data_3FRS
# 
_entry.id   3FRS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3FRS         
RCSB  RCSB050962   
WWPDB D_1000050962 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3FRR . unspecified 
PDB 3FRT . unspecified 
PDB 3FRV . unspecified 
# 
_pdbx_database_status.entry_id                        3FRS 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2009-01-08 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Schubert, H.L.'  1 
'Hill, C.P.'      2 
'Bajorek, M.'     3 
'Sundquist, W.I.' 4 
# 
_citation.id                        primary 
_citation.title                     'Structural basis for ESCRT-III protein autoinhibition.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            16 
_citation.page_first                754 
_citation.page_last                 762 
_citation.year                      2009 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19525971 
_citation.pdbx_database_id_DOI      10.1038/nsmb.1621 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bajorek, M.'        1  
primary 'Schubert, H.L.'     2  
primary 'McCullough, J.'     3  
primary 'Langelier, C.'      4  
primary 'Eckert, D.M.'       5  
primary 'Stubblefield, W.M.' 6  
primary 'Uter, N.T.'         7  
primary 'Myszka, D.G.'       8  
primary 'Hill, C.P.'         9  
primary 'Sundquist, W.I.'    10 
# 
_cell.length_a           57.180 
_cell.length_b           57.180 
_cell.length_c           157.262 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3FRS 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.entry_id                         3FRS 
_symmetry.Int_Tables_number                96 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Uncharacterized protein KIAA0174' 21625.352 1  ? ? 'UNP residues 1-189' ? 
2 non-polymer syn GLYCEROL                           92.094    1  ? ? ?                    ? 
3 water       nat water                              18.015    35 ? ? ?                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Putative MAPK-activating protein PM28' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GHMLGFKAERLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELYCDLLL
ARFGLIQSMKELDSGLAESVSTLIWAAPRLQSEVAELKIVADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKI
LVERYLIEIAKNYNVPYEPDSVVMAEAPP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GHMLGFKAERLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELYCDLLL
ARFGLIQSMKELDSGLAESVSTLIWAAPRLQSEVAELKIVADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKI
LVERYLIEIAKNYNVPYEPDSVVMAEAPP
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   HIS n 
1 3   MET n 
1 4   LEU n 
1 5   GLY n 
1 6   PHE n 
1 7   LYS n 
1 8   ALA n 
1 9   GLU n 
1 10  ARG n 
1 11  LEU n 
1 12  ARG n 
1 13  VAL n 
1 14  ASN n 
1 15  LEU n 
1 16  ARG n 
1 17  LEU n 
1 18  VAL n 
1 19  ILE n 
1 20  ASN n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  LEU n 
1 25  LEU n 
1 26  GLU n 
1 27  LYS n 
1 28  LYS n 
1 29  LYS n 
1 30  THR n 
1 31  GLU n 
1 32  LEU n 
1 33  ALA n 
1 34  GLN n 
1 35  LYS n 
1 36  ALA n 
1 37  ARG n 
1 38  LYS n 
1 39  GLU n 
1 40  ILE n 
1 41  ALA n 
1 42  ASP n 
1 43  TYR n 
1 44  LEU n 
1 45  ALA n 
1 46  ALA n 
1 47  GLY n 
1 48  LYS n 
1 49  ASP n 
1 50  GLU n 
1 51  ARG n 
1 52  ALA n 
1 53  ARG n 
1 54  ILE n 
1 55  ARG n 
1 56  VAL n 
1 57  GLU n 
1 58  HIS n 
1 59  ILE n 
1 60  ILE n 
1 61  ARG n 
1 62  GLU n 
1 63  ASP n 
1 64  TYR n 
1 65  LEU n 
1 66  VAL n 
1 67  GLU n 
1 68  ALA n 
1 69  MET n 
1 70  GLU n 
1 71  ILE n 
1 72  LEU n 
1 73  GLU n 
1 74  LEU n 
1 75  TYR n 
1 76  CYS n 
1 77  ASP n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  ALA n 
1 82  ARG n 
1 83  PHE n 
1 84  GLY n 
1 85  LEU n 
1 86  ILE n 
1 87  GLN n 
1 88  SER n 
1 89  MET n 
1 90  LYS n 
1 91  GLU n 
1 92  LEU n 
1 93  ASP n 
1 94  SER n 
1 95  GLY n 
1 96  LEU n 
1 97  ALA n 
1 98  GLU n 
1 99  SER n 
1 100 VAL n 
1 101 SER n 
1 102 THR n 
1 103 LEU n 
1 104 ILE n 
1 105 TRP n 
1 106 ALA n 
1 107 ALA n 
1 108 PRO n 
1 109 ARG n 
1 110 LEU n 
1 111 GLN n 
1 112 SER n 
1 113 GLU n 
1 114 VAL n 
1 115 ALA n 
1 116 GLU n 
1 117 LEU n 
1 118 LYS n 
1 119 ILE n 
1 120 VAL n 
1 121 ALA n 
1 122 ASP n 
1 123 GLN n 
1 124 LEU n 
1 125 CYS n 
1 126 ALA n 
1 127 LYS n 
1 128 TYR n 
1 129 SER n 
1 130 LYS n 
1 131 GLU n 
1 132 TYR n 
1 133 GLY n 
1 134 LYS n 
1 135 LEU n 
1 136 CYS n 
1 137 ARG n 
1 138 THR n 
1 139 ASN n 
1 140 GLN n 
1 141 ILE n 
1 142 GLY n 
1 143 THR n 
1 144 VAL n 
1 145 ASN n 
1 146 ASP n 
1 147 ARG n 
1 148 LEU n 
1 149 MET n 
1 150 HIS n 
1 151 LYS n 
1 152 LEU n 
1 153 SER n 
1 154 VAL n 
1 155 GLU n 
1 156 ALA n 
1 157 PRO n 
1 158 PRO n 
1 159 LYS n 
1 160 ILE n 
1 161 LEU n 
1 162 VAL n 
1 163 GLU n 
1 164 ARG n 
1 165 TYR n 
1 166 LEU n 
1 167 ILE n 
1 168 GLU n 
1 169 ILE n 
1 170 ALA n 
1 171 LYS n 
1 172 ASN n 
1 173 TYR n 
1 174 ASN n 
1 175 VAL n 
1 176 PRO n 
1 177 TYR n 
1 178 GLU n 
1 179 PRO n 
1 180 ASP n 
1 181 SER n 
1 182 VAL n 
1 183 VAL n 
1 184 MET n 
1 185 ALA n 
1 186 GLU n 
1 187 ALA n 
1 188 PRO n 
1 189 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'IST1, KIAA0174' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)Codon+RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    K0174_HUMAN 
_struct_ref.pdbx_db_accession          P53990 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GFKAERLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELYCDLLLARFG
LIQSMKELDSGLAESVSTLIWAAPRLQSEVAELKIVADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVER
YLIEIAKNYNVPYEPDSVVMAEAPP
;
_struct_ref.pdbx_align_begin           5 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3FRS 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 5 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 189 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P53990 
_struct_ref_seq.db_align_beg                  5 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  189 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       5 
_struct_ref_seq.pdbx_auth_seq_align_end       189 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3FRS GLY A 1 ? UNP P53990 ? ? 'EXPRESSION TAG' 1 1 
1 3FRS HIS A 2 ? UNP P53990 ? ? 'EXPRESSION TAG' 2 2 
1 3FRS MET A 3 ? UNP P53990 ? ? 'EXPRESSION TAG' 3 3 
1 3FRS LEU A 4 ? UNP P53990 ? ? 'EXPRESSION TAG' 4 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   2 
_exptl.entry_id          3FRS 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.97 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   58.61 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.temp            296 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;10mM Tris-HCL, pH 8.0,  
350mM NaCl, 1mM DTT, VAPOR DIFFUSION, SITTING DROP, temperature 296K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100 ? 1 
2 100 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 'IMAGE PLATE' 'RIGAKU RAXIS IV'      2008-09-08 ? 
2 CCD           'MARMOSAIC 325 mm CCD' 2008-08-06 ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.pdbx_scattering_type 
1 1 'SINGLE WAVELENGTH' 'verimax HR'                                                                      M x-ray 
2 1 MAD                 'Side scattering bent cube-root I-beam single crystal, asymmetric cut 4.965 degs' M x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.54    1.0 
2 0.97852 1.0 
3 0.91837 1.0 
4 0.97922 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
1 'ROTATING ANODE' 'RIGAKU MICROMAX-007 HF' ? 1.54                        ?    ?      
2 SYNCHROTRON      'SSRL BEAMLINE BL11-1'   ? '0.97852, 0.91837, 0.97922' SSRL BL11-1 
# 
_reflns.entry_id                     3FRS 
_reflns.d_resolution_high            2.610 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   8387 
_reflns.pdbx_Rmerge_I_obs            0.079 
_reflns.pdbx_netI_over_sigmaI        13.470 
_reflns.pdbx_chi_squared             1.031 
_reflns.pdbx_redundancy              3.800 
_reflns.percent_possible_obs         97.700 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.number_all                   8387 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        84.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1,2 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.61 2.70  ? ? ? 0.459 ? ? 1.023 2.80 ? 727 88.30  1  1,2 
2.70 2.81  ? ? ? 0.385 ? ? 0.913 3.50 ? 814 99.40  2  1,2 
2.81 2.94  ? ? ? 0.333 ? ? 1.004 3.90 ? 826 100.00 3  1,2 
2.94 3.09  ? ? ? 0.232 ? ? 1.075 4.00 ? 836 100.00 4  1,2 
3.09 3.29  ? ? ? 0.163 ? ? 1.063 4.00 ? 850 100.00 5  1,2 
3.29 3.54  ? ? ? 0.134 ? ? 1.121 4.00 ? 842 99.60  6  1,2 
3.54 3.90  ? ? ? 0.104 ? ? 1.039 4.00 ? 846 99.40  7  1,2 
3.90 4.46  ? ? ? 0.083 ? ? 1.037 3.90 ? 852 99.20  8  1,2 
4.46 5.62  ? ? ? 0.074 ? ? 1.051 3.90 ? 876 98.30  9  1,2 
5.62 50.00 ? ? ? 0.051 ? ? 0.955 3.60 ? 918 93.60  10 1,2 
# 
_refine.entry_id                                 3FRS 
_refine.ls_d_res_high                            2.610 
_refine.ls_d_res_low                             30.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    98.150 
_refine.ls_number_reflns_obs                     8360 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS   
 U VALUES      : REFINED INDIVIDUALLY
;
_refine.ls_R_factor_obs                          0.261 
_refine.ls_R_factor_R_work                       0.259 
_refine.ls_wR_factor_R_work                      0.292 
_refine.ls_R_factor_R_free                       0.298 
_refine.ls_wR_factor_R_free                      0.321 
_refine.ls_percent_reflns_R_free                 4.700 
_refine.ls_number_reflns_R_free                  392 
_refine.B_iso_mean                               86.846 
_refine.aniso_B[1][1]                            2.110 
_refine.aniso_B[2][2]                            2.110 
_refine.aniso_B[3][3]                            -4.210 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.942 
_refine.correlation_coeff_Fo_to_Fc_free          0.902 
_refine.overall_SU_R_Cruickshank_DPI             0.576 
_refine.overall_SU_R_free                        0.341 
_refine.pdbx_overall_ESU_R                       0.576 
_refine.pdbx_overall_ESU_R_Free                  0.341 
_refine.overall_SU_ML                            0.305 
_refine.overall_SU_B                             16.758 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD WITH PHASES' 
_refine.overall_FOM_work_R_set                   0.695 
_refine.B_iso_max                                116.21 
_refine.B_iso_min                                36.15 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            0.50 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     8360 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1,2 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1414 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             35 
_refine_hist.number_atoms_total               1455 
_refine_hist.d_res_high                       2.610 
_refine_hist.d_res_low                        30.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       1446 0.007  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    1943 1.177  2.006  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 175  6.771  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 65   37.858 23.692 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 293  18.772 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 14   15.684 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr         224  0.105  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   1042 0.004  0.021  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it            878  0.408  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it           1413 0.752  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it            568  0.620  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it           530  1.154  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.61 
_refine_ls_shell.d_res_low                        2.676 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               86.120 
_refine_ls_shell.number_reflns_R_work             497 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.427 
_refine_ls_shell.R_factor_R_free                  0.476 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             18 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                515 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3FRS 
_struct.title                     'Structure of human IST1(NTD) (residues 1-189)(p43212)' 
_struct.pdbx_descriptor           'Uncharacterized protein KIAA0174' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3FRS 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            'ESCRT, ESCRT-III, IST1, Phosphoprotein, PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS A 7   ? GLY A 47  ? LYS A 7   GLY A 47  1 ? 41 
HELX_P HELX_P2 2 LYS A 48  ? ARG A 82  ? LYS A 48  ARG A 82  1 ? 35 
HELX_P HELX_P3 3 ARG A 82  ? GLN A 87  ? ARG A 82  GLN A 87  1 ? 6  
HELX_P HELX_P4 4 ASP A 93  ? GLY A 95  ? ASP A 93  GLY A 95  5 ? 3  
HELX_P HELX_P5 5 LEU A 96  ? GLN A 111 ? LEU A 96  GLN A 111 1 ? 16 
HELX_P HELX_P6 6 ALA A 115 ? SER A 129 ? ALA A 115 SER A 129 1 ? 15 
HELX_P HELX_P7 7 SER A 129 ? THR A 138 ? SER A 129 THR A 138 1 ? 10 
HELX_P HELX_P8 8 ASN A 145 ? SER A 153 ? ASN A 145 SER A 153 1 ? 9  
HELX_P HELX_P9 9 ILE A 160 ? TYR A 173 ? ILE A 160 TYR A 173 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ALA 46 A . ? ALA 46 A GLY 47 A ? GLY 47 A 1 -13.14 
2 GLY 47 A . ? GLY 47 A LYS 48 A ? LYS 48 A 1 20.64  
3 GLN 87 A . ? GLN 87 A SER 88 A ? SER 88 A 1 -8.66  
4 SER 88 A . ? SER 88 A MET 89 A ? MET 89 A 1 4.13   
5 MET 89 A . ? MET 89 A LYS 90 A ? LYS 90 A 1 -2.19  
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    3 
_struct_site.details              'BINDING SITE FOR RESIDUE GOL A 190' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 3 ALA A 170 ? ALA A 170 . ? 1_555 ? 
