG1 1 
ATOM 420  C CG2 . VAL A 1 51  ? 0.115   -64.815 -10.301 1.00 66.54 ? 68  VAL A CG2 1 
ATOM 421  N N   . HIS A 1 52  ? 3.952   -64.890 -12.518 1.00 69.36 ? 69  HIS A N   1 
ATOM 422  C CA  . HIS A 1 52  ? 4.932   -64.770 -13.626 1.00 70.58 ? 69  HIS A CA  1 
ATOM 423  C C   . HIS A 1 52  ? 6.038   -63.784 -13.295 1.00 71.15 ? 69  HIS A C   1 
ATOM 424  O O   . HIS A 1 52  ? 6.339   -62.883 -14.098 1.00 71.12 ? 69  HIS A O   1 
ATOM 425  C CB  . HIS A 1 52  ? 4.275   -64.379 -14.979 1.00 70.93 ? 69  HIS A CB  1 
ATOM 426  C CG  . HIS A 1 52  ? 3.338   -65.414 -15.536 1.00 71.23 ? 69  HIS A CG  1 
ATOM 427  N ND1 . HIS A 1 52  ? 2.247   -65.087 -16.313 1.00 72.76 ? 69  HIS A ND1 1 
ATOM 428  C CD2 . HIS A 1 52  ? 3.318   -66.763 -15.418 1.00 70.46 ? 69  HIS A CD2 1 
ATOM 429  C CE1 . HIS A 1 52  ? 1.596   -66.187 -16.651 1.00 70.83 ? 69  HIS A CE1 1 
ATOM 430  N NE2 . HIS A 1 52  ? 2.222   -67.216 -16.113 1.00 69.76 ? 69  HIS A NE2 1 
ATOM 431  N N   . GLY A 1 53  ? 6.610   -63.940 -12.098 1.00 72.01 ? 70  GLY A N   1 
ATOM 432  C CA  . GLY A 1 53  ? 7.762   -63.134 -11.652 1.00 72.95 ? 70  GLY A CA  1 
ATOM 433  C C   . GLY A 1 53  ? 7.587   -61.615 -11.646 1.00 73.32 ? 70  GLY A C   1 
ATOM 434  O O   . GLY A 1 53  ? 8.565   -60.870 -11.654 1.00 73.36 ? 70  GLY A O   1 
ATOM 435  N N   . GLU A 1 54  ? 6.342   -61.157 -11.658 1.00 73.53 ? 71  GLU A N   1 
ATOM 436  C CA  . GLU A 1 54  ? 6.050   -59.757 -11.427 1.00 73.90 ? 71  GLU A CA  1 
ATOM 437  C C   . GLU A 1 54  ? 4.987   -59.674 -10.339 1.00 73.87 ? 71  GLU A C   1 
ATOM 438  O O   . GLU A 1 54  ? 4.447   -60.690 -9.889  1.00 74.31 ? 71  GLU A O   1 
ATOM 439  C CB  . GLU A 1 54  ? 5.603   -59.072 -12.718 1.00 73.82 ? 71  GLU A CB  1 
ATOM 440  C CG  . GLU A 1 54  ? 6.736   -58.381 -13.486 1.00 74.31 ? 71  GLU A CG  1 
ATOM 441  C CD  . GLU A 1 54  ? 6.312   -57.867 -14.882 1.00 74.87 ? 71  GLU A CD  1 
ATOM 442  O OE1 . GLU A 1 54  ? 7.144   -57.922 -15.819 1.00 75.71 ? 71  GLU A OE1 1 
ATOM 443  O OE2 . GLU A 1 54  ? 5.155   -57.403 -15.053 1.00 76.05 ? 71  GLU A OE2 1 
ATOM 444  N N   . GLU A 1 55  ? 4.690   -58.469 -9.894  1.00 73.73 ? 72  GLU A N   1 
ATOM 445  C CA  . GLU A 1 55  ? 3.762   -58.302 -8.795  1.00 73.56 ? 72  GLU A CA  1 
ATOM 446  C C   . GLU A 1 55  ? 2.611   -57.500 -9.361  1.00 72.99 ? 72  GLU A C   1 
ATOM 447  O O   . GLU A 1 55  ? 2.826   -56.472 -10.004 1.00 72.99 ? 72  GLU A O   1 
ATOM 448  C CB  . GLU A 1 55  ? 4.426   -57.574 -7.616  1.00 73.68 ? 72  GLU A CB  1 
ATOM 449  C CG  . GLU A 1 55  ? 5.916   -57.885 -7.405  1.00 75.66 ? 72  GLU A CG  1 
ATOM 450  C CD  . GLU A 1 55  ? 6.831   -57.483 -8.605  1.00 78.65 ? 72  GLU A CD  1 
ATOM 451  O OE1 . GLU A 1 55  ? 6.513   -56.519 -9.363  1.00 78.37 ? 72  GLU A OE1 1 
ATOM 452  O OE2 . GLU A 1 55  ? 7.876   -58.151 -8.787  1.00 79.39 ? 72  GLU A OE2 1 
ATOM 453  N N   . ASP A 1 56  ? 1.397   -57.987 -9.142  1.00 72.36 ? 73  ASP A N   1 
ATOM 454  C CA  . ASP A 1 56  ? 0.218   -57.392 -9.732  1.00 72.23 ? 73  ASP A CA  1 
ATOM 455  C C   . ASP A 1 56  ? -0.267  -56.293 -8.799  1.00 71.60 ? 73  ASP A C   1 
ATOM 456  O O   . ASP A 1 56  ? -0.907  -56.557 -7.772  1.00 71.47 ? 73  ASP A O   1 
ATOM 457  C CB  . ASP A 1 56  ? -0.857  -58.466 -9.970  1.00 72.83 ? 73  ASP A CB  1 
ATOM 458  C CG  . ASP A 1 56  ? -1.607  -58.271 -11.289 1.00 74.54 ? 73  ASP A CG  1 
ATOM 459  O OD1 . ASP A 1 56  ? -2.868  -58.178 -11.266 1.00 75.29 ? 73  ASP A OD1 1 
ATOM 460  O OD2 . ASP A 1 56  ? -0.925  -58.208 -12.349 1.00 75.57 ? 73  ASP A OD2 1 
ATOM 461  N N   . LEU A 1 57  ? 0.069   -55.055 -9.151  1.00 71.06 ? 74  LEU A N   1 
ATOM 462  C CA  . LEU A 1 57  ? -0.155  -53.909 -8.255  1.00 70.11 ? 74  LEU A CA  1 
ATOM 463  C C   . LEU A 1 57  ? -1.623  -53.497 -8.280  1.00 69.85 ? 74  LEU A C   1 
ATOM 464  O O   . LEU A 1 57  ? -2.182  -53.085 -7.256  1.00 69.98 ? 74  LEU A O   1 
ATOM 465  C CB  . LEU A 1 57  ? 0.789   -52.714 -8.582  1.00 69.95 ? 74  LEU A CB  1 
ATOM 466  C CG  . LEU A 1 57  ? 2.307   -52.642 -8.248  1.00 67.77 ? 74  LEU A CG  1 
ATOM 467  C CD1 . LEU A 1 57  ? 2.668   -53.215 -6.879  1.00 64.97 ? 74  LEU A CD1 1 
ATOM 468  C CD2 . LEU A 1 57  ? 3.204   -53.265 -9.334  1.00 66.76 ? 74  LEU A CD2 1 
ATOM 469  N N   . LYS A 1 58  ? -2.243  -53.651 -9.448  1.00 69.45 ? 75  LYS A N   1 
ATOM 470  C CA  . LYS A 1 58  ? -3.627  -53.233 -9.683  1.00 69.18 ? 75  LYS A CA  1 
ATOM 471  C C   . LYS A 1 58  ? -4.585  -53.844 -8.675  1.00 68.94 ? 75  LYS A C   1 
ATOM 472  O O   . LYS A 1 58  ? -5.689  -53.334 -8.481  1.00 69.02 ? 75  LYS A O   1 
ATOM 473  C CB  . LYS A 1 58  ? -4.060  -53.623 -11.096 1.00 69.16 ? 75  LYS A CB  1 
ATOM 474  C CG  . LYS A 1 58  ? -5.246  -52.829 -11.660 1.00 69.65 ? 75  LYS A CG  1 
ATOM 475  C CD  . LYS A 1 58  ? -5.958  -53.596 -12.811 1.00 69.03 ? 75  LYS A CD  1 
ATOM 476  C CE  . LYS A 1 58  ? -5.207  -53.521 -14.170 1.00 68.66 ? 75  LYS A CE  1 
ATOM 477  N NZ  . LYS A 1 58  ? -3.778  -54.011 -14.139 1.00 66.99 ? 75  LYS A NZ  1 
ATOM 478  N N   . VAL A 1 59  ? -4.158  -54.930 -8.034  1.00 68.58 ? 76  VAL A N   1 
ATOM 479  C CA  . VAL A 1 59  ? -5.022  -55.670 -7.117  1.00 68.23 ? 76  VAL A CA  1 
ATOM 480  C C   . VAL A 1 59  ? -4.656  -55.453 -5.662  1.00 67.90 ? 76  VAL A C   1 
ATOM 481  O O   . VAL A 1 59  ? -5.426  -55.809 -4.774  1.00 68.47 ? 76  VAL A O   1 
ATOM 482  C CB  . VAL A 1 59  ? -5.027  -57.186 -7.401  1.00 68.43 ? 76  VAL A CB  1 
ATOM 483  C CG1 . VAL A 1 59  ? -6.034  -57.892 -6.496  1.00 68.72 ? 76  VAL A CG1 1 
ATOM 484  C CG2 . VAL A 1 59  ? -5.337  -57.480 -8.886  1.00 68.75 ? 76  VAL A CG2 1 
ATOM 485  N N   . GLN A 1 60  ? -3.494  -54.869 -5.413  1.00 67.15 ? 77  GLN A N   1 
ATOM 486  C CA  . GLN A 1 60  ? -3.092  -54.542 -4.057  1.00 66.76 ? 77  GLN A CA  1 
ATOM 487  C C   . GLN A 1 60  ? -4.071  -53.551 -3.429  1.00 66.58 ? 77  GLN A C   1 
ATOM 488  O O   . GLN A 1 60  ? -4.209  -52.439 -3.916  1.00 66.88 ? 77  GLN A O   1 
ATOM 489  C CB  . GLN A 1 60  ? -1.689  -53.959 -4.105  1.00 66.70 ? 77  GLN A CB  1 
ATOM 490  C CG  . GLN A 1 60  ? -1.075  -53.572 -2.786  1.00 66.72 ? 77  GLN A CG  1 
ATOM 491  C CD  . GLN A 1 60  ? 0.374   -53.129 -2.960  1.00 66.98 ? 77  GLN A CD  1 
ATOM 492  O OE1 . GLN A 1 60  ? 0.687   -52.302 -3.821  1.00 67.22 ? 77  GLN A OE1 1 
ATOM 493  N NE2 . GLN A 1 60  ? 1.267   -53.682 -2.146  1.00 67.30 ? 77  GLN A NE2 1 
ATOM 494  N N   . HIS A 1 61  ? -4.765  -53.956 -2.367  1.00 66.36 ? 78  HIS A N   1 
ATOM 495  C CA  . HIS A 1 61  ? -5.646  -53.047 -1.612  1.00 66.63 ? 78  HIS A CA  1 
ATOM 496  C C   . HIS A 1 61  ? -4.977  -51.687 -1.521  1.00 67.25 ? 78  HIS A C   1 
ATOM 497  O O   . HIS A 1 61  ? -3.768  -51.620 -1.219  1.00 67.28 ? 78  HIS A O   1 
ATOM 498  C CB  . HIS A 1 61  ? -5.885  -53.583 -0.204  1.00 66.26 ? 78  HIS A CB  1 
ATOM 499  C CG  . HIS A 1 61  ? -6.816  -52.756 0.632   1.00 66.01 ? 78  HIS A CG  1 
ATOM 500  N ND1 . HIS A 1 61  ? -6.479  -51.514 1.128   1.00 65.77 ? 78  HIS A ND1 1 
ATOM 501  C CD2 . HIS A 1 61  ? -8.058  -53.024 1.107   1.00 65.61 ? 78  HIS A CD2 1 
ATOM 502  C CE1 . HIS A 1 61  ? -7.482  -51.044 1.852   1.00 65.80 ? 78  HIS A CE1 1 
ATOM 503  N NE2 . HIS A 1 61  ? -8.450  -51.944 1.862   1.00 64.70 ? 78  HIS A NE2 1 
ATOM 504  N N   . SER A 1 62  ? -5.752  -50.622 -1.802  1.00 67.55 ? 79  SER A N   1 
ATOM 505  C CA  . SER A 1 62  ? -5.247  -49.218 -1.817  1.00 67.16 ? 79  SER A CA  1 
ATOM 506  C C   . SER A 1 62  ? -4.313  -48.912 -0.627  1.00 66.67 ? 79  SER A C   1 
ATOM 507  O O   . SER A 1 62  ? -3.185  -48.448 -0.816  1.00 66.70 ? 79  SER A O   1 
ATOM 508  C CB  . SER A 1 62  ? -6.412  -48.205 -1.874  1.00 67.43 ? 79  SER A CB  1 
ATOM 509  O OG  . SER A 1 62  ? -7.053  -48.018 -0.600  1.00 67.19 ? 79  SER A OG  1 
ATOM 510  N N   . SER A 1 63  ? -4.781  -49.238 0.579   1.00 65.86 ? 80  SER A N   1 
ATOM 511  C CA  . SER A 1 63  ? -4.084  -48.928 1.815   1.00 65.37 ? 80  SER A CA  1 
ATOM 512  C C   . SER A 1 63  ? -2.685  -49.524 1.971   1.00 64.90 ? 80  SER A C   1 
ATOM 513  O O   . SER A 1 63  ? -2.018  -49.248 2.965   1.00 65.01 ? 80  SER A O   1 
ATOM 514  C CB  . SER A 1 63  ? -4.943  -49.331 3.021   1.00 65.68 ? 80  SER A CB  1 
ATOM 515  O OG  . SER A 1 63  ? -4.770  -50.699 3.359   1.00 64.99 ? 80  SER A OG  1 
ATOM 516  N N   . TYR A 1 64  ? -2.251  -50.356 1.028   1.00 64.47 ? 81  TYR A N   1 
ATOM 517  C CA  . TYR A 1 64  ? -0.913  -51.008 1.117   1.00 64.05 ? 81  TYR A CA  1 
ATOM 518  C C   . TYR A 1 64  ? 0.044   -50.411 0.086   1.00 64.19 ? 81  TYR A C   1 
ATOM 519  O O   . TYR A 1 64  ? 1.212   -50.845 -0.041  1.00 63.30 ? 81  TYR A O   1 
ATOM 520  C CB  . TYR A 1 64  ? -0.985  -52.565 1.029   1.00 63.42 ? 81  TYR A CB  1 
ATOM 521  C CG  . TYR A 1 64  ? -1.300  -53.263 2.367   1.00 62.43 ? 81  TYR A CG  1 
ATOM 522  C CD1 . TYR A 1 64  ? -2.594  -53.706 2.678   1.00 61.09 ? 81  TYR A CD1 1 
ATOM 523  C CD2 . TYR A 1 64  ? -0.298  -53.458 3.324   1.00 61.51 ? 81  TYR A CD2 1 
ATOM 524  C CE1 . TYR A 1 64  ? -2.872  -54.325 3.923   1.00 61.01 ? 81  TYR A CE1 1 
ATOM 525  C CE2 . TYR A 1 64  ? -0.563  -54.063 4.550   1.00 61.24 ? 81  TYR A CE2 1 
ATOM 526  C CZ  . TYR A 1 64  ? -1.843  -54.498 4.848   1.00 61.31 ? 81  TYR A CZ  1 
ATOM 527  O OH  . TYR A 1 64  ? -2.065  -55.098 6.078   1.00 61.80 ? 81  TYR A OH  1 
ATOM 528  N N   . ARG A 1 65  ? -0.469  -49.372 -0.593  1.00 64.51 ? 82  ARG A N   1 
ATOM 529  C CA  . ARG A 1 65  ? 0.222   -48.702 -1.689  1.00 64.73 ? 82  ARG A CA  1 
ATOM 530  C C   . ARG A 1 65  ? 1.618   -48.248 -1.277  1.00 64.58 ? 82  ARG A C   1 
ATOM 531  O O   . ARG A 1 65  ? 1.797   -47.413 -0.391  1.00 64.62 ? 82  ARG A O   1 
ATOM 532  C CB  . ARG A 1 65  ? -0.623  -47.550 -2.239  1.00 64.80 ? 82  ARG A CB  1 
ATOM 533  C CG  . ARG A 1 65  ? -0.043  -46.846 -3.462  1.00 66.06 ? 82  ARG A CG  1 
ATOM 534  C CD  . ARG A 1 65  ? -1.075  -45.869 -4.040  1.00 69.70 ? 82  ARG A CD  1 
ATOM 535  N NE  . ARG A 1 65  ? -0.695  -45.286 -5.336  1.00 71.29 ? 82  ARG A NE  1 
ATOM 536  C CZ  . ARG A 1 65  ? -1.404  -44.362 -5.998  1.00 72.71 ? 82  ARG A CZ  1 
ATOM 537  N NH1 . ARG A 1 65  ? -2.546  -43.892 -5.499  1.00 73.79 ? 82  ARG A NH1 1 
ATOM 538  N NH2 . ARG A 1 65  ? -0.971  -43.890 -7.168  1.00 73.20 ? 82  ARG A NH2 1 
ATOM 539  N N   . GLN A 1 66  ? 2.598   -48.860 -1.924  1.00 64.71 ? 83  GLN A N   1 
ATOM 540  C CA  . GLN A 1 66  ? 4.010   -48.538 -1.770  1.00 65.05 ? 83  GLN A CA  1 
ATOM 541  C C   . GLN A 1 66  ? 4.533   -48.723 -0.352  1.00 64.27 ? 83  GLN A C   1 
ATOM 542  O O   . GLN A 1 66  ? 5.682   -48.383 -0.072  1.00 63.74 ? 83  GLN A O   1 
ATOM 543  C CB  . GLN A 1 66  ? 4.303   -47.132 -2.290  1.00 65.22 ? 83  GLN A CB  1 
ATOM 544  C CG  . GLN A 1 66  ? 5.563   -47.062 -3.159  1.00 67.00 ? 83  GLN A CG  1 
ATOM 545  C CD  . GLN A 1 66  ? 5.972   -45.624 -3.549  1.00 67.21 ? 83  GLN A CD  1 
ATOM 546  O OE1 . GLN A 1 66  ? 6.006   -45.275 -4.739  1.00 71.63 ? 83  GLN A OE1 1 
ATOM 547  N NE2 . GLN A 1 66  ? 6.286   -44.796 -2.549  1.00 66.99 ? 83  GLN A NE2 1 
ATOM 548  N N   . ARG A 1 67  ? 3.708   -49.279 0.536   1.00 64.13 ? 84  ARG A N   1 
ATOM 549  C CA  . ARG A 1 67  ? 4.207   -49.644 1.868   1.00 64.01 ? 84  ARG A CA  1 
ATOM 550  C C   . ARG A 1 67  ? 4.584   -51.107 2.012   1.00 63.88 ? 84  ARG A C   1 
ATOM 551  O O   . ARG A 1 67  ? 5.367   -51.467 2.903   1.00 63.53 ? 84  ARG A O   1 
ATOM 552  C CB  . ARG A 1 67  ? 3.296   -49.163 3.006   1.00 63.75 ? 84  ARG A CB  1 
ATOM 553  C CG  . ARG A 1 67  ? 1.885   -49.684 3.017   1.00 63.80 ? 84  ARG A CG  1 
ATOM 554  C CD  . ARG A 1 67  ? 1.126   -49.136 4.226   1.00 64.17 ? 84  ARG A CD  1 
ATOM 555  N NE  . ARG A 1 67  ? 1.896   -49.297 5.469   1.00 65.10 ? 84  ARG A NE  1 
ATOM 556  C CZ  . ARG A 1 67  ? 1.547   -50.082 6.488   1.00 63.74 ? 84  ARG A CZ  1 
ATOM 557  N NH1 . ARG A 1 67  ? 0.421   -50.792 6.445   1.00 63.19 ? 84  ARG A NH1 1 
ATOM 558  N NH2 . ARG A 1 67  ? 2.330   -50.150 7.554   1.00 61.63 ? 84  ARG A NH2 1 
ATOM 559  N N   . ALA A 1 68  ? 4.053   -51.940 1.117   1.00 64.14 ? 85  ALA A N   1 
ATOM 560  C CA  . ALA A 1 68  ? 4.381   -53.368 1.109   1.00 64.67 ? 85  ALA A CA  1 
ATOM 561  C C   . ALA A 1 68  ? 5.057   -53.804 -0.169  1.00 65.26 ? 85  ALA A C   1 
ATOM 562  O O   . ALA A 1 68  ? 4.579   -53.523 -1.264  1.00 65.13 ? 85  ALA A O   1 
ATOM 563  C CB  . ALA A 1 68  ? 3.154   -54.194 1.343   1.00 64.42 ? 85  ALA A CB  1 
ATOM 564  N N   . ARG A 1 69  ? 6.171   -54.502 -0.009  1.00 66.47 ? 86  ARG A N   1 
ATOM 565  C CA  . ARG A 1 69  ? 6.941   -55.014 -1.123  1.00 68.26 ? 86  ARG A CA  1 
ATOM 566  C C   . ARG A 1 69  ? 7.267   -56.462 -0.854  1.00 68.99 ? 86  ARG A C   1 
ATOM 567  O O   . ARG A 1 69  ? 7.211   -56.925 0.292   1.00 69.37 ? 86  ARG A O   1 
ATOM 568  C CB  . ARG A 1 69  ? 8.237   -54.233 -1.285  1.00 68.55 ? 86  ARG A CB  1 
ATOM 569  C CG  . ARG A 1 69  ? 8.063   -52.886 -1.972  1.00 71.15 ? 86  ARG A CG  1 
ATOM 570  C CD  . ARG A 1 69  ? 9.149   -51.898 -1.506  1.00 76.23 ? 86  ARG A CD  1 
ATOM 571  N NE  . ARG A 1 69  ? 9.089   -50.573 -2.147  1.00 78.91 ? 86  ARG A NE  1 
ATOM 572  C CZ  . ARG A 1 69  ? 8.075   -49.710 -2.031  1.00 80.61 ? 86  ARG A CZ  1 
ATOM 573  N NH1 . ARG A 1 69  ? 6.997   -50.026 -1.324  1.00 82.09 ? 86  ARG A NH1 1 
ATOM 574  N NH2 . ARG A 1 69  ? 8.125   -48.531 -2.637  1.00 81.04 ? 86  ARG A NH2 1 
ATOM 575  N N   . LEU A 1 70  ? 7.605   -57.177 -1.917  1.00 69.80 ? 87  LEU A N   1 
ATOM 576  C CA  . LEU A 1 70  ? 8.010   -58.568 -1.807  1.00 70.46 ? 87  LEU A CA  1 
ATOM 577  C C   . LEU A 1 70  ? 9.456   -58.596 -2.199  1.00 71.10 ? 87  LEU A C   1 
ATOM 578  O O   . LEU A 1 70  ? 9.839   -57.953 -3.178  1.00 71.28 ? 87  LEU A O   1 
ATOM 579  C CB  . LEU A 1 70  ? 7.198   -59.435 -2.774  1.00 70.37 ? 87  LEU A CB  1 
ATOM 580  C CG  . LEU A 1 70  ? 7.266   -60.966 -2.771  1.00 70.17 ? 87  LEU A CG  1 
ATOM 581  C CD1 . LEU A 1 70  ? 6.847   -61.597 -1.444  1.00 69.95 ? 87  LEU A CD1 1 
ATOM 582  C CD2 . LEU A 1 70  ? 6.375   -61.471 -3.871  1.00 70.39 ? 87  LEU A CD2 1 
ATOM 583  N N   . LEU A 1 71  ? 10.264  -59.317 -1.433  1.00 71.81 ? 88  LEU A N   1 
ATOM 584  C CA  . LEU A 1 71  ? 11.645  -59.545 -1.821  1.00 73.07 ? 88  LEU A CA  1 
ATOM 585  C C   . LEU A 1 71  ? 11.679  -60.241 -3.183  1.00 73.85 ? 88  LEU A C   1 
ATOM 586  O O   . LEU A 1 71  ? 10.646  -60.708 -3.686  1.00 74.57 ? 88  LEU A O   1 
ATOM 587  C CB  . LEU A 1 71  ? 12.315  -60.445 -0.811  1.00 73.03 ? 88  LEU A CB  1 
ATOM 588  C CG  . LEU A 1 71  ? 12.214  -61.967 -1.007  1.00 74.24 ? 88  LEU A CG  1 
ATOM 589  C CD1 . LEU A 1 71  ? 12.823  -62.498 0.243   1.00 76.30 ? 88  LEU A CD1 1 
ATOM 590  C CD2 . LEU A 1 71  ? 10.804  -62.609 -1.205  1.00 72.76 ? 88  LEU A CD2 1 
ATOM 591  N N   . LYS A 1 72  ? 12.854  -60.334 -3.785  1.00 73.93 ? 89  LYS A N   1 
ATOM 592  C CA  . LYS A 1 72  ? 12.942  -61.052 -5.042  1.00 73.65 ? 89  LYS A CA  1 
ATOM 593  C C   . LYS A 1 72  ? 14.024  -62.087 -4.896  1.00 73.44 ? 89  LYS A C   1 
ATOM 594  O O   . LYS A 1 72  ? 13.969  -63.145 -5.515  1.00 73.34 ? 89  LYS A O   1 
ATOM 595  C CB  . LYS A 1 72  ? 13.205  -60.085 -6.194  1.00 73.77 ? 89  LYS A CB  1 
ATOM 596  C CG  . LYS A 1 72  ? 11.962  -59.274 -6.590  1.00 73.46 ? 89  LYS A CG  1 
ATOM 597  C CD  . LYS A 1 72  ? 12.163  -58.628 -7.952  1.00 72.92 ? 89  LYS A CD  1 
ATOM 598  C CE  . LYS A 1 72  ? 10.889  -58.670 -8.767  1.00 71.38 ? 89  LYS A CE  1 
ATOM 599  N NZ  . LYS A 1 72  ? 11.184  -58.575 -10.215 1.00 70.91 ? 89  LYS A NZ  1 
ATOM 600  N N   . ASP A 1 73  ? 14.973  -61.763 -4.024  1.00 73.04 ? 90  ASP A N   1 
ATOM 601  C CA  . ASP A 1 73  ? 16.103  -62.613 -3.698  1.00 73.04 ? 90  ASP A CA  1 
ATOM 602  C C   . ASP A 1 73  ? 15.714  -63.911 -2.975  1.00 72.67 ? 90  ASP A C   1 
ATOM 603  O O   . ASP A 1 73  ? 16.025  -65.002 -3.468  1.00 73.05 ? 90  ASP A O   1 
ATOM 604  C CB  . ASP A 1 73  ? 17.202  -61.834 -2.931  1.00 73.26 ? 90  ASP A CB  1 
ATOM 605  C CG  . ASP A 1 73  ? 16.690  -60.517 -2.286  1.00 74.63 ? 90  ASP A CG  1 
ATOM 606  O OD1 . ASP A 1 73  ? 17.062  -60.253 -1.119  1.00 73.47 ? 90  ASP A OD1 1 
ATOM 607  O OD2 . ASP A 1 73  ? 15.933  -59.741 -2.940  1.00 76.28 ? 90  ASP A OD2 1 
ATOM 608  N N   . GLN A 1 74  ? 15.025  -63.812 -1.838  1.00 72.02 ? 91  GLN A N   1 
ATOM 609  C CA  . GLN A 1 74  ? 14.727  -65.011 -1.020  1.00 71.59 ? 91  GLN A CA  1 
ATOM 610  C C   . GLN A 1 74  ? 13.653  -65.973 -1.570  1.00 71.00 ? 91  GLN A C   1 
ATOM 611  O O   . GLN A 1 74  ? 13.562  -67.116 -1.123  1.00 70.62 ? 91  GLN A O   1 
ATOM 612  C CB  . GLN A 1 74  ? 14.444  -64.654 0.447   1.00 71.82 ? 91  GLN A CB  1 
ATOM 613  C CG  . GLN A 1 74  ? 15.609  -63.976 1.190   1.00 73.34 ? 91  GLN A CG  1 
ATOM 614  C CD  . GLN A 1 74  ? 15.812  -64.549 2.588   1.00 75.18 ? 91  GLN A CD  1 
ATOM 615  O OE1 . GLN A 1 74  ? 14.860  -64.717 3.356   1.00 73.73 ? 91  GLN A OE1 1 
ATOM 616  N NE2 . GLN A 1 74  ? 17.066  -64.873 2.915   1.00 77.92 ? 91  GLN A NE2 1 
ATOM 617  N N   . LEU A 1 75  ? 12.836  -65.525 -2.522  1.00 70.37 ? 92  LEU A N   1 
ATOM 618  C CA  . LEU A 1 75  ? 12.132  -66.474 -3.371  1.00 69.96 ? 92  LEU A CA  1 
ATOM 619  C C   . LEU A 1 75  ? 13.143  -67.540 -3.801  1.00 70.13 ? 92  LEU A C   1 
ATOM 620  O O   . LEU A 1 75  ? 12.928  -68.745 -3.587  1.00 69.92 ? 92  LEU A O   1 
ATOM 621  C CB  . LEU A 1 75  ? 11.596  -65.804 -4.644  1.00 69.93 ? 92  LEU A CB  1 
ATOM 622  C CG  . LEU A 1 75  ? 10.149  -65.352 -4.870  1.00 68.65 ? 92  LEU A CG  1 
ATOM 623  C CD1 . LEU A 1 75  ? 9.201   -65.744 -3.732  1.00 66.70 ? 92  LEU A CD1 1 
ATOM 624  C CD2 . LEU A 1 75  ? 10.143  -63.855 -5.113  1.00 67.90 ? 92  LEU A CD2 1 
ATOM 625  N N   . SER A 1 76  ? 14.251  -67.065 -4.387  1.00 69.86 ? 93  SER A N   1 
ATOM 626  C CA  . SER A 1 76  ? 15.293  -67.911 -4.962  1.00 69.82 ? 93  SER A CA  1 
ATOM 627  C C   . SER A 1 76  ? 15.800  -69.016 -4.038  1.00 70.12 ? 93  SER A C   1 
ATOM 628  O O   . SER A 1 76  ? 16.357  -70.007 -4.507  1.00 70.45 ? 93  SER A O   1 
ATOM 629  C CB  . SER A 1 76  ? 16.456  -67.060 -5.481  1.00 69.46 ? 93  SER A CB  1 
ATOM 630  O OG  . SER A 1 76  ? 16.120  -66.488 -6.730  1.00 68.67 ? 93  SER A OG  1 
ATOM 631  N N   . LEU A 1 77  ? 15.600  -68.848 -2.734  1.00 70.31 ? 94  LEU A N   1 
ATOM 632  C CA  . LEU A 1 77  ? 16.045  -69.835 -1.756  1.00 70.15 ? 94  LEU A CA  1 
ATOM 633  C C   . LEU A 1 77  ? 14.874  -70.510 -1.065  1.00 69.75 ? 94  LEU A C   1 
ATOM 634  O O   . LEU A 1 77  ? 15.030  -71.048 0.027   1.00 69.52 ? 94  LEU A O   1 
ATOM 635  C CB  . LEU A 1 77  ? 16.928  -69.174 -0.698  1.00 70.59 ? 94  LEU A CB  1 
ATOM 636  C CG  . LEU A 1 77  ? 18.109  -68.270 -1.079  1.00 71.38 ? 94  LEU A CG  1 
ATOM 637  C CD1 . LEU A 1 77  ? 18.526  -67.397 0.124   1.00 71.51 ? 94  LEU A CD1 1 
ATOM 638  C CD2 . LEU A 1 77  ? 19.294  -69.088 -1.589  1.00 72.29 ? 94  LEU A CD2 1 
ATOM 639  N N   . GLY A 1 78  ? 13.705  -70.467 -1.704  1.00 69.74 ? 95  GLY A N   1 
ATOM 640  C CA  . GLY A 1 78  ? 12.480  -71.071 -1.170  1.00 69.22 ? 95  GLY A CA  1 
ATOM 641  C C   . GLY A 1 78  ? 11.909  -70.349 0.043   1.00 68.81 ? 95  GLY A C   1 
ATOM 642  O O   . GLY A 1 78  ? 11.326  -70.986 0.929   1.00 68.92 ? 95  GLY A O   1 
ATOM 643  N N   . ASN A 1 79  ? 12.065  -69.021 0.074   1.00 68.00 ? 96  ASN A N   1 
ATOM 644  C CA  . ASN A 1 79  ? 11.619  -68.183 1.204   1.00 66.96 ? 96  ASN A CA  1 
ATOM 645  C C   . ASN A 1 79  ? 10.803  -66.988 0.678   1.00 65.72 ? 96  ASN A C   1 
ATOM 646  O O   . ASN A 1 79  ? 11.344  -66.089 0.026   1.00 65.72 ? 96  ASN A O   1 
ATOM 647  C CB  . ASN A 1 79  ? 12.835  -67.733 2.056   1.00 67.17 ? 96  ASN A CB  1 
ATOM 648  C CG  . ASN A 1 79  ? 12.443  -66.921 3.319   1.00 68.22 ? 96  ASN A CG  1 
ATOM 649  O OD1 . ASN A 1 79  ? 12.759  -67.315 4.453   1.00 67.95 ? 96  ASN A OD1 1 
ATOM 650  N ND2 . ASN A 1 79  ? 11.785  -65.775 3.117   1.00 68.38 ? 96  ASN A ND2 1 
ATOM 651  N N   . ALA A 1 80  ? 9.495   -67.001 0.944   1.00 64.10 ? 97  ALA A N   1 
ATOM 652  C CA  . ALA A 1 80  ? 8.603   -65.895 0.543   1.00 62.60 ? 97  ALA A CA  1 
ATOM 653  C C   . ALA A 1 80  ? 8.571   -64.853 1.663   1.00 61.16 ? 97  ALA A C   1 
ATOM 654  O O   . ALA A 1 80  ? 8.091   -65.123 2.766   1.00 60.78 ? 97  ALA A O   1 
ATOM 655  C CB  . ALA A 1 80  ? 7.196   -66.416 0.232   1.00 62.30 ? 97  ALA A CB  1 
ATOM 656  N N   . ALA A 1 81  ? 9.124   -63.682 1.393   1.00 59.51 ? 98  ALA A N   1 
ATOM 657  C CA  . ALA A 1 81  ? 9.312   -62.710 2.465   1.00 58.41 ? 98  ALA A CA  1 
ATOM 658  C C   . ALA A 1 81  ? 8.610   -61.370 2.197   1.00 57.50 ? 98  ALA A C   1 
ATOM 659  O O   . ALA A 1 81  ? 8.948   -60.632 1.257   1.00 56.91 ? 98  ALA A O   1 
ATOM 660  C CB  . ALA A 1 81  ? 10.785  -62.526 2.780   1.00 58.00 ? 98  ALA A CB  1 
ATOM 661  N N   . LEU A 1 82  ? 7.607   -61.095 3.028   1.00 56.34 ? 99  LEU A N   1 
ATOM 662  C CA  . LEU A 1 82  ? 6.773   -59.917 2.869   1.00 55.64 ? 99  LEU A CA  1 
ATOM 663  C C   . LEU A 1 82  ? 7.345   -58.814 3.734   1.00 55.09 ? 99  LEU A C   1 
ATOM 664  O O   . LEU A 1 82  ? 7.526   -58.986 4.934   1.00 54.54 ? 99  LEU A O   1 
ATOM 665  C CB  . LEU A 1 82  ? 5.316   -60.223 3.275   1.00 55.95 ? 99  LEU A CB  1 
ATOM 666  C CG  . LEU A 1 82  ? 4.353   -59.038 3.309   1.00 54.72 ? 99  LEU A CG  1 
ATOM 667  C CD1 . LEU A 1 82  ? 4.348   -58.397 1.953   1.00 54.77 ? 99  LEU A CD1 1 
ATOM 668  C CD2 . LEU A 1 82  ? 2.949   -59.403 3.759   1.00 54.74 ? 99  LEU A CD2 1 
ATOM 669  N N   . GLN A 1 83  ? 7.632   -57.680 3.133   1.00 54.69 ? 100 GLN A N   1 
ATOM 670  C CA  . GLN A 1 83  ? 8.211   -56.616 3.925   1.00 55.09 ? 100 GLN A CA  1 
ATOM 671  C C   . GLN A 1 83  ? 7.274   -55.424 3.982   1.00 54.90 ? 100 GLN A C   1 
ATOM 672  O O   . GLN A 1 83  ? 6.813   -54.943 2.934   1.00 55.25 ? 100 GLN A O   1 
ATOM 673  C CB  . GLN A 1 83  ? 9.567   -56.215 3.383   1.00 54.99 ? 100 GLN A CB  1 
ATOM 674  C CG  . GLN A 1 83  ? 10.426  -55.550 4.402   1.00 54.88 ? 100 GLN A CG  1 
ATOM 675  C CD  . GLN A 1 83  ? 11.317  -54.511 3.786   1.00 55.84 ? 100 GLN A CD  1 
ATOM 676  O OE1 . GLN A 1 83  ? 10.842  -53.481 3.267   1.00 56.39 ? 100 GLN A OE1 1 
ATOM 677  N NE2 . GLN A 1 83  ? 12.622  -54.771 3.819   1.00 55.38 ? 100 GLN A NE2 1 
ATOM 678  N N   . ILE A 1 84  ? 6.968   -54.969 5.195   1.00 54.05 ? 101 ILE A N   1 
ATOM 679  C CA  . ILE A 1 84  ? 6.038   -53.852 5.331   1.00 53.72 ? 101 ILE A CA  1 
ATOM 680  C C   . ILE A 1 84  ? 6.729   -52.715 6.076   1.00 54.51 ? 101 ILE A C   1 
ATOM 681  O O   . ILE A 1 84  ? 7.260   -52.895 7.189   1.00 54.41 ? 101 ILE A O   1 
ATOM 682  C CB  . ILE A 1 84  ? 4.686   -54.284 5.946   1.00 53.22 ? 101 ILE A CB  1 
ATOM 683  C CG1 . ILE A 1 84  ? 3.933   -55.196 4.959   1.00 51.69 ? 101 ILE A CG1 1 
ATOM 684  C CG2 . ILE A 1 84  ? 3.862   -53.089 6.308   1.00 51.77 ? 101 ILE A CG2 1 
ATOM 685  C CD1 . ILE A 1 84  ? 2.644   -55.764 5.481   1.00 49.10 ? 101 ILE A CD1 1 
ATOM 686  N N   . THR A 1 85  ? 6.772   -51.561 5.411   1.00 54.79 ? 102 THR A N   1 
ATOM 687  C CA  . THR A 1 85  ? 7.514   -50.407 5.904   1.00 55.44 ? 102 THR A CA  1 
ATOM 688  C C   . THR A 1 85  ? 6.644   -49.573 6.800   1.00 55.59 ? 102 THR A C   1 
ATOM 689  O O   . THR A 1 85  ? 5.432   -49.475 6.552   1.00 56.03 ? 102 THR A O   1 
ATOM 690  C CB  . THR A 1 85  ? 7.878   -49.463 4.780   1.00 55.36 ? 102 THR A CB  1 
ATOM 691  O OG1 . THR A 1 85  ? 6.672   -49.085 4.100   1.00 56.26 ? 102 THR A OG1 1 
ATOM 692  C CG2 . THR A 1 85  ? 8.843   -50.105 3.823   1.00 55.65 ? 102 THR A CG2 1 
ATOM 693  N N   . ASP A 1 86  ? 7.267   -48.933 7.796   1.00 55.61 ? 103 ASP A N   1 
ATOM 694  C CA  . ASP A 1 86  ? 6.570   -48.019 8.712   1.00 55.73 ? 103 ASP A CA  1 
ATOM 695  C C   . ASP A 1 86  ? 5.313   -48.704 9.251   1.00 55.13 ? 103 ASP A C   1 
ATOM 696  O O   . ASP A 1 86  ? 4.205   -48.450 8.781   1.00 55.42 ? 103 ASP A O   1 
ATOM 697  C CB  . ASP A 1 86  ? 6.229   -46.685 8.002   1.00 55.86 ? 103 ASP A CB  1 
ATOM 698  C CG  . ASP A 1 86  ? 5.652   -45.603 8.952   1.00 57.13 ? 103 ASP A CG  1 
ATOM 699  O OD1 . ASP A 1 86  ? 5.680   -45.726 10.218  1.00 55.75 ? 103 ASP A OD1 1 
ATOM 700  O OD2 . ASP A 1 86  ? 5.178   -44.593 8.391   1.00 57.56 ? 103 ASP A OD2 1 
ATOM 701  N N   . VAL A 1 87  ? 5.498   -49.572 10.232  1.00 54.51 ? 104 VAL A N   1 
ATOM 702  C CA  . VAL A 1 87  ? 4.411   -50.365 10.790  1.00 54.30 ? 104 VAL A CA  1 
ATOM 703  C C   . VAL A 1 87  ? 3.451   -49.516 11.622  1.00 54.26 ? 104 VAL A C   1 
ATOM 704  O O   . VAL A 1 87  ? 3.879   -48.723 12.445  1.00 54.65 ? 104 VAL A O   1 
ATOM 705  C CB  . VAL A 1 87  ? 5.005   -51.531 11.602  1.00 54.20 ? 104 VAL A CB  1 
ATOM 706  C CG1 . VAL A 1 87  ? 3.960   -52.234 12.459  1.00 54.43 ? 104 VAL A CG1 1 
ATOM 707  C CG2 . VAL A 1 87  ? 5.692   -52.502 10.660  1.00 53.60 ? 104 VAL A CG2 1 
ATOM 708  N N   . LYS A 1 88  ? 2.155   -49.664 11.376  1.00 54.65 ? 105 LYS A N   1 
ATOM 709  C CA  . LYS A 1 88  ? 1.124   -48.995 12.166  1.00 55.11 ? 105 LYS A CA  1 
ATOM 710  C C   . LYS A 1 88  ? 0.497   -49.965 13.138  1.00 55.08 ? 105 LYS A C   1 
ATOM 711  O O   . LYS A 1 88  ? 0.736   -51.164 13.081  1.00 55.25 ? 105 LYS A O   1 
ATOM 712  C CB  . LYS A 1 88  ? 0.033   -48.436 11.266  1.00 56.14 ? 105 LYS A CB  1 
ATOM 713  C CG  . LYS A 1 88  ? 0.344   -47.068 10.666  1.00 58.41 ? 105 LYS A CG  1 
ATOM 714  C CD  . LYS A 1 88  ? 0.645   -46.006 11.759  1.00 61.72 ? 105 LYS A CD  1 
ATOM 715  C CE  . LYS A 1 88  ? 0.910   -44.623 11.151  1.00 61.48 ? 105 LYS A CE  1 
ATOM 716  N NZ  . LYS A 1 88  ? 2.128   -44.609 10.251  1.00 65.02 ? 105 LYS A NZ  1 
ATOM 717  N N   . LEU A 1 89  ? -0.323  -49.441 14.035  1.00 55.25 ? 106 LEU A N   1 
ATOM 718  C CA  . LEU A 1 89  ? -0.958  -50.251 15.060  1.00 54.97 ? 106 LEU A CA  1 
ATOM 719  C C   . LEU A 1 89  ? -1.967  -51.198 14.398  1.00 54.75 ? 106 LEU A C   1 
ATOM 720  O O   . LEU A 1 89  ? -2.080  -52.367 14.770  1.00 54.22 ? 106 LEU A O   1 
ATOM 721  C CB  . LEU A 1 89  ? -1.621  -49.341 16.099  1.00 54.63 ? 106 LEU A CB  1 
ATOM 722  C CG  . LEU A 1 89  ? -1.626  -49.928 17.514  1.00 56.04 ? 106 LEU A CG  1 
ATOM 723  C CD1 . LEU A 1 89  ? -0.188  -50.096 18.080  1.00 56.75 ? 106 LEU A CD1 1 
ATOM 724  C CD2 . LEU A 1 89  ? -2.521  -49.162 18.498  1.00 55.37 ? 106 LEU A CD2 1 
ATOM 725  N N   . GLN A 1 90  ? -2.664  -50.678 13.392  1.00 54.70 ? 107 GLN A N   1 
ATOM 726  C CA  . GLN A 1 90  ? -3.588  -51.459 12.561  1.00 55.37 ? 107 GLN A CA  1 
ATOM 727  C C   . GLN A 1 90  ? -2.949  -52.738 11.998  1.00 54.95 ? 107 GLN A C   1 
ATOM 728  O O   . GLN A 1 90  ? -3.582  -53.791 11.975  1.00 55.09 ? 107 GLN A O   1 
ATOM 729  C CB  . GLN A 1 90  ? -4.145  -50.602 11.408  1.00 55.58 ? 107 GLN A CB  1 
ATOM 730  C CG  . GLN A 1 90  ? -4.928  -49.343 11.838  1.00 57.45 ? 107 GLN A CG  1 
ATOM 731  C CD  . GLN A 1 90  ? -4.039  -48.125 12.268  1.00 60.57 ? 107 GLN A CD  1 
ATOM 732  O OE1 . GLN A 1 90  ? -4.554  -47.156 12.856  1.00 62.54 ? 107 GLN A OE1 1 
ATOM 733  N NE2 . GLN A 1 90  ? -2.733  -48.174 11.973  1.00 57.79 ? 107 GLN A NE2 1 
ATOM 734  N N   . ASP A 1 91  ? -1.691  -52.631 11.571  1.00 54.55 ? 108 ASP A N   1 
ATOM 735  C CA  . ASP A 1 91  ? -0.916  -53.752 11.039  1.00 54.22 ? 108 ASP A CA  1 
ATOM 736  C C   . ASP A 1 91  ? -0.868  -55.023 11.912  1.00 54.00 ? 108 ASP A C   1 
ATOM 737  O O   . ASP A 1 91  ? -0.394  -56.072 11.460  1.00 53.62 ? 108 ASP A O   1 
ATOM 738  C CB  . ASP A 1 91  ? 0.503   -53.296 10.684  1.00 54.19 ? 108 ASP A CB  1 
ATOM 739  C CG  . ASP A 1 91  ? 0.532   -52.276 9.554   1.00 55.62 ? 108 ASP A CG  1 
ATOM 740  O OD1 . ASP A 1 91  ? -0.455  -52.182 8.793   1.00 57.44 ? 108 ASP A OD1 1 
ATOM 741  O OD2 . ASP A 1 91  ? 1.556   -51.571 9.405   1.00 56.67 ? 108 ASP A OD2 1 
ATOM 742  N N   . ALA A 1 92  ? -1.345  -54.940 13.154  1.00 54.25 ? 109 ALA A N   1 
ATOM 743  C CA  . ALA A 1 92  ? -1.460  -56.138 14.004  1.00 54.26 ? 109 ALA A CA  1 
ATOM 744  C C   . ALA A 1 92  ? -2.636  -56.997 13.496  1.00 54.42 ? 109 ALA A C   1 
ATOM 745  O O   . ALA A 1 92  ? -3.586  -56.476 12.858  1.00 54.46 ? 109 ALA A O   1 
ATOM 746  C CB  . ALA A 1 92  ? -1.631  -55.763 15.469  1.00 54.09 ? 109 ALA A CB  1 
ATOM 747  N N   . GLY A 1 93  ? -2.564  -58.305 13.727  1.00 53.77 ? 110 GLY A N   1 
ATOM 748  C CA  . GLY A 1 93  ? -3.521  -59.203 13.090  1.00 53.48 ? 110 GLY A CA  1 
ATOM 749  C C   . GLY A 1 93  ? -2.875  -60.411 12.440  1.00 53.54 ? 110 GLY A C   1 
ATOM 750  O O   . GLY A 1 93  ? -1.664  -60.693 12.642  1.00 52.57 ? 110 GLY A O   1 
ATOM 751  N N   . VAL A 1 94  ? -3.696  -61.122 11.656  1.00 53.76 ? 111 VAL A N   1 
ATOM 752  C CA  . VAL A 1 94  ? -3.323  -62.435 11.099  1.00 53.60 ? 111 VAL A CA  1 
ATOM 753  C C   . VAL A 1 94  ? -3.107  -62.393 9.573   1.00 53.37 ? 111 VAL A C   1 
ATOM 754  O O   . VAL A 1 94  ? -3.981  -61.947 8.798   1.00 53.35 ? 111 VAL A O   1 
ATOM 755  C CB  . VAL A 1 94  ? -4.372  -63.541 11.486  1.00 54.20 ? 111 VAL A CB  1 
ATOM 756  C CG1 . VAL A 1 94  ? -3.699  -64.928 11.615  1.00 54.07 ? 111 VAL A CG1 1 
ATOM 757  C CG2 . VAL A 1 94  ? -5.144  -63.186 12.779  1.00 53.87 ? 111 VAL A CG2 1 
ATOM 758  N N   . TYR A 1 95  ? -1.940  -62.865 9.143   1.00 53.05 ? 112 TYR A N   1 
ATOM 759  C CA  . TYR A 1 95  ? -1.540  -62.746 7.732   1.00 52.97 ? 112 TYR A CA  1 
ATOM 760  C C   . TYR A 1 95  ? -1.486  -64.121 7.105   1.00 53.48 ? 112 TYR A C   1 
ATOM 761  O O   . TYR A 1 95  ? -0.794  -65.003 7.606   1.00 53.70 ? 112 TYR A O   1 
ATOM 762  C CB  . TYR A 1 95  ? -0.163  -62.074 7.585   1.00 52.06 ? 112 TYR A CB  1 
ATOM 763  C CG  . TYR A 1 95  ? -0.107  -60.596 7.946   1.00 51.30 ? 112 TYR A CG  1 
ATOM 764  C CD1 . TYR A 1 95  ? -0.303  -60.161 9.252   1.00 49.44 ? 112 TYR A CD1 1 
ATOM 765  C CD2 . TYR A 1 95  ? 0.178   -59.640 6.981   1.00 52.79 ? 112 TYR A CD2 1 
ATOM 766  C CE1 . TYR A 1 95  ? -0.256  -58.825 9.587   1.00 49.34 ? 112 TYR A CE1 1 
ATOM 767  C CE2 . TYR A 1 95  ? 0.231   -58.286 7.308   1.00 53.08 ? 112 TYR A CE2 1 
ATOM 768  C CZ  . TYR A 1 95  ? 0.023   -57.887 8.623   1.00 51.06 ? 112 TYR A CZ  1 
ATOM 769  O OH  . TYR A 1 95  ? 0.086   -56.553 8.945   1.00 49.27 ? 112 TYR A OH  1 
ATOM 770  N N   . ARG A 1 96  ? -2.230  -64.308 6.022   1.00 54.04 ? 113 ARG A N   1 
ATOM 771  C CA  . ARG A 1 96  ? -2.172  -65.541 5.265   1.00 55.17 ? 113 ARG A CA  1 
ATOM 772  C C   . ARG A 1 96  ? -1.176  -65.400 4.118   1.00 55.72 ? 113 ARG A C   1 
ATOM 773  O O   . ARG A 1 96  ? -1.237  -64.409 3.377   1.00 56.15 ? 113 ARG A O   1 
ATOM 774  C CB  . ARG A 1 96  ? -3.567  -65.925 4.734   1.00 54.99 ? 113 ARG A CB  1 
ATOM 775  C CG  . ARG A 1 96  ? -3.684  -67.399 4.270   1.00 54.92 ? 113 ARG A CG  1 
ATOM 776  C CD  . ARG A 1 96  ? -5.114  -67.747 3.907   1.00 55.56 ? 113 ARG A CD  1 
ATOM 777  N NE  . ARG A 1 96  ? -5.470  -67.091 2.653   1.00 58.40 ? 113 ARG A NE  1 
ATOM 778  C CZ  . ARG A 1 96  ? -5.725  -67.714 1.503   1.00 58.34 ? 113 ARG A CZ  1 
ATOM 779  N NH1 . ARG A 1 96  ? -5.734  -69.044 1.421   1.00 58.92 ? 113 ARG A NH1 1 
ATOM 780  N NH2 . ARG A 1 96  ? -6.005  -66.996 0.430   1.00 57.67 ? 113 ARG A NH2 1 
ATOM 781  N N   . CYS A 1 97  ? -0.263  -66.363 3.982   1.00 56.09 ? 114 CYS A N   1 
ATOM 782  C CA  . CYS A 1 97  ? 0.515   -66.483 2.741   1.00 57.57 ? 114 CYS A CA  1 
ATOM 783  C C   . CYS A 1 97  ? 0.020   -67.635 1.897   1.00 58.01 ? 114 CYS A C   1 
ATOM 784  O O   . CYS A 1 97  ? -0.359  -68.680 2.411   1.00 58.34 ? 114 CYS A O   1 
ATOM 785  C CB  . CYS A 1 97  ? 1.999   -66.713 3.011   1.00 57.85 ? 114 CYS A CB  1 
ATOM 786  S SG  . CYS A 1 97  ? 2.397   -68.331 3.681   1.00 58.80 ? 114 CYS A SG  1 
ATOM 787  N N   . MET A 1 98  ? 0.057   -67.455 0.594   1.00 58.73 ? 115 MET A N   1 
ATOM 788  C CA  . MET A 1 98  ? -0.369  -68.504 -0.306  1.00 59.82 ? 115 MET A CA  1 
ATOM 789  C C   . MET A 1 98  ? 0.660   -68.635 -1.433  1.00 60.36 ? 115 MET A C   1 
ATOM 790  O O   . MET A 1 98  ? 0.893   -67.701 -2.225  1.00 59.77 ? 115 MET A O   1 
ATOM 791  C CB  . MET A 1 98  ? -1.793  -68.250 -0.826  1.00 60.09 ? 115 MET A CB  1 
ATOM 792  C CG  . MET A 1 98  ? -2.709  -69.495 -0.884  1.00 61.19 ? 115 MET A CG  1 
ATOM 793  S SD  . MET A 1 98  ? -2.775  -70.363 -2.475  1.00 65.12 ? 115 MET A SD  1 
ATOM 794  C CE  . MET A 1 98  ? -4.148  -69.625 -3.366  1.00 61.99 ? 115 MET A CE  1 
ATOM 795  N N   . ILE A 1 99  ? 1.304   -69.798 -1.448  1.00 61.15 ? 116 ILE A N   1 
ATOM 796  C CA  . ILE A 1 99  ? 2.289   -70.123 -2.458  1.00 62.07 ? 116 ILE A CA  1 
ATOM 797  C C   . ILE A 1 99  ? 1.772   -71.308 -3.221  1.00 62.41 ? 116 ILE A C   1 
ATOM 798  O O   . ILE A 1 99  ? 1.195   -72.251 -2.634  1.00 62.79 ? 116 ILE A O   1 
ATOM 799  C CB  . ILE A 1 99  ? 3.657   -70.484 -1.836  1.00 62.25 ? 116 ILE A CB  1 
ATOM 800  C CG1 . ILE A 1 99  ? 4.239   -69.262 -1.124  1.00 62.63 ? 116 ILE A CG1 1 
ATOM 801  C CG2 . ILE A 1 99  ? 4.639   -71.009 -2.909  1.00 61.61 ? 116 ILE A CG2 1 
ATOM 802  C CD1 . ILE A 1 99  ? 4.977   -69.606 0.133   1.00 63.80 ? 116 ILE A CD1 1 
ATOM 803  N N   . SER A 1 100 ? 1.978   -71.252 -4.528  1.00 62.56 ? 117 SER A N   1 
ATOM 804  C CA  . SER A 1 100 ? 1.677   -72.383 -5.386  1.00 62.99 ? 117 SER A CA  1 
ATOM 805  C C   . SER A 1 100 ? 2.765   -72.604 -6.435  1.00 63.23 ? 117 SER A C   1 
ATOM 806  O O   . SER A 1 100 ? 2.736   -72.040 -7.534  1.00 63.21 ? 117 SER A O   1 
ATOM 807  C CB  . SER A 1 100 ? 0.290   -72.261 -6.016  1.00 62.38 ? 117 SER A CB  1 
ATOM 808  O OG  . SER A 1 100 ? 0.292   -72.944 -7.240  1.00 62.52 ? 117 SER A OG  1 
ATOM 809  N N   . TYR A 1 101 ? 3.708   -73.455 -6.057  1.00 63.92 ? 118 TYR A N   1 
ATOM 810  C CA  . TYR A 1 101 ? 4.811   -73.896 -6.889  1.00 64.76 ? 118 TYR A CA  1 
ATOM 811  C C   . TYR A 1 101 ? 4.678   -75.424 -6.933  1.00 65.37 ? 118 TYR A C   1 
ATOM 812  O O   . TYR A 1 101 ? 5.124   -76.122 -6.000  1.00 65.69 ? 118 TYR A O   1 
ATOM 813  C CB  . TYR A 1 101 ? 6.114   -73.488 -6.193  1.00 64.83 ? 118 TYR A CB  1 
ATOM 814  C CG  . TYR A 1 101 ? 7.391   -73.630 -6.972  1.00 64.05 ? 118 TYR A CG  1 
ATOM 815  C CD1 . TYR A 1 101 ? 7.524   -73.074 -8.239  1.00 64.78 ? 118 TYR A CD1 1 
ATOM 816  C CD2 . TYR A 1 101 ? 8.504   -74.276 -6.403  1.00 65.13 ? 118 TYR A CD2 1 
ATOM 817  C CE1 . TYR A 1 101 ? 8.746   -73.185 -8.960  1.00 66.95 ? 118 TYR A CE1 1 
ATOM 818  C CE2 . TYR A 1 101 ? 9.732   -74.403 -7.100  1.00 65.65 ? 118 TYR A CE2 1 
ATOM 819  C CZ  . TYR A 1 101 ? 9.847   -73.857 -8.382  1.00 66.40 ? 118 TYR A CZ  1 
ATOM 820  O OH  . TYR A 1 101 ? 11.043  -73.961 -9.081  1.00 65.77 ? 118 TYR A OH  1 
ATOM 821  N N   . GLY A 1 102 ? 4.050   -75.948 -7.988  1.00 65.54 ? 119 GLY A N   1 
ATOM 822  C CA  . GLY A 1 102 ? 3.733   -77.388 -8.052  1.00 65.71 ? 119 GLY A CA  1 
ATOM 823  C C   . GLY A 1 102 ? 3.267   -77.991 -6.721  1.00 65.74 ? 119 GLY A C   1 
ATOM 824  O O   . GLY A 1 102 ? 3.866   -78.936 -6.201  1.00 65.83 ? 119 GLY A O   1 