2 AC1 3 VAL A 175 ? VAL A 175 . ? 1_555 ? 
3 AC1 3 HOH C .   ? HOH A 210 . ? 7_555 ? 
# 
_atom_sites.entry_id                    3FRS 
_atom_sites.fract_transf_matrix[1][1]   0.017489 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017489 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006359 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A 1 5   ? -1.989  42.584 21.713  1.00 95.27  ? 5   GLY A N   1 
ATOM   2    C CA  . GLY A 1 5   ? -2.983  41.861 22.557  1.00 95.19  ? 5   GLY A CA  1 
ATOM   3    C C   . GLY A 1 5   ? -2.801  40.355 22.502  1.00 95.22  ? 5   GLY A C   1 
ATOM   4    O O   . GLY A 1 5   ? -3.549  39.656 21.813  1.00 95.25  ? 5   GLY A O   1 
ATOM   5    N N   . PHE A 1 6   ? -1.802  39.859 23.231  1.00 95.08  ? 6   PHE A N   1 
ATOM   6    C CA  . PHE A 1 6   ? -1.527  38.423 23.317  1.00 94.92  ? 6   PHE A CA  1 
ATOM   7    C C   . PHE A 1 6   ? -2.514  37.715 24.252  1.00 94.69  ? 6   PHE A C   1 
ATOM   8    O O   . PHE A 1 6   ? -2.580  38.025 25.445  1.00 94.78  ? 6   PHE A O   1 
ATOM   9    C CB  . PHE A 1 6   ? -0.074  38.182 23.767  1.00 94.97  ? 6   PHE A CB  1 
ATOM   10   C CG  . PHE A 1 6   ? 0.274   36.727 23.997  1.00 95.23  ? 6   PHE A CG  1 
ATOM   11   C CD1 . PHE A 1 6   ? 0.364   35.834 22.930  1.00 95.32  ? 6   PHE A CD1 1 
ATOM   12   C CD2 . PHE A 1 6   ? 0.531   36.255 25.284  1.00 95.18  ? 6   PHE A CD2 1 
ATOM   13   C CE1 . PHE A 1 6   ? 0.694   34.496 23.142  1.00 95.29  ? 6   PHE A CE1 1 
ATOM   14   C CE2 . PHE A 1 6   ? 0.860   34.916 25.506  1.00 95.26  ? 6   PHE A CE2 1 
ATOM   15   C CZ  . PHE A 1 6   ? 0.945   34.037 24.433  1.00 95.17  ? 6   PHE A CZ  1 
ATOM   16   N N   . LYS A 1 7   ? -3.285  36.780 23.696  1.00 94.30  ? 7   LYS A N   1 
ATOM   17   C CA  . LYS A 1 7   ? -4.156  35.908 24.491  1.00 93.86  ? 7   LYS A CA  1 
ATOM   18   C C   . LYS A 1 7   ? -3.630  34.470 24.432  1.00 93.35  ? 7   LYS A C   1 
ATOM   19   O O   . LYS A 1 7   ? -3.643  33.842 23.369  1.00 93.39  ? 7   LYS A O   1 
ATOM   20   C CB  . LYS A 1 7   ? -5.614  35.947 24.001  1.00 94.02  ? 7   LYS A CB  1 
ATOM   21   C CG  . LYS A 1 7   ? -6.257  37.331 23.822  1.00 94.66  ? 7   LYS A CG  1 
ATOM   22   C CD  . LYS A 1 7   ? -6.249  37.775 22.349  1.00 95.51  ? 7   LYS A CD  1 
ATOM   23   C CE  . LYS A 1 7   ? -7.590  38.386 21.906  1.00 95.59  ? 7   LYS A CE  1 
ATOM   24   N NZ  . LYS A 1 7   ? -7.946  39.656 22.607  1.00 95.69  ? 7   LYS A NZ  1 
ATOM   25   N N   . ALA A 1 8   ? -3.173  33.957 25.573  1.00 92.64  ? 8   ALA A N   1 
ATOM   26   C CA  . ALA A 1 8   ? -2.609  32.603 25.663  1.00 91.80  ? 8   ALA A CA  1 
ATOM   27   C C   . ALA A 1 8   ? -3.573  31.501 25.207  1.00 91.20  ? 8   ALA A C   1 
ATOM   28   O O   . ALA A 1 8   ? -3.153  30.517 24.596  1.00 91.15  ? 8   ALA A O   1 
ATOM   29   C CB  . ALA A 1 8   ? -2.110  32.330 27.074  1.00 91.83  ? 8   ALA A CB  1 
ATOM   30   N N   . GLU A 1 9   ? -4.858  31.674 25.506  1.00 90.44  ? 9   GLU A N   1 
ATOM   31   C CA  . GLU A 1 9   ? -5.896  30.740 25.068  1.00 89.76  ? 9   GLU A CA  1 
ATOM   32   C C   . GLU A 1 9   ? -6.134  30.828 23.558  1.00 89.27  ? 9   GLU A C   1 
ATOM   33   O O   . GLU A 1 9   ? -6.330  29.805 22.901  1.00 89.22  ? 9   GLU A O   1 
ATOM   34   C CB  . GLU A 1 9   ? -7.199  30.973 25.842  1.00 89.78  ? 9   GLU A CB  1 
ATOM   35   C CG  . GLU A 1 9   ? -8.414  30.171 25.350  1.00 89.80  ? 9   GLU A CG  1 
ATOM   36   C CD  . GLU A 1 9   ? -8.418  28.711 25.793  1.00 89.72  ? 9   GLU A CD  1 
ATOM   37   O OE1 . GLU A 1 9   ? -7.407  28.237 26.364  1.00 89.36  ? 9   GLU A OE1 1 
ATOM   38   O OE2 . GLU A 1 9   ? -9.449  28.038 25.566  1.00 89.51  ? 9   GLU A OE2 1 
ATOM   39   N N   . ARG A 1 10  ? -6.116  32.045 23.016  1.00 88.57  ? 10  ARG A N   1 
ATOM   40   C CA  . ARG A 1 10  ? -6.208  32.240 21.568  1.00 87.95  ? 10  ARG A CA  1 
ATOM   41   C C   . ARG A 1 10  ? -5.132  31.451 20.832  1.00 87.29  ? 10  ARG A C   1 
ATOM   42   O O   . ARG A 1 10  ? -5.418  30.797 19.828  1.00 87.28  ? 10  ARG A O   1 
ATOM   43   C CB  . ARG A 1 10  ? -6.109  33.718 21.192  1.00 88.05  ? 10  ARG A CB  1 
ATOM   44   C CG  . ARG A 1 10  ? -7.432  34.344 20.828  1.00 88.70  ? 10  ARG A CG  1 
ATOM   45   C CD  . ARG A 1 10  ? -7.257  35.319 19.681  1.00 89.84  ? 10  ARG A CD  1 
ATOM   46   N NE  . ARG A 1 10  ? -8.461  35.400 18.857  1.00 90.96  ? 10  ARG A NE  1 
ATOM   47   C CZ  . ARG A 1 10  ? -8.493  35.853 17.605  1.00 91.17  ? 10  ARG A CZ  1 
ATOM   48   N NH1 . ARG A 1 10  ? -7.381  36.273 17.012  1.00 91.44  ? 10  ARG A NH1 1 
ATOM   49   N NH2 . ARG A 1 10  ? -9.643  35.884 16.943  1.00 90.95  ? 10  ARG A NH2 1 
ATOM   50   N N   . LEU A 1 11  ? -3.903  31.512 21.347  1.00 86.38  ? 11  LEU A N   1 
ATOM   51   C CA  . LEU A 1 11  ? -2.775  30.806 20.753  1.00 85.48  ? 11  LEU A CA  1 
ATOM   52   C C   . LEU A 1 11  ? -2.987  29.291 20.753  1.00 84.99  ? 11  LEU A C   1 
ATOM   53   O O   . LEU A 1 11  ? -2.915  28.665 19.694  1.00 85.00  ? 11  LEU A O   1 
ATOM   54   C CB  . LEU A 1 11  ? -1.461  31.183 21.450  1.00 85.39  ? 11  LEU A CB  1 
ATOM   55   C CG  . LEU A 1 11  ? -0.155  30.600 20.892  1.00 85.29  ? 11  LEU A CG  1 
ATOM   56   C CD1 . LEU A 1 11  ? 0.039   30.941 19.423  1.00 85.19  ? 11  LEU A CD1 1 
ATOM   57   C CD2 . LEU A 1 11  ? 1.042   31.074 21.701  1.00 85.10  ? 11  LEU A CD2 1 
ATOM   58   N N   . ARG A 1 12  ? -3.269  28.710 21.921  1.00 84.22  ? 12  ARG A N   1 
ATOM   59   C CA  . ARG A 1 12  ? -3.450  27.257 22.010  1.00 83.45  ? 12  ARG A CA  1 
ATOM   60   C C   . ARG A 1 12  ? -4.619  26.771 21.155  1.00 83.06  ? 12  ARG A C   1 
ATOM   61   O O   . ARG A 1 12  ? -4.505  25.748 20.484  1.00 83.16  ? 12  ARG A O   1 
ATOM   62   C CB  . ARG A 1 12  ? -3.561  26.754 23.462  1.00 83.26  ? 12  ARG A CB  1 
ATOM   63   C CG  . ARG A 1 12  ? -4.899  26.987 24.145  1.00 82.70  ? 12  ARG A CG  1 
ATOM   64   C CD  . ARG A 1 12  ? -5.067  26.111 25.386  1.00 81.28  ? 12  ARG A CD  1 
ATOM   65   N NE  . ARG A 1 12  ? -5.627  24.794 25.087  1.00 80.06  ? 12  ARG A NE  1 
ATOM   66   C CZ  . ARG A 1 12  ? -6.929  24.516 25.002  1.00 79.54  ? 12  ARG A CZ  1 
ATOM   67   N NH1 . ARG A 1 12  ? -7.845  25.461 25.181  1.00 78.66  ? 12  ARG A NH1 1 
ATOM   68   N NH2 . ARG A 1 12  ? -7.317  23.279 24.729  1.00 79.58  ? 12  ARG A NH2 1 
ATOM   69   N N   . VAL A 1 13  ? -5.724  27.514 21.161  1.00 82.47  ? 13  VAL A N   1 
ATOM   70   C CA  . VAL A 1 13  ? -6.904  27.132 20.386  1.00 82.04  ? 13  VAL A CA  1 
ATOM   71   C C   . VAL A 1 13  ? -6.553  27.029 18.900  1.00 81.82  ? 13  VAL A C   1 
ATOM   72   O O   . VAL A 1 13  ? -6.887  26.041 18.241  1.00 81.87  ? 13  VAL A O   1 
ATOM   73   C CB  . VAL A 1 13  ? -8.105  28.093 20.623  1.00 82.00  ? 13  VAL A CB  1 
ATOM   74   C CG1 . VAL A 1 13  ? -9.241  27.815 19.644  1.00 81.74  ? 13  VAL A CG1 1 
ATOM   75   C CG2 . VAL A 1 13  ? -8.614  27.954 22.043  1.00 82.07  ? 13  VAL A CG2 1 
ATOM   76   N N   . ASN A 1 14  ? -5.852  28.036 18.389  1.00 81.34  ? 14  ASN A N   1 
ATOM   77   C CA  . ASN A 1 14  ? -5.521  28.084 16.972  1.00 80.76  ? 14  ASN A CA  1 
ATOM   78   C C   . ASN A 1 14  ? -4.384  27.146 16.597  1.00 80.20  ? 14  ASN A C   1 
ATOM   79   O O   . ASN A 1 14  ? -4.413  26.547 15.523  1.00 80.15  ? 14  ASN A O   1 
ATOM   80   C CB  . ASN A 1 14  ? -5.271  29.521 16.520  1.00 80.86  ? 14  ASN A CB  1 
ATOM   81   C CG  . ASN A 1 14  ? -6.557  30.332 16.458  1.00 81.27  ? 14  ASN A CG  1 
ATOM   82   O OD1 . ASN A 1 14  ? -7.347  30.195 15.519  1.00 81.58  ? 14  ASN A OD1 1 
ATOM   83   N ND2 . ASN A 1 14  ? -6.783  31.168 17.470  1.00 81.37  ? 14  ASN A ND2 1 
ATOM   84   N N   . LEU A 1 15  ? -3.404  27.007 17.491  1.00 79.48  ? 15  LEU A N   1 
ATOM   85   C CA  . LEU A 1 15  ? -2.366  25.984 17.356  1.00 78.78  ? 15  LEU A CA  1 
ATOM   86   C C   . LEU A 1 15  ? -2.997  24.607 17.190  1.00 78.51  ? 15  LEU A C   1 
ATOM   87   O O   . LEU A 1 15  ? -2.492  23.760 16.447  1.00 78.67  ? 15  LEU A O   1 
ATOM   88   C CB  . LEU A 1 15  ? -1.449  25.970 18.579  1.00 78.62  ? 15  LEU A CB  1 
ATOM   89   C CG  . LEU A 1 15  ? -0.232  26.889 18.605  1.00 78.27  ? 15  LEU A CG  1 
ATOM   90   C CD1 . LEU A 1 15  ? 0.359   26.892 19.997  1.00 78.23  ? 15  LEU A CD1 1 
ATOM   91   C CD2 . LEU A 1 15  ? 0.809   26.440 17.599  1.00 78.01  ? 15  LEU A CD2 1 
ATOM   92   N N   . ARG A 1 16  ? -4.110  24.400 17.885  1.00 77.94  ? 16  ARG A N   1 
ATOM   93   C CA  . ARG A 1 16  ? -4.845  23.150 17.838  1.00 77.27  ? 16  ARG A CA  1 
ATOM   94   C C   . ARG A 1 16  ? -5.621  23.009 16.532  1.00 76.95  ? 16  ARG A C   1 
ATOM   95   O O   . ARG A 1 16  ? -5.618  21.942 15.912  1.00 76.88  ? 16  ARG A O   1 
ATOM   96   C CB  . ARG A 1 16  ? -5.805  23.086 19.018  1.00 77.16  ? 16  ARG A CB  1 
ATOM   97   C CG  . ARG A 1 16  ? -6.015  21.710 19.563  1.00 76.75  ? 16  ARG A CG  1 
ATOM   98   C CD  . ARG A 1 16  ? -4.811  21.261 20.355  1.00 75.74  ? 16  ARG A CD  1 
ATOM   99   N NE  . ARG A 1 16  ? -5.166  20.631 21.628  1.00 76.16  ? 16  ARG A NE  1 
ATOM   100  C CZ  . ARG A 1 16  ? -6.296  19.973 21.895  1.00 75.61  ? 16  ARG A CZ  1 
ATOM   101  N NH1 . ARG A 1 16  ? -7.245  19.800 20.979  1.00 74.34  ? 16  ARG A NH1 1 
ATOM   102  N NH2 . ARG A 1 16  ? -6.464  19.463 23.104  1.00 76.07  ? 16  ARG A NH2 1 
ATOM   103  N N   . LEU A 1 17  ? -6.286  24.091 16.130  1.00 76.57  ? 17  LEU A N   1 
ATOM   104  C CA  . LEU A 1 17  ? -7.049  24.137 14.885  1.00 76.19  ? 17  LEU A CA  1 
ATOM   105  C C   . LEU A 1 17  ? -6.149  23.944 13.670  1.00 75.92  ? 17  LEU A C   1 
ATOM   106  O O   . LEU A 1 17  ? -6.548  23.308 12.691  1.00 75.80  ? 17  LEU A O   1 
ATOM   107  C CB  . LEU A 1 17  ? -7.806  25.460 14.768  1.00 76.17  ? 17  LEU A CB  1 
ATOM   108  C CG  . LEU A 1 17  ? -8.996  25.661 15.710  1.00 76.33  ? 17  LEU A CG  1 
ATOM   109  C CD1 . LEU A 1 17  ? -9.359  27.139 15.821  1.00 76.27  ? 17  LEU A CD1 1 
ATOM   110  C CD2 . LEU A 1 17  ? -10.199 24.833 15.271  1.00 76.59  ? 17  LEU A CD2 1 
ATOM   111  N N   . VAL A 1 18  ? -4.938  24.497 13.750  1.00 75.56  ? 18  VAL A N   1 
ATOM   112  C CA  . VAL A 1 18  ? -3.922  24.336 12.713  1.00 75.28  ? 18  VAL A CA  1 
ATOM   113  C C   . VAL A 1 18  ? -3.542  22.861 12.562  1.00 75.37  ? 18  VAL A C   1 
ATOM   114  O O   . VAL A 1 18  ? -3.560  22.331 11.449  1.00 75.40  ? 18  VAL A O   1 
ATOM   115  C CB  . VAL A 1 18  ? -2.677  25.230 12.987  1.00 75.17  ? 18  VAL A CB  1 
ATOM   116  C CG1 . VAL A 1 18  ? -1.469  24.773 12.191  1.00 74.72  ? 18  VAL A CG1 1 
ATOM   117  C CG2 . VAL A 1 18  ? -2.989  26.673 12.670  1.00 74.86  ? 18  VAL A CG2 1 
ATOM   118  N N   . ILE A 1 19  ? -3.227  22.201 13.679  1.00 75.32  ? 19  ILE A N   1 
ATOM   119  C CA  . ILE A 1 19  ? -2.904  20.773 13.662  1.00 75.32  ? 19  ILE A CA  1 
ATOM   120  C C   . ILE A 1 19  ? -4.003  19.978 12.959  1.00 75.48  ? 19  ILE A C   1 
ATOM   121  O O   . ILE A 1 19  ? -3.716  19.127 12.117  1.00 75.57  ? 19  ILE A O   1 
ATOM   122  C CB  . ILE A 1 19  ? -2.652  20.212 15.080  1.00 75.21  ? 19  ILE A CB  1 
ATOM   123  C CG1 . ILE A 1 19  ? -1.345  20.771 15.635  1.00 75.21  ? 19  ILE A CG1 1 
ATOM   124  C CG2 . ILE A 1 19  ? -2.588  18.680 15.066  1.00 74.97  ? 19  ILE A CG2 1 
ATOM   125  C CD1 . ILE A 1 19  ? -1.203  20.642 17.131  1.00 75.13  ? 19  ILE A CD1 1 
ATOM   126  N N   . ASN A 1 20  ? -5.255  20.277 13.290  1.00 75.59  ? 20  ASN A N   1 
ATOM   127  C CA  . ASN A 1 20  ? -6.387  19.593 12.678  1.00 75.86  ? 20  ASN A CA  1 
ATOM   128  C C   . ASN A 1 20  ? -6.477  19.836 11.177  1.00 76.08  ? 20  ASN A C   1 
ATOM   129  O O   . ASN A 1 20  ? -6.791  18.924 10.408  1.00 75.99  ? 20  ASN A O   1 
ATOM   130  C CB  . ASN A 1 20  ? -7.692  19.983 13.374  1.00 75.76  ? 20  ASN A CB  1 
ATOM   131  C CG  . ASN A 1 20  ? -7.765  19.470 14.803  1.00 75.94  ? 20  ASN A CG  1 
ATOM   132  O OD1 . ASN A 1 20  ? -6.904  18.707 15.250  1.00 75.99  ? 20  ASN A OD1 1 
ATOM   133  N ND2 . ASN A 1 20  ? -8.794  19.889 15.530  1.00 76.18  ? 20  ASN A ND2 1 
ATOM   134  N N   . ARG A 1 21  ? -6.173  21.066 10.773  1.00 76.43  ? 21  ARG A N   1 
ATOM   135  C CA  . ARG A 1 21  ? -6.252  21.476 9.378   1.00 76.76  ? 21  ARG A CA  1 
ATOM   136  C C   . ARG A 1 21  ? -5.113  20.868 8.566   1.00 76.71  ? 21  ARG A C   1 
ATOM   137  O O   . ARG A 1 21  ? -5.325  20.374 7.455   1.00 76.76  ? 21  ARG A O   1 
ATOM   138  C CB  . ARG A 1 21  ? -6.224  23.000 9.277   1.00 76.96  ? 21  ARG A CB  1 
ATOM   139  C CG  . ARG A 1 21  ? -7.325  23.571 8.416   1.00 78.02  ? 21  ARG A CG  1 
ATOM   140  C CD  . ARG A 1 21  ? -7.075  23.337 6.943   1.00 80.41  ? 21  ARG A CD  1 
ATOM   141  N NE  . ARG A 1 21  ? -8.334  23.338 6.204   1.00 82.75  ? 21  ARG A NE  1 
ATOM   142  C CZ  . ARG A 1 21  ? -8.474  23.727 4.938   1.00 83.77  ? 21  ARG A CZ  1 
ATOM   143  N NH1 . ARG A 1 21  ? -7.426  24.164 4.242   1.00 83.83  ? 21  ARG A NH1 1 
ATOM   144  N NH2 . ARG A 1 21  ? -9.673  23.689 4.366   1.00 84.47  ? 21  ARG A NH2 1 
ATOM   145  N N   . LEU A 1 22  ? -3.909  20.908 9.132   1.00 76.60  ? 22  LEU A N   1 
ATOM   146  C CA  . LEU A 1 22  ? -2.751  20.259 8.537   1.00 76.51  ? 22  LEU A CA  1 