ATOM 825  N N   . GLY A 1 103 ? 2.193   -77.435 -6.166  1.00 65.78 ? 120 GLY A N   1 
ATOM 826  C CA  . GLY A 1 103 ? 1.724   -77.824 -4.852  1.00 65.33 ? 120 GLY A CA  1 
ATOM 827  C C   . GLY A 1 103 ? 1.338   -76.547 -4.167  1.00 65.35 ? 120 GLY A C   1 
ATOM 828  O O   . GLY A 1 103 ? 2.166   -75.687 -3.950  1.00 65.49 ? 120 GLY A O   1 
ATOM 829  N N   . ALA A 1 104 ? 0.061   -76.403 -3.873  1.00 65.79 ? 121 ALA A N   1 
ATOM 830  C CA  . ALA A 1 104 ? -0.411  -75.256 -3.125  1.00 66.09 ? 121 ALA A CA  1 
ATOM 831  C C   . ALA A 1 104 ? -0.443  -75.597 -1.640  1.00 66.50 ? 121 ALA A C   1 
ATOM 832  O O   . ALA A 1 104 ? -0.914  -76.676 -1.227  1.00 66.27 ? 121 ALA A O   1 
ATOM 833  C CB  . ALA A 1 104 ? -1.787  -74.813 -3.613  1.00 65.69 ? 121 ALA A CB  1 
ATOM 834  N N   . ASP A 1 105 ? 0.107   -74.691 -0.839  1.00 66.68 ? 122 ASP A N   1 
ATOM 835  C CA  . ASP A 1 105 ? -0.189  -74.691 0.588   1.00 66.41 ? 122 ASP A CA  1 
ATOM 836  C C   . ASP A 1 105 ? -0.316  -73.249 1.074   1.00 66.37 ? 122 ASP A C   1 
ATOM 837  O O   . ASP A 1 105 ? -0.094  -72.294 0.300   1.00 66.26 ? 122 ASP A O   1 
ATOM 838  C CB  . ASP A 1 105 ? 0.854   -75.479 1.385   1.00 66.06 ? 122 ASP A CB  1 
ATOM 839  C CG  . ASP A 1 105 ? 0.321   -75.962 2.727   1.00 66.08 ? 122 ASP A CG  1 
ATOM 840  O OD1 . ASP A 1 105 ? 1.145   -76.304 3.603   1.00 65.82 ? 122 ASP A OD1 1 
ATOM 841  O OD2 . ASP A 1 105 ? -0.919  -76.013 2.909   1.00 64.86 ? 122 ASP A OD2 1 
ATOM 842  N N   . TYR A 1 106 ? -0.713  -73.110 2.336   1.00 66.13 ? 123 TYR A N   1 
ATOM 843  C CA  . TYR A 1 106 ? -0.795  -71.822 2.990   1.00 66.11 ? 123 TYR A CA  1 
ATOM 844  C C   . TYR A 1 106 ? -0.510  -71.906 4.486   1.00 65.43 ? 123 TYR A C   1 
ATOM 845  O O   . TYR A 1 106 ? -0.622  -72.980 5.072   1.00 65.41 ? 123 TYR A O   1 
ATOM 846  C CB  . TYR A 1 106 ? -2.148  -71.188 2.724   1.00 67.09 ? 123 TYR A CB  1 
ATOM 847  C CG  . TYR A 1 106 ? -3.358  -71.837 3.362   1.00 68.40 ? 123 TYR A CG  1 
ATOM 848  C CD1 . TYR A 1 106 ? -4.442  -72.246 2.572   1.00 68.14 ? 123 TYR A CD1 1 
ATOM 849  C CD2 . TYR A 1 106 ? -3.462  -71.956 4.759   1.00 69.26 ? 123 TYR A CD2 1 
ATOM 850  C CE1 . TYR A 1 106 ? -5.582  -72.800 3.154   1.00 69.83 ? 123 TYR A CE1 1 
ATOM 851  C CE2 . TYR A 1 106 ? -4.587  -72.509 5.356   1.00 69.79 ? 123 TYR A CE2 1 
ATOM 852  C CZ  . TYR A 1 106 ? -5.648  -72.938 4.552   1.00 69.95 ? 123 TYR A CZ  1 
ATOM 853  O OH  . TYR A 1 106 ? -6.770  -73.497 5.152   1.00 69.55 ? 123 TYR A OH  1 
ATOM 854  N N   . LYS A 1 107 ? -0.093  -70.789 5.087   1.00 64.46 ? 124 LYS A N   1 
ATOM 855  C CA  . LYS A 1 107 ? 0.129   -70.723 6.544   1.00 63.05 ? 124 LYS A CA  1 
ATOM 856  C C   . LYS A 1 107 ? -0.479  -69.434 7.095   1.00 62.05 ? 124 LYS A C   1 
ATOM 857  O O   . LYS A 1 107 ? -0.991  -68.613 6.349   1.00 62.62 ? 124 LYS A O   1 
ATOM 858  C CB  . LYS A 1 107 ? 1.615   -70.840 6.899   1.00 63.10 ? 124 LYS A CB  1 
ATOM 859  C CG  . LYS A 1 107 ? 2.195   -72.233 6.759   1.00 62.91 ? 124 LYS A CG  1 
ATOM 860  C CD  . LYS A 1 107 ? 2.028   -73.090 8.024   1.00 63.74 ? 124 LYS A CD  1 
ATOM 861  C CE  . LYS A 1 107 ? 2.110   -74.628 7.738   1.00 63.55 ? 124 LYS A CE  1 
ATOM 862  N NZ  . LYS A 1 107 ? 2.613   -75.483 8.889   1.00 62.20 ? 124 LYS A NZ  1 
ATOM 863  N N   . ARG A 1 108 ? -0.461  -69.267 8.399   1.00 60.39 ? 125 ARG A N   1 
ATOM 864  C CA  . ARG A 1 108 ? -1.101  -68.124 8.997   1.00 59.29 ? 125 ARG A CA  1 
ATOM 865  C C   . ARG A 1 108 ? -0.186  -67.624 10.107  1.00 57.81 ? 125 ARG A C   1 
ATOM 866  O O   . ARG A 1 108 ? -0.155  -68.212 11.177  1.00 57.35 ? 125 ARG A O   1 
ATOM 867  C CB  . ARG A 1 108 ? -2.490  -68.507 9.542   1.00 59.22 ? 125 ARG A CB  1 
ATOM 868  C CG  . ARG A 1 108 ? -3.577  -68.579 8.502   1.00 59.53 ? 125 ARG A CG  1 
ATOM 869  C CD  . ARG A 1 108 ? -4.956  -68.824 9.128   1.00 61.15 ? 125 ARG A CD  1 
ATOM 870  N NE  . ARG A 1 108 ? -6.012  -68.168 8.329   1.00 67.79 ? 125 ARG A NE  1 
ATOM 871  C CZ  . ARG A 1 108 ? -6.930  -67.299 8.799   1.00 69.11 ? 125 ARG A CZ  1 
ATOM 872  N NH1 . ARG A 1 108 ? -6.996  -66.985 10.094  1.00 69.41 ? 125 ARG A NH1 1 
ATOM 873  N NH2 . ARG A 1 108 ? -7.821  -66.754 7.974   1.00 68.99 ? 125 ARG A NH2 1 
ATOM 874  N N   . ILE A 1 109 ? 0.591   -66.570 9.819   1.00 56.63 ? 126 ILE A N   1 
ATOM 875  C CA  . ILE A 1 109 ? 1.444   -65.875 10.806  1.00 54.48 ? 126 ILE A CA  1 
ATOM 876  C C   . ILE A 1 109 ? 0.638   -64.814 11.544  1.00 53.82 ? 126 ILE A C   1 
ATOM 877  O O   . ILE A 1 109 ? 0.044   -63.923 10.918  1.00 54.42 ? 126 ILE A O   1 
ATOM 878  C CB  . ILE A 1 109 ? 2.618   -65.140 10.130  1.00 54.28 ? 126 ILE A CB  1 
ATOM 879  C CG1 . ILE A 1 109 ? 3.558   -66.128 9.433   1.00 52.61 ? 126 ILE A CG1 1 
ATOM 880  C CG2 . ILE A 1 109 ? 3.360   -64.293 11.165  1.00 53.36 ? 126 ILE A CG2 1 
ATOM 881  C CD1 . ILE A 1 109 ? 3.921   -65.772 8.021   1.00 48.89 ? 126 ILE A CD1 1 
ATOM 882  N N   . THR A 1 110 ? 0.605   -64.904 12.863  1.00 52.41 ? 127 THR A N   1 
ATOM 883  C CA  . THR A 1 110 ? -0.074  -63.906 13.671  1.00 51.77 ? 127 THR A CA  1 
ATOM 884  C C   . THR A 1 110 ? 0.947   -62.784 13.977  1.00 51.53 ? 127 THR A C   1 
ATOM 885  O O   . THR A 1 110 ? 2.150   -63.077 14.125  1.00 52.26 ? 127 THR A O   1 
ATOM 886  C CB  . THR A 1 110 ? -0.693  -64.561 14.917  1.00 51.45 ? 127 THR A CB  1 
ATOM 887  O OG1 . THR A 1 110 ? -1.263  -63.571 15.768  1.00 50.00 ? 127 THR A OG1 1 
ATOM 888  C CG2 . THR A 1 110 ? 0.355   -65.311 15.691  1.00 53.44 ? 127 THR A CG2 1 
ATOM 889  N N   . VAL A 1 111 ? 0.506   -61.515 13.996  1.00 50.26 ? 128 VAL A N   1 
ATOM 890  C CA  . VAL A 1 111 ? 1.437   -60.369 14.131  1.00 49.11 ? 128 VAL A CA  1 
ATOM 891  C C   . VAL A 1 111 ? 0.988   -59.305 15.127  1.00 49.05 ? 128 VAL A C   1 
ATOM 892  O O   . VAL A 1 111 ? 0.022   -58.569 14.879  1.00 50.00 ? 128 VAL A O   1 
ATOM 893  C CB  . VAL A 1 111 ? 1.705   -59.670 12.759  1.00 49.20 ? 128 VAL A CB  1 
ATOM 894  C CG1 . VAL A 1 111 ? 2.305   -58.261 12.948  1.00 48.18 ? 128 VAL A CG1 1 
ATOM 895  C CG2 . VAL A 1 111 ? 2.602   -60.517 11.869  1.00 47.47 ? 128 VAL A CG2 1 
ATOM 896  N N   . LYS A 1 112 ? 1.689   -59.197 16.246  1.00 48.36 ? 129 LYS A N   1 
ATOM 897  C CA  . LYS A 1 112 ? 1.410   -58.133 17.188  1.00 47.67 ? 129 LYS A CA  1 
ATOM 898  C C   . LYS A 1 112 ? 2.336   -56.926 17.003  1.00 46.80 ? 129 LYS A C   1 
ATOM 899  O O   . LYS A 1 112 ? 3.475   -57.039 16.557  1.00 46.73 ? 129 LYS A O   1 
ATOM 900  C CB  . LYS A 1 112 ? 1.412   -58.680 18.610  1.00 48.73 ? 129 LYS A CB  1 
ATOM 901  C CG  . LYS A 1 112 ? 0.137   -59.545 18.929  1.00 51.24 ? 129 LYS A CG  1 
ATOM 902  C CD  . LYS A 1 112 ? -1.125  -58.675 19.186  1.00 54.79 ? 129 LYS A CD  1 
ATOM 903  C CE  . LYS A 1 112 ? -2.407  -59.179 18.449  1.00 56.57 ? 129 LYS A CE  1 
ATOM 904  N NZ  . LYS A 1 112 ? -2.412  -59.079 16.922  1.00 55.46 ? 129 LYS A NZ  1 
ATOM 905  N N   . VAL A 1 113 ? 1.812   -55.745 17.274  1.00 45.75 ? 130 VAL A N   1 
ATOM 906  C CA  . VAL A 1 113 ? 2.600   -54.538 17.113  1.00 44.55 ? 130 VAL A CA  1 
ATOM 907  C C   . VAL A 1 113 ? 2.763   -53.957 18.486  1.00 43.62 ? 130 VAL A C   1 
ATOM 908  O O   . VAL A 1 113 ? 1.780   -53.794 19.222  1.00 43.28 ? 130 VAL A O   1 
ATOM 909  C CB  . VAL A 1 113 ? 1.878   -53.510 16.196  1.00 45.10 ? 130 VAL A CB  1 
ATOM 910  C CG1 . VAL A 1 113 ? 2.699   -52.230 16.039  1.00 44.59 ? 130 VAL A CG1 1 
ATOM 911  C CG2 . VAL A 1 113 ? 1.597   -54.124 14.830  1.00 44.56 ? 130 VAL A CG2 1 
ATOM 912  N N   . ASN A 1 114 ? 3.989   -53.664 18.876  1.00 42.56 ? 131 ASN A N   1 
ATOM 913  C CA  . ASN A 1 114 ? 4.124   -52.929 20.127  1.00 42.12 ? 131 ASN A CA  1 
ATOM 914  C C   . ASN A 1 114 ? 4.668   -51.514 19.929  1.00 41.57 ? 131 ASN A C   1 
ATOM 915  O O   . ASN A 1 114 ? 5.377   -51.225 18.957  1.00 42.30 ? 131 ASN A O   1 
ATOM 916  C CB  . ASN A 1 114 ? 4.818   -53.766 21.200  1.00 41.88 ? 131 ASN A CB  1 
ATOM 917  C CG  . ASN A 1 114 ? 6.217   -53.313 21.510  1.00 43.40 ? 131 ASN A CG  1 
ATOM 918  O OD1 . ASN A 1 114 ? 6.574   -53.133 22.696  1.00 43.28 ? 131 ASN A OD1 1 
ATOM 919  N ND2 . ASN A 1 114 ? 7.047   -53.166 20.467  1.00 43.79 ? 131 ASN A ND2 1 
ATOM 920  N N   . ALA A 1 115 ? 4.250   -50.604 20.794  1.00 40.73 ? 132 ALA A N   1 
ATOM 921  C CA  . ALA A 1 115 ? 4.798   -49.228 20.806  1.00 39.51 ? 132 ALA A CA  1 
ATOM 922  C C   . ALA A 1 115 ? 5.516   -49.012 22.143  1.00 38.59 ? 132 ALA A C   1 
ATOM 923  O O   . ALA A 1 115 ? 4.887   -48.608 23.141  1.00 38.52 ? 132 ALA A O   1 
ATOM 924  C CB  . ALA A 1 115 ? 3.690   -48.212 20.616  1.00 39.40 ? 132 ALA A CB  1 
ATOM 925  N N   . PRO A 1 116 ? 6.813   -49.355 22.186  1.00 37.44 ? 133 PRO A N   1 
ATOM 926  C CA  . PRO A 1 116 ? 7.589   -49.228 23.413  1.00 36.67 ? 133 PRO A CA  1 
ATOM 927  C C   . PRO A 1 116 ? 7.939   -47.780 23.659  1.00 36.23 ? 133 PRO A C   1 
ATOM 928  O O   . PRO A 1 116 ? 8.230   -47.033 22.706  1.00 35.45 ? 133 PRO A O   1 
ATOM 929  C CB  . PRO A 1 116 ? 8.879   -50.003 23.090  1.00 36.38 ? 133 PRO A CB  1 
ATOM 930  C CG  . PRO A 1 116 ? 9.042   -49.875 21.633  1.00 36.13 ? 133 PRO A CG  1 
ATOM 931  C CD  . PRO A 1 116 ? 7.628   -49.883 21.072  1.00 37.33 ? 133 PRO A CD  1 
ATOM 932  N N   . TYR A 1 117 ? 7.936   -47.397 24.930  1.00 36.73 ? 134 TYR A N   1 
ATOM 933  C CA  . TYR A 1 117 ? 8.472   -46.070 25.362  1.00 37.38 ? 134 TYR A CA  1 
ATOM 934  C C   . TYR A 1 117 ? 9.981   -45.935 25.200  1.00 37.60 ? 134 TYR A C   1 
ATOM 935  O O   . TYR A 1 117 ? 10.709  -45.678 26.152  1.00 37.59 ? 134 TYR A O   1 
ATOM 936  C CB  . TYR A 1 117 ? 8.044   -45.746 26.784  1.00 36.01 ? 134 TYR A CB  1 
ATOM 937  C CG  . TYR A 1 117 ? 6.553   -45.530 26.838  1.00 36.37 ? 134 TYR A CG  1 
ATOM 938  C CD1 . TYR A 1 117 ? 5.995   -44.248 26.737  1.00 35.07 ? 134 TYR A CD1 1 
ATOM 939  C CD2 . TYR A 1 117 ? 5.697   -46.613 26.943  1.00 34.02 ? 134 TYR A CD2 1 
ATOM 940  C CE1 . TYR A 1 117 ? 4.622   -44.087 26.765  1.00 35.30 ? 134 TYR A CE1 1 
ATOM 941  C CE2 . TYR A 1 117 ? 4.360   -46.452 26.957  1.00 34.81 ? 134 TYR A CE2 1 
ATOM 942  C CZ  . TYR A 1 117 ? 3.826   -45.200 26.870  1.00 34.50 ? 134 TYR A CZ  1 
ATOM 943  O OH  . TYR A 1 117 ? 2.481   -45.099 26.915  1.00 36.52 ? 134 TYR A OH  1 
ATOM 944  N N   . ASN A 1 118 ? 10.443  -46.091 23.971  1.00 38.12 ? 135 ASN A N   1 
ATOM 945  C CA  . ASN A 1 118 ? 11.861  -46.172 23.771  1.00 38.37 ? 135 ASN A CA  1 
ATOM 946  C C   . ASN A 1 118 ? 12.539  -45.014 23.141  1.00 38.38 ? 135 ASN A C   1 
ATOM 947  O O   . ASN A 1 118 ? 13.726  -45.099 23.065  1.00 39.28 ? 135 ASN A O   1 
ATOM 948  C CB  . ASN A 1 118 ? 12.227  -47.386 22.955  1.00 38.46 ? 135 ASN A CB  1 
ATOM 949  C CG  . ASN A 1 118 ? 11.807  -47.258 21.529  1.00 39.39 ? 135 ASN A CG  1 
ATOM 950  O OD1 . ASN A 1 118 ? 10.963  -46.414 21.169  1.00 39.71 ? 135 ASN A OD1 1 
ATOM 951  N ND2 . ASN A 1 118 ? 12.369  -48.123 20.688  1.00 40.35 ? 135 ASN A ND2 1 
ATOM 952  N N   . LYS A 1 119 ? 11.836  -44.001 22.613  1.00 38.55 ? 136 LYS A N   1 
ATOM 953  C CA  . LYS A 1 119 ? 12.500  -42.728 22.277  1.00 38.63 ? 136 LYS A CA  1 
ATOM 954  C C   . LYS A 1 119 ? 12.239  -41.688 23.369  1.00 38.65 ? 136 LYS A C   1 
ATOM 955  O O   . LYS A 1 119 ? 11.300  -40.898 23.277  1.00 40.09 ? 136 LYS A O   1 
ATOM 956  C CB  . LYS A 1 119 ? 12.097  -42.156 20.911  1.00 38.32 ? 136 LYS A CB  1 
ATOM 957  C CG  . LYS A 1 119 ? 12.236  -43.094 19.721  1.00 40.72 ? 136 LYS A CG  1 
ATOM 958  C CD  . LYS A 1 119 ? 10.840  -43.622 19.270  1.00 45.13 ? 136 LYS A CD  1 
ATOM 959  C CE  . LYS A 1 119 ? 10.923  -44.994 18.561  1.00 46.56 ? 136 LYS A CE  1 
ATOM 960  N NZ  . LYS A 1 119 ? 9.834   -45.891 19.080  1.00 43.93 ? 136 LYS A NZ  1 
ATOM 961  N N   . ILE A 1 120 ? 13.066  -41.672 24.401  1.00 38.50 ? 137 ILE A N   1 
ATOM 962  C CA  . ILE A 1 120 ? 12.892  -40.722 25.519  1.00 38.29 ? 137 ILE A CA  1 
ATOM 963  C C   . ILE A 1 120 ? 13.568  -39.353 25.316  1.00 39.42 ? 137 ILE A C   1 
ATOM 964  O O   . ILE A 1 120 ? 14.790  -39.231 25.476  1.00 39.45 ? 137 ILE A O   1 
ATOM 965  C CB  . ILE A 1 120 ? 13.499  -41.274 26.809  1.00 37.55 ? 137 ILE A CB  1 
ATOM 966  C CG1 . ILE A 1 120 ? 12.965  -42.687 27.129  1.00 35.39 ? 137 ILE A CG1 1 
ATOM 967  C CG2 . ILE A 1 120 ? 13.315  -40.272 27.896  1.00 35.89 ? 137 ILE A CG2 1 
ATOM 968  C CD1 . ILE A 1 120 ? 13.788  -43.444 28.129  1.00 32.46 ? 137 ILE A CD1 1 
ATOM 969  N N   . ASN A 1 121 ? 12.778  -38.325 24.995  1.00 40.63 ? 138 ASN A N   1 
ATOM 970  C CA  . ASN A 1 121 ? 13.275  -36.941 24.974  1.00 41.23 ? 138 ASN A CA  1 
ATOM 971  C C   . ASN A 1 121 ? 13.435  -36.430 26.396  1.00 40.51 ? 138 ASN A C   1 
ATOM 972  O O   . ASN A 1 121 ? 12.491  -36.461 27.194  1.00 40.16 ? 138 ASN A O   1 
ATOM 973  C CB  . ASN A 1 121 ? 12.379  -36.075 24.101  1.00 41.91 ? 138 ASN A CB  1 
ATOM 974  C CG  . ASN A 1 121 ? 12.005  -36.811 22.768  1.00 47.26 ? 138 ASN A CG  1 
ATOM 975  O OD1 . ASN A 1 121 ? 12.799  -36.815 21.793  1.00 50.00 ? 138 ASN A OD1 1 
ATOM 976  N ND2 . ASN A 1 121 ? 10.828  -37.508 22.760  1.00 47.10 ? 138 ASN A ND2 1 
ATOM 977  N N   . GLN A 1 122 ? 14.673  -36.058 26.728  1.00 40.05 ? 139 GLN A N   1 
ATOM 978  C CA  . GLN A 1 122 ? 15.013  -35.546 28.056  1.00 39.87 ? 139 GLN A CA  1 
ATOM 979  C C   . GLN A 1 122 ? 15.404  -34.059 28.048  1.00 39.89 ? 139 GLN A C   1 
ATOM 980  O O   . GLN A 1 122 ? 15.612  -33.483 26.996  1.00 40.51 ? 139 GLN A O   1 
ATOM 981  C CB  . GLN A 1 122 ? 16.140  -36.376 28.638  1.00 39.22 ? 139 GLN A CB  1 
ATOM 982  C CG  . GLN A 1 122 ? 17.436  -36.226 27.874  1.00 38.89 ? 139 GLN A CG  1 
ATOM 983  C CD  . GLN A 1 122 ? 18.615  -36.802 28.635  1.00 37.39 ? 139 GLN A CD  1 
ATOM 984  O OE1 . GLN A 1 122 ? 18.783  -38.040 28.721  1.00 35.76 ? 139 GLN A OE1 1 
ATOM 985  N NE2 . GLN A 1 122 ? 19.451  -35.909 29.192  1.00 35.99 ? 139 GLN A NE2 1 
ATOM 986  N N   . ARG A 1 123 ? 15.494  -33.438 29.218  1.00 40.26 ? 140 ARG A N   1 
ATOM 987  C CA  . ARG A 1 123 ? 15.860  -32.018 29.341  1.00 40.59 ? 140 ARG A CA  1 
ATOM 988  C C   . ARG A 1 123 ? 16.091  -31.697 30.805  1.00 40.56 ? 140 ARG A C   1 
ATOM 989  O O   . ARG A 1 123 ? 15.486  -32.326 31.686  1.00 41.13 ? 140 ARG A O   1 
ATOM 990  C CB  . ARG A 1 123 ? 14.817  -31.074 28.702  1.00 40.01 ? 140 ARG A CB  1 
ATOM 991  C CG  . ARG A 1 123 ? 13.369  -31.065 29.272  1.00 42.17 ? 140 ARG A CG  1 
ATOM 992  C CD  . ARG A 1 123 ? 12.406  -29.991 28.579  1.00 42.70 ? 140 ARG A CD  1 
ATOM 993  N NE  . ARG A 1 123 ? 12.465  -28.642 29.203  1.00 46.74 ? 140 ARG A NE  1 
ATOM 994  C CZ  . ARG A 1 123 ? 11.455  -28.067 29.879  1.00 51.11 ? 140 ARG A CZ  1 
ATOM 995  N NH1 . ARG A 1 123 ? 10.274  -28.699 30.001  1.00 53.71 ? 140 ARG A NH1 1 
ATOM 996  N NH2 . ARG A 1 123 ? 11.593  -26.850 30.430  1.00 49.80 ? 140 ARG A NH2 1 
ATOM 997  N N   . ILE A 1 124 ? 16.970  -30.733 31.069  1.00 40.45 ? 141 ILE A N   1 
ATOM 998  C CA  . ILE A 1 124 ? 17.379  -30.367 32.438  1.00 39.62 ? 141 ILE A CA  1 
ATOM 999  C C   . ILE A 1 124 ? 17.359  -28.852 32.583  1.00 39.96 ? 141 ILE A C   1 
ATOM 1000 O O   . ILE A 1 124 ? 17.778  -28.146 31.693  1.00 40.13 ? 141 ILE A O   1 
ATOM 1001 C CB  . ILE A 1 124 ? 18.826  -30.902 32.761  1.00 39.40 ? 141 ILE A CB  1 
ATOM 1002 C CG1 . ILE A 1 124 ? 18.916  -32.426 32.472  1.00 37.88 ? 141 ILE A CG1 1 
ATOM 1003 C CG2 . ILE A 1 124 ? 19.272  -30.507 34.197  1.00 37.28 ? 141 ILE A CG2 1 
ATOM 1004 C CD1 . ILE A 1 124 ? 20.030  -33.121 33.191  1.00 34.53 ? 141 ILE A CD1 1 
ATOM 1005 N N   . LEU A 1 125 ? 16.861  -28.345 33.694  1.00 40.73 ? 142 LEU A N   1 
ATOM 1006 C CA  . LEU A 1 125 ? 16.804  -26.911 33.895  1.00 40.97 ? 142 LEU A CA  1 
ATOM 1007 C C   . LEU A 1 125 ? 17.416  -26.644 35.222  1.00 41.52 ? 142 LEU A C   1 
ATOM 1008 O O   . LEU A 1 125 ? 16.935  -27.131 36.242  1.00 41.52 ? 142 LEU A O   1 
ATOM 1009 C CB  . LEU A 1 125 ? 15.360  -26.415 33.871  1.00 40.66 ? 142 LEU A CB  1 
ATOM 1010 C CG  . LEU A 1 125 ? 14.907  -24.988 34.287  1.00 41.89 ? 142 LEU A CG  1 
ATOM 1011 C CD1 . LEU A 1 125 ? 15.707  -23.811 33.664  1.00 41.84 ? 142 LEU A CD1 1 
ATOM 1012 C CD2 . LEU A 1 125 ? 13.410  -24.798 33.943  1.00 41.65 ? 142 LEU A CD2 1 
ATOM 1013 N N   . VAL A 1 126 ? 18.489  -25.878 35.258  1.00 42.45 ? 143 VAL A N   1 
ATOM 1014 C CA  . VAL A 1 126 ? 18.911  -25.514 36.582  1.00 44.30 ? 143 VAL A CA  1 
ATOM 1015 C C   . VAL A 1 126 ? 18.093  -24.345 37.020  1.00 45.00 ? 143 VAL A C   1 
ATOM 1016 O O   . VAL A 1 126 ? 18.198  -23.283 36.450  1.00 45.00 ? 143 VAL A O   1 
ATOM 1017 C CB  . VAL A 1 126 ? 20.425  -25.401 36.808  1.00 44.26 ? 143 VAL A CB  1 
ATOM 1018 C CG1 . VAL A 1 126 ? 21.142  -24.809 35.618  1.00 44.91 ? 143 VAL A CG1 1 
ATOM 1019 C CG2 . VAL A 1 126 ? 20.672  -24.661 38.105  1.00 44.21 ? 143 VAL A CG2 1 
ATOM 1020 N N   . VAL A 1 127 ? 17.227  -24.606 37.995  1.00 46.65 ? 144 VAL A N   1 
ATOM 1021 C CA  . VAL A 1 127 ? 16.142  -23.712 38.366  1.00 48.32 ? 144 VAL A CA  1 
ATOM 1022 C C   . VAL A 1 127 ? 16.671  -22.555 39.188  1.00 49.73 ? 144 VAL A C   1 
ATOM 1023 O O   . VAL A 1 127 ? 16.294  -21.400 38.947  1.00 50.73 ? 144 VAL A O   1 
ATOM 1024 C CB  . VAL A 1 127 ? 14.993  -24.447 39.163  1.00 48.45 ? 144 VAL A CB  1 
ATOM 1025 C CG1 . VAL A 1 127 ? 14.018  -23.455 39.789  1.00 48.53 ? 144 VAL A CG1 1 
ATOM 1026 C CG2 . VAL A 1 127 ? 14.244  -25.422 38.288  1.00 46.92 ? 144 VAL A CG2 1 
ATOM 1027 N N   . ASP A 1 128 ? 17.534  -22.854 40.154  1.00 50.67 ? 145 ASP A N   1 
ATOM 1028 C CA  . ASP A 1 128 ? 18.026  -21.842 41.069  1.00 51.70 ? 145 ASP A CA  1 
ATOM 1029 C C   . ASP A 1 128 ? 19.342  -22.346 41.556  1.00 52.16 ? 145 ASP A C   1 
ATOM 1030 O O   . ASP A 1 128 ? 19.351  -23.147 42.463  1.00 53.50 ? 145 ASP A O   1 
ATOM 1031 C CB  . ASP A 1 128 ? 17.069  -21.723 42.256  1.00 51.85 ? 145 ASP A CB  1 
ATOM 1032 C CG  . ASP A 1 128 ? 17.498  -20.648 43.262  1.00 54.05 ? 145 ASP A CG  1 
ATOM 1033 O OD1 . ASP A 1 128 ? 18.724  -20.470 43.492  1.00 55.55 ? 145 ASP A OD1 1 
ATOM 1034 O OD2 . ASP A 1 128 ? 16.594  -19.989 43.830  1.00 53.61 ? 145 ASP A OD2 1 
ATOM 1035 N N   . PRO A 1 129 ? 20.459  -21.871 40.987  1.00 52.51 ? 146 PRO A N   1 
ATOM 1036 C CA  . PRO A 1 129 ? 21.769  -22.492 41.250  1.00 52.62 ? 146 PRO A CA  1 
ATOM 1037 C C   . PRO A 1 129 ? 22.316  -22.202 42.651  1.00 52.72 ? 146 PRO A C   1 
ATOM 1038 O O   . PRO A 1 129 ? 23.331  -22.794 43.062  1.00 52.25 ? 146 PRO A O   1 
ATOM 1039 C CB  . PRO A 1 129 ? 22.683  -21.859 40.198  1.00 52.65 ? 146 PRO A CB  1 
ATOM 1040 C CG  . PRO A 1 129 ? 22.055  -20.560 39.882  1.00 52.66 ? 146 PRO A CG  1 
ATOM 1041 C CD  . PRO A 1 129 ? 20.567  -20.706 40.091  1.00 52.76 ? 146 PRO A CD  1 
ATOM 1042 N N   . VAL A 1 130 ? 21.657  -21.277 43.349  1.00 52.73 ? 147 VAL A N   1 
ATOM 1043 C CA  . VAL A 1 130 ? 21.984  -20.932 44.729  1.00 52.71 ? 147 VAL A CA  1 
ATOM 1044 C C   . VAL A 1 130 ? 21.535  -22.127 45.572  1.00 52.58 ? 147 VAL A C   1 
ATOM 1045 O O   . VAL A 1 130 ? 22.317  -22.701 46.329  1.00 52.27 ? 147 VAL A O   1 
ATOM 1046 C CB  . VAL A 1 130 ? 21.242  -19.619 45.134  1.00 53.04 ? 147 VAL A CB  1 
ATOM 1047 C CG1 . VAL A 1 130 ? 21.001  -19.510 46.636  1.00 52.61 ? 147 VAL A CG1 1 
ATOM 1048 C CG2 . VAL A 1 130 ? 21.973  -18.386 44.584  1.00 53.35 ? 147 VAL A CG2 1 
ATOM 1049 N N   . THR A 1 131 ? 20.265  -22.494 45.419  1.00 52.59 ? 148 THR A N   1 
ATOM 1050 C CA  . THR A 1 131 ? 19.681  -23.683 46.067  1.00 52.30 ? 148 THR A CA  1 
ATOM 1051 C C   . THR A 1 131 ? 20.120  -24.996 45.384  1.00 51.67 ? 148 THR A C   1 
ATOM 1052 O O   . THR A 1 131 ? 19.891  -26.088 45.909  1.00 52.64 ? 148 THR A O   1 
ATOM 1053 C CB  . THR A 1 131 ? 18.141  -23.629 46.039  1.00 52.58 ? 148 THR A CB  1 
ATOM 1054 O OG1 . THR A 1 131 ? 17.689  -22.937 44.853  1.00 52.52 ? 148 THR A OG1 1 
ATOM 1055 C CG2 . THR A 1 131 ? 17.639  -22.912 47.250  1.00 52.97 ? 148 THR A CG2 1 
ATOM 1056 N N   . SER A 1 132 ? 20.747  -24.879 44.216  1.00 49.75 ? 149 SER A N   1 
ATOM 1057 C CA  . SER A 1 132 ? 21.115  -26.025 43.417  1.00 48.23 ? 149 SER A CA  1 
ATOM 1058 C C   . SER A 1 132 ? 19.932  -26.860 42.918  1.00 46.86 ? 149 SER A C   1 
ATOM 1059 O O   . SER A 1 132 ? 20.119  -27.954 42.407  1.00 47.02 ? 149 SER A O   1 
ATOM 1060 C CB  . SER A 1 132 ? 22.114  -26.910 44.174  1.00 48.49 ? 149 SER A CB  1 
ATOM 1061 O OG  . SER A 1 132 ? 23.194  -27.273 43.318  1.00 48.44 ? 149 SER A OG  1 
ATOM 1062 N N   . GLU A 1 133 ? 18.718  -26.365 43.054  1.00 45.25 ? 150 GLU A N   1 
ATOM 1063 C CA  . GLU A 1 133 ? 17.557  -27.167 42.619  1.00 43.88 ? 150 GLU A CA  1 
ATOM 1064 C C   . GLU A 1 133 ? 17.400  -27.186 41.109  1.00 42.27 ? 150 GLU A C   1 
ATOM 1065 O O   . GLU A 1 133 ? 17.310  -26.125 40.466  1.00 41.95 ? 150 GLU A O   1 
ATOM 1066 C CB  . GLU A 1 133 ? 16.264  -26.671 43.260  1.00 44.15 ? 150 GLU A CB  1 
ATOM 1067 C CG  . GLU A 1 133 ? 15.031  -26.665 42.383  1.00 44.10 ? 150 GLU A CG  1 
ATOM 1068 C CD  . GLU A 1 133 ? 13.982  -25.761 42.988  1.00 47.77 ? 150 GLU A CD  1 
ATOM 1069 O OE1 . GLU A 1 133 ? 13.961  -25.663 44.231  1.00 49.29 ? 150 GLU A OE1 1 
ATOM 1070 O OE2 . GLU A 1 133 ? 13.203  -25.125 42.245  1.00 49.18 ? 150 GLU A OE2 1 
ATOM 1071 N N   . HIS A 1 134 ? 17.354  -28.401 40.573  1.00 39.59 ? 151 HIS A N   1 
ATOM 1072 C CA  . HIS A 1 134 ? 17.199  -28.606 39.178  1.00 37.66 ? 151 HIS A CA  1 
ATOM 1073 C C   . HIS A 1 134 ? 15.803  -29.162 38.813  1.00 36.81 ? 151 HIS A C   1 
ATOM 1074 O O   . HIS A 1 134 ? 14.996  -29.545 39.669  1.00 35.84 ? 151 HIS A O   1 
ATOM 1075 C CB  . HIS A 1 134 ? 18.298  -29.518 38.723  1.00 36.69 ? 151 HIS A CB  1 
ATOM 1076 C CG  . HIS A 1 134 ? 19.662  -28.905 38.772  1.00 38.96 ? 151 HIS A CG  1 
ATOM 1077 N ND1 . HIS A 1 134 ? 20.272  -28.517 39.953  1.00 40.13 ? 151 HIS A ND1 1 
ATOM 1078 C CD2 . HIS A 1 134 ? 20.568  -28.665 37.783  1.00 38.59 ? 151 HIS A CD2 1 
ATOM 1079 C CE1 . HIS A 1 134 ? 21.486  -28.055 39.686  1.00 39.40 ? 151 HIS A CE1 1 
ATOM 1080 N NE2 . HIS A 1 134 ? 21.685  -28.120 38.376  1.00 38.25 ? 151 HIS A NE2 1 
ATOM 1081 N N   . GLU A 1 135 ? 15.535  -29.213 37.516  1.00 36.24 ? 152 GLU A N   1 
ATOM 1082 C CA  . GLU A 1 135 ? 14.298  -29.754 37.007  1.00 36.02 ? 152 GLU A CA  1 
ATOM 1083 C C   . GLU A 1 135 ? 14.607  -30.676 35.865  1.00 35.83 ? 152 GLU A C   1 
ATOM 1084 O O   . GLU A 1 135 ? 14.944  -30.217 34.752  1.00 35.80 ? 152 GLU A O   1 
ATOM 1085 C CB  . GLU A 1 135 ? 13.393  -28.641 36.522  1.00 36.21 ? 152 GLU A CB  1 
ATOM 1086 C CG  . GLU A 1 135 ? 11.992  -29.071 36.290  1.00 37.89 ? 152 GLU A CG  1 
ATOM 1087 C CD  . GLU A 1 135 ? 11.040  -27.901 36.286  1.00 40.08 ? 152 GLU A CD  1 
ATOM 1088 O OE1 . GLU A 1 135 ? 10.555  -27.578 35.159  1.00 36.77 ? 152 GLU A OE1 1 
ATOM 1089 O OE2 . GLU A 1 135 ? 10.801  -27.333 37.407  1.00 39.33 ? 152 GLU A OE2 1 
ATOM 1090 N N   . LEU A 1 136 ? 14.484  -31.978 36.144  1.00 35.59 ? 153 LEU A N   1 
ATOM 1091 C CA  . LEU A 1 136 ? 14.778  -33.014 35.156  1.00 35.49 ? 153 LEU A CA  1 
ATOM 1092 C C   . LEU A 1 136 ? 13.473  -33.509 34.586  1.00 35.41 ? 153 LEU A C   1 
ATOM 1093 O O   . LEU A 1 136 ? 12.529  -33.833 35.323  1.00 35.93 ? 153 LEU A O   1 
ATOM 1094 C CB  . LEU A 1 136 ? 15.552  -34.185 35.752  1.00 35.71 ? 153 LEU A CB  1 
ATOM 1095 C CG  . LEU A 1 136 ? 16.585  -34.087 36.888  1.00 36.62 ? 153 LEU A CG  1 
ATOM 1096 C CD1 . LEU A 1 136 ? 17.584  -35.237 36.801  1.00 35.26 ? 153 LEU A CD1 1 
ATOM 1097 C CD2 . LEU A 1 136 ? 17.335  -32.748 36.932  1.00 37.67 ? 153 LEU A CD2 1 
ATOM 1098 N N   . THR A 1 137 ? 13.406  -33.532 33.266  1.00 35.24 ? 154 THR A N   1 
ATOM 1099 C CA  . THR A 1 137 ? 12.201  -33.985 32.585  1.00 34.92 ? 154 THR A CA  1 
ATOM 1100 C C   . THR A 1 137 ? 12.522  -35.065 31.544  1.00 34.28 ? 154 THR A C   1 
ATOM 1101 O O   . THR A 1 137 ? 13.591  -35.017 30.892  1.00 33.52 ? 154 THR A O   1 
ATOM 1102 C CB  . THR A 1 137 ? 11.430  -32.769 32.020  1.00 35.08 ? 154 THR A CB  1 
ATOM 1103 O OG1 . THR A 1 137 ? 10.880  -32.043 33.132  1.00 35.47 ? 154 THR A OG1 1 
ATOM 1104 C CG2 . THR A 1 137 ? 10.295  -33.205 31.075  1.00 33.81 ? 154 THR A CG2 1 
ATOM 1105 N N   . CYS A 1 138 ? 11.622  -36.055 31.447  1.00 33.99 ? 155 CYS A N   1 
ATOM 1106 C CA  . CYS A 1 138 ? 11.688  -37.151 30.428  1.00 33.04 ? 155 CYS A CA  1 
ATOM 1107 C C   . CYS A 1 138 ? 10.295  -37.283 29.876  1.00 33.68 ? 155 CYS A C   1 
ATOM 1108 O O   . CYS A 1 138 ? 9.310   -37.292 30.641  1.00 34.12 ? 155 CYS A O   1 
ATOM 1109 C CB  . CYS A 1 138 ? 12.083  -38.491 31.058  1.00 32.31 ? 155 CYS A CB  1 
ATOM 1110 S SG  . CYS A 1 138 ? 13.824  -38.581 31.578  1.00 32.46 ? 155 CYS A SG  1 
ATOM 1111 N N   . GLN A 1 139 ? 10.194  -37.345 28.563  1.00 33.63 ? 156 GLN A N   1 
ATOM 1112 C CA  . GLN A 1 139 ? 8.918   -37.514 27.928  1.00 34.26 ? 156 GLN A CA  1 
ATOM 1113 C C   . GLN A 1 139 ? 8.993   -38.568 26.809  1.00 35.22 ? 156 GLN A C   1 
ATOM 1114 O O   . GLN A 1 139 ? 10.020  -38.700 26.138  1.00 36.12 ? 156 GLN A O   1 
ATOM 1115 C CB  . GLN A 1 139 ? 8.485   -36.189 27.349  1.00 33.11 ? 156 GLN A CB  1 
ATOM 1116 C CG  . GLN A 1 139 ? 8.991   -35.939 25.968  1.00 34.59 ? 156 GLN A CG  1 
ATOM 1117 C CD  . GLN A 1 139 ? 8.052   -36.447 24.908  1.00 37.01 ? 156 GLN A CD  1 
ATOM 1118 O OE1 . GLN A 1 139 ? 8.459   -37.143 23.996  1.00 39.83 ? 156 GLN A OE1 1 
ATOM 1119 N NE2 . GLN A 1 139 ? 6.790   -36.103 25.022  1.00 38.45 ? 156 GLN A NE2 1 
ATOM 1120 N N   . ALA A 1 140 ? 7.907   -39.294 26.574  1.00 35.38 ? 157 ALA A N   1 
ATOM 1121 C CA  . ALA A 1 140 ? 7.904   -40.261 25.480  1.00 35.29 ? 157 ALA A CA  1 
ATOM 1122 C C   . ALA A 1 140 ? 6.493   -40.776 25.220  1.00 35.80 ? 157 ALA A C   1 
ATOM 1123 O O   . ALA A 1 140 ? 5.560   -40.507 25.980  1.00 37.00 ? 157 ALA A O   1 
ATOM 1124 C CB  . ALA A 1 140 ? 8.846   -41.389 25.799  1.00 34.60 ? 157 ALA A CB  1 
ATOM 1125 N N   . GLU A 1 141 ? 6.319   -41.490 24.137  1.00 36.08 ? 158 GLU A N   1 
ATOM 1126 C CA  . GLU A 1 141 ? 5.009   -41.992 23.794  1.00 37.06 ? 158 GLU A CA  1 
ATOM 1127 C C   . GLU A 1 141 ? 5.098   -43.445 23.424  1.00 37.79 ? 158 GLU A C   1 
ATOM 1128 O O   . GLU A 1 141 ? 5.955   -43.851 22.622  1.00 37.80 ? 158 GLU A O   1 
ATOM 1129 C CB  . GLU A 1 141 ? 4.416   -41.284 22.563  1.00 36.94 ? 158 GLU A CB  1 
ATOM 1130 C CG  . GLU A 1 141 ? 4.784   -39.849 22.371  1.00 37.84 ? 158 GLU A CG  1 
ATOM 1131 C CD  . GLU A 1 141 ? 3.807   -39.135 21.474  1.00 38.85 ? 158 GLU A CD  1 
ATOM 1132 O OE1 . GLU A 1 141 ? 3.502   -39.724 20.406  1.00 38.26 ? 158 GLU A OE1 1 
ATOM 1133 O OE2 . GLU A 1 141 ? 3.358   -37.992 21.848  1.00 39.69 ? 158 GLU A OE2 1 
ATOM 1134 N N   . GLY A 1 142 ? 4.182   -44.232 23.949  1.00 38.15 ? 159 GLY A N   1 
ATOM 1135 C CA  . GLY A 1 142 ? 3.999   -45.537 23.396  1.00 39.06 ? 159 GLY A CA  1 
ATOM 1136 C C   . GLY A 1 142 ? 2.614   -45.981 23.780  1.00 40.01 ? 159 GLY A C   1 
ATOM 1137 O O   . GLY A 1 142 ? 1.756   -45.171 24.131  1.00 39.74 ? 159 GLY A O   1 
ATOM 1138 N N   . TYR A 1 143 ? 2.412   -47.289 23.724  1.00 39.94 ? 160 TYR A N   1 
ATOM 1139 C CA  . TYR A 1 143 ? 1.174   -47.867 24.114  1.00 39.51 ? 160 TYR A CA  1 
ATOM 1140 C C   . TYR A 1 143 ? 1.539   -49.140 24.891  1.00 38.85 ? 160 TYR A C   1 
ATOM 1141 O O   . TYR A 1 143 ? 2.474   -49.828 24.480  1.00 39.91 ? 160 TYR A O   1 
ATOM 1142 C CB  . TYR A 1 143 ? 0.375   -48.182 22.851  1.00 39.81 ? 160 TYR A CB  1 
ATOM 1143 C CG  . TYR A 1 143 ? -0.909  -48.811 23.207  1.00 41.20 ? 160 TYR A CG  1 
ATOM 1144 C CD1 . TYR A 1 143 ? -2.039  -48.029 23.469  1.00 41.25 ? 160 TYR A CD1 1 
ATOM 1145 C CD2 . TYR A 1 143 ? -0.993  -50.192 23.366  1.00 41.27 ? 160 TYR A CD2 1 
ATOM 1146 C CE1 . TYR A 1 143 ? -3.228  -48.621 23.841  1.00 42.89 ? 160 TYR A CE1 1 
ATOM 1147 C CE2 . TYR A 1 143 ? -2.172  -50.787 23.742  1.00 42.27 ? 160 TYR A CE2 1 
ATOM 1148 C CZ  . TYR A 1 143 ? -3.281  -50.003 23.975  1.00 42.37 ? 160 TYR A CZ  1 
ATOM 1149 O OH  . TYR A 1 143 ? -4.443  -50.617 24.347  1.00 43.74 ? 160 TYR A OH  1 
ATOM 1150 N N   . PRO A 1 144 ? 0.844   -49.444 26.014  1.00 37.15 ? 161 PRO A N   1 
ATOM 1151 C CA  . PRO A 1 144 ? -0.203  -48.676 26.719  1.00 36.44 ? 161 PRO A CA  1 
ATOM 1152 C C   . PRO A 1 144 ? 0.334   -47.666 27.716  1.00 36.20 ? 161 PRO A C   1 
ATOM 1153 O O   . PRO A 1 144 ? 1.517   -47.402 27.793  1.00 36.24 ? 161 PRO A O   1 
ATOM 1154 C CB  . PRO A 1 144 ? -0.973  -49.745 27.498  1.00 36.21 ? 161 PRO A CB  1 
ATOM 1155 C CG  . PRO A 1 144 ? 0.021   -50.850 27.749  1.00 36.26 ? 161 PRO A CG  1 
ATOM 1156 C CD  . PRO A 1 144 ? 1.136   -50.720 26.683  1.00 36.57 ? 161 PRO A CD  1 
ATOM 1157 N N   . LYS A 1 145 ? -0.545  -47.113 28.518  1.00 36.86 ? 162 LYS A N   1 
ATOM 1158 C CA  . LYS A 1 145 ? -0.108  -46.155 29.489  1.00 36.82 ? 162 LYS A CA  1 
ATOM 1159 C C   . LYS A 1 145 ? 1.105   -46.717 30.232  1.00 36.30 ? 162 LYS A C   1 
ATOM 1160 O O   . LYS A 1 145 ? 1.073   -47.856 30.676  1.00 35.26 ? 162 LYS A O   1 
ATOM 1161 C CB  . LYS A 1 145 ? -1.248  -45.913 30.463  1.00 37.35 ? 162 LYS A CB  1 
ATOM 1162 C CG  . LYS A 1 145 ? -2.272  -44.913 29.963  1.00 38.57 ? 162 LYS A CG  1 
ATOM 1163 C CD  . LYS A 1 145 ? -3.431  -44.718 30.968  1.00 37.21 ? 162 LYS A CD  1 
ATOM 1164 C CE  . LYS A 1 145 ? -4.653  -44.140 30.271  1.00 36.36 ? 162 LYS A CE  1 
ATOM 1165 N NZ  . LYS A 1 145 ? -5.768  -43.806 31.199  1.00 38.37 ? 162 LYS A NZ  1 
ATOM 1166 N N   . ALA A 1 146 ? 2.164   -45.914 30.349  1.00 36.00 ? 163 ALA A N   1 
ATOM 1167 C CA  . ALA A 1 146 ? 3.335   -46.247 31.181  1.00 35.40 ? 163 ALA A CA  1 
ATOM 1168 C C   . ALA A 1 146 ? 3.541   -45.287 32.341  1.00 35.48 ? 163 ALA A C   1 
ATOM 1169 O O   . ALA A 1 146 ? 3.174   -44.117 32.284  1.00 36.54 ? 163 ALA A O   1 
ATOM 1170 C CB  . ALA A 1 146 ? 4.551   -46.244 30.353  1.00 35.21 ? 163 ALA A CB  1 
ATOM 1171 N N   . GLU A 1 147 ? 4.143   -45.770 33.407  1.00 35.06 ? 164 GLU A N   1 
ATOM 1172 C CA  . GLU A 1 147 ? 4.555   -44.910 34.495  1.00 35.03 ? 164 GLU A CA  1 
ATOM 1173 C C   . GLU A 1 147 ? 6.057   -44.461 34.379  1.00 34.78 ? 164 GLU A C   1 
ATOM 1174 O O   . GLU A 1 147 ? 6.879   -45.136 33.743  1.00 35.42 ? 164 GLU A O   1 
ATOM 1175 C CB  . GLU A 1 147 ? 4.326   -45.650 35.793  1.00 34.96 ? 164 GLU A CB  1 
ATOM 1176 C CG  . GLU A 1 147 ? 5.101   -46.927 35.861  1.00 37.44 ? 164 GLU A CG  1 
ATOM 1177 C CD  . GLU A 1 147 ? 5.267   -47.419 37.261  1.00 41.62 ? 164 GLU A CD  1 
ATOM 1178 O OE1 . GLU A 1 147 ? 4.958   -48.622 37.470  1.00 46.12 ? 164 GLU A OE1 1 
ATOM 1179 O OE2 . GLU A 1 147 ? 5.689   -46.627 38.144  1.00 39.72 ? 164 GLU A OE2 1 
ATOM 1180 N N   . VAL A 1 148 ? 6.428   -43.334 34.966  1.00 33.46 ? 165 VAL A N   1 
ATOM 1181 C CA  . VAL A 1 148 ? 7.840   -43.017 35.008  1.00 32.77 ? 165 VAL A CA  1 
ATOM 1182 C C   . VAL A 1 148 ? 8.299   -43.213 36.421  1.00 32.39 ? 165 VAL A C   1 
ATOM 1183 O O   . VAL A 1 148 ? 7.551   -42.899 37.339  1.00 33.90 ? 165 VAL A O   1 
ATOM 1184 C CB  . VAL A 1 148 ? 8.092   -41.590 34.568  1.00 33.23 ? 165 VAL A CB  1 
ATOM 1185 C CG1 . VAL A 1 148 ? 9.529   -41.165 34.878  1.00 31.11 ? 165 VAL A CG1 1 
ATOM 1186 C CG2 . VAL A 1 148 ? 7.737   -41.443 33.057  1.00 33.63 ? 165 VAL A CG2 1 
ATOM 1187 N N   . ILE A 1 149 ? 9.479   -43.788 36.617  1.00 30.87 ? 166 ILE A N   1 
ATOM 1188 C CA  . ILE A 1 149 ? 10.004  -44.000 37.956  1.00 29.69 ? 166 ILE A CA  1 
ATOM 1189 C C   . ILE A 1 149 ? 11.319  -43.266 37.911  1.00 30.00 ? 166 ILE A C   1 
ATOM 1190 O O   . ILE A 1 149 ? 12.120  -43.470 36.985  1.00 30.56 ? 166 ILE A O   1 
ATOM 1191 C CB  . ILE A 1 149 ? 10.237  -45.531 38.325  1.00 29.52 ? 166 ILE A CB  1 
ATOM 1192 C CG1 . ILE A 1 149 ? 8.959   -46.357 38.219  1.00 29.04 ? 166 ILE A CG1 1 
ATOM 1193 C CG2 . ILE A 1 149 ? 10.780  -45.711 39.776  1.00 29.10 ? 166 ILE A CG2 1 
ATOM 1194 C CD1 . ILE A 1 149 ? 9.140   -47.825 38.440  1.00 28.71 ? 166 ILE A CD1 1 
ATOM 1195 N N   . TRP A 1 150 ? 11.532  -42.402 38.884  1.00 29.92 ? 167 TRP A N   1 
ATOM 1196 C CA  . TRP A 1 150 ? 12.791  -41.668 38.992  1.00 30.40 ? 167 TRP A CA  1 
ATOM 1197 C C   . TRP A 1 150 ? 13.642  -42.351 40.055  1.00 31.28 ? 167 TRP A C   1 
ATOM 1198 O O   . TRP A 1 150 ? 13.123  -42.724 41.135  1.00 32.18 ? 167 TRP A O   1 
ATOM 1199 C CB  . TRP A 1 150 ? 12.527  -40.194 39.389  1.00 29.49 ? 167 TRP A CB  1 
ATOM 1200 C CG  . TRP A 1 150 ? 11.923  -39.353 38.282  1.00 28.37 ? 167 TRP A CG  1 
ATOM 1201 C CD1 . TRP A 1 150 ? 10.601  -39.106 38.044  1.00 29.34 ? 167 TRP A CD1 1 
ATOM 1202 C CD2 . TRP A 1 150 ? 12.634  -38.665 37.275  1.00 27.91 ? 167 TRP A CD2 1 
ATOM 1203 N NE1 . TRP A 1 150 ? 10.446  -38.332 36.922  1.00 27.94 ? 167 TRP A NE1 1 
ATOM 1204 C CE2 . TRP A 1 150 ? 11.688  -38.034 36.446  1.00 29.19 ? 167 TRP A CE2 1 
ATOM 1205 C CE3 . TRP A 1 150 ? 13.988  -38.544 36.973  1.00 27.11 ? 167 TRP A CE3 1 
ATOM 1206 C CZ2 . TRP A 1 150 ? 12.058  -37.286 35.344  1.00 31.38 ? 167 TRP A CZ2 1 
ATOM 1207 C CZ3 . TRP A 1 150 ? 14.362  -37.816 35.893  1.00 28.52 ? 167 TRP A CZ3 1 
ATOM 1208 C CH2 . TRP A 1 150 ? 13.404  -37.174 35.089  1.00 31.32 ? 167 TRP A CH2 1 
ATOM 1209 N N   . THR A 1 151 ? 14.938  -42.496 39.797  1.00 31.68 ? 168 THR A N   1 
ATOM 1210 C CA  . THR A 1 151 ? 15.832  -43.040 40.820  1.00 33.00 ? 168 THR A CA  1 
ATOM 1211 C C   . THR A 1 151 ? 17.147  -42.289 40.853  1.00 34.66 ? 168 THR A C   1 
ATOM 1212 O O   . THR A 1 151 ? 17.612  -41.840 39.788  1.00 35.10 ? 168 THR A O   1 
ATOM 1213 C CB  . THR A 1 151 ? 16.166  -44.541 40.581  1.00 32.82 ? 168 THR A CB  1 
ATOM 1214 O OG1 . THR A 1 151 ? 16.800  -44.696 39.310  1.00 31.76 ? 168 THR A OG1 1 
ATOM 1215 C CG2 . THR A 1 151 ? 14.921  -45.433 40.655  1.00 32.65 ? 168 THR A CG2 1 
ATOM 1216 N N   . SER A 1 152 ? 17.773  -42.181 42.042  1.00 36.46 ? 169 SER A N   1 
ATOM 1217 C CA  . SER A 1 152 ? 19.141  -41.601 42.144  1.00 38.13 ? 169 SER A CA  1 
ATOM 1218 C C   . SER A 1 152 ? 20.129  -42.540 41.534  1.00 38.79 ? 169 SER A C   1 
ATOM 1219 O O   . SER A 1 152 ? 19.734  -43.503 40.877  1.00 39.75 ? 169 SER A O   1 
ATOM 1220 C CB  . SER A 1 152 ? 19.566  -41.213 43.558  1.00 37.69 ? 169 SER A CB  1 
ATOM 1221 O OG  . SER A 1 152 ? 18.912  -41.991 44.543  1.00 41.35 ? 169 SER A OG  1 
ATOM 1222 N N   . SER A 1 153 ? 21.418  -42.275 41.698  1.00 39.78 ? 170 SER A N   1 
ATOM 1223 C CA  . SER A 1 153 ? 22.399  -43.190 41.093  1.00 39.85 ? 170 SER A CA  1 
ATOM 1224 C C   . SER A 1 153 ? 22.564  -44.426 41.991  1.00 39.80 ? 170 SER A C   1 
ATOM 1225 O O   . SER A 1 153 ? 23.152  -45.415 41.586  1.00 40.35 ? 170 SER A O   1 
ATOM 1226 C CB  . SER A 1 153 ? 23.733  -42.494 40.889  1.00 39.57 ? 170 SER A CB  1 
ATOM 1227 O OG  . SER A 1 153 ? 24.325  -42.268 42.160  1.00 40.22 ? 170 SER A OG  1 
ATOM 1228 N N   . ASP A 1 154 ? 22.062  -44.347 43.214  1.00 39.75 ? 171 ASP A N   1 