ATOM   147  C C   . LEU A 1 22  ? -3.024  18.781 8.311   1.00 76.72  ? 22  LEU A C   1 
ATOM   148  O O   . LEU A 1 22  ? -2.866  18.288 7.200   1.00 76.96  ? 22  LEU A O   1 
ATOM   149  C CB  . LEU A 1 22  ? -1.512  20.451 9.409   1.00 76.24  ? 22  LEU A CB  1 
ATOM   150  C CG  . LEU A 1 22  ? -0.961  21.876 9.454   1.00 75.98  ? 22  LEU A CG  1 
ATOM   151  C CD1 . LEU A 1 22  ? 0.198   21.974 10.420  1.00 75.77  ? 22  LEU A CD1 1 
ATOM   152  C CD2 . LEU A 1 22  ? -0.537  22.347 8.077   1.00 75.59  ? 22  LEU A CD2 1 
ATOM   153  N N   . LYS A 1 23  ? -3.461  18.090 9.360   1.00 76.97  ? 23  LYS A N   1 
ATOM   154  C CA  . LYS A 1 23  ? -3.816  16.675 9.279   1.00 77.25  ? 23  LYS A CA  1 
ATOM   155  C C   . LYS A 1 23  ? -4.737  16.365 8.097   1.00 77.44  ? 23  LYS A C   1 
ATOM   156  O O   . LYS A 1 23  ? -4.512  15.404 7.359   1.00 77.39  ? 23  LYS A O   1 
ATOM   157  C CB  . LYS A 1 23  ? -4.470  16.225 10.582  1.00 77.22  ? 23  LYS A CB  1 
ATOM   158  C CG  . LYS A 1 23  ? -3.484  15.890 11.674  1.00 77.53  ? 23  LYS A CG  1 
ATOM   159  C CD  . LYS A 1 23  ? -4.193  15.651 12.987  1.00 77.92  ? 23  LYS A CD  1 
ATOM   160  C CE  . LYS A 1 23  ? -3.281  14.928 13.955  1.00 78.81  ? 23  LYS A CE  1 
ATOM   161  N NZ  . LYS A 1 23  ? -3.804  15.007 15.344  1.00 80.10  ? 23  LYS A NZ  1 
ATOM   162  N N   . LEU A 1 24  ? -5.761  17.196 7.928   1.00 77.72  ? 24  LEU A N   1 
ATOM   163  C CA  . LEU A 1 24  ? -6.738  17.047 6.855   1.00 78.01  ? 24  LEU A CA  1 
ATOM   164  C C   . LEU A 1 24  ? -6.114  17.227 5.471   1.00 78.17  ? 24  LEU A C   1 
ATOM   165  O O   . LEU A 1 24  ? -6.281  16.374 4.591   1.00 78.15  ? 24  LEU A O   1 
ATOM   166  C CB  . LEU A 1 24  ? -7.868  18.060 7.044   1.00 78.01  ? 24  LEU A CB  1 
ATOM   167  C CG  . LEU A 1 24  ? -8.976  18.111 5.991   1.00 78.43  ? 24  LEU A CG  1 
ATOM   168  C CD1 . LEU A 1 24  ? -9.960  16.950 6.167   1.00 78.52  ? 24  LEU A CD1 1 
ATOM   169  C CD2 . LEU A 1 24  ? -9.693  19.458 6.057   1.00 78.70  ? 24  LEU A CD2 1 
ATOM   170  N N   . LEU A 1 25  ? -5.407  18.343 5.290   1.00 78.23  ? 25  LEU A N   1 
ATOM   171  C CA  . LEU A 1 25  ? -4.788  18.677 4.012   1.00 78.29  ? 25  LEU A CA  1 
ATOM   172  C C   . LEU A 1 25  ? -3.706  17.676 3.615   1.00 78.61  ? 25  LEU A C   1 
ATOM   173  O O   . LEU A 1 25  ? -3.620  17.287 2.451   1.00 78.77  ? 25  LEU A O   1 
ATOM   174  C CB  . LEU A 1 25  ? -4.233  20.103 4.026   1.00 78.10  ? 25  LEU A CB  1 
ATOM   175  C CG  . LEU A 1 25  ? -5.248  21.245 4.105   1.00 77.58  ? 25  LEU A CG  1 
ATOM   176  C CD1 . LEU A 1 25  ? -4.521  22.566 4.154   1.00 77.00  ? 25  LEU A CD1 1 
ATOM   177  C CD2 . LEU A 1 25  ? -6.214  21.215 2.933   1.00 77.02  ? 25  LEU A CD2 1 
ATOM   178  N N   . GLU A 1 26  ? -2.893  17.255 4.583   1.00 78.85  ? 26  GLU A N   1 
ATOM   179  C CA  . GLU A 1 26  ? -1.890  16.221 4.348   1.00 79.07  ? 26  GLU A CA  1 
ATOM   180  C C   . GLU A 1 26  ? -2.548  14.995 3.728   1.00 79.45  ? 26  GLU A C   1 
ATOM   181  O O   . GLU A 1 26  ? -2.119  14.523 2.676   1.00 79.49  ? 26  GLU A O   1 
ATOM   182  C CB  . GLU A 1 26  ? -1.176  15.849 5.646   1.00 78.82  ? 26  GLU A CB  1 
ATOM   183  C CG  . GLU A 1 26  ? -0.130  16.860 6.077   1.00 78.88  ? 26  GLU A CG  1 
ATOM   184  C CD  . GLU A 1 26  ? 0.220   16.765 7.551   1.00 79.07  ? 26  GLU A CD  1 
ATOM   185  O OE1 . GLU A 1 26  ? -0.033  15.710 8.168   1.00 79.73  ? 26  GLU A OE1 1 
ATOM   186  O OE2 . GLU A 1 26  ? 0.755   17.750 8.098   1.00 78.70  ? 26  GLU A OE2 1 
ATOM   187  N N   . LYS A 1 27  ? -3.608  14.512 4.374   1.00 79.93  ? 27  LYS A N   1 
ATOM   188  C CA  . LYS A 1 27  ? -4.372  13.356 3.903   1.00 80.45  ? 27  LYS A CA  1 
ATOM   189  C C   . LYS A 1 27  ? -4.928  13.574 2.486   1.00 80.61  ? 27  LYS A C   1 
ATOM   190  O O   . LYS A 1 27  ? -4.758  12.718 1.615   1.00 80.58  ? 27  LYS A O   1 
ATOM   191  C CB  . LYS A 1 27  ? -5.478  13.014 4.914   1.00 80.53  ? 27  LYS A CB  1 
ATOM   192  C CG  . LYS A 1 27  ? -6.395  11.841 4.557   1.00 81.52  ? 27  LYS A CG  1 
ATOM   193  C CD  . LYS A 1 27  ? -7.783  12.337 4.125   1.00 83.17  ? 27  LYS A CD  1 
ATOM   194  C CE  . LYS A 1 27  ? -8.880  11.325 4.467   1.00 83.66  ? 27  LYS A CE  1 
ATOM   195  N NZ  . LYS A 1 27  ? -10.251 11.898 4.310   1.00 83.99  ? 27  LYS A NZ  1 
ATOM   196  N N   . LYS A 1 28  ? -5.567  14.723 2.261   1.00 80.77  ? 28  LYS A N   1 
ATOM   197  C CA  . LYS A 1 28  ? -6.123  15.069 0.950   1.00 80.98  ? 28  LYS A CA  1 
ATOM   198  C C   . LYS A 1 28  ? -5.067  15.068 -0.152  1.00 80.91  ? 28  LYS A C   1 
ATOM   199  O O   . LYS A 1 28  ? -5.228  14.401 -1.179  1.00 80.98  ? 28  LYS A O   1 
ATOM   200  C CB  . LYS A 1 28  ? -6.815  16.434 0.989   1.00 81.06  ? 28  LYS A CB  1 
ATOM   201  C CG  . LYS A 1 28  ? -8.266  16.388 1.437   1.00 82.03  ? 28  LYS A CG  1 
ATOM   202  C CD  . LYS A 1 28  ? -9.142  17.287 0.563   1.00 83.50  ? 28  LYS A CD  1 
ATOM   203  C CE  . LYS A 1 28  ? -9.402  16.654 -0.812  1.00 84.21  ? 28  LYS A CE  1 
ATOM   204  N NZ  . LYS A 1 28  ? -10.297 17.485 -1.669  1.00 84.56  ? 28  LYS A NZ  1 
ATOM   205  N N   . LYS A 1 29  ? -3.989  15.817 0.075   1.00 80.70  ? 29  LYS A N   1 
ATOM   206  C CA  . LYS A 1 29  ? -2.930  15.995 -0.917  1.00 80.38  ? 29  LYS A CA  1 
ATOM   207  C C   . LYS A 1 29  ? -2.185  14.697 -1.219  1.00 80.29  ? 29  LYS A C   1 
ATOM   208  O O   . LYS A 1 29  ? -1.698  14.506 -2.333  1.00 80.40  ? 29  LYS A O   1 
ATOM   209  C CB  . LYS A 1 29  ? -1.963  17.106 -0.489  1.00 80.25  ? 29  LYS A CB  1 
ATOM   210  C CG  . LYS A 1 29  ? -2.623  18.469 -0.401  1.00 80.01  ? 29  LYS A CG  1 
ATOM   211  C CD  . LYS A 1 29  ? -1.623  19.601 -0.464  1.00 79.93  ? 29  LYS A CD  1 
ATOM   212  C CE  . LYS A 1 29  ? -2.328  20.923 -0.756  1.00 80.64  ? 29  LYS A CE  1 
ATOM   213  N NZ  . LYS A 1 29  ? -3.036  20.936 -2.077  1.00 80.60  ? 29  LYS A NZ  1 
ATOM   214  N N   . THR A 1 30  ? -2.113  13.810 -0.229  1.00 80.11  ? 30  THR A N   1 
ATOM   215  C CA  . THR A 1 30  ? -1.518  12.490 -0.408  1.00 80.01  ? 30  THR A CA  1 
ATOM   216  C C   . THR A 1 30  ? -2.387  11.644 -1.333  1.00 80.25  ? 30  THR A C   1 
ATOM   217  O O   . THR A 1 30  ? -1.875  10.887 -2.160  1.00 80.22  ? 30  THR A O   1 
ATOM   218  C CB  . THR A 1 30  ? -1.339  11.776 0.939   1.00 79.87  ? 30  THR A CB  1 
ATOM   219  O OG1 . THR A 1 30  ? -0.536  12.590 1.799   1.00 79.56  ? 30  THR A OG1 1 
ATOM   220  C CG2 . THR A 1 30  ? -0.659  10.427 0.757   1.00 79.71  ? 30  THR A CG2 1 
ATOM   221  N N   . GLU A 1 31  ? -3.702  11.785 -1.185  1.00 80.54  ? 31  GLU A N   1 
ATOM   222  C CA  . GLU A 1 31  ? -4.660  11.098 -2.046  1.00 80.86  ? 31  GLU A CA  1 
ATOM   223  C C   . GLU A 1 31  ? -4.557  11.631 -3.479  1.00 80.63  ? 31  GLU A C   1 
ATOM   224  O O   . GLU A 1 31  ? -4.360  10.853 -4.417  1.00 80.60  ? 31  GLU A O   1 
ATOM   225  C CB  . GLU A 1 31  ? -6.088  11.245 -1.500  1.00 81.11  ? 31  GLU A CB  1 
ATOM   226  C CG  . GLU A 1 31  ? -6.351  10.483 -0.192  1.00 82.59  ? 31  GLU A CG  1 
ATOM   227  C CD  . GLU A 1 31  ? -7.639  10.914 0.533   1.00 84.78  ? 31  GLU A CD  1 
ATOM   228  O OE1 . GLU A 1 31  ? -8.243  11.957 0.171   1.00 85.29  ? 31  GLU A OE1 1 
ATOM   229  O OE2 . GLU A 1 31  ? -8.044  10.200 1.481   1.00 85.45  ? 31  GLU A OE2 1 
ATOM   230  N N   . LEU A 1 32  ? -4.661  12.955 -3.627  1.00 80.35  ? 32  LEU A N   1 
ATOM   231  C CA  . LEU A 1 32  ? -4.538  13.636 -4.922  1.00 80.07  ? 32  LEU A CA  1 
ATOM   232  C C   . LEU A 1 32  ? -3.255  13.267 -5.660  1.00 79.96  ? 32  LEU A C   1 
ATOM   233  O O   . LEU A 1 32  ? -3.265  13.077 -6.877  1.00 79.94  ? 32  LEU A O   1 
ATOM   234  C CB  . LEU A 1 32  ? -4.599  15.162 -4.753  1.00 80.01  ? 32  LEU A CB  1 
ATOM   235  C CG  . LEU A 1 32  ? -5.850  15.851 -4.190  1.00 80.17  ? 32  LEU A CG  1 
ATOM   236  C CD1 . LEU A 1 32  ? -5.637  17.366 -4.119  1.00 79.90  ? 32  LEU A CD1 1 
ATOM   237  C CD2 . LEU A 1 32  ? -7.106  15.518 -4.994  1.00 80.00  ? 32  LEU A CD2 1 
ATOM   238  N N   . ALA A 1 33  ? -2.155  13.173 -4.919  1.00 79.88  ? 33  ALA A N   1 
ATOM   239  C CA  . ALA A 1 33  ? -0.865  12.832 -5.500  1.00 79.81  ? 33  ALA A CA  1 
ATOM   240  C C   . ALA A 1 33  ? -0.811  11.366 -5.912  1.00 79.83  ? 33  ALA A C   1 
ATOM   241  O O   . ALA A 1 33  ? -0.076  11.007 -6.830  1.00 79.85  ? 33  ALA A O   1 
ATOM   242  C CB  . ALA A 1 33  ? 0.265   13.160 -4.537  1.00 79.70  ? 33  ALA A CB  1 
ATOM   243  N N   . GLN A 1 34  ? -1.592  10.524 -5.240  1.00 79.88  ? 34  GLN A N   1 
ATOM   244  C CA  . GLN A 1 34  ? -1.587  9.096  -5.534  1.00 79.95  ? 34  GLN A CA  1 
ATOM   245  C C   . GLN A 1 34  ? -2.305  8.817  -6.844  1.00 79.83  ? 34  GLN A C   1 
ATOM   246  O O   . GLN A 1 34  ? -1.868  7.978  -7.633  1.00 79.81  ? 34  GLN A O   1 
ATOM   247  C CB  . GLN A 1 34  ? -2.204  8.291  -4.387  1.00 80.12  ? 34  GLN A CB  1 
ATOM   248  C CG  . GLN A 1 34  ? -1.782  6.819  -4.370  1.00 80.89  ? 34  GLN A CG  1 
ATOM   249  C CD  . GLN A 1 34  ? -0.269  6.639  -4.376  1.00 81.97  ? 34  GLN A CD  1 
ATOM   250  O OE1 . GLN A 1 34  ? 0.438   7.183  -3.521  1.00 82.67  ? 34  GLN A OE1 1 
ATOM   251  N NE2 . GLN A 1 34  ? 0.236   5.878  -5.346  1.00 82.16  ? 34  GLN A NE2 1 
ATOM   252  N N   . LYS A 1 35  ? -3.401  9.538  -7.069  1.00 79.79  ? 35  LYS A N   1 
ATOM   253  C CA  . LYS A 1 35  ? -4.129  9.486  -8.335  1.00 79.85  ? 35  LYS A CA  1 
ATOM   254  C C   . LYS A 1 35  ? -3.279  10.051 -9.470  1.00 79.48  ? 35  LYS A C   1 
ATOM   255  O O   . LYS A 1 35  ? -3.331  9.560  -10.596 1.00 79.61  ? 35  LYS A O   1 
ATOM   256  C CB  . LYS A 1 35  ? -5.457  10.249 -8.237  1.00 79.97  ? 35  LYS A CB  1 
ATOM   257  C CG  . LYS A 1 35  ? -6.504  9.572  -7.354  1.00 81.21  ? 35  LYS A CG  1 
ATOM   258  C CD  . LYS A 1 35  ? -7.859  10.273 -7.445  1.00 83.09  ? 35  LYS A CD  1 
ATOM   259  C CE  . LYS A 1 35  ? -8.953  9.464  -6.746  1.00 84.27  ? 35  LYS A CE  1 
ATOM   260  N NZ  . LYS A 1 35  ? -10.328 9.952  -7.084  1.00 85.12  ? 35  LYS A NZ  1 
ATOM   261  N N   . ALA A 1 36  ? -2.494  11.079 -9.160  1.00 78.99  ? 36  ALA A N   1 
ATOM   262  C CA  . ALA A 1 36  ? -1.595  11.688 -10.131 1.00 78.64  ? 36  ALA A CA  1 
ATOM   263  C C   . ALA A 1 36  ? -0.448  10.748 -10.531 1.00 78.45  ? 36  ALA A C   1 
ATOM   264  O O   . ALA A 1 36  ? 0.023   10.787 -11.670 1.00 78.32  ? 36  ALA A O   1 
ATOM   265  C CB  . ALA A 1 36  ? -1.058  13.000 -9.592  1.00 78.60  ? 36  ALA A CB  1 
ATOM   266  N N   . ARG A 1 37  ? -0.006  9.913  -9.591  1.00 78.21  ? 37  ARG A N   1 
ATOM   267  C CA  . ARG A 1 37  ? 1.013   8.901  -9.865  1.00 78.05  ? 37  ARG A CA  1 
ATOM   268  C C   . ARG A 1 37  ? 0.445   7.835  -10.795 1.00 78.18  ? 37  ARG A C   1 
ATOM   269  O O   . ARG A 1 37  ? 1.152   7.304  -11.653 1.00 78.27  ? 37  ARG A O   1 
ATOM   270  C CB  . ARG A 1 37  ? 1.529   8.269  -8.568  1.00 77.92  ? 37  ARG A CB  1 
ATOM   271  C CG  . ARG A 1 37  ? 2.258   9.246  -7.650  1.00 77.65  ? 37  ARG A CG  1 
ATOM   272  C CD  . ARG A 1 37  ? 2.818   8.564  -6.413  1.00 77.15  ? 37  ARG A CD  1 
ATOM   273  N NE  . ARG A 1 37  ? 4.259   8.334  -6.516  1.00 77.07  ? 37  ARG A NE  1 
ATOM   274  C CZ  . ARG A 1 37  ? 5.190   9.142  -6.010  1.00 76.91  ? 37  ARG A CZ  1 
ATOM   275  N NH1 . ARG A 1 37  ? 4.844   10.243 -5.356  1.00 76.68  ? 37  ARG A NH1 1 
ATOM   276  N NH2 . ARG A 1 37  ? 6.476   8.852  -6.157  1.00 76.97  ? 37  ARG A NH2 1 
ATOM   277  N N   . LYS A 1 38  ? -0.841  7.537  -10.620 1.00 78.23  ? 38  LYS A N   1 
ATOM   278  C CA  . LYS A 1 38  ? -1.551  6.613  -11.493 1.00 78.20  ? 38  LYS A CA  1 
ATOM   279  C C   . LYS A 1 38  ? -1.737  7.211  -12.890 1.00 78.10  ? 38  LYS A C   1 
ATOM   280  O O   . LYS A 1 38  ? -1.571  6.505  -13.886 1.00 78.16  ? 38  LYS A O   1 
ATOM   281  C CB  . LYS A 1 38  ? -2.895  6.215  -10.877 1.00 78.29  ? 38  LYS A CB  1 
ATOM   282  C CG  . LYS A 1 38  ? -3.574  5.016  -11.536 1.00 78.98  ? 38  LYS A CG  1 
ATOM   283  C CD  . LYS A 1 38  ? -4.617  5.446  -12.569 1.00 80.57  ? 38  LYS A CD  1 
ATOM   284  C CE  . LYS A 1 38  ? -5.260  4.241  -13.260 1.00 81.43  ? 38  LYS A CE  1 
ATOM   285  N NZ  . LYS A 1 38  ? -4.286  3.477  -14.104 1.00 81.97  ? 38  LYS A NZ  1 
ATOM   286  N N   A GLU A 1 39  ? -2.076  8.500  -12.956 0.50 78.01  ? 39  GLU A N   1 
ATOM   287  N N   B GLU A 1 39  ? -2.074  8.498  -12.950 0.50 78.02  ? 39  GLU A N   1 
ATOM   288  C CA  A GLU A 1 39  ? -2.258  9.193  -14.235 0.50 77.98  ? 39  GLU A CA  1 
ATOM   289  C CA  B GLU A 1 39  ? -2.266  9.205  -14.217 0.50 77.98  ? 39  GLU A CA  1 
ATOM   290  C C   A GLU A 1 39  ? -0.965  9.209  -15.046 0.50 77.98  ? 39  GLU A C   1 
ATOM   291  C C   B GLU A 1 39  ? -0.976  9.275  -15.040 0.50 77.99  ? 39  GLU A C   1 
ATOM   292  O O   A GLU A 1 39  ? -0.989  9.081  -16.270 0.50 78.07  ? 39  GLU A O   1 
ATOM   293  O O   B GLU A 1 39  ? -1.016  9.236  -16.270 0.50 78.07  ? 39  GLU A O   1 
ATOM   294  C CB  A GLU A 1 39  ? -2.755  10.628 -14.032 0.50 77.96  ? 39  GLU A CB  1 
ATOM   295  C CB  B GLU A 1 39  ? -2.844  10.604 -13.973 0.50 77.97  ? 39  GLU A CB  1 
ATOM   296  C CG  A GLU A 1 39  ? -3.205  11.300 -15.328 0.50 78.03  ? 39  GLU A CG  1 
ATOM   297  C CG  B GLU A 1 39  ? -4.331  10.603 -13.625 0.50 78.05  ? 39  GLU A CG  1 
ATOM   298  C CD  A GLU A 1 39  ? -3.063  12.814 -15.308 0.50 78.16  ? 39  GLU A CD  1 
ATOM   299  C CD  B GLU A 1 39  ? -4.787  11.876 -12.929 0.50 78.28  ? 39  GLU A CD  1 
ATOM   300  O OE1 A GLU A 1 39  ? -2.307  13.343 -14.463 0.50 78.10  ? 39  GLU A OE1 1 
ATOM   301  O OE1 B GLU A 1 39  ? -3.981  12.824 -12.815 0.50 78.28  ? 39  GLU A OE1 1 
ATOM   302  O OE2 A GLU A 1 39  ? -3.704  13.476 -16.153 0.50 78.23  ? 39  GLU A OE2 1 
ATOM   303  O OE2 B GLU A 1 39  ? -5.957  11.929 -12.491 0.50 78.43  ? 39  GLU A OE2 1 
ATOM   304  N N   . ILE A 1 40  ? 0.160   9.362  -14.352 1.00 77.97  ? 40  ILE A N   1 
ATOM   305  C CA  . ILE A 1 40  ? 1.469   9.373  -14.996 1.00 77.77  ? 40  ILE A CA  1 
ATOM   306  C C   . ILE A 1 40  ? 1.866   7.979  -15.458 1.00 77.86  ? 40  ILE A C   1 
ATOM   307  O O   . ILE A 1 40  ? 2.475   7.821  -16.516 1.00 77.90  ? 40  ILE A O   1 
ATOM   308  C CB  . ILE A 1 40  ? 2.526   10.026 -14.085 1.00 77.70  ? 40  ILE A CB  1 
ATOM   309  C CG1 . ILE A 1 40  ? 2.534   11.525 -14.359 1.00 77.44  ? 40  ILE A CG1 1 
ATOM   310  C CG2 . ILE A 1 40  ? 3.924   9.447  -14.321 1.00 77.54  ? 40  ILE A CG2 1 
ATOM   311  C CD1 . ILE A 1 40  ? 2.793   12.357 -13.171 1.00 77.48  ? 40  ILE A CD1 1 
ATOM   312  N N   . ALA A 1 41  ? 1.493   6.971  -14.677 1.00 78.03  ? 41  ALA A N   1 
ATOM   313  C CA  . ALA A 1 41  ? 1.700   5.580  -15.068 1.00 78.33  ? 41  ALA A CA  1 
ATOM   314  C C   . ALA A 1 41  ? 1.049   5.306  -16.423 1.00 78.62  ? 41  ALA A C   1 
ATOM   315  O O   . ALA A 1 41  ? 1.595   4.562  -17.239 1.00 78.61  ? 41  ALA A O   1 
ATOM   316  C CB  . ALA A 1 41  ? 1.142   4.648  -14.015 1.00 78.27  ? 41  ALA A CB  1 
ATOM   317  N N   . ASP A 1 42  ? -0.113  5.920  -16.650 1.00 78.96  ? 42  ASP A N   1 
ATOM   318  C CA  . ASP A 1 42  ? -0.831  5.810  -17.917 1.00 79.30  ? 42  ASP A CA  1 
ATOM   319  C C   . ASP A 1 42  ? -0.064  6.475  -19.055 1.00 79.55  ? 42  ASP A C   1 
ATOM   320  O O   . ASP A 1 42  ? -0.028  5.948  -20.171 1.00 79.62  ? 42  ASP A O   1 
ATOM   321  C CB  . ASP A 1 42  ? -2.244  6.401  -17.806 1.00 79.23  ? 42  ASP A CB  1 
ATOM   322  C CG  . ASP A 1 42  ? -3.174  5.559  -16.933 1.00 79.45  ? 42  ASP A CG  1 
ATOM   323  O OD1 . ASP A 1 42  ? -2.866  4.370  -16.674 1.00 79.08  ? 42  ASP A OD1 1 
ATOM   324  O OD2 . ASP A 1 42  ? -4.224  6.094  -16.507 1.00 79.50  ? 42  ASP A OD2 1 
ATOM   325  N N   . TYR A 1 43  ? 0.545   7.627  -18.769 1.00 79.79  ? 43  TYR A N   1 
ATOM   326  C CA  . TYR A 1 43  ? 1.385   8.309  -19.749 1.00 80.07  ? 43  TYR A CA  1 
ATOM   327  C C   . TYR A 1 43  ? 2.636   7.496  -20.059 1.00 80.38  ? 43  TYR A C   1 
ATOM   328  O O   . TYR A 1 43  ? 3.008   7.363  -21.216 1.00 80.47  ? 43  TYR A O   1 
ATOM   329  C CB  . TYR A 1 43  ? 1.784   9.710  -19.282 1.00 80.04  ? 43  TYR A CB  1 
ATOM   330  C CG  . TYR A 1 43  ? 0.663   10.724 -19.254 1.00 80.09  ? 43  TYR A CG  1 
ATOM   331  C CD1 . TYR A 1 43  ? -0.041  11.055 -20.409 1.00 80.50  ? 43  TYR A CD1 1 
ATOM   332  C CD2 . TYR A 1 43  ? 0.331   11.380 -18.075 1.00 80.44  ? 43  TYR A CD2 1 
ATOM   333  C CE1 . TYR A 1 43  ? -1.067  11.997 -20.381 1.00 80.63  ? 43  TYR A CE1 1 
ATOM   334  C CE2 . TYR A 1 43  ? -0.691  12.315 -18.034 1.00 80.72  ? 43  TYR A CE2 1 
ATOM   335  C CZ  . TYR A 1 43  ? -1.383  12.623 -19.190 1.00 80.73  ? 43  TYR A CZ  1 
ATOM   336  O OH  . TYR A 1 43  ? -2.391  13.558 -19.147 1.00 81.02  ? 43  TYR A OH  1 
ATOM   337  N N   . LEU A 1 44  ? 3.279   6.950  -19.029 1.00 80.73  ? 44  LEU A N   1 
ATOM   338  C CA  . LEU A 1 44  ? 4.504   6.169  -19.227 1.00 81.12  ? 44  LEU A CA  1 
ATOM   339  C C   . LEU A 1 44  ? 4.270   4.914  -20.067 1.00 81.45  ? 44  LEU A C   1 
ATOM   340  O O   . LEU A 1 44  ? 5.123   4.524  -20.868 1.00 81.50  ? 44  LEU A O   1 
ATOM   341  C CB  . LEU A 1 44  ? 5.151   5.796  -17.890 1.00 81.00  ? 44  LEU A CB  1 
ATOM   342  C CG  . LEU A 1 44  ? 5.833   6.888  -17.065 1.00 80.79  ? 44  LEU A CG  1 
ATOM   343  C CD1 . LEU A 1 44  ? 6.613   6.227  -15.948 1.00 81.05  ? 44  LEU A CD1 1 
ATOM   344  C CD2 . LEU A 1 44  ? 6.753   7.759  -17.904 1.00 80.18  ? 44  LEU A CD2 1 
ATOM   345  N N   . ALA A 1 45  ? 3.109   4.294  -19.875 1.00 81.87  ? 45  ALA A N   1 
ATOM   346  C CA  . ALA A 1 45  ? 2.703   3.142  -20.668 1.00 82.20  ? 45  ALA A CA  1 
ATOM   347  C C   . ALA A 1 45  ? 2.307   3.556  -22.080 1.00 82.51  ? 45  ALA A C   1 
ATOM   348  O O   . ALA A 1 45  ? 2.438   2.761  -23.012 1.00 82.61  ? 45  ALA A O   1 
ATOM   349  C CB  . ALA A 1 45  ? 1.553   2.410  -19.996 1.00 82.14  ? 45  ALA A CB  1 
ATOM   350  N N   . ALA A 1 46  ? 1.831   4.794  -22.236 1.00 82.79  ? 46  ALA A N   1 
ATOM   351  C CA  . ALA A 1 46  ? 1.327   5.260  -23.530 1.00 83.10  ? 46  ALA A CA  1 
ATOM   352  C C   . ALA A 1 46  ? 2.366   5.211  -24.669 1.00 83.39  ? 46  ALA A C   1 
ATOM   353  O O   . ALA A 1 46  ? 2.152   4.463  -25.624 1.00 83.76  ? 46  ALA A O   1 
ATOM   354  C CB  . ALA A 1 46  ? 0.628   6.615  -23.425 1.00 83.02  ? 46  ALA A CB  1 
ATOM   355  N N   . GLY A 1 47  ? 3.464   5.975  -24.635 1.00 83.47  ? 47  GLY A N   1 
ATOM   356  C CA  . GLY A 1 47  ? 3.747   7.109  -23.752 1.00 83.62  ? 47  GLY A CA  1 
ATOM   357  C C   . GLY A 1 47  ? 4.753   7.947  -24.525 1.00 83.72  ? 47  GLY A C   1 
ATOM   358  O O   . GLY A 1 47  ? 5.700   7.374  -25.058 1.00 83.80  ? 47  GLY A O   1 
ATOM   359  N N   . LYS A 1 48  ? 4.633   9.278  -24.603 1.00 83.89  ? 48  LYS A N   1 
ATOM   360  C CA  . LYS A 1 48  ? 3.886   10.206 -23.726 1.00 83.94  ? 48  LYS A CA  1 
ATOM   361  C C   . LYS A 1 48  ? 4.808   10.633 -22.578 1.00 83.94  ? 48  LYS A C   1 
ATOM   362  O O   . LYS A 1 48  ? 4.382   11.254 -21.600 1.00 83.99  ? 48  LYS A O   1 
ATOM   363  C CB  . LYS A 1 48  ? 2.528   9.670  -23.258 1.00 83.87  ? 48  LYS A CB  1 
ATOM   364  C CG  . LYS A 1 48  ? 1.457   9.637  -24.352 1.00 84.10  ? 48  LYS A CG  1 
ATOM   365  C CD  . LYS A 1 48  ? 0.415   10.726 -24.192 1.00 83.89  ? 48  LYS A CD  1 
ATOM   366  C CE  . LYS A 1 48  ? -0.867  10.343 -24.921 1.00 83.45  ? 48  LYS A CE  1 
ATOM   367  N NZ  . LYS A 1 48  ? -1.938  11.359 -24.721 1.00 83.56  ? 48  LYS A NZ  1 
ATOM   368  N N   . ASP A 1 49  ? 6.090   10.317 -22.758 1.00 83.86  ? 49  ASP A N   1 
ATOM   369  C CA  . ASP A 1 49  ? 7.142   10.525 -21.767 1.00 83.88  ? 49  ASP A CA  1 
ATOM   370  C C   . ASP A 1 49  ? 7.532   11.987 -21.546 1.00 83.83  ? 49  ASP A C   1 
ATOM   371  O O   . ASP A 1 49  ? 8.046   12.328 -20.480 1.00 83.83  ? 49  ASP A O   1 
ATOM   372  C CB  . ASP A 1 49  ? 8.383   9.706  -22.142 1.00 83.88  ? 49  ASP A CB  1 
ATOM   373  C CG  . ASP A 1 49  ? 8.151   8.209  -22.029 1.00 84.41  ? 49  ASP A CG  1 
ATOM   374  O OD1 . ASP A 1 49  ? 7.730   7.595  -23.028 1.00 85.30  ? 49  ASP A OD1 1 
ATOM   375  O OD2 . ASP A 1 49  ? 8.380   7.642  -20.942 1.00 84.79  ? 49  ASP A OD2 1 
ATOM   376  N N   . GLU A 1 50  ? 7.313   12.848 -22.538 1.00 83.70  ? 50  GLU A N   1 
ATOM   377  C CA  . GLU A 1 50  ? 7.577   14.270 -22.331 1.00 83.66  ? 50  GLU A CA  1 
ATOM   378  C C   . GLU A 1 50  ? 6.436   14.904 -21.532 1.00 83.34  ? 50  GLU A C   1 
ATOM   379  O O   . GLU A 1 50  ? 6.650   15.867 -20.794 1.00 83.37  ? 50  GLU A O   1 
ATOM   380  C CB  . GLU A 1 50  ? 7.881   15.021 -23.643 1.00 83.78  ? 50  GLU A CB  1 
ATOM   381  C CG  . GLU A 1 50  ? 6.678   15.377 -24.525 1.00 84.95  ? 50  GLU A CG  1 
ATOM   382  C CD  . GLU A 1 50  ? 6.904   16.638 -25.373 1.00 86.27  ? 50  GLU A CD  1 
ATOM   383  O OE1 . GLU A 1 50  ? 7.352   17.668 -24.821 1.00 86.19  ? 50  GLU A OE1 1 
ATOM   384  O OE2 . GLU A 1 50  ? 6.615   16.606 -26.591 1.00 86.80  ? 50  GLU A OE2 1 
ATOM   385  N N   . ARG A 1 51  ? 5.236   14.339 -21.670 1.00 82.93  ? 51  ARG A N   1 
ATOM   386  C CA  . ARG A 1 51  ? 4.080   14.749 -20.872 1.00 82.53  ? 51  ARG A CA  1 
ATOM   387  C C   . ARG A 1 51  ? 4.206   14.291 -19.423 1.00 81.90  ? 51  ARG A C   1 
ATOM   388  O O   . ARG A 1 51  ? 3.946   15.059 -18.497 1.00 81.80  ? 51  ARG A O   1 
ATOM   389  C CB  . ARG A 1 51  ? 2.784   14.222 -21.483 1.00 82.75  ? 51  ARG A CB  1 
ATOM   390  C CG  . ARG A 1 51  ? 2.145   15.192 -22.440 1.00 83.51  ? 51  ARG A CG  1 
ATOM   391  C CD  . ARG A 1 51  ? 1.084   14.521 -23.292 1.00 85.07  ? 51  ARG A CD  1 
ATOM   392  N NE  . ARG A 1 51  ? 0.592   15.439 -24.315 1.00 85.84  ? 51  ARG A NE  1 
ATOM   393  C CZ  . ARG A 1 51  ? 1.182   15.643 -25.491 1.00 86.34  ? 51  ARG A CZ  1 
ATOM   394  N NH1 . ARG A 1 51  ? 2.296   14.987 -25.815 1.00 86.19  ? 51  ARG A NH1 1 
ATOM   395  N NH2 . ARG A 1 51  ? 0.653   16.508 -26.345 1.00 86.56  ? 51  ARG A NH2 1 
ATOM   396  N N   . ALA A 1 52  ? 4.605   13.036 -19.242 1.00 81.21  ? 52  ALA A N   1 
ATOM   397  C CA  . ALA A 1 52  ? 4.909   12.498 -17.925 1.00 80.69  ? 52  ALA A CA  1 
ATOM   398  C C   . ALA A 1 52  ? 5.974   13.344 -17.220 1.00 80.32  ? 52  ALA A C   1 
ATOM   399  O O   . ALA A 1 52  ? 5.831   13.677 -16.044 1.00 80.28  ? 52  ALA A O   1 
ATOM   400  C CB  . ALA A 1 52  ? 5.359   11.052 -18.042 1.00 80.60  ? 52  ALA A CB  1 
ATOM   401  N N   . ARG A 1 53  ? 7.017   13.710 -17.962 1.00 79.84  ? 53  ARG A N   1 
ATOM   402  C CA  . ARG A 1 53  ? 8.142   14.483 -17.442 1.00 79.40  ? 53  ARG A CA  1 
ATOM   403  C C   . ARG A 1 53  ? 7.738   15.878 -16.955 1.00 79.10  ? 53  ARG A C   1 
ATOM   404  O O   . ARG A 1 53  ? 8.335   16.406 -16.015 1.00 79.06  ? 53  ARG A O   1 
ATOM   405  C CB  . ARG A 1 53  ? 9.243   14.578 -18.506 1.00 79.49  ? 53  ARG A CB  1 
ATOM   406  C CG  . ARG A 1 53  ? 10.592  15.064 -17.996 1.00 79.66  ? 53  ARG A CG  1 
ATOM   407  C CD  . ARG A 1 53  ? 11.732  14.638 -18.911 1.00 79.92  ? 53  ARG A CD  1 
ATOM   408  N NE  . ARG A 1 53  ? 12.098  13.231 -18.734 1.00 80.42  ? 53  ARG A NE  1 
ATOM   409  C CZ  . ARG A 1 53  ? 11.776  12.248 -19.574 1.00 80.89  ? 53  ARG A CZ  1 
ATOM   410  N NH1 . ARG A 1 53  ? 11.072  12.506 -20.674 1.00 81.01  ? 53  ARG A NH1 1 
ATOM   411  N NH2 . ARG A 1 53  ? 12.162  11.002 -19.315 1.00 80.57  ? 53  ARG A NH2 1 
ATOM   412  N N   . ILE A 1 54  ? 6.731   16.468 -17.593 1.00 78.75  ? 54  ILE A N   1 
ATOM   413  C CA  . ILE A 1 54  ? 6.246   17.793 -17.201 1.00 78.56  ? 54  ILE A CA  1 
ATOM   414  C C   . ILE A 1 54  ? 5.258   17.704 -16.036 1.00 78.47  ? 54  ILE A C   1 
ATOM   415  O O   . ILE A 1 54  ? 5.316   18.504 -15.098 1.00 78.41  ? 54  ILE A O   1 
ATOM   416  C CB  . ILE A 1 54  ? 5.602   18.551 -18.394 1.00 78.58  ? 54  ILE A CB  1 
ATOM   417  C CG1 . ILE A 1 54  ? 6.645   18.809 -19.490 1.00 78.79  ? 54  ILE A CG1 1 
ATOM   418  C CG2 . ILE A 1 54  ? 4.972   19.872 -17.934 1.00 78.19  ? 54  ILE A CG2 1 
ATOM   419  C CD1 . ILE A 1 54  ? 6.058   19.068 -20.873 1.00 78.93  ? 54  ILE A CD1 1 
ATOM   420  N N   . ARG A 1 55  ? 4.358   16.726 -16.102 1.00 78.37  ? 55  ARG A N   1 
ATOM   421  C CA  . ARG A 1 55  ? 3.296   16.578 -15.107 1.00 78.27  ? 55  ARG A CA  1 
ATOM   422  C C   . ARG A 1 55  ? 3.797   16.054 -13.768 1.00 77.84  ? 55  ARG A C   1 
ATOM   423  O O   . ARG A 1 55  ? 3.272   16.441 -12.726 1.00 78.00  ? 55  ARG A O   1 
ATOM   424  C CB  . ARG A 1 55  ? 2.163   15.697 -15.638 1.00 78.43  ? 55  ARG A CB  1 
ATOM   425  C CG  . ARG A 1 55  ? 1.317   16.391 -16.682 1.00 79.68  ? 55  ARG A CG  1 
ATOM   426  C CD  . ARG A 1 55  ? 0.155   15.535 -17.148 1.00 82.24  ? 55  ARG A CD  1 
ATOM   427  N NE  . ARG A 1 55  ? -0.831  16.327 -17.889 1.00 84.27  ? 55  ARG A NE  1 
ATOM   428  C CZ  . ARG A 1 55  ? -1.829  17.014 -17.327 1.00 85.45  ? 55  ARG A CZ  1 
ATOM   429  N NH1 . ARG A 1 55  ? -1.997  17.017 -16.005 1.00 86.04  ? 55  ARG A NH1 1 
ATOM   430  N NH2 . ARG A 1 55  ? -2.666  17.705 -18.091 1.00 85.51  ? 55  ARG A NH2 1 
ATOM   431  N N   . VAL A 1 56  ? 4.814   15.195 -13.793 1.00 77.26  ? 56  VAL A N   1 
ATOM   432  C CA  . VAL A 1 56  ? 5.359   14.611 -12.564 1.00 76.73  ? 56  VAL A CA  1 
ATOM   433  C C   . VAL A 1 56  ? 5.953   15.665 -11.619 1.00 76.68  ? 56  VAL A C   1 
ATOM   434  O O   . VAL A 1 56  ? 6.142   15.404 -10.431 1.00 76.79  ? 56  VAL A O   1 
ATOM   435  C CB  . VAL A 1 56  ? 6.368   13.464 -12.863 1.00 76.51  ? 56  VAL A CB  1 
ATOM   436  C CG1 . VAL A 1 56  ? 7.761   14.005 -13.106 1.00 76.41  ? 56  VAL A CG1 1 
ATOM   437  C CG2 . VAL A 1 56  ? 6.377   12.451 -11.740 1.00 76.10  ? 56  VAL A CG2 1 
ATOM   438  N N   . GLU A 1 57  ? 6.220   16.857 -12.153 1.00 76.47  ? 57  GLU A N   1 
ATOM   439  C CA  . GLU A 1 57  ? 6.722   17.985 -11.365 1.00 76.29  ? 57  GLU A CA  1 
ATOM   440  C C   . GLU A 1 57  ? 5.682   18.530 -10.391 1.00 76.31  ? 57  GLU A C   1 
ATOM   441  O O   . GLU A 1 57  ? 6.030   19.095 -9.350  1.00 76.38  ? 57  GLU A O   1 
ATOM   442  C CB  . GLU A 1 57  ? 7.192   19.104 -12.283 1.00 76.13  ? 57  GLU A CB  1 
ATOM   443  C CG  . GLU A 1 57  ? 8.420   18.748 -13.079 1.00 75.97  ? 57  GLU A CG  1 
ATOM   444  C CD  . GLU A 1 57  ? 8.711   19.738 -14.184 1.00 75.39  ? 57  GLU A CD  1 
ATOM   445  O OE1 . GLU A 1 57  ? 8.099   20.828 -14.193 1.00 74.47  ? 57  GLU A OE1 1 