ATOM 1229 C CA  . ASP A 1 154 ? 22.077  -45.482 44.109  1.00 40.12 ? 171 ASP A CA  1 
ATOM 1230 C C   . ASP A 1 154 ? 20.678  -46.093 44.145  1.00 39.99 ? 171 ASP A C   1 
ATOM 1231 O O   . ASP A 1 154 ? 20.283  -46.720 45.142  1.00 40.36 ? 171 ASP A O   1 
ATOM 1232 C CB  . ASP A 1 154 ? 22.495  -45.052 45.506  1.00 39.88 ? 171 ASP A CB  1 
ATOM 1233 C CG  . ASP A 1 154 ? 21.477  -44.150 46.162  1.00 43.16 ? 171 ASP A CG  1 
ATOM 1234 O OD1 . ASP A 1 154 ? 20.558  -43.647 45.482  1.00 46.70 ? 171 ASP A OD1 1 
ATOM 1235 O OD2 . ASP A 1 154 ? 21.560  -43.947 47.386  1.00 49.15 ? 171 ASP A OD2 1 
ATOM 1236 N N   . HIS A 1 155 ? 19.906  -45.871 43.076  1.00 39.26 ? 172 HIS A N   1 
ATOM 1237 C CA  . HIS A 1 155 ? 18.672  -46.649 42.820  1.00 38.11 ? 172 HIS A CA  1 
ATOM 1238 C C   . HIS A 1 155 ? 17.625  -46.459 43.879  1.00 38.41 ? 172 HIS A C   1 
ATOM 1239 O O   . HIS A 1 155 ? 16.731  -47.258 43.989  1.00 38.02 ? 172 HIS A O   1 
ATOM 1240 C CB  . HIS A 1 155 ? 19.019  -48.133 42.656  1.00 36.68 ? 172 HIS A CB  1 
ATOM 1241 C CG  . HIS A 1 155 ? 20.214  -48.342 41.807  1.00 34.58 ? 172 HIS A CG  1 
ATOM 1242 N ND1 . HIS A 1 155 ? 20.184  -48.159 40.436  1.00 34.34 ? 172 HIS A ND1 1 
ATOM 1243 C CD2 . HIS A 1 155 ? 21.508  -48.590 42.129  1.00 33.68 ? 172 HIS A CD2 1 
ATOM 1244 C CE1 . HIS A 1 155 ? 21.400  -48.336 39.937  1.00 31.48 ? 172 HIS A CE1 1 
ATOM 1245 N NE2 . HIS A 1 155 ? 22.223  -48.588 40.944  1.00 34.10 ? 172 HIS A NE2 1 
ATOM 1246 N N   . GLN A 1 156 ? 17.773  -45.416 44.689  1.00 40.43 ? 173 GLN A N   1 
ATOM 1247 C CA  . GLN A 1 156 ? 16.684  -44.931 45.554  1.00 42.09 ? 173 GLN A CA  1 
ATOM 1248 C C   . GLN A 1 156 ? 15.658  -44.224 44.677  1.00 42.25 ? 173 GLN A C   1 
ATOM 1249 O O   . GLN A 1 156 ? 16.001  -43.473 43.749  1.00 41.48 ? 173 GLN A O   1 
ATOM 1250 C CB  . GLN A 1 156 ? 17.207  -43.964 46.613  1.00 42.37 ? 173 GLN A CB  1 
ATOM 1251 C CG  . GLN A 1 156 ? 17.895  -44.636 47.814  1.00 47.51 ? 173 GLN A CG  1 
ATOM 1252 C CD  . GLN A 1 156 ? 17.110  -44.458 49.117  1.00 54.20 ? 173 GLN A CD  1 
ATOM 1253 O OE1 . GLN A 1 156 ? 16.409  -45.378 49.579  1.00 57.86 ? 173 GLN A OE1 1 
ATOM 1254 N NE2 . GLN A 1 156 ? 17.209  -43.265 49.709  1.00 55.36 ? 173 GLN A NE2 1 
ATOM 1255 N N   . VAL A 1 157 ? 14.391  -44.476 44.974  1.00 42.96 ? 174 VAL A N   1 
ATOM 1256 C CA  . VAL A 1 157 ? 13.299  -43.971 44.145  1.00 43.18 ? 174 VAL A CA  1 
ATOM 1257 C C   . VAL A 1 157 ? 13.004  -42.560 44.603  1.00 43.09 ? 174 VAL A C   1 
ATOM 1258 O O   . VAL A 1 157 ? 13.263  -42.230 45.744  1.00 43.34 ? 174 VAL A O   1 
ATOM 1259 C CB  . VAL A 1 157 ? 12.036  -44.916 44.213  1.00 43.62 ? 174 VAL A CB  1 
ATOM 1260 C CG1 . VAL A 1 157 ? 10.775  -44.239 43.636  1.00 42.47 ? 174 VAL A CG1 1 
ATOM 1261 C CG2 . VAL A 1 157 ? 12.346  -46.247 43.495  1.00 41.62 ? 174 VAL A CG2 1 
ATOM 1262 N N   . LEU A 1 158 ? 12.514  -41.726 43.699  1.00 42.75 ? 175 LEU A N   1 
ATOM 1263 C CA  . LEU A 1 158 ? 12.275  -40.349 44.024  1.00 42.97 ? 175 LEU A CA  1 
ATOM 1264 C C   . LEU A 1 158 ? 10.850  -39.918 43.642  1.00 43.43 ? 175 LEU A C   1 
ATOM 1265 O O   . LEU A 1 158 ? 10.147  -40.592 42.855  1.00 44.15 ? 175 LEU A O   1 
ATOM 1266 C CB  . LEU A 1 158 ? 13.306  -39.499 43.292  1.00 43.25 ? 175 LEU A CB  1 
ATOM 1267 C CG  . LEU A 1 158 ? 14.783  -39.929 43.388  1.00 43.80 ? 175 LEU A CG  1 
ATOM 1268 C CD1 . LEU A 1 158 ? 15.643  -39.232 42.344  1.00 42.25 ? 175 LEU A CD1 1 
ATOM 1269 C CD2 . LEU A 1 158 ? 15.366  -39.739 44.810  1.00 42.51 ? 175 LEU A CD2 1 
ATOM 1270 N N   . SER A 1 159 ? 10.420  -38.791 44.183  1.00 42.79 ? 176 SER A N   1 
ATOM 1271 C CA  . SER A 1 159 ? 9.104   -38.312 43.901  1.00 43.15 ? 176 SER A CA  1 
ATOM 1272 C C   . SER A 1 159 ? 9.125   -37.495 42.661  1.00 42.84 ? 176 SER A C   1 
ATOM 1273 O O   . SER A 1 159 ? 9.802   -36.453 42.631  1.00 43.87 ? 176 SER A O   1 
ATOM 1274 C CB  . SER A 1 159 ? 8.597   -37.430 45.030  1.00 43.50 ? 176 SER A CB  1 
ATOM 1275 O OG  . SER A 1 159 ? 8.234   -38.228 46.135  1.00 46.54 ? 176 SER A OG  1 
ATOM 1276 N N   . GLY A 1 160 ? 8.343   -37.934 41.670  1.00 42.17 ? 177 GLY A N   1 
ATOM 1277 C CA  . GLY A 1 160 ? 8.158   -37.195 40.412  1.00 41.00 ? 177 GLY A CA  1 
ATOM 1278 C C   . GLY A 1 160 ? 6.715   -36.757 40.185  1.00 40.45 ? 177 GLY A C   1 
ATOM 1279 O O   . GLY A 1 160 ? 5.807   -37.072 40.961  1.00 41.05 ? 177 GLY A O   1 
ATOM 1280 N N   . LYS A 1 161 ? 6.499   -36.026 39.109  1.00 39.48 ? 178 LYS A N   1 
ATOM 1281 C CA  . LYS A 1 161 ? 5.180   -35.552 38.759  1.00 39.13 ? 178 LYS A CA  1 
ATOM 1282 C C   . LYS A 1 161 ? 5.013   -35.994 37.328  1.00 37.99 ? 178 LYS A C   1 
ATOM 1283 O O   . LYS A 1 161 ? 5.698   -35.464 36.421  1.00 38.24 ? 178 LYS A O   1 
ATOM 1284 C CB  . LYS A 1 161 ? 5.115   -34.020 38.871  1.00 38.95 ? 178 LYS A CB  1 
ATOM 1285 C CG  . LYS A 1 161 ? 3.867   -33.356 38.287  1.00 40.17 ? 178 LYS A CG  1 
ATOM 1286 C CD  . LYS A 1 161 ? 3.699   -31.916 38.831  1.00 40.88 ? 178 LYS A CD  1 
ATOM 1287 C CE  . LYS A 1 161 ? 2.503   -31.225 38.177  1.00 43.76 ? 178 LYS A CE  1 
ATOM 1288 N NZ  . LYS A 1 161 ? 2.179   -29.922 38.816  1.00 45.80 ? 178 LYS A NZ  1 
ATOM 1289 N N   . THR A 1 162 ? 4.159   -36.991 37.111  1.00 35.80 ? 179 THR A N   1 
ATOM 1290 C CA  . THR A 1 162 ? 3.998   -37.453 35.751  1.00 34.23 ? 179 THR A CA  1 
ATOM 1291 C C   . THR A 1 162 ? 2.597   -37.202 35.164  1.00 33.22 ? 179 THR A C   1 
ATOM 1292 O O   . THR A 1 162 ? 1.587   -37.271 35.862  1.00 33.08 ? 179 THR A O   1 
ATOM 1293 C CB  . THR A 1 162 ? 4.648   -38.844 35.480  1.00 33.83 ? 179 THR A CB  1 
ATOM 1294 O OG1 . THR A 1 162 ? 3.735   -39.664 34.752  1.00 32.67 ? 179 THR A OG1 1 
ATOM 1295 C CG2 . THR A 1 162 ? 5.046   -39.513 36.723  1.00 33.43 ? 179 THR A CG2 1 
ATOM 1296 N N   . THR A 1 163 ? 2.569   -36.916 33.875  1.00 32.14 ? 180 THR A N   1 
ATOM 1297 C CA  . THR A 1 163 ? 1.385   -36.366 33.223  1.00 32.20 ? 180 THR A CA  1 
ATOM 1298 C C   . THR A 1 163 ? 1.133   -37.119 31.946  1.00 32.60 ? 180 THR A C   1 
ATOM 1299 O O   . THR A 1 163 ? 1.937   -37.034 31.010  1.00 33.70 ? 180 THR A O   1 
ATOM 1300 C CB  . THR A 1 163 ? 1.599   -34.874 32.869  1.00 31.70 ? 180 THR A CB  1 
ATOM 1301 O OG1 . THR A 1 163 ? 1.978   -34.161 34.053  1.00 31.51 ? 180 THR A OG1 1 
ATOM 1302 C CG2 . THR A 1 163 ? 0.373   -34.262 32.266  1.00 28.56 ? 180 THR A CG2 1 
ATOM 1303 N N   . THR A 1 164 ? 0.033   -37.861 31.920  1.00 32.65 ? 181 THR A N   1 
ATOM 1304 C CA  . THR A 1 164 ? -0.314  -38.732 30.802  1.00 32.93 ? 181 THR A CA  1 
ATOM 1305 C C   . THR A 1 164 ? -1.474  -38.076 30.118  1.00 33.80 ? 181 THR A C   1 
ATOM 1306 O O   . THR A 1 164 ? -2.363  -37.532 30.786  1.00 34.63 ? 181 THR A O   1 
ATOM 1307 C CB  . THR A 1 164 ? -0.795  -40.130 31.302  1.00 32.79 ? 181 THR A CB  1 
ATOM 1308 O OG1 . THR A 1 164 ? 0.186   -40.707 32.167  1.00 32.44 ? 181 THR A OG1 1 
ATOM 1309 C CG2 . THR A 1 164 ? -0.977  -41.061 30.186  1.00 31.22 ? 181 THR A CG2 1 
ATOM 1310 N N   . THR A 1 165 ? -1.452  -38.106 28.795  1.00 34.65 ? 182 THR A N   1 
ATOM 1311 C CA  . THR A 1 165 ? -2.546  -37.657 27.936  1.00 35.98 ? 182 THR A CA  1 
ATOM 1312 C C   . THR A 1 165 ? -2.459  -38.485 26.641  1.00 37.34 ? 182 THR A C   1 
ATOM 1313 O O   . THR A 1 165 ? -1.503  -39.242 26.450  1.00 38.50 ? 182 THR A O   1 
ATOM 1314 C CB  . THR A 1 165 ? -2.405  -36.157 27.564  1.00 35.47 ? 182 THR A CB  1 
ATOM 1315 O OG1 . THR A 1 165 ? -1.232  -35.982 26.786  1.00 35.89 ? 182 THR A OG1 1 
ATOM 1316 C CG2 . THR A 1 165 ? -2.288  -35.277 28.765  1.00 34.59 ? 182 THR A CG2 1 
ATOM 1317 N N   . ASN A 1 166 ? -3.405  -38.329 25.733  1.00 38.23 ? 183 ASN A N   1 
ATOM 1318 C CA  . ASN A 1 166 ? -3.276  -38.962 24.435  1.00 39.72 ? 183 ASN A CA  1 
ATOM 1319 C C   . ASN A 1 166 ? -2.317  -38.236 23.532  1.00 41.16 ? 183 ASN A C   1 
ATOM 1320 O O   . ASN A 1 166 ? -2.421  -37.025 23.392  1.00 41.42 ? 183 ASN A O   1 
ATOM 1321 C CB  . ASN A 1 166 ? -4.625  -39.044 23.747  1.00 39.37 ? 183 ASN A CB  1 
ATOM 1322 C CG  . ASN A 1 166 ? -5.471  -40.094 24.336  1.00 40.43 ? 183 ASN A CG  1 
ATOM 1323 O OD1 . ASN A 1 166 ? -5.059  -41.254 24.452  1.00 43.55 ? 183 ASN A OD1 1 
ATOM 1324 N ND2 . ASN A 1 166 ? -6.652  -39.724 24.736  1.00 39.68 ? 183 ASN A ND2 1 
ATOM 1325 N N   . SER A 1 167 ? -1.388  -38.966 22.906  1.00 42.80 ? 184 SER A N   1 
ATOM 1326 C CA  . SER A 1 167 ? -0.471  -38.363 21.954  1.00 44.30 ? 184 SER A CA  1 
ATOM 1327 C C   . SER A 1 167 ? -1.301  -37.628 20.915  1.00 47.03 ? 184 SER A C   1 
ATOM 1328 O O   . SER A 1 167 ? -2.350  -38.126 20.490  1.00 45.89 ? 184 SER A O   1 
ATOM 1329 C CB  . SER A 1 167 ? 0.418   -39.410 21.282  1.00 44.03 ? 184 SER A CB  1 
ATOM 1330 O OG  . SER A 1 167 ? 1.005   -38.962 20.055  1.00 41.04 ? 184 SER A OG  1 
ATOM 1331 N N   . LYS A 1 168 ? -0.829  -36.420 20.564  1.00 50.21 ? 185 LYS A N   1 
ATOM 1332 C CA  . LYS A 1 168 ? -1.386  -35.629 19.477  1.00 53.14 ? 185 LYS A CA  1 
ATOM 1333 C C   . LYS A 1 168 ? -0.776  -36.007 18.140  1.00 54.28 ? 185 LYS A C   1 
ATOM 1334 O O   . LYS A 1 168 ? -1.317  -35.646 17.104  1.00 54.93 ? 185 LYS A O   1 
ATOM 1335 C CB  . LYS A 1 168 ? -1.212  -34.128 19.727  1.00 52.94 ? 185 LYS A CB  1 
ATOM 1336 C CG  . LYS A 1 168 ? -2.284  -33.510 20.636  1.00 54.97 ? 185 LYS A CG  1 
ATOM 1337 C CD  . LYS A 1 168 ? -1.908  -32.109 21.144  1.00 55.58 ? 185 LYS A CD  1 
ATOM 1338 C CE  . LYS A 1 168 ? -0.567  -32.138 21.916  1.00 60.14 ? 185 LYS A CE  1 
ATOM 1339 N NZ  . LYS A 1 168 ? -0.095  -30.786 22.348  1.00 62.05 ? 185 LYS A NZ  1 
ATOM 1340 N N   . ARG A 1 169 ? 0.346   -36.713 18.137  1.00 56.20 ? 186 ARG A N   1 
ATOM 1341 C CA  . ARG A 1 169 ? 0.841   -37.287 16.879  1.00 58.18 ? 186 ARG A CA  1 
ATOM 1342 C C   . ARG A 1 169 ? -0.074  -38.441 16.439  1.00 58.61 ? 186 ARG A C   1 
ATOM 1343 O O   . ARG A 1 169 ? -0.758  -38.336 15.432  1.00 58.74 ? 186 ARG A O   1 
ATOM 1344 C CB  . ARG A 1 169 ? 2.280   -37.788 17.013  1.00 58.28 ? 186 ARG A CB  1 
ATOM 1345 C CG  . ARG A 1 169 ? 3.378   -36.741 16.900  1.00 59.35 ? 186 ARG A CG  1 
ATOM 1346 C CD  . ARG A 1 169 ? 4.732   -37.447 16.575  1.00 59.93 ? 186 ARG A CD  1 
ATOM 1347 N NE  . ARG A 1 169 ? 5.901   -36.795 17.182  1.00 62.70 ? 186 ARG A NE  1 
ATOM 1348 C CZ  . ARG A 1 169 ? 6.059   -36.619 18.494  1.00 64.02 ? 186 ARG A CZ  1 
ATOM 1349 N NH1 . ARG A 1 169 ? 5.107   -37.012 19.352  1.00 62.67 ? 186 ARG A NH1 1 
ATOM 1350 N NH2 . ARG A 1 169 ? 7.165   -36.040 18.951  1.00 64.42 ? 186 ARG A NH2 1 
ATOM 1351 N N   . GLU A 1 170 ? -0.096  -39.534 17.201  1.00 59.48 ? 187 GLU A N   1 
ATOM 1352 C CA  . GLU A 1 170 ? -0.961  -40.663 16.885  1.00 60.12 ? 187 GLU A CA  1 
ATOM 1353 C C   . GLU A 1 170 ? -2.081  -40.758 17.896  1.00 60.49 ? 187 GLU A C   1 
ATOM 1354 O O   . GLU A 1 170 ? -1.812  -40.787 19.099  1.00 60.99 ? 187 GLU A O   1 
ATOM 1355 C CB  . GLU A 1 170 ? -0.161  -41.947 16.941  1.00 60.46 ? 187 GLU A CB  1 
ATOM 1356 C CG  . GLU A 1 170 ? -1.014  -43.209 17.142  1.00 61.49 ? 187 GLU A CG  1 
ATOM 1357 C CD  . GLU A 1 170 ? -1.897  -43.544 15.953  1.00 63.30 ? 187 GLU A CD  1 
ATOM 1358 O OE1 . GLU A 1 170 ? -1.366  -43.631 14.805  1.00 60.06 ? 187 GLU A OE1 1 
ATOM 1359 O OE2 . GLU A 1 170 ? -3.121  -43.744 16.199  1.00 65.53 ? 187 GLU A OE2 1 
ATOM 1360 N N   . GLU A 1 171 ? -3.329  -40.828 17.424  1.00 60.44 ? 188 GLU A N   1 
ATOM 1361 C CA  . GLU A 1 171 ? -4.502  -40.841 18.338  1.00 59.80 ? 188 GLU A CA  1 
ATOM 1362 C C   . GLU A 1 171 ? -4.513  -42.008 19.372  1.00 58.88 ? 188 GLU A C   1 
ATOM 1363 O O   . GLU A 1 171 ? -4.988  -41.841 20.509  1.00 58.80 ? 188 GLU A O   1 
ATOM 1364 C CB  . GLU A 1 171 ? -5.856  -40.742 17.565  1.00 60.27 ? 188 GLU A CB  1 
ATOM 1365 C CG  . GLU A 1 171 ? -5.974  -41.424 16.156  1.00 59.94 ? 188 GLU A CG  1 
ATOM 1366 C CD  . GLU A 1 171 ? -7.449  -41.634 15.738  1.00 60.75 ? 188 GLU A CD  1 
ATOM 1367 O OE1 . GLU A 1 171 ? -8.231  -42.212 16.534  1.00 60.51 ? 188 GLU A OE1 1 
ATOM 1368 O OE2 . GLU A 1 171 ? -7.844  -41.231 14.613  1.00 63.01 ? 188 GLU A OE2 1 
ATOM 1369 N N   . LYS A 1 172 ? -3.979  -43.168 18.976  1.00 57.11 ? 189 LYS A N   1 
ATOM 1370 C CA  . LYS A 1 172 ? -4.017  -44.365 19.817  1.00 55.45 ? 189 LYS A CA  1 
ATOM 1371 C C   . LYS A 1 172 ? -2.890  -44.452 20.859  1.00 53.56 ? 189 LYS A C   1 
ATOM 1372 O O   . LYS A 1 172 ? -3.011  -45.188 21.834  1.00 53.85 ? 189 LYS A O   1 
ATOM 1373 C CB  . LYS A 1 172 ? -3.994  -45.626 18.943  1.00 56.24 ? 189 LYS A CB  1 
ATOM 1374 C CG  . LYS A 1 172 ? -5.067  -45.719 17.871  1.00 58.56 ? 189 LYS A CG  1 
ATOM 1375 C CD  . LYS A 1 172 ? -6.453  -46.022 18.463  1.00 62.59 ? 189 LYS A CD  1 
ATOM 1376 C CE  . LYS A 1 172 ? -7.567  -45.743 17.437  1.00 65.10 ? 189 LYS A CE  1 
ATOM 1377 N NZ  . LYS A 1 172 ? -8.893  -45.746 18.106  1.00 66.87 ? 189 LYS A NZ  1 
ATOM 1378 N N   . LEU A 1 173 ? -1.790  -43.734 20.649  1.00 51.00 ? 190 LEU A N   1 
ATOM 1379 C CA  . LEU A 1 173 ? -0.690  -43.716 21.619  1.00 48.76 ? 190 LEU A CA  1 
ATOM 1380 C C   . LEU A 1 173 ? -0.864  -42.676 22.733  1.00 47.61 ? 190 LEU A C   1 
ATOM 1381 O O   . LEU A 1 173 ? -1.708  -41.779 22.625  1.00 48.03 ? 190 LEU A O   1 
ATOM 1382 C CB  . LEU A 1 173 ? 0.630   -43.445 20.907  1.00 48.75 ? 190 LEU A CB  1 
ATOM 1383 C CG  . LEU A 1 173 ? 0.967   -44.254 19.660  1.00 46.75 ? 190 LEU A CG  1 
ATOM 1384 C CD1 . LEU A 1 173 ? 2.294   -43.742 19.195  1.00 46.50 ? 190 LEU A CD1 1 
ATOM 1385 C CD2 . LEU A 1 173 ? 0.978   -45.786 19.868  1.00 45.45 ? 190 LEU A CD2 1 
ATOM 1386 N N   . PHE A 1 174 ? -0.056  -42.790 23.792  1.00 45.40 ? 191 PHE A N   1 
ATOM 1387 C CA  . PHE A 1 174 ? -0.106  -41.856 24.926  1.00 43.74 ? 191 PHE A CA  1 
ATOM 1388 C C   . PHE A 1 174 ? 1.132   -40.993 25.065  1.00 42.91 ? 191 PHE A C   1 
ATOM 1389 O O   . PHE A 1 174 ? 2.246   -41.470 24.810  1.00 43.59 ? 191 PHE A O   1 
ATOM 1390 C CB  . PHE A 1 174 ? -0.260  -42.612 26.222  1.00 42.96 ? 191 PHE A CB  1 
ATOM 1391 C CG  . PHE A 1 174 ? -1.496  -43.389 26.282  1.00 43.82 ? 191 PHE A CG  1 
ATOM 1392 C CD1 . PHE A 1 174 ? -1.497  -44.738 25.930  1.00 44.38 ? 191 PHE A CD1 1 
ATOM 1393 C CD2 . PHE A 1 174 ? -2.686  -42.781 26.673  1.00 43.19 ? 191 PHE A CD2 1 
ATOM 1394 C CE1 . PHE A 1 174 ? -2.678  -45.467 25.970  1.00 44.88 ? 191 PHE A CE1 1 
ATOM 1395 C CE2 . PHE A 1 174 ? -3.876  -43.492 26.716  1.00 41.76 ? 191 PHE A CE2 1 
ATOM 1396 C CZ  . PHE A 1 174 ? -3.876  -44.835 26.369  1.00 43.96 ? 191 PHE A CZ  1 
ATOM 1397 N N   . ASN A 1 175 ? 0.963   -39.744 25.502  1.00 40.30 ? 192 ASN A N   1 
ATOM 1398 C CA  . ASN A 1 175 ? 2.130   -38.989 25.829  1.00 38.18 ? 192 ASN A CA  1 
ATOM 1399 C C   . ASN A 1 175 ? 2.372   -39.171 27.303  1.00 37.20 ? 192 ASN A C   1 
ATOM 1400 O O   . ASN A 1 175 ? 1.436   -39.093 28.085  1.00 37.15 ? 192 ASN A O   1 
ATOM 1401 C CB  . ASN A 1 175 ? 1.972   -37.509 25.477  1.00 38.38 ? 192 ASN A CB  1 
ATOM 1402 C CG  . ASN A 1 175 ? 3.290   -36.789 25.483  1.00 36.42 ? 192 ASN A CG  1 
ATOM 1403 O OD1 . ASN A 1 175 ? 4.205   -37.173 24.762  1.00 36.14 ? 192 ASN A OD1 1 
ATOM 1404 N ND2 . ASN A 1 175 ? 3.418   -35.773 26.325  1.00 33.34 ? 192 ASN A ND2 1 
ATOM 1405 N N   . VAL A 1 176 ? 3.620   -39.435 27.689  1.00 36.02 ? 193 VAL A N   1 
ATOM 1406 C CA  . VAL A 1 176 ? 3.975   -39.458 29.105  1.00 34.47 ? 193 VAL A CA  1 
ATOM 1407 C C   . VAL A 1 176 ? 5.227   -38.637 29.361  1.00 33.55 ? 193 VAL A C   1 
ATOM 1408 O O   . VAL A 1 176 ? 6.286   -38.878 28.708  1.00 32.23 ? 193 VAL A O   1 
ATOM 1409 C CB  . VAL A 1 176 ? 4.194   -40.903 29.625  1.00 34.78 ? 193 VAL A CB  1 
ATOM 1410 C CG1 . VAL A 1 176 ? 4.441   -40.893 31.153  1.00 35.35 ? 193 VAL A CG1 1 
ATOM 1411 C CG2 . VAL A 1 176 ? 2.998   -41.772 29.309  1.00 34.42 ? 193 VAL A CG2 1 
ATOM 1412 N N   . THR A 1 177 ? 5.066   -37.687 30.304  1.00 32.61 ? 194 THR A N   1 
ATOM 1413 C CA  . THR A 1 177 ? 6.085   -36.698 30.756  1.00 32.31 ? 194 THR A CA  1 
ATOM 1414 C C   . THR A 1 177 ? 6.153   -36.694 32.242  1.00 31.63 ? 194 THR A C   1 
ATOM 1415 O O   . THR A 1 177 ? 5.136   -36.678 32.922  1.00 31.44 ? 194 THR A O   1 
ATOM 1416 C CB  . THR A 1 177 ? 5.735   -35.206 30.504  1.00 31.88 ? 194 THR A CB  1 
ATOM 1417 O OG1 . THR A 1 177 ? 4.605   -35.072 29.672  1.00 33.32 ? 194 THR A OG1 1 
ATOM 1418 C CG2 . THR A 1 177 ? 6.856   -34.485 29.866  1.00 33.25 ? 194 THR A CG2 1 
ATOM 1419 N N   . SER A 1 178 ? 7.350   -36.613 32.768  1.00 31.86 ? 195 SER A N   1 
ATOM 1420 C CA  . SER A 1 178 ? 7.492   -36.674 34.199  1.00 32.50 ? 195 SER A CA  1 
ATOM 1421 C C   . SER A 1 178 ? 8.569   -35.654 34.522  1.00 32.61 ? 195 SER A C   1 
ATOM 1422 O O   . SER A 1 178 ? 9.447   -35.388 33.679  1.00 32.56 ? 195 SER A O   1 
ATOM 1423 C CB  . SER A 1 178 ? 7.911   -38.108 34.572  1.00 33.40 ? 195 SER A CB  1 
ATOM 1424 O OG  . SER A 1 178 ? 7.966   -38.381 35.960  1.00 33.98 ? 195 SER A OG  1 
ATOM 1425 N N   . THR A 1 179 ? 8.492   -35.085 35.722  1.00 33.16 ? 196 THR A N   1 
ATOM 1426 C CA  . THR A 1 179 ? 9.389   -34.021 36.128  1.00 33.79 ? 196 THR A CA  1 
ATOM 1427 C C   . THR A 1 179 ? 9.810   -34.245 37.553  1.00 34.55 ? 196 THR A C   1 
ATOM 1428 O O   . THR A 1 179 ? 9.003   -34.575 38.402  1.00 34.92 ? 196 THR A O   1 
ATOM 1429 C CB  . THR A 1 179 ? 8.740   -32.629 35.912  1.00 33.63 ? 196 THR A CB  1 
ATOM 1430 O OG1 . THR A 1 179 ? 8.743   -32.347 34.503  1.00 34.20 ? 196 THR A OG1 1 
ATOM 1431 C CG2 . THR A 1 179 ? 9.493   -31.526 36.610  1.00 31.94 ? 196 THR A CG2 1 
ATOM 1432 N N   . LEU A 1 180 ? 11.104  -34.116 37.790  1.00 35.62 ? 197 LEU A N   1 
ATOM 1433 C CA  . LEU A 1 180 ? 11.691  -34.269 39.113  1.00 36.21 ? 197 LEU A CA  1 
ATOM 1434 C C   . LEU A 1 180 ? 12.282  -32.917 39.427  1.00 37.30 ? 197 LEU A C   1 
ATOM 1435 O O   . LEU A 1 180 ? 13.034  -32.401 38.607  1.00 37.35 ? 197 LEU A O   1 
ATOM 1436 C CB  . LEU A 1 180 ? 12.867  -35.220 39.014  1.00 35.59 ? 197 LEU A CB  1 
ATOM 1437 C CG  . LEU A 1 180 ? 13.396  -36.003 40.188  1.00 33.28 ? 197 LEU A CG  1 
ATOM 1438 C CD1 . LEU A 1 180 ? 14.881  -35.876 40.191  1.00 31.24 ? 197 LEU A CD1 1 
ATOM 1439 C CD2 . LEU A 1 180 ? 12.792  -35.615 41.502  1.00 32.47 ? 197 LEU A CD2 1 
ATOM 1440 N N   . ARG A 1 181 ? 11.984  -32.370 40.604  1.00 38.68 ? 198 ARG A N   1 
ATOM 1441 C CA  . ARG A 1 181 ? 12.658  -31.164 41.077  1.00 40.64 ? 198 ARG A CA  1 
ATOM 1442 C C   . ARG A 1 181 ? 13.564  -31.574 42.240  1.00 40.44 ? 198 ARG A C   1 
ATOM 1443 O O   . ARG A 1 181 ? 13.101  -32.116 43.249  1.00 40.50 ? 198 ARG A O   1 
ATOM 1444 C CB  . ARG A 1 181 ? 11.650  -30.078 41.474  1.00 40.20 ? 198 ARG A CB  1 
ATOM 1445 C CG  . ARG A 1 181 ? 10.580  -29.796 40.389  1.00 43.03 ? 198 ARG A CG  1 
ATOM 1446 C CD  . ARG A 1 181 ? 9.592   -28.638 40.758  1.00 44.26 ? 198 ARG A CD  1 
ATOM 1447 N NE  . ARG A 1 181 ? 9.960   -27.343 40.131  1.00 51.06 ? 198 ARG A NE  1 
ATOM 1448 C CZ  . ARG A 1 181 ? 10.842  -26.469 40.640  1.00 52.86 ? 198 ARG A CZ  1 
ATOM 1449 N NH1 . ARG A 1 181 ? 11.478  -26.723 41.801  1.00 52.42 ? 198 ARG A NH1 1 
ATOM 1450 N NH2 . ARG A 1 181 ? 11.103  -25.335 39.987  1.00 55.24 ? 198 ARG A NH2 1 
ATOM 1451 N N   . ILE A 1 182 ? 14.862  -31.364 42.099  1.00 40.56 ? 199 ILE A N   1 
ATOM 1452 C CA  . ILE A 1 182 ? 15.730  -31.921 43.093  1.00 41.80 ? 199 ILE A CA  1 
ATOM 1453 C C   . ILE A 1 182 ? 16.958  -31.090 43.213  1.00 42.36 ? 199 ILE A C   1 
ATOM 1454 O O   . ILE A 1 182 ? 17.509  -30.711 42.199  1.00 42.50 ? 199 ILE A O   1 
ATOM 1455 C CB  . ILE A 1 182 ? 16.179  -33.357 42.706  1.00 42.27 ? 199 ILE A CB  1 
ATOM 1456 C CG1 . ILE A 1 182 ? 16.781  -34.107 43.911  1.00 41.29 ? 199 ILE A CG1 1 
ATOM 1457 C CG2 . ILE A 1 182 ? 17.186  -33.314 41.522  1.00 42.24 ? 199 ILE A CG2 1 
ATOM 1458 C CD1 . ILE A 1 182 ? 15.752  -34.844 44.755  1.00 42.29 ? 199 ILE A CD1 1 
ATOM 1459 N N   . ASN A 1 183 ? 17.403  -30.847 44.444  1.00 42.78 ? 200 ASN A N   1 
ATOM 1460 C CA  . ASN A 1 183 ? 18.659  -30.179 44.662  1.00 43.39 ? 200 ASN A CA  1 
ATOM 1461 C C   . ASN A 1 183 ? 19.696  -31.199 44.443  1.00 44.13 ? 200 ASN A C   1 
ATOM 1462 O O   . ASN A 1 183 ? 19.695  -32.178 45.152  1.00 44.39 ? 200 ASN A O   1 
ATOM 1463 C CB  . ASN A 1 183 ? 18.810  -29.753 46.109  1.00 43.45 ? 200 ASN A CB  1 
ATOM 1464 C CG  . ASN A 1 183 ? 17.877  -28.686 46.480  1.00 41.41 ? 200 ASN A CG  1 
ATOM 1465 O OD1 . ASN A 1 183 ? 17.320  -28.026 45.627  1.00 41.75 ? 200 ASN A OD1 1 
ATOM 1466 N ND2 . ASN A 1 183 ? 17.680  -28.506 47.758  1.00 40.80 ? 200 ASN A ND2 1 
ATOM 1467 N N   . THR A 1 184 ? 20.598  -30.956 43.498  1.00 45.27 ? 201 THR A N   1 
ATOM 1468 C CA  . THR A 1 184 ? 21.666  -31.905 43.160  1.00 46.06 ? 201 THR A CA  1 
ATOM 1469 C C   . THR A 1 184 ? 22.928  -31.110 42.767  1.00 47.01 ? 201 THR A C   1 
ATOM 1470 O O   . THR A 1 184 ? 22.981  -29.922 43.044  1.00 47.81 ? 201 THR A O   1 
ATOM 1471 C CB  . THR A 1 184 ? 21.176  -32.841 42.060  1.00 45.92 ? 201 THR A CB  1 
ATOM 1472 O OG1 . THR A 1 184 ? 22.255  -33.650 41.596  1.00 45.26 ? 201 THR A OG1 1 
ATOM 1473 C CG2 . THR A 1 184 ? 20.572  -32.044 40.916  1.00 44.44 ? 201 THR A CG2 1 
ATOM 1474 N N   . THR A 1 185 ? 23.942  -31.726 42.156  1.00 47.86 ? 202 THR A N   1 
ATOM 1475 C CA  . THR A 1 185 ? 25.210  -31.005 41.803  1.00 49.03 ? 202 THR A CA  1 
ATOM 1476 C C   . THR A 1 185 ? 25.873  -31.602 40.575  1.00 48.94 ? 202 THR A C   1 
ATOM 1477 O O   . THR A 1 185 ? 25.700  -32.792 40.289  1.00 48.98 ? 202 THR A O   1 
ATOM 1478 C CB  . THR A 1 185 ? 26.319  -30.979 42.960  1.00 49.22 ? 202 THR A CB  1 
ATOM 1479 O OG1 . THR A 1 185 ? 26.547  -32.300 43.460  1.00 50.33 ? 202 THR A OG1 1 
ATOM 1480 C CG2 . THR A 1 185 ? 25.944  -30.072 44.147  1.00 49.54 ? 202 THR A CG2 1 
ATOM 1481 N N   . THR A 1 186 ? 26.647  -30.779 39.868  1.00 49.24 ? 203 THR A N   1 
ATOM 1482 C CA  . THR A 1 186 ? 27.334  -31.214 38.656  1.00 49.10 ? 203 THR A CA  1 
ATOM 1483 C C   . THR A 1 186 ? 27.768  -32.653 38.766  1.00 49.06 ? 203 THR A C   1 
ATOM 1484 O O   . THR A 1 186 ? 28.329  -33.059 39.798  1.00 49.00 ? 203 THR A O   1 
ATOM 1485 C CB  . THR A 1 186 ? 28.563  -30.345 38.348  1.00 49.26 ? 203 THR A CB  1 
ATOM 1486 O OG1 . THR A 1 186 ? 28.138  -29.217 37.571  1.00 49.30 ? 203 THR A OG1 1 
ATOM 1487 C CG2 . THR A 1 186 ? 29.616  -31.134 37.541  1.00 48.57 ? 203 THR A CG2 1 
ATOM 1488 N N   . ASN A 1 187 ? 27.468  -33.408 37.704  1.00 48.73 ? 204 ASN A N   1 
ATOM 1489 C CA  . ASN A 1 187 ? 27.915  -34.794 37.501  1.00 48.49 ? 204 ASN A CA  1 
ATOM 1490 C C   . ASN A 1 187 ? 27.140  -35.852 38.219  1.00 48.01 ? 204 ASN A C   1 
ATOM 1491 O O   . ASN A 1 187 ? 27.300  -37.013 37.906  1.00 48.40 ? 204 ASN A O   1 
ATOM 1492 C CB  . ASN A 1 187 ? 29.403  -34.980 37.791  1.00 48.83 ? 204 ASN A CB  1 
ATOM 1493 C CG  . ASN A 1 187 ? 30.253  -34.935 36.530  1.00 51.01 ? 204 ASN A CG  1 
ATOM 1494 O OD1 . ASN A 1 187 ? 29.739  -34.949 35.393  1.00 52.68 ? 204 ASN A OD1 1 
ATOM 1495 N ND2 . ASN A 1 187 ? 31.567  -34.908 36.720  1.00 52.91 ? 204 ASN A ND2 1 
ATOM 1496 N N   . GLU A 1 188 ? 26.308  -35.479 39.183  1.00 47.57 ? 205 GLU A N   1 
ATOM 1497 C CA  . GLU A 1 188 ? 25.355  -36.437 39.713  1.00 47.55 ? 205 GLU A CA  1 
ATOM 1498 C C   . GLU A 1 188 ? 24.520  -37.087 38.588  1.00 46.65 ? 205 GLU A C   1 
ATOM 1499 O O   . GLU A 1 188 ? 24.226  -36.455 37.564  1.00 46.84 ? 205 GLU A O   1 
ATOM 1500 C CB  . GLU A 1 188 ? 24.442  -35.754 40.701  1.00 48.24 ? 205 GLU A CB  1 
ATOM 1501 C CG  . GLU A 1 188 ? 25.159  -35.233 41.909  1.00 51.13 ? 205 GLU A CG  1 
ATOM 1502 C CD  . GLU A 1 188 ? 25.355  -36.291 42.988  1.00 57.15 ? 205 GLU A CD  1 
ATOM 1503 O OE1 . GLU A 1 188 ? 26.255  -36.072 43.845  1.00 60.19 ? 205 GLU A OE1 1 
ATOM 1504 O OE2 . GLU A 1 188 ? 24.632  -37.337 42.978  1.00 57.64 ? 205 GLU A OE2 1 
ATOM 1505 N N   . ILE A 1 189 ? 24.164  -38.359 38.765  1.00 45.58 ? 206 ILE A N   1 
ATOM 1506 C CA  . ILE A 1 189 ? 23.362  -39.091 37.764  1.00 43.81 ? 206 ILE A CA  1 
ATOM 1507 C C   . ILE A 1 189 ? 21.968  -39.515 38.267  1.00 42.11 ? 206 ILE A C   1 
ATOM 1508 O O   . ILE A 1 189 ? 21.796  -39.891 39.446  1.00 41.41 ? 206 ILE A O   1 
ATOM 1509 C CB  . ILE A 1 189 ? 24.117  -40.289 37.223  1.00 44.27 ? 206 ILE A CB  1 
ATOM 1510 C CG1 . ILE A 1 189 ? 25.410  -39.817 36.530  1.00 45.87 ? 206 ILE A CG1 1 
ATOM 1511 C CG2 . ILE A 1 189 ? 23.252  -41.049 36.233  1.00 44.80 ? 206 ILE A CG2 1 
ATOM 1512 C CD1 . ILE A 1 189 ? 26.514  -40.879 36.414  1.00 47.50 ? 206 ILE A CD1 1 
ATOM 1513 N N   . PHE A 1 190 ? 20.986  -39.434 37.366  1.00 39.81 ? 207 PHE A N   1 
ATOM 1514 C CA  . PHE A 1 190 ? 19.607  -39.777 37.692  1.00 38.77 ? 207 PHE A CA  1 
ATOM 1515 C C   . PHE A 1 190 ? 19.009  -40.559 36.566  1.00 37.90 ? 207 PHE A C   1 
ATOM 1516 O O   . PHE A 1 190 ? 19.429  -40.368 35.418  1.00 38.55 ? 207 PHE A O   1 
ATOM 1517 C CB  . PHE A 1 190 ? 18.762  -38.517 37.918  1.00 38.09 ? 207 PHE A CB  1 
ATOM 1518 C CG  . PHE A 1 190 ? 19.123  -37.778 39.164  1.00 38.28 ? 207 PHE A CG  1 
ATOM 1519 C CD1 . PHE A 1 190 ? 20.097  -36.791 39.152  1.00 36.94 ? 207 PHE A CD1 1 
ATOM 1520 C CD2 . PHE A 1 190 ? 18.516  -38.087 40.372  1.00 37.27 ? 207 PHE A CD2 1 
ATOM 1521 C CE1 . PHE A 1 190 ? 20.453  -36.150 40.321  1.00 34.53 ? 207 PHE A CE1 1 
ATOM 1522 C CE2 . PHE A 1 190 ? 18.866  -37.410 41.527  1.00 33.71 ? 207 PHE A CE2 1 
ATOM 1523 C CZ  . PHE A 1 190 ? 19.836  -36.461 41.485  1.00 34.35 ? 207 PHE A CZ  1 
ATOM 1524 N N   . TYR A 1 191 ? 18.026  -41.414 36.868  1.00 36.36 ? 208 TYR A N   1 
ATOM 1525 C CA  . TYR A 1 191 ? 17.351  -42.167 35.799  1.00 35.75 ? 208 TYR A CA  1 
ATOM 1526 C C   . TYR A 1 191 ? 15.871  -41.952 35.786  1.00 35.25 ? 208 TYR A C   1 
ATOM 1527 O O   . TYR A 1 191 ? 15.238  -41.840 36.862  1.00 34.89 ? 208 TYR A O   1 
ATOM 1528 C CB  . TYR A 1 191 ? 17.565  -43.680 35.916  1.00 35.60 ? 208 TYR A CB  1 
ATOM 1529 C CG  . TYR A 1 191 ? 18.971  -44.085 36.106  1.00 33.82 ? 208 TYR A CG  1 
ATOM 1530 C CD1 . TYR A 1 191 ? 19.423  -44.474 37.352  1.00 31.93 ? 208 TYR A CD1 1 
ATOM 1531 C CD2 . TYR A 1 191 ? 19.869  -44.060 35.033  1.00 34.21 ? 208 TYR A CD2 1 
ATOM 1532 C CE1 . TYR A 1 191 ? 20.735  -44.856 37.541  1.00 33.04 ? 208 TYR A CE1 1 
ATOM 1533 C CE2 . TYR A 1 191 ? 21.183  -44.441 35.196  1.00 32.10 ? 208 TYR A CE2 1 
ATOM 1534 C CZ  . TYR A 1 191 ? 21.599  -44.829 36.451  1.00 34.78 ? 208 TYR A CZ  1 
ATOM 1535 O OH  . TYR A 1 191 ? 22.906  -45.174 36.621  1.00 37.92 ? 208 TYR A OH  1 
ATOM 1536 N N   . CYS A 1 192 ? 15.330  -41.929 34.567  1.00 34.40 ? 209 CYS A N   1 
ATOM 1537 C CA  . CYS A 1 192 ? 13.896  -41.979 34.375  1.00 34.43 ? 209 CYS A CA  1 
ATOM 1538 C C   . CYS A 1 192 ? 13.567  -43.217 33.550  1.00 33.91 ? 209 CYS A C   1 
ATOM 1539 O O   . CYS A 1 192 ? 13.987  -43.339 32.400  1.00 33.62 ? 209 CYS A O   1 
ATOM 1540 C CB  . CYS A 1 192 ? 13.393  -40.716 33.692  1.00 34.06 ? 209 CYS A CB  1 
ATOM 1541 S SG  . CYS A 1 192 ? 14.175  -40.499 32.116  1.00 36.69 ? 209 CYS A SG  1 
ATOM 1542 N N   . THR A 1 193 ? 12.811  -44.113 34.176  1.00 33.23 ? 210 THR A N   1 
ATOM 1543 C CA  . THR A 1 193 ? 12.437  -45.406 33.658  1.00 33.07 ? 210 THR A CA  1 
ATOM 1544 C C   . THR A 1 193 ? 10.949  -45.447 33.274  1.00 33.11 ? 210 THR A C   1 
ATOM 1545 O O   . THR A 1 193 ? 10.050  -45.252 34.098  1.00 32.84 ? 210 THR A O   1 
ATOM 1546 C CB  . THR A 1 193 ? 12.760  -46.447 34.758  1.00 33.72 ? 210 THR A CB  1 
ATOM 1547 O OG1 . THR A 1 193 ? 14.175  -46.602 34.776  1.00 35.56 ? 210 THR A OG1 1 
ATOM 1548 C CG2 . THR A 1 193 ? 12.106  -47.839 34.534  1.00 31.00 ? 210 THR A CG2 1 
ATOM 1549 N N   . PHE A 1 194 ? 10.690  -45.678 32.007  1.00 33.19 ? 211 PHE A N   1 
ATOM 1550 C CA  . PHE A 1 194 ? 9.329   -45.796 31.551  1.00 33.53 ? 211 PHE A CA  1 
ATOM 1551 C C   . PHE A 1 194 ? 9.000   -47.274 31.630  1.00 33.97 ? 211 PHE A C   1 
ATOM 1552 O O   . PHE A 1 194 ? 9.511   -48.085 30.839  1.00 32.69 ? 211 PHE A O   1 
ATOM 1553 C CB  . PHE A 1 194 ? 9.229   -45.297 30.116  1.00 33.67 ? 211 PHE A CB  1 
ATOM 1554 C CG  . PHE A 1 194 ? 9.344   -43.854 30.005  1.00 33.35 ? 211 PHE A CG  1 
ATOM 1555 C CD1 . PHE A 1 194 ? 10.574  -43.237 30.217  1.00 35.14 ? 211 PHE A CD1 1 
ATOM 1556 C CD2 . PHE A 1 194 ? 8.210   -43.084 29.754  1.00 33.11 ? 211 PHE A CD2 1 
ATOM 1557 C CE1 . PHE A 1 194 ? 10.683  -41.848 30.177  1.00 34.66 ? 211 PHE A CE1 1 
ATOM 1558 C CE2 . PHE A 1 194 ? 8.274   -41.738 29.727  1.00 33.74 ? 211 PHE A CE2 1 
ATOM 1559 C CZ  . PHE A 1 194 ? 9.529   -41.094 29.922  1.00 36.24 ? 211 PHE A CZ  1 
ATOM 1560 N N   . ARG A 1 195 ? 8.172   -47.617 32.603  1.00 34.43 ? 212 ARG A N   1 
ATOM 1561 C CA  . ARG A 1 195 ? 7.775   -48.969 32.763  1.00 36.31 ? 212 ARG A CA  1 
ATOM 1562 C C   . ARG A 1 195 ? 6.365   -49.101 32.268  1.00 38.44 ? 212 ARG A C   1 
ATOM 1563 O O   . ARG A 1 195 ? 5.651   -48.131 32.173  1.00 38.87 ? 212 ARG A O   1 
ATOM 1564 C CB  . ARG A 1 195 ? 7.908   -49.395 34.220  1.00 36.22 ? 212 ARG A CB  1 
ATOM 1565 C CG  . ARG A 1 195 ? 7.275   -50.743 34.607  1.00 34.37 ? 212 ARG A CG  1 
ATOM 1566 C CD  . ARG A 1 195 ? 7.554   -51.027 36.043  1.00 29.85 ? 212 ARG A CD  1 
ATOM 1567 N NE  . ARG A 1 195 ? 8.997   -51.104 36.203  1.00 31.27 ? 212 ARG A NE  1 
ATOM 1568 C CZ  . ARG A 1 195 ? 9.625   -51.288 37.363  1.00 31.64 ? 212 ARG A CZ  1 
ATOM 1569 N NH1 . ARG A 1 195 ? 8.937   -51.443 38.502  1.00 28.12 ? 212 ARG A NH1 1 
ATOM 1570 N NH2 . ARG A 1 195 ? 10.957  -51.345 37.366  1.00 29.85 ? 212 ARG A NH2 1 
ATOM 1571 N N   . ARG A 1 196 ? 5.975   -50.341 31.993  1.00 41.08 ? 213 ARG A N   1 
ATOM 1572 C CA  . ARG A 1 196 ? 4.693   -50.693 31.425  1.00 42.79 ? 213 ARG A CA  1 
ATOM 1573 C C   . ARG A 1 196 ? 4.596   -52.216 31.595  1.00 43.97 ? 213 ARG A C   1 
ATOM 1574 O O   . ARG A 1 196 ? 5.561   -52.931 31.339  1.00 44.38 ? 213 ARG A O   1 
ATOM 1575 C CB  . ARG A 1 196 ? 4.702   -50.236 29.962  1.00 43.07 ? 213 ARG A CB  1 
ATOM 1576 C CG  . ARG A 1 196 ? 3.958   -51.044 28.973  1.00 44.26 ? 213 ARG A CG  1 
ATOM 1577 C CD  . ARG A 1 196 ? 4.686   -52.370 28.689  1.00 47.36 ? 213 ARG A CD  1 
ATOM 1578 N NE  . ARG A 1 196 ? 3.672   -53.429 28.597  1.00 46.87 ? 213 ARG A NE  1 
ATOM 1579 C CZ  . ARG A 1 196 ? 3.168   -53.859 27.451  1.00 44.63 ? 213 ARG A CZ  1 
ATOM 1580 N NH1 . ARG A 1 196 ? 3.631   -53.361 26.315  1.00 45.97 ? 213 ARG A NH1 1 
ATOM 1581 N NH2 . ARG A 1 196 ? 2.237   -54.794 27.440  1.00 43.35 ? 213 ARG A NH2 1 
ATOM 1582 N N   . LEU A 1 197 ? 3.441   -52.700 32.049  1.00 45.62 ? 214 LEU A N   1 
ATOM 1583 C CA  . LEU A 1 197 ? 3.233   -54.113 32.483  1.00 46.48 ? 214 LEU A CA  1 
ATOM 1584 C C   . LEU A 1 197 ? 2.587   -55.038 31.450  1.00 46.56 ? 214 LEU A C   1 
ATOM 1585 O O   . LEU A 1 197 ? 2.121   -54.548 30.422  1.00 47.14 ? 214 LEU A O   1 
ATOM 1586 C CB  . LEU A 1 197 ? 2.315   -54.084 33.684  1.00 46.12 ? 214 LEU A CB  1 
ATOM 1587 C CG  . LEU A 1 197 ? 2.744   -53.036 34.693  1.00 48.38 ? 214 LEU A CG  1 
ATOM 1588 C CD1 . LEU A 1 197 ? 1.653   -52.849 35.774  1.00 49.29 ? 214 LEU A CD1 1 
ATOM 1589 C CD2 . LEU A 1 197 ? 4.085   -53.475 35.304  1.00 49.40 ? 214 LEU A CD2 1 
ATOM 1590 N N   . ASP A 1 198 ? 2.528   -56.349 31.762  1.00 46.40 ? 215 ASP A N   1 
ATOM 1591 C CA  . ASP A 1 198 ? 1.878   -57.433 30.951  1.00 45.87 ? 215 ASP A CA  1 
ATOM 1592 C C   . ASP A 1 198 ? 2.218   -57.420 29.480  1.00 44.92 ? 215 ASP A C   1 
ATOM 1593 O O   . ASP A 1 198 ? 1.330   -57.165 28.676  1.00 44.59 ? 215 ASP A O   1 
ATOM 1594 C CB  . ASP A 1 198 ? 0.338   -57.388 30.961  1.00 46.30 ? 215 ASP A CB  1 
ATOM 1595 C CG  . ASP A 1 198 ? -0.268  -57.175 32.333  1.00 49.45 ? 215 ASP A CG  1 
ATOM 1596 O OD1 . ASP A 1 198 ? 0.428   -57.361 33.361  1.00 52.75 ? 215 ASP A OD1 1 
ATOM 1597 O OD2 . ASP A 1 198 ? -1.480  -56.814 32.375  1.00 52.16 ? 215 ASP A OD2 1 
ATOM 1598 N N   . PRO A 1 199 ? 3.466   -57.713 29.101  1.00 44.41 ? 216 PRO A N   1 
ATOM 1599 C CA  . PRO A 1 199 ? 4.581   -58.055 29.954  1.00 44.46 ? 216 PRO A CA  1 
ATOM 1600 C C   . PRO A 1 199 ? 5.223   -56.784 30.436  1.00 45.11 ? 216 PRO A C   1 
ATOM 1601 O O   . PRO A 1 199 ? 5.019   -55.743 29.830  1.00 45.88 ? 216 PRO A O   1 
ATOM 1602 C CB  . PRO A 1 199 ? 5.530   -58.761 29.002  1.00 44.51 ? 216 PRO A CB  1 
ATOM 1603 C CG  . PRO A 1 199 ? 5.230   -58.198 27.633  1.00 44.12 ? 216 PRO A CG  1 
ATOM 1604 C CD  . PRO A 1 199 ? 3.818   -57.712 27.665  1.00 44.11 ? 216 PRO A CD  1 
ATOM 1605 N N   . GLU A 1 200 ? 6.004   -56.846 31.511  1.00 45.24 ? 217 GLU A N   1 
ATOM 1606 C CA  . GLU A 1 200 ? 6.774   -55.684 31.882  1.00 43.89 ? 217 GLU A CA  1 
ATOM 1607 C C   . GLU A 1 200 ? 7.761   -55.347 30.773  1.00 43.52 ? 217 GLU A C   1 
ATOM 1608 O O   . GLU A 1 200 ? 8.272   -56.216 30.070  1.00 43.30 ? 217 GLU A O   1 
ATOM 1609 C CB  . GLU A 1 200 ? 7.513   -55.888 33.172  1.00 43.77 ? 217 GLU A CB  1 
ATOM 1610 C CG  . GLU A 1 200 ? 8.219   -54.640 33.518  1.00 44.29 ? 217 GLU A CG  1 
ATOM 1611 C CD  . GLU A 1 200 ? 8.870   -54.675 34.852  1.00 45.92 ? 217 GLU A CD  1 
ATOM 1612 O OE1 . GLU A 1 200 ? 10.103  -54.372 34.902  1.00 43.16 ? 217 GLU A OE1 1 
ATOM 1613 O OE2 . GLU A 1 200 ? 8.139   -54.988 35.838  1.00 46.32 ? 217 GLU A OE2 1 
ATOM 1614 N N   . GLU A 1 201 ? 8.002   -54.057 30.617  1.00 43.44 ? 218 GLU A N   1 
ATOM 1615 C CA  . GLU A 1 201 ? 8.987   -53.548 29.681  1.00 42.95 ? 218 GLU A CA  1 
ATOM 1616 C C   . GLU A 1 201 ? 9.498   -52.212 30.247  1.00 42.55 ? 218 GLU A C   1 
ATOM 1617 O O   . GLU A 1 201 ? 8.701   -51.299 30.515  1.00 42.52 ? 218 GLU A O   1 
ATOM 1618 C CB  . GLU A 1 201 ? 8.352   -53.379 28.302  1.00 42.82 ? 218 GLU A CB  1 
ATOM 1619 C CG  . GLU A 1 201 ? 9.336   -53.170 27.206  1.00 43.55 ? 218 GLU A CG  1 
ATOM 1620 C CD  . GLU A 1 201 ? 8.726   -53.162 25.816  1.00 45.80 ? 218 GLU A CD  1 
ATOM 1621 O OE1 . GLU A 1 201 ? 9.506   -53.070 24.848  1.00 48.30 ? 218 GLU A OE1 1 
ATOM 1622 O OE2 . GLU A 1 201 ? 7.492   -53.270 25.660  1.00 47.17 ? 218 GLU A OE2 1 
ATOM 1623 N N   . ASN A 1 202 ? 10.811  -52.140 30.472  1.00 41.70 ? 219 ASN A N   1 
ATOM 1624 C CA  . ASN A 1 202 ? 11.491  -50.927 30.889  1.00 41.10 ? 219 ASN A CA  1 
ATOM 1625 C C   . ASN A 1 202 ? 12.360  -50.305 29.778  1.00 41.46 ? 219 ASN A C   1 
ATOM 1626 O O   . ASN A 1 202 ? 13.012  -50.990 28.967  1.00 41.14 ? 219 ASN A O   1 
ATOM 1627 C CB  . ASN A 1 202 ? 12.360  -51.168 32.116  1.00 40.77 ? 219 ASN A CB  1 
ATOM 1628 C CG  . ASN A 1 202 ? 11.607  -51.793 33.246  1.00 40.01 ? 219 ASN A CG  1 
ATOM 1629 O OD1 . ASN A 1 202 ? 10.846  -51.138 33.958  1.00 42.31 ? 219 ASN A OD1 1 
ATOM 1630 N ND2 . ASN A 1 202 ? 11.841  -53.062 33.454  1.00 40.75 ? 219 ASN A ND2 1 
ATOM 1631 N N   . HIS A 1 203 ? 12.325  -48.979 29.760  1.00 41.36 ? 220 HIS A N   1 
ATOM 1632 C CA  . HIS A 1 203 ? 13.197  -48.173 28.973  1.00 40.87 ? 220 HIS A CA  1 
ATOM 1633 C C   . HIS A 1 203 ? 13.541  -47.035 29.862  1.00 40.74 ? 220 HIS A C   1 
ATOM 1634 O O   . HIS A 1 203 ? 12.644  -46.384 30.422  1.00 41.27 ? 220 HIS A O   1 
ATOM 1635 C CB  . HIS A 1 203 ? 12.471  -47.677 27.769  1.00 40.66 ? 220 HIS A CB  1 
ATOM 1636 C CG  . HIS A 1 203 ? 12.185  -48.754 26.787  1.00 43.56 ? 220 HIS A CG  1 
ATOM 1637 N ND1 . HIS A 1 203 ? 13.165  -49.612 26.327  1.00 45.17 ? 220 HIS A ND1 1 
ATOM 1638 C CD2 . HIS A 1 203 ? 11.039  -49.119 26.169  1.00 44.22 ? 220 HIS A CD2 1 
ATOM 1639 C CE1 . HIS A 1 203 ? 12.634  -50.457 25.464  1.00 44.95 ? 220 HIS A CE1 1 
ATOM 1640 N NE2 . HIS A 1 203 ? 11.347  -50.178 25.347  1.00 45.04 ? 220 HIS A NE2 1 
ATOM 1641 N N   . THR A 1 204 ? 14.834  -46.809 30.036  1.00 40.12 ? 221 THR A N   1 
ATOM 1642 C CA  . THR A 1 204 ? 15.262  -45.734 30.886  1.00 40.36 ? 221 THR A CA  1 
ATOM 1643 C C   . THR A 1 204 ? 16.372  -44.941 30.231  1.00 40.59 ? 221 THR A C   1 
ATOM 1644 O O   . THR A 1 204 ? 17.227  -45.519 29.540  1.00 40.70 ? 221 THR A O   1 
ATOM 1645 C CB  . THR A 1 204 ? 15.648  -46.217 32.312  1.00 40.23 ? 221 THR A CB  1 
ATOM 1646 O OG1 . THR A 1 204 ? 17.036  -45.987 32.565  1.00 39.97 ? 221 THR A OG1 1 
ATOM 1647 C CG2 . THR A 1 204 ? 15.310  -47.658 32.496  1.00 40.31 ? 221 THR A CG2 1 
ATOM 1648 N N   . ALA A 1 205 ? 16.317  -43.617 30.421  1.00 40.27 ? 222 ALA A N   1 
ATOM 1649 C CA  . ALA A 1 205 ? 17.347  -42.700 29.923  1.00 40.13 ? 222 ALA A CA  1 
ATOM 1650 C C   . ALA A 1 205 ? 18.252  -42.291 31.066  1.00 40.34 ? 222 ALA A C   1 
ATOM 1651 O O   . ALA A 1 205 ? 17.811  -42.230 32.215  1.00 40.76 ? 222 ALA A O   1 
ATOM 1652 C CB  . ALA A 1 205 ? 16.725  -41.494 29.296  1.00 39.42 ? 222 ALA A CB  1 
ATOM 1653 N N   . GLU A 1 206 ? 19.527  -42.052 30.772  1.00 40.79 ? 223 GLU A N   1 
ATOM 1654 C CA  . GLU A 1 206 ? 20.450  -41.623 31.828  1.00 41.05 ? 223 GLU A CA  1 
ATOM 1655 C C   . GLU A 1 206 ? 20.630  -40.095 31.807  1.00 41.12 ? 223 GLU A C   1 
ATOM 1656 O O   . GLU A 1 206 ? 20.902  -39.502 30.754  1.00 40.71 ? 223 GLU A O   1 
ATOM 1657 C CB  . GLU A 1 206 ? 21.785  -42.321 31.661  1.00 40.95 ? 223 GLU A CB  1 
ATOM 1658 C CG  . GLU A 1 206 ? 22.623  -42.207 32.865  1.00 42.23 ? 223 GLU A CG  1 
ATOM 1659 C CD  . GLU A 1 206 ? 24.066  -42.505 32.608  1.00 45.33 ? 223 GLU A CD  1 
ATOM 1660 O OE1 . GLU A 1 206 ? 24.589  -42.220 31.513  1.00 49.35 ? 223 GLU A OE1 1 
ATOM 1661 O OE2 . GLU A 1 206 ? 24.714  -43.009 33.525  1.00 48.96 ? 223 GLU A OE2 1 
ATOM 1662 N N   . LEU A 1 207 ? 20.457  -39.458 32.959  1.00 41.23 ? 224 LEU A N   1 
ATOM 1663 C CA  . LEU A 1 207 ? 20.515  -37.998 33.032  1.00 41.44 ? 224 LEU A CA  1 
ATOM 1664 C C   . LEU A 1 207 ? 21.717  -37.568 33.862  1.00 42.55 ? 224 LEU A C   1 
ATOM 1665 O O   . LEU A 1 207 ? 21.856  -37.951 35.031  1.00 43.54 ? 224 LEU A O   1 
ATOM 1666 C CB  . LEU A 1 207 ? 19.209  -37.403 33.586  1.00 40.40 ? 224 LEU A CB  1 
ATOM 1667 C CG  . LEU A 1 207 ? 17.924  -37.532 32.728  1.00 39.60 ? 224 LEU A CG  1 
ATOM 1668 C CD1 . LEU A 1 207 ? 17.076  -38.704 33.133  1.00 37.98 ? 224 LEU A CD1 1 
ATOM 1669 C CD2 . LEU A 1 207 ? 17.054  -36.298 32.774  1.00 37.07 ? 224 LEU A CD2 1 
ATOM 1670 N N   . VAL A 1 208 ? 22.606  -36.798 33.245  1.00 43.31 ? 225 VAL A N   1 
ATOM 1671 C CA  . VAL A 1 208 ? 23.759  -36.236 33.947  1.00 43.85 ? 225 VAL A CA  1 
ATOM 1672 C C   . VAL A 1 208 ? 23.542  -34.768 34.195  1.00 44.21 ? 225 VAL A C   1 
ATOM 1673 O O   . VAL A 1 208 ? 23.367  -34.015 33.236  1.00 44.24 ? 225 VAL A O   1 
ATOM 1674 C CB  . VAL A 1 208 ? 25.035  -36.335 33.100  1.00 43.73 ? 225 VAL A CB  1 
ATOM 1675 C CG1 . VAL A 1 208 ? 26.237  -35.780 33.864  1.00 42.10 ? 225 VAL A CG1 1 
ATOM 1676 C CG2 . VAL A 1 208 ? 25.245  -37.783 32.668  1.00 44.34 ? 225 VAL A CG2 1 
ATOM 1677 N N   . ILE A 1 209 ? 23.581  -34.368 35.466  1.00 44.29 ? 226 ILE A N   1 
ATOM 1678 C CA  . ILE A 1 209 ? 23.643  -32.964 35.821  1.00 44.61 ? 226 ILE A CA  1 
ATOM 1679 C C   . ILE A 1 209 ? 24.913  -32.332 35.241  1.00 45.92 ? 226 ILE A C   1 
ATOM 1680 O O   . ILE A 1 209 ? 26.041  -32.738 35.589  1.00 45.68 ? 226 ILE A O   1 
ATOM 1681 C CB  . ILE A 1 209 ? 23.629  -32.759 37.337  1.00 44.54 ? 226 ILE A CB  1 
ATOM 1682 C CG1 . ILE A 1 209 ? 22.448  -33.498 37.990  1.00 42.90 ? 226 ILE A CG1 1 
ATOM 1683 C CG2 . ILE A 1 209 ? 23.623  -31.257 37.668  1.00 44.10 ? 226 ILE A CG2 1 
ATOM 1684 C CD1 . ILE A 1 209 ? 21.088  -33.233 37.321  1.00 39.49 ? 226 ILE A CD1 1 
ATOM 1685 N N   . PRO A 1 210 ? 24.738  -31.322 34.362  1.00 47.08 ? 227 PRO A N   1 
ATOM 1686 C CA  . PRO A 1 210 ? 25.850  -30.666 33.685  1.00 47.97 ? 227 PRO A CA  1 
ATOM 1687 C C   . PRO A 1 210 ? 26.521  -29.571 34.521  1.00 48.56 ? 227 PRO A C   1 
ATOM 1688 O O   . PRO A 1 210 ? 26.117  -29.278 35.628  1.00 48.31 ? 227 PRO A O   1 
ATOM 1689 C CB  . PRO A 1 210 ? 25.159  -30.029 32.480  1.00 48.21 ? 227 PRO A CB  1 
ATOM 1690 C CG  . PRO A 1 210 ? 23.881  -29.572 33.049  1.00 47.34 ? 227 PRO A CG  1 
ATOM 1691 C CD  . PRO A 1 210 ? 23.454  -30.719 33.951  1.00 47.10 ? 227 PRO A CD  1 
ATOM 1692 N N   . GLU A 1 211 ? 27.557  -28.983 33.955  1.00 50.18 ? 228 GLU A N   1 
ATOM 1693 C CA  . GLU A 1 211 ? 28.236  -27.845 34.541  1.00 51.66 ? 228 GLU A CA  1 
ATOM 1694 C C   . GLU A 1 211 ? 28.064  -26.680 33.594  1.00 52.18 ? 228 GLU A C   1 
ATOM 1695 O O   . GLU A 1 211 ? 28.384  -26.764 32.393  1.00 52.47 ? 228 GLU A O   1 
ATOM 1696 C CB  . GLU A 1 211 ? 29.724  -28.129 34.722  1.00 51.17 ? 228 GLU A CB  1 
ATOM 1697 C CG  . GLU A 1 211 ? 30.486  -26.989 35.360  1.00 52.69 ? 228 GLU A CG  1 
ATOM 1698 C CD  . GLU A 1 211 ? 31.911  -27.346 35.774  1.00 53.36 ? 228 GLU A CD  1 
ATOM 1699 O OE1 . GLU A 1 211 ? 32.632  -28.081 35.022  1.00 56.63 ? 228 GLU A OE1 1 
ATOM 1700 O OE2 . GLU A 1 211 ? 32.305  -26.866 36.863  1.00 54.31 ? 228 GLU A OE2 1 
ATOM 1701 N N   . LEU A 1 212 ? 27.543  -25.590 34.132  1.00 52.87 ? 229 LEU A N   1 
ATOM 1702 C CA  . LEU A 1 212 ? 27.428  -24.377 33.358  1.00 53.22 ? 229 LEU A CA  1 
ATOM 1703 C C   . LEU A 1 212 ? 28.300  -23.303 33.998  1.00 54.49 ? 229 LEU A C   1 
ATOM 1704 O O   . LEU A 1 212 ? 28.686  -23.412 35.177  1.00 54.49 ? 229 LEU A O   1 
ATOM 1705 C CB  . LEU A 1 212 ? 25.968  -23.947 33.280  1.00 52.44 ? 229 LEU A CB  1 
ATOM 1706 C CG  . LEU A 1 212 ? 24.992  -25.041 32.836  1.00 50.62 ? 229 LEU A CG  1 
ATOM 1707 C CD1 . LEU A 1 212 ? 23.633  -24.726 33.327  1.00 51.50 ? 229 LEU A CD1 1 
ATOM 1708 C CD2 . LEU A 1 212 ? 24.919  -25.212 31.356  1.00 49.77 ? 229 LEU A CD2 1 
ATOM 1709 N N   . PRO A 1 213 ? 28.656  -22.280 33.211  1.00 55.50 ? 230 PRO A N   1 
ATOM 1710 C CA  . PRO A 1 213 ? 29.311  -21.062 33.671  1.00 56.54 ? 230 PRO A CA  1 
ATOM 1711 C C   . PRO A 1 213 ? 28.858  -20.504 35.038  1.00 57.91 ? 230 PRO A C   1 
ATOM 1712 O O   . PRO A 1 213 ? 27.663  -20.514 35.347  1.00 57.85 ? 230 PRO A O   1 
ATOM 1713 C CB  . PRO A 1 213 ? 28.941  -20.072 32.571  1.00 56.15 ? 230 PRO A CB  1 
ATOM 1714 C CG  . PRO A 1 213 ? 28.966  -20.896 31.347  1.00 55.28 ? 230 PRO A CG  1 
ATOM 1715 C CD  . PRO A 1 213 ? 28.478  -22.266 31.750  1.00 55.33 ? 230 PRO A CD  1 
ATOM 1716 N N   . LEU A 1 214 ? 29.854  -20.099 35.843  1.00 59.79 ? 231 LEU A N   1 
ATOM 1717 C CA  . LEU A 1 214 ? 29.781  -19.071 36.929  1.00 60.96 ? 231 LEU A CA  1 
ATOM 1718 C C   . LEU A 1 214 ? 28.690  -19.208 38.008  1.00 61.93 ? 231 LEU A C   1 
ATOM 1719 O O   . LEU A 1 214 ? 27.529  -18.854 37.770  1.00 63.08 ? 231 LEU A O   1 
ATOM 1720 C CB  . LEU A 1 214 ? 29.758  -17.652 36.305  1.00 61.43 ? 231 LEU A CB  1 
ATOM 1721 C CG  . LEU A 1 214 ? 30.914  -17.166 35.387  1.00 61.05 ? 231 LEU A CG  1 
ATOM 1722 C CD1 . LEU A 1 214 ? 30.460  -16.076 34.400  1.00 60.69 ? 231 LEU A CD1 1 
ATOM 1723 C CD2 . LEU A 1 214 ? 32.087  -16.649 36.213  1.00 62.00 ? 231 LEU A CD2 1 
ATOM 1724 N N   . ALA A 1 215 ? 29.065  -19.691 39.199  1.00 62.54 ? 232 ALA A N   1 
ATOM 1725 C CA  . ALA A 1 215 ? 28.098  -20.022 40.285  1.00 62.77 ? 232 ALA A CA  1 
ATOM 1726 C C   . ALA A 1 215 ? 27.434  -18.816 40.971  1.00 62.69 ? 232 ALA A C   1 
ATOM 1727 O O   . ALA A 1 215 ? 26.754  -18.963 42.003  1.00 62.70 ? 232 ALA A O   1 
ATOM 1728 C CB  . ALA A 1 215 ? 28.752  -20.980 41.351  1.00 63.02 ? 232 ALA A CB  1 
ATOM 1729 N N   . MET B 1 1   ? 22.489  -71.494 -4.385  1.00 78.98 ? 18  MET B N   1 
ATOM 1730 C CA  . MET B 1 1   ? 21.258  -71.630 -3.561  1.00 79.60 ? 18  MET B CA  1 
ATOM 1731 C C   . MET B 1 1   ? 21.533  -71.598 -2.029  1.00 78.68 ? 18  MET B C   1 
ATOM 1732 O O   . MET B 1 1   ? 20.737  -72.084 -1.197  1.00 78.76 ? 18  MET B O   1 
ATOM 1733 C CB  . MET B 1 1   ? 20.482  -72.878 -3.989  1.00 79.66 ? 18  MET B CB  1 
ATOM 1734 C CG  . MET B 1 1   ? 19.016  -72.847 -3.580  1.00 80.69 ? 18  MET B CG  1 
ATOM 1735 S SD  . MET B 1 1   ? 18.027  -74.286 -4.062  1.00 82.54 ? 18  MET B SD  1 
ATOM 1736 C CE  . MET B 1 1   ? 17.148  -74.549 -2.488  1.00 81.92 ? 18  MET B CE  1 
ATOM 1737 N N   . PHE B 1 2   ? 22.680  -71.039 -1.664  1.00 77.56 ? 19  PHE B N   1 
ATOM 1738 C CA  . PHE B 1 2   ? 22.879  -70.545 -0.320  1.00 76.36 ? 19  PHE B CA  1 
ATOM 1739 C C   . PHE B 1 2   ? 23.515  -69.198 -0.488  1.00 76.32 ? 19  PHE B C   1 
ATOM 1740 O O   . PHE B 1 2   ? 24.605  -69.085 -1.053  1.00 76.34 ? 19  PHE B O   1 
ATOM 1741 C CB  . PHE B 1 2   ? 23.780  -71.424 0.531   1.00 75.61 ? 19  PHE B CB  1 
ATOM 1742 C CG  . PHE B 1 2   ? 24.052  -70.846 1.903   1.00 74.67 ? 19  PHE B CG  1 
ATOM 1743 C CD1 . PHE B 1 2   ? 23.363  -71.313 3.021   1.00 73.50 ? 19  PHE B CD1 1 
ATOM 1744 C CD2 . PHE B 1 2   ? 24.982  -69.817 2.078   1.00 73.21 ? 19  PHE B CD2 1 
ATOM 1745 C CE1 . PHE B 1 2   ? 23.604  -70.771 4.291   1.00 72.43 ? 19  PHE B CE1 1 
ATOM 1746 C CE2 . PHE B 1 2   ? 25.228  -69.278 3.343   1.00 72.04 ? 19  PHE B CE2 1 
ATOM 1747 C CZ  . PHE B 1 2   ? 24.539  -69.757 4.448   1.00 72.63 ? 19  PHE B CZ  1 
ATOM 1748 N N   . THR B 1 3   ? 22.817  -68.180 0.006   1.00 76.28 ? 20  THR B N   1 
ATOM 1749 C CA  . THR B 1 3   ? 23.263  -66.790 -0.069  1.00 76.01 ? 20  THR B CA  1 
ATOM 1750 C C   . THR B 1 3   ? 22.882  -66.056 1.210   1.00 75.74 ? 20  THR B C   1 
ATOM 1751 O O   . THR B 1 3   ? 21.808  -66.278 1.768   1.00 75.82 ? 20  THR B O   1 
ATOM 1752 C CB  . THR B 1 3   ? 22.645  -66.060 -1.285  1.00 75.91 ? 20  THR B CB  1 
ATOM 1753 O OG1 . THR B 1 3   ? 21.302  -66.516 -1.472  1.00 75.59 ? 20  THR B OG1 1 
ATOM 1754 C CG2 . THR B 1 3   ? 23.442  -66.346 -2.556  1.00 75.99 ? 20  THR B CG2 1 
ATOM 1755 N N   . VAL B 1 4   ? 23.769  -65.203 1.696   1.00 75.36 ? 21  VAL B N   1 
ATOM 1756 C CA  . VAL B 1 4   ? 23.392  -64.369 2.802   1.00 75.15 ? 21  VAL B CA  1 
ATOM 1757 C C   . VAL B 1 4   ? 22.644  -63.218 2.176   1.00 74.97 ? 21  VAL B C   1 
ATOM 1758 O O   . VAL B 1 4   ? 23.097  -62.633 1.193   1.00 74.90 ? 21  VAL B O   1 
ATOM 1759 C CB  . VAL B 1 4   ? 24.605  -63.953 3.674   1.00 75.39 ? 21  VAL B CB  1 
ATOM 1760 C CG1 . VAL B 1 4   ? 24.308  -62.724 4.527   1.00 75.34 ? 21  VAL B CG1 1 
ATOM 1761 C CG2 . VAL B 1 4   ? 24.992  -65.111 4.587   1.00 75.64 ? 21  VAL B CG2 1 
ATOM 1762 N N   . THR B 1 5   ? 21.449  -62.980 2.703   1.00 75.07 ? 22  THR B N   1 
ATOM 1763 C CA  . THR B 1 5   ? 20.657  -61.813 2.391   1.00 74.97 ? 22  THR B CA  1 
ATOM 1764 C C   . THR B 1 5   ? 20.927  -60.804 3.482   1.00 74.89 ? 22  THR B C   1 
ATOM 1765 O O   . THR B 1 5   ? 21.221  -61.177 4.632   1.00 75.08 ? 22  THR B O   1 
ATOM 1766 C CB  . THR B 1 5   ? 19.171  -62.122 2.501   1.00 75.22 ? 22  THR B CB  1 
ATOM 1767 O OG1 . THR B 1 5   ? 18.831  -63.226 1.650   1.00 76.19 ? 22  THR B OG1 1 
ATOM 1768 C CG2 . THR B 1 5   ? 18.324  -60.872 2.135   1.00 76.23 ? 22  THR B CG2 1 
ATOM 1769 N N   . VAL B 1 6   ? 20.790  -59.527 3.137   1.00 74.52 ? 23  VAL B N   1 
ATOM 1770 C CA  . VAL B 1 6   ? 20.821  -58.449 4.130   1.00 73.75 ? 23  VAL B CA  1 
ATOM 1771 C C   . VAL B 1 6   ? 19.483  -57.647 4.109   1.00 73.41 ? 23  VAL B C   1 
ATOM 1772 O O   . VAL B 1 6   ? 18.977  -57.330 3.043   1.00 73.27 ? 23  VAL B O   1 
ATOM 1773 C CB  . VAL B 1 6   ? 22.128  -57.610 3.938   1.00 73.75 ? 23  VAL B CB  1 
ATOM 1774 C CG1 . VAL B 1 6   ? 21.858  -56.182 3.435   1.00 73.71 ? 23  VAL B CG1 1 
ATOM 1775 C CG2 . VAL B 1 6   ? 23.023  -57.687 5.186   1.00 72.56 ? 23  VAL B CG2 1 
ATOM 1776 N N   . PRO B 1 7   ? 18.866  -57.381 5.283   1.00 73.15 ? 24  PRO B N   1 
ATOM 1777 C CA  . PRO B 1 7   ? 17.679  -56.510 5.197   1.00 72.86 ? 24  PRO B CA  1 
ATOM 1778 C C   . PRO B 1 7   ? 18.038  -55.012 5.028   1.00 72.43 ? 24  PRO B C   1 
ATOM 1779 O O   . PRO B 1 7   ? 17.311  -54.284 4.343   1.00 72.66 ? 24  PRO B O   1 
ATOM 1780 C CB  . PRO B 1 7   ? 16.931  -56.779 6.516   1.00 72.67 ? 24  PRO B CB  1 
ATOM 1781 C CG  . PRO B 1 7   ? 17.988  -57.206 7.488   1.00 72.87 ? 24  PRO B CG  1 
ATOM 1782 C CD  . PRO B 1 7   ? 19.138  -57.815 6.670   1.00 73.34 ? 24  PRO B CD  1 
ATOM 1783 N N   . LYS B 1 8   ? 19.155  -54.575 5.618   1.00 71.67 ? 25  LYS B N   1 
ATOM 1784 C CA  . LYS B 1 8   ? 19.612  -53.191 5.520   1.00 70.92 ? 25  LYS B CA  1 
ATOM 1785 C C   . LYS B 1 8   ? 21.098  -53.133 5.192   1.00 70.29 ? 25  LYS B C   1 
ATOM 1786 O O   . LYS B 1 8   ? 21.920  -53.576 5.991   1.00 70.09 ? 25  LYS B O   1 
ATOM 1787 C CB  . LYS B 1 8   ? 19.371  -52.438 6.843   1.00 71.11 ? 25  LYS B CB  1 
ATOM 1788 C CG  . LYS B 1 8   ? 17.937  -51.954 7.098   1.00 71.28 ? 25  LYS B CG  1 
ATOM 1789 C CD  . LYS B 1 8   ? 17.732  -51.380 8.523   1.00 71.10 ? 25  LYS B CD  1 
ATOM 1790 C CE  . LYS B 1 8   ? 17.749  -49.848 8.527   1.00 71.49 ? 25  LYS B CE  1 
ATOM 1791 N NZ  . LYS B 1 8   ? 17.282  -49.245 9.812   1.00 71.26 ? 25  LYS B NZ  1 
ATOM 1792 N N   . ASP B 1 9   ? 21.438  -52.566 4.030   1.00 69.51 ? 26  ASP B N   1 
ATOM 1793 C CA  . ASP B 1 9   ? 22.835  -52.284 3.677   1.00 68.44 ? 26  ASP B CA  1 
ATOM 1794 C C   . ASP B 1 9   ? 23.379  -51.208 4.608   1.00 67.95 ? 26  ASP B C   1 
ATOM 1795 O O   . ASP B 1 9   ? 24.611  -51.022 4.700   1.00 67.96 ? 26  ASP B O   1 
ATOM 1796 C CB  . ASP B 1 9   ? 22.988  -51.793 2.227   1.00 68.30 ? 26  ASP B CB  1 
ATOM 1797 C CG  . ASP B 1 9   ? 21.721  -51.966 1.386   1.00 68.53 ? 26  ASP B CG  1 
ATOM 1798 O OD1 . ASP B 1 9   ? 21.705  -51.420 0.271   1.00 69.84 ? 26  ASP B OD1 1 
ATOM 1799 O OD2 . ASP B 1 9   ? 20.746  -52.629 1.801   1.00 67.31 ? 26  ASP B OD2 1 
ATOM 1800 N N   . LEU B 1 10  ? 22.457  -50.514 5.292   1.00 66.91 ? 27  LEU B N   1 
ATOM 1801 C CA  . LEU B 1 10  ? 22.760  -49.295 6.062   1.00 66.36 ? 27  LEU B CA  1 
ATOM 1802 C C   . LEU B 1 10  ? 22.071  -49.231 7.423   1.00 66.15 ? 27  LEU B C   1 
ATOM 1803 O O   . LEU B 1 10  ? 20.871  -49.493 7.539   1.00 66.19 ? 27  LEU B O   1 
ATOM 1804 C CB  . LEU B 1 10  ? 22.374  -48.043 5.247   1.00 66.49 ? 27  LEU B CB  1 
ATOM 1805 C CG  . LEU B 1 10  ? 22.642  -46.612 5.743   1.00 66.22 ? 27  LEU B CG  1 
ATOM 1806 C CD1 . LEU B 1 10  ? 24.100  -46.391 6.119   1.00 65.54 ? 27  LEU B CD1 1 
ATOM 1807 C CD2 . LEU B 1 10  ? 22.226  -45.610 4.695   1.00 65.72 ? 27  LEU B CD2 1 
ATOM 1808 N N   . TYR B 1 11  ? 22.829  -48.869 8.455   1.00 65.65 ? 28  TYR B N   1 
ATOM 1809 C CA  . TYR B 1 11  ? 22.229  -48.554 9.743   1.00 65.21 ? 28  TYR B CA  1 
ATOM 1810 C C   . TYR B 1 11  ? 22.696  -47.199 10.242  1.00 65.21 ? 28  TYR B C   1 
ATOM 1811 O O   . TYR B 1 11  ? 23.918  -46.934 10.364  1.00 64.70 ? 28  TYR B O   1 
ATOM 1812 C CB  . TYR B 1 11  ? 22.498  -49.635 10.788  1.00 65.03 ? 28  TYR B CB  1 
ATOM 1813 C CG  . TYR B 1 11  ? 21.654  -50.886 10.640  1.00 65.28 ? 28  TYR B CG  1 
ATOM 1814 C CD1 . TYR B 1 11  ? 21.921  -51.830 9.631   1.00 65.11 ? 28  TYR B CD1 1 
ATOM 1815 C CD2 . TYR B 1 11  ? 20.613  -51.150 11.522  1.00 64.57 ? 28  TYR B CD2 1 
ATOM 1816 C CE1 . TYR B 1 11  ? 21.164  -52.992 9.498   1.00 64.69 ? 28  TYR B CE1 1 
ATOM 1817 C CE2 . TYR B 1 11  ? 19.847  -52.315 11.395  1.00 65.51 ? 28  TYR B CE2 1 
ATOM 1818 C CZ  . TYR B 1 11  ? 20.127  -53.229 10.381  1.00 65.34 ? 28  TYR B CZ  1 
ATOM 1819 O OH  . TYR B 1 11  ? 19.366  -54.372 10.260  1.00 65.38 ? 28  TYR B OH  1 
ATOM 1820 N N   . VAL B 1 12  ? 21.700  -46.342 10.501  1.00 64.95 ? 29  VAL B N   1 
ATOM 1821 C CA  . VAL B 1 12  ? 21.927  -45.023 11.096  1.00 64.36 ? 29  VAL B CA  1 
ATOM 1822 C C   . VAL B 1 12  ? 21.387  -45.054 12.508  1.00 63.99 ? 29  VAL B C   1 
ATOM 1823 O O   . VAL B 1 12  ? 20.174  -45.174 12.741  1.00 64.05 ? 29  VAL B O   1 
ATOM 1824 C CB  . VAL B 1 12  ? 21.290  -43.845 10.283  1.00 64.55 ? 29  VAL B CB  1 
ATOM 1825 C CG1 . VAL B 1 12  ? 22.053  -42.544 10.570  1.00 64.09 ? 29  VAL B CG1 1 
ATOM 1826 C CG2 . VAL B 1 12  ? 21.269  -44.137 8.777   1.00 62.70 ? 29  VAL B CG2 1 
ATOM 1827 N N   . VAL B 1 13  ? 22.310  -44.938 13.443  1.00 63.25 ? 30  VAL B N   1 
ATOM 1828 C CA  . VAL B 1 13  ? 22.037  -45.244 14.807  1.00 62.98 ? 30  VAL B CA  1 
ATOM 1829 C C   . VAL B 1 13  ? 22.650  -44.195 15.725  1.00 63.07 ? 30  VAL B C   1 
ATOM 1830 O O   . VAL B 1 13  ? 23.671  -43.593 15.417  1.00 62.68 ? 30  VAL B O   1 
ATOM 1831 C CB  . VAL B 1 13  ? 22.579  -46.633 15.101  1.00 63.18 ? 30  VAL B CB  1 
ATOM 1832 C CG1 . VAL B 1 13  ? 22.897  -46.812 16.605  1.00 64.55 ? 30  VAL B CG1 1 
ATOM 1833 C CG2 . VAL B 1 13  ? 21.597  -47.711 14.582  1.00 62.83 ? 30  VAL B CG2 1 
ATOM 1834 N N   . GLU B 1 14  ? 22.009  -43.995 16.870  1.00 63.50 ? 31  GLU B N   1 
ATOM 1835 C CA  . GLU B 1 14  ? 22.287  -42.873 17.753  1.00 63.73 ? 31  GLU B CA  1 
ATOM 1836 C C   . GLU B 1 14  ? 23.379  -43.154 18.749  1.00 63.01 ? 31  GLU B C   1 
ATOM 1837 O O   . GLU B 1 14  ? 23.366  -44.180 19.409  1.00 63.82 ? 31  GLU B O   1 
ATOM 1838 C CB  . GLU B 1 14  ? 21.016  -42.512 18.518  1.00 64.26 ? 31  GLU B CB  1 
ATOM 1839 C CG  . GLU B 1 14  ? 19.880  -42.021 17.623  1.00 66.45 ? 31  GLU B CG  1 
ATOM 1840 C CD  . GLU B 1 14  ? 19.607  -40.534 17.793  1.00 69.78 ? 31  GLU B CD  1 
ATOM 1841 O OE1 . GLU B 1 14  ? 19.282  -40.124 18.940  1.00 71.10 ? 31  GLU B OE1 1 
ATOM 1842 O OE2 . GLU B 1 14  ? 19.689  -39.788 16.783  1.00 70.04 ? 31  GLU B OE2 1 
ATOM 1843 N N   . TYR B 1 15  ? 24.319  -42.228 18.883  1.00 62.27 ? 32  TYR B N   1 
ATOM 1844 C CA  . TYR B 1 15  ? 25.330  -42.339 19.920  1.00 61.21 ? 32  TYR B CA  1 
ATOM 1845 C C   . TYR B 1 15  ? 24.708  -42.844 21.229  1.00 61.47 ? 32  TYR B C   1 
ATOM 1846 O O   . TYR B 1 15  ? 23.555  -42.522 21.563  1.00 61.50 ? 32  TYR B O   1 
ATOM 1847 C CB  . TYR B 1 15  ? 26.013  -40.994 20.137  1.00 60.23 ? 32  TYR B CB  1 
ATOM 1848 C CG  . TYR B 1 15  ? 27.309  -41.078 20.917  1.00 58.60 ? 32  TYR B CG  1 
ATOM 1849 C CD1 . TYR B 1 15  ? 28.522  -41.264 20.259  1.00 57.67 ? 32  TYR B CD1 1 
ATOM 1850 C CD2 . TYR B 1 15  ? 27.327  -40.963 22.300  1.00 55.41 ? 32  TYR B CD2 1 
ATOM 1851 C CE1 . TYR B 1 15  ? 29.711  -41.344 20.958  1.00 56.98 ? 32  TYR B CE1 1 
ATOM 1852 C CE2 . TYR B 1 15  ? 28.508  -41.038 23.004  1.00 56.14 ? 32  TYR B CE2 1 
ATOM 1853 C CZ  . TYR B 1 15  ? 29.703  -41.230 22.325  1.00 57.35 ? 32  TYR B CZ  1 
ATOM 1854 O OH  . TYR B 1 15  ? 30.905  -41.318 23.000  1.00 59.08 ? 32  TYR B OH  1 
ATOM 1855 N N   . GLY B 1 16  ? 25.476  -43.660 21.947  1.00 61.74 ? 33  GLY B N   1 
ATOM 1856 C CA  . GLY B 1 16  ? 25.069  -44.199 23.250  1.00 61.64 ? 33  GLY B CA  1 
ATOM 1857 C C   . GLY B 1 16  ? 23.985  -45.268 23.242  1.00 61.67 ? 33  GLY B C   1 
ATOM 1858 O O   . GLY B 1 16  ? 23.678  -45.832 24.306  1.00 61.94 ? 33  GLY B O   1 
ATOM 1859 N N   . SER B 1 17  ? 23.410  -45.553 22.066  1.00 61.09 ? 34  SER B N   1 
ATOM 1860 C CA  . SER B 1 17  ? 22.282  -46.463 21.954  1.00 60.57 ? 34  SER B CA  1 
ATOM 1861 C C   . SER B 1 17  ? 22.693  -47.929 21.811  1.00 60.68 ? 34  SER B C   1 
ATOM 1862 O O   . SER B 1 17  ? 23.843  -48.303 22.069  1.00 60.54 ? 34  SER B O   1 
ATOM 1863 C CB  . SER B 1 17  ? 21.408  -46.086 20.771  1.00 60.36 ? 34  SER B CB  1 
ATOM 1864 O OG  . SER B 1 17  ? 21.727  -46.917 19.658  1.00 60.55 ? 34  SER B OG  1 
ATOM 1865 N N   . ASN B 1 18  ? 21.718  -48.726 21.375  1.00 60.86 ? 35  ASN B N   1 
ATOM 1866 C CA  . ASN B 1 18  ? 21.811  -50.169 21.239  1.00 61.54 ? 35  ASN B CA  1 
ATOM 1867 C C   . ASN B 1 18  ? 21.384  -50.589 19.861  1.00 61.77 ? 35  ASN B C   1 
ATOM 1868 O O   . ASN B 1 18  ? 20.248  -50.347 19.436  1.00 61.52 ? 35  ASN B O   1 
ATOM 1869 C CB  . ASN B 1 18  ? 20.948  -50.878 22.279  1.00 61.39 ? 35  ASN B CB  1 
ATOM 1870 C CG  . ASN B 1 18  ? 21.681  -51.078 23.589  1.00 62.85 ? 35  ASN B CG  1 
ATOM 1871 O OD1 . ASN B 1 18  ? 22.720  -50.453 23.852  1.00 62.44 ? 35  ASN B OD1 1 
ATOM 1872 N ND2 . ASN B 1 18  ? 21.150  -51.957 24.421  1.00 64.69 ? 35  ASN B ND2 1 
ATOM 1873 N N   . MET B 1 19  ? 22.324  -51.245 19.184  1.00 62.19 ? 36  MET B N   1 
ATOM 1874 C CA  . MET B 1 19  ? 22.286  -51.479 17.746  1.00 61.83 ? 36  MET B CA  1 
ATOM 1875 C C   . MET B 1 19  ? 22.235  -52.965 17.432  1.00 62.18 ? 36  MET B C   1 
ATOM 1876 O O   . MET B 1 19  ? 23.030  -53.758 17.941  1.00 62.21 ? 36  MET B O   1 
ATOM 1877 C CB  . MET B 1 19  ? 23.529  -50.864 17.136  1.00 61.65 ? 36  MET B CB  1 
ATOM 1878 C CG  . MET B 1 19  ? 23.804  -51.184 15.702  1.00 61.72 ? 36  MET B CG  1 
ATOM 1879 S SD  . MET B 1 19  ? 25.529  -50.774 15.550  1.00 61.48 ? 36  MET B SD  1 
ATOM 1880 C CE  . MET B 1 19  ? 25.992  -51.819 14.179  1.00 62.85 ? 36  MET B CE  1 
ATOM 1881 N N   . THR B 1 20  ? 21.293  -53.320 16.574  1.00 62.09 ? 37  THR B N   1 
ATOM 1882 C CA  . THR B 1 20  ? 21.038  -54.692 16.240  1.00 61.87 ? 37  THR B CA  1 
ATOM 1883 C C   . THR B 1 20  ? 21.084  -54.784 14.732  1.00 61.39 ? 37  THR B C   1 
ATOM 1884 O O   . THR B 1 20  ? 20.089  -54.489 14.064  1.00 61.30 ? 37  THR B O   1 
ATOM 1885 C CB  . THR B 1 20  ? 19.664  -55.120 16.793  1.00 62.06 ? 37  THR B CB  1 
ATOM 1886 O OG1 . THR B 1 20  ? 19.694  -54.966 18.209  1.00 62.16 ? 37  THR B OG1 1 
ATOM 1887 C CG2 . THR B 1 20  ? 19.336  -56.587 16.457  1.00 62.20 ? 37  THR B CG2 1 
ATOM 1888 N N   . ILE B 1 21  ? 22.248  -55.167 14.206  1.00 60.53 ? 38  ILE B N   1 
ATOM 1889 C CA  . ILE B 1 21  ? 22.392  -55.375 12.775  1.00 59.88 ? 38  ILE B CA  1 
ATOM 1890 C C   . ILE B 1 21  ? 22.277  -56.869 12.411  1.00 60.11 ? 38  ILE B C   1 
ATOM 1891 O O   . ILE B 1 21  ? 22.737  -57.737 13.161  1.00 60.32 ? 38  ILE B O   1 
ATOM 1892 C CB  . ILE B 1 21  ? 23.655  -54.673 12.192  1.00 60.13 ? 38  ILE B CB  1 
ATOM 1893 C CG1 . ILE B 1 21  ? 24.954  -55.175 12.828  1.00 59.54 ? 38  ILE B CG1 1 
ATOM 1894 C CG2 . ILE B 1 21  ? 23.541  -53.150 12.348  1.00 60.34 ? 38  ILE B CG2 1 
ATOM 1895 C CD1 . ILE B 1 21  ? 26.183  -54.824 12.006  1.00 58.98 ? 38  ILE B CD1 1 
ATOM 1896 N N   . GLU B 1 22  ? 21.661  -57.150 11.262  1.00 59.84 ? 39  GLU B N   1 
ATOM 1897 C CA  . GLU B 1 22  ? 21.170  -58.477 10.939  1.00 60.41 ? 39  GLU B CA  1 
ATOM 1898 C C   . GLU B 1 22  ? 21.613  -59.013 9.582   1.00 60.80 ? 39  GLU B C   1 
ATOM 1899 O O   . GLU B 1 22  ? 21.648  -58.279 8.608   1.00 60.64 ? 39  GLU B O   1 
ATOM 1900 C CB  . GLU B 1 22  ? 19.639  -58.484 11.017  1.00 60.43 ? 39  GLU B CB  1 
ATOM 1901 C CG  . GLU B 1 22  ? 19.112  -58.177 12.418  1.00 60.58 ? 39  GLU B CG  1 
ATOM 1902 C CD  . GLU B 1 22  ? 17.599  -58.019 12.503  1.00 60.60 ? 39  GLU B CD  1 
ATOM 1903 O OE1 . GLU B 1 22  ? 17.101  -57.679 13.611  1.00 62.26 ? 39  GLU B OE1 1 
ATOM 1904 O OE2 . GLU B 1 22  ? 16.909  -58.214 11.482  1.00 60.76 ? 39  GLU B OE2 1 
ATOM 1905 N N   . CYS B 1 23  ? 21.947  -60.309 9.553   1.00 61.90 ? 40  CYS B N   1 
ATOM 1906 C CA  . CYS B 1 23  ? 22.263  -61.071 8.335   1.00 62.71 ? 40  CYS B CA  1 
ATOM 1907 C C   . CYS B 1 23  ? 21.452  -62.355 8.314   1.00 63.10 ? 40  CYS B C   1 
ATOM 1908 O O   . CYS B 1 23  ? 21.574  -63.164 9.229   1.00 63.18 ? 40  CYS B O   1 
ATOM 1909 C CB  . CYS B 1 23  ? 23.719  -61.473 8.334   1.00 62.86 ? 40  CYS B CB  1 
ATOM 1910 S SG  . CYS B 1 23  ? 24.852  -60.341 7.554   1.00 64.44 ? 40  CYS B SG  1 
ATOM 1911 N N   . LYS B 1 24  ? 20.632  -62.537 7.278   1.00 63.83 ? 41  LYS B N   1 
ATOM 1912 C CA  . LYS B 1 24  ? 19.759  -63.694 7.170   1.00 64.58 ? 41  LYS B CA  1 
ATOM 1913 C C   . LYS B 1 24  ? 20.347  -64.759 6.239   1.00 65.34 ? 41  LYS B C   1 
ATOM 1914 O O   . LYS B 1 24  ? 21.110  -64.464 5.314   1.00 64.72 ? 41  LYS B O   1 
ATOM 1915 C CB  . LYS B 1 24  ? 18.365  -63.269 6.702   1.00 64.92 ? 41  LYS B CB  1 
ATOM 1916 C CG  . LYS B 1 24  ? 17.534  -62.390 7.709   1.00 66.20 ? 41  LYS B CG  1 
ATOM 1917 C CD  . LYS B 1 24  ? 16.294  -63.144 8.319   1.00 66.34 ? 41  LYS B CD  1 
ATOM 1918 C CE  . LYS B 1 24  ? 15.192  -62.200 8.845   1.00 66.22 ? 41  LYS B CE  1 
ATOM 1919 N NZ  . LYS B 1 24  ? 14.205  -61.777 7.765   1.00 66.45 ? 41  LYS B NZ  1 
ATOM 1920 N N   . PHE B 1 25  ? 19.962  -66.004 6.486   1.00 66.81 ? 42  PHE B N   1 
ATOM 1921 C CA  . PHE B 1 25  ? 20.539  -67.173 5.803   1.00 68.30 ? 42  PHE B CA  1 
ATOM 1922 C C   . PHE B 1 25  ? 19.564  -68.356 5.904   1.00 68.51 ? 42  PHE B C   1 
ATOM 1923 O O   . PHE B 1 25  ? 18.874  -68.477 6.936   1.00 68.33 ? 42  PHE B O   1 
ATOM 1924 C CB  . PHE B 1 25  ? 21.876  -67.546 6.463   1.00 68.45 ? 42  PHE B CB  1 
ATOM 1925 C CG  . PHE B 1 25  ? 21.738  -67.983 7.892   1.00 68.57 ? 42  PHE B CG  1 
ATOM 1926 C CD1 . PHE B 1 25  ? 21.791  -69.332 8.227   1.00 68.34 ? 42  PHE B CD1 1 
ATOM 1927 C CD2 . PHE B 1 25  ? 21.522  -67.049 8.905   1.00 69.77 ? 42  PHE B CD2 1 
ATOM 1928 C CE1 . PHE B 1 25  ? 21.638  -69.754 9.557   1.00 68.32 ? 42  PHE B CE1 1 
ATOM 1929 C CE2 . PHE B 1 25  ? 21.374  -67.462 10.249  1.00 70.08 ? 42  PHE B CE2 1 
ATOM 1930 C CZ  . PHE B 1 25  ? 21.431  -68.815 10.569  1.00 69.09 ? 42  PHE B CZ  1 
ATOM 1931 N N   . PRO B 1 26  ? 19.512  -69.231 4.854   1.00 69.35 ? 43  PRO B N   1 
ATOM 1932 C CA  . PRO B 1 26  ? 18.506  -70.322 4.705   1.00 69.99 ? 43  PRO B CA  1 
ATOM 1933 C C   . PRO B 1 26  ? 18.535  -71.416 5.793   1.00 71.69 ? 43  PRO B C   1 
ATOM 1934 O O   . PRO B 1 26  ? 19.517  -72.146 5.916   1.00 71.80 ? 43  PRO B O   1 
ATOM 1935 C CB  . PRO B 1 26  ? 18.847  -70.938 3.340   1.00 69.72 ? 43  PRO B CB  1 
ATOM 1936 C CG  . PRO B 1 26  ? 19.713  -69.932 2.649   1.00 69.13 ? 43  PRO B CG  1 
ATOM 1937 C CD  . PRO B 1 26  ? 20.456  -69.214 3.717   1.00 69.08 ? 43  PRO B CD  1 
ATOM 1938 N N   . VAL B 1 27  ? 17.473  -71.529 6.579   1.00 73.52 ? 44  VAL B N   1 
ATOM 1939 C CA  . VAL B 1 27  ? 17.407  -72.605 7.568   1.00 75.93 ? 44  VAL B CA  1 
ATOM 1940 C C   . VAL B 1 27  ? 16.354  -73.609 7.123   1.00 77.51 ? 44  VAL B C   1 
ATOM 1941 O O   . VAL B 1 27  ? 15.215  -73.234 6.853   1.00 77.85 ? 44  VAL B O   1 
ATOM 1942 C CB  . VAL B 1 27  ? 17.118  -72.092 9.021   1.00 75.96 ? 44  VAL B CB  1 
ATOM 1943 C CG1 . VAL B 1 27  ? 17.327  -73.197 10.058  1.00 75.73 ? 44  VAL B CG1 1 
ATOM 1944 C CG2 . VAL B 1 27  ? 18.011  -70.925 9.362   1.00 75.82 ? 44  VAL B CG2 1 
ATOM 1945 N N   . GLU B 1 28  ? 16.746  -74.877 7.019   1.00 79.55 ? 45  GLU B N   1 
ATOM 1946 C CA  . GLU B 1 28  ? 15.830  -75.931 6.580   1.00 81.36 ? 45  GLU B CA  1 
ATOM 1947 C C   . GLU B 1 28  ? 15.489  -76.891 7.725   1.00 82.17 ? 45  GLU B C   1 
ATOM 1948 O O   . GLU B 1 28  ? 16.380  -77.387 8.430   1.00 82.34 ? 45  GLU B O   1 
ATOM 1949 C CB  . GLU B 1 28  ? 16.419  -76.698 5.400   1.00 81.51 ? 45  GLU B CB  1 
ATOM 1950 C CG  . GLU B 1 28  ? 15.520  -77.824 4.878   1.00 83.87 ? 45  GLU B CG  1 
ATOM 1951 C CD  . GLU B 1 28  ? 16.286  -79.126 4.651   1.00 86.78 ? 45  GLU B CD  1 
ATOM 1952 O OE1 . GLU B 1 28  ? 16.033  -79.797 3.622   1.00 86.63 ? 45  GLU B OE1 1 
ATOM 1953 O OE2 . GLU B 1 28  ? 17.148  -79.474 5.502   1.00 88.25 ? 45  GLU B OE2 1 
ATOM 1954 N N   . LYS B 1 29  ? 14.190  -77.146 7.882   1.00 83.20 ? 46  LYS B N   1 
ATOM 1955 C CA  . LYS B 1 29  ? 13.616  -78.016 8.943   1.00 84.07 ? 46  LYS B CA  1 
ATOM 1956 C C   . LYS B 1 29  ? 14.083  -77.800 10.409  1.00 84.14 ? 46  LYS B C   1 
ATOM 1957 O O   . LYS B 1 29  ? 13.267  -77.452 11.265  1.00 83.91 ? 46  LYS B O   1 
ATOM 1958 C CB  . LYS B 1 29  ? 13.596  -79.522 8.535   1.00 84.14 ? 46  LYS B CB  1 
ATOM 1959 C CG  . LYS B 1 29  ? 14.879  -80.103 7.904   1.00 84.65 ? 46  LYS B CG  1 
ATOM 1960 C CD  . LYS B 1 29  ? 15.030  -81.602 8.271   1.00 85.96 ? 46  LYS B CD  1 
ATOM 1961 C CE  . LYS B 1 29  ? 16.473  -82.108 8.153   1.00 83.90 ? 46  LYS B CE  1 
ATOM 1962 N NZ  . LYS B 1 29  ? 16.782  -82.448 6.744   1.00 82.90 ? 46  LYS B NZ  1 
ATOM 1963 N N   . GLN B 1 30  ? 15.377  -77.980 10.676  1.00 84.65 ? 47  GLN B N   1 
ATOM 1964 C CA  . GLN B 1 30  ? 15.933  -77.936 12.039  1.00 85.31 ? 47  GLN B CA  1 
ATOM 1965 C C   . GLN B 1 30  ? 17.231  -77.141 12.124  1.00 85.56 ? 47  GLN B C   1 
ATOM 1966 O O   . GLN B 1 30  ? 17.921  -76.961 11.114  1.00 85.91 ? 47  GLN B O   1 
ATOM 1967 C CB  . GLN B 1 30  ? 16.199  -79.356 12.548  1.00 85.35 ? 47  GLN B CB  1 
ATOM 1968 C CG  . GLN B 1 30  ? 14.946  -80.110 12.976  1.00 86.39 ? 47  GLN B CG  1 
ATOM 1969 C CD  . GLN B 1 30  ? 14.434  -79.663 14.333  1.00 86.99 ? 47  GLN B CD  1 
ATOM 1970 O OE1 . GLN B 1 30  ? 13.969  -78.524 14.510  1.00 85.96 ? 47  GLN B OE1 1 
ATOM 1971 N NE2 . GLN B 1 30  ? 14.520  -80.565 15.309  1.00 87.90 ? 47  GLN B NE2 1 
ATOM 1972 N N   . LEU B 1 31  ? 17.578  -76.687 13.328  1.00 85.60 ? 48  LEU B N   1 
ATOM 1973 C CA  . LEU B 1 31  ? 18.831  -75.944 13.521  1.00 85.51 ? 48  LEU B CA  1 
ATOM 1974 C C   . LEU B 1 31  ? 20.025  -76.807 13.950  1.00 85.73 ? 48  LEU B C   1 
ATOM 1975 O O   . LEU B 1 31  ? 20.298  -76.971 15.152  1.00 85.56 ? 48  LEU B O   1 
ATOM 1976 C CB  . LEU B 1 31  ? 18.656  -74.755 14.479  1.00 85.51 ? 48  LEU B CB  1 
ATOM 1977 C CG  . LEU B 1 31  ? 19.935  -73.946 14.740  1.00 84.46 ? 48  LEU B CG  1 
ATOM 1978 C CD1 . LEU B 1 31  ? 20.532  -73.348 13.452  1.00 82.63 ? 48  LEU B CD1 1 
ATOM 1979 C CD2 . LEU B 1 31  ? 19.684  -72.883 15.789  1.00 85.10 ? 48  LEU B CD2 1 
ATOM 1980 N N   . ASP B 1 32  ? 20.736  -77.324 12.946  1.00 85.68 ? 49  ASP B N   1 
ATOM 1981 C CA  . ASP B 1 32  ? 21.980  -78.066 13.119  1.00 85.85 ? 49  ASP B CA  1 
ATOM 1982 C C   . ASP B 1 32  ? 23.042  -77.175 13.790  1.00 85.99 ? 49  ASP B C   1 
ATOM 1983 O O   . ASP B 1 32  ? 24.036  -76.786 13.159  1.00 85.92 ? 49  ASP B O   1 
ATOM 1984 C CB  . ASP B 1 32  ? 22.447  -78.545 11.736  1.00 85.92 ? 49  ASP B CB  1 
ATOM 1985 C CG  . ASP B 1 32  ? 23.552  -79.595 11.795  1.00 86.17 ? 49  ASP B CG  1 
ATOM 1986 O OD1 . ASP B 1 32  ? 24.173  -79.806 12.867  1.00 86.76 ? 49  ASP B OD1 1 
ATOM 1987 O OD2 . ASP B 1 32  ? 23.810  -80.197 10.729  1.00 85.21 ? 49  ASP B OD2 1 
ATOM 1988 N N   . LEU B 1 33  ? 22.811  -76.857 15.072  1.00 85.94 ? 50  LEU B N   1 
ATOM 1989 C CA  . LEU B 1 33  ? 23.690  -75.973 15.876  1.00 85.66 ? 50  LEU B CA  1 
ATOM 1990 C C   . LEU B 1 33  ? 25.150  -76.436 15.894  1.00 85.19 ? 50  LEU B C   1 
ATOM 1991 O O   . LEU B 1 33  ? 26.060  -75.604 15.976  1.00 85.51 ? 50  LEU B O   1 
ATOM 1992 C CB  . LEU B 1 33  ? 23.180  -75.823 17.330  1.00 86.00 ? 50  LEU B CB  1 
ATOM 1993 C CG  . LEU B 1 33  ? 21.951  -74.970 17.712  1.00 86.21 ? 50  LEU B CG  1 
ATOM 1994 C CD1 . LEU B 1 33  ? 21.121  -75.602 18.859  1.00 85.81 ? 50  LEU B CD1 1 
ATOM 1995 C CD2 . LEU B 1 33  ? 22.363  -73.542 18.065  1.00 85.66 ? 50  LEU B CD2 1 
ATOM 1996 N N   . ALA B 1 34  ? 25.362  -77.755 15.817  1.00 84.34 ? 51  ALA B N   1 
ATOM 1997 C CA  . ALA B 1 34  ? 26.710  -78.332 15.706  1.00 83.34 ? 51  ALA B CA  1 
ATOM 1998 C C   . ALA B 1 34  ? 27.363  -78.054 14.345  1.00 82.25 ? 51  ALA B C   1 
ATOM 1999 O O   . ALA B 1 34  ? 28.511  -78.421 14.124  1.00 82.37 ? 51  ALA B O   1 
ATOM 2000 C CB  . ALA B 1 34  ? 26.694  -79.856 16.008  1.00 83.44 ? 51  ALA B CB  1 
ATOM 2001 N N   . ALA B 1 35  ? 26.642  -77.399 13.446  1.00 80.86 ? 52  ALA B N   1 
ATOM 2002 C CA  . ALA B 1 35  ? 27.132  -77.194 12.094  1.00 79.90 ? 52  ALA B CA  1 
ATOM 2003 C C   . ALA B 1 35  ? 27.382  -75.735 11.833  1.00 79.23 ? 52  ALA B C   1 
ATOM 2004 O O   . ALA B 1 35  ? 28.127  -75.363 10.914  1.00 78.95 ? 52  ALA B O   1 
ATOM 2005 C CB  . ALA B 1 35  ? 26.122  -77.705 11.098  1.00 79.97 ? 52  ALA B CB  1 
ATOM 2006 N N   . LEU B 1 36  ? 26.733  -74.908 12.640  1.00 78.38 ? 53  LEU B N   1 
ATOM 2007 C CA  . LEU B 1 36  ? 26.601  -73.504 12.309  1.00 77.64 ? 53  LEU B CA  1 
ATOM 2008 C C   . LEU B 1 36  ? 27.874  -72.712 12.602  1.00 77.20 ? 53  LEU B C   1 
ATOM 2009 O O   . LEU B 1 36  ? 28.429  -72.770 13.702  1.00 77.18 ? 53  LEU B O   1 
ATOM 2010 C CB  . LEU B 1 36  ? 25.376  -72.892 13.015  1.00 77.52 ? 53  LEU B CB  1 
ATOM 2011 C CG  . LEU B 1 36  ? 25.162  -71.375 12.907  1.00 77.02 ? 53  LEU B CG  1 
ATOM 2012 C CD1 . LEU B 1 36  ? 25.005  -70.921 11.460  1.00 76.27 ? 53  LEU B CD1 1 
ATOM 2013 C CD2 . LEU B 1 36  ? 23.999  -70.898 13.769  1.00 77.36 ? 53  LEU B CD2 1 
ATOM 2014 N N   . ILE B 1 37  ? 28.328  -71.973 11.603  1.00 76.45 ? 54  ILE B N   1 
ATOM 2015 C CA  . ILE B 1 37  ? 29.395  -71.029 11.824  1.00 76.04 ? 54  ILE B CA  1 
ATOM 2016 C C   . ILE B 1 37  ? 28.925  -69.612 11.480  1.00 75.91 ? 54  ILE B C   1 
ATOM 2017 O O   . ILE B 1 37  ? 28.344  -69.377 10.420  1.00 75.88 ? 54  ILE B O   1 
ATOM 2018 C CB  . ILE B 1 37  ? 30.660  -71.450 11.068  1.00 75.87 ? 54  ILE B CB  1 
ATOM 2019 C CG1 . ILE B 1 37  ? 31.324  -72.610 11.813  1.00 75.75 ? 54  ILE B CG1 1 
ATOM 2020 C CG2 . ILE B 1 37  ? 31.632  -70.287 10.931  1.00 75.44 ? 54  ILE B CG2 1 
ATOM 2021 C CD1 . ILE B 1 37  ? 32.230  -73.453 10.943  1.00 75.75 ? 54  ILE B CD1 1 
ATOM 2022 N N   . VAL B 1 38  ? 29.142  -68.680 12.405  1.00 75.56 ? 55  VAL B N   1 
ATOM 2023 C CA  . VAL B 1 38  ? 28.880  -67.264 12.141  1.00 75.17 ? 55  VAL B CA  1 
ATOM 2024 C C   . VAL B 1 38  ? 30.075  -66.455 12.617  1.00 74.54 ? 55  VAL B C   1 
ATOM 2025 O O   . VAL B 1 38  ? 30.452  -66.555 13.789  1.00 74.55 ? 55  VAL B O   1 
ATOM 2026 C CB  . VAL B 1 38  ? 27.553  -66.769 12.820  1.00 75.32 ? 55  VAL B CB  1 
ATOM 2027 C CG1 . VAL B 1 38  ? 27.448  -65.247 12.802  1.00 75.29 ? 55  VAL B CG1 1 
ATOM 2028 C CG2 . VAL B 1 38  ? 26.325  -67.380 12.137  1.00 75.27 ? 55  VAL B CG2 1 
ATOM 2029 N N   . TYR B 1 39  ? 30.681  -65.694 11.701  1.00 73.96 ? 56  TYR B N   1 
ATOM 2030 C CA  . TYR B 1 39  ? 31.752  -64.724 12.041  1.00 73.54 ? 56  TYR B CA  1 
ATOM 2031 C C   . TYR B 1 39  ? 31.306  -63.282 11.842  1.00 73.05 ? 56  TYR B C   1 
ATOM 2032 O O   . TYR B 1 39  ? 31.022  -62.867 10.708  1.00 73.00 ? 56  TYR B O   1 
ATOM 2033 C CB  . TYR B 1 39  ? 33.018  -64.941 11.198  1.00 73.42 ? 56  TYR B CB  1 
ATOM 2034 C CG  . TYR B 1 39  ? 34.052  -65.848 11.801  1.00 73.30 ? 56  TYR B CG  1 
ATOM 2035 C CD1 . TYR B 1 39  ? 35.415  -65.592 11.637  1.00 73.96 ? 56  TYR B CD1 1 
ATOM 2036 C CD2 . TYR B 1 39  ? 33.671  -66.979 12.522  1.00 73.22 ? 56  TYR B CD2 1 
ATOM 2037 C CE1 . TYR B 1 39  ? 36.374  -66.452 12.187  1.00 73.78 ? 56  TYR B CE1 1 
ATOM 2038 C CE2 . TYR B 1 39  ? 34.606  -67.832 13.071  1.00 73.15 ? 56  TYR B CE2 1 