ATOM   446  O OE2 . GLU A 1 57  ? 9.558   19.416 -15.047 1.00 75.30  ? 57  GLU A OE2 1 
ATOM   447  N N   . HIS A 1 58  ? 4.409   18.374 -10.742 1.00 76.18  ? 58  HIS A N   1 
ATOM   448  C CA  . HIS A 1 58  ? 3.321   18.717 -9.843  1.00 76.22  ? 58  HIS A CA  1 
ATOM   449  C C   . HIS A 1 58  ? 3.323   17.771 -8.639  1.00 76.09  ? 58  HIS A C   1 
ATOM   450  O O   . HIS A 1 58  ? 3.151   18.216 -7.502  1.00 76.18  ? 58  HIS A O   1 
ATOM   451  C CB  . HIS A 1 58  ? 1.981   18.667 -10.577 1.00 76.32  ? 58  HIS A CB  1 
ATOM   452  C CG  . HIS A 1 58  ? 0.790   18.804 -9.679  1.00 77.13  ? 58  HIS A CG  1 
ATOM   453  N ND1 . HIS A 1 58  ? 0.453   19.992 -9.063  1.00 77.50  ? 58  HIS A ND1 1 
ATOM   454  C CD2 . HIS A 1 58  ? -0.147  17.902 -9.298  1.00 77.52  ? 58  HIS A CD2 1 
ATOM   455  C CE1 . HIS A 1 58  ? -0.639  19.815 -8.341  1.00 78.02  ? 58  HIS A CE1 1 
ATOM   456  N NE2 . HIS A 1 58  ? -1.023  18.556 -8.465  1.00 78.22  ? 58  HIS A NE2 1 
ATOM   457  N N   . ILE A 1 59  ? 3.532   16.479 -8.897  1.00 75.69  ? 59  ILE A N   1 
ATOM   458  C CA  . ILE A 1 59  ? 3.621   15.474 -7.838  1.00 75.48  ? 59  ILE A CA  1 
ATOM   459  C C   . ILE A 1 59  ? 4.788   15.753 -6.895  1.00 75.40  ? 59  ILE A C   1 
ATOM   460  O O   . ILE A 1 59  ? 4.650   15.619 -5.683  1.00 75.41  ? 59  ILE A O   1 
ATOM   461  C CB  . ILE A 1 59  ? 3.751   14.042 -8.402  1.00 75.54  ? 59  ILE A CB  1 
ATOM   462  C CG1 . ILE A 1 59  ? 2.565   13.712 -9.310  1.00 75.34  ? 59  ILE A CG1 1 
ATOM   463  C CG2 . ILE A 1 59  ? 3.867   13.016 -7.266  1.00 75.29  ? 59  ILE A CG2 1 
ATOM   464  C CD1 . ILE A 1 59  ? 2.590   12.302 -9.849  1.00 75.24  ? 59  ILE A CD1 1 
ATOM   465  N N   . ILE A 1 60  ? 5.928   16.142 -7.456  1.00 75.39  ? 60  ILE A N   1 
ATOM   466  C CA  . ILE A 1 60  ? 7.086   16.541 -6.659  1.00 75.48  ? 60  ILE A CA  1 
ATOM   467  C C   . ILE A 1 60  ? 6.759   17.748 -5.768  1.00 75.72  ? 60  ILE A C   1 
ATOM   468  O O   . ILE A 1 60  ? 7.199   17.809 -4.618  1.00 75.77  ? 60  ILE A O   1 
ATOM   469  C CB  . ILE A 1 60  ? 8.331   16.816 -7.546  1.00 75.37  ? 60  ILE A CB  1 
ATOM   470  C CG1 . ILE A 1 60  ? 8.852   15.506 -8.142  1.00 75.12  ? 60  ILE A CG1 1 
ATOM   471  C CG2 . ILE A 1 60  ? 9.438   17.500 -6.745  1.00 75.16  ? 60  ILE A CG2 1 
ATOM   472  C CD1 . ILE A 1 60  ? 9.822   15.676 -9.288  1.00 74.82  ? 60  ILE A CD1 1 
ATOM   473  N N   . ARG A 1 61  ? 5.972   18.688 -6.292  1.00 75.96  ? 61  ARG A N   1 
ATOM   474  C CA  . ARG A 1 61  ? 5.589   19.879 -5.531  1.00 76.37  ? 61  ARG A CA  1 
ATOM   475  C C   . ARG A 1 61  ? 4.601   19.544 -4.410  1.00 76.01  ? 61  ARG A C   1 
ATOM   476  O O   . ARG A 1 61  ? 4.693   20.096 -3.311  1.00 76.03  ? 61  ARG A O   1 
ATOM   477  C CB  . ARG A 1 61  ? 5.017   20.963 -6.450  1.00 76.70  ? 61  ARG A CB  1 
ATOM   478  C CG  . ARG A 1 61  ? 5.306   22.390 -5.967  1.00 78.96  ? 61  ARG A CG  1 
ATOM   479  C CD  . ARG A 1 61  ? 4.855   23.472 -6.968  1.00 82.97  ? 61  ARG A CD  1 
ATOM   480  N NE  . ARG A 1 61  ? 5.450   23.326 -8.307  1.00 85.96  ? 61  ARG A NE  1 
ATOM   481  C CZ  . ARG A 1 61  ? 6.643   23.801 -8.677  1.00 87.31  ? 61  ARG A CZ  1 
ATOM   482  N NH1 . ARG A 1 61  ? 7.410   24.461 -7.812  1.00 87.82  ? 61  ARG A NH1 1 
ATOM   483  N NH2 . ARG A 1 61  ? 7.078   23.607 -9.922  1.00 87.48  ? 61  ARG A NH2 1 
ATOM   484  N N   . GLU A 1 62  ? 3.669   18.636 -4.700  1.00 75.61  ? 62  GLU A N   1 
ATOM   485  C CA  . GLU A 1 62  ? 2.671   18.183 -3.733  1.00 75.29  ? 62  GLU A CA  1 
ATOM   486  C C   . GLU A 1 62  ? 3.319   17.445 -2.572  1.00 74.78  ? 62  GLU A C   1 
ATOM   487  O O   . GLU A 1 62  ? 3.010   17.714 -1.415  1.00 74.88  ? 62  GLU A O   1 
ATOM   488  C CB  . GLU A 1 62  ? 1.636   17.276 -4.407  1.00 75.48  ? 62  GLU A CB  1 
ATOM   489  C CG  . GLU A 1 62  ? 0.621   18.013 -5.271  1.00 77.06  ? 62  GLU A CG  1 
ATOM   490  C CD  . GLU A 1 62  ? -0.453  18.726 -4.455  1.00 79.03  ? 62  GLU A CD  1 
ATOM   491  O OE1 . GLU A 1 62  ? -1.392  18.043 -3.978  1.00 79.50  ? 62  GLU A OE1 1 
ATOM   492  O OE2 . GLU A 1 62  ? -0.363  19.970 -4.307  1.00 79.82  ? 62  GLU A OE2 1 
ATOM   493  N N   . ASP A 1 63  ? 4.220   16.519 -2.893  1.00 74.11  ? 63  ASP A N   1 
ATOM   494  C CA  . ASP A 1 63  ? 4.931   15.733 -1.895  1.00 73.42  ? 63  ASP A CA  1 
ATOM   495  C C   . ASP A 1 63  ? 5.770   16.601 -0.963  1.00 73.25  ? 63  ASP A C   1 
ATOM   496  O O   . ASP A 1 63  ? 5.782   16.378 0.246   1.00 73.31  ? 63  ASP A O   1 
ATOM   497  C CB  . ASP A 1 63  ? 5.806   14.676 -2.570  1.00 73.25  ? 63  ASP A CB  1 
ATOM   498  C CG  . ASP A 1 63  ? 4.997   13.525 -3.155  1.00 73.14  ? 63  ASP A CG  1 
ATOM   499  O OD1 . ASP A 1 63  ? 3.748   13.550 -3.095  1.00 73.01  ? 63  ASP A OD1 1 
ATOM   500  O OD2 . ASP A 1 63  ? 5.618   12.582 -3.680  1.00 73.05  ? 63  ASP A OD2 1 
ATOM   501  N N   . TYR A 1 64  ? 6.464   17.589 -1.525  1.00 72.96  ? 64  TYR A N   1 
ATOM   502  C CA  . TYR A 1 64  ? 7.232   18.542 -0.726  1.00 72.73  ? 64  TYR A CA  1 
ATOM   503  C C   . TYR A 1 64  ? 6.316   19.337 0.200   1.00 72.39  ? 64  TYR A C   1 
ATOM   504  O O   . TYR A 1 64  ? 6.643   19.556 1.367   1.00 72.36  ? 64  TYR A O   1 
ATOM   505  C CB  . TYR A 1 64  ? 8.024   19.503 -1.620  1.00 72.91  ? 64  TYR A CB  1 
ATOM   506  C CG  . TYR A 1 64  ? 9.395   19.011 -2.047  1.00 73.64  ? 64  TYR A CG  1 
ATOM   507  C CD1 . TYR A 1 64  ? 10.030  17.956 -1.379  1.00 73.99  ? 64  TYR A CD1 1 
ATOM   508  C CD2 . TYR A 1 64  ? 10.074  19.626 -3.104  1.00 74.25  ? 64  TYR A CD2 1 
ATOM   509  C CE1 . TYR A 1 64  ? 11.290  17.512 -1.767  1.00 74.31  ? 64  TYR A CE1 1 
ATOM   510  C CE2 . TYR A 1 64  ? 11.341  19.191 -3.498  1.00 74.83  ? 64  TYR A CE2 1 
ATOM   511  C CZ  . TYR A 1 64  ? 11.942  18.133 -2.823  1.00 75.05  ? 64  TYR A CZ  1 
ATOM   512  O OH  . TYR A 1 64  ? 13.197  17.701 -3.203  1.00 75.61  ? 64  TYR A OH  1 
ATOM   513  N N   . LEU A 1 65  ? 5.173   19.760 -0.335  1.00 71.92  ? 65  LEU A N   1 
ATOM   514  C CA  . LEU A 1 65  ? 4.173   20.512 0.420   1.00 71.53  ? 65  LEU A CA  1 
ATOM   515  C C   . LEU A 1 65  ? 3.623   19.705 1.598   1.00 71.26  ? 65  LEU A C   1 
ATOM   516  O O   . LEU A 1 65  ? 3.402   20.252 2.680   1.00 71.42  ? 65  LEU A O   1 
ATOM   517  C CB  . LEU A 1 65  ? 3.033   20.957 -0.506  1.00 71.51  ? 65  LEU A CB  1 
ATOM   518  C CG  . LEU A 1 65  ? 1.861   21.787 0.031   1.00 71.39  ? 65  LEU A CG  1 
ATOM   519  C CD1 . LEU A 1 65  ? 2.334   23.010 0.804   1.00 71.22  ? 65  LEU A CD1 1 
ATOM   520  C CD2 . LEU A 1 65  ? 0.954   22.206 -1.118  1.00 71.39  ? 65  LEU A CD2 1 
ATOM   521  N N   . VAL A 1 66  ? 3.409   18.409 1.381   1.00 70.69  ? 66  VAL A N   1 
ATOM   522  C CA  . VAL A 1 66  ? 2.933   17.518 2.433   1.00 70.17  ? 66  VAL A CA  1 
ATOM   523  C C   . VAL A 1 66  ? 3.975   17.418 3.550   1.00 70.03  ? 66  VAL A C   1 
ATOM   524  O O   . VAL A 1 66  ? 3.637   17.553 4.729   1.00 70.06  ? 66  VAL A O   1 
ATOM   525  C CB  . VAL A 1 66  ? 2.558   16.119 1.877   1.00 70.09  ? 66  VAL A CB  1 
ATOM   526  C CG1 . VAL A 1 66  ? 2.339   15.110 3.006   1.00 69.91  ? 66  VAL A CG1 1 
ATOM   527  C CG2 . VAL A 1 66  ? 1.317   16.214 1.006   1.00 69.76  ? 66  VAL A CG2 1 
ATOM   528  N N   . GLU A 1 67  ? 5.235   17.207 3.166   1.00 69.65  ? 67  GLU A N   1 
ATOM   529  C CA  . GLU A 1 67  ? 6.355   17.157 4.110   1.00 69.34  ? 67  GLU A CA  1 
ATOM   530  C C   . GLU A 1 67  ? 6.497   18.465 4.887   1.00 69.18  ? 67  GLU A C   1 
ATOM   531  O O   . GLU A 1 67  ? 6.920   18.463 6.040   1.00 69.10  ? 67  GLU A O   1 
ATOM   532  C CB  . GLU A 1 67  ? 7.665   16.860 3.378   1.00 69.24  ? 67  GLU A CB  1 
ATOM   533  C CG  . GLU A 1 67  ? 7.756   15.483 2.744   1.00 69.16  ? 67  GLU A CG  1 
ATOM   534  C CD  . GLU A 1 67  ? 8.992   15.312 1.862   1.00 69.65  ? 67  GLU A CD  1 
ATOM   535  O OE1 . GLU A 1 67  ? 9.889   16.187 1.877   1.00 69.22  ? 67  GLU A OE1 1 
ATOM   536  O OE2 . GLU A 1 67  ? 9.070   14.291 1.147   1.00 69.91  ? 67  GLU A OE2 1 
ATOM   537  N N   . ALA A 1 68  ? 6.144   19.573 4.243   1.00 69.10  ? 68  ALA A N   1 
ATOM   538  C CA  . ALA A 1 68  ? 6.235   20.892 4.852   1.00 69.20  ? 68  ALA A CA  1 
ATOM   539  C C   . ALA A 1 68  ? 5.128   21.098 5.890   1.00 69.34  ? 68  ALA A C   1 
ATOM   540  O O   . ALA A 1 68  ? 5.365   21.675 6.956   1.00 69.54  ? 68  ALA A O   1 
ATOM   541  C CB  . ALA A 1 68  ? 6.187   21.973 3.784   1.00 69.07  ? 68  ALA A CB  1 
ATOM   542  N N   . MET A 1 69  ? 3.927   20.620 5.574   1.00 69.23  ? 69  MET A N   1 
ATOM   543  C CA  . MET A 1 69  ? 2.805   20.646 6.509   1.00 69.12  ? 69  MET A CA  1 
ATOM   544  C C   . MET A 1 69  ? 3.050   19.734 7.714   1.00 69.03  ? 69  MET A C   1 
ATOM   545  O O   . MET A 1 69  ? 2.591   20.025 8.818   1.00 68.98  ? 69  MET A O   1 
ATOM   546  C CB  . MET A 1 69  ? 1.515   20.249 5.801   1.00 69.10  ? 69  MET A CB  1 
ATOM   547  C CG  . MET A 1 69  ? 1.002   21.302 4.839   1.00 69.61  ? 69  MET A CG  1 
ATOM   548  S SD  . MET A 1 69  ? -0.503  20.781 3.990   1.00 71.35  ? 69  MET A SD  1 
ATOM   549  C CE  . MET A 1 69  ? -1.009  22.321 3.214   1.00 71.42  ? 69  MET A CE  1 
ATOM   550  N N   . GLU A 1 70  ? 3.769   18.635 7.494   1.00 68.96  ? 70  GLU A N   1 
ATOM   551  C CA  . GLU A 1 70  ? 4.164   17.726 8.569   1.00 68.94  ? 70  GLU A CA  1 
ATOM   552  C C   . GLU A 1 70  ? 5.089   18.428 9.550   1.00 68.96  ? 70  GLU A C   1 
ATOM   553  O O   . GLU A 1 70  ? 4.854   18.404 10.756  1.00 68.84  ? 70  GLU A O   1 
ATOM   554  C CB  . GLU A 1 70  ? 4.863   16.491 8.007   1.00 68.90  ? 70  GLU A CB  1 
ATOM   555  C CG  . GLU A 1 70  ? 3.930   15.469 7.370   1.00 69.11  ? 70  GLU A CG  1 
ATOM   556  C CD  . GLU A 1 70  ? 4.678   14.346 6.667   1.00 69.24  ? 70  GLU A CD  1 
ATOM   557  O OE1 . GLU A 1 70  ? 4.014   13.439 6.129   1.00 69.54  ? 70  GLU A OE1 1 
ATOM   558  O OE2 . GLU A 1 70  ? 5.928   14.363 6.652   1.00 69.42  ? 70  GLU A OE2 1 
ATOM   559  N N   . ILE A 1 71  ? 6.137   19.052 9.016   1.00 69.08  ? 71  ILE A N   1 
ATOM   560  C CA  . ILE A 1 71  ? 7.098   19.814 9.811   1.00 69.25  ? 71  ILE A CA  1 
ATOM   561  C C   . ILE A 1 71  ? 6.400   20.909 10.628  1.00 69.48  ? 71  ILE A C   1 
ATOM   562  O O   . ILE A 1 71  ? 6.675   21.076 11.818  1.00 69.62  ? 71  ILE A O   1 
ATOM   563  C CB  . ILE A 1 71  ? 8.232   20.402 8.921   1.00 69.24  ? 71  ILE A CB  1 
ATOM   564  C CG1 . ILE A 1 71  ? 9.098   19.273 8.349   1.00 68.84  ? 71  ILE A CG1 1 
ATOM   565  C CG2 . ILE A 1 71  ? 9.090   21.399 9.703   1.00 69.16  ? 71  ILE A CG2 1 
ATOM   566  C CD1 . ILE A 1 71  ? 10.154  19.724 7.371   1.00 68.20  ? 71  ILE A CD1 1 
ATOM   567  N N   . LEU A 1 72  ? 5.489   21.638 9.992   1.00 69.60  ? 72  LEU A N   1 
ATOM   568  C CA  . LEU A 1 72  ? 4.696   22.644 10.686  1.00 69.79  ? 72  LEU A CA  1 
ATOM   569  C C   . LEU A 1 72  ? 3.889   22.044 11.839  1.00 70.19  ? 72  LEU A C   1 
ATOM   570  O O   . LEU A 1 72  ? 3.885   22.586 12.945  1.00 70.28  ? 72  LEU A O   1 
ATOM   571  C CB  . LEU A 1 72  ? 3.782   23.371 9.701   1.00 69.56  ? 72  LEU A CB  1 
ATOM   572  C CG  . LEU A 1 72  ? 4.136   24.802 9.291   1.00 69.29  ? 72  LEU A CG  1 
ATOM   573  C CD1 . LEU A 1 72  ? 5.634   25.062 9.193   1.00 68.53  ? 72  LEU A CD1 1 
ATOM   574  C CD2 . LEU A 1 72  ? 3.449   25.121 7.984   1.00 69.07  ? 72  LEU A CD2 1 
ATOM   575  N N   . GLU A 1 73  ? 3.226   20.919 11.573  1.00 70.64  ? 73  GLU A N   1 
ATOM   576  C CA  . GLU A 1 73  ? 2.436   20.194 12.573  1.00 71.08  ? 73  GLU A CA  1 
ATOM   577  C C   . GLU A 1 73  ? 3.301   19.805 13.773  1.00 71.29  ? 73  GLU A C   1 
ATOM   578  O O   . GLU A 1 73  ? 2.899   20.001 14.917  1.00 71.34  ? 73  GLU A O   1 
ATOM   579  C CB  . GLU A 1 73  ? 1.810   18.957 11.930  1.00 71.11  ? 73  GLU A CB  1 
ATOM   580  C CG  . GLU A 1 73  ? 0.709   18.273 12.712  1.00 71.75  ? 73  GLU A CG  1 
ATOM   581  C CD  . GLU A 1 73  ? 0.293   16.963 12.056  1.00 73.51  ? 73  GLU A CD  1 
ATOM   582  O OE1 . GLU A 1 73  ? -0.133  16.990 10.882  1.00 74.30  ? 73  GLU A OE1 1 
ATOM   583  O OE2 . GLU A 1 73  ? 0.401   15.900 12.703  1.00 74.55  ? 73  GLU A OE2 1 
ATOM   584  N N   . LEU A 1 74  ? 4.489   19.268 13.498  1.00 71.58  ? 74  LEU A N   1 
ATOM   585  C CA  . LEU A 1 74  ? 5.482   18.972 14.526  1.00 72.01  ? 74  LEU A CA  1 
ATOM   586  C C   . LEU A 1 74  ? 5.761   20.180 15.403  1.00 72.42  ? 74  LEU A C   1 
ATOM   587  O O   . LEU A 1 74  ? 5.809   20.066 16.626  1.00 72.57  ? 74  LEU A O   1 
ATOM   588  C CB  . LEU A 1 74  ? 6.796   18.536 13.887  1.00 71.90  ? 74  LEU A CB  1 
ATOM   589  C CG  . LEU A 1 74  ? 6.833   17.188 13.187  1.00 72.11  ? 74  LEU A CG  1 
ATOM   590  C CD1 . LEU A 1 74  ? 8.063   17.105 12.308  1.00 72.12  ? 74  LEU A CD1 1 
ATOM   591  C CD2 . LEU A 1 74  ? 6.832   16.085 14.216  1.00 72.46  ? 74  LEU A CD2 1 
ATOM   592  N N   . TYR A 1 75  ? 5.953   21.332 14.769  1.00 72.89  ? 75  TYR A N   1 
ATOM   593  C CA  . TYR A 1 75  ? 6.256   22.561 15.484  1.00 73.45  ? 75  TYR A CA  1 
ATOM   594  C C   . TYR A 1 75  ? 5.094   23.055 16.342  1.00 73.96  ? 75  TYR A C   1 
ATOM   595  O O   . TYR A 1 75  ? 5.314   23.617 17.412  1.00 74.11  ? 75  TYR A O   1 