ATOM 2039 C CZ  . TYR B 1 39  ? 35.945  -67.571 12.906  1.00 73.11 ? 56  TYR B CZ  1 
ATOM 2040 O OH  . TYR B 1 39  ? 36.829  -68.449 13.468  1.00 73.10 ? 56  TYR B OH  1 
ATOM 2041 N N   . TRP B 1 40  ? 31.258  -62.523 12.933  1.00 72.36 ? 57  TRP B N   1 
ATOM 2042 C CA  . TRP B 1 40  ? 31.031  -61.088 12.835  1.00 72.10 ? 57  TRP B CA  1 
ATOM 2043 C C   . TRP B 1 40  ? 32.339  -60.339 13.103  1.00 72.22 ? 57  TRP B C   1 
ATOM 2044 O O   . TRP B 1 40  ? 32.933  -60.463 14.185  1.00 71.98 ? 57  TRP B O   1 
ATOM 2045 C CB  . TRP B 1 40  ? 29.945  -60.622 13.806  1.00 71.32 ? 57  TRP B CB  1 
ATOM 2046 C CG  . TRP B 1 40  ? 28.508  -60.810 13.372  1.00 70.31 ? 57  TRP B CG  1 
ATOM 2047 C CD1 . TRP B 1 40  ? 27.626  -61.710 13.876  1.00 69.84 ? 57  TRP B CD1 1 
ATOM 2048 C CD2 . TRP B 1 40  ? 27.785  -60.047 12.395  1.00 69.20 ? 57  TRP B CD2 1 
ATOM 2049 N NE1 . TRP B 1 40  ? 26.401  -61.571 13.267  1.00 69.23 ? 57  TRP B NE1 1 
ATOM 2050 C CE2 . TRP B 1 40  ? 26.470  -60.553 12.359  1.00 68.79 ? 57  TRP B CE2 1 
ATOM 2051 C CE3 . TRP B 1 40  ? 28.118  -58.989 11.547  1.00 70.04 ? 57  TRP B CE3 1 
ATOM 2052 C CZ2 . TRP B 1 40  ? 25.484  -60.035 11.511  1.00 69.49 ? 57  TRP B CZ2 1 
ATOM 2053 C CZ3 . TRP B 1 40  ? 27.124  -58.468 10.698  1.00 69.33 ? 57  TRP B CZ3 1 
ATOM 2054 C CH2 . TRP B 1 40  ? 25.830  -58.992 10.696  1.00 69.38 ? 57  TRP B CH2 1 
ATOM 2055 N N   . GLU B 1 41  ? 32.783  -59.592 12.090  1.00 72.43 ? 58  GLU B N   1 
ATOM 2056 C CA  . GLU B 1 41  ? 33.973  -58.728 12.169  1.00 72.76 ? 58  GLU B CA  1 
ATOM 2057 C C   . GLU B 1 41  ? 33.798  -57.452 11.322  1.00 73.55 ? 58  GLU B C   1 
ATOM 2058 O O   . GLU B 1 41  ? 33.335  -57.499 10.181  1.00 73.79 ? 58  GLU B O   1 
ATOM 2059 C CB  . GLU B 1 41  ? 35.272  -59.482 11.799  1.00 72.57 ? 58  GLU B CB  1 
ATOM 2060 C CG  . GLU B 1 41  ? 35.084  -60.908 11.275  1.00 71.77 ? 58  GLU B CG  1 
ATOM 2061 C CD  . GLU B 1 41  ? 36.373  -61.600 10.882  1.00 71.79 ? 58  GLU B CD  1 
ATOM 2062 O OE1 . GLU B 1 41  ? 37.172  -61.020 10.112  1.00 70.62 ? 58  GLU B OE1 1 
ATOM 2063 O OE2 . GLU B 1 41  ? 36.570  -62.745 11.323  1.00 70.47 ? 58  GLU B OE2 1 
ATOM 2064 N N   . MET B 1 42  ? 34.154  -56.311 11.893  1.00 74.06 ? 59  MET B N   1 
ATOM 2065 C CA  . MET B 1 42  ? 34.027  -55.044 11.197  1.00 75.00 ? 59  MET B CA  1 
ATOM 2066 C C   . MET B 1 42  ? 35.407  -54.601 10.781  1.00 74.90 ? 59  MET B C   1 
ATOM 2067 O O   . MET B 1 42  ? 36.381  -54.892 11.485  1.00 74.58 ? 59  MET B O   1 
ATOM 2068 C CB  . MET B 1 42  ? 33.424  -53.997 12.137  1.00 75.32 ? 59  MET B CB  1 
ATOM 2069 C CG  . MET B 1 42  ? 33.887  -52.548 11.899  1.00 75.87 ? 59  MET B CG  1 
ATOM 2070 S SD  . MET B 1 42  ? 34.279  -51.743 13.470  1.00 76.12 ? 59  MET B SD  1 
ATOM 2071 C CE  . MET B 1 42  ? 36.010  -52.123 13.675  1.00 75.96 ? 59  MET B CE  1 
ATOM 2072 N N   . GLU B 1 43  ? 35.481  -53.904 9.645   1.00 75.04 ? 60  GLU B N   1 
ATOM 2073 C CA  . GLU B 1 43  ? 36.700  -53.229 9.212   1.00 75.23 ? 60  GLU B CA  1 
ATOM 2074 C C   . GLU B 1 43  ? 37.922  -53.677 10.016  1.00 75.67 ? 60  GLU B C   1 
ATOM 2075 O O   . GLU B 1 43  ? 38.349  -52.977 10.951  1.00 75.52 ? 60  GLU B O   1 
ATOM 2076 C CB  . GLU B 1 43  ? 36.572  -51.722 9.418   1.00 75.49 ? 60  GLU B CB  1 
ATOM 2077 C CG  . GLU B 1 43  ? 35.427  -51.000 8.754   1.00 74.64 ? 60  GLU B CG  1 
ATOM 2078 C CD  . GLU B 1 43  ? 35.710  -49.503 8.663   1.00 73.14 ? 60  GLU B CD  1 
ATOM 2079 O OE1 . GLU B 1 43  ? 36.627  -49.026 9.368   1.00 71.50 ? 60  GLU B OE1 1 
ATOM 2080 O OE2 . GLU B 1 43  ? 35.035  -48.805 7.875   1.00 73.13 ? 60  GLU B OE2 1 
ATOM 2081 N N   . ASP B 1 44  ? 38.468  -54.843 9.673   1.00 75.98 ? 61  ASP B N   1 
ATOM 2082 C CA  . ASP B 1 44  ? 39.712  -55.336 10.272  1.00 76.55 ? 61  ASP B CA  1 
ATOM 2083 C C   . ASP B 1 44  ? 39.771  -55.323 11.827  1.00 76.75 ? 61  ASP B C   1 
ATOM 2084 O O   . ASP B 1 44  ? 40.696  -54.754 12.434  1.00 76.78 ? 61  ASP B O   1 
ATOM 2085 C CB  . ASP B 1 44  ? 40.902  -54.595 9.656   1.00 76.76 ? 61  ASP B CB  1 
ATOM 2086 C CG  . ASP B 1 44  ? 41.106  -54.952 8.192   1.00 77.81 ? 61  ASP B CG  1 
ATOM 2087 O OD1 . ASP B 1 44  ? 41.764  -55.988 7.924   1.00 77.21 ? 61  ASP B OD1 1 
ATOM 2088 O OD2 . ASP B 1 44  ? 40.609  -54.203 7.311   1.00 78.94 ? 61  ASP B OD2 1 
ATOM 2089 N N   . LYS B 1 45  ? 38.767  -55.959 12.436  1.00 76.42 ? 62  LYS B N   1 
ATOM 2090 C CA  . LYS B 1 45  ? 38.721  -56.275 13.861  1.00 76.06 ? 62  LYS B CA  1 
ATOM 2091 C C   . LYS B 1 45  ? 37.682  -57.421 14.039  1.00 75.72 ? 62  LYS B C   1 
ATOM 2092 O O   . LYS B 1 45  ? 36.764  -57.567 13.214  1.00 75.51 ? 62  LYS B O   1 
ATOM 2093 C CB  . LYS B 1 45  ? 38.322  -55.034 14.649  1.00 76.09 ? 62  LYS B CB  1 
ATOM 2094 C CG  . LYS B 1 45  ? 38.985  -54.885 16.013  1.00 76.54 ? 62  LYS B CG  1 
ATOM 2095 C CD  . LYS B 1 45  ? 38.366  -53.720 16.796  1.00 76.70 ? 62  LYS B CD  1 
ATOM 2096 C CE  . LYS B 1 45  ? 38.706  -52.347 16.178  1.00 78.38 ? 62  LYS B CE  1 
ATOM 2097 N NZ  . LYS B 1 45  ? 37.985  -51.207 16.826  1.00 77.84 ? 62  LYS B NZ  1 
ATOM 2098 N N   . ASN B 1 46  ? 37.820  -58.243 15.081  1.00 74.97 ? 63  ASN B N   1 
ATOM 2099 C CA  . ASN B 1 46  ? 36.894  -59.370 15.248  1.00 74.24 ? 63  ASN B CA  1 
ATOM 2100 C C   . ASN B 1 46  ? 35.926  -59.100 16.396  1.00 73.69 ? 63  ASN B C   1 
ATOM 2101 O O   . ASN B 1 46  ? 36.359  -58.740 17.503  1.00 73.25 ? 63  ASN B O   1 
ATOM 2102 C CB  . ASN B 1 46  ? 37.639  -60.712 15.430  1.00 74.33 ? 63  ASN B CB  1 
ATOM 2103 C CG  . ASN B 1 46  ? 36.756  -61.937 15.100  1.00 74.51 ? 63  ASN B CG  1 
ATOM 2104 O OD1 . ASN B 1 46  ? 36.800  -62.456 13.976  1.00 73.91 ? 63  ASN B OD1 1 
ATOM 2105 N ND2 . ASN B 1 46  ? 35.951  -62.395 16.078  1.00 72.71 ? 63  ASN B ND2 1 
ATOM 2106 N N   . ILE B 1 47  ? 34.625  -59.255 16.115  1.00 72.82 ? 64  ILE B N   1 
ATOM 2107 C CA  . ILE B 1 47  ? 33.569  -58.955 17.084  1.00 72.14 ? 64  ILE B CA  1 
ATOM 2108 C C   . ILE B 1 47  ? 33.043  -60.241 17.692  1.00 72.23 ? 64  ILE B C   1 
ATOM 2109 O O   . ILE B 1 47  ? 33.171  -60.470 18.899  1.00 72.55 ? 64  ILE B O   1 
ATOM 2110 C CB  . ILE B 1 47  ? 32.359  -58.181 16.453  1.00 72.22 ? 64  ILE B CB  1 
ATOM 2111 C CG1 . ILE B 1 47  ? 32.830  -57.044 15.535  1.00 72.40 ? 64  ILE B CG1 1 
ATOM 2112 C CG2 . ILE B 1 47  ? 31.406  -57.655 17.543  1.00 71.43 ? 64  ILE B CG2 1 
ATOM 2113 C CD1 . ILE B 1 47  ? 31.733  -56.408 14.696  1.00 72.15 ? 64  ILE B CD1 1 
ATOM 2114 N N   . ILE B 1 48  ? 32.417  -61.062 16.851  1.00 72.08 ? 65  ILE B N   1 
ATOM 2115 C CA  . ILE B 1 48  ? 31.827  -62.326 17.272  1.00 71.50 ? 65  ILE B CA  1 
ATOM 2116 C C   . ILE B 1 48  ? 32.346  -63.406 16.346  1.00 71.59 ? 65  ILE B C   1 
ATOM 2117 O O   . ILE B 1 48  ? 32.484  -63.201 15.132  1.00 70.89 ? 65  ILE B O   1 
ATOM 2118 C CB  . ILE B 1 48  ? 30.269  -62.288 17.217  1.00 71.28 ? 65  ILE B CB  1 
ATOM 2119 C CG1 . ILE B 1 48  ? 29.672  -61.551 18.426  1.00 70.92 ? 65  ILE B CG1 1 
ATOM 2120 C CG2 . ILE B 1 48  ? 29.673  -63.685 17.070  1.00 71.28 ? 65  ILE B CG2 1 
ATOM 2121 C CD1 . ILE B 1 48  ? 29.967  -62.176 19.786  1.00 71.17 ? 65  ILE B CD1 1 
ATOM 2122 N N   . GLN B 1 49  ? 32.677  -64.541 16.936  1.00 71.91 ? 66  GLN B N   1 
ATOM 2123 C CA  . GLN B 1 49  ? 32.777  -65.753 16.160  1.00 72.77 ? 66  GLN B CA  1 
ATOM 2124 C C   . GLN B 1 49  ? 32.184  -66.885 16.941  1.00 72.94 ? 66  GLN B C   1 
ATOM 2125 O O   . GLN B 1 49  ? 32.348  -67.001 18.161  1.00 73.00 ? 66  GLN B O   1 
ATOM 2126 C CB  . GLN B 1 49  ? 34.193  -66.049 15.700  1.00 72.92 ? 66  GLN B CB  1 
ATOM 2127 C CG  . GLN B 1 49  ? 35.126  -66.506 16.764  1.00 74.03 ? 66  GLN B CG  1 
ATOM 2128 C CD  . GLN B 1 49  ? 36.510  -66.793 16.214  1.00 75.76 ? 66  GLN B CD  1 
ATOM 2129 O OE1 . GLN B 1 49  ? 36.885  -66.326 15.137  1.00 75.03 ? 66  GLN B OE1 1 
ATOM 2130 N NE2 . GLN B 1 49  ? 37.290  -67.551 16.974  1.00 77.46 ? 66  GLN B NE2 1 
ATOM 2131 N N   . PHE B 1 50  ? 31.467  -67.710 16.199  1.00 73.34 ? 67  PHE B N   1 
ATOM 2132 C CA  . PHE B 1 50  ? 30.566  -68.668 16.775  1.00 73.40 ? 67  PHE B CA  1 
ATOM 2133 C C   . PHE B 1 50  ? 30.744  -69.960 16.016  1.00 74.29 ? 67  PHE B C   1 
ATOM 2134 O O   . PHE B 1 50  ? 30.313  -70.103 14.863  1.00 74.25 ? 67  PHE B O   1 
ATOM 2135 C CB  . PHE B 1 50  ? 29.156  -68.134 16.647  1.00 72.61 ? 67  PHE B CB  1 
ATOM 2136 C CG  . PHE B 1 50  ? 28.126  -69.012 17.229  1.00 71.04 ? 67  PHE B CG  1 
ATOM 2137 C CD1 . PHE B 1 50  ? 27.877  -68.997 18.588  1.00 70.01 ? 67  PHE B CD1 1 
ATOM 2138 C CD2 . PHE B 1 50  ? 27.365  -69.829 16.417  1.00 69.79 ? 67  PHE B CD2 1 
ATOM 2139 C CE1 . PHE B 1 50  ? 26.892  -69.807 19.141  1.00 69.83 ? 67  PHE B CE1 1 
ATOM 2140 C CE2 . PHE B 1 50  ? 26.375  -70.638 16.965  1.00 70.35 ? 67  PHE B CE2 1 
ATOM 2141 C CZ  . PHE B 1 50  ? 26.138  -70.625 18.329  1.00 69.32 ? 67  PHE B CZ  1 
ATOM 2142 N N   . VAL B 1 51  ? 31.449  -70.874 16.671  1.00 75.43 ? 68  VAL B N   1 
ATOM 2143 C CA  . VAL B 1 51  ? 31.752  -72.189 16.122  1.00 76.32 ? 68  VAL B CA  1 
ATOM 2144 C C   . VAL B 1 51  ? 30.928  -73.228 16.840  1.00 76.85 ? 68  VAL B C   1 
ATOM 2145 O O   . VAL B 1 51  ? 31.012  -73.394 18.061  1.00 76.16 ? 68  VAL B O   1 
ATOM 2146 C CB  . VAL B 1 51  ? 33.267  -72.556 16.161  1.00 76.28 ? 68  VAL B CB  1 
ATOM 2147 C CG1 . VAL B 1 51  ? 33.954  -72.019 14.926  1.00 76.48 ? 68  VAL B CG1 1 
ATOM 2148 C CG2 . VAL B 1 51  ? 33.966  -72.056 17.458  1.00 76.14 ? 68  VAL B CG2 1 
ATOM 2149 N N   . HIS B 1 52  ? 30.092  -73.878 16.042  1.00 78.05 ? 69  HIS B N   1 
ATOM 2150 C CA  . HIS B 1 52  ? 29.267  -74.986 16.466  1.00 79.46 ? 69  HIS B CA  1 
ATOM 2151 C C   . HIS B 1 52  ? 28.737  -74.778 17.898  1.00 79.71 ? 69  HIS B C   1 
ATOM 2152 O O   . HIS B 1 52  ? 29.339  -75.239 18.886  1.00 79.80 ? 69  HIS B O   1 
ATOM 2153 C CB  . HIS B 1 52  ? 30.033  -76.315 16.284  1.00 79.99 ? 69  HIS B CB  1 
ATOM 2154 C CG  . HIS B 1 52  ? 30.767  -76.420 14.972  1.00 81.81 ? 69  HIS B CG  1 
ATOM 2155 N ND1 . HIS B 1 52  ? 30.118  -76.540 13.758  1.00 82.87 ? 69  HIS B ND1 1 
ATOM 2156 C CD2 . HIS B 1 52  ? 32.094  -76.422 14.688  1.00 83.20 ? 69  HIS B CD2 1 
ATOM 2157 C CE1 . HIS B 1 52  ? 31.010  -76.613 12.786  1.00 82.64 ? 69  HIS B CE1 1 
ATOM 2158 N NE2 . HIS B 1 52  ? 32.216  -76.545 13.323  1.00 83.56 ? 69  HIS B NE2 1 
ATOM 2159 N N   . GLY B 1 53  ? 27.631  -74.038 17.990  1.00 79.67 ? 70  GLY B N   1 
ATOM 2160 C CA  . GLY B 1 53  ? 26.921  -73.842 19.254  1.00 79.74 ? 70  GLY B CA  1 
ATOM 2161 C C   . GLY B 1 53  ? 27.637  -73.016 20.303  1.00 79.85 ? 70  GLY B C   1 
ATOM 2162 O O   . GLY B 1 53  ? 27.081  -72.752 21.371  1.00 79.77 ? 70  GLY B O   1 
ATOM 2163 N N   . GLU B 1 54  ? 28.857  -72.591 19.996  1.00 80.08 ? 71  GLU B N   1 
ATOM 2164 C CA  . GLU B 1 54  ? 29.675  -71.886 20.970  1.00 80.62 ? 71  GLU B CA  1 
ATOM 2165 C C   . GLU B 1 54  ? 30.252  -70.551 20.503  1.00 80.66 ? 71  GLU B C   1 
ATOM 2166 O O   . GLU B 1 54  ? 30.805  -70.420 19.401  1.00 80.57 ? 71  GLU B O   1 
ATOM 2167 C CB  . GLU B 1 54  ? 30.794  -72.799 21.498  1.00 81.03 ? 71  GLU B CB  1 
ATOM 2168 C CG  . GLU B 1 54  ? 30.402  -73.625 22.735  1.00 81.79 ? 71  GLU B CG  1 
ATOM 2169 C CD  . GLU B 1 54  ? 30.159  -72.760 23.976  1.00 82.45 ? 71  GLU B CD  1 
ATOM 2170 O OE1 . GLU B 1 54  ? 31.057  -72.699 24.853  1.00 82.76 ? 71  GLU B OE1 1 
ATOM 2171 O OE2 . GLU B 1 54  ? 29.076  -72.135 24.065  1.00 82.17 ? 71  GLU B OE2 1 
ATOM 2172 N N   . GLU B 1 55  ? 30.118  -69.559 21.374  1.00 80.75 ? 72  GLU B N   1 
ATOM 2173 C CA  . GLU B 1 55  ? 30.676  -68.242 21.145  1.00 80.90 ? 72  GLU B CA  1 
ATOM 2174 C C   . GLU B 1 55  ? 32.118  -68.307 21.606  1.00 80.34 ? 72  GLU B C   1 
ATOM 2175 O O   . GLU B 1 55  ? 32.364  -68.587 22.783  1.00 79.98 ? 72  GLU B O   1 
ATOM 2176 C CB  . GLU B 1 55  ? 29.896  -67.243 21.986  1.00 81.32 ? 72  GLU B CB  1 
ATOM 2177 C CG  . GLU B 1 55  ? 29.553  -65.926 21.317  1.00 82.73 ? 72  GLU B CG  1 
ATOM 2178 C CD  . GLU B 1 55  ? 28.431  -65.215 22.063  1.00 84.98 ? 72  GLU B CD  1 
ATOM 2179 O OE1 . GLU B 1 55  ? 28.253  -63.997 21.869  1.00 85.26 ? 72  GLU B OE1 1 
ATOM 2180 O OE2 . GLU B 1 55  ? 27.723  -65.883 22.857  1.00 86.93 ? 72  GLU B OE2 1 
ATOM 2181 N N   . ASP B 1 56  ? 33.064  -68.105 20.684  1.00 79.99 ? 73  ASP B N   1 
ATOM 2182 C CA  . ASP B 1 56  ? 34.493  -68.120 21.043  1.00 79.61 ? 73  ASP B CA  1 
ATOM 2183 C C   . ASP B 1 56  ? 35.095  -66.725 21.308  1.00 79.85 ? 73  ASP B C   1 
ATOM 2184 O O   . ASP B 1 56  ? 35.532  -66.009 20.393  1.00 79.70 ? 73  ASP B O   1 
ATOM 2185 C CB  . ASP B 1 56  ? 35.367  -68.926 20.060  1.00 79.13 ? 73  ASP B CB  1 
ATOM 2186 C CG  . ASP B 1 56  ? 36.847  -69.010 20.514  1.00 78.29 ? 73  ASP B CG  1 
ATOM 2187 O OD1 . ASP B 1 56  ? 37.155  -68.782 21.701  1.00 74.77 ? 73  ASP B OD1 1 
ATOM 2188 O OD2 . ASP B 1 56  ? 37.724  -69.309 19.683  1.00 79.16 ? 73  ASP B OD2 1 
ATOM 2189 N N   . LEU B 1 57  ? 35.131  -66.380 22.590  1.00 79.97 ? 74  LEU B N   1 
ATOM 2190 C CA  . LEU B 1 57  ? 35.743  -65.158 23.057  1.00 80.26 ? 74  LEU B CA  1 
ATOM 2191 C C   . LEU B 1 57  ? 37.232  -65.105 22.708  1.00 80.75 ? 74  LEU B C   1 
ATOM 2192 O O   . LEU B 1 57  ? 37.635  -64.241 21.933  1.00 80.77 ? 74  LEU B O   1 
ATOM 2193 C CB  . LEU B 1 57  ? 35.478  -64.958 24.559  1.00 80.33 ? 74  LEU B CB  1 
ATOM 2194 C CG  . LEU B 1 57  ? 34.268  -64.079 24.982  1.00 80.19 ? 74  LEU B CG  1 
ATOM 2195 C CD1 . LEU B 1 57  ? 33.086  -64.062 23.975  1.00 78.86 ? 74  LEU B CD1 1 
ATOM 2196 C CD2 . LEU B 1 57  ? 33.770  -64.402 26.406  1.00 79.90 ? 74  LEU B CD2 1 
ATOM 2197 N N   . LYS B 1 58  ? 38.032  -66.038 23.238  1.00 81.16 ? 75  LYS B N   1 
ATOM 2198 C CA  . LYS B 1 58  ? 39.488  -66.081 22.989  1.00 81.35 ? 75  LYS B CA  1 
ATOM 2199 C C   . LYS B 1 58  ? 39.951  -65.087 21.911  1.00 81.80 ? 75  LYS B C   1 
ATOM 2200 O O   . LYS B 1 58  ? 40.901  -64.340 22.114  1.00 81.78 ? 75  LYS B O   1 
ATOM 2201 C CB  . LYS B 1 58  ? 39.969  -67.497 22.616  1.00 81.08 ? 75  LYS B CB  1 
ATOM 2202 C CG  . LYS B 1 58  ? 40.082  -68.510 23.744  1.00 80.77 ? 75  LYS B CG  1 
ATOM 2203 C CD  . LYS B 1 58  ? 40.600  -69.833 23.179  1.00 81.22 ? 75  LYS B CD  1 
ATOM 2204 C CE  . LYS B 1 58  ? 40.431  -70.997 24.157  1.00 81.24 ? 75  LYS B CE  1 
ATOM 2205 N NZ  . LYS B 1 58  ? 39.262  -71.880 23.854  1.00 81.00 ? 75  LYS B NZ  1 
ATOM 2206 N N   . VAL B 1 59  ? 39.270  -65.066 20.775  1.00 82.63 ? 76  VAL B N   1 
ATOM 2207 C CA  . VAL B 1 59  ? 39.737  -64.280 19.649  1.00 84.01 ? 76  VAL B CA  1 
ATOM 2208 C C   . VAL B 1 59  ? 39.245  -62.818 19.613  1.00 84.72 ? 76  VAL B C   1 
ATOM 2209 O O   . VAL B 1 59  ? 40.020  -61.925 19.285  1.00 84.75 ? 76  VAL B O   1 
ATOM 2210 C CB  . VAL B 1 59  ? 39.416  -64.980 18.314  1.00 83.98 ? 76  VAL B CB  1 
ATOM 2211 C CG1 . VAL B 1 59  ? 38.056  -64.545 17.804  1.00 84.45 ? 76  VAL B CG1 1 
ATOM 2212 C CG2 . VAL B 1 59  ? 40.483  -64.654 17.289  1.00 84.45 ? 76  VAL B CG2 1 
ATOM 2213 N N   . GLN B 1 60  ? 37.972  -62.583 19.934  1.00 85.72 ? 77  GLN B N   1 
ATOM 2214 C CA  . GLN B 1 60  ? 37.348  -61.275 19.711  1.00 86.76 ? 77  GLN B CA  1 
ATOM 2215 C C   . GLN B 1 60  ? 38.162  -60.086 20.275  1.00 87.99 ? 77  GLN B C   1 
ATOM 2216 O O   . GLN B 1 60  ? 38.764  -60.190 21.355  1.00 88.44 ? 77  GLN B O   1 
ATOM 2217 C CB  . GLN B 1 60  ? 35.900  -61.260 20.240  1.00 86.60 ? 77  GLN B CB  1 
ATOM 2218 C CG  . GLN B 1 60  ? 35.734  -60.931 21.726  1.00 86.07 ? 77  GLN B CG  1 
ATOM 2219 C CD  . GLN B 1 60  ? 34.360  -60.381 22.073  1.00 85.95 ? 77  GLN B CD  1 
ATOM 2220 O OE1 . GLN B 1 60  ? 34.227  -59.216 22.425  1.00 84.57 ? 77  GLN B OE1 1 
ATOM 2221 N NE2 . GLN B 1 60  ? 33.335  -61.223 21.983  1.00 85.50 ? 77  GLN B NE2 1 
ATOM 2222 N N   . HIS B 1 61  ? 38.175  -58.961 19.555  1.00 89.01 ? 78  HIS B N   1 
ATOM 2223 C CA  . HIS B 1 61  ? 38.880  -57.777 20.043  1.00 89.87 ? 78  HIS B CA  1 
ATOM 2224 C C   . HIS B 1 61  ? 38.357  -57.281 21.394  1.00 89.86 ? 78  HIS B C   1 
ATOM 2225 O O   . HIS B 1 61  ? 37.300  -57.705 21.875  1.00 90.10 ? 78  HIS B O   1 
ATOM 2226 C CB  . HIS B 1 61  ? 38.905  -56.642 19.018  1.00 90.36 ? 78  HIS B CB  1 
ATOM 2227 C CG  . HIS B 1 61  ? 39.865  -55.547 19.376  1.00 92.53 ? 78  HIS B CG  1 
ATOM 2228 N ND1 . HIS B 1 61  ? 39.490  -54.431 20.097  1.00 93.90 ? 78  HIS B ND1 1 
ATOM 2229 C CD2 . HIS B 1 61  ? 41.197  -55.419 19.153  1.00 94.20 ? 78  HIS B CD2 1 
ATOM 2230 C CE1 . HIS B 1 61  ? 40.544  -53.657 20.290  1.00 94.41 ? 78  HIS B CE1 1 
ATOM 2231 N NE2 . HIS B 1 61  ? 41.593  -54.233 19.727  1.00 94.58 ? 78  HIS B NE2 1 
ATOM 2232 N N   . SER B 1 62  ? 39.128  -56.384 21.995  1.00 89.84 ? 79  SER B N   1 
ATOM 2233 C CA  . SER B 1 62  ? 38.943  -55.959 23.375  1.00 89.59 ? 79  SER B CA  1 
ATOM 2234 C C   . SER B 1 62  ? 37.968  -54.796 23.510  1.00 88.99 ? 79  SER B C   1 
ATOM 2235 O O   . SER B 1 62  ? 37.407  -54.572 24.570  1.00 88.86 ? 79  SER B O   1 
ATOM 2236 C CB  . SER B 1 62  ? 40.310  -55.596 23.961  1.00 89.78 ? 79  SER B CB  1 
ATOM 2237 O OG  . SER B 1 62  ? 41.278  -56.560 23.554  1.00 90.22 ? 79  SER B OG  1 
ATOM 2238 N N   . SER B 1 63  ? 37.771  -54.060 22.425  1.00 88.66 ? 80  SER B N   1 
ATOM 2239 C CA  . SER B 1 63  ? 36.861  -52.920 22.414  1.00 88.27 ? 80  SER B CA  1 
ATOM 2240 C C   . SER B 1 63  ? 35.413  -53.385 22.538  1.00 88.16 ? 80  SER B C   1 
ATOM 2241 O O   . SER B 1 63  ? 34.515  -52.598 22.877  1.00 87.94 ? 80  SER B O   1 
ATOM 2242 C CB  . SER B 1 63  ? 37.052  -52.118 21.124  1.00 88.31 ? 80  SER B CB  1 
ATOM 2243 O OG  . SER B 1 63  ? 37.447  -52.969 20.063  1.00 87.37 ? 80  SER B OG  1 
ATOM 2244 N N   . TYR B 1 64  ? 35.210  -54.675 22.264  1.00 87.78 ? 81  TYR B N   1 
ATOM 2245 C CA  . TYR B 1 64  ? 33.885  -55.289 22.227  1.00 87.14 ? 81  TYR B CA  1 
ATOM 2246 C C   . TYR B 1 64  ? 33.632  -56.124 23.457  1.00 87.03 ? 81  TYR B C   1 
ATOM 2247 O O   . TYR B 1 64  ? 32.485  -56.455 23.757  1.00 86.80 ? 81  TYR B O   1 
ATOM 2248 C CB  . TYR B 1 64  ? 33.731  -56.131 20.959  1.00 86.57 ? 81  TYR B CB  1 
ATOM 2249 C CG  . TYR B 1 64  ? 33.855  -55.287 19.723  1.00 85.98 ? 81  TYR B CG  1 
ATOM 2250 C CD1 . TYR B 1 64  ? 35.069  -55.161 19.058  1.00 85.48 ? 81  TYR B CD1 1 
ATOM 2251 C CD2 . TYR B 1 64  ? 32.759  -54.568 19.237  1.00 86.23 ? 81  TYR B CD2 1 
ATOM 2252 C CE1 . TYR B 1 64  ? 35.181  -54.347 17.916  1.00 85.59 ? 81  TYR B CE1 1 
ATOM 2253 C CE2 . TYR B 1 64  ? 32.861  -53.760 18.102  1.00 85.18 ? 81  TYR B CE2 1 
ATOM 2254 C CZ  . TYR B 1 64  ? 34.071  -53.655 17.455  1.00 85.07 ? 81  TYR B CZ  1 
ATOM 2255 O OH  . TYR B 1 64  ? 34.167  -52.864 16.348  1.00 85.23 ? 81  TYR B OH  1 
ATOM 2256 N N   . ARG B 1 65  ? 34.713  -56.419 24.178  1.00 87.14 ? 82  ARG B N   1 
ATOM 2257 C CA  . ARG B 1 65  ? 34.724  -57.397 25.272  1.00 87.43 ? 82  ARG B CA  1 
ATOM 2258 C C   . ARG B 1 65  ? 33.390  -57.644 25.984  1.00 86.98 ? 82  ARG B C   1 
ATOM 2259 O O   . ARG B 1 65  ? 32.877  -58.772 25.970  1.00 87.36 ? 82  ARG B O   1 
ATOM 2260 C CB  . ARG B 1 65  ? 35.832  -57.089 26.293  1.00 87.78 ? 82  ARG B CB  1 
ATOM 2261 C CG  . ARG B 1 65  ? 37.140  -57.851 26.051  1.00 89.16 ? 82  ARG B CG  1 
ATOM 2262 C CD  . ARG B 1 65  ? 36.979  -59.356 26.278  1.00 91.15 ? 82  ARG B CD  1 
ATOM 2263 N NE  . ARG B 1 65  ? 37.833  -60.122 25.364  1.00 93.01 ? 82  ARG B NE  1 
ATOM 2264 C CZ  . ARG B 1 65  ? 37.855  -61.454 25.259  1.00 93.52 ? 82  ARG B CZ  1 
ATOM 2265 N NH1 . ARG B 1 65  ? 37.068  -62.220 26.014  1.00 94.48 ? 82  ARG B NH1 1 
ATOM 2266 N NH2 . ARG B 1 65  ? 38.675  -62.025 24.391  1.00 93.07 ? 82  ARG B NH2 1 
ATOM 2267 N N   . GLN B 1 66  ? 32.837  -56.599 26.593  1.00 86.07 ? 83  GLN B N   1 
ATOM 2268 C CA  . GLN B 1 66  ? 31.610  -56.727 27.376  1.00 85.34 ? 83  GLN B CA  1 
ATOM 2269 C C   . GLN B 1 66  ? 30.378  -56.153 26.655  1.00 84.32 ? 83  GLN B C   1 
ATOM 2270 O O   . GLN B 1 66  ? 29.277  -56.136 27.213  1.00 84.27 ? 83  GLN B O   1 
ATOM 2271 C CB  . GLN B 1 66  ? 31.797  -56.072 28.763  1.00 85.85 ? 83  GLN B CB  1 
ATOM 2272 C CG  . GLN B 1 66  ? 32.400  -56.972 29.857  1.00 86.38 ? 83  GLN B CG  1 
ATOM 2273 C CD  . GLN B 1 66  ? 33.845  -57.406 29.579  1.00 87.49 ? 83  GLN B CD  1 
ATOM 2274 O OE1 . GLN B 1 66  ? 34.739  -56.569 29.444  1.00 87.48 ? 83  GLN B OE1 1 
ATOM 2275 N NE2 . GLN B 1 66  ? 34.077  -58.724 29.515  1.00 87.49 ? 83  GLN B NE2 1 
ATOM 2276 N N   . ARG B 1 67  ? 30.558  -55.708 25.412  1.00 83.18 ? 84  ARG B N   1 
ATOM 2277 C CA  . ARG B 1 67  ? 29.509  -54.951 24.711  1.00 82.07 ? 84  ARG B CA  1 
ATOM 2278 C C   . ARG B 1 67  ? 28.955  -55.546 23.405  1.00 81.63 ? 84  ARG B C   1 
ATOM 2279 O O   . ARG B 1 67  ? 27.926  -55.093 22.915  1.00 81.70 ? 84  ARG B O   1 
ATOM 2280 C CB  . ARG B 1 67  ? 29.945  -53.493 24.503  1.00 82.28 ? 84  ARG B CB  1 
ATOM 2281 C CG  . ARG B 1 67  ? 31.278  -53.309 23.757  1.00 82.00 ? 84  ARG B CG  1 
ATOM 2282 C CD  . ARG B 1 67  ? 31.768  -51.862 23.812  1.00 81.21 ? 84  ARG B CD  1 
ATOM 2283 N NE  . ARG B 1 67  ? 30.767  -50.923 23.324  1.00 77.09 ? 84  ARG B NE  1 
ATOM 2284 C CZ  . ARG B 1 67  ? 30.613  -50.598 22.050  1.00 76.20 ? 84  ARG B CZ  1 
ATOM 2285 N NH1 . ARG B 1 67  ? 31.390  -51.113 21.109  1.00 75.20 ? 84  ARG B NH1 1 
ATOM 2286 N NH2 . ARG B 1 67  ? 29.673  -49.744 21.714  1.00 77.81 ? 84  ARG B NH2 1 
ATOM 2287 N N   . ALA B 1 68  ? 29.622  -56.547 22.841  1.00 80.89 ? 85  ALA B N   1 
ATOM 2288 C CA  . ALA B 1 68  ? 29.099  -57.218 21.651  1.00 80.18 ? 85  ALA B CA  1 
ATOM 2289 C C   . ALA B 1 68  ? 28.507  -58.597 21.984  1.00 79.73 ? 85  ALA B C   1 
ATOM 2290 O O   . ALA B 1 68  ? 28.950  -59.253 22.930  1.00 79.79 ? 85  ALA B O   1 
ATOM 2291 C CB  . ALA B 1 68  ? 30.181  -57.336 20.595  1.00 80.10 ? 85  ALA B CB  1 
ATOM 2292 N N   . ARG B 1 69  ? 27.504  -59.025 21.214  1.00 78.80 ? 86  ARG B N   1 
ATOM 2293 C CA  . ARG B 1 69  ? 26.965  -60.379 21.336  1.00 77.81 ? 86  ARG B CA  1 
ATOM 2294 C C   . ARG B 1 69  ? 26.068  -60.844 20.157  1.00 77.17 ? 86  ARG B C   1 
ATOM 2295 O O   . ARG B 1 69  ? 25.618  -60.027 19.350  1.00 76.99 ? 86  ARG B O   1 
ATOM 2296 C CB  . ARG B 1 69  ? 26.260  -60.545 22.686  1.00 77.87 ? 86  ARG B CB  1 
ATOM 2297 C CG  . ARG B 1 69  ? 24.900  -59.924 22.774  1.00 78.31 ? 86  ARG B CG  1 
ATOM 2298 C CD  . ARG B 1 69  ? 24.200  -60.385 24.033  1.00 78.38 ? 86  ARG B CD  1 
ATOM 2299 N NE  . ARG B 1 69  ? 22.779  -60.058 23.990  1.00 79.83 ? 86  ARG B NE  1 
ATOM 2300 C CZ  . ARG B 1 69  ? 21.886  -60.450 24.896  1.00 80.76 ? 86  ARG B CZ  1 
ATOM 2301 N NH1 . ARG B 1 69  ? 22.259  -61.195 25.935  1.00 80.88 ? 86  ARG B NH1 1 
ATOM 2302 N NH2 . ARG B 1 69  ? 20.613  -60.089 24.767  1.00 80.61 ? 86  ARG B NH2 1 
ATOM 2303 N N   . LEU B 1 70  ? 25.825  -62.160 20.073  1.00 76.20 ? 87  LEU B N   1 
ATOM 2304 C CA  . LEU B 1 70  ? 24.967  -62.760 19.041  1.00 74.87 ? 87  LEU B CA  1 
ATOM 2305 C C   . LEU B 1 70  ? 23.627  -63.255 19.611  1.00 74.78 ? 87  LEU B C   1 
ATOM 2306 O O   . LEU B 1 70  ? 23.614  -64.076 20.530  1.00 75.05 ? 87  LEU B O   1 
ATOM 2307 C CB  . LEU B 1 70  ? 25.712  -63.906 18.373  1.00 74.17 ? 87  LEU B CB  1 
ATOM 2308 C CG  . LEU B 1 70  ? 25.125  -64.482 17.085  1.00 72.95 ? 87  LEU B CG  1 
ATOM 2309 C CD1 . LEU B 1 70  ? 25.290  -63.548 15.903  1.00 71.39 ? 87  LEU B CD1 1 
ATOM 2310 C CD2 . LEU B 1 70  ? 25.794  -65.807 16.790  1.00 70.93 ? 87  LEU B CD2 1 
ATOM 2311 N N   . LEU B 1 71  ? 22.509  -62.754 19.075  1.00 74.22 ? 88  LEU B N   1 
ATOM 2312 C CA  . LEU B 1 71  ? 21.159  -63.102 19.576  1.00 73.87 ? 88  LEU B CA  1 
ATOM 2313 C C   . LEU B 1 71  ? 20.765  -64.552 19.279  1.00 73.36 ? 88  LEU B C   1 
ATOM 2314 O O   . LEU B 1 71  ? 20.452  -64.908 18.139  1.00 73.32 ? 88  LEU B O   1 
ATOM 2315 C CB  . LEU B 1 71  ? 20.109  -62.143 19.005  1.00 73.91 ? 88  LEU B CB  1 
ATOM 2316 C CG  . LEU B 1 71  ? 19.514  -60.968 19.813  1.00 74.70 ? 88  LEU B CG  1 
ATOM 2317 C CD1 . LEU B 1 71  ? 20.560  -59.972 20.421  1.00 73.87 ? 88  LEU B CD1 1 
ATOM 2318 C CD2 . LEU B 1 71  ? 18.472  -60.228 18.953  1.00 74.21 ? 88  LEU B CD2 1 
ATOM 2319 N N   . LYS B 1 72  ? 20.775  -65.384 20.310  1.00 72.87 ? 89  LYS B N   1 
ATOM 2320 C CA  . LYS B 1 72  ? 20.843  -66.840 20.102  1.00 72.76 ? 89  LYS B CA  1 
ATOM 2321 C C   . LYS B 1 72  ? 19.591  -67.498 19.458  1.00 72.31 ? 89  LYS B C   1 
ATOM 2322 O O   . LYS B 1 72  ? 19.691  -68.261 18.476  1.00 72.06 ? 89  LYS B O   1 
ATOM 2323 C CB  . LYS B 1 72  ? 21.253  -67.542 21.404  1.00 72.70 ? 89  LYS B CB  1 
ATOM 2324 C CG  . LYS B 1 72  ? 22.489  -66.963 22.050  1.00 73.18 ? 89  LYS B CG  1 
ATOM 2325 C CD  . LYS B 1 72  ? 23.303  -68.022 22.785  1.00 74.14 ? 89  LYS B CD  1 
ATOM 2326 C CE  . LYS B 1 72  ? 24.639  -67.438 23.281  1.00 74.48 ? 89  LYS B CE  1 
ATOM 2327 N NZ  . LYS B 1 72  ? 25.517  -68.480 23.877  1.00 72.85 ? 89  LYS B NZ  1 
ATOM 2328 N N   . ASP B 1 73  ? 18.426  -67.180 20.023  1.00 71.83 ? 90  ASP B N   1 
ATOM 2329 C CA  . ASP B 1 73  ? 17.119  -67.636 19.543  1.00 70.92 ? 90  ASP B CA  1 
ATOM 2330 C C   . ASP B 1 73  ? 16.943  -67.398 18.048  1.00 70.82 ? 90  ASP B C   1 
ATOM 2331 O O   . ASP B 1 73  ? 16.376  -68.228 17.359  1.00 71.07 ? 90  ASP B O   1 
ATOM 2332 C CB  . ASP B 1 73  ? 16.000  -66.929 20.324  1.00 70.51 ? 90  ASP B CB  1 
ATOM 2333 C CG  . ASP B 1 73  ? 16.085  -65.421 20.232  1.00 69.13 ? 90  ASP B CG  1 
ATOM 2334 O OD1 . ASP B 1 73  ? 15.046  -64.780 20.040  1.00 68.53 ? 90  ASP B OD1 1 
ATOM 2335 O OD2 . ASP B 1 73  ? 17.188  -64.865 20.340  1.00 69.59 ? 90  ASP B OD2 1 
ATOM 2336 N N   . GLN B 1 74  ? 17.450  -66.264 17.571  1.00 70.58 ? 91  GLN B N   1 
ATOM 2337 C CA  . GLN B 1 74  ? 17.381  -65.832 16.167  1.00 70.32 ? 91  GLN B CA  1 
ATOM 2338 C C   . GLN B 1 74  ? 18.009  -66.739 15.090  1.00 70.06 ? 91  GLN B C   1 
ATOM 2339 O O   . GLN B 1 74  ? 17.552  -66.756 13.926  1.00 69.31 ? 91  GLN B O   1 
ATOM 2340 C CB  . GLN B 1 74  ? 17.980  -64.437 16.073  1.00 70.12 ? 91  GLN B CB  1 
ATOM 2341 C CG  . GLN B 1 74  ? 17.139  -63.437 16.813  1.00 70.16 ? 91  GLN B CG  1 
ATOM 2342 C CD  . GLN B 1 74  ? 15.695  -63.487 16.367  1.00 70.26 ? 91  GLN B CD  1 
ATOM 2343 O OE1 . GLN B 1 74  ? 15.350  -62.998 15.280  1.00 70.16 ? 91  GLN B OE1 1 
ATOM 2344 N NE2 . GLN B 1 74  ? 14.839  -64.091 17.196  1.00 69.03 ? 91  GLN B NE2 1 
ATOM 2345 N N   . LEU B 1 75  ? 19.052  -67.468 15.497  1.00 70.02 ? 92  LEU B N   1 
ATOM 2346 C CA  . LEU B 1 75  ? 19.808  -68.381 14.632  1.00 69.74 ? 92  LEU B CA  1 
ATOM 2347 C C   . LEU B 1 75  ? 18.887  -69.453 14.069  1.00 69.04 ? 92  LEU B C   1 
ATOM 2348 O O   . LEU B 1 75  ? 18.967  -69.811 12.891  1.00 68.64 ? 92  LEU B O   1 
ATOM 2349 C CB  . LEU B 1 75  ? 20.925  -69.043 15.436  1.00 69.99 ? 92  LEU B CB  1 
ATOM 2350 C CG  . LEU B 1 75  ? 22.140  -68.285 15.987  1.00 71.47 ? 92  LEU B CG  1 
ATOM 2351 C CD1 . LEU B 1 75  ? 22.051  -66.741 15.889  1.00 73.46 ? 92  LEU B CD1 1 
ATOM 2352 C CD2 . LEU B 1 75  ? 22.424  -68.740 17.432  1.00 70.93 ? 92  LEU B CD2 1 
ATOM 2353 N N   . SER B 1 76  ? 18.010  -69.945 14.937  1.00 68.50 ? 93  SER B N   1 
ATOM 2354 C CA  . SER B 1 76  ? 16.979  -70.892 14.579  1.00 68.44 ? 93  SER B CA  1 
ATOM 2355 C C   . SER B 1 76  ? 16.230  -70.428 13.345  1.00 68.45 ? 93  SER B C   1 
ATOM 2356 O O   . SER B 1 76  ? 15.826  -71.230 12.527  1.00 68.96 ? 93  SER B O   1 
ATOM 2357 C CB  . SER B 1 76  ? 16.002  -71.041 15.745  1.00 68.51 ? 93  SER B CB  1 
ATOM 2358 O OG  . SER B 1 76  ? 16.689  -71.158 16.994  1.00 69.48 ? 93  SER B OG  1 
ATOM 2359 N N   . LEU B 1 77  ? 16.075  -69.122 13.194  1.00 68.73 ? 94  LEU B N   1 
ATOM 2360 C CA  . LEU B 1 77  ? 15.131  -68.575 12.229  1.00 68.78 ? 94  LEU B CA  1 
ATOM 2361 C C   . LEU B 1 77  ? 15.812  -68.166 10.936  1.00 68.70 ? 94  LEU B C   1 
ATOM 2362 O O   . LEU B 1 77  ? 15.152  -67.958 9.905   1.00 68.84 ? 94  LEU B O   1 
ATOM 2363 C CB  . LEU B 1 77  ? 14.399  -67.372 12.837  1.00 68.84 ? 94  LEU B CB  1 
ATOM 2364 C CG  . LEU B 1 77  ? 14.026  -67.439 14.320  1.00 69.00 ? 94  LEU B CG  1 
ATOM 2365 C CD1 . LEU B 1 77  ? 13.562  -66.081 14.772  1.00 69.50 ? 94  LEU B CD1 1 
ATOM 2366 C CD2 . LEU B 1 77  ? 12.961  -68.499 14.611  1.00 68.78 ? 94  LEU B CD2 1 
ATOM 2367 N N   . GLY B 1 78  ? 17.132  -68.040 11.004  1.00 68.32 ? 95  GLY B N   1 
ATOM 2368 C CA  . GLY B 1 78  ? 17.910  -67.627 9.858   1.00 67.88 ? 95  GLY B CA  1 
ATOM 2369 C C   . GLY B 1 78  ? 18.332  -66.194 10.025  1.00 67.59 ? 95  GLY B C   1 
ATOM 2370 O O   . GLY B 1 78  ? 18.454  -65.475 9.037   1.00 67.90 ? 95  GLY B O   1 
ATOM 2371 N N   . ASN B 1 79  ? 18.576  -65.792 11.276  1.00 67.05 ? 96  ASN B N   1 
ATOM 2372 C CA  . ASN B 1 79  ? 18.976  -64.425 11.608  1.00 66.19 ? 96  ASN B CA  1 
ATOM 2373 C C   . ASN B 1 79  ? 20.261  -64.416 12.433  1.00 65.73 ? 96  ASN B C   1 
ATOM 2374 O O   . ASN B 1 79  ? 20.243  -64.684 13.633  1.00 65.96 ? 96  ASN B O   1 
ATOM 2375 C CB  . ASN B 1 79  ? 17.847  -63.696 12.373  1.00 66.08 ? 96  ASN B CB  1 
ATOM 2376 C CG  . ASN B 1 79  ? 17.832  -62.184 12.114  1.00 66.32 ? 96  ASN B CG  1 
ATOM 2377 O OD1 . ASN B 1 79  ? 17.700  -61.736 10.969  1.00 66.70 ? 96  ASN B OD1 1 
ATOM 2378 N ND2 . ASN B 1 79  ? 17.959  -61.398 13.177  1.00 65.12 ? 96  ASN B ND2 1 
ATOM 2379 N N   . ALA B 1 80  ? 21.382  -64.122 11.789  1.00 64.96 ? 97  ALA B N   1 
ATOM 2380 C CA  . ALA B 1 80  ? 22.604  -63.856 12.524  1.00 64.38 ? 97  ALA B CA  1 
ATOM 2381 C C   . ALA B 1 80  ? 22.508  -62.401 12.971  1.00 63.96 ? 97  ALA B C   1 
ATOM 2382 O O   . ALA B 1 80  ? 22.912  -61.481 12.241  1.00 63.98 ? 97  ALA B O   1 
ATOM 2383 C CB  . ALA B 1 80  ? 23.841  -64.087 11.647  1.00 64.39 ? 97  ALA B CB  1 
ATOM 2384 N N   . ALA B 1 81  ? 21.944  -62.196 14.161  1.00 63.01 ? 98  ALA B N   1 
ATOM 2385 C CA  . ALA B 1 81  ? 21.698  -60.844 14.670  1.00 61.81 ? 98  ALA B CA  1 
ATOM 2386 C C   . ALA B 1 81  ? 22.785  -60.403 15.652  1.00 60.90 ? 98  ALA B C   1 
ATOM 2387 O O   . ALA B 1 81  ? 22.866  -60.918 16.771  1.00 60.91 ? 98  ALA B O   1 
ATOM 2388 C CB  . ALA B 1 81  ? 20.315  -60.771 15.312  1.00 61.57 ? 98  ALA B CB  1 
ATOM 2389 N N   . LEU B 1 82  ? 23.634  -59.473 15.225  1.00 59.88 ? 99  LEU B N   1 
ATOM 2390 C CA  . LEU B 1 82  ? 24.673  -58.968 16.093  1.00 59.26 ? 99  LEU B CA  1 
ATOM 2391 C C   . LEU B 1 82  ? 24.140  -57.779 16.809  1.00 59.68 ? 99  LEU B C   1 
ATOM 2392 O O   . LEU B 1 82  ? 23.480  -56.945 16.203  1.00 60.16 ? 99  LEU B O   1 
ATOM 2393 C CB  . LEU B 1 82  ? 25.898  -58.537 15.303  1.00 59.13 ? 99  LEU B CB  1 
ATOM 2394 C CG  . LEU B 1 82  ? 26.983  -57.712 16.028  1.00 58.46 ? 99  LEU B CG  1 
ATOM 2395 C CD1 . LEU B 1 82  ? 27.579  -58.333 17.306  1.00 55.36 ? 99  LEU B CD1 1 
ATOM 2396 C CD2 . LEU B 1 82  ? 28.070  -57.410 15.034  1.00 58.89 ? 99  LEU B CD2 1 
ATOM 2397 N N   . GLN B 1 83  ? 24.450  -57.690 18.096  1.00 60.01 ? 100 GLN B N   1 
ATOM 2398 C CA  . GLN B 1 83  ? 24.003  -56.588 18.923  1.00 60.54 ? 100 GLN B CA  1 
ATOM 2399 C C   . GLN B 1 83  ? 25.171  -55.873 19.578  1.00 61.07 ? 100 GLN B C   1 
ATOM 2400 O O   . GLN B 1 83  ? 26.025  -56.507 20.217  1.00 61.35 ? 100 GLN B O   1 
ATOM 2401 C CB  . GLN B 1 83  ? 23.032  -57.076 19.997  1.00 60.34 ? 100 GLN B CB  1 
ATOM 2402 C CG  . GLN B 1 83  ? 22.184  -55.978 20.607  1.00 60.41 ? 100 GLN B CG  1 
ATOM 2403 C CD  . GLN B 1 83  ? 21.406  -56.437 21.836  1.00 61.40 ? 100 GLN B CD  1 
ATOM 2404 O OE1 . GLN B 1 83  ? 21.986  -56.945 22.823  1.00 64.04 ? 100 GLN B OE1 1 
ATOM 2405 N NE2 . GLN B 1 83  ? 20.089  -56.244 21.798  1.00 59.07 ? 100 GLN B NE2 1 
ATOM 2406 N N   . ILE B 1 84  ? 25.192  -54.548 19.426  1.00 61.31 ? 101 ILE B N   1 
ATOM 2407 C CA  . ILE B 1 84  ? 26.143  -53.718 20.127  1.00 61.80 ? 101 ILE B CA  1 
ATOM 2408 C C   . ILE B 1 84  ? 25.419  -52.798 21.103  1.00 62.71 ? 101 ILE B C   1 
ATOM 2409 O O   . ILE B 1 84  ? 24.358  -52.230 20.789  1.00 62.95 ? 101 ILE B O   1 
ATOM 2410 C CB  . ILE B 1 84  ? 26.988  -52.893 19.163  1.00 61.80 ? 101 ILE B CB  1 
ATOM 2411 C CG1 . ILE B 1 84  ? 27.536  -53.770 18.031  1.00 61.79 ? 101 ILE B CG1 1 
ATOM 2412 C CG2 . ILE B 1 84  ? 28.112  -52.190 19.907  1.00 61.83 ? 101 ILE B CG2 1 
ATOM 2413 C CD1 . ILE B 1 84  ? 28.294  -54.981 18.478  1.00 61.37 ? 101 ILE B CD1 1 
ATOM 2414 N N   . THR B 1 85  ? 25.991  -52.680 22.297  1.00 63.37 ? 102 THR B N   1 
ATOM 2415 C CA  . THR B 1 85  ? 25.469  -51.798 23.328  1.00 64.57 ? 102 THR B CA  1 
ATOM 2416 C C   . THR B 1 85  ? 26.450  -50.651 23.521  1.00 65.09 ? 102 THR B C   1 
ATOM 2417 O O   . THR B 1 85  ? 27.643  -50.799 23.232  1.00 65.05 ? 102 THR B O   1 
ATOM 2418 C CB  . THR B 1 85  ? 25.294  -52.526 24.689  1.00 64.74 ? 102 THR B CB  1 
ATOM 2419 O OG1 . THR B 1 85  ? 26.501  -53.230 24.996  1.00 65.07 ? 102 THR B OG1 1 
ATOM 2420 C CG2 . THR B 1 85  ? 24.097  -53.506 24.674  1.00 64.03 ? 102 THR B CG2 1 
ATOM 2421 N N   . ASP B 1 86  ? 25.938  -49.522 24.020  1.00 65.85 ? 103 ASP B N   1 
ATOM 2422 C CA  . ASP B 1 86  ? 26.711  -48.282 24.221  1.00 66.36 ? 103 ASP B CA  1 
ATOM 2423 C C   . ASP B 1 86  ? 27.483  -47.850 22.969  1.00 66.41 ? 103 ASP B C   1 
ATOM 2424 O O   . ASP B 1 86  ? 28.668  -47.506 23.049  1.00 65.87 ? 103 ASP B O   1 
ATOM 2425 C CB  . ASP B 1 86  ? 27.654  -48.407 25.428  1.00 66.75 ? 103 ASP B CB  1 
ATOM 2426 C CG  . ASP B 1 86  ? 27.865  -47.082 26.159  1.00 68.11 ? 103 ASP B CG  1 
ATOM 2427 O OD1 . ASP B 1 86  ? 27.208  -46.073 25.805  1.00 69.53 ? 103 ASP B OD1 1 
ATOM 2428 O OD2 . ASP B 1 86  ? 28.687  -47.056 27.106  1.00 69.64 ? 103 ASP B OD2 1 
ATOM 2429 N N   . VAL B 1 87  ? 26.795  -47.868 21.823  1.00 66.62 ? 104 VAL B N   1 
ATOM 2430 C CA  . VAL B 1 87  ? 27.394  -47.543 20.528  1.00 66.84 ? 104 VAL B CA  1 
ATOM 2431 C C   . VAL B 1 87  ? 28.153  -46.216 20.588  1.00 67.19 ? 104 VAL B C   1 
ATOM 2432 O O   . VAL B 1 87  ? 27.590  -45.189 20.969  1.00 67.20 ? 104 VAL B O   1 
ATOM 2433 C CB  . VAL B 1 87  ? 26.320  -47.489 19.438  1.00 66.82 ? 104 VAL B CB  1 
ATOM 2434 C CG1 . VAL B 1 87  ? 26.831  -46.764 18.201  1.00 66.74 ? 104 VAL B CG1 1 
ATOM 2435 C CG2 . VAL B 1 87  ? 25.887  -48.883 19.094  1.00 66.61 ? 104 VAL B CG2 1 
ATOM 2436 N N   . LYS B 1 88  ? 29.435  -46.258 20.226  1.00 67.54 ? 105 LYS B N   1 
ATOM 2437 C CA  . LYS B 1 88  ? 30.308  -45.075 20.251  1.00 67.49 ? 105 LYS B CA  1 
ATOM 2438 C C   . LYS B 1 88  ? 30.546  -44.485 18.850  1.00 67.20 ? 105 LYS B C   1 
ATOM 2439 O O   . LYS B 1 88  ? 29.936  -44.899 17.859  1.00 66.95 ? 105 LYS B O   1 
ATOM 2440 C CB  . LYS B 1 88  ? 31.658  -45.408 20.925  1.00 67.86 ? 105 LYS B CB  1 
ATOM 2441 C CG  . LYS B 1 88  ? 31.602  -45.756 22.417  1.00 68.52 ? 105 LYS B CG  1 
ATOM 2442 C CD  . LYS B 1 88  ? 31.387  -44.523 23.301  1.00 70.04 ? 105 LYS B CD  1 
ATOM 2443 C CE  . LYS B 1 88  ? 31.299  -44.910 24.773  1.00 71.24 ? 105 LYS B CE  1 
ATOM 2444 N NZ  . LYS B 1 88  ? 31.247  -43.692 25.644  1.00 73.96 ? 105 LYS B NZ  1 
ATOM 2445 N N   . LEU B 1 89  ? 31.451  -43.521 18.772  1.00 67.15 ? 106 LEU B N   1 
ATOM 2446 C CA  . LEU B 1 89  ? 31.713  -42.849 17.517  1.00 67.12 ? 106 LEU B CA  1 
ATOM 2447 C C   . LEU B 1 89  ? 32.632  -43.680 16.631  1.00 67.58 ? 106 LEU B C   1 
ATOM 2448 O O   . LEU B 1 89  ? 32.527  -43.623 15.402  1.00 67.52 ? 106 LEU B O   1 
ATOM 2449 C CB  . LEU B 1 89  ? 32.300  -41.463 17.784  1.00 66.85 ? 106 LEU B CB  1 
ATOM 2450 C CG  . LEU B 1 89  ? 31.840  -40.365 16.823  1.00 64.95 ? 106 LEU B CG  1 
ATOM 2451 C CD1 . LEU B 1 89  ? 30.344  -40.478 16.485  1.00 62.82 ? 106 LEU B CD1 1 
ATOM 2452 C CD2 . LEU B 1 89  ? 32.175  -39.043 17.433  1.00 61.52 ? 106 LEU B CD2 1 
ATOM 2453 N N   . GLN B 1 90  ? 33.521  -44.451 17.274  1.00 67.80 ? 107 GLN B N   1 
ATOM 2454 C CA  . GLN B 1 90  ? 34.425  -45.408 16.610  1.00 67.80 ? 107 GLN B CA  1 
ATOM 2455 C C   . GLN B 1 90  ? 33.666  -46.584 15.956  1.00 67.44 ? 107 GLN B C   1 
ATOM 2456 O O   . GLN B 1 90  ? 34.013  -47.009 14.846  1.00 67.60 ? 107 GLN B O   1 
ATOM 2457 C CB  . GLN B 1 90  ? 35.469  -45.931 17.605  1.00 67.84 ? 107 GLN B CB  1 
ATOM 2458 C CG  . GLN B 1 90  ? 36.240  -44.828 18.357  1.00 69.15 ? 107 GLN B CG  1 
ATOM 2459 C CD  . GLN B 1 90  ? 35.418  -44.158 19.483  1.00 71.74 ? 107 GLN B CD  1 
ATOM 2460 O OE1 . GLN B 1 90  ? 34.205  -43.945 19.344  1.00 72.88 ? 107 GLN B OE1 1 
ATOM 2461 N NE2 . GLN B 1 90  ? 36.082  -43.830 20.601  1.00 70.31 ? 107 GLN B NE2 1 
ATOM 2462 N N   . ASP B 1 91  ? 32.630  -47.086 16.639  1.00 66.76 ? 108 ASP B N   1 
ATOM 2463 C CA  . ASP B 1 91  ? 31.770  -48.179 16.150  1.00 66.04 ? 108 ASP B CA  1 
ATOM 2464 C C   . ASP B 1 91  ? 31.165  -47.966 14.758  1.00 65.16 ? 108 ASP B C   1 
ATOM 2465 O O   . ASP B 1 91  ? 30.356  -48.756 14.306  1.00 64.87 ? 108 ASP B O   1 
ATOM 2466 C CB  . ASP B 1 91  ? 30.624  -48.455 17.139  1.00 66.43 ? 108 ASP B CB  1 
ATOM 2467 C CG  . ASP B 1 91  ? 31.088  -49.135 18.432  1.00 68.27 ? 108 ASP B CG  1 
ATOM 2468 O OD1 . ASP B 1 91  ? 32.313  -49.313 18.634  1.00 70.10 ? 108 ASP B OD1 1 
ATOM 2469 O OD2 . ASP B 1 91  ? 30.210  -49.496 19.256  1.00 68.68 ? 108 ASP B OD2 1 
ATOM 2470 N N   . ALA B 1 92  ? 31.527  -46.893 14.081  1.00 64.60 ? 109 ALA B N   1 
ATOM 2471 C CA  . ALA B 1 92  ? 31.024  -46.687 12.729  1.00 64.17 ? 109 ALA B CA  1 
ATOM 2472 C C   . ALA B 1 92  ? 32.004  -47.300 11.757  1.00 63.94 ? 109 ALA B C   1 
ATOM 2473 O O   . ALA B 1 92  ? 33.211  -47.354 12.012  1.00 63.69 ? 109 ALA B O   1 
ATOM 2474 C CB  . ALA B 1 92  ? 30.844  -45.206 12.437  1.00 64.04 ? 109 ALA B CB  1 
ATOM 2475 N N   . GLY B 1 93  ? 31.492  -47.762 10.632  1.00 63.65 ? 110 GLY B N   1 
ATOM 2476 C CA  . GLY B 1 93  ? 32.361  -48.372 9.657   1.00 63.57 ? 110 GLY B CA  1 
ATOM 2477 C C   . GLY B 1 93  ? 31.604  -49.426 8.905   1.00 63.42 ? 110 GLY B C   1 
ATOM 2478 O O   . GLY B 1 93  ? 30.375  -49.382 8.852   1.00 63.54 ? 110 GLY B O   1 
ATOM 2479 N N   . VAL B 1 94  ? 32.345  -50.360 8.318   1.00 63.17 ? 111 VAL B N   1 
ATOM 2480 C CA  . VAL B 1 94  ? 31.760  -51.397 7.488   1.00 62.99 ? 111 VAL B CA  1 
ATOM 2481 C C   . VAL B 1 94  ? 31.868  -52.767 8.162   1.00 63.62 ? 111 VAL B C   1 
ATOM 2482 O O   . VAL B 1 94  ? 32.960  -53.269 8.481   1.00 63.44 ? 111 VAL B O   1 
ATOM 2483 C CB  . VAL B 1 94  ? 32.315  -51.365 6.055   1.00 62.69 ? 111 VAL B CB  1 
ATOM 2484 C CG1 . VAL B 1 94  ? 31.545  -52.318 5.149   1.00 61.23 ? 111 VAL B CG1 1 
ATOM 2485 C CG2 . VAL B 1 94  ? 32.198  -49.959 5.524   1.00 61.44 ? 111 VAL B CG2 1 
ATOM 2486 N N   . TYR B 1 95  ? 30.689  -53.330 8.404   1.00 64.14 ? 112 TYR B N   1 
ATOM 2487 C CA  . TYR B 1 95  ? 30.534  -54.614 9.065   1.00 64.94 ? 112 TYR B CA  1 
ATOM 2488 C C   . TYR B 1 95  ? 30.326  -55.750 8.036   1.00 65.29 ? 112 TYR B C   1 
ATOM 2489 O O   . TYR B 1 95  ? 29.575  -55.600 7.052   1.00 65.04 ? 112 TYR B O   1 
ATOM 2490 C CB  . TYR B 1 95  ? 29.358  -54.557 10.044  1.00 65.06 ? 112 TYR B CB  1 
ATOM 2491 C CG  . TYR B 1 95  ? 29.596  -53.653 11.231  1.00 65.59 ? 112 TYR B CG  1 
ATOM 2492 C CD1 . TYR B 1 95  ? 29.520  -52.260 11.109  1.00 65.45 ? 112 TYR B CD1 1 
ATOM 2493 C CD2 . TYR B 1 95  ? 29.890  -54.186 12.476  1.00 65.70 ? 112 TYR B CD2 1 
ATOM 2494 C CE1 . TYR B 1 95  ? 29.739  -51.441 12.182  1.00 64.13 ? 112 TYR B CE1 1 
ATOM 2495 C CE2 . TYR B 1 95  ? 30.098  -53.375 13.562  1.00 65.68 ? 112 TYR B CE2 1 
ATOM 2496 C CZ  . TYR B 1 95  ? 30.023  -52.002 13.411  1.00 65.68 ? 112 TYR B CZ  1 
ATOM 2497 O OH  . TYR B 1 95  ? 30.243  -51.199 14.508  1.00 66.75 ? 112 TYR B OH  1 
ATOM 2498 N N   . ARG B 1 96  ? 31.012  -56.872 8.290   1.00 65.41 ? 113 ARG B N   1 
ATOM 2499 C CA  . ARG B 1 96  ? 30.952  -58.090 7.492   1.00 65.05 ? 113 ARG B CA  1 
ATOM 2500 C C   . ARG B 1 96  ? 30.335  -59.204 8.305   1.00 65.15 ? 113 ARG B C   1 
ATOM 2501 O O   . ARG B 1 96  ? 30.652  -59.377 9.498   1.00 65.02 ? 113 ARG B O   1 
ATOM 2502 C CB  . ARG B 1 96  ? 32.366  -58.533 7.126   1.00 65.13 ? 113 ARG B CB  1 
ATOM 2503 C CG  . ARG B 1 96  ? 33.130  -57.566 6.241   1.00 65.18 ? 113 ARG B CG  1 
ATOM 2504 C CD  . ARG B 1 96  ? 34.599  -57.914 6.184   1.00 62.09 ? 113 ARG B CD  1 
ATOM 2505 N NE  . ARG B 1 96  ? 35.349  -57.141 7.155   1.00 59.44 ? 113 ARG B NE  1 
ATOM 2506 C CZ  . ARG B 1 96  ? 36.045  -57.666 8.150   1.00 60.29 ? 113 ARG B CZ  1 
ATOM 2507 N NH1 . ARG B 1 96  ? 36.126  -58.983 8.314   1.00 61.65 ? 113 ARG B NH1 1 
ATOM 2508 N NH2 . ARG B 1 96  ? 36.690  -56.865 8.974   1.00 61.14 ? 113 ARG B NH2 1 
ATOM 2509 N N   . CYS B 1 97  ? 29.469  -59.982 7.667   1.00 65.44 ? 114 CYS B N   1 
ATOM 2510 C CA  . CYS B 1 97  ? 29.021  -61.208 8.305   1.00 66.12 ? 114 CYS B CA  1 
ATOM 2511 C C   . CYS B 1 97  ? 29.378  -62.438 7.464   1.00 66.39 ? 114 CYS B C   1 
ATOM 2512 O O   . CYS B 1 97  ? 29.042  -62.509 6.272   1.00 66.45 ? 114 CYS B O   1 
ATOM 2513 C CB  . CYS B 1 97  ? 27.541  -61.140 8.676   1.00 65.44 ? 114 CYS B CB  1 
ATOM 2514 S SG  . CYS B 1 97  ? 26.504  -61.511 7.350   1.00 66.33 ? 114 CYS B SG  1 
ATOM 2515 N N   . MET B 1 98  ? 30.101  -63.376 8.093   1.00 67.02 ? 115 MET B N   1 
ATOM 2516 C CA  . MET B 1 98  ? 30.493  -64.653 7.464   1.00 67.17 ? 115 MET B CA  1 
ATOM 2517 C C   . MET B 1 98  ? 29.672  -65.750 8.098   1.00 66.97 ? 115 MET B C   1 
ATOM 2518 O O   . MET B 1 98  ? 29.897  -66.099 9.272   1.00 66.43 ? 115 MET B O   1 
ATOM 2519 C CB  . MET B 1 98  ? 31.969  -64.983 7.679   1.00 67.22 ? 115 MET B CB  1 
ATOM 2520 C CG  . MET B 1 98  ? 32.827  -63.848 8.198   1.00 68.95 ? 115 MET B CG  1 
ATOM 2521 S SD  . MET B 1 98  ? 33.111  -62.462 7.049   1.00 72.87 ? 115 MET B SD  1 
ATOM 2522 C CE  . MET B 1 98  ? 34.200  -61.495 8.082   1.00 69.24 ? 115 MET B CE  1 
ATOM 2523 N N   . ILE B 1 99  ? 28.706  -66.267 7.334   1.00 66.79 ? 116 ILE B N   1 
ATOM 2524 C CA  . ILE B 1 99  ? 27.868  -67.359 7.815   1.00 66.79 ? 116 ILE B CA  1 
ATOM 2525 C C   . ILE B 1 99  ? 28.098  -68.641 7.011   1.00 66.96 ? 116 ILE B C   1 
ATOM 2526 O O   . ILE B 1 99  ? 28.076  -68.622 5.776   1.00 67.46 ? 116 ILE B O   1 
ATOM 2527 C CB  . ILE B 1 99  ? 26.382  -66.987 7.832   1.00 66.56 ? 116 ILE B CB  1 
ATOM 2528 C CG1 . ILE B 1 99  ? 26.186  -65.644 8.527   1.00 67.00 ? 116 ILE B CG1 1 
ATOM 2529 C CG2 . ILE B 1 99  ? 25.593  -68.039 8.604   1.00 66.63 ? 116 ILE B CG2 1 
ATOM 2530 C CD1 . ILE B 1 99  ? 24.920  -64.911 8.131   1.00 67.32 ? 116 ILE B CD1 1 
ATOM 2531 N N   . SER B 1 100 ? 28.333  -69.739 7.733   1.00 66.70 ? 117 SER B N   1 
ATOM 2532 C CA  . SER B 1 100 ? 28.484  -71.069 7.169   1.00 66.58 ? 117 SER B CA  1 
ATOM 2533 C C   . SER B 1 100 ? 27.478  -72.039 7.813   1.00 66.95 ? 117 SER B C   1 
ATOM 2534 O O   . SER B 1 100 ? 27.521  -72.298 9.029   1.00 66.61 ? 117 SER B O   1 
ATOM 2535 C CB  . SER B 1 100 ? 29.913  -71.551 7.395   1.00 66.56 ? 117 SER B CB  1 
ATOM 2536 O OG  . SER B 1 100 ? 30.100  -72.848 6.885   1.00 66.27 ? 117 SER B OG  1 
ATOM 2537 N N   . TYR B 1 101 ? 26.577  -72.559 6.977   1.00 67.55 ? 118 TYR B N   1 
ATOM 2538 C CA  . TYR B 1 101 ? 25.553  -73.547 7.352   1.00 68.37 ? 118 TYR B CA  1 
ATOM 2539 C C   . TYR B 1 101 ? 24.909  -74.011 6.065   1.00 68.18 ? 118 TYR B C   1 
ATOM 2540 O O   . TYR B 1 101 ? 24.068  -73.307 5.507   1.00 68.18 ? 118 TYR B O   1 
ATOM 2541 C CB  . TYR B 1 101 ? 24.478  -72.902 8.238   1.00 69.21 ? 118 TYR B CB  1 
ATOM 2542 C CG  . TYR B 1 101 ? 23.434  -73.832 8.859   1.00 70.09 ? 118 TYR B CG  1 
ATOM 2543 C CD1 . TYR B 1 101 ? 23.531  -74.218 10.198  1.00 70.82 ? 118 TYR B CD1 1 
ATOM 2544 C CD2 . TYR B 1 101 ? 22.327  -74.283 8.130   1.00 71.28 ? 118 TYR B CD2 1 
ATOM 2545 C CE1 . TYR B 1 101 ? 22.571  -75.034 10.793  1.00 70.71 ? 118 TYR B CE1 1 
ATOM 2546 C CE2 . TYR B 1 101 ? 21.355  -75.114 8.723   1.00 71.29 ? 118 TYR B CE2 1 
ATOM 2547 C CZ  . TYR B 1 101 ? 21.497  -75.476 10.054  1.00 71.00 ? 118 TYR B CZ  1 
ATOM 2548 O OH  . TYR B 1 101 ? 20.574  -76.289 10.659  1.00 72.27 ? 118 TYR B OH  1 
ATOM 2549 N N   . GLY B 1 102 ? 25.283  -75.197 5.602   1.00 68.12 ? 119 GLY B N   1 
ATOM 2550 C CA  . GLY B 1 102 ? 24.924  -75.630 4.249   1.00 67.93 ? 119 GLY B CA  1 
ATOM 2551 C C   . GLY B 1 102 ? 26.026  -75.093 3.362   1.00 67.70 ? 119 GLY B C   1 
ATOM 2552 O O   . GLY B 1 102 ? 27.134  -75.629 3.342   1.00 68.09 ? 119 GLY B O   1 
ATOM 2553 N N   . GLY B 1 103 ? 25.745  -74.005 2.658   1.00 67.68 ? 120 GLY B N   1 
ATOM 2554 C CA  . GLY B 1 103 ? 26.794  -73.251 1.962   1.00 67.55 ? 120 GLY B CA  1 
ATOM 2555 C C   . GLY B 1 103 ? 27.486  -72.275 2.899   1.00 67.18 ? 120 GLY B C   1 
ATOM 2556 O O   . GLY B 1 103 ? 27.451  -72.413 4.128   1.00 66.87 ? 120 GLY B O   1 
ATOM 2557 N N   . ALA B 1 104 ? 28.128  -71.275 2.327   1.00 67.22 ? 121 ALA B N   1 
ATOM 2558 C CA  . ALA B 1 104 ? 28.732  -70.253 3.166   1.00 67.49 ? 121 ALA B CA  1 
ATOM 2559 C C   . ALA B 1 104 ? 28.734  -68.899 2.453   1.00 67.58 ? 121 ALA B C   1 
ATOM 2560 O O   . ALA B 1 104 ? 29.386  -68.760 1.416   1.00 68.24 ? 121 ALA B O   1 
ATOM 2561 C CB  . ALA B 1 104 ? 30.138  -70.672 3.569   1.00 67.26 ? 121 ALA B CB  1 
ATOM 2562 N N   . ASP B 1 105 ? 27.995  -67.909 2.976   1.00 67.15 ? 122 ASP B N   1 
ATOM 2563 C CA  . ASP B 1 105 ? 28.050  -66.551 2.380   1.00 66.33 ? 122 ASP B CA  1 
ATOM 2564 C C   . ASP B 1 105 ? 28.434  -65.415 3.340   1.00 66.10 ? 122 ASP B C   1 
ATOM 2565 O O   . ASP B 1 105 ? 28.588  -65.615 4.565   1.00 65.45 ? 122 ASP B O   1 
ATOM 2566 C CB  . ASP B 1 105 ? 26.802  -66.202 1.531   1.00 65.84 ? 122 ASP B CB  1 
ATOM 2567 C CG  . ASP B 1 105 ? 27.153  -65.352 0.310   1.00 64.37 ? 122 ASP B CG  1 
ATOM 2568 O OD1 . ASP B 1 105 ? 26.270  -65.054 -0.529  1.00 63.05 ? 122 ASP B OD1 1 
ATOM 2569 O OD2 . ASP B 1 105 ? 28.338  -64.991 0.182   1.00 60.82 ? 122 ASP B OD2 1 
ATOM 2570 N N   . TYR B 1 106 ? 28.612  -64.237 2.729   1.00 66.02 ? 123 TYR B N   1 
ATOM 2571 C CA  . TYR B 1 106 ? 29.019  -62.994 3.388   1.00 65.71 ? 123 TYR B CA  1 
ATOM 2572 C C   . TYR B 1 106 ? 28.385  -61.757 2.703   1.00 65.41 ? 123 TYR B C   1 
ATOM 2573 O O   . TYR B 1 106 ? 28.471  -61.572 1.464   1.00 64.68 ? 123 TYR B O   1 
ATOM 2574 C CB  . TYR B 1 106 ? 30.553  -62.858 3.387   1.00 65.62 ? 123 TYR B CB  1 
ATOM 2575 C CG  . TYR B 1 106 ? 31.077  -62.101 2.180   1.00 66.56 ? 123 TYR B CG  1 
ATOM 2576 C CD1 . TYR B 1 106 ? 31.136  -60.705 2.189   1.00 66.33 ? 123 TYR B CD1 1 
ATOM 2577 C CD2 . TYR B 1 106 ? 31.481  -62.775 1.013   1.00 66.74 ? 123 TYR B CD2 1 
ATOM 2578 C CE1 . TYR B 1 106 ? 31.582  -59.996 1.076   1.00 66.38 ? 123 TYR B CE1 1 
ATOM 2579 C CE2 . TYR B 1 106 ? 31.926  -62.069 -0.108  1.00 65.97 ? 123 TYR B CE2 1 
ATOM 2580 C CZ  . TYR B 1 106 ? 31.976  -60.681 -0.060  1.00 65.84 ? 123 TYR B CZ  1 
ATOM 2581 O OH  . TYR B 1 106 ? 32.423  -59.951 -1.130  1.00 66.09 ? 123 TYR B OH  1 
ATOM 2582 N N   . LYS B 1 107 ? 27.750  -60.917 3.519   1.00 65.13 ? 124 LYS B N   1 
ATOM 2583 C CA  . LYS B 1 107 ? 27.341  -59.579 3.071   1.00 64.67 ? 124 LYS B CA  1 
ATOM 2584 C C   . LYS B 1 107 ? 27.883  -58.501 4.012   1.00 64.11 ? 124 LYS B C   1 
ATOM 2585 O O   . LYS B 1 107 ? 28.400  -58.815 5.088   1.00 63.87 ? 124 LYS B O   1 
ATOM 2586 C CB  . LYS B 1 107 ? 25.823  -59.480 2.898   1.00 64.76 ? 124 LYS B CB  1 
ATOM 2587 C CG  . LYS B 1 107 ? 25.249  -60.429 1.826   1.00 65.11 ? 124 LYS B CG  1 
ATOM 2588 C CD  . LYS B 1 107 ? 25.298  -59.879 0.405   1.00 64.22 ? 124 LYS B CD  1 
ATOM 2589 C CE  . LYS B 1 107 ? 24.766  -60.917 -0.588  1.00 64.85 ? 124 LYS B CE  1 
ATOM 2590 N NZ  . LYS B 1 107 ? 25.665  -62.093 -0.799  1.00 63.84 ? 124 LYS B NZ  1 
ATOM 2591 N N   . ARG B 1 108 ? 27.793  -57.243 3.577   1.00 63.65 ? 125 ARG B N   1 
ATOM 2592 C CA  . ARG B 1 108 ? 28.355  -56.098 4.312   1.00 63.18 ? 125 ARG B CA  1 
ATOM 2593 C C   . ARG B 1 108 ? 27.329  -55.011 4.685   1.00 62.01 ? 125 ARG B C   1 
ATOM 2594 O O   . ARG B 1 108 ? 26.550  -54.556 3.843   1.00 61.59 ? 125 ARG B O   1 
ATOM 2595 C CB  . ARG B 1 108 ? 29.514  -55.475 3.519   1.00 62.97 ? 125 ARG B CB  1 
ATOM 2596 C CG  . ARG B 1 108 ? 30.869  -56.109 3.786   1.00 63.53 ? 125 ARG B CG  1 
ATOM 2597 C CD  . ARG B 1 108 ? 32.017  -55.393 3.065   1.00 64.81 ? 125 ARG B CD  1 
ATOM 2598 N NE  . ARG B 1 108 ? 32.295  -55.907 1.720   1.00 69.33 ? 125 ARG B NE  1 
ATOM 2599 C CZ  . ARG B 1 108 ? 31.579  -55.635 0.625   1.00 71.58 ? 125 ARG B CZ  1 
ATOM 2600 N NH1 . ARG B 1 108 ? 30.495  -54.860 0.677   1.00 71.43 ? 125 ARG B NH1 1 
ATOM 2601 N NH2 . ARG B 1 108 ? 31.942  -56.165 -0.538  1.00 74.65 ? 125 ARG B NH2 1 
ATOM 2602 N N   . ILE B 1 109 ? 27.344  -54.598 5.949   1.00 61.22 ? 126 ILE B N   1 
ATOM 2603 C CA  . ILE B 1 109 ? 26.454  -53.533 6.427   1.00 60.31 ? 126 ILE B CA  1 
ATOM 2604 C C   . ILE B 1 109 ? 27.262  -52.289 6.786   1.00 60.33 ? 126 ILE B C   1 
ATOM 2605 O O   . ILE B 1 109 ? 28.267  -52.384 7.504   1.00 60.00 ? 126 ILE B O   1 
ATOM 2606 C CB  . ILE B 1 109 ? 25.595  -54.007 7.618   1.00 59.78 ? 126 ILE B CB  1 
ATOM 2607 C CG1 . ILE B 1 109 ? 24.514  -54.980 7.140   1.00 59.39 ? 126 ILE B CG1 1 
ATOM 2608 C CG2 . ILE B 1 109 ? 24.893  -52.870 8.228   1.00 59.45 ? 126 ILE B CG2 1 
ATOM 2609 C CD1 . ILE B 1 109 ? 24.019  -55.950 8.183   1.00 57.07 ? 126 ILE B CD1 1 
ATOM 2610 N N   . THR B 1 110 ? 26.852  -51.137 6.247   1.00 60.17 ? 127 THR B N   1 
ATOM 2611 C CA  . THR B 1 110 ? 27.461  -49.867 6.640   1.00 60.34 ? 127 THR B CA  1 
ATOM 2612 C C   . THR B 1 110 ? 26.789  -49.349 7.891   1.00 60.02 ? 127 THR B C   1 
ATOM 2613 O O   . THR B 1 110 ? 25.567  -49.324 7.974   1.00 60.15 ? 127 THR B O   1 
ATOM 2614 C CB  . THR B 1 110 ? 27.340  -48.768 5.564   1.00 60.53 ? 127 THR B CB  1 
ATOM 2615 O OG1 . THR B 1 110 ? 27.888  -49.234 4.327   1.00 61.80 ? 127 THR B OG1 1 
ATOM 2616 C CG2 . THR B 1 110 ? 28.112  -47.516 6.003   1.00 60.05 ? 127 THR B CG2 1 
ATOM 2617 N N   . VAL B 1 111 ? 27.580  -48.922 8.864   1.00 60.07 ? 128 VAL B N   1 
ATOM 2618 C CA  . VAL B 1 111 ? 26.996  -48.367 10.078  1.00 60.39 ? 128 VAL B CA  1 
ATOM 2619 C C   . VAL B 1 111 ? 27.404  -46.897 10.381  1.00 60.64 ? 128 VAL B C   1 
ATOM 2620 O O   . VAL B 1 111 ? 28.574  -46.593 10.683  1.00 60.57 ? 128 VAL B O   1 
ATOM 2621 C CB  . VAL B 1 111 ? 27.178  -49.339 11.267  1.00 60.39 ? 128 VAL B CB  1 
ATOM 2622 C CG1 . VAL B 1 111 ? 26.829  -48.658 12.571  1.00 60.43 ? 128 VAL B CG1 1 
ATOM 2623 C CG2 . VAL B 1 111 ? 26.306  -50.592 11.066  1.00 59.22 ? 128 VAL B CG2 1 
ATOM 2624 N N   . LYS B 1 112 ? 26.415  -46.001 10.268  1.00 60.66 ? 129 LYS B N   1 
ATOM 2625 C CA  . LYS B 1 112 ? 26.597  -44.564 10.535  1.00 60.79 ? 129 LYS B CA  1 
ATOM 2626 C C   . LYS B 1 112 ? 26.152  -44.202 11.950  1.00 60.49 ? 129 LYS B C   1 
ATOM 2627 O O   . LYS B 1 112 ? 25.020  -44.476 12.345  1.00 61.28 ? 129 LYS B O   1 
ATOM 2628 C CB  . LYS B 1 112 ? 25.842  -43.712 9.503   1.00 60.82 ? 129 LYS B CB  1 
ATOM 2629 C CG  . LYS B 1 112 ? 26.700  -43.254 8.313   1.00 61.89 ? 129 LYS B CG  1 
ATOM 2630 C CD  . LYS B 1 112 ? 25.862  -43.116 7.029   1.00 63.61 ? 129 LYS B CD  1 
ATOM 2631 C CE  . LYS B 1 112 ? 26.761  -43.082 5.743   1.00 63.61 ? 129 LYS B CE  1 
ATOM 2632 N NZ  . LYS B 1 112 ? 26.059  -42.393 4.568   1.00 63.59 ? 129 LYS B NZ  1 
ATOM 2633 N N   . VAL B 1 113 ? 27.049  -43.601 12.719  1.00 59.90 ? 130 VAL B N   1 
ATOM 2634 C CA  . VAL B 1 113 ? 26.700  -43.132 14.062  1.00 59.10 ? 130 VAL B CA  1 
ATOM 2635 C C   . VAL B 1 113 ? 26.499  -41.578 14.057  1.00 58.90 ? 130 VAL B C   1 
ATOM 2636 O O   . VAL B 1 113 ? 27.463  -40.819 13.833  1.00 58.45 ? 130 VAL B O   1 
ATOM 2637 C CB  . VAL B 1 113 ? 27.748  -43.616 15.156  1.00 58.90 ? 130 VAL B CB  1 
ATOM 2638 C CG1 . VAL B 1 113 ? 27.227  -43.376 16.550  1.00 57.69 ? 130 VAL B CG1 1 
ATOM 2639 C CG2 . VAL B 1 113 ? 28.051  -45.100 15.023  1.00 58.13 ? 130 VAL B CG2 1 
ATOM 2640 N N   . ASN B 1 114 ? 25.248  -41.129 14.257  1.00 58.03 ? 131 ASN B N   1 
ATOM 2641 C CA  . ASN B 1 114 ? 24.944  -39.715 14.508  1.00 57.45 ? 131 ASN B CA  1 
ATOM 2642 C C   . ASN B 1 114 ? 24.961  -39.459 16.006  1.00 56.72 ? 131 ASN B C   1 
ATOM 2643 O O   . ASN B 1 114 ? 24.392  -40.235 16.785  1.00 56.59 ? 131 ASN B O   1 
ATOM 2644 C CB  . ASN B 1 114 ? 23.594  -39.313 13.896  1.00 57.89 ? 131 ASN B CB  1 
ATOM 2645 C CG  . ASN B 1 114 ? 23.683  -39.011 12.359  1.00 60.47 ? 131 ASN B CG  1 
ATOM 2646 O OD1 . ASN B 1 114 ? 24.622  -39.441 11.655  1.00 61.65 ? 131 ASN B OD1 1 
ATOM 2647 N ND2 . ASN B 1 114 ? 22.695  -38.259 11.849  1.00 61.67 ? 131 ASN B ND2 1 
ATOM 2648 N N   . ALA B 1 115 ? 25.653  -38.403 16.429  1.00 55.61 ? 132 ALA B N   1 
ATOM 2649 C CA  . ALA B 1 115 ? 25.647  -38.034 17.848  1.00 54.43 ? 132 ALA B CA  1 
ATOM 2650 C C   . ALA B 1 115 ? 24.970  -36.684 17.966  1.00 53.70 ? 132 ALA B C   1 
ATOM 2651 O O   . ALA B 1 115 ? 25.668  -35.659 18.000  1.00 53.87 ? 132 ALA B O   1 
ATOM 2652 C CB  . ALA B 1 115 ? 27.047  -37.963 18.391  1.00 54.25 ? 132 ALA B CB  1 
ATOM 2653 N N   . PRO B 1 116 ? 23.611  -36.664 18.008  1.00 52.60 ? 133 PRO B N   1 
ATOM 2654 C CA  . PRO B 1 116 ? 22.925  -35.389 17.866  1.00 51.47 ? 133 PRO B CA  1 
ATOM 2655 C C   . PRO B 1 116 ? 22.872  -34.583 19.173  1.00 50.35 ? 133 PRO B C   1 
ATOM 2656 O O   . PRO B 1 116 ? 22.808  -35.156 20.244  1.00 50.38 ? 133 PRO B O   1 
ATOM 2657 C CB  . PRO B 1 116 ? 21.549  -35.794 17.360  1.00 50.97 ? 133 PRO B CB  1 
ATOM 2658 C CG  . PRO B 1 116 ? 21.326  -37.105 17.933  1.00 51.68 ? 133 PRO B CG  1 
ATOM 2659 C CD  . PRO B 1 116 ? 22.648  -37.761 18.203  1.00 52.48 ? 133 PRO B CD  1 
ATOM 2660 N N   . TYR B 1 117 ? 22.963  -33.262 19.054  1.00 49.38 ? 134 TYR B N   1 
ATOM 2661 C CA  . TYR B 1 117 ? 22.808  -32.341 20.165  1.00 48.69 ? 134 TYR B CA  1 
ATOM 2662 C C   . TYR B 1 117 ? 21.341  -32.335 20.641  1.00 48.78 ? 134 TYR B C   1 
ATOM 2663 O O   . TYR B 1 117 ? 20.578  -31.452 20.257  1.00 48.21 ? 134 TYR B O   1 
ATOM 2664 C CB  . TYR B 1 117 ? 23.183  -30.945 19.675  1.00 48.20 ? 134 TYR B CB  1 
ATOM 2665 C CG  . TYR B 1 117 ? 24.666  -30.728 19.476  1.00 47.61 ? 134 TYR B CG  1 
ATOM 2666 C CD1 . TYR B 1 117 ? 25.502  -30.437 20.570  1.00 46.29 ? 134 TYR B CD1 1 
ATOM 2667 C CD2 . TYR B 1 117 ? 25.237  -30.817 18.210  1.00 46.35 ? 134 TYR B CD2 1 
ATOM 2668 C CE1 . TYR B 1 117 ? 26.854  -30.244 20.411  1.00 45.01 ? 134 TYR B CE1 1 
ATOM 2669 C CE2 . TYR B 1 117 ? 26.600  -30.619 18.033  1.00 46.17 ? 134 TYR B CE2 1 
ATOM 2670 C CZ  . TYR B 1 117 ? 27.403  -30.324 19.141  1.00 47.11 ? 134 TYR B CZ  1 
ATOM 2671 O OH  . TYR B 1 117 ? 28.771  -30.118 18.977  1.00 49.36 ? 134 TYR B OH  1 
ATOM 2672 N N   . ASN B 1 118 ? 20.930  -33.327 21.442  1.00 48.67 ? 135 ASN B N   1 
ATOM 2673 C CA  . ASN B 1 118 ? 19.485  -33.500 21.745  1.00 48.02 ? 135 ASN B CA  1 
ATOM 2674 C C   . ASN B 1 118 ? 19.115  -33.606 23.216  1.00 47.94 ? 135 ASN B C   1 
ATOM 2675 O O   . ASN B 1 118 ? 17.943  -33.725 23.543  1.00 48.53 ? 135 ASN B O   1 
ATOM 2676 C CB  . ASN B 1 118 ? 18.884  -34.691 20.988  1.00 47.83 ? 135 ASN B CB  1 
ATOM 2677 C CG  . ASN B 1 118 ? 19.589  -36.021 21.280  1.00 47.00 ? 135 ASN B CG  1 
ATOM 2678 O OD1 . ASN B 1 118 ? 20.490  -36.122 22.130  1.00 46.45 ? 135 ASN B OD1 1 
ATOM 2679 N ND2 . ASN B 1 118 ? 19.183  -37.051 20.542  1.00 44.79 ? 135 ASN B ND2 1 
ATOM 2680 N N   . LYS B 1 119 ? 20.124  -33.618 24.084  1.00 47.17 ? 136 LYS B N   1 
ATOM 2681 C CA  . LYS B 1 119 ? 19.930  -33.577 25.498  1.00 46.18 ? 136 LYS B CA  1 
ATOM 2682 C C   . LYS B 1 119 ? 20.331  -32.160 25.770  1.00 45.75 ? 136 LYS B C   1 
ATOM 2683 O O   . LYS B 1 119 ? 21.511  -31.897 25.961  1.00 46.97 ? 136 LYS B O   1 
ATOM 2684 C CB  . LYS B 1 119 ? 20.926  -34.494 26.202  1.00 46.21 ? 136 LYS B CB  1 
ATOM 2685 C CG  . LYS B 1 119 ? 20.735  -35.975 25.992  1.00 47.27 ? 136 LYS B CG  1 
ATOM 2686 C CD  . LYS B 1 119 ? 21.646  -36.509 24.890  1.00 51.60 ? 136 LYS B CD  1 
ATOM 2687 C CE  . LYS B 1 119 ? 22.221  -37.868 25.263  1.00 52.26 ? 136 LYS B CE  1 
ATOM 2688 N NZ  . LYS B 1 119 ? 21.160  -38.874 25.540  1.00 50.28 ? 136 LYS B NZ  1 
ATOM 2689 N N   . ILE B 1 120 ? 19.380  -31.234 25.767  1.00 44.71 ? 137 ILE B N   1 
ATOM 2690 C CA  . ILE B 1 120 ? 19.698  -29.828 25.993  1.00 42.54 ? 137 ILE B CA  1 
ATOM 2691 C C   . ILE B 1 120 ? 19.384  -29.381 27.418  1.00 42.34 ? 137 ILE B C   1 
ATOM 2692 O O   . ILE B 1 120 ? 18.250  -29.413 27.878  1.00 41.92 ? 137 ILE B O   1 
ATOM 2693 C CB  . ILE B 1 120 ? 18.997  -28.932 24.987  1.00 42.33 ? 137 ILE B CB  1 
ATOM 2694 C CG1 . ILE B 1 120 ? 19.271  -29.410 23.560  1.00 40.29 ? 137 ILE B CG1 1 
ATOM 2695 C CG2 . ILE B 1 120 ? 19.492  -27.490 25.128  1.00 44.37 ? 137 ILE B CG2 1 
ATOM 2696 C CD1 . ILE B 1 120 ? 18.319  -28.889 22.527  1.00 35.55 ? 137 ILE B CD1 1 
ATOM 2697 N N   . ASN B 1 121 ? 20.439  -28.998 28.112  1.00 42.17 ? 138 ASN B N   1 
ATOM 2698 C CA  . ASN B 1 121 ? 20.378  -28.413 29.431  1.00 41.86 ? 138 ASN B CA  1 
ATOM 2699 C C   . ASN B 1 121 ? 20.350  -26.859 29.336  1.00 41.38 ? 138 ASN B C   1 
ATOM 2700 O O   . ASN B 1 121 ? 20.958  -26.266 28.428  1.00 40.76 ? 138 ASN B O   1 
ATOM 2701 C CB  . ASN B 1 121 ? 21.594  -28.882 30.216  1.00 42.64 ? 138 ASN B CB  1 
ATOM 2702 C CG  . ASN B 1 121 ? 21.763  -30.414 30.191  1.00 44.33 ? 138 ASN B CG  1 
ATOM 2703 O OD1 . ASN B 1 121 ? 20.824  -31.145 30.461  1.00 46.39 ? 138 ASN B OD1 1 
ATOM 2704 N ND2 . ASN B 1 121 ? 22.973  -30.887 29.866  1.00 46.25 ? 138 ASN B ND2 1 
ATOM 2705 N N   . GLN B 1 122 ? 19.634  -26.216 30.268  1.00 40.39 ? 139 GLN B N   1 
ATOM 2706 C CA  . GLN B 1 122 ? 19.237  -24.818 30.113  1.00 39.25 ? 139 GLN B CA  1 
ATOM 2707 C C   . GLN B 1 122 ? 19.204  -24.074 31.444  1.00 39.42 ? 139 GLN B C   1 
ATOM 2708 O O   . GLN B 1 122 ? 18.813  -24.645 32.461  1.00 39.18 ? 139 GLN B O   1 
ATOM 2709 C CB  . GLN B 1 122 ? 17.881  -24.706 29.382  1.00 38.71 ? 139 GLN B CB  1 
ATOM 2710 C CG  . GLN B 1 122 ? 16.692  -24.927 30.247  1.00 37.80 ? 139 GLN B CG  1 
ATOM 2711 C CD  . GLN B 1 122 ? 15.373  -24.531 29.600  1.00 38.09 ? 139 GLN B CD  1 
ATOM 2712 O OE1 . GLN B 1 122 ? 15.123  -24.813 28.437  1.00 33.77 ? 139 GLN B OE1 1 
ATOM 2713 N NE2 . GLN B 1 122 ? 14.507  -23.876 30.381  1.00 39.42 ? 139 GLN B NE2 1 
ATOM 2714 N N   . ARG B 1 123 ? 19.634  -22.807 31.440  1.00 39.65 ? 140 ARG B N   1 
ATOM 2715 C CA  . ARG B 1 123 ? 19.469  -21.943 32.627  1.00 39.60 ? 140 ARG B CA  1 
ATOM 2716 C C   . ARG B 1 123 ? 18.866  -20.620 32.288  1.00 38.90 ? 140 ARG B C   1 
ATOM 2717 O O   . ARG B 1 123 ? 19.124  -20.061 31.238  1.00 39.13 ? 140 ARG B O   1 
ATOM 2718 C CB  . ARG B 1 123 ? 20.783  -21.712 33.342  1.00 39.75 ? 140 ARG B CB  1 
ATOM 2719 C CG  . ARG B 1 123 ? 20.593  -21.266 34.777  1.00 40.81 ? 140 ARG B CG  1 
ATOM 2720 C CD  . ARG B 1 123 ? 21.935  -21.206 35.514  1.00 44.05 ? 140 ARG B CD  1 
ATOM 2721 N NE  . ARG B 1 123 ? 22.931  -20.523 34.689  1.00 45.15 ? 140 ARG B NE  1 
ATOM 2722 C CZ  . ARG B 1 123 ? 24.210  -20.368 35.002  1.00 44.48 ? 140 ARG B CZ  1 
ATOM 2723 N NH1 . ARG B 1 123 ? 24.703  -20.833 36.148  1.00 42.65 ? 140 ARG B NH1 1 
ATOM 2724 N NH2 . ARG B 1 123 ? 24.992  -19.736 34.140  1.00 44.48 ? 140 ARG B NH2 1 
ATOM 2725 N N   . ILE B 1 124 ? 18.042  -20.131 33.185  1.00 39.13 ? 141 ILE B N   1 
ATOM 2726 C CA  . ILE B 1 124 ? 17.490  -18.786 33.083  1.00 39.68 ? 141 ILE B CA  1 
ATOM 2727 C C   . ILE B 1 124 ? 17.812  -18.072 34.394  1.00 40.34 ? 141 ILE B C   1 
ATOM 2728 O O   . ILE B 1 124 ? 17.318  -18.471 35.452  1.00 39.71 ? 141 ILE B O   1 
ATOM 2729 C CB  . ILE B 1 124 ? 15.961  -18.819 32.898  1.00 39.60 ? 141 ILE B CB  1 
ATOM 2730 C CG1 . ILE B 1 124 ? 15.572  -19.817 31.783  1.00 39.02 ? 141 ILE B CG1 1 
ATOM 2731 C CG2 . ILE B 1 124 ? 15.443  -17.445 32.655  1.00 39.62 ? 141 ILE B CG2 1 
ATOM 2732 C CD1 . ILE B 1 124 ? 14.261  -19.541 31.122  1.00 38.02 ? 141 ILE B CD1 1 
ATOM 2733 N N   . LEU B 1 125 ? 18.675  -17.055 34.328  1.00 41.58 ? 142 LEU B N   1 
ATOM 2734 C CA  . LEU B 1 125 ? 18.938  -16.161 35.478  1.00 42.30 ? 142 LEU B CA  1 
ATOM 2735 C C   . LEU B 1 125 ? 18.451  -14.734 35.307  1.00 41.83 ? 142 LEU B C   1 
ATOM 2736 O O   . LEU B 1 125 ? 18.484  -14.132 34.234  1.00 42.12 ? 142 LEU B O   1 
ATOM 2737 C CB  . LEU B 1 125 ? 20.415  -16.083 35.794  1.00 42.97 ? 142 LEU B CB  1 
ATOM 2738 C CG  . LEU B 1 125 ? 21.231  -17.295 36.198  1.00 44.88 ? 142 LEU B CG  1 
ATOM 2739 C CD1 . LEU B 1 125 ? 22.631  -16.776 36.344  1.00 45.51 ? 142 LEU B CD1 1 
ATOM 2740 C CD2 . LEU B 1 125 ? 20.713  -17.877 37.511  1.00 48.77 ? 142 LEU B CD2 1 
ATOM 2741 N N   . VAL B 1 126 ? 18.027  -14.193 36.417  1.00 41.70 ? 143 VAL B N   1 
ATOM 2742 C CA  . VAL B 1 126 ? 17.719  -12.783 36.527  1.00 42.04 ? 143 VAL B CA  1 
ATOM 2743 C C   . VAL B 1 126 ? 18.992  -12.044 37.021  1.00 41.68 ? 143 VAL B C   1 
ATOM 2744 O O   . VAL B 1 126 ? 19.334  -12.019 38.219  1.00 41.75 ? 143 VAL B O   1 
ATOM 2745 C CB  . VAL B 1 126 ? 16.450  -12.558 37.426  1.00 41.75 ? 143 VAL B CB  1 
ATOM 2746 C CG1 . VAL B 1 126 ? 16.310  -13.703 38.522  1.00 42.36 ? 143 VAL B CG1 1 
ATOM 2747 C CG2 . VAL B 1 126 ? 16.484  -11.197 38.061  1.00 41.74 ? 143 VAL B CG2 1 
ATOM 2748 N N   . VAL B 1 127 ? 19.685  -11.465 36.057  1.00 41.61 ? 144 VAL B N   1 
ATOM 2749 C CA  . VAL B 1 127 ? 20.936  -10.745 36.269  1.00 41.84 ? 144 VAL B CA  1 
ATOM 2750 C C   . VAL B 1 127 ? 20.761  -9.389  36.986  1.00 41.77 ? 144 VAL B C   1 
ATOM 2751 O O   . VAL B 1 127 ? 21.686  -8.896  37.639  1.00 40.77 ? 144 VAL B O   1 
ATOM 2752 C CB  . VAL B 1 127 ? 21.625  -10.535 34.883  1.00 42.14 ? 144 VAL B CB  1 
ATOM 2753 C CG1 . VAL B 1 127 ? 22.599  -9.355  34.899  1.00 40.78 ? 144 VAL B CG1 1 
ATOM 2754 C CG2 . VAL B 1 127 ? 22.294  -11.833 34.457  1.00 40.79 ? 144 VAL B CG2 1 
ATOM 2755 N N   . ASP B 1 128 ? 19.562  -8.817  36.833  1.00 42.18 ? 145 ASP B N   1 
ATOM 2756 C CA  . ASP B 1 128 ? 19.221  -7.462  37.268  1.00 41.91 ? 145 ASP B CA  1 
ATOM 2757 C C   . ASP B 1 128 ? 17.697  -7.270  37.268  1.00 41.65 ? 145 ASP B C   1 
ATOM 2758 O O   . ASP B 1 128 ? 17.092  -6.997  36.247  1.00 41.70 ? 145 ASP B O   1 
ATOM 2759 C CB  . ASP B 1 128 ? 19.855  -6.460  36.313  1.00 41.63 ? 145 ASP B CB  1 
ATOM 2760 C CG  . ASP B 1 128 ? 19.738  -5.033  36.807  1.00 42.89 ? 145 ASP B CG  1 
ATOM 2761 O OD1 . ASP B 1 128 ? 18.848  -4.743  37.672  1.00 41.04 ? 145 ASP B OD1 1 
ATOM 2762 O OD2 . ASP B 1 128 ? 20.555  -4.201  36.312  1.00 42.88 ? 145 ASP B OD2 1 
ATOM 2763 N N   . PRO B 1 129 ? 17.059  -7.441  38.408  1.00 41.81 ? 146 PRO B N   1 
ATOM 2764 C CA  . PRO B 1 129 ? 15.603  -7.285  38.372  1.00 42.15 ? 146 PRO B CA  1 
ATOM 2765 C C   . PRO B 1 129 ? 15.106  -5.860  37.981  1.00 42.73 ? 146 PRO B C   1 
ATOM 2766 O O   . PRO B 1 129 ? 14.098  -5.734  37.241  1.00 42.82 ? 146 PRO B O   1 
ATOM 2767 C CB  . PRO B 1 129 ? 15.177  -7.651  39.796  1.00 42.22 ? 146 PRO B CB  1 
ATOM 2768 C CG  . PRO B 1 129 ? 16.407  -7.431  40.638  1.00 42.17 ? 146 PRO B CG  1 
ATOM 2769 C CD  . PRO B 1 129 ? 17.562  -7.805  39.744  1.00 41.77 ? 146 PRO B CD  1 
ATOM 2770 N N   . VAL B 1 130 ? 15.786  -4.800  38.438  1.00 42.24 ? 147 VAL B N   1 
ATOM 2771 C CA  . VAL B 1 130 ? 15.365  -3.454  38.016  1.00 41.85 ? 147 VAL B CA  1 
ATOM 2772 C C   . VAL B 1 130 ? 15.347  -3.278  36.478  1.00 42.63 ? 147 VAL B C   1 
ATOM 2773 O O   . VAL B 1 130 ? 14.509  -2.562  35.942  1.00 43.85 ? 147 VAL B O   1 
ATOM 2774 C CB  . VAL B 1 130 ? 16.144  -2.282  38.671  1.00 41.49 ? 147 VAL B CB  1 
ATOM 2775 C CG1 . VAL B 1 130 ? 15.428  -0.960  38.381  1.00 38.68 ? 147 VAL B CG1 1 
ATOM 2776 C CG2 . VAL B 1 130 ? 16.344  -2.485  40.188  1.00 38.87 ? 147 VAL B CG2 1 
ATOM 2777 N N   . THR B 1 131 ? 16.240  -3.941  35.772  1.00 42.45 ? 148 THR B N   1 
ATOM 2778 C CA  . THR B 1 131 ? 16.394  -3.735  34.329  1.00 42.59 ? 148 THR B CA  1 
ATOM 2779 C C   . THR B 1 131 ? 15.673  -4.854  33.599  1.00 42.27 ? 148 THR B C   1 
ATOM 2780 O O   . THR B 1 131 ? 15.606  -4.862  32.353  1.00 42.15 ? 148 THR B O   1 
ATOM 2781 C CB  . THR B 1 131 ? 17.910  -3.770  33.984  1.00 42.79 ? 148 THR B CB  1 
ATOM 2782 O OG1 . THR B 1 131 ? 18.486  -2.504  34.300  1.00 44.58 ? 148 THR B OG1 1 
ATOM 2783 C CG2 . THR B 1 131 ? 18.199  -4.074  32.510  1.00 45.37 ? 148 THR B CG2 1 
ATOM 2784 N N   . SER B 1 132 ? 15.152  -5.808  34.388  1.00 41.60 ? 149 SER B N   1 
ATOM 2785 C CA  . SER B 1 132 ? 14.606  -7.067  33.881  1.00 40.45 ? 149 SER B CA  1 
ATOM 2786 C C   . SER B 1 132 ? 15.519  -7.735  32.838  1.00 40.13 ? 149 SER B C   1 
ATOM 2787 O O   . SER B 1 132 ? 15.056  -8.348  31.841  1.00 40.35 ? 149 SER B O   1 
ATOM 2788 C CB  . SER B 1 132 ? 13.203  -6.849  33.329  1.00 40.67 ? 149 SER B CB  1 
ATOM 2789 O OG  . SER B 1 132 ? 13.242  -5.912  32.267  1.00 40.15 ? 149 SER B OG  1 
ATOM 2790 N N   . GLU B 1 133 ? 16.819  -7.630  33.076  1.00 39.01 ? 150 GLU B N   1 
ATOM 2791 C CA  . GLU B 1 133 ? 17.768  -8.270  32.220  1.00 38.73 ? 150 GLU B CA  1 
ATOM 2792 C C   . GLU B 1 133 ? 17.957  -9.710  32.714  1.00 39.58 ? 150 GLU B C   1 
ATOM 2793 O O   . GLU B 1 133 ? 18.024  -9.974  33.931  1.00 39.72 ? 150 GLU B O   1 
ATOM 2794 C CB  . GLU B 1 133 ? 19.060  -7.504  32.283  1.00 38.25 ? 150 GLU B CB  1 
ATOM 2795 C CG  . GLU B 1 133 ? 20.073  -7.904  31.235  1.00 37.91 ? 150 GLU B CG  1 
ATOM 2796 C CD  . GLU B 1 133 ? 21.470  -7.335  31.511  1.00 37.59 ? 150 GLU B CD  1 
ATOM 2797 O OE1 . GLU B 1 133 ? 21.636  -6.357  32.260  1.00 33.97 ? 150 GLU B OE1 1 
ATOM 2798 O OE2 . GLU B 1 133 ? 22.434  -7.878  30.963  1.00 42.14 ? 150 GLU B OE2 1 
ATOM 2799 N N   . HIS B 1 134 ? 18.046  -10.645 31.773  1.00 40.15 ? 151 HIS B N   1 
ATOM 2800 C CA  . HIS B 1 134 ? 18.210  -12.048 32.119  1.00 40.61 ? 151 HIS B CA  1 
ATOM 2801 C C   . HIS B 1 134 ? 19.420  -12.624 31.432  1.00 40.44 ? 151 HIS B C   1 
ATOM 2802 O O   . HIS B 1 134 ? 19.835  -12.166 30.340  1.00 39.78 ? 151 HIS B O   1 
ATOM 2803 C CB  . HIS B 1 134 ? 16.967  -12.856 31.750  1.00 41.35 ? 151 HIS B CB  1 
ATOM 2804 C CG  . HIS B 1 134 ? 15.762  -12.519 32.583  1.00 44.59 ? 151 HIS B CG  1 
ATOM 2805 N ND1 . HIS B 1 134 ? 14.980  -11.407 32.348  1.00 46.17 ? 151 HIS B ND1 1 
ATOM 2806 C CD2 . HIS B 1 134 ? 15.218  -13.138 33.661  1.00 45.54 ? 151 HIS B CD2 1 
ATOM 2807 C CE1 . HIS B 1 134 ? 14.023  -11.346 33.259  1.00 46.09 ? 151 HIS B CE1 1 
ATOM 2808 N NE2 . HIS B 1 134 ? 14.141  -12.389 34.063  1.00 44.46 ? 151 HIS B NE2 1 
ATOM 2809 N N   . GLU B 1 135 ? 20.012  -13.616 32.093  1.00 40.35 ? 152 GLU B N   1 
ATOM 2810 C CA  . GLU B 1 135 ? 20.922  -14.474 31.406  1.00 40.40 ? 152 GLU B CA  1 
ATOM 2811 C C   . GLU B 1 135 ? 20.200  -15.769 31.107  1.00 40.10 ? 152 GLU B C   1 
ATOM 2812 O O   . GLU B 1 135 ? 19.775  -16.473 32.025  1.00 39.61 ? 152 GLU B O   1 
ATOM 2813 C CB  . GLU B 1 135 ? 22.173  -14.754 32.222  1.00 40.53 ? 152 GLU B CB  1 
ATOM 2814 C CG  . GLU B 1 135 ? 23.276  -15.540 31.426  1.00 40.16 ? 152 GLU B CG  1 
ATOM 2815 C CD  . GLU B 1 135 ? 24.475  -15.927 32.298  1.00 41.71 ? 152 GLU B CD  1 
ATOM 2816 O OE1 . GLU B 1 135 ? 24.290  -16.417 33.448  1.00 43.34 ? 152 GLU B OE1 1 
ATOM 2817 O OE2 . GLU B 1 135 ? 25.614  -15.745 31.833  1.00 44.21 ? 152 GLU B OE2 1 
ATOM 2818 N N   . LEU B 1 136 ? 20.075  -16.061 29.819  1.00 39.98 ? 153 LEU B N   1 
ATOM 2819 C CA  . LEU B 1 136 ? 19.723  -17.395 29.341  1.00 40.36 ? 153 LEU B CA  1 
ATOM 2820 C C   . LEU B 1 136 ? 20.951  -18.158 28.822  1.00 40.70 ? 153 LEU B C   1 
ATOM 2821 O O   . LEU B 1 136 ? 21.766  -17.625 28.055  1.00 40.25 ? 153 LEU B O   1 
ATOM 2822 C CB  . LEU B 1 136 ? 18.678  -17.327 28.223  1.00 39.78 ? 153 LEU B CB  1 
ATOM 2823 C CG  . LEU B 1 136 ? 17.513  -16.352 28.255  1.00 38.96 ? 153 LEU B CG  1 
ATOM 2824 C CD1 . LEU B 1 136 ? 16.589  -16.699 27.136  1.00 39.84 ? 153 LEU B CD1 1 
ATOM 2825 C CD2 . LEU B 1 136 ? 16.739  -16.339 29.532  1.00 40.49 ? 153 LEU B CD2 1 
ATOM 2826 N N   . THR B 1 137 ? 21.031  -19.422 29.220  1.00 41.68 ? 154 THR B N   1 
ATOM 2827 C CA  . THR B 1 137 ? 22.126  -20.326 28.863  1.00 43.01 ? 154 THR B CA  1 
ATOM 2828 C C   . THR B 1 137 ? 21.612  -21.680 28.344  1.00 43.46 ? 154 THR B C   1 
ATOM 2829 O O   . THR B 1 137 ? 20.600  -22.192 28.816  1.00 43.28 ? 154 THR B O   1 
ATOM 2830 C CB  . THR B 1 137 ? 22.954  -20.608 30.103  1.00 43.11 ? 154 THR B CB  1 
ATOM 2831 O OG1 . THR B 1 137 ? 22.613  -19.649 31.142  1.00 45.63 ? 154 THR B OG1 1 
ATOM 2832 C CG2 . THR B 1 137 ? 24.405  -20.546 29.769  1.00 42.88 ? 154 THR B CG2 1 
ATOM 2833 N N   . CYS B 1 138 ? 22.320  -22.269 27.386  1.00 44.37 ? 155 CYS B N   1 
ATOM 2834 C CA  . CYS B 1 138 ? 21.963  -23.574 26.828  1.00 45.05 ? 155 CYS B CA  1 
ATOM 2835 C C   . CYS B 1 138 ? 23.222  -24.353 26.542  1.00 45.54 ? 155 CYS B C   1 
ATOM 2836 O O   . CYS B 1 138 ? 24.191  -23.798 26.040  1.00 45.72 ? 155 CYS B O   1 
ATOM 2837 C CB  . CYS B 1 138 ? 21.190  -23.427 25.519  1.00 45.41 ? 155 CYS B CB  1 
ATOM 2838 S SG  . CYS B 1 138 ? 19.378  -23.263 25.649  1.00 46.61 ? 155 CYS B SG  1 
ATOM 2839 N N   . GLN B 1 139 ? 23.194  -25.648 26.833  1.00 45.93 ? 156 GLN B N   1 
ATOM 2840 C CA  . GLN B 1 139 ? 24.348  -26.506 26.660  1.00 46.57 ? 156 GLN B CA  1 
ATOM 2841 C C   . GLN B 1 139 ? 23.894  -27.875 26.185  1.00 46.46 ? 156 GLN B C   1 
ATOM 2842 O O   . GLN B 1 139 ? 22.830  -28.355 26.578  1.00 46.31 ? 156 GLN B O   1 
ATOM 2843 C CB  . GLN B 1 139 ? 25.099  -26.628 27.985  1.00 46.56 ? 156 GLN B CB  1 
ATOM 2844 C CG  . GLN B 1 139 ? 26.177  -27.720 28.064  1.00 47.33 ? 156 GLN B CG  1 
ATOM 2845 C CD  . GLN B 1 139 ? 27.082  -27.523 29.275  1.00 48.92 ? 156 GLN B CD  1 
ATOM 2846 O OE1 . GLN B 1 139 ? 26.970  -28.229 30.278  1.00 52.52 ? 156 GLN B OE1 1 
ATOM 2847 N NE2 . GLN B 1 139 ? 27.967  -26.523 29.201  1.00 53.15 ? 156 GLN B NE2 1 