ATOM   596  C CB  . TYR A 1 75  ? 6.718   23.649 14.516  1.00 73.43  ? 75  TYR A CB  1 
ATOM   597  C CG  . TYR A 1 75  ? 8.100   23.419 13.944  1.00 73.14  ? 75  TYR A CG  1 
ATOM   598  C CD1 . TYR A 1 75  ? 9.069   22.717 14.663  1.00 73.11  ? 75  TYR A CD1 1 
ATOM   599  C CD2 . TYR A 1 75  ? 8.447   23.928 12.698  1.00 72.90  ? 75  TYR A CD2 1 
ATOM   600  C CE1 . TYR A 1 75  ? 10.341  22.512 14.143  1.00 72.91  ? 75  TYR A CE1 1 
ATOM   601  C CE2 . TYR A 1 75  ? 9.715   23.733 12.174  1.00 72.81  ? 75  TYR A CE2 1 
ATOM   602  C CZ  . TYR A 1 75  ? 10.653  23.026 12.900  1.00 72.94  ? 75  TYR A CZ  1 
ATOM   603  O OH  . TYR A 1 75  ? 11.906  22.834 12.377  1.00 73.59  ? 75  TYR A OH  1 
ATOM   604  N N   . CYS A 1 76  ? 3.867   22.843 15.872  1.00 74.51  ? 76  CYS A N   1 
ATOM   605  C CA  . CYS A 1 76  ? 2.677   23.104 16.680  1.00 75.13  ? 76  CYS A CA  1 
ATOM   606  C C   . CYS A 1 76  ? 2.580   22.134 17.849  1.00 75.69  ? 76  CYS A C   1 
ATOM   607  O O   . CYS A 1 76  ? 2.166   22.516 18.946  1.00 75.87  ? 76  CYS A O   1 
ATOM   608  C CB  . CYS A 1 76  ? 1.421   22.988 15.835  1.00 74.96  ? 76  CYS A CB  1 
ATOM   609  S SG  . CYS A 1 76  ? 1.299   24.243 14.586  1.00 75.03  ? 76  CYS A SG  1 
ATOM   610  N N   . ASP A 1 77  ? 2.953   20.881 17.601  1.00 76.37  ? 77  ASP A N   1 
ATOM   611  C CA  . ASP A 1 77  ? 2.973   19.851 18.631  1.00 77.12  ? 77  ASP A CA  1 
ATOM   612  C C   . ASP A 1 77  ? 3.955   20.226 19.736  1.00 77.87  ? 77  ASP A C   1 
ATOM   613  O O   . ASP A 1 77  ? 3.608   20.178 20.914  1.00 78.08  ? 77  ASP A O   1 
ATOM   614  C CB  . ASP A 1 77  ? 3.345   18.483 18.040  1.00 76.97  ? 77  ASP A CB  1 
ATOM   615  C CG  . ASP A 1 77  ? 2.199   17.827 17.278  1.00 76.70  ? 77  ASP A CG  1 
ATOM   616  O OD1 . ASP A 1 77  ? 1.023   18.196 17.487  1.00 76.05  ? 77  ASP A OD1 1 
ATOM   617  O OD2 . ASP A 1 77  ? 2.483   16.921 16.465  1.00 76.43  ? 77  ASP A OD2 1 
ATOM   618  N N   . LEU A 1 78  ? 5.167   20.616 19.348  1.00 78.73  ? 78  LEU A N   1 
ATOM   619  C CA  . LEU A 1 78  ? 6.216   20.954 20.307  1.00 79.59  ? 78  LEU A CA  1 
ATOM   620  C C   . LEU A 1 78  ? 5.957   22.268 21.053  1.00 80.30  ? 78  LEU A C   1 
ATOM   621  O O   . LEU A 1 78  ? 6.383   22.418 22.202  1.00 80.57  ? 78  LEU A O   1 
ATOM   622  C CB  . LEU A 1 78  ? 7.592   20.952 19.634  1.00 79.54  ? 78  LEU A CB  1 
ATOM   623  C CG  . LEU A 1 78  ? 8.812   21.185 20.527  1.00 79.60  ? 78  LEU A CG  1 
ATOM   624  C CD1 . LEU A 1 78  ? 9.902   20.146 20.296  1.00 79.84  ? 78  LEU A CD1 1 
ATOM   625  C CD2 . LEU A 1 78  ? 9.337   22.586 20.309  1.00 79.81  ? 78  LEU A CD2 1 
ATOM   626  N N   . LEU A 1 79  ? 5.263   23.209 20.414  1.00 80.99  ? 79  LEU A N   1 
ATOM   627  C CA  . LEU A 1 79  ? 4.838   24.432 21.101  1.00 81.75  ? 79  LEU A CA  1 
ATOM   628  C C   . LEU A 1 79  ? 3.789   24.138 22.172  1.00 82.43  ? 79  LEU A C   1 
ATOM   629  O O   . LEU A 1 79  ? 3.913   24.594 23.304  1.00 82.48  ? 79  LEU A O   1 
ATOM   630  C CB  . LEU A 1 79  ? 4.316   25.491 20.121  1.00 81.63  ? 79  LEU A CB  1 
ATOM   631  C CG  . LEU A 1 79  ? 5.318   26.312 19.301  1.00 81.32  ? 79  LEU A CG  1 
ATOM   632  C CD1 . LEU A 1 79  ? 4.661   27.606 18.845  1.00 80.55  ? 79  LEU A CD1 1 
ATOM   633  C CD2 . LEU A 1 79  ? 6.602   26.608 20.075  1.00 81.11  ? 79  LEU A CD2 1 
ATOM   634  N N   . LEU A 1 80  ? 2.770   23.364 21.812  1.00 83.33  ? 80  LEU A N   1 
ATOM   635  C CA  . LEU A 1 80  ? 1.730   22.977 22.756  1.00 84.26  ? 80  LEU A CA  1 
ATOM   636  C C   . LEU A 1 80  ? 2.270   22.111 23.894  1.00 85.28  ? 80  LEU A C   1 
ATOM   637  O O   . LEU A 1 80  ? 1.766   22.171 25.017  1.00 85.40  ? 80  LEU A O   1 
ATOM   638  C CB  . LEU A 1 80  ? 0.590   22.259 22.034  1.00 84.00  ? 80  LEU A CB  1 
ATOM   639  C CG  . LEU A 1 80  ? -0.374  23.125 21.220  1.00 83.70  ? 80  LEU A CG  1 
ATOM   640  C CD1 . LEU A 1 80  ? -1.285  22.248 20.395  1.00 83.22  ? 80  LEU A CD1 1 
ATOM   641  C CD2 . LEU A 1 80  ? -1.196  24.045 22.113  1.00 83.37  ? 80  LEU A CD2 1 
ATOM   642  N N   . ALA A 1 81  ? 3.298   21.316 23.600  1.00 86.55  ? 81  ALA A N   1 
ATOM   643  C CA  . ALA A 1 81  ? 3.900   20.419 24.588  1.00 87.78  ? 81  ALA A CA  1 
ATOM   644  C C   . ALA A 1 81  ? 4.680   21.183 25.650  1.00 88.79  ? 81  ALA A C   1 
ATOM   645  O O   . ALA A 1 81  ? 4.766   20.743 26.799  1.00 89.01  ? 81  ALA A O   1 
ATOM   646  C CB  . ALA A 1 81  ? 4.796   19.392 23.910  1.00 87.65  ? 81  ALA A CB  1 
ATOM   647  N N   . ARG A 1 82  ? 5.252   22.318 25.256  1.00 89.96  ? 82  ARG A N   1 
ATOM   648  C CA  . ARG A 1 82  ? 5.983   23.178 26.182  1.00 91.22  ? 82  ARG A CA  1 
ATOM   649  C C   . ARG A 1 82  ? 5.311   24.550 26.252  1.00 91.96  ? 82  ARG A C   1 
ATOM   650  O O   . ARG A 1 82  ? 5.977   25.590 26.230  1.00 91.98  ? 82  ARG A O   1 
ATOM   651  C CB  . ARG A 1 82  ? 7.459   23.283 25.781  1.00 91.18  ? 82  ARG A CB  1 
ATOM   652  C CG  . ARG A 1 82  ? 8.166   21.935 25.665  1.00 92.19  ? 82  ARG A CG  1 
ATOM   653  C CD  . ARG A 1 82  ? 9.639   22.109 25.322  1.00 94.32  ? 82  ARG A CD  1 
ATOM   654  N NE  . ARG A 1 82  ? 10.195  20.971 24.579  1.00 95.64  ? 82  ARG A NE  1 
ATOM   655  C CZ  . ARG A 1 82  ? 11.356  20.990 23.920  1.00 96.24  ? 82  ARG A CZ  1 
ATOM   656  N NH1 . ARG A 1 82  ? 12.104  22.089 23.899  1.00 96.59  ? 82  ARG A NH1 1 
ATOM   657  N NH2 . ARG A 1 82  ? 11.773  19.908 23.276  1.00 96.31  ? 82  ARG A NH2 1 
ATOM   658  N N   . PHE A 1 83  ? 3.981   24.532 26.347  1.00 93.03  ? 83  PHE A N   1 
ATOM   659  C CA  . PHE A 1 83  ? 3.164   25.748 26.353  1.00 94.14  ? 83  PHE A CA  1 
ATOM   660  C C   . PHE A 1 83  ? 3.337   26.579 27.619  1.00 95.08  ? 83  PHE A C   1 
ATOM   661  O O   . PHE A 1 83  ? 3.099   27.786 27.605  1.00 95.15  ? 83  PHE A O   1 
ATOM   662  C CB  . PHE A 1 83  ? 1.687   25.405 26.144  1.00 94.02  ? 83  PHE A CB  1 
ATOM   663  C CG  . PHE A 1 83  ? 0.880   26.529 25.557  1.00 94.08  ? 83  PHE A CG  1 
ATOM   664  C CD1 . PHE A 1 83  ? 1.170   27.025 24.288  1.00 94.00  ? 83  PHE A CD1 1 
ATOM   665  C CD2 . PHE A 1 83  ? -0.181  27.084 26.262  1.00 94.12  ? 83  PHE A CD2 1 
ATOM   666  C CE1 . PHE A 1 83  ? 0.424   28.064 23.736  1.00 93.94  ? 83  PHE A CE1 1 
ATOM   667  C CE2 . PHE A 1 83  ? -0.936  28.126 25.713  1.00 94.21  ? 83  PHE A CE2 1 
ATOM   668  C CZ  . PHE A 1 83  ? -0.629  28.616 24.449  1.00 93.92  ? 83  PHE A CZ  1 
ATOM   669  N N   . GLY A 1 84  ? 3.739   25.923 28.707  1.00 96.24  ? 84  GLY A N   1 
ATOM   670  C CA  . GLY A 1 84  ? 4.097   26.606 29.948  1.00 97.69  ? 84  GLY A CA  1 
ATOM   671  C C   . GLY A 1 84  ? 5.252   27.565 29.727  1.00 98.78  ? 84  GLY A C   1 
ATOM   672  O O   . GLY A 1 84  ? 5.188   28.724 30.141  1.00 98.79  ? 84  GLY A O   1 
ATOM   673  N N   . LEU A 1 85  ? 6.296   27.074 29.056  1.00 99.95  ? 85  LEU A N   1 
ATOM   674  C CA  . LEU A 1 85  ? 7.472   27.869 28.684  1.00 101.15 ? 85  LEU A CA  1 
ATOM   675  C C   . LEU A 1 85  ? 7.111   29.129 27.901  1.00 102.04 ? 85  LEU A C   1 
ATOM   676  O O   . LEU A 1 85  ? 7.742   30.171 28.079  1.00 102.13 ? 85  LEU A O   1 
ATOM   677  C CB  . LEU A 1 85  ? 8.456   27.031 27.854  1.00 101.12 ? 85  LEU A CB  1 
ATOM   678  C CG  . LEU A 1 85  ? 9.460   26.041 28.468  1.00 101.44 ? 85  LEU A CG  1 
ATOM   679  C CD1 . LEU A 1 85  ? 10.571  26.765 29.227  1.00 101.54 ? 85  LEU A CD1 1 
ATOM   680  C CD2 . LEU A 1 85  ? 8.797   24.960 29.338  1.00 101.72 ? 85  LEU A CD2 1 
ATOM   681  N N   . ILE A 1 86  ? 6.104   29.024 27.033  1.00 103.29 ? 86  ILE A N   1 
ATOM   682  C CA  . ILE A 1 86  ? 5.647   30.155 26.214  1.00 104.47 ? 86  ILE A CA  1 
ATOM   683  C C   . ILE A 1 86  ? 5.288   31.353 27.097  1.00 105.35 ? 86  ILE A C   1 
ATOM   684  O O   . ILE A 1 86  ? 5.834   32.447 26.925  1.00 105.47 ? 86  ILE A O   1 
ATOM   685  C CB  . ILE A 1 86  ? 4.436   29.770 25.292  1.00 104.36 ? 86  ILE A CB  1 
ATOM   686  C CG1 . ILE A 1 86  ? 4.804   28.633 24.323  1.00 104.39 ? 86  ILE A CG1 1 
ATOM   687  C CG2 . ILE A 1 86  ? 3.890   30.990 24.540  1.00 104.29 ? 86  ILE A CG2 1 
ATOM   688  C CD1 . ILE A 1 86  ? 5.792   29.005 23.215  1.00 104.18 ? 86  ILE A CD1 1 
ATOM   689  N N   . GLN A 1 87  ? 4.391   31.127 28.052  1.00 106.47 ? 87  GLN A N   1 
ATOM   690  C CA  . GLN A 1 87  ? 3.896   32.194 28.921  1.00 107.59 ? 87  GLN A CA  1 
ATOM   691  C C   . GLN A 1 87  ? 3.952   31.824 30.408  1.00 108.28 ? 87  GLN A C   1 
ATOM   692  O O   . GLN A 1 87  ? 3.108   31.070 30.892  1.00 108.37 ? 87  GLN A O   1 
ATOM   693  C CB  . GLN A 1 87  ? 2.474   32.629 28.509  1.00 107.61 ? 87  GLN A CB  1 
ATOM   694  C CG  . GLN A 1 87  ? 1.626   31.547 27.821  1.00 107.71 ? 87  GLN A CG  1 
ATOM   695  C CD  . GLN A 1 87  ? 0.995   30.561 28.792  1.00 107.60 ? 87  GLN A CD  1 
ATOM   696  O OE1 . GLN A 1 87  ? -0.118  30.773 29.276  1.00 107.64 ? 87  GLN A OE1 1 
ATOM   697  N NE2 . GLN A 1 87  ? 1.698   29.468 29.064  1.00 107.41 ? 87  GLN A NE2 1 
ATOM   698  N N   . SER A 1 88  ? 4.958   32.316 31.131  1.00 109.11 ? 88  SER A N   1 
ATOM   699  C CA  . SER A 1 88  ? 6.107   33.032 30.573  1.00 109.94 ? 88  SER A CA  1 
ATOM   700  C C   . SER A 1 88  ? 7.354   32.387 31.206  1.00 110.48 ? 88  SER A C   1 
ATOM   701  O O   . SER A 1 88  ? 7.211   31.343 31.846  1.00 110.37 ? 88  SER A O   1 
ATOM   702  C CB  . SER A 1 88  ? 5.990   34.542 30.844  1.00 109.92 ? 88  SER A CB  1 
ATOM   703  O OG  . SER A 1 88  ? 6.058   34.842 32.225  1.00 110.27 ? 88  SER A OG  1 
ATOM   704  N N   . MET A 1 89  ? 8.566   32.936 31.061  1.00 111.37 ? 89  MET A N   1 
ATOM   705  C CA  . MET A 1 89  ? 8.913   34.207 30.400  1.00 112.30 ? 89  MET A CA  1 
ATOM   706  C C   . MET A 1 89  ? 8.712   34.206 28.869  1.00 112.56 ? 89  MET A C   1 
ATOM   707  O O   . MET A 1 89  ? 8.646   33.134 28.264  1.00 112.75 ? 89  MET A O   1 
ATOM   708  C CB  . MET A 1 89  ? 10.369  34.586 30.753  1.00 112.54 ? 89  MET A CB  1 
ATOM   709  C CG  . MET A 1 89  ? 11.342  33.411 30.983  1.00 113.66 ? 89  MET A CG  1 
ATOM   710  S SD  . MET A 1 89  ? 11.420  32.160 29.668  1.00 116.21 ? 89  MET A SD  1 
ATOM   711  C CE  . MET A 1 89  ? 12.393  32.995 28.409  1.00 115.82 ? 89  MET A CE  1 
ATOM   712  N N   . LYS A 1 90  ? 8.595   35.379 28.233  1.00 112.86 ? 90  LYS A N   1 
ATOM   713  C CA  . LYS A 1 90  ? 8.595   36.704 28.872  1.00 113.03 ? 90  LYS A CA  1 
ATOM   714  C C   . LYS A 1 90  ? 7.704   37.682 28.111  1.00 113.08 ? 90  LYS A C   1 
ATOM   715  O O   . LYS A 1 90  ? 7.864   37.874 26.903  1.00 113.10 ? 90  LYS A O   1 
ATOM   716  C CB  . LYS A 1 90  ? 10.020  37.268 28.983  1.00 113.10 ? 90  LYS A CB  1 
ATOM   717  C CG  . LYS A 1 90  ? 10.946  36.919 27.824  1.00 113.21 ? 90  LYS A CG  1 
ATOM   718  C CD  . LYS A 1 90  ? 12.365  36.752 28.328  1.00 113.47 ? 90  LYS A CD  1 
ATOM   719  C CE  . LYS A 1 90  ? 13.315  36.428 27.200  1.00 113.72 ? 90  LYS A CE  1 
ATOM   720  N NZ  . LYS A 1 90  ? 14.503  35.696 27.712  1.00 114.10 ? 90  LYS A NZ  1 
ATOM   721  N N   . LEU A 1 92  ? 11.531  34.261 25.401  1.00 98.39  ? 92  LEU A N   1 
ATOM   722  C CA  . LEU A 1 92  ? 11.578  33.115 24.496  1.00 98.37  ? 92  LEU A CA  1 
ATOM   723  C C   . LEU A 1 92  ? 12.729  32.161 24.809  1.00 98.31  ? 92  LEU A C   1 
ATOM   724  O O   . LEU A 1 92  ? 13.894  32.565 24.852  1.00 98.32  ? 92  LEU A O   1 
ATOM   725  C CB  . LEU A 1 92  ? 11.658  33.578 23.035  1.00 98.36  ? 92  LEU A CB  1 
ATOM   726  C CG  . LEU A 1 92  ? 11.429  32.529 21.937  1.00 98.26  ? 92  LEU A CG  1 
ATOM   727  C CD1 . LEU A 1 92  ? 10.567  33.090 20.816  1.00 98.02  ? 92  LEU A CD1 1 
ATOM   728  C CD2 . LEU A 1 92  ? 12.752  32.005 21.393  1.00 98.15  ? 92  LEU A CD2 1 
ATOM   729  N N   . ASP A 1 93  ? 12.382  30.892 25.011  1.00 98.19  ? 93  ASP A N   1 
ATOM   730  C CA  . ASP A 1 93  ? 13.360  29.824 25.199  1.00 98.02  ? 93  ASP A CA  1 
ATOM   731  C C   . ASP A 1 93  ? 13.971  29.411 23.856  1.00 97.67  ? 93  ASP A C   1 
ATOM   732  O O   . ASP A 1 93  ? 13.251  29.222 22.871  1.00 97.64  ? 93  ASP A O   1 
ATOM   733  C CB  . ASP A 1 93  ? 12.699  28.621 25.888  1.00 98.16  ? 93  ASP A CB  1 
ATOM   734  C CG  . ASP A 1 93  ? 13.614  27.409 25.962  1.00 98.82  ? 93  ASP A CG  1 
ATOM   735  O OD1 . ASP A 1 93  ? 13.209  26.332 25.468  1.00 99.66  ? 93  ASP A OD1 1 
ATOM   736  O OD2 . ASP A 1 93  ? 14.736  27.531 26.505  1.00 99.48  ? 93  ASP A OD2 1 
ATOM   737  N N   . SER A 1 94  ? 15.296  29.264 23.830  1.00 97.21  ? 94  SER A N   1 
ATOM   738  C CA  . SER A 1 94  ? 16.030  28.912 22.607  1.00 96.74  ? 94  SER A CA  1 
ATOM   739  C C   . SER A 1 94  ? 15.684  27.522 22.057  1.00 96.37  ? 94  SER A C   1 
ATOM   740  O O   . SER A 1 94  ? 15.903  27.246 20.875  1.00 96.37  ? 94  SER A O   1 
ATOM   741  C CB  . SER A 1 94  ? 17.541  29.029 22.828  1.00 96.72  ? 94  SER A CB  1 
ATOM   742  O OG  . SER A 1 94  ? 18.014  27.987 23.662  1.00 96.69  ? 94  SER A OG  1 
ATOM   743  N N   . GLY A 1 95  ? 15.154  26.653 22.917  1.00 95.81  ? 95  GLY A N   1 
ATOM   744  C CA  . GLY A 1 95  ? 14.700  25.326 22.500  1.00 95.12  ? 95  GLY A CA  1 
ATOM   745  C C   . GLY A 1 95  ? 13.462  25.388 21.621  1.00 94.66  ? 95  GLY A C   1 
ATOM   746  O O   . GLY A 1 95  ? 13.215  24.487 20.816  1.00 94.61  ? 95  GLY A O   1 
ATOM   747  N N   . LEU A 1 96  ? 12.688  26.459 21.777  1.00 94.11  ? 96  LEU A N   1 
ATOM   748  C CA  . LEU A 1 96  ? 11.465  26.657 21.005  1.00 93.58  ? 96  LEU A CA  1 
ATOM   749  C C   . LEU A 1 96  ? 11.648  27.722 19.923  1.00 93.22  ? 96  LEU A C   1 
ATOM   750  O O   . LEU A 1 96  ? 10.684  28.104 19.250  1.00 93.12  ? 96  LEU A O   1 
ATOM   751  C CB  . LEU A 1 96  ? 10.300  27.043 21.930  1.00 93.61  ? 96  LEU A CB  1 
ATOM   752  C CG  . LEU A 1 96  ? 10.071  26.288 23.246  1.00 93.55  ? 96  LEU A CG  1 
ATOM   753  C CD1 . LEU A 1 96  ? 8.782   26.761 23.902  1.00 93.66  ? 96  LEU A CD1 1 
ATOM   754  C CD2 . LEU A 1 96  ? 10.035  24.788 23.043  1.00 93.24  ? 96  LEU A CD2 1 
ATOM   755  N N   . ALA A 1 97  ? 12.886  28.187 19.755  1.00 92.71  ? 97  ALA A N   1 
ATOM   756  C CA  . ALA A 1 97  ? 13.194  29.278 18.827  1.00 92.20  ? 97  ALA A CA  1 
ATOM   757  C C   . ALA A 1 97  ? 12.880  28.921 17.374  1.00 91.84  ? 97  ALA A C   1 
ATOM   758  O O   . ALA A 1 97  ? 12.200  29.681 16.678  1.00 91.90  ? 97  ALA A O   1 
ATOM   759  C CB  . ALA A 1 97  ? 14.645  29.718 18.977  1.00 92.23  ? 97  ALA A CB  1 
ATOM   760  N N   . GLU A 1 98  ? 13.365  27.761 16.933  1.00 91.20  ? 98  GLU A N   1 
ATOM   761  C CA  . GLU A 1 98  ? 13.124  27.278 15.577  1.00 90.62  ? 98  GLU A CA  1 
ATOM   762  C C   . GLU A 1 98  ? 11.635  27.115 15.307  1.00 90.17  ? 98  GLU A C   1 
ATOM   763  O O   . GLU A 1 98  ? 11.148  27.521 14.256  1.00 90.17  ? 98  GLU A O   1 
ATOM   764  C CB  . GLU A 1 98  ? 13.858  25.957 15.344  1.00 90.66  ? 98  GLU A CB  1 
ATOM   765  C CG  . GLU A 1 98  ? 13.679  25.364 13.961  1.00 90.94  ? 98  GLU A CG  1 
ATOM   766  C CD  . GLU A 1 98  ? 14.519  24.120 13.762  1.00 91.72  ? 98  GLU A CD  1 
ATOM   767  O OE1 . GLU A 1 98  ? 15.722  24.259 13.455  1.00 92.00  ? 98  GLU A OE1 1 
ATOM   768  O OE2 . GLU A 1 98  ? 13.977  23.002 13.910  1.00 92.09  ? 98  GLU A OE2 1 
ATOM   769  N N   . SER A 1 99  ? 10.920  26.538 16.269  1.00 89.66  ? 99  SER A N   1 
ATOM   770  C CA  . SER A 1 99  ? 9.489   26.280 16.130  1.00 89.20  ? 99  SER A CA  1 
ATOM   771  C C   . SER A 1 99  ? 8.706   27.573 15.924  1.00 88.98  ? 99  SER A C   1 
ATOM   772  O O   . SER A 1 99  ? 7.854   27.651 15.036  1.00 89.03  ? 99  SER A O   1 
ATOM   773  C CB  . SER A 1 99  ? 8.954   25.536 17.355  1.00 89.14  ? 99  SER A CB  1 
ATOM   774  O OG  . SER A 1 99  ? 9.902   24.605 17.841  1.00 88.98  ? 99  SER A OG  1 
ATOM   775  N N   . VAL A 1 100 ? 9.012   28.582 16.739  1.00 88.62  ? 100 VAL A N   1 
ATOM   776  C CA  . VAL A 1 100 ? 8.296   29.862 16.719  1.00 88.20  ? 100 VAL A CA  1 
ATOM   777  C C   . VAL A 1 100 ? 8.631   30.673 15.464  1.00 88.00  ? 100 VAL A C   1 
ATOM   778  O O   . VAL A 1 100 ? 7.730   31.190 14.793  1.00 87.90  ? 100 VAL A O   1 
ATOM   779  C CB  . VAL A 1 100 ? 8.567   30.691 18.009  1.00 88.19  ? 100 VAL A CB  1 
ATOM   780  C CG1 . VAL A 1 100 ? 7.963   32.085 17.907  1.00 88.10  ? 100 VAL A CG1 1 
ATOM   781  C CG2 . VAL A 1 100 ? 8.013   29.973 19.227  1.00 87.95  ? 100 VAL A CG2 1 
ATOM   782  N N   . SER A 1 101 ? 9.921   30.764 15.149  1.00 87.65  ? 101 SER A N   1 
ATOM   783  C CA  . SER A 1 101 ? 10.380  31.499 13.977  1.00 87.47  ? 101 SER A CA  1 
ATOM   784  C C   . SER A 1 101 ? 9.816   30.917 12.681  1.00 87.34  ? 101 SER A C   1 
ATOM   785  O O   . SER A 1 101 ? 9.243   31.645 11.865  1.00 87.28  ? 101 SER A O   1 
ATOM   786  C CB  . SER A 1 101 ? 11.910  31.544 13.930  1.00 87.48  ? 101 SER A CB  1 
ATOM   787  O OG  . SER A 1 101 ? 12.463  30.246 13.829  1.00 87.69  ? 101 SER A OG  1 
ATOM   788  N N   . THR A 1 102 ? 9.965   29.600 12.520  1.00 87.13  ? 102 THR A N   1 
ATOM   789  C CA  . THR A 1 102 ? 9.503   28.880 11.330  1.00 86.85  ? 102 THR A CA  1 
ATOM   790  C C   . THR A 1 102 ? 7.992   29.023 11.107  1.00 86.90  ? 102 THR A C   1 
ATOM   791  O O   . THR A 1 102 ? 7.543   29.139 9.966   1.00 86.78  ? 102 THR A O   1 
ATOM   792  C CB  . THR A 1 102 ? 9.905   27.386 11.387  1.00 86.76  ? 102 THR A CB  1 
ATOM   793  O OG1 . THR A 1 102 ? 11.311  27.273 11.637  1.00 86.36  ? 102 THR A OG1 1 
ATOM   794  C CG2 . THR A 1 102 ? 9.598   26.695 10.088  1.00 86.61  ? 102 THR A CG2 1 
ATOM   795  N N   . LEU A 1 103 ? 7.221   29.022 12.194  1.00 87.01  ? 103 LEU A N   1 
ATOM   796  C CA  . LEU A 1 103 ? 5.769   29.203 12.114  1.00 87.26  ? 103 LEU A CA  1 
ATOM   797  C C   . LEU A 1 103 ? 5.370   30.622 11.696  1.00 87.62  ? 103 LEU A C   1 
ATOM   798  O O   . LEU A 1 103 ? 4.412   30.806 10.942  1.00 87.52  ? 103 LEU A O   1 
ATOM   799  C CB  . LEU A 1 103 ? 5.090   28.815 13.431  1.00 87.11  ? 103 LEU A CB  1 
ATOM   800  C CG  . LEU A 1 103 ? 4.796   27.328 13.661  1.00 87.00  ? 103 LEU A CG  1 
ATOM   801  C CD1 . LEU A 1 103 ? 4.495   27.055 15.125  1.00 86.56  ? 103 LEU A CD1 1 
ATOM   802  C CD2 . LEU A 1 103 ? 3.648   26.842 12.783  1.00 86.41  ? 103 LEU A CD2 1 
ATOM   803  N N   . ILE A 1 104 ? 6.106   31.617 12.190  1.00 88.12  ? 104 ILE A N   1 
ATOM   804  C CA  . ILE A 1 104 ? 5.898   33.008 11.784  1.00 88.56  ? 104 ILE A CA  1 
ATOM   805  C C   . ILE A 1 104 ? 6.289   33.173 10.313  1.00 88.86  ? 104 ILE A C   1 
ATOM   806  O O   . ILE A 1 104 ? 5.613   33.877 9.554   1.00 88.92  ? 104 ILE A O   1 
ATOM   807  C CB  . ILE A 1 104 ? 6.691   33.998 12.682  1.00 88.57  ? 104 ILE A CB  1 
ATOM   808  C CG1 . ILE A 1 104 ? 6.132   33.989 14.112  1.00 88.60  ? 104 ILE A CG1 1 
ATOM   809  C CG2 . ILE A 1 104 ? 6.653   35.416 12.101  1.00 88.47  ? 104 ILE A CG2 1 
ATOM   810  C CD1 . ILE A 1 104 ? 7.089   34.531 15.169  1.00 88.30  ? 104 ILE A CD1 1 
ATOM   811  N N   . TRP A 1 105 ? 7.374   32.502 9.927   1.00 89.14  ? 105 TRP A N   1 
ATOM   812  C CA  . TRP A 1 105 ? 7.860   32.514 8.554   1.00 89.41  ? 105 TRP A CA  1 
ATOM   813  C C   . TRP A 1 105 ? 6.845   31.907 7.588   1.00 89.45  ? 105 TRP A C   1 
ATOM   814  O O   . TRP A 1 105 ? 6.506   32.518 6.580   1.00 89.54  ? 105 TRP A O   1 
ATOM   815  C CB  . TRP A 1 105 ? 9.199   31.771 8.446   1.00 89.52  ? 105 TRP A CB  1 
ATOM   816  C CG  . TRP A 1 105 ? 9.802   31.847 7.073   1.00 90.21  ? 105 TRP A CG  1 
ATOM   817  C CD1 . TRP A 1 105 ? 10.662  32.796 6.615   1.00 90.58  ? 105 TRP A CD1 1 
ATOM   818  C CD2 . TRP A 1 105 ? 9.570   30.951 5.973   1.00 90.92  ? 105 TRP A CD2 1 
ATOM   819  N NE1 . TRP A 1 105 ? 10.988  32.551 5.304   1.00 91.04  ? 105 TRP A NE1 1 
ATOM   820  C CE2 . TRP A 1 105 ? 10.333  31.423 4.885   1.00 91.22  ? 105 TRP A CE2 1 
ATOM   821  C CE3 . TRP A 1 105 ? 8.796   29.793 5.803   1.00 90.93  ? 105 TRP A CE3 1 
ATOM   822  C CZ2 . TRP A 1 105 ? 10.345  30.778 3.638   1.00 91.35  ? 105 TRP A CZ2 1 
ATOM   823  C CZ3 . TRP A 1 105 ? 8.806   29.154 4.564   1.00 90.90  ? 105 TRP A CZ3 1 
ATOM   824  C CH2 . TRP A 1 105 ? 9.575   29.650 3.500   1.00 91.14  ? 105 TRP A CH2 1 
ATOM   825  N N   . ALA A 1 106 ? 6.362   30.708 7.907   1.00 89.53  ? 106 ALA A N   1 
ATOM   826  C CA  . ALA A 1 106 ? 5.545   29.928 6.979   1.00 89.56  ? 106 ALA A CA  1 
ATOM   827  C C   . ALA A 1 106 ? 4.121   30.447 6.840   1.00 89.69  ? 106 ALA A C   1 
ATOM   828  O O   . ALA A 1 106 ? 3.431   30.111 5.874   1.00 89.71  ? 106 ALA A O   1 
ATOM   829  C CB  . ALA A 1 106 ? 5.544   28.457 7.379   1.00 89.48  ? 106 ALA A CB  1 
ATOM   830  N N   . ALA A 1 107 ? 3.693   31.266 7.796   1.00 89.96  ? 107 ALA A N   1 
ATOM   831  C CA  . ALA A 1 107 ? 2.302   31.721 7.865   1.00 90.35  ? 107 ALA A CA  1 
ATOM   832  C C   . ALA A 1 107 ? 1.817   32.481 6.623   1.00 90.62  ? 107 ALA A C   1 
ATOM   833  O O   . ALA A 1 107 ? 0.781   32.114 6.058   1.00 90.57  ? 107 ALA A O   1 
ATOM   834  C CB  . ALA A 1 107 ? 2.049   32.527 9.141   1.00 90.36  ? 107 ALA A CB  1 
ATOM   835  N N   . PRO A 1 108 ? 2.566   33.521 6.180   1.00 90.91  ? 108 PRO A N   1 
ATOM   836  C CA  . PRO A 1 108 ? 2.132   34.296 5.010   1.00 91.15  ? 108 PRO A CA  1 
ATOM   837  C C   . PRO A 1 108 ? 1.983   33.427 3.764   1.00 91.44  ? 108 PRO A C   1 
ATOM   838  O O   . PRO A 1 108 ? 1.055   33.629 2.977   1.00 91.37  ? 108 PRO A O   1 
ATOM   839  C CB  . PRO A 1 108 ? 3.270   35.303 4.812   1.00 91.14  ? 108 PRO A CB  1 
ATOM   840  C CG  . PRO A 1 108 ? 3.961   35.375 6.122   1.00 90.95  ? 108 PRO A CG  1 
ATOM   841  C CD  . PRO A 1 108 ? 3.857   34.012 6.699   1.00 90.88  ? 108 PRO A CD  1 
ATOM   842  N N   . ARG A 1 109 ? 2.893   32.465 3.613   1.00 91.84  ? 109 ARG A N   1 
ATOM   843  C CA  . ARG A 1 109 ? 2.911   31.533 2.489   1.00 92.27  ? 109 ARG A CA  1 
ATOM   844  C C   . ARG A 1 109 ? 1.696   30.599 2.472   1.00 92.59  ? 109 ARG A C   1 
ATOM   845  O O   . ARG A 1 109 ? 1.109   30.343 1.412   1.00 92.70  ? 109 ARG A O   1 
ATOM   846  C CB  . ARG A 1 109 ? 4.199   30.695 2.516   1.00 92.27  ? 109 ARG A CB  1 
ATOM   847  C CG  . ARG A 1 109 ? 5.479   31.422 2.082   1.00 92.65  ? 109 ARG A CG  1 
ATOM   848  C CD  . ARG A 1 109 ? 6.127   32.195 3.225   1.00 93.33  ? 109 ARG A CD  1 
ATOM   849  N NE  . ARG A 1 109 ? 7.434   32.740 2.857   1.00 93.95  ? 109 ARG A NE  1 
ATOM   850  C CZ  . ARG A 1 109 ? 8.113   33.636 3.574   1.00 94.41  ? 109 ARG A CZ  1 
ATOM   851  N NH1 . ARG A 1 109 ? 7.620   34.115 4.710   1.00 94.53  ? 109 ARG A NH1 1 
ATOM   852  N NH2 . ARG A 1 109 ? 9.294   34.064 3.150   1.00 94.71  ? 109 ARG A NH2 1 
ATOM   853  N N   . LEU A 1 110 ? 1.313   30.106 3.648   1.00 92.85  ? 110 LEU A N   1 
ATOM   854  C CA  . LEU A 1 110 ? 0.341   29.020 3.736   1.00 93.03  ? 110 LEU A CA  1 
ATOM   855  C C   . LEU A 1 110 ? -1.044  29.385 4.276   1.00 93.22  ? 110 LEU A C   1 
ATOM   856  O O   . LEU A 1 110 ? -1.954  28.556 4.239   1.00 93.12  ? 110 LEU A O   1 
ATOM   857  C CB  . LEU A 1 110 ? 0.935   27.848 4.523   1.00 92.99  ? 110 LEU A CB  1 
ATOM   858  C CG  . LEU A 1 110 ? 1.872   26.924 3.744   1.00 92.92  ? 110 LEU A CG  1 
ATOM   859  C CD1 . LEU A 1 110 ? 2.708   26.105 4.693   1.00 92.69  ? 110 LEU A CD1 1 
ATOM   860  C CD2 . LEU A 1 110 ? 1.089   26.013 2.804   1.00 93.15  ? 110 LEU A CD2 1 
ATOM   861  N N   . GLN A 1 111 ? -1.217  30.616 4.752   1.00 93.56  ? 111 GLN A N   1 
ATOM   862  C CA  . GLN A 1 111 ? -2.529  31.054 5.248   1.00 94.10  ? 111 GLN A CA  1 
ATOM   863  C C   . GLN A 1 111 ? -3.618  31.037 4.166   1.00 94.26  ? 111 GLN A C   1 
ATOM   864  O O   . GLN A 1 111 ? -4.794  31.298 4.443   1.00 94.21  ? 111 GLN A O   1 
ATOM   865  C CB  . GLN A 1 111 ? -2.443  32.426 5.922   1.00 94.19  ? 111 GLN A CB  1 
ATOM   866  C CG  . GLN A 1 111 ? -1.974  33.557 5.021   1.00 94.97  ? 111 GLN A CG  1 
ATOM   867  C CD  . GLN A 1 111 ? -1.565  34.790 5.807   1.00 95.96  ? 111 GLN A CD  1 
ATOM   868  O OE1 . GLN A 1 111 ? -0.712  34.724 6.700   1.00 96.17  ? 111 GLN A OE1 1 
ATOM   869  N NE2 . GLN A 1 111 ? -2.171  35.927 5.477   1.00 96.36  ? 111 GLN A NE2 1 
ATOM   870  N N   . SER A 1 112 ? -3.206  30.717 2.940   1.00 94.61  ? 112 SER A N   1 
ATOM   871  C CA  . SER A 1 112 ? -4.111  30.535 1.805   1.00 94.88  ? 112 SER A CA  1 
ATOM   872  C C   . SER A 1 112 ? -5.004  29.318 2.035   1.00 94.98  ? 112 SER A C   1 
ATOM   873  O O   . SER A 1 112 ? -6.191  29.330 1.695   1.00 95.02  ? 112 SER A O   1 
ATOM   874  C CB  . SER A 1 112 ? -3.316  30.342 0.507   1.00 94.87  ? 112 SER A CB  1 
ATOM   875  O OG  . SER A 1 112 ? -2.041  30.968 0.569   1.00 95.08  ? 112 SER A OG  1 
ATOM   876  N N   . GLU A 1 113 ? -4.418  28.275 2.620   1.00 95.09  ? 113 GLU A N   1 
ATOM   877  C CA  . GLU A 1 113 ? -5.125  27.025 2.885   1.00 95.17  ? 113 GLU A CA  1 
ATOM   878  C C   . GLU A 1 113 ? -5.452  26.858 4.377   1.00 95.08  ? 113 GLU A C   1 
ATOM   879  O O   . GLU A 1 113 ? -6.591  26.556 4.734   1.00 95.04  ? 113 GLU A O   1 
ATOM   880  C CB  . GLU A 1 113 ? -4.326  25.836 2.338   1.00 95.28  ? 113 GLU A CB  1 
ATOM   881  C CG  . GLU A 1 113 ? -3.918  25.992 0.866   1.00 95.73  ? 113 GLU A CG  1 
ATOM   882  C CD  . GLU A 1 113 ? -3.461  24.688 0.222   1.00 96.37  ? 113 GLU A CD  1 
ATOM   883  O OE1 . GLU A 1 113 ? -4.250  23.717 0.202   1.00 96.28  ? 113 GLU A OE1 1 
ATOM   884  O OE2 . GLU A 1 113 ? -2.316  24.642 -0.281  1.00 96.68  ? 113 GLU A OE2 1 
ATOM   885  N N   . VAL A 1 114 ? -4.460  27.073 5.239   1.00 94.99  ? 114 VAL A N   1 
ATOM   886  C CA  . VAL A 1 114 ? -4.673  27.049 6.687   1.00 94.91  ? 114 VAL A CA  1 
ATOM   887  C C   . VAL A 1 114 ? -4.753  28.478 7.226   1.00 94.84  ? 114 VAL A C   1 
ATOM   888  O O   . VAL A 1 114 ? -3.731  29.112 7.510   1.00 94.79  ? 114 VAL A O   1 
ATOM   889  C CB  . VAL A 1 114 ? -3.576  26.239 7.426   1.00 94.92  ? 114 VAL A CB  1 
ATOM   890  C CG1 . VAL A 1 114 ? -3.846  26.203 8.926   1.00 94.87  ? 114 VAL A CG1 1 
ATOM   891  C CG2 . VAL A 1 114 ? -3.502  24.821 6.877   1.00 95.09  ? 114 VAL A CG2 1 
ATOM   892  N N   . ALA A 1 115 ? -5.983  28.969 7.359   1.00 94.79  ? 115 ALA A N   1 
ATOM   893  C CA  . ALA A 1 115 ? -6.247  30.345 7.784   1.00 94.83  ? 115 ALA A CA  1 
ATOM   894  C C   . ALA A 1 115 ? -5.753  30.652 9.203   1.00 94.83  ? 115 ALA A C   1 