ATOM 2848 N N   . ALA B 1 140 ? 24.722  -28.484 25.338  1.00 46.35 ? 157 ALA B N   1 
ATOM 2849 C CA  . ALA B 1 140 ? 24.500  -29.794 24.762  1.00 46.32 ? 157 ALA B CA  1 
ATOM 2850 C C   . ALA B 1 140 ? 25.821  -30.317 24.161  1.00 47.36 ? 157 ALA B C   1 
ATOM 2851 O O   . ALA B 1 140 ? 26.703  -29.540 23.739  1.00 47.43 ? 157 ALA B O   1 
ATOM 2852 C CB  . ALA B 1 140 ? 23.447  -29.728 23.704  1.00 45.34 ? 157 ALA B CB  1 
ATOM 2853 N N   . GLU B 1 141 ? 25.942  -31.646 24.135  1.00 47.87 ? 158 GLU B N   1 
ATOM 2854 C CA  . GLU B 1 141 ? 27.026  -32.339 23.469  1.00 47.40 ? 158 GLU B CA  1 
ATOM 2855 C C   . GLU B 1 141 ? 26.548  -33.069 22.231  1.00 47.48 ? 158 GLU B C   1 
ATOM 2856 O O   . GLU B 1 141 ? 25.382  -33.449 22.125  1.00 46.92 ? 158 GLU B O   1 
ATOM 2857 C CB  . GLU B 1 141 ? 27.694  -33.272 24.452  1.00 47.27 ? 158 GLU B CB  1 
ATOM 2858 C CG  . GLU B 1 141 ? 28.032  -32.515 25.723  1.00 48.50 ? 158 GLU B CG  1 
ATOM 2859 C CD  . GLU B 1 141 ? 29.147  -33.154 26.523  1.00 47.81 ? 158 GLU B CD  1 
ATOM 2860 O OE1 . GLU B 1 141 ? 29.171  -34.410 26.567  1.00 45.70 ? 158 GLU B OE1 1 
ATOM 2861 O OE2 . GLU B 1 141 ? 29.975  -32.386 27.097  1.00 45.25 ? 158 GLU B OE2 1 
ATOM 2862 N N   . GLY B 1 142 ? 27.476  -33.200 21.288  1.00 48.37 ? 159 GLY B N   1 
ATOM 2863 C CA  . GLY B 1 142 ? 27.295  -33.879 19.995  1.00 49.40 ? 159 GLY B CA  1 
ATOM 2864 C C   . GLY B 1 142 ? 28.576  -33.952 19.133  1.00 50.55 ? 159 GLY B C   1 
ATOM 2865 O O   . GLY B 1 142 ? 29.708  -33.866 19.647  1.00 49.92 ? 159 GLY B O   1 
ATOM 2866 N N   . TYR B 1 143 ? 28.378  -34.108 17.820  1.00 51.60 ? 160 TYR B N   1 
ATOM 2867 C CA  . TYR B 1 143 ? 29.440  -34.163 16.822  1.00 53.33 ? 160 TYR B CA  1 
ATOM 2868 C C   . TYR B 1 143 ? 28.773  -34.011 15.446  1.00 54.60 ? 160 TYR B C   1 
ATOM 2869 O O   . TYR B 1 143 ? 27.683  -34.526 15.254  1.00 54.76 ? 160 TYR B O   1 
ATOM 2870 C CB  . TYR B 1 143 ? 30.185  -35.507 16.895  1.00 53.37 ? 160 TYR B CB  1 
ATOM 2871 C CG  . TYR B 1 143 ? 31.471  -35.568 16.067  1.00 54.16 ? 160 TYR B CG  1 
ATOM 2872 C CD1 . TYR B 1 143 ? 32.702  -35.218 16.629  1.00 53.20 ? 160 TYR B CD1 1 
ATOM 2873 C CD2 . TYR B 1 143 ? 31.451  -35.982 14.730  1.00 54.43 ? 160 TYR B CD2 1 
ATOM 2874 C CE1 . TYR B 1 143 ? 33.865  -35.273 15.893  1.00 54.34 ? 160 TYR B CE1 1 
ATOM 2875 C CE2 . TYR B 1 143 ? 32.623  -36.026 13.975  1.00 55.04 ? 160 TYR B CE2 1 
ATOM 2876 C CZ  . TYR B 1 143 ? 33.819  -35.668 14.571  1.00 55.56 ? 160 TYR B CZ  1 
ATOM 2877 O OH  . TYR B 1 143 ? 34.983  -35.704 13.844  1.00 58.26 ? 160 TYR B OH  1 
ATOM 2878 N N   . PRO B 1 144 ? 29.387  -33.252 14.500  1.00 56.04 ? 161 PRO B N   1 
ATOM 2879 C CA  . PRO B 1 144 ? 30.558  -32.347 14.655  1.00 56.97 ? 161 PRO B CA  1 
ATOM 2880 C C   . PRO B 1 144 ? 30.233  -31.121 15.538  1.00 57.70 ? 161 PRO B C   1 
ATOM 2881 O O   . PRO B 1 144 ? 29.259  -31.160 16.296  1.00 57.99 ? 161 PRO B O   1 
ATOM 2882 C CB  . PRO B 1 144 ? 30.872  -31.925 13.203  1.00 57.10 ? 161 PRO B CB  1 
ATOM 2883 C CG  . PRO B 1 144 ? 29.534  -32.102 12.465  1.00 56.71 ? 161 PRO B CG  1 
ATOM 2884 C CD  . PRO B 1 144 ? 28.913  -33.308 13.099  1.00 55.97 ? 161 PRO B CD  1 
ATOM 2885 N N   . LYS B 1 145 ? 31.043  -30.057 15.447  1.00 58.31 ? 162 LYS B N   1 
ATOM 2886 C CA  . LYS B 1 145 ? 30.744  -28.769 16.102  1.00 58.34 ? 162 LYS B CA  1 
ATOM 2887 C C   . LYS B 1 145 ? 29.423  -28.166 15.616  1.00 57.95 ? 162 LYS B C   1 
ATOM 2888 O O   . LYS B 1 145 ? 29.061  -28.281 14.421  1.00 57.29 ? 162 LYS B O   1 
ATOM 2889 C CB  . LYS B 1 145 ? 31.882  -27.760 15.882  1.00 58.77 ? 162 LYS B CB  1 
ATOM 2890 C CG  . LYS B 1 145 ? 32.993  -27.825 16.924  1.00 59.44 ? 162 LYS B CG  1 
ATOM 2891 C CD  . LYS B 1 145 ? 34.327  -27.261 16.435  1.00 59.18 ? 162 LYS B CD  1 
ATOM 2892 C CE  . LYS B 1 145 ? 35.408  -27.425 17.533  1.00 61.49 ? 162 LYS B CE  1 
ATOM 2893 N NZ  . LYS B 1 145 ? 36.657  -26.685 17.196  1.00 63.55 ? 162 LYS B NZ  1 
ATOM 2894 N N   . ALA B 1 146 ? 28.712  -27.536 16.560  1.00 57.75 ? 163 ALA B N   1 
ATOM 2895 C CA  . ALA B 1 146 ? 27.477  -26.802 16.265  1.00 57.56 ? 163 ALA B CA  1 
ATOM 2896 C C   . ALA B 1 146 ? 27.566  -25.321 16.596  1.00 57.43 ? 163 ALA B C   1 
ATOM 2897 O O   . ALA B 1 146 ? 28.392  -24.876 17.395  1.00 57.12 ? 163 ALA B O   1 
ATOM 2898 C CB  . ALA B 1 146 ? 26.310  -27.418 16.985  1.00 57.53 ? 163 ALA B CB  1 
ATOM 2899 N N   . GLU B 1 147 ? 26.721  -24.554 15.931  1.00 57.75 ? 164 GLU B N   1 
ATOM 2900 C CA  . GLU B 1 147 ? 26.513  -23.154 16.283  1.00 57.79 ? 164 GLU B CA  1 
ATOM 2901 C C   . GLU B 1 147 ? 25.177  -23.099 17.017  1.00 57.11 ? 164 GLU B C   1 
ATOM 2902 O O   . GLU B 1 147 ? 24.360  -24.019 16.902  1.00 56.79 ? 164 GLU B O   1 
ATOM 2903 C CB  . GLU B 1 147 ? 26.516  -22.256 15.045  1.00 57.22 ? 164 GLU B CB  1 
ATOM 2904 C CG  . GLU B 1 147 ? 25.575  -22.716 13.965  1.00 58.27 ? 164 GLU B CG  1 
ATOM 2905 C CD  . GLU B 1 147 ? 25.497  -21.775 12.769  1.00 59.35 ? 164 GLU B CD  1 
ATOM 2906 O OE1 . GLU B 1 147 ? 25.350  -22.289 11.628  1.00 60.78 ? 164 GLU B OE1 1 
ATOM 2907 O OE2 . GLU B 1 147 ? 25.565  -20.534 12.969  1.00 60.03 ? 164 GLU B OE2 1 
ATOM 2908 N N   . VAL B 1 148 ? 24.986  -22.049 17.810  1.00 56.84 ? 165 VAL B N   1 
ATOM 2909 C CA  . VAL B 1 148 ? 23.753  -21.860 18.562  1.00 56.09 ? 165 VAL B CA  1 
ATOM 2910 C C   . VAL B 1 148 ? 23.012  -20.600 18.132  1.00 56.29 ? 165 VAL B C   1 
ATOM 2911 O O   . VAL B 1 148 ? 23.491  -19.470 18.295  1.00 56.26 ? 165 VAL B O   1 
ATOM 2912 C CB  . VAL B 1 148 ? 23.987  -21.847 20.061  1.00 55.78 ? 165 VAL B CB  1 
ATOM 2913 C CG1 . VAL B 1 148 ? 22.682  -21.531 20.792  1.00 54.39 ? 165 VAL B CG1 1 
ATOM 2914 C CG2 . VAL B 1 148 ? 24.534  -23.179 20.477  1.00 54.71 ? 165 VAL B CG2 1 
ATOM 2915 N N   . ILE B 1 149 ? 21.827  -20.824 17.587  1.00 56.18 ? 166 ILE B N   1 
ATOM 2916 C CA  . ILE B 1 149 ? 21.009  -19.748 17.109  1.00 56.19 ? 166 ILE B CA  1 
ATOM 2917 C C   . ILE B 1 149 ? 19.864  -19.486 18.086  1.00 56.20 ? 166 ILE B C   1 
ATOM 2918 O O   . ILE B 1 149 ? 19.073  -20.399 18.424  1.00 56.44 ? 166 ILE B O   1 
ATOM 2919 C CB  . ILE B 1 149 ? 20.529  -20.050 15.685  1.00 56.12 ? 166 ILE B CB  1 
ATOM 2920 C CG1 . ILE B 1 149 ? 21.748  -20.334 14.824  1.00 55.99 ? 166 ILE B CG1 1 
ATOM 2921 C CG2 . ILE B 1 149 ? 19.786  -18.862 15.103  1.00 55.09 ? 166 ILE B CG2 1 
ATOM 2922 C CD1 . ILE B 1 149 ? 21.685  -21.621 14.094  1.00 56.96 ? 166 ILE B CD1 1 
ATOM 2923 N N   . TRP B 1 150 ? 19.801  -18.229 18.538  1.00 55.79 ? 167 TRP B N   1 
ATOM 2924 C CA  . TRP B 1 150 ? 18.773  -17.761 19.490  1.00 54.85 ? 167 TRP B CA  1 
ATOM 2925 C C   . TRP B 1 150 ? 17.688  -16.968 18.786  1.00 55.09 ? 167 TRP B C   1 
ATOM 2926 O O   . TRP B 1 150 ? 17.973  -16.105 17.980  1.00 55.32 ? 167 TRP B O   1 
ATOM 2927 C CB  . TRP B 1 150 ? 19.398  -16.863 20.543  1.00 53.89 ? 167 TRP B CB  1 
ATOM 2928 C CG  . TRP B 1 150 ? 20.447  -17.494 21.425  1.00 51.22 ? 167 TRP B CG  1 
ATOM 2929 C CD1 . TRP B 1 150 ? 21.784  -17.563 21.176  1.00 49.41 ? 167 TRP B CD1 1 
ATOM 2930 C CD2 . TRP B 1 150 ? 20.248  -18.084 22.719  1.00 47.44 ? 167 TRP B CD2 1 
ATOM 2931 N NE1 . TRP B 1 150 ? 22.432  -18.159 22.225  1.00 48.07 ? 167 TRP B NE1 1 
ATOM 2932 C CE2 . TRP B 1 150 ? 21.513  -18.498 23.184  1.00 47.75 ? 167 TRP B CE2 1 
ATOM 2933 C CE3 . TRP B 1 150 ? 19.120  -18.312 23.523  1.00 46.51 ? 167 TRP B CE3 1 
ATOM 2934 C CZ2 . TRP B 1 150 ? 21.692  -19.128 24.422  1.00 48.42 ? 167 TRP B CZ2 1 
ATOM 2935 C CZ3 . TRP B 1 150 ? 19.284  -18.935 24.753  1.00 46.85 ? 167 TRP B CZ3 1 
ATOM 2936 C CH2 . TRP B 1 150 ? 20.567  -19.331 25.198  1.00 49.54 ? 167 TRP B CH2 1 
ATOM 2937 N N   . THR B 1 151 ? 16.441  -17.256 19.096  1.00 55.70 ? 168 THR B N   1 
ATOM 2938 C CA  . THR B 1 151 ? 15.329  -16.577 18.468  1.00 56.57 ? 168 THR B CA  1 
ATOM 2939 C C   . THR B 1 151 ? 14.328  -16.383 19.570  1.00 57.63 ? 168 THR B C   1 
ATOM 2940 O O   . THR B 1 151 ? 14.428  -17.032 20.619  1.00 57.49 ? 168 THR B O   1 
ATOM 2941 C CB  . THR B 1 151 ? 14.639  -17.441 17.387  1.00 56.44 ? 168 THR B CB  1 
ATOM 2942 O OG1 . THR B 1 151 ? 14.355  -18.744 17.923  1.00 58.41 ? 168 THR B OG1 1 
ATOM 2943 C CG2 . THR B 1 151 ? 15.465  -17.584 16.134  1.00 54.86 ? 168 THR B CG2 1 
ATOM 2944 N N   . SER B 1 152 ? 13.345  -15.522 19.324  1.00 59.07 ? 169 SER B N   1 
ATOM 2945 C CA  . SER B 1 152 ? 12.351  -15.193 20.328  1.00 60.83 ? 169 SER B CA  1 
ATOM 2946 C C   . SER B 1 152 ? 10.916  -15.382 19.832  1.00 61.80 ? 169 SER B C   1 
ATOM 2947 O O   . SER B 1 152 ? 10.669  -15.608 18.652  1.00 61.40 ? 169 SER B O   1 
ATOM 2948 C CB  . SER B 1 152 ? 12.553  -13.749 20.783  1.00 60.88 ? 169 SER B CB  1 
ATOM 2949 O OG  . SER B 1 152 ? 12.012  -12.829 19.829  1.00 63.41 ? 169 SER B OG  1 
ATOM 2950 N N   . SER B 1 153 ? 9.981   -15.257 20.763  1.00 63.63 ? 170 SER B N   1 
ATOM 2951 C CA  . SER B 1 153 ? 8.552   -15.313 20.506  1.00 65.84 ? 170 SER B CA  1 
ATOM 2952 C C   . SER B 1 153 ? 8.026   -14.325 19.415  1.00 67.69 ? 170 SER B C   1 
ATOM 2953 O O   . SER B 1 153 ? 6.802   -14.120 19.276  1.00 68.25 ? 170 SER B O   1 
ATOM 2954 C CB  . SER B 1 153 ? 7.838   -15.082 21.846  1.00 65.66 ? 170 SER B CB  1 
ATOM 2955 O OG  . SER B 1 153 ? 6.431   -14.989 21.693  1.00 66.99 ? 170 SER B OG  1 
ATOM 2956 N N   . ASP B 1 154 ? 8.934   -13.706 18.655  1.00 69.25 ? 171 ASP B N   1 
ATOM 2957 C CA  . ASP B 1 154 ? 8.551   -12.884 17.501  1.00 70.61 ? 171 ASP B CA  1 
ATOM 2958 C C   . ASP B 1 154 ? 9.660   -12.888 16.446  1.00 71.51 ? 171 ASP B C   1 
ATOM 2959 O O   . ASP B 1 154 ? 9.568   -12.185 15.432  1.00 71.91 ? 171 ASP B O   1 
ATOM 2960 C CB  . ASP B 1 154 ? 8.180   -11.446 17.930  1.00 70.61 ? 171 ASP B CB  1 
ATOM 2961 C CG  . ASP B 1 154 ? 9.360   -10.677 18.475  1.00 70.88 ? 171 ASP B CG  1 
ATOM 2962 O OD1 . ASP B 1 154 ? 9.420   -10.493 19.713  1.00 71.83 ? 171 ASP B OD1 1 
ATOM 2963 O OD2 . ASP B 1 154 ? 10.237  -10.283 17.664  1.00 71.29 ? 171 ASP B OD2 1 
ATOM 2964 N N   . HIS B 1 155 ? 10.702  -13.683 16.698  1.00 72.36 ? 172 HIS B N   1 
ATOM 2965 C CA  . HIS B 1 155 ? 11.872  -13.819 15.791  1.00 73.44 ? 172 HIS B CA  1 
ATOM 2966 C C   . HIS B 1 155 ? 12.680  -12.493 15.632  1.00 73.21 ? 172 HIS B C   1 
ATOM 2967 O O   . HIS B 1 155 ? 13.048  -12.107 14.498  1.00 73.34 ? 172 HIS B O   1 
ATOM 2968 C CB  . HIS B 1 155 ? 11.505  -14.411 14.381  1.00 73.71 ? 172 HIS B CB  1 
ATOM 2969 C CG  . HIS B 1 155 ? 10.521  -15.560 14.390  1.00 75.81 ? 172 HIS B CG  1 
ATOM 2970 N ND1 . HIS B 1 155 ? 10.486  -16.532 15.374  1.00 75.75 ? 172 HIS B ND1 1 
ATOM 2971 C CD2 . HIS B 1 155 ? 9.560   -15.907 13.491  1.00 76.84 ? 172 HIS B CD2 1 
ATOM 2972 C CE1 . HIS B 1 155 ? 9.526   -17.403 15.099  1.00 76.30 ? 172 HIS B CE1 1 
ATOM 2973 N NE2 . HIS B 1 155 ? 8.958   -17.054 13.955  1.00 76.04 ? 172 HIS B NE2 1 
ATOM 2974 N N   . GLN B 1 156 ? 12.932  -11.798 16.749  1.00 72.47 ? 173 GLN B N   1 
ATOM 2975 C CA  . GLN B 1 156 ? 13.778  -10.590 16.724  1.00 71.74 ? 173 GLN B CA  1 
ATOM 2976 C C   . GLN B 1 156 ? 15.274  -10.969 16.661  1.00 71.43 ? 173 GLN B C   1 
ATOM 2977 O O   . GLN B 1 156 ? 15.630  -12.136 16.874  1.00 71.40 ? 173 GLN B O   1 
ATOM 2978 C CB  . GLN B 1 156 ? 13.481  -9.641  17.903  1.00 71.52 ? 173 GLN B CB  1 
ATOM 2979 C CG  . GLN B 1 156 ? 13.488  -10.330 19.267  1.00 69.70 ? 173 GLN B CG  1 
ATOM 2980 C CD  . GLN B 1 156 ? 14.078  -9.481  20.375  1.00 66.69 ? 173 GLN B CD  1 
ATOM 2981 O OE1 . GLN B 1 156 ? 13.665  -9.575  21.543  1.00 62.84 ? 173 GLN B OE1 1 
ATOM 2982 N NE2 . GLN B 1 156 ? 15.063  -8.650  20.020  1.00 66.70 ? 173 GLN B NE2 1 
ATOM 2983 N N   . VAL B 1 157 ? 16.129  -9.979  16.372  1.00 70.75 ? 174 VAL B N   1 
ATOM 2984 C CA  . VAL B 1 157 ? 17.552  -10.210 16.045  1.00 69.73 ? 174 VAL B CA  1 
ATOM 2985 C C   . VAL B 1 157 ? 18.466  -10.342 17.311  1.00 68.92 ? 174 VAL B C   1 
ATOM 2986 O O   . VAL B 1 157 ? 19.026  -9.342  17.826  1.00 68.81 ? 174 VAL B O   1 
ATOM 2987 C CB  . VAL B 1 157 ? 18.080  -9.178  14.947  1.00 69.62 ? 174 VAL B CB  1 
ATOM 2988 C CG1 . VAL B 1 157 ? 18.454  -7.834  15.564  1.00 69.68 ? 174 VAL B CG1 1 
ATOM 2989 C CG2 . VAL B 1 157 ? 19.242  -9.755  14.118  1.00 69.15 ? 174 VAL B CG2 1 
ATOM 2990 N N   . LEU B 1 158 ? 18.596  -11.588 17.793  1.00 67.20 ? 175 LEU B N   1 
ATOM 2991 C CA  . LEU B 1 158 ? 19.370  -11.902 19.006  1.00 65.47 ? 175 LEU B CA  1 
ATOM 2992 C C   . LEU B 1 158 ? 20.786  -12.417 18.724  1.00 64.60 ? 175 LEU B C   1 
ATOM 2993 O O   . LEU B 1 158 ? 21.027  -13.020 17.675  1.00 64.57 ? 175 LEU B O   1 
ATOM 2994 C CB  . LEU B 1 158 ? 18.619  -12.914 19.862  1.00 64.89 ? 175 LEU B CB  1 
ATOM 2995 C CG  . LEU B 1 158 ? 17.270  -12.434 20.392  1.00 64.78 ? 175 LEU B CG  1 
ATOM 2996 C CD1 . LEU B 1 158 ? 16.393  -13.574 20.976  1.00 63.27 ? 175 LEU B CD1 1 
ATOM 2997 C CD2 . LEU B 1 158 ? 17.469  -11.318 21.408  1.00 63.66 ? 175 LEU B CD2 1 
ATOM 2998 N N   . SER B 1 159 ? 21.704  -12.171 19.669  1.00 63.25 ? 176 SER B N   1 
ATOM 2999 C CA  . SER B 1 159 ? 23.071  -12.692 19.612  1.00 62.06 ? 176 SER B CA  1 
ATOM 3000 C C   . SER B 1 159 ? 23.599  -13.044 20.972  1.00 61.07 ? 176 SER B C   1 
ATOM 3001 O O   . SER B 1 159 ? 23.285  -12.374 21.935  1.00 60.97 ? 176 SER B O   1 
ATOM 3002 C CB  . SER B 1 159 ? 23.990  -11.687 18.967  1.00 61.78 ? 176 SER B CB  1 
ATOM 3003 O OG  . SER B 1 159 ? 23.728  -11.708 17.584  1.00 63.00 ? 176 SER B OG  1 
ATOM 3004 N N   . GLY B 1 160 ? 24.401  -14.101 21.039  1.00 60.15 ? 177 GLY B N   1 
ATOM 3005 C CA  . GLY B 1 160 ? 24.952  -14.586 22.308  1.00 59.08 ? 177 GLY B CA  1 
ATOM 3006 C C   . GLY B 1 160 ? 26.408  -15.000 22.178  1.00 58.51 ? 177 GLY B C   1 
ATOM 3007 O O   . GLY B 1 160 ? 26.986  -14.908 21.094  1.00 58.27 ? 177 GLY B O   1 
ATOM 3008 N N   . LYS B 1 161 ? 27.001  -15.429 23.289  1.00 58.18 ? 178 LYS B N   1 
ATOM 3009 C CA  . LYS B 1 161 ? 28.384  -15.919 23.325  1.00 58.25 ? 178 LYS B CA  1 
ATOM 3010 C C   . LYS B 1 161 ? 28.335  -17.430 23.402  1.00 57.63 ? 178 LYS B C   1 
ATOM 3011 O O   . LYS B 1 161 ? 27.809  -17.985 24.360  1.00 57.37 ? 178 LYS B O   1 
ATOM 3012 C CB  . LYS B 1 161 ? 29.169  -15.391 24.552  1.00 58.79 ? 178 LYS B CB  1 
ATOM 3013 C CG  . LYS B 1 161 ? 28.926  -13.904 24.980  1.00 60.30 ? 178 LYS B CG  1 
ATOM 3014 C CD  . LYS B 1 161 ? 29.782  -12.889 24.180  1.00 62.74 ? 178 LYS B CD  1 
ATOM 3015 C CE  . LYS B 1 161 ? 29.209  -11.472 24.206  1.00 61.97 ? 178 LYS B CE  1 
ATOM 3016 N NZ  . LYS B 1 161 ? 29.723  -10.657 25.346  1.00 64.23 ? 178 LYS B NZ  1 
ATOM 3017 N N   . THR B 1 162 ? 28.889  -18.081 22.390  1.00 57.18 ? 179 THR B N   1 
ATOM 3018 C CA  . THR B 1 162 ? 29.006  -19.531 22.340  1.00 56.76 ? 179 THR B CA  1 
ATOM 3019 C C   . THR B 1 162 ? 30.396  -20.038 22.717  1.00 56.93 ? 179 THR B C   1 
ATOM 3020 O O   . THR B 1 162 ? 31.384  -19.568 22.191  1.00 57.06 ? 179 THR B O   1 
ATOM 3021 C CB  . THR B 1 162 ? 28.729  -19.993 20.942  1.00 56.35 ? 179 THR B CB  1 
ATOM 3022 O OG1 . THR B 1 162 ? 27.420  -19.557 20.578  1.00 56.62 ? 179 THR B OG1 1 
ATOM 3023 C CG2 . THR B 1 162 ? 28.802  -21.495 20.863  1.00 56.82 ? 179 THR B CG2 1 
ATOM 3024 N N   . THR B 1 163 ? 30.471  -21.035 23.589  1.00 57.43 ? 180 THR B N   1 
ATOM 3025 C CA  . THR B 1 163 ? 31.755  -21.552 24.066  1.00 57.33 ? 180 THR B CA  1 
ATOM 3026 C C   . THR B 1 163 ? 31.858  -23.087 23.952  1.00 58.07 ? 180 THR B C   1 
ATOM 3027 O O   . THR B 1 163 ? 31.183  -23.854 24.685  1.00 58.50 ? 180 THR B O   1 
ATOM 3028 C CB  . THR B 1 163 ? 32.011  -21.083 25.497  1.00 57.22 ? 180 THR B CB  1 
ATOM 3029 O OG1 . THR B 1 163 ? 31.902  -19.655 25.546  1.00 56.85 ? 180 THR B OG1 1 
ATOM 3030 C CG2 . THR B 1 163 ? 33.378  -21.517 25.994  1.00 57.56 ? 180 THR B CG2 1 
ATOM 3031 N N   . THR B 1 164 ? 32.729  -23.516 23.034  1.00 58.31 ? 181 THR B N   1 
ATOM 3032 C CA  . THR B 1 164 ? 32.925  -24.923 22.670  1.00 57.99 ? 181 THR B CA  1 
ATOM 3033 C C   . THR B 1 164 ? 34.144  -25.556 23.341  1.00 58.11 ? 181 THR B C   1 
ATOM 3034 O O   . THR B 1 164 ? 35.232  -25.022 23.262  1.00 58.27 ? 181 THR B O   1 
ATOM 3035 C CB  . THR B 1 164 ? 33.051  -25.048 21.159  1.00 57.38 ? 181 THR B CB  1 
ATOM 3036 O OG1 . THR B 1 164 ? 31.833  -24.587 20.569  1.00 58.10 ? 181 THR B OG1 1 
ATOM 3037 C CG2 . THR B 1 164 ? 33.286  -26.474 20.757  1.00 56.93 ? 181 THR B CG2 1 
ATOM 3038 N N   . THR B 1 165 ? 33.942  -26.682 24.023  1.00 58.65 ? 182 THR B N   1 
ATOM 3039 C CA  . THR B 1 165 ? 35.049  -27.497 24.545  1.00 58.80 ? 182 THR B CA  1 
ATOM 3040 C C   . THR B 1 165 ? 34.958  -28.935 24.027  1.00 59.66 ? 182 THR B C   1 
ATOM 3041 O O   . THR B 1 165 ? 33.981  -29.319 23.376  1.00 60.08 ? 182 THR B O   1 
ATOM 3042 C CB  . THR B 1 165 ? 35.209  -27.473 26.128  1.00 58.48 ? 182 THR B CB  1 
ATOM 3043 O OG1 . THR B 1 165 ? 33.964  -27.749 26.791  1.00 57.14 ? 182 THR B OG1 1 
ATOM 3044 C CG2 . THR B 1 165 ? 35.789  -26.153 26.617  1.00 56.96 ? 182 THR B CG2 1 
ATOM 3045 N N   . ASN B 1 166 ? 36.016  -29.702 24.264  1.00 60.41 ? 183 ASN B N   1 
ATOM 3046 C CA  . ASN B 1 166 ? 35.944  -31.139 24.148  1.00 60.99 ? 183 ASN B CA  1 
ATOM 3047 C C   . ASN B 1 166 ? 35.179  -31.578 25.392  1.00 60.95 ? 183 ASN B C   1 
ATOM 3048 O O   . ASN B 1 166 ? 35.355  -30.967 26.457  1.00 60.45 ? 183 ASN B O   1 
ATOM 3049 C CB  . ASN B 1 166 ? 37.347  -31.751 24.147  1.00 61.12 ? 183 ASN B CB  1 
ATOM 3050 C CG  . ASN B 1 166 ? 38.194  -31.275 22.984  1.00 62.67 ? 183 ASN B CG  1 
ATOM 3051 O OD1 . ASN B 1 166 ? 37.843  -30.312 22.301  1.00 64.01 ? 183 ASN B OD1 1 
ATOM 3052 N ND2 . ASN B 1 166 ? 39.322  -31.951 22.749  1.00 63.96 ? 183 ASN B ND2 1 
ATOM 3053 N N   . SER B 1 167 ? 34.329  -32.602 25.249  1.00 60.85 ? 184 SER B N   1 
ATOM 3054 C CA  . SER B 1 167 ? 33.578  -33.154 26.366  1.00 61.03 ? 184 SER B CA  1 
ATOM 3055 C C   . SER B 1 167 ? 34.460  -33.864 27.381  1.00 62.07 ? 184 SER B C   1 
ATOM 3056 O O   . SER B 1 167 ? 35.317  -34.685 27.018  1.00 62.14 ? 184 SER B O   1 
ATOM 3057 C CB  . SER B 1 167 ? 32.563  -34.161 25.874  1.00 60.75 ? 184 SER B CB  1 
ATOM 3058 O OG  . SER B 1 167 ? 31.994  -34.831 26.983  1.00 59.68 ? 184 SER B OG  1 
ATOM 3059 N N   . LYS B 1 168 ? 34.226  -33.583 28.660  1.00 62.77 ? 185 LYS B N   1 
ATOM 3060 C CA  . LYS B 1 168 ? 34.903  -34.342 29.715  1.00 63.55 ? 185 LYS B CA  1 
ATOM 3061 C C   . LYS B 1 168 ? 34.374  -35.798 29.863  1.00 64.22 ? 185 LYS B C   1 
ATOM 3062 O O   . LYS B 1 168 ? 35.141  -36.704 30.192  1.00 64.02 ? 185 LYS B O   1 
ATOM 3063 C CB  . LYS B 1 168 ? 34.887  -33.567 31.043  1.00 63.33 ? 185 LYS B CB  1 
ATOM 3064 C CG  . LYS B 1 168 ? 35.349  -32.103 30.879  1.00 63.70 ? 185 LYS B CG  1 
ATOM 3065 C CD  . LYS B 1 168 ? 35.524  -31.359 32.204  1.00 62.84 ? 185 LYS B CD  1 
ATOM 3066 C CE  . LYS B 1 168 ? 35.515  -29.841 32.015  1.00 60.44 ? 185 LYS B CE  1 
ATOM 3067 N NZ  . LYS B 1 168 ? 35.734  -29.195 33.348  1.00 60.18 ? 185 LYS B NZ  1 
ATOM 3068 N N   . ARG B 1 169 ? 33.092  -36.027 29.572  1.00 64.91 ? 186 ARG B N   1 
ATOM 3069 C CA  . ARG B 1 169 ? 32.493  -37.342 29.813  1.00 65.87 ? 186 ARG B CA  1 
ATOM 3070 C C   . ARG B 1 169 ? 32.533  -38.362 28.675  1.00 66.13 ? 186 ARG B C   1 
ATOM 3071 O O   . ARG B 1 169 ? 32.908  -39.508 28.926  1.00 67.11 ? 186 ARG B O   1 
ATOM 3072 C CB  . ARG B 1 169 ? 31.111  -37.232 30.451  1.00 65.68 ? 186 ARG B CB  1 
ATOM 3073 C CG  . ARG B 1 169 ? 31.217  -36.744 31.893  1.00 68.13 ? 186 ARG B CG  1 
ATOM 3074 C CD  . ARG B 1 169 ? 29.934  -36.951 32.697  1.00 70.84 ? 186 ARG B CD  1 
ATOM 3075 N NE  . ARG B 1 169 ? 29.751  -38.330 33.177  1.00 71.58 ? 186 ARG B NE  1 
ATOM 3076 C CZ  . ARG B 1 169 ? 28.967  -39.244 32.593  1.00 72.47 ? 186 ARG B CZ  1 
ATOM 3077 N NH1 . ARG B 1 169 ? 28.288  -38.963 31.475  1.00 71.72 ? 186 ARG B NH1 1 
ATOM 3078 N NH2 . ARG B 1 169 ? 28.858  -40.460 33.130  1.00 73.58 ? 186 ARG B NH2 1 
ATOM 3079 N N   . GLU B 1 170 ? 32.142  -37.997 27.458  1.00 66.04 ? 187 GLU B N   1 
ATOM 3080 C CA  . GLU B 1 170 ? 32.387  -38.884 26.310  1.00 66.53 ? 187 GLU B CA  1 
ATOM 3081 C C   . GLU B 1 170 ? 33.438  -38.255 25.405  1.00 66.72 ? 187 GLU B C   1 
ATOM 3082 O O   . GLU B 1 170 ? 33.147  -37.343 24.611  1.00 66.71 ? 187 GLU B O   1 
ATOM 3083 C CB  . GLU B 1 170 ? 31.112  -39.232 25.524  1.00 66.80 ? 187 GLU B CB  1 
ATOM 3084 C CG  . GLU B 1 170 ? 30.322  -40.424 26.066  1.00 68.25 ? 187 GLU B CG  1 
ATOM 3085 C CD  . GLU B 1 170 ? 29.403  -40.058 27.250  1.00 71.98 ? 187 GLU B CD  1 
ATOM 3086 O OE1 . GLU B 1 170 ? 29.161  -38.844 27.499  1.00 71.72 ? 187 GLU B OE1 1 
ATOM 3087 O OE2 . GLU B 1 170 ? 28.910  -40.996 27.932  1.00 73.22 ? 187 GLU B OE2 1 
ATOM 3088 N N   . GLU B 1 171 ? 34.665  -38.754 25.542  1.00 66.65 ? 188 GLU B N   1 
ATOM 3089 C CA  . GLU B 1 171 ? 35.859  -38.130 24.954  1.00 66.07 ? 188 GLU B CA  1 
ATOM 3090 C C   . GLU B 1 171 ? 35.750  -37.516 23.541  1.00 65.23 ? 188 GLU B C   1 
ATOM 3091 O O   . GLU B 1 171 ? 36.279  -36.439 23.324  1.00 66.07 ? 188 GLU B O   1 
ATOM 3092 C CB  . GLU B 1 171 ? 37.081  -39.051 25.074  1.00 66.39 ? 188 GLU B CB  1 
ATOM 3093 C CG  . GLU B 1 171 ? 36.796  -40.548 24.872  1.00 67.77 ? 188 GLU B CG  1 
ATOM 3094 C CD  . GLU B 1 171 ? 37.817  -41.215 23.955  1.00 69.76 ? 188 GLU B CD  1 
ATOM 3095 O OE1 . GLU B 1 171 ? 37.873  -42.470 23.934  1.00 71.09 ? 188 GLU B OE1 1 
ATOM 3096 O OE2 . GLU B 1 171 ? 38.567  -40.484 23.255  1.00 69.29 ? 188 GLU B OE2 1 
ATOM 3097 N N   . LYS B 1 172 ? 35.084  -38.158 22.586  1.00 63.94 ? 189 LYS B N   1 
ATOM 3098 C CA  . LYS B 1 172 ? 35.050  -37.594 21.206  1.00 62.89 ? 189 LYS B CA  1 
ATOM 3099 C C   . LYS B 1 172 ? 34.029  -36.446 20.891  1.00 61.48 ? 189 LYS B C   1 
ATOM 3100 O O   . LYS B 1 172 ? 34.080  -35.828 19.817  1.00 60.71 ? 189 LYS B O   1 
ATOM 3101 C CB  . LYS B 1 172 ? 35.006  -38.719 20.158  1.00 63.28 ? 189 LYS B CB  1 
ATOM 3102 C CG  . LYS B 1 172 ? 36.411  -39.092 19.706  1.00 65.25 ? 189 LYS B CG  1 
ATOM 3103 C CD  . LYS B 1 172 ? 36.565  -40.557 19.335  1.00 67.32 ? 189 LYS B CD  1 
ATOM 3104 C CE  . LYS B 1 172 ? 38.053  -40.860 19.067  1.00 68.55 ? 189 LYS B CE  1 
ATOM 3105 N NZ  . LYS B 1 172 ? 38.246  -42.085 18.210  1.00 68.95 ? 189 LYS B NZ  1 
ATOM 3106 N N   . LEU B 1 173 ? 33.137  -36.177 21.848  1.00 59.96 ? 190 LEU B N   1 
ATOM 3107 C CA  . LEU B 1 173 ? 32.109  -35.144 21.773  1.00 58.36 ? 190 LEU B CA  1 
ATOM 3108 C C   . LEU B 1 173 ? 32.557  -33.715 22.054  1.00 57.85 ? 190 LEU B C   1 
ATOM 3109 O O   . LEU B 1 173 ? 33.522  -33.469 22.790  1.00 57.50 ? 190 LEU B O   1 
ATOM 3110 C CB  . LEU B 1 173 ? 31.008  -35.463 22.772  1.00 58.43 ? 190 LEU B CB  1 
ATOM 3111 C CG  . LEU B 1 173 ? 30.279  -36.757 22.493  1.00 57.03 ? 190 LEU B CG  1 
ATOM 3112 C CD1 . LEU B 1 173 ? 29.094  -36.871 23.390  1.00 55.20 ? 190 LEU B CD1 1 
ATOM 3113 C CD2 . LEU B 1 173 ? 29.863  -36.745 21.045  1.00 57.21 ? 190 LEU B CD2 1 
ATOM 3114 N N   . PHE B 1 174 ? 31.807  -32.772 21.484  1.00 57.26 ? 191 PHE B N   1 
ATOM 3115 C CA  . PHE B 1 174 ? 31.944  -31.361 21.830  1.00 56.50 ? 191 PHE B CA  1 
ATOM 3116 C C   . PHE B 1 174 ? 30.907  -30.935 22.850  1.00 56.23 ? 191 PHE B C   1 
ATOM 3117 O O   . PHE B 1 174 ? 29.739  -31.310 22.747  1.00 56.77 ? 191 PHE B O   1 
ATOM 3118 C CB  . PHE B 1 174 ? 31.835  -30.523 20.587  1.00 56.20 ? 191 PHE B CB  1 
ATOM 3119 C CG  . PHE B 1 174 ? 32.815  -30.916 19.563  1.00 56.12 ? 191 PHE B CG  1 
ATOM 3120 C CD1 . PHE B 1 174 ? 32.399  -31.293 18.298  1.00 56.18 ? 191 PHE B CD1 1 
ATOM 3121 C CD2 . PHE B 1 174 ? 34.169  -30.963 19.884  1.00 54.36 ? 191 PHE B CD2 1 
ATOM 3122 C CE1 . PHE B 1 174 ? 33.323  -31.687 17.351  1.00 56.42 ? 191 PHE B CE1 1 
ATOM 3123 C CE2 . PHE B 1 174 ? 35.096  -31.352 18.956  1.00 54.54 ? 191 PHE B CE2 1 
ATOM 3124 C CZ  . PHE B 1 174 ? 34.683  -31.719 17.681  1.00 56.13 ? 191 PHE B CZ  1 
ATOM 3125 N N   . ASN B 1 175 ? 31.357  -30.197 23.859  1.00 55.41 ? 192 ASN B N   1 
ATOM 3126 C CA  . ASN B 1 175 ? 30.473  -29.547 24.800  1.00 54.38 ? 192 ASN B CA  1 
ATOM 3127 C C   . ASN B 1 175 ? 30.329  -28.077 24.375  1.00 52.89 ? 192 ASN B C   1 
ATOM 3128 O O   . ASN B 1 175 ? 31.259  -27.287 24.500  1.00 52.78 ? 192 ASN B O   1 
ATOM 3129 C CB  . ASN B 1 175 ? 30.997  -29.687 26.232  1.00 54.68 ? 192 ASN B CB  1 
ATOM 3130 C CG  . ASN B 1 175 ? 30.428  -28.629 27.165  1.00 57.17 ? 192 ASN B CG  1 
ATOM 3131 O OD1 . ASN B 1 175 ? 29.396  -28.837 27.809  1.00 57.83 ? 192 ASN B OD1 1 
ATOM 3132 N ND2 . ASN B 1 175 ? 31.082  -27.459 27.209  1.00 60.78 ? 192 ASN B ND2 1 
ATOM 3133 N N   . VAL B 1 176 ? 29.149  -27.735 23.876  1.00 51.08 ? 193 VAL B N   1 
ATOM 3134 C CA  . VAL B 1 176 ? 28.876  -26.420 23.324  1.00 49.56 ? 193 VAL B CA  1 
ATOM 3135 C C   . VAL B 1 176 ? 27.913  -25.693 24.272  1.00 49.12 ? 193 VAL B C   1 
ATOM 3136 O O   . VAL B 1 176 ? 26.802  -26.175 24.500  1.00 49.73 ? 193 VAL B O   1 
ATOM 3137 C CB  . VAL B 1 176 ? 28.263  -26.568 21.898  1.00 49.10 ? 193 VAL B CB  1 
ATOM 3138 C CG1 . VAL B 1 176 ? 27.606  -25.301 21.423  1.00 48.21 ? 193 VAL B CG1 1 
ATOM 3139 C CG2 . VAL B 1 176 ? 29.312  -27.031 20.908  1.00 48.12 ? 193 VAL B CG2 1 
ATOM 3140 N N   . THR B 1 177 ? 28.340  -24.560 24.838  1.00 47.93 ? 194 THR B N   1 
ATOM 3141 C CA  . THR B 1 177 ? 27.505  -23.797 25.760  1.00 46.83 ? 194 THR B CA  1 
ATOM 3142 C C   . THR B 1 177 ? 27.321  -22.427 25.208  1.00 46.78 ? 194 THR B C   1 
ATOM 3143 O O   . THR B 1 177 ? 28.303  -21.764 24.891  1.00 47.29 ? 194 THR B O   1 
ATOM 3144 C CB  . THR B 1 177 ? 28.187  -23.526 27.083  1.00 46.91 ? 194 THR B CB  1 
ATOM 3145 O OG1 . THR B 1 177 ? 28.958  -24.655 27.515  1.00 46.96 ? 194 THR B OG1 1 
ATOM 3146 C CG2 . THR B 1 177 ? 27.155  -23.130 28.131  1.00 47.13 ? 194 THR B CG2 1 
ATOM 3147 N N   . SER B 1 178 ? 26.081  -21.958 25.145  1.00 46.08 ? 195 SER B N   1 
ATOM 3148 C CA  . SER B 1 178 ? 25.817  -20.636 24.618  1.00 44.98 ? 195 SER B CA  1 
ATOM 3149 C C   . SER B 1 178 ? 25.115  -19.761 25.633  1.00 44.92 ? 195 SER B C   1 
ATOM 3150 O O   . SER B 1 178 ? 24.480  -20.265 26.536  1.00 44.97 ? 195 SER B O   1 
ATOM 3151 C CB  . SER B 1 178 ? 25.000  -20.759 23.393  1.00 44.35 ? 195 SER B CB  1 
ATOM 3152 O OG  . SER B 1 178 ? 24.958  -19.515 22.796  1.00 46.85 ? 195 SER B OG  1 
ATOM 3153 N N   . THR B 1 179 ? 25.253  -18.444 25.533  1.00 45.07 ? 196 THR B N   1 
ATOM 3154 C CA  . THR B 1 179 ? 24.761  -17.594 26.627  1.00 45.18 ? 196 THR B CA  1 
ATOM 3155 C C   . THR B 1 179 ? 24.174  -16.356 26.052  1.00 45.77 ? 196 THR B C   1 
ATOM 3156 O O   . THR B 1 179 ? 24.833  -15.649 25.296  1.00 46.61 ? 196 THR B O   1 
ATOM 3157 C CB  . THR B 1 179 ? 25.866  -17.208 27.628  1.00 44.94 ? 196 THR B CB  1 
ATOM 3158 O OG1 . THR B 1 179 ? 26.440  -18.392 28.210  1.00 45.68 ? 196 THR B OG1 1 
ATOM 3159 C CG2 . THR B 1 179 ? 25.309  -16.364 28.732  1.00 43.78 ? 196 THR B CG2 1 
ATOM 3160 N N   . LEU B 1 180 ? 22.922  -16.096 26.393  1.00 46.18 ? 197 LEU B N   1 
ATOM 3161 C CA  . LEU B 1 180 ? 22.225  -14.940 25.862  1.00 46.83 ? 197 LEU B CA  1 
ATOM 3162 C C   . LEU B 1 180 ? 21.952  -13.970 26.992  1.00 46.89 ? 197 LEU B C   1 
ATOM 3163 O O   . LEU B 1 180 ? 21.475  -14.372 28.051  1.00 47.31 ? 197 LEU B O   1 
ATOM 3164 C CB  . LEU B 1 180 ? 20.889  -15.370 25.272  1.00 47.03 ? 197 LEU B CB  1 
ATOM 3165 C CG  . LEU B 1 180 ? 20.253  -14.666 24.068  1.00 48.51 ? 197 LEU B CG  1 
ATOM 3166 C CD1 . LEU B 1 180 ? 18.732  -14.621 24.256  1.00 48.16 ? 197 LEU B CD1 1 
ATOM 3167 C CD2 . LEU B 1 180 ? 20.807  -13.258 23.802  1.00 50.29 ? 197 LEU B CD2 1 
ATOM 3168 N N   . ARG B 1 181 ? 22.247  -12.694 26.769  1.00 47.41 ? 198 ARG B N   1 
ATOM 3169 C CA  . ARG B 1 181 ? 21.808  -11.630 27.686  1.00 47.31 ? 198 ARG B CA  1 
ATOM 3170 C C   . ARG B 1 181 ? 20.738  -10.770 27.056  1.00 47.00 ? 198 ARG B C   1 
ATOM 3171 O O   . ARG B 1 181 ? 20.864  -10.375 25.901  1.00 46.42 ? 198 ARG B O   1 
ATOM 3172 C CB  . ARG B 1 181 ? 22.988  -10.812 28.184  1.00 47.34 ? 198 ARG B CB  1 
ATOM 3173 C CG  . ARG B 1 181 ? 23.267  -11.133 29.646  1.00 48.91 ? 198 ARG B CG  1 
ATOM 3174 C CD  . ARG B 1 181 ? 24.724  -11.244 29.940  1.00 51.80 ? 198 ARG B CD  1 
ATOM 3175 N NE  . ARG B 1 181 ? 24.974  -11.362 31.374  1.00 52.60 ? 198 ARG B NE  1 
ATOM 3176 C CZ  . ARG B 1 181 ? 25.000  -10.339 32.230  1.00 52.14 ? 198 ARG B CZ  1 
ATOM 3177 N NH1 . ARG B 1 181 ? 24.757  -9.089  31.849  1.00 48.80 ? 198 ARG B NH1 1 
ATOM 3178 N NH2 . ARG B 1 181 ? 25.259  -10.576 33.500  1.00 54.28 ? 198 ARG B NH2 1 
ATOM 3179 N N   . ILE B 1 182 ? 19.662  -10.530 27.799  1.00 47.46 ? 199 ILE B N   1 
ATOM 3180 C CA  . ILE B 1 182 ? 18.495  -9.879  27.221  1.00 48.57 ? 199 ILE B CA  1 
ATOM 3181 C C   . ILE B 1 182 ? 17.496  -9.374  28.259  1.00 49.56 ? 199 ILE B C   1 
ATOM 3182 O O   . ILE B 1 182 ? 17.344  -9.949  29.330  1.00 50.45 ? 199 ILE B O   1 
ATOM 3183 C CB  . ILE B 1 182 ? 17.796  -10.828 26.183  1.00 48.95 ? 199 ILE B CB  1 
ATOM 3184 C CG1 . ILE B 1 182 ? 17.405  -10.047 24.921  1.00 48.24 ? 199 ILE B CG1 1 
ATOM 3185 C CG2 . ILE B 1 182 ? 16.677  -11.742 26.841  1.00 47.95 ? 199 ILE B CG2 1 
ATOM 3186 C CD1 . ILE B 1 182 ? 18.617  -9.816  23.970  1.00 48.24 ? 199 ILE B CD1 1 
ATOM 3187 N N   . ASN B 1 183 ? 16.810  -8.294  27.929  1.00 50.76 ? 200 ASN B N   1 
ATOM 3188 C CA  . ASN B 1 183 ? 15.770  -7.756  28.788  1.00 52.21 ? 200 ASN B CA  1 
ATOM 3189 C C   . ASN B 1 183 ? 14.437  -8.318  28.379  1.00 54.13 ? 200 ASN B C   1 
ATOM 3190 O O   . ASN B 1 183 ? 14.194  -8.548  27.203  1.00 54.09 ? 200 ASN B O   1 
ATOM 3191 C CB  . ASN B 1 183 ? 15.732  -6.236  28.674  1.00 51.46 ? 200 ASN B CB  1 
ATOM 3192 C CG  . ASN B 1 183 ? 17.074  -5.596  28.990  1.00 49.41 ? 200 ASN B CG  1 
ATOM 3193 O OD1 . ASN B 1 183 ? 17.376  -5.287  30.145  1.00 45.14 ? 200 ASN B OD1 1 
ATOM 3194 N ND2 . ASN B 1 183 ? 17.880  -5.388  27.957  1.00 45.65 ? 200 ASN B ND2 1 
ATOM 3195 N N   . THR B 1 184 ? 13.549  -8.530  29.335  1.00 56.98 ? 201 THR B N   1 
ATOM 3196 C CA  . THR B 1 184 ? 12.270  -9.126  28.978  1.00 59.86 ? 201 THR B CA  1 
ATOM 3197 C C   . THR B 1 184 ? 11.260  -9.249  30.101  1.00 61.46 ? 201 THR B C   1 
ATOM 3198 O O   . THR B 1 184 ? 11.625  -9.420  31.263  1.00 61.66 ? 201 THR B O   1 
ATOM 3199 C CB  . THR B 1 184 ? 12.467  -10.529 28.304  1.00 60.13 ? 201 THR B CB  1 
ATOM 3200 O OG1 . THR B 1 184 ? 11.189  -11.052 27.909  1.00 62.21 ? 201 THR B OG1 1 
ATOM 3201 C CG2 . THR B 1 184 ? 13.226  -11.534 29.220  1.00 58.91 ? 201 THR B CG2 1 
ATOM 3202 N N   . THR B 1 185 ? 9.982   -9.166  29.721  1.00 64.18 ? 202 THR B N   1 
ATOM 3203 C CA  . THR B 1 185 ? 8.833   -9.464  30.618  1.00 66.13 ? 202 THR B CA  1 
ATOM 3204 C C   . THR B 1 185 ? 8.708   -10.980 30.958  1.00 67.21 ? 202 THR B C   1 
ATOM 3205 O O   . THR B 1 185 ? 9.455   -11.849 30.424  1.00 67.37 ? 202 THR B O   1 
ATOM 3206 C CB  . THR B 1 185 ? 7.457   -8.907  30.040  1.00 66.48 ? 202 THR B CB  1 
ATOM 3207 O OG1 . THR B 1 185 ? 6.994   -9.700  28.920  1.00 66.39 ? 202 THR B OG1 1 
ATOM 3208 C CG2 . THR B 1 185 ? 7.575   -7.403  29.630  1.00 66.93 ? 202 THR B CG2 1 
ATOM 3209 N N   . THR B 1 186 ? 7.753   -11.283 31.840  1.00 68.08 ? 203 THR B N   1 
ATOM 3210 C CA  . THR B 1 186 ? 7.471   -12.656 32.285  1.00 68.55 ? 203 THR B CA  1 
ATOM 3211 C C   . THR B 1 186 ? 6.745   -13.451 31.189  1.00 68.20 ? 203 THR B C   1 
ATOM 3212 O O   . THR B 1 186 ? 6.196   -12.850 30.253  1.00 68.58 ? 203 THR B O   1 
ATOM 3213 C CB  . THR B 1 186 ? 6.681   -12.665 33.633  1.00 69.08 ? 203 THR B CB  1 
ATOM 3214 O OG1 . THR B 1 186 ? 6.761   -13.968 34.223  1.00 70.52 ? 203 THR B OG1 1 
ATOM 3215 C CG2 . THR B 1 186 ? 5.182   -12.244 33.440  1.00 68.86 ? 203 THR B CG2 1 
ATOM 3216 N N   . ASN B 1 187 ? 6.787   -14.785 31.299  1.00 67.69 ? 204 ASN B N   1 
ATOM 3217 C CA  . ASN B 1 187 ? 6.195   -15.748 30.333  1.00 66.99 ? 204 ASN B CA  1 
ATOM 3218 C C   . ASN B 1 187 ? 6.504   -15.580 28.836  1.00 66.33 ? 204 ASN B C   1 
ATOM 3219 O O   . ASN B 1 187 ? 5.755   -16.085 27.992  1.00 66.20 ? 204 ASN B O   1 
ATOM 3220 C CB  . ASN B 1 187 ? 4.682   -15.901 30.552  1.00 67.23 ? 204 ASN B CB  1 
ATOM 3221 C CG  . ASN B 1 187 ? 4.344   -16.331 31.961  1.00 68.29 ? 204 ASN B CG  1 
ATOM 3222 O OD1 . ASN B 1 187 ? 4.780   -17.394 32.417  1.00 70.08 ? 204 ASN B OD1 1 
ATOM 3223 N ND2 . ASN B 1 187 ? 3.573   -15.504 32.669  1.00 67.62 ? 204 ASN B ND2 1 
ATOM 3224 N N   . GLU B 1 188 ? 7.594   -14.871 28.520  1.00 65.65 ? 205 GLU B N   1 
ATOM 3225 C CA  . GLU B 1 188 ? 8.112   -14.757 27.139  1.00 64.54 ? 205 GLU B CA  1 
ATOM 3226 C C   . GLU B 1 188 ? 8.913   -15.985 26.806  1.00 62.92 ? 205 GLU B C   1 
ATOM 3227 O O   . GLU B 1 188 ? 9.464   -16.640 27.701  1.00 62.74 ? 205 GLU B O   1 
ATOM 3228 C CB  . GLU B 1 188 ? 9.011   -13.528 26.934  1.00 65.13 ? 205 GLU B CB  1 
ATOM 3229 C CG  . GLU B 1 188 ? 8.326   -12.185 27.093  1.00 68.20 ? 205 GLU B CG  1 
ATOM 3230 C CD  . GLU B 1 188 ? 7.048   -12.087 26.280  1.00 73.31 ? 205 GLU B CD  1 
ATOM 3231 O OE1 . GLU B 1 188 ? 7.130   -12.255 25.027  1.00 74.52 ? 205 GLU B OE1 1 
ATOM 3232 O OE2 . GLU B 1 188 ? 5.971   -11.845 26.903  1.00 75.28 ? 205 GLU B OE2 1 
ATOM 3233 N N   . ILE B 1 189 ? 8.994   -16.260 25.504  1.00 61.38 ? 206 ILE B N   1 
ATOM 3234 C CA  . ILE B 1 189 ? 9.508   -17.509 24.963  1.00 59.02 ? 206 ILE B CA  1 
ATOM 3235 C C   . ILE B 1 189 ? 10.638  -17.199 24.039  1.00 57.69 ? 206 ILE B C   1 
ATOM 3236 O O   . ILE B 1 189 ? 10.481  -16.436 23.084  1.00 56.53 ? 206 ILE B O   1 
ATOM 3237 C CB  . ILE B 1 189 ? 8.415   -18.259 24.169  1.00 59.21 ? 206 ILE B CB  1 
ATOM 3238 C CG1 . ILE B 1 189 ? 7.477   -19.017 25.116  1.00 59.06 ? 206 ILE B CG1 1 
ATOM 3239 C CG2 . ILE B 1 189 ? 9.020   -19.234 23.137  1.00 59.60 ? 206 ILE B CG2 1 
ATOM 3240 C CD1 . ILE B 1 189 ? 6.436   -18.164 25.822  1.00 58.89 ? 206 ILE B CD1 1 
ATOM 3241 N N   . PHE B 1 190 ? 11.785  -17.795 24.349  1.00 56.74 ? 207 PHE B N   1 
ATOM 3242 C CA  . PHE B 1 190 ? 12.958  -17.755 23.477  1.00 55.64 ? 207 PHE B CA  1 
ATOM 3243 C C   . PHE B 1 190 ? 13.310  -19.197 23.187  1.00 55.82 ? 207 PHE B C   1 
ATOM 3244 O O   . PHE B 1 190 ? 12.775  -20.101 23.863  1.00 56.23 ? 207 PHE B O   1 
ATOM 3245 C CB  . PHE B 1 190 ? 14.122  -17.070 24.190  1.00 54.63 ? 207 PHE B CB  1 
ATOM 3246 C CG  . PHE B 1 190 ? 13.766  -15.753 24.784  1.00 52.07 ? 207 PHE B CG  1 
ATOM 3247 C CD1 . PHE B 1 190 ? 13.091  -15.678 25.988  1.00 50.96 ? 207 PHE B CD1 1 
ATOM 3248 C CD2 . PHE B 1 190 ? 14.083  -14.575 24.129  1.00 50.45 ? 207 PHE B CD2 1 
ATOM 3249 C CE1 . PHE B 1 190 ? 12.743  -14.432 26.536  1.00 49.47 ? 207 PHE B CE1 1 
ATOM 3250 C CE2 . PHE B 1 190 ? 13.744  -13.352 24.665  1.00 47.34 ? 207 PHE B CE2 1 
ATOM 3251 C CZ  . PHE B 1 190 ? 13.072  -13.286 25.867  1.00 47.71 ? 207 PHE B CZ  1 
ATOM 3252 N N   . TYR B 1 191 ? 14.192  -19.411 22.208  1.00 55.42 ? 208 TYR B N   1 
ATOM 3253 C CA  . TYR B 1 191 ? 14.701  -20.734 21.912  1.00 55.62 ? 208 TYR B CA  1 
ATOM 3254 C C   . TYR B 1 191 ? 16.164  -20.763 21.539  1.00 54.98 ? 208 TYR B C   1 
ATOM 3255 O O   . TYR B 1 191 ? 16.648  -19.967 20.734  1.00 55.13 ? 208 TYR B O   1 
ATOM 3256 C CB  . TYR B 1 191 ? 14.011  -21.381 20.725  1.00 56.30 ? 208 TYR B CB  1 
ATOM 3257 C CG  . TYR B 1 191 ? 12.587  -21.041 20.452  1.00 58.94 ? 208 TYR B CG  1 
ATOM 3258 C CD1 . TYR B 1 191 ? 12.273  -20.059 19.517  1.00 63.03 ? 208 TYR B CD1 1 
ATOM 3259 C CD2 . TYR B 1 191 ? 11.548  -21.749 21.049  1.00 60.18 ? 208 TYR B CD2 1 
ATOM 3260 C CE1 . TYR B 1 191 ? 10.964  -19.753 19.211  1.00 64.32 ? 208 TYR B CE1 1 
ATOM 3261 C CE2 . TYR B 1 191 ? 10.232  -21.453 20.756  1.00 62.32 ? 208 TYR B CE2 1 
ATOM 3262 C CZ  . TYR B 1 191 ? 9.948   -20.447 19.836  1.00 64.78 ? 208 TYR B CZ  1 
ATOM 3263 O OH  . TYR B 1 191 ? 8.648   -20.119 19.506  1.00 68.49 ? 208 TYR B OH  1 
ATOM 3264 N N   . CYS B 1 192 ? 16.853  -21.764 22.052  1.00 54.13 ? 209 CYS B N   1 
ATOM 3265 C CA  . CYS B 1 192 ? 18.211  -21.974 21.647  1.00 53.38 ? 209 CYS B CA  1 
ATOM 3266 C C   . CYS B 1 192 ? 18.228  -23.120 20.670  1.00 54.37 ? 209 CYS B C   1 
ATOM 3267 O O   . CYS B 1 192 ? 17.893  -24.252 21.008  1.00 54.26 ? 209 CYS B O   1 
ATOM 3268 C CB  . CYS B 1 192 ? 19.121  -22.234 22.848  1.00 52.29 ? 209 CYS B CB  1 
ATOM 3269 S SG  . CYS B 1 192 ? 18.679  -23.643 23.767  1.00 47.78 ? 209 CYS B SG  1 
ATOM 3270 N N   . THR B 1 193 ? 18.584  -22.810 19.434  1.00 55.49 ? 210 THR B N   1 
ATOM 3271 C CA  . THR B 1 193 ? 18.781  -23.852 18.466  1.00 56.65 ? 210 THR B CA  1 
ATOM 3272 C C   . THR B 1 193 ? 20.269  -24.160 18.349  1.00 57.50 ? 210 THR B C   1 
ATOM 3273 O O   . THR B 1 193 ? 21.088  -23.252 18.208  1.00 57.75 ? 210 THR B O   1 
ATOM 3274 C CB  . THR B 1 193 ? 18.196  -23.507 17.104  1.00 56.67 ? 210 THR B CB  1 
ATOM 3275 O OG1 . THR B 1 193 ? 16.799  -23.230 17.234  1.00 57.07 ? 210 THR B OG1 1 
ATOM 3276 C CG2 . THR B 1 193 ? 18.334  -24.692 16.203  1.00 57.57 ? 210 THR B CG2 1 
ATOM 3277 N N   . PHE B 1 194 ? 20.597  -25.445 18.454  1.00 58.27 ? 211 PHE B N   1 
ATOM 3278 C CA  . PHE B 1 194 ? 21.922  -25.952 18.162  1.00 59.00 ? 211 PHE B CA  1 
ATOM 3279 C C   . PHE B 1 194 ? 21.892  -26.389 16.733  1.00 60.75 ? 211 PHE B C   1 
ATOM 3280 O O   . PHE B 1 194 ? 20.899  -26.964 16.277  1.00 61.37 ? 211 PHE B O   1 
ATOM 3281 C CB  . PHE B 1 194 ? 22.231  -27.152 19.035  1.00 58.29 ? 211 PHE B CB  1 
ATOM 3282 C CG  . PHE B 1 194 ? 22.561  -26.791 20.441  1.00 55.88 ? 211 PHE B CG  1 
ATOM 3283 C CD1 . PHE B 1 194 ? 21.555  -26.385 21.323  1.00 53.80 ? 211 PHE B CD1 1 
ATOM 3284 C CD2 . PHE B 1 194 ? 23.880  -26.840 20.883  1.00 53.17 ? 211 PHE B CD2 1 
ATOM 3285 C CE1 . PHE B 1 194 ? 21.848  -26.040 22.615  1.00 51.43 ? 211 PHE B CE1 1 
ATOM 3286 C CE2 . PHE B 1 194 ? 24.192  -26.505 22.167  1.00 52.75 ? 211 PHE B CE2 1 
ATOM 3287 C CZ  . PHE B 1 194 ? 23.163  -26.089 23.044  1.00 53.74 ? 211 PHE B CZ  1 
ATOM 3288 N N   . ARG B 1 195 ? 22.968  -26.111 16.009  1.00 62.69 ? 212 ARG B N   1 
ATOM 3289 C CA  . ARG B 1 195 ? 22.981  -26.436 14.595  1.00 64.36 ? 212 ARG B CA  1 
ATOM 3290 C C   . ARG B 1 195 ? 24.249  -27.138 14.113  1.00 65.17 ? 212 ARG B C   1 
ATOM 3291 O O   . ARG B 1 195 ? 25.355  -26.616 14.246  1.00 64.84 ? 212 ARG B O   1 
ATOM 3292 C CB  . ARG B 1 195 ? 22.671  -25.210 13.742  1.00 64.21 ? 212 ARG B CB  1 
ATOM 3293 C CG  . ARG B 1 195 ? 22.276  -25.602 12.352  1.00 65.69 ? 212 ARG B CG  1 
ATOM 3294 C CD  . ARG B 1 195 ? 22.353  -24.462 11.408  1.00 67.26 ? 212 ARG B CD  1 
ATOM 3295 N NE  . ARG B 1 195 ? 21.084  -23.753 11.376  1.00 69.09 ? 212 ARG B NE  1 
ATOM 3296 C CZ  . ARG B 1 195 ? 20.902  -22.605 10.737  1.00 71.00 ? 212 ARG B CZ  1 
ATOM 3297 N NH1 . ARG B 1 195 ? 21.921  -22.045 10.078  1.00 70.63 ? 212 ARG B NH1 1 
ATOM 3298 N NH2 . ARG B 1 195 ? 19.713  -22.010 10.766  1.00 71.91 ? 212 ARG B NH2 1 
ATOM 3299 N N   . ARG B 1 196 ? 24.052  -28.343 13.588  1.00 66.67 ? 213 ARG B N   1 
ATOM 3300 C CA  . ARG B 1 196 ? 25.061  -29.035 12.801  1.00 68.44 ? 213 ARG B CA  1 
ATOM 3301 C C   . ARG B 1 196 ? 24.678  -28.878 11.336  1.00 69.48 ? 213 ARG B C   1 
ATOM 3302 O O   . ARG B 1 196 ? 23.513  -28.605 10.999  1.00 69.58 ? 213 ARG B O   1 
ATOM 3303 C CB  . ARG B 1 196 ? 25.102  -30.536 13.122  1.00 67.81 ? 213 ARG B CB  1 
ATOM 3304 C CG  . ARG B 1 196 ? 25.674  -30.865 14.469  1.00 68.67 ? 213 ARG B CG  1 
ATOM 3305 C CD  . ARG B 1 196 ? 25.532  -32.348 14.840  1.00 69.27 ? 213 ARG B CD  1 
ATOM 3306 N NE  . ARG B 1 196 ? 24.309  -32.991 14.338  1.00 71.58 ? 213 ARG B NE  1 
ATOM 3307 C CZ  . ARG B 1 196 ? 24.013  -34.288 14.483  1.00 70.59 ? 213 ARG B CZ  1 
ATOM 3308 N NH1 . ARG B 1 196 ? 24.842  -35.100 15.130  1.00 69.98 ? 213 ARG B NH1 1 
ATOM 3309 N NH2 . ARG B 1 196 ? 22.890  -34.779 13.970  1.00 69.19 ? 213 ARG B NH2 1 
ATOM 3310 N N   . LEU B 1 197 ? 25.671  -29.053 10.470  1.00 70.63 ? 214 LEU B N   1 
ATOM 3311 C CA  . LEU B 1 197 ? 25.430  -29.258 9.053   1.00 71.69 ? 214 LEU B CA  1 
ATOM 3312 C C   . LEU B 1 197 ? 25.875  -30.697 8.710   1.00 72.03 ? 214 LEU B C   1 
ATOM 3313 O O   . LEU B 1 197 ? 26.148  -31.503 9.623   1.00 72.26 ? 214 LEU B O   1 
ATOM 3314 C CB  . LEU B 1 197 ? 26.157  -28.181 8.239   1.00 71.95 ? 214 LEU B CB  1 
ATOM 3315 C CG  . LEU B 1 197 ? 26.199  -26.814 8.959   1.00 72.93 ? 214 LEU B CG  1 
ATOM 3316 C CD1 . LEU B 1 197 ? 27.304  -25.898 8.429   1.00 73.16 ? 214 LEU B CD1 1 
ATOM 3317 C CD2 . LEU B 1 197 ? 24.823  -26.098 8.971   1.00 73.36 ? 214 LEU B CD2 1 
ATOM 3318 N N   . ASP B 1 198 ? 25.906  -31.026 7.417   1.00 72.08 ? 215 ASP B N   1 
ATOM 3319 C CA  . ASP B 1 198 ? 26.440  -32.314 6.920   1.00 71.96 ? 215 ASP B CA  1 
ATOM 3320 C C   . ASP B 1 198 ? 25.951  -33.586 7.631   1.00 71.55 ? 215 ASP B C   1 
ATOM 3321 O O   . ASP B 1 198 ? 26.718  -34.235 8.377   1.00 71.46 ? 215 ASP B O   1 
ATOM 3322 C CB  . ASP B 1 198 ? 27.969  -32.273 6.883   1.00 72.32 ? 215 ASP B CB  1 
ATOM 3323 C CG  . ASP B 1 198 ? 28.502  -31.133 6.020   1.00 73.41 ? 215 ASP B CG  1 
ATOM 3324 O OD1 . ASP B 1 198 ? 27.691  -30.332 5.489   1.00 73.93 ? 215 ASP B OD1 1 
ATOM 3325 O OD2 . ASP B 1 198 ? 29.741  -31.044 5.875   1.00 74.48 ? 215 ASP B OD2 1 
ATOM 3326 N N   . PRO B 1 199 ? 24.660  -33.930 7.426   1.00 71.16 ? 216 PRO B N   1 
ATOM 3327 C CA  . PRO B 1 199 ? 23.663  -33.051 6.794   1.00 70.68 ? 216 PRO B CA  1 
ATOM 3328 C C   . PRO B 1 199 ? 23.138  -32.012 7.810   1.00 70.41 ? 216 PRO B C   1 
ATOM 3329 O O   . PRO B 1 199 ? 23.079  -32.291 9.022   1.00 70.42 ? 216 PRO B O   1 
ATOM 3330 C CB  . PRO B 1 199 ? 22.554  -34.022 6.404   1.00 70.73 ? 216 PRO B CB  1 
ATOM 3331 C CG  . PRO B 1 199 ? 22.629  -35.099 7.471   1.00 70.93 ? 216 PRO B CG  1 
ATOM 3332 C CD  . PRO B 1 199 ? 24.090  -35.243 7.804   1.00 70.94 ? 216 PRO B CD  1 
ATOM 3333 N N   . GLU B 1 200 ? 22.767  -30.825 7.342   1.00 69.66 ? 217 GLU B N   1 
ATOM 3334 C CA  . GLU B 1 200 ? 22.284  -29.801 8.274   1.00 69.13 ? 217 GLU B CA  1 
ATOM 3335 C C   . GLU B 1 200 ? 21.214  -30.334 9.232   1.00 68.12 ? 217 GLU B C   1 
ATOM 3336 O O   . GLU B 1 200 ? 20.083  -30.598 8.830   1.00 68.62 ? 217 GLU B O   1 
ATOM 3337 C CB  . GLU B 1 200 ? 21.755  -28.562 7.556   1.00 69.33 ? 217 GLU B CB  1 
ATOM 3338 C CG  . GLU B 1 200 ? 21.255  -27.490 8.535   1.00 71.15 ? 217 GLU B CG  1 
ATOM 3339 C CD  . GLU B 1 200 ? 19.773  -27.119 8.345   1.00 72.99 ? 217 GLU B CD  1 
ATOM 3340 O OE1 . GLU B 1 200 ? 19.007  -27.972 7.813   1.00 74.64 ? 217 GLU B OE1 1 
ATOM 3341 O OE2 . GLU B 1 200 ? 19.379  -25.981 8.741   1.00 70.81 ? 217 GLU B OE2 1 
ATOM 3342 N N   . GLU B 1 201 ? 21.572  -30.482 10.499  1.00 66.25 ? 218 GLU B N   1 
ATOM 3343 C CA  . GLU B 1 201 ? 20.626  -30.943 11.489  1.00 64.39 ? 218 GLU B CA  1 
ATOM 3344 C C   . GLU B 1 201 ? 20.437  -29.849 12.551  1.00 63.29 ? 218 GLU B C   1 
ATOM 3345 O O   . GLU B 1 201 ? 21.405  -29.153 12.910  1.00 63.04 ? 218 GLU B O   1 
ATOM 3346 C CB  . GLU B 1 201 ? 21.134  -32.259 12.087  1.00 64.67 ? 218 GLU B CB  1 
ATOM 3347 C CG  . GLU B 1 201 ? 20.360  -32.806 13.280  1.00 64.23 ? 218 GLU B CG  1 
ATOM 3348 C CD  . GLU B 1 201 ? 20.091  -34.289 13.152  1.00 63.59 ? 218 GLU B CD  1 
ATOM 3349 O OE1 . GLU B 1 201 ? 20.340  -35.043 14.116  1.00 63.14 ? 218 GLU B OE1 1 
ATOM 3350 O OE2 . GLU B 1 201 ? 19.635  -34.702 12.069  1.00 64.76 ? 218 GLU B OE2 1 
ATOM 3351 N N   . ASN B 1 202 ? 19.195  -29.703 13.037  1.00 61.54 ? 219 ASN B N   1 
ATOM 3352 C CA  . ASN B 1 202 ? 18.840  -28.661 14.002  1.00 59.93 ? 219 ASN B CA  1 
ATOM 3353 C C   . ASN B 1 202 ? 18.094  -29.178 15.164  1.00 58.81 ? 219 ASN B C   1 
ATOM 3354 O O   . ASN B 1 202 ? 17.141  -29.911 15.012  1.00 58.56 ? 219 ASN B O   1 
ATOM 3355 C CB  . ASN B 1 202 ? 17.980  -27.577 13.366  1.00 60.21 ? 219 ASN B CB  1 
ATOM 3356 C CG  . ASN B 1 202 ? 18.792  -26.572 12.648  1.00 60.16 ? 219 ASN B CG  1 
ATOM 3357 O OD1 . ASN B 1 202 ? 19.057  -25.484 13.156  1.00 60.45 ? 219 ASN B OD1 1 
ATOM 3358 N ND2 . ASN B 1 202 ? 19.261  -26.946 11.474  1.00 62.30 ? 219 ASN B ND2 1 
ATOM 3359 N N   . HIS B 1 203 ? 18.518  -28.772 16.337  1.00 57.94 ? 220 HIS B N   1 
ATOM 3360 C CA  . HIS B 1 203 ? 17.807  -29.147 17.528  1.00 57.86 ? 220 HIS B CA  1 
ATOM 3361 C C   . HIS B 1 203 ? 17.640  -27.894 18.325  1.00 57.36 ? 220 HIS B C   1 
ATOM 3362 O O   . HIS B 1 203 ? 18.604  -27.155 18.562  1.00 57.37 ? 220 HIS B O   1 
ATOM 3363 C CB  . HIS B 1 203 ? 18.591  -30.142 18.357  1.00 58.20 ? 220 HIS B CB  1 
ATOM 3364 C CG  . HIS B 1 203 ? 18.438  -31.554 17.912  1.00 60.02 ? 220 HIS B CG  1 
ATOM 3365 N ND1 . HIS B 1 203 ? 17.482  -32.398 18.439  1.00 61.95 ? 220 HIS B ND1 1 
ATOM 3366 C CD2 . HIS B 1 203 ? 19.131  -32.283 17.002  1.00 60.96 ? 220 HIS B CD2 1 
ATOM 3367 C CE1 . HIS B 1 203 ? 17.585  -33.587 17.867  1.00 61.60 ? 220 HIS B CE1 1 
ATOM 3368 N NE2 . HIS B 1 203 ? 18.581  -33.543 16.995  1.00 62.24 ? 220 HIS B NE2 1 
ATOM 3369 N N   . THR B 1 204 ? 16.410  -27.672 18.755  1.00 56.40 ? 221 THR B N   1 
ATOM 3370 C CA  . THR B 1 204 ? 16.080  -26.467 19.448  1.00 55.63 ? 221 THR B CA  1 
ATOM 3371 C C   . THR B 1 204 ? 15.432  -26.767 20.800  1.00 54.70 ? 221 THR B C   1 
ATOM 3372 O O   . THR B 1 204 ? 14.909  -27.865 21.011  1.00 54.02 ? 221 THR B O   1 
ATOM 3373 C CB  . THR B 1 204 ? 15.247  -25.524 18.530  1.00 56.18 ? 221 THR B CB  1 
ATOM 3374 O OG1 . THR B 1 204 ? 14.080  -25.046 19.226  1.00 56.53 ? 221 THR B OG1 1 
ATOM 3375 C CG2 . THR B 1 204 ? 14.849  -26.235 17.234  1.00 55.79 ? 221 THR B CG2 1 
ATOM 3376 N N   . ALA B 1 205 ? 15.515  -25.798 21.717  1.00 53.77 ? 222 ALA B N   1 
ATOM 3377 C CA  . ALA B 1 205 ? 14.939  -25.915 23.070  1.00 52.84 ? 222 ALA B CA  1 
ATOM 3378 C C   . ALA B 1 205 ? 14.212  -24.647 23.441  1.00 52.07 ? 222 ALA B C   1 
ATOM 3379 O O   . ALA B 1 205 ? 14.593  -23.560 23.046  1.00 52.14 ? 222 ALA B O   1 
ATOM 3380 C CB  . ALA B 1 205 ? 16.009  -26.215 24.088  1.00 52.43 ? 222 ALA B CB  1 
ATOM 3381 N N   . GLU B 1 206 ? 13.156  -24.787 24.212  1.00 51.54 ? 223 GLU B N   1 
ATOM 3382 C CA  . GLU B 1 206 ? 12.311  -23.651 24.482  1.00 51.31 ? 223 GLU B CA  1 
ATOM 3383 C C   . GLU B 1 206 ? 12.568  -23.179 25.908  1.00 50.62 ? 223 GLU B C   1 
ATOM 3384 O O   . GLU B 1 206 ? 12.658  -24.001 26.797  1.00 50.47 ? 223 GLU B O   1 
ATOM 3385 C CB  . GLU B 1 206 ? 10.854  -24.041 24.227  1.00 50.92 ? 223 GLU B CB  1 
ATOM 3386 C CG  . GLU B 1 206 ? 9.805   -23.244 24.990  1.00 52.39 ? 223 GLU B CG  1 
ATOM 3387 C CD  . GLU B 1 206 ? 8.421   -23.851 24.880  1.00 51.74 ? 223 GLU B CD  1 
ATOM 3388 O OE1 . GLU B 1 206 ? 7.903   -24.289 25.926  1.00 53.73 ? 223 GLU B OE1 1 
ATOM 3389 O OE2 . GLU B 1 206 ? 7.873   -23.912 23.753  1.00 51.20 ? 223 GLU B OE2 1 
ATOM 3390 N N   . LEU B 1 207 ? 12.722  -21.870 26.116  1.00 50.46 ? 224 LEU B N   1 
ATOM 3391 C CA  . LEU B 1 207 ? 12.962  -21.334 27.466  1.00 50.70 ? 224 LEU B CA  1 
ATOM 3392 C C   . LEU B 1 207 ? 11.808  -20.423 27.859  1.00 51.29 ? 224 LEU B C   1 
ATOM 3393 O O   . LEU B 1 207 ? 11.483  -19.504 27.130  1.00 52.17 ? 224 LEU B O   1 
ATOM 3394 C CB  . LEU B 1 207 ? 14.287  -20.571 27.522  1.00 50.56 ? 224 LEU B CB  1 
ATOM 3395 C CG  . LEU B 1 207 ? 15.554  -21.260 26.962  1.00 50.45 ? 224 LEU B CG  1 
ATOM 3396 C CD1 . LEU B 1 207 ? 15.686  -21.011 25.479  1.00 47.95 ? 224 LEU B CD1 1 
ATOM 3397 C CD2 . LEU B 1 207 ? 16.871  -20.874 27.694  1.00 49.61 ? 224 LEU B CD2 1 
ATOM 3398 N N   . VAL B 1 208 ? 11.135  -20.708 28.963  1.00 51.58 ? 225 VAL B N   1 
ATOM 3399 C CA  . VAL B 1 208 ? 10.051  -19.840 29.389  1.00 52.03 ? 225 VAL B CA  1 
ATOM 3400 C C   . VAL B 1 208 ? 10.463  -19.006 30.566  1.00 52.73 ? 225 VAL B C   1 
ATOM 3401 O O   . VAL B 1 208 ? 10.835  -19.551 31.609  1.00 52.67 ? 225 VAL B O   1 
ATOM 3402 C CB  . VAL B 1 208 ? 8.747   -20.598 29.733  1.00 52.13 ? 225 VAL B CB  1 
ATOM 3403 C CG1 . VAL B 1 208 ? 8.100   -20.049 31.016  1.00 50.43 ? 225 VAL B CG1 1 
ATOM 3404 C CG2 . VAL B 1 208 ? 7.791   -20.486 28.581  1.00 51.92 ? 225 VAL B CG2 1 
ATOM 3405 N N   . ILE B 1 209 ? 10.368  -17.683 30.395  1.00 53.30 ? 226 ILE B N   1 
ATOM 3406 C CA  . ILE B 1 209 ? 10.760  -16.753 31.435  1.00 53.64 ? 226 ILE B CA  1 
ATOM 3407 C C   . ILE B 1 209 ? 9.814   -16.854 32.618  1.00 54.75 ? 226 ILE B C   1 
ATOM 3408 O O   . ILE B 1 209 ? 8.631   -16.569 32.508  1.00 53.93 ? 226 ILE B O   1 
ATOM 3409 C CB  . ILE B 1 209 ? 10.844  -15.327 30.899  1.00 53.36 ? 226 ILE B CB  1 
ATOM 3410 C CG1 . ILE B 1 209 ? 11.828  -15.251 29.716  1.00 52.26 ? 226 ILE B CG1 1 
ATOM 3411 C CG2 . ILE B 1 209 ? 11.183  -14.340 32.019  1.00 53.53 ? 226 ILE B CG2 1 
ATOM 3412 C CD1 . ILE B 1 209 ? 13.245  -15.562 30.025  1.00 50.22 ? 226 ILE B CD1 1 
ATOM 3413 N N   . PRO B 1 210 ? 10.350  -17.271 33.765  1.00 56.62 ? 227 PRO B N   1 
ATOM 3414 C CA  . PRO B 1 210 ? 9.573   -17.461 34.993  1.00 58.56 ? 227 PRO B CA  1 
ATOM 3415 C C   . PRO B 1 210 ? 8.953   -16.130 35.436  1.00 60.31 ? 227 PRO B C   1 
ATOM 3416 O O   . PRO B 1 210 ? 9.465   -15.074 35.064  1.00 61.12 ? 227 PRO B O   1 
ATOM 3417 C CB  . PRO B 1 210 ? 10.631  -17.917 36.006  1.00 58.57 ? 227 PRO B CB  1 
ATOM 3418 C CG  . PRO B 1 210 ? 11.956  -17.372 35.453  1.00 57.89 ? 227 PRO B CG  1 
ATOM 3419 C CD  . PRO B 1 210 ? 11.791  -17.521 33.967  1.00 56.89 ? 227 PRO B CD  1 
ATOM 3420 N N   . GLU B 1 211 ? 7.872   -16.163 36.216  1.00 62.16 ? 228 GLU B N   1 
ATOM 3421 C CA  . GLU B 1 211 ? 7.209   -14.907 36.657  1.00 63.72 ? 228 GLU B CA  1 
ATOM 3422 C C   . GLU B 1 211 ? 7.998   -14.203 37.764  1.00 63.60 ? 228 GLU B C   1 
ATOM 3423 O O   . GLU B 1 211 ? 8.476   -14.856 38.693  1.00 64.02 ? 228 GLU B O   1 
ATOM 3424 C CB  . GLU B 1 211 ? 5.740   -15.147 37.085  1.00 63.87 ? 228 GLU B CB  1 
ATOM 3425 C CG  . GLU B 1 211 ? 4.794   -13.935 36.808  1.00 65.46 ? 228 GLU B CG  1 
ATOM 3426 C CD  . GLU B 1 211 ? 3.333   -14.195 37.210  1.00 64.80 ? 228 GLU B CD  1 
ATOM 3427 O OE1 . GLU B 1 211 ? 3.069   -14.344 38.433  1.00 65.25 ? 228 GLU B OE1 1 
ATOM 3428 O OE2 . GLU B 1 211 ? 2.458   -14.238 36.303  1.00 64.09 ? 228 GLU B OE2 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   18  18  MET MET A . n 
A 1 2   PHE 2   19  19  PHE PHE A . n 
A 1 3   THR 3   20  20  THR THR A . n 
A 1 4   VAL 4   21  21  VAL VAL A . n 
A 1 5   THR 5   22  22  THR THR A . n 
A 1 6   VAL 6   23  23  VAL VAL A . n 
A 1 7   PRO 7   24  24  PRO PRO A . n 
A 1 8   LYS 8   25  25  LYS LYS A . n 
A 1 9   ASP 9   26  26  ASP ASP A . n 
A 1 10  LEU 10  27  27  LEU LEU A . n 
A 1 11  TYR 11  28  28  TYR TYR A . n 
A 1 12  VAL 12  29  29  VAL VAL A . n 
A 1 13  VAL 13  30  30  VAL VAL A . n 
A 1 14  GLU 14  31  31  GLU GLU A . n 
A 1 15  TYR 15  32  32  TYR TYR A . n 
A 1 16  GLY 16  33  33  GLY GLY A . n 
A 1 17  SER 17  34  34  SER SER A . n 
A 1 18  ASN 18  35  35  ASN ASN A . n 
A 1 19  MET 19  36  36  MET MET A . n 
A 1 20  THR 20  37  37  THR THR A . n 
A 1 21  ILE 21  38  38  ILE ILE A . n 
A 1 22  GLU 22  39  39  GLU GLU A . n 
A 1 23  CYS 23  40  40  CYS CYS A . n 
A 1 24  LYS 24  41  41  LYS LYS A . n 
A 1 25  PHE 25  42  42  PHE PHE A . n 
A 1 26  PRO 26  43  43  PRO PRO A . n 
A 1 27  VAL 27  44  44  VAL VAL A . n 
A 1 28  GLU 28  45  45  GLU GLU A . n 
A 1 29  LYS 29  46  46  LYS LYS A . n 
A 1 30  GLN 30  47  47  GLN GLN A . n 
A 1 31  LEU 31  48  48  LEU LEU A . n 
A 1 32  ASP 32  49  49  ASP ASP A . n 
A 1 33  LEU 33  50  50  LEU LEU A . n 
A 1 34  ALA 34  51  51  ALA ALA A . n 
A 1 35  ALA 35  52  52  ALA ALA A . n 
A 1 36  LEU 36  53  53  LEU LEU A . n 
A 1 37  ILE 37  54  54  ILE ILE A . n 
A 1 38  VAL 38  55  55  VAL VAL A . n 
A 1 39  TYR 39  56  56  TYR TYR A . n 
A 1 40  TRP 40  57  57  TRP TRP A . n 
A 1 41  GLU 41  58  58  GLU GLU A . n 
A 1 42  MET 42  59  59  MET MET A . n 
A 1 43  GLU 43  60  60  GLU GLU A . n 
A 1 44  ASP 44  61  61  ASP ASP A . n 
A 1 45  LYS 45  62  62  LYS LYS A . n 
A 1 46  ASN 46  63  63  ASN ASN A . n 
A 1 47  ILE 47  64  64  ILE ILE A . n 
A 1 48  ILE 48  65  65  ILE ILE A . n 
A 1 49  GLN 49  66  66  GLN GLN A . n 
A 1 50  PHE 50  67  67  PHE PHE A . n 
A 1 51  VAL 51  68  68  VAL VAL A . n 
A 1 52  HIS 52  69  69  HIS HIS A . n 
A 1 53  GLY 53  70  70  GLY GLY A . n 
A 1 54  GLU 54  71  71  GLU GLU A . n 
A 1 55  GLU 55  72  72  GLU GLU A . n 
A 1 56  ASP 56  73  73  ASP ASP A . n 
A 1 57  LEU 57  74  74  LEU LEU A . n 
A 1 58  LYS 58  75  75  LYS LYS A . n 
A 1 59  VAL 59  76  76  VAL VAL A . n 
A 1 60  GLN 60  77  77  GLN GLN A . n 
A 1 61  HIS 61  78  78  HIS HIS A . n 
A 1 62  SER 62  79  79  SER SER A . n 
A 1 63  SER 63  80  80  SER SER A . n 
A 1 64  TYR 64  81  81  TYR TYR A . n 
A 1 65  ARG 65  82  82  ARG ARG A . n 
A 1 66  GLN 66  83  83  GLN GLN A . n 
A 1 67  ARG 67  84  84  ARG ARG A . n 
A 1 68  ALA 68  85  85  ALA ALA A . n 
A 1 69  ARG 69  86  86  ARG ARG A . n 
A 1 70  LEU 70  87  87  LEU LEU A . n 
A 1 71  LEU 71  88  88  LEU LEU A . n 
A 1 72  LYS 72  89  89  LYS LYS A . n 
A 1 73  ASP 73  90  90  ASP ASP A . n 
A 1 74  GLN 74  91  91  GLN GLN A . n 
A 1 75  LEU 75  92  92  LEU LEU A . n 
A 1 76  SER 76  93  93  SER SER A . n 
A 1 77  LEU 77  94  94  LEU LEU A . n 
A 1 78  GLY 78  95  95  GLY GLY A . n 
A 1 79  ASN 79  96  96  ASN ASN A . n 
A 1 80  ALA 80  97  97  ALA ALA A . n 
A 1 81  ALA 81  98  98  ALA ALA A . n 
A 1 82  LEU 82  99  99  LEU LEU A . n 
A 1 83  GLN 83  100 100 GLN GLN A . n 
A 1 84  ILE 84  101 101 ILE ILE A . n 
A 1 85  THR 85  102 102 THR THR A . n 
A 1 86  ASP 86  103 103 ASP ASP A . n 
A 1 87  VAL 87  104 104 VAL VAL A . n 
A 1 88  LYS 88  105 105 LYS LYS A . n 
A 1 89  LEU 89  106 106 LEU LEU A . n 
A 1 90  GLN 90  107 107 GLN GLN A . n 
A 1 91  ASP 91  108 108 ASP ASP A . n 
A 1 92  ALA 92  109 109 ALA ALA A . n 
A 1 93  GLY 93  110 110 GLY GLY A . n 
A 1 94  VAL 94  111 111 VAL VAL A . n 
A 1 95  TYR 95  112 112 TYR TYR A . n 
A 1 96  ARG 96  113 113 ARG ARG A . n 
A 1 97  CYS 97  114 114 CYS CYS A . n 
A 1 98  MET 98  115 115 MET MET A . n 
A 1 99  ILE 99  116 116 ILE ILE A . n 
A 1 100 SER 100 117 117 SER SER A . n 
A 1 101 TYR 101 118 118 TYR TYR A . n 
A 1 102 GLY 102 119 119 GLY GLY A . n 
A 1 103 GLY 103 120 120 GLY GLY A . n 
A 1 104 ALA 104 121 121 ALA ALA A . n 
A 1 105 ASP 105 122 122 ASP ASP A . n 
A 1 106 TYR 106 123 123 TYR TYR A . n 
A 1 107 LYS 107 124 124 LYS LYS A . n 
A 1 108 ARG 108 125 125 ARG ARG A . n 
A 1 109 ILE 109 126 126 ILE ILE A . n 
A 1 110 THR 110 127 127 THR THR A . n 
A 1 111 VAL 111 128 128 VAL VAL A . n 
A 1 112 LYS 112 129 129 LYS LYS A . n 
A 1 113 VAL 113 130 130 VAL VAL A . n 
A 1 114 ASN 114 131 131 ASN ASN A . n 
A 1 115 ALA 115 132 132 ALA ALA A . n 
A 1 116 PRO 116 133 133 PRO PRO A . n 
A 1 117 TYR 117 134 134 TYR TYR A . n 
A 1 118 ASN 118 135 135 ASN ASN A . n 
A 1 119 LYS 119 136 136 LYS LYS A . n 
A 1 120 ILE 120 137 137 ILE ILE A . n 
A 1 121 ASN 121 138 138 ASN ASN A . n 
A 1 122 GLN 122 139 139 GLN GLN A . n 
A 1 123 ARG 123 140 140 ARG ARG A . n 
A 1 124 ILE 124 141 141 ILE ILE A . n 
A 1 125 LEU 125 142 142 LEU LEU A . n 
A 1 126 VAL 126 143 143 VAL VAL A . n 
A 1 127 VAL 127 144 144 VAL VAL A . n 
A 1 128 ASP 128 145 145 ASP ASP A . n 
A 1 129 PRO 129 146 146 PRO PRO A . n 
A 1 130 VAL 130 147 147 VAL VAL A . n 
A 1 131 THR 131 148 148 THR THR A . n 
A 1 132 SER 132 149 149 SER SER A . n 
A 1 133 GLU 133 150 150 GLU GLU A . n 
A 1 134 HIS 134 151 151 HIS HIS A . n 
A 1 135 GLU 135 152 152 GLU GLU A . n 
A 1 136 LEU 136 153 153 LEU LEU A . n 
A 1 137 THR 137 154 154 THR THR A . n 
A 1 138 CYS 138 155 155 CYS CYS A . n 
A 1 139 GLN 139 156 156 GLN GLN A . n 
A 1 140 ALA 140 157 157 ALA ALA A . n 
A 1 141 GLU 141 158 158 GLU GLU A . n 
A 1 142 GLY 142 159 159 GLY GLY A . n 
A 1 143 TYR 143 160 160 TYR TYR A . n 
A 1 144 PRO 144 161 161 PRO PRO A . n 
A 1 145 LYS 145 162 162 LYS LYS A . n 
A 1 146 ALA 146 163 163 ALA ALA A . n 
A 1 147 GLU 147 164 164 GLU GLU A . n 
A 1 148 VAL 148 165 165 VAL VAL A . n 
A 1 149 ILE 149 166 166 ILE ILE A . n 
A 1 150 TRP 150 167 167 TRP TRP A . n 
A 1 151 THR 151 168 168 THR THR A . n 
A 1 152 SER 152 169 169 SER SER A . n 
A 1 153 SER 153 170 170 SER SER A . n 
A 1 154 ASP 154 171 171 ASP ASP A . n 
A 1 155 HIS 155 172 172 HIS HIS A . n 
A 1 156 GLN 156 173 173 GLN GLN A . n 
A 1 157 VAL 157 174 174 VAL VAL A . n 
A 1 158 LEU 158 175 175 LEU LEU A . n 
A 1 159 SER 159 176 176 SER SER A . n 
A 1 160 GLY 160 177 177 GLY GLY A . n 
A 1 161 LYS 161 178 178 LYS LYS A . n 
A 1 162 THR 162 179 179 THR THR A . n 
A 1 163 THR 163 180 180 THR THR A . n 
A 1 164 THR 164 181 181 THR THR A . n 
A 1 165 THR 165 182 182 THR THR A . n 
A 1 166 ASN 166 183 183 ASN ASN A . n 
A 1 167 SER 167 184 184 SER SER A . n 
A 1 168 LYS 168 185 185 LYS LYS A . n 
A 1 169 ARG 169 186 186 ARG ARG A . n 
A 1 170 GLU 170 187 187 GLU GLU A . n 
A 1 171 GLU 171 188 188 GLU GLU A . n 
A 1 172 LYS 172 189 189 LYS LYS A . n 
A 1 173 LEU 173 190 190 LEU LEU A . n 
A 1 174 PHE 174 191 191 PHE PHE A . n 
A 1 175 ASN 175 192 192 ASN ASN A . n 
A 1 176 VAL 176 193 193 VAL VAL A . n 
A 1 177 THR 177 194 194 THR THR A . n 
A 1 178 SER 178 195 195 SER SER A . n 
A 1 179 THR 179 196 196 THR THR A . n 
A 1 180 LEU 180 197 197 LEU LEU A . n 
A 1 181 ARG 181 198 198 ARG ARG A . n 
A 1 182 ILE 182 199 199 ILE ILE A . n 
A 1 183 ASN 183 200 200 ASN ASN A . n 
A 1 184 THR 184 201 201 THR THR A . n 
A 1 185 THR 185 202 202 THR THR A . n 
A 1 186 THR 186 203 203 THR THR A . n 
A 1 187 ASN 187 204 204 ASN ASN A . n 
A 1 188 GLU 188 205 205 GLU GLU A . n 
A 1 189 ILE 189 206 206 ILE ILE A . n 
A 1 190 PHE 190 207 207 PHE PHE A . n 
A 1 191 TYR 191 208 208 TYR TYR A . n 
A 1 192 CYS 192 209 209 CYS CYS A . n 
A 1 193 THR 193 210 210 THR THR A . n 
A 1 194 PHE 194 211 211 PHE PHE A . n 
A 1 195 ARG 195 212 212 ARG ARG A . n 
A 1 196 ARG 196 213 213 ARG ARG A . n 
A 1 197 LEU 197 214 214 LEU LEU A . n 
A 1 198 ASP 198 215 215 ASP ASP A . n 
A 1 199 PRO 199 216 216 PRO PRO A . n 
A 1 200 GLU 200 217 217 GLU GLU A . n 
A 1 201 GLU 201 218 218 GLU GLU A . n 
A 1 202 ASN 202 219 219 ASN ASN A . n 
A 1 203 HIS 203 220 220 HIS HIS A . n 
A 1 204 THR 204 221 221 THR THR A . n 
A 1 205 ALA 205 222 222 ALA ALA A . n 
A 1 206 GLU 206 223 223 GLU GLU A . n 
A 1 207 LEU 207 224 224 LEU LEU A . n 
A 1 208 VAL 208 225 225 VAL VAL A . n 
A 1 209 ILE 209 226 226 ILE ILE A . n 
A 1 210 PRO 210 227 227 PRO PRO A . n 
A 1 211 GLU 211 228 228 GLU GLU A . n 
A 1 212 LEU 212 229 229 LEU LEU A . n 
A 1 213 PRO 213 230 230 PRO PRO A . n 
A 1 214 LEU 214 231 231 LEU LEU A . n 
A 1 215 ALA 215 232 232 ALA ALA A . n 
A 1 216 HIS 216 233 ?   ?   ?   A . n 
A 1 217 PRO 217 234 ?   ?   ?   A . n 
A 1 218 PRO 218 235 ?   ?   ?   A . n 
A 1 219 ASN 219 236 ?   ?   ?   A . n 
A 1 220 GLU 220 237 ?   ?   ?   A . n 
A 1 221 ARG 221 238 ?   ?   ?   A . n 
B 1 1   MET 1   18  18  MET MET B . n 
B 1 2   PHE 2   19  19  PHE PHE B . n 
B 1 3   THR 3   20  20  THR THR B . n 
B 1 4   VAL 4   21  21  VAL VAL B . n 
B 1 5   THR 5   22  22  THR THR B . n 
B 1 6   VAL 6   23  23  VAL VAL B . n 
B 1 7   PRO 7   24  24  PRO PRO B . n 
B 1 8   LYS 8   25  25  LYS LYS B . n 
B 1 9   ASP 9   26  26  ASP ASP B . n 
B 1 10  LEU 10  27  27  LEU LEU B . n 
B 1 11  TYR 11  28  28  TYR TYR B . n 
B 1 12  VAL 12  29  29  VAL VAL B . n 
B 1 13  VAL 13  30  30  VAL VAL B . n 
B 1 14  GLU 14  31  31  GLU GLU B . n 
B 1 15  TYR 15  32  32  TYR TYR B . n 
B 1 16  GLY 16  33  33  GLY GLY B . n 
B 1 17  SER 17  34  34  SER SER B . n 
B 1 18  ASN 18  35  35  ASN ASN B . n 
B 1 19  MET 19  36  36  MET MET B . n 
B 1 20  THR 20  37  37  THR THR B . n 
B 1 21  ILE 21  38  38  ILE ILE B . n 
B 1 22  GLU 22  39  39  GLU GLU B . n 
B 1 23  CYS 23  40  40  CYS CYS B . n 
B 1 24  LYS 24  41  41  LYS LYS B . n 
B 1 25  PHE 25  42  42  PHE PHE B . n 
B 1 26  PRO 26  43  43  PRO PRO B . n 
B 1 27  VAL 27  44  44  VAL VAL B . n 
B 1 28  GLU 28  45  45  GLU GLU B . n 
B 1 29  LYS 29  46  46  LYS LYS B . n 
B 1 30  GLN 30  47  47  GLN GLN B . n 
B 1 31  LEU 31  48  48  LEU LEU B . n 
B 1 32  ASP 32  49  49  ASP ASP B . n 
B 1 33  LEU 33  50  50  LEU LEU B . n 
B 1 34  ALA 34  51  51  ALA ALA B . n 
B 1 35  ALA 35  52  52  ALA ALA B . n 
B 1 36  LEU 36  53  53  LEU LEU B . n 
B 1 37  ILE 37  54  54  ILE ILE B . n 
B 1 38  VAL 38  55  55  VAL VAL B . n 
B 1 39  TYR 39  56  56  TYR TYR B . n 
B 1 40  TRP 40  57  57  TRP TRP B . n 
B 1 41  GLU 41  58  58  GLU GLU B . n 
B 1 42  MET 42  59  59  MET MET B . n 
B 1 43  GLU 43  60  60  GLU GLU B . n 
B 1 44  ASP 44  61  61  ASP ASP B . n 
B 1 45  LYS 45  62  62  LYS LYS B . n 
B 1 46  ASN 46  63  63  ASN ASN B . n 
B 1 47  ILE 47  64  64  ILE ILE B . n 
B 1 48  ILE 48  65  65  ILE ILE B . n 
B 1 49  GLN 49  66  66  GLN GLN B . n 
B 1 50  PHE 50  67  67  PHE PHE B . n 
B 1 51  VAL 51  68  68  VAL VAL B . n 
B 1 52  HIS 52  69  69  HIS HIS B . n 
B 1 53  GLY 53  70  70  GLY GLY B . n 
B 1 54  GLU 54  71  71  GLU GLU B . n 
B 1 55  GLU 55  72  72  GLU GLU B . n 
B 1 56  ASP 56  73  73  ASP ASP B . n 
B 1 57  LEU 57  74  74  LEU LEU B . n 
B 1 58  LYS 58  75  75  LYS LYS B . n 
B 1 59  VAL 59  76  76  VAL VAL B . n 
B 1 60  GLN 60  77  77  GLN GLN B . n 
B 1 61  HIS 61  78  78  HIS HIS B . n 
B 1 62  SER 62  79  79  SER SER B . n 
B 1 63  SER 63  80  80  SER SER B . n 
B 1 64  TYR 64  81  81  TYR TYR B . n 
B 1 65  ARG 65  82  82  ARG ARG B . n 
B 1 66  GLN 66  83  83  GLN GLN B . n 
B 1 67  ARG 67  84  84  ARG ARG B . n 
B 1 68  ALA 68  85  85  ALA ALA B . n 
B 1 69  ARG 69  86  86  ARG ARG B . n 
B 1 70  LEU 70  87  87  LEU LEU B . n 
B 1 71  LEU 71  88  88  LEU LEU B . n 
B 1 72  LYS 72  89  89  LYS LYS B . n 
B 1 73  ASP 73  90  90  ASP ASP B . n 
B 1 74  GLN 74  91  91  GLN GLN B . n 
B 1 75  LEU 75  92  92  LEU LEU B . n 
B 1 76  SER 76  93  93  SER SER B . n 
B 1 77  LEU 77  94  94  LEU LEU B . n 
B 1 78  GLY 78  95  95  GLY GLY B . n 
B 1 79  ASN 79  96  96  ASN ASN B . n 
B 1 80  ALA 80  97  97  ALA ALA B . n 
B 1 81  ALA 81  98  98  ALA ALA B . n 
B 1 82  LEU 82  99  99  LEU LEU B . n 
B 1 83  GLN 83  100 100 GLN GLN B . n 
B 1 84  ILE 84  101 101 ILE ILE B . n 
B 1 85  THR 85  102 102 THR THR B . n 
B 1 86  ASP 86  103 103 ASP ASP B . n 
B 1 87  VAL 87  104 104 VAL VAL B . n 
B 1 88  LYS 88  105 105 LYS LYS B . n 
B 1 89  LEU 89  106 106 LEU LEU B . n 
B 1 90  GLN 90  107 107 GLN GLN B . n 
B 1 91  ASP 91  108 108 ASP ASP B . n 
B 1 92  ALA 92  109 109 ALA ALA B . n 
B 1 93  GLY 93  110 110 GLY GLY B . n 
B 1 94  VAL 94  111 111 VAL VAL B . n 
B 1 95  TYR 95  112 112 TYR TYR B . n 
B 1 96  ARG 96  113 113 ARG ARG B . n 
B 1 97  CYS 97  114 114 CYS CYS B . n 
B 1 98  MET 98  115 115 MET MET B . n 
B 1 99  ILE 99  116 116 ILE ILE B . n 
B 1 100 SER 100 117 117 SER SER B . n 
B 1 101 TYR 101 118 118 TYR TYR B . n 
B 1 102 GLY 102 119 119 GLY GLY B . n 
B 1 103 GLY 103 120 120 GLY GLY B . n 
B 1 104 ALA 104 121 121 ALA ALA B . n 
B 1 105 ASP 105 122 122 ASP ASP B . n 
B 1 106 TYR 106 123 123 TYR TYR B . n 
B 1 107 LYS 107 124 124 LYS LYS B . n 
B 1 108 ARG 108 125 125 ARG ARG B . n 
B 1 109 ILE 109 126 126 ILE ILE B . n 
B 1 110 THR 110 127 127 THR THR B . n 
B 1 111 VAL 111 128 128 VAL VAL B . n 
B 1 112 LYS 112 129 129 LYS LYS B . n 
B 1 113 VAL 113 130 130 VAL VAL B . n 
B 1 114 ASN 114 131 131 ASN ASN B . n 
B 1 115 ALA 115 132 132 ALA ALA B . n 
B 1 116 PRO 116 133 133 PRO PRO B . n 
B 1 117 TYR 117 134 134 TYR TYR B . n 
B 1 118 ASN 118 135 135 ASN ASN B . n 
B 1 119 LYS 119 136 136 LYS LYS B . n 
B 1 120 ILE 120 137 137 ILE ILE B . n 
B 1 121 ASN 121 138 138 ASN ASN B . n 
B 1 122 GLN 122 139 139 GLN GLN B . n 
B 1 123 ARG 123 140 140 ARG ARG B . n 
B 1 124 ILE 124 141 141 ILE ILE B . n 
B 1 125 LEU 125 142 142 LEU LEU B . n 
B 1 126 VAL 126 143 143 VAL VAL B . n 
B 1 127 VAL 127 144 144 VAL VAL B . n 
B 1 128 ASP 128 145 145 ASP ASP B . n 
B 1 129 PRO 129 146 146 PRO PRO B . n 
B 1 130 VAL 130 147 147 VAL VAL B . n 
B 1 131 THR 131 148 148 THR THR B . n 
B 1 132 SER 132 149 149 SER SER B . n 
B 1 133 GLU 133 150 150 GLU GLU B . n 
B 1 134 HIS 134 151 151 HIS HIS B . n 
B 1 135 GLU 135 152 152 GLU GLU B . n 
B 1 136 LEU 136 153 153 LEU LEU B . n 
B 1 137 THR 137 154 154 THR THR B . n 
B 1 138 CYS 138 155 155 CYS CYS B . n 
B 1 139 GLN 139 156 156 GLN GLN B . n 
B 1 140 ALA 140 157 157 ALA ALA B . n 
B 1 141 GLU 141 158 158 GLU GLU B . n 
B 1 142 GLY 142 159 159 GLY GLY B . n 
B 1 143 TYR 143 160 160 TYR TYR B . n 
B 1 144 PRO 144 161 161 PRO PRO B . n 
B 1 145 LYS 145 162 162 LYS LYS B . n 
B 1 146 ALA 146 163 163 ALA ALA B . n 
B 1 147 GLU 147 164 164 GLU GLU B . n 
B 1 148 VAL 148 165 165 VAL VAL B . n 
B 1 149 ILE 149 166 166 ILE ILE B . n 
B 1 150 TRP 150 167 167 TRP TRP B . n 
B 1 151 THR 151 168 168 THR THR B . n 
B 1 152 SER 152 169 169 SER SER B . n 
B 1 153 SER 153 170 170 SER SER B . n 
B 1 154 ASP 154 171 171 ASP ASP B . n 
B 1 155 HIS 155 172 172 HIS HIS B . n 
B 1 156 GLN 156 173 173 GLN GLN B . n 
B 1 157 VAL 157 174 174 VAL VAL B . n 
B 1 158 LEU 158 175 175 LEU LEU B . n 
B 1 159 SER 159 176 176 SER SER B . n 
B 1 160 GLY 160 177 177 GLY GLY B . n 
B 1 161 LYS 161 178 178 LYS LYS B . n 
B 1 162 THR 162 179 179 THR THR B . n 
B 1 163 THR 163 180 180 THR THR B . n 
B 1 164 THR 164 181 181 THR THR B . n 
B 1 165 THR 165 182 182 THR THR B . n 
B 1 166 ASN 166 183 183 ASN ASN B . n 
B 1 167 SER 167 184 184 SER SER B . n 
B 1 168 LYS 168 185 185 LYS LYS B . n 
B 1 169 ARG 169 186 186 ARG ARG B . n 
B 1 170 GLU 170 187 187 GLU GLU B . n 
B 1 171 GLU 171 188 188 GLU GLU B . n 
B 1 172 LYS 172 189 189 LYS LYS B . n 
B 1 173 LEU 173 190 190 LEU LEU B . n 
B 1 174 PHE 174 191 191 PHE PHE B . n 
B 1 175 ASN 175 192 192 ASN ASN B . n 
B 1 176 VAL 176 193 193 VAL VAL B . n 
B 1 177 THR 177 194 194 THR THR B . n 
B 1 178 SER 178 195 195 SER SER B . n 
B 1 179 THR 179 196 196 THR THR B . n 
B 1 180 LEU 180 197 197 LEU LEU B . n 
B 1 181 ARG 181 198 198 ARG ARG B . n 
B 1 182 ILE 182 199 199 ILE ILE B . n 
B 1 183 ASN 183 200 200 ASN ASN B . n 
B 1 184 THR 184 201 201 THR THR B . n 
B 1 185 THR 185 202 202 THR THR B . n 
B 1 186 THR 186 203 203 THR THR B . n 
B 1 187 ASN 187 204 204 ASN ASN B . n 
B 1 188 GLU 188 205 205 GLU GLU B . n 
B 1 189 ILE 189 206 206 ILE ILE B . n 
B 1 190 PHE 190 207 207 PHE PHE B . n 
B 1 191 TYR 191 208 208 TYR TYR B . n 
B 1 192 CYS 192 209 209 CYS CYS B . n 
B 1 193 THR 193 210 210 THR THR B . n 
B 1 194 PHE 194 211 211 PHE PHE B . n 
B 1 195 ARG 195 212 212 ARG ARG B . n 
B 1 196 ARG 196 213 213 ARG ARG B . n 
B 1 197 LEU 197 214 214 LEU LEU B . n 
B 1 198 ASP 198 215 215 ASP ASP B . n 
B 1 199 PRO 199 216 216 PRO PRO B . n 
B 1 200 GLU 200 217 217 GLU GLU B . n 
B 1 201 GLU 201 218 218 GLU GLU B . n 
B 1 202 ASN 202 219 219 ASN ASN B . n 
B 1 203 HIS 203 220 220 HIS HIS B . n 
B 1 204 THR 204 221 221 THR THR B . n 
B 1 205 ALA 205 222 222 ALA ALA B . n 
B 1 206 GLU 206 223 223 GLU GLU B . n 
B 1 207 LEU 207 224 224 LEU LEU B . n 
B 1 208 VAL 208 225 225 VAL VAL B . n 
B 1 209 ILE 209 226 226 ILE ILE B . n 
B 1 210 PRO 210 227 227 PRO PRO B . n 
B 1 211 GLU 211 228 228 GLU GLU B . n 
B 1 212 LEU 212 229 ?   ?   ?   B . n 
B 1 213 PRO 213 230 ?   ?   ?   B . n 
B 1 214 LEU 214 231 ?   ?   ?   B . n 
B 1 215 ALA 215 232 ?   ?   ?   B . n 
B 1 216 HIS 216 233 ?   ?   ?   B . n 
B 1 217 PRO 217 234 ?   ?   ?   B . n 
B 1 218 PRO 218 235 ?   ?   ?   B . n 
B 1 219 ASN 219 236 ?   ?   ?   B . n 
B 1 220 GLU 220 237 ?   ?   ?   B . n 
B 1 221 ARG 221 238 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-12-29 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CrystalClear 'data collection' .        ? 1 
PHASES       phasing           .        ? 2 
REFMAC       refinement        5.2.0019 ? 3 
HKL-2000     'data reduction'  .        ? 4 
HKL-2000     'data scaling'    .        ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   LEU 
_pdbx_validate_close_contact.auth_seq_id_1    74 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   N 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   VAL 
_pdbx_validate_close_contact.auth_seq_id_2    76 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.17 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 19  ? ? 84.95   109.98  
2  1 LYS A 46  ? ? 38.73   -67.85  
3  1 GLU A 60  ? ? 28.44   57.48   
4  1 ASP A 61  ? ? 66.85   -8.76   
5  1 HIS A 78  ? ? -38.87  133.35  
6  1 SER A 80  ? ? -59.84  -5.08   
7  1 ASP A 103 ? ? 49.70   79.27   
8  1 TYR A 134 ? ? -67.79  59.12   
9  1 SER A 169 ? ? -69.90  -170.88 
10 1 THR A 203 ? ? -34.58  132.44  
11 1 ASN A 204 ? ? 80.61   -13.72  
12 1 PRO A 230 ? ? -37.69  136.22  
13 1 LEU A 231 ? ? 52.58   102.14  
14 1 LYS B 46  ? ? 48.24   -61.48  
15 1 ASP B 49  ? ? -60.79  68.89   
16 1 GLU B 60  ? ? 13.22   79.24   
17 1 ILE B 64  ? ? -102.17 -65.37  
18 1 HIS B 69  ? ? 37.40   84.09   
19 1 LYS B 75  ? ? -8.44   -48.31  
20 1 ARG B 82  ? ? -25.86  -61.14  
21 1 ASP B 108 ? ? -53.03  4.66    
22 1 TYR B 118 ? ? -171.21 102.58  
23 1 TYR B 134 ? ? -69.22  80.23   
24 1 ASP B 145 ? ? -165.36 96.14   
25 1 PRO B 161 ? ? -66.94  -161.14 
26 1 SER B 170 ? ? -54.08  11.87   
27 1 ASP B 171 ? ? -151.37 4.56    
28 1 THR B 201 ? ? -175.70 149.22  
29 1 ASN B 204 ? ? 49.75   20.70   
30 1 ASP B 215 ? ? 48.16   70.11   
31 1 GLU B 217 ? ? -49.20  108.98  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A HIS 233 ? A HIS 216 
2  1 Y 1 A PRO 234 ? A PRO 217 
3  1 Y 1 A PRO 235 ? A PRO 218 
4  1 Y 1 A ASN 236 ? A ASN 219 
5  1 Y 1 A GLU 237 ? A GLU 220 
6  1 Y 1 A ARG 238 ? A ARG 221 
7  1 Y 1 B LEU 229 ? B LEU 212 
8  1 Y 1 B PRO 230 ? B PRO 213 
9  1 Y 1 B LEU 231 ? B LEU 214 
10 1 Y 1 B ALA 232 ? B ALA 215 
11 1 Y 1 B HIS 233 ? B HIS 216 
12 1 Y 1 B PRO 234 ? B PRO 217 
13 1 Y 1 B PRO 235 ? B PRO 218 
14 1 Y 1 B ASN 236 ? B ASN 219 
15 1 Y 1 B GLU 237 ? B GLU 220 
16 1 Y 1 B ARG 238 ? B ARG 221 
#