ATOM   895  O O   . ALA A 1 115 ? -5.135  31.696 9.439   1.00 94.77  ? 115 ALA A O   1 
ATOM   896  C CB  . ALA A 1 115 ? -7.735  30.654 7.658   1.00 94.83  ? 115 ALA A CB  1 
ATOM   897  N N   . GLU A 1 116 ? -6.023  29.728 10.127  1.00 94.87  ? 116 GLU A N   1 
ATOM   898  C CA  . GLU A 1 116 ? -5.677  29.867 11.549  1.00 94.81  ? 116 GLU A CA  1 
ATOM   899  C C   . GLU A 1 116 ? -4.181  30.044 11.796  1.00 94.85  ? 116 GLU A C   1 
ATOM   900  O O   . GLU A 1 116 ? -3.775  30.567 12.837  1.00 94.83  ? 116 GLU A O   1 
ATOM   901  C CB  . GLU A 1 116 ? -6.195  28.668 12.353  1.00 94.75  ? 116 GLU A CB  1 
ATOM   902  C CG  . GLU A 1 116 ? -7.716  28.541 12.413  1.00 94.60  ? 116 GLU A CG  1 
ATOM   903  C CD  . GLU A 1 116 ? -8.324  27.898 11.171  1.00 94.51  ? 116 GLU A CD  1 
ATOM   904  O OE1 . GLU A 1 116 ? -7.581  27.305 10.359  1.00 94.32  ? 116 GLU A OE1 1 
ATOM   905  O OE2 . GLU A 1 116 ? -9.558  27.983 11.010  1.00 94.80  ? 116 GLU A OE2 1 
ATOM   906  N N   . LEU A 1 117 ? -3.370  29.608 10.834  1.00 94.97  ? 117 LEU A N   1 
ATOM   907  C CA  . LEU A 1 117 ? -1.922  29.774 10.898  1.00 95.12  ? 117 LEU A CA  1 
ATOM   908  C C   . LEU A 1 117 ? -1.553  31.250 10.994  1.00 95.37  ? 117 LEU A C   1 
ATOM   909  O O   . LEU A 1 117 ? -0.499  31.603 11.528  1.00 95.27  ? 117 LEU A O   1 
ATOM   910  C CB  . LEU A 1 117 ? -1.253  29.115 9.689   1.00 94.96  ? 117 LEU A CB  1 
ATOM   911  C CG  . LEU A 1 117 ? 0.276   29.076 9.613   1.00 94.71  ? 117 LEU A CG  1 
ATOM   912  C CD1 . LEU A 1 117 ? 0.908   28.570 10.901  1.00 94.16  ? 117 LEU A CD1 1 
ATOM   913  C CD2 . LEU A 1 117 ? 0.711   28.226 8.436   1.00 94.76  ? 117 LEU A CD2 1 
ATOM   914  N N   . LYS A 1 118 ? -2.436  32.105 10.482  1.00 95.77  ? 118 LYS A N   1 
ATOM   915  C CA  . LYS A 1 118 ? -2.263  33.541 10.603  1.00 96.23  ? 118 LYS A CA  1 
ATOM   916  C C   . LYS A 1 118 ? -2.317  33.936 12.074  1.00 96.39  ? 118 LYS A C   1 
ATOM   917  O O   . LYS A 1 118 ? -1.388  34.569 12.576  1.00 96.42  ? 118 LYS A O   1 
ATOM   918  C CB  . LYS A 1 118 ? -3.321  34.299 9.794   1.00 96.35  ? 118 LYS A CB  1 
ATOM   919  C CG  . LYS A 1 118 ? -2.914  35.729 9.448   1.00 96.88  ? 118 LYS A CG  1 
ATOM   920  C CD  . LYS A 1 118 ? -4.040  36.500 8.766   1.00 97.64  ? 118 LYS A CD  1 
ATOM   921  C CE  . LYS A 1 118 ? -3.551  37.846 8.220   1.00 97.99  ? 118 LYS A CE  1 
ATOM   922  N NZ  . LYS A 1 118 ? -3.052  38.776 9.280   1.00 98.10  ? 118 LYS A NZ  1 
ATOM   923  N N   . ILE A 1 119 ? -3.387  33.531 12.763  1.00 96.60  ? 119 ILE A N   1 
ATOM   924  C CA  . ILE A 1 119 ? -3.571  33.860 14.184  1.00 96.80  ? 119 ILE A CA  1 
ATOM   925  C C   . ILE A 1 119 ? -2.424  33.325 15.041  1.00 97.13  ? 119 ILE A C   1 
ATOM   926  O O   . ILE A 1 119 ? -1.978  34.004 15.966  1.00 97.14  ? 119 ILE A O   1 
ATOM   927  C CB  . ILE A 1 119 ? -4.936  33.377 14.754  1.00 96.66  ? 119 ILE A CB  1 
ATOM   928  C CG1 . ILE A 1 119 ? -6.106  33.992 13.985  1.00 96.51  ? 119 ILE A CG1 1 
ATOM   929  C CG2 . ILE A 1 119 ? -5.076  33.759 16.218  1.00 96.41  ? 119 ILE A CG2 1 
ATOM   930  C CD1 . ILE A 1 119 ? -6.679  33.106 12.903  1.00 96.39  ? 119 ILE A CD1 1 
ATOM   931  N N   . VAL A 1 120 ? -1.946  32.124 14.719  1.00 97.57  ? 120 VAL A N   1 
ATOM   932  C CA  . VAL A 1 120 ? -0.819  31.520 15.437  1.00 98.14  ? 120 VAL A CA  1 
ATOM   933  C C   . VAL A 1 120 ? 0.434   32.397 15.349  1.00 98.69  ? 120 VAL A C   1 
ATOM   934  O O   . VAL A 1 120 ? 1.069   32.684 16.366  1.00 98.77  ? 120 VAL A O   1 
ATOM   935  C CB  . VAL A 1 120 ? -0.507  30.083 14.945  1.00 98.06  ? 120 VAL A CB  1 
ATOM   936  C CG1 . VAL A 1 120 ? 0.747   29.537 15.624  1.00 97.76  ? 120 VAL A CG1 1 
ATOM   937  C CG2 . VAL A 1 120 ? -1.691  29.162 15.196  1.00 98.06  ? 120 VAL A CG2 1 
ATOM   938  N N   . ALA A 1 121 ? 0.774   32.830 14.136  1.00 99.35  ? 121 ALA A N   1 
ATOM   939  C CA  . ALA A 1 121 ? 1.913   33.722 13.934  1.00 99.93  ? 121 ALA A CA  1 
ATOM   940  C C   . ALA A 1 121 ? 1.668   35.075 14.601  1.00 100.33 ? 121 ALA A C   1 
ATOM   941  O O   . ALA A 1 121 ? 2.560   35.615 15.259  1.00 100.38 ? 121 ALA A O   1 
ATOM   942  C CB  . ALA A 1 121 ? 2.204   33.894 12.450  1.00 99.91  ? 121 ALA A CB  1 
ATOM   943  N N   . ASP A 1 122 ? 0.452   35.600 14.441  1.00 100.79 ? 122 ASP A N   1 
ATOM   944  C CA  . ASP A 1 122 ? 0.062   36.883 15.029  1.00 101.32 ? 122 ASP A CA  1 
ATOM   945  C C   . ASP A 1 122 ? 0.187   36.890 16.548  1.00 101.68 ? 122 ASP A C   1 
ATOM   946  O O   . ASP A 1 122 ? 0.718   37.841 17.125  1.00 101.76 ? 122 ASP A O   1 
ATOM   947  C CB  . ASP A 1 122 ? -1.365  37.259 14.614  1.00 101.29 ? 122 ASP A CB  1 
ATOM   948  C CG  . ASP A 1 122 ? -1.476  37.609 13.136  1.00 101.55 ? 122 ASP A CG  1 
ATOM   949  O OD1 . ASP A 1 122 ? -0.478  37.454 12.395  1.00 101.52 ? 122 ASP A OD1 1 
ATOM   950  O OD2 . ASP A 1 122 ? -2.571  38.036 12.713  1.00 101.89 ? 122 ASP A OD2 1 
ATOM   951  N N   . GLN A 1 123 ? -0.296  35.829 17.188  1.00 102.16 ? 123 GLN A N   1 
ATOM   952  C CA  . GLN A 1 123 ? -0.195  35.704 18.637  1.00 102.71 ? 123 GLN A CA  1 
ATOM   953  C C   . GLN A 1 123 ? 1.254   35.527 19.075  1.00 103.15 ? 123 GLN A C   1 
ATOM   954  O O   . GLN A 1 123 ? 1.680   36.136 20.055  1.00 103.25 ? 123 GLN A O   1 
ATOM   955  C CB  . GLN A 1 123 ? -1.066  34.558 19.157  1.00 102.65 ? 123 GLN A CB  1 
ATOM   956  C CG  . GLN A 1 123 ? -2.569  34.774 18.974  1.00 102.63 ? 123 GLN A CG  1 
ATOM   957  C CD  . GLN A 1 123 ? -3.120  35.921 19.803  1.00 102.55 ? 123 GLN A CD  1 
ATOM   958  O OE1 . GLN A 1 123 ? -2.552  36.295 20.831  1.00 102.58 ? 123 GLN A OE1 1 
ATOM   959  N NE2 . GLN A 1 123 ? -4.240  36.480 19.359  1.00 102.38 ? 123 GLN A NE2 1 
ATOM   960  N N   . LEU A 1 124 ? 2.006   34.710 18.338  1.00 103.75 ? 124 LEU A N   1 
ATOM   961  C CA  . LEU A 1 124 ? 3.439   34.525 18.591  1.00 104.39 ? 124 LEU A CA  1 
ATOM   962  C C   . LEU A 1 124 ? 4.199   35.847 18.479  1.00 104.89 ? 124 LEU A C   1 
ATOM   963  O O   . LEU A 1 124 ? 5.144   36.093 19.232  1.00 104.87 ? 124 LEU A O   1 
ATOM   964  C CB  . LEU A 1 124 ? 4.038   33.483 17.638  1.00 104.35 ? 124 LEU A CB  1 
ATOM   965  C CG  . LEU A 1 124 ? 3.746   31.999 17.891  1.00 104.38 ? 124 LEU A CG  1 
ATOM   966  C CD1 . LEU A 1 124 ? 4.093   31.166 16.664  1.00 104.30 ? 124 LEU A CD1 1 
ATOM   967  C CD2 . LEU A 1 124 ? 4.478   31.476 19.123  1.00 104.27 ? 124 LEU A CD2 1 
ATOM   968  N N   . CYS A 1 125 ? 3.771   36.687 17.536  1.00 105.60 ? 125 CYS A N   1 
ATOM   969  C CA  . CYS A 1 125 ? 4.297   38.042 17.382  1.00 106.33 ? 125 CYS A CA  1 
ATOM   970  C C   . CYS A 1 125 ? 3.963   38.901 18.589  1.00 106.69 ? 125 CYS A C   1 
ATOM   971  O O   . CYS A 1 125 ? 4.839   39.561 19.142  1.00 106.73 ? 125 CYS A O   1 
ATOM   972  C CB  . CYS A 1 125 ? 3.734   38.704 16.123  1.00 106.36 ? 125 CYS A CB  1 
ATOM   973  S SG  . CYS A 1 125 ? 4.574   38.241 14.608  1.00 106.94 ? 125 CYS A SG  1 
ATOM   974  N N   . ALA A 1 126 ? 2.692   38.879 18.990  1.00 107.15 ? 126 ALA A N   1 
ATOM   975  C CA  . ALA A 1 126 ? 2.209   39.650 20.134  1.00 107.59 ? 126 ALA A CA  1 
ATOM   976  C C   . ALA A 1 126 ? 2.970   39.325 21.421  1.00 107.97 ? 126 ALA A C   1 
ATOM   977  O O   . ALA A 1 126 ? 3.142   40.192 22.280  1.00 108.06 ? 126 ALA A O   1 
ATOM   978  C CB  . ALA A 1 126 ? 0.714   39.437 20.323  1.00 107.52 ? 126 ALA A CB  1 
ATOM   979  N N   . LYS A 1 127 ? 3.431   38.081 21.540  1.00 108.45 ? 127 LYS A N   1 
ATOM   980  C CA  . LYS A 1 127 ? 4.187   37.636 22.711  1.00 108.96 ? 127 LYS A CA  1 
ATOM   981  C C   . LYS A 1 127 ? 5.675   38.003 22.634  1.00 109.31 ? 127 LYS A C   1 
ATOM   982  O O   . LYS A 1 127 ? 6.339   38.133 23.670  1.00 109.36 ? 127 LYS A O   1 
ATOM   983  C CB  . LYS A 1 127 ? 4.003   36.123 22.926  1.00 108.92 ? 127 LYS A CB  1 
ATOM   984  C CG  . LYS A 1 127 ? 4.751   35.519 24.124  1.00 109.08 ? 127 LYS A CG  1 
ATOM   985  C CD  . LYS A 1 127 ? 4.231   36.026 25.462  1.00 109.41 ? 127 LYS A CD  1 
ATOM   986  C CE  . LYS A 1 127 ? 5.079   35.506 26.610  1.00 109.70 ? 127 LYS A CE  1 
ATOM   987  N NZ  . LYS A 1 127 ? 4.497   35.834 27.945  1.00 110.15 ? 127 LYS A NZ  1 
ATOM   988  N N   . TYR A 1 128 ? 6.192   38.185 21.418  1.00 109.69 ? 128 TYR A N   1 
ATOM   989  C CA  . TYR A 1 128 ? 7.632   38.403 21.224  1.00 110.06 ? 128 TYR A CA  1 
ATOM   990  C C   . TYR A 1 128 ? 8.004   39.620 20.361  1.00 110.33 ? 128 TYR A C   1 
ATOM   991  O O   . TYR A 1 128 ? 9.166   39.769 19.967  1.00 110.34 ? 128 TYR A O   1 
ATOM   992  C CB  . TYR A 1 128 ? 8.293   37.124 20.691  1.00 110.05 ? 128 TYR A CB  1 
ATOM   993  C CG  . TYR A 1 128 ? 8.141   35.936 21.617  1.00 110.20 ? 128 TYR A CG  1 
ATOM   994  C CD1 . TYR A 1 128 ? 8.828   35.883 22.830  1.00 110.45 ? 128 TYR A CD1 1 
ATOM   995  C CD2 . TYR A 1 128 ? 7.306   34.869 21.285  1.00 110.14 ? 128 TYR A CD2 1 
ATOM   996  C CE1 . TYR A 1 128 ? 8.685   34.801 23.691  1.00 110.56 ? 128 TYR A CE1 1 
ATOM   997  C CE2 . TYR A 1 128 ? 7.162   33.775 22.136  1.00 110.25 ? 128 TYR A CE2 1 
ATOM   998  C CZ  . TYR A 1 128 ? 7.857   33.748 23.337  1.00 110.57 ? 128 TYR A CZ  1 
ATOM   999  O OH  . TYR A 1 128 ? 7.726   32.674 24.190  1.00 110.55 ? 128 TYR A OH  1 
ATOM   1000 N N   . SER A 1 129 ? 7.014   40.482 20.105  1.00 110.66 ? 129 SER A N   1 
ATOM   1001 C CA  . SER A 1 129 ? 7.138   41.735 19.320  1.00 110.92 ? 129 SER A CA  1 
ATOM   1002 C C   . SER A 1 129 ? 7.094   41.529 17.803  1.00 111.09 ? 129 SER A C   1 
ATOM   1003 O O   . SER A 1 129 ? 7.530   40.497 17.294  1.00 111.12 ? 129 SER A O   1 
ATOM   1004 C CB  . SER A 1 129 ? 8.363   42.574 19.731  1.00 110.90 ? 129 SER A CB  1 
ATOM   1005 O OG  . SER A 1 129 ? 9.563   42.075 19.158  1.00 111.03 ? 129 SER A OG  1 
ATOM   1006 N N   . LYS A 1 130 ? 6.555   42.517 17.091  1.00 111.36 ? 130 LYS A N   1 
ATOM   1007 C CA  . LYS A 1 130 ? 6.539   42.492 15.627  1.00 111.62 ? 130 LYS A CA  1 
ATOM   1008 C C   . LYS A 1 130 ? 7.924   42.728 15.018  1.00 111.85 ? 130 LYS A C   1 
ATOM   1009 O O   . LYS A 1 130 ? 8.130   42.473 13.827  1.00 111.85 ? 130 LYS A O   1 
ATOM   1010 C CB  . LYS A 1 130 ? 5.509   43.478 15.062  1.00 111.61 ? 130 LYS A CB  1 
ATOM   1011 C CG  . LYS A 1 130 ? 4.165   42.841 14.691  1.00 111.60 ? 130 LYS A CG  1 
ATOM   1012 C CD  . LYS A 1 130 ? 4.237   42.089 13.357  1.00 111.16 ? 130 LYS A CD  1 
ATOM   1013 C CE  . LYS A 1 130 ? 2.985   41.258 13.098  1.00 110.80 ? 130 LYS A CE  1 
ATOM   1014 N NZ  . LYS A 1 130 ? 1.788   42.090 12.804  1.00 110.74 ? 130 LYS A NZ  1 
ATOM   1015 N N   . GLU A 1 131 ? 8.858   43.223 15.838  1.00 112.11 ? 131 GLU A N   1 
ATOM   1016 C CA  . GLU A 1 131 ? 10.273  43.327 15.460  1.00 112.39 ? 131 GLU A CA  1 
ATOM   1017 C C   . GLU A 1 131 ? 10.836  41.936 15.190  1.00 112.34 ? 131 GLU A C   1 
ATOM   1018 O O   . GLU A 1 131 ? 11.544  41.719 14.200  1.00 112.40 ? 131 GLU A O   1 
ATOM   1019 C CB  . GLU A 1 131 ? 11.106  44.015 16.551  1.00 112.46 ? 131 GLU A CB  1 
ATOM   1020 C CG  . GLU A 1 131 ? 10.963  45.533 16.620  1.00 113.11 ? 131 GLU A CG  1 
ATOM   1021 C CD  . GLU A 1 131 ? 9.968   45.987 17.679  1.00 114.15 ? 131 GLU A CD  1 
ATOM   1022 O OE1 . GLU A 1 131 ? 10.050  45.502 18.831  1.00 114.40 ? 131 GLU A OE1 1 
ATOM   1023 O OE2 . GLU A 1 131 ? 9.110   46.842 17.362  1.00 114.46 ? 131 GLU A OE2 1 
ATOM   1024 N N   . TYR A 1 132 ? 10.510  41.004 16.084  1.00 112.24 ? 132 TYR A N   1 
ATOM   1025 C CA  . TYR A 1 132 ? 10.825  39.590 15.912  1.00 112.12 ? 132 TYR A CA  1 
ATOM   1026 C C   . TYR A 1 132 ? 10.069  39.024 14.706  1.00 111.99 ? 132 TYR A C   1 
ATOM   1027 O O   . TYR A 1 132 ? 10.583  38.161 13.991  1.00 111.95 ? 132 TYR A O   1 
ATOM   1028 C CB  . TYR A 1 132 ? 10.473  38.823 17.192  1.00 112.10 ? 132 TYR A CB  1 
ATOM   1029 C CG  . TYR A 1 132 ? 10.886  37.368 17.203  1.00 112.08 ? 132 TYR A CG  1 
ATOM   1030 C CD1 . TYR A 1 132 ? 12.206  37.001 17.459  1.00 112.03 ? 132 TYR A CD1 1 
ATOM   1031 C CD2 . TYR A 1 132 ? 9.950   36.356 16.972  1.00 111.93 ? 132 TYR A CD2 1 
ATOM   1032 C CE1 . TYR A 1 132 ? 12.588  35.664 17.476  1.00 112.00 ? 132 TYR A CE1 1 
ATOM   1033 C CE2 . TYR A 1 132 ? 10.324  35.014 16.986  1.00 111.86 ? 132 TYR A CE2 1 
ATOM   1034 C CZ  . TYR A 1 132 ? 11.646  34.677 17.237  1.00 111.96 ? 132 TYR A CZ  1 
ATOM   1035 O OH  . TYR A 1 132 ? 12.031  33.356 17.253  1.00 112.07 ? 132 TYR A OH  1 
ATOM   1036 N N   . GLY A 1 133 ? 8.858   39.535 14.482  1.00 111.83 ? 133 GLY A N   1 
ATOM   1037 C CA  . GLY A 1 133 ? 8.019   39.131 13.358  1.00 111.67 ? 133 GLY A CA  1 
ATOM   1038 C C   . GLY A 1 133 ? 8.703   39.204 12.006  1.00 111.62 ? 133 GLY A C   1 
ATOM   1039 O O   . GLY A 1 133 ? 8.725   38.214 11.270  1.00 111.62 ? 133 GLY A O   1 
ATOM   1040 N N   . LYS A 1 134 ? 9.262   40.369 11.675  1.00 111.53 ? 134 LYS A N   1 
ATOM   1041 C CA  . LYS A 1 134 ? 9.920   40.559 10.375  1.00 111.43 ? 134 LYS A CA  1 
ATOM   1042 C C   . LYS A 1 134 ? 11.302  39.892 10.281  1.00 111.23 ? 134 LYS A C   1 
ATOM   1043 O O   . LYS A 1 134 ? 11.745  39.534 9.188   1.00 111.23 ? 134 LYS A O   1 
ATOM   1044 C CB  . LYS A 1 134 ? 9.960   42.040 9.949   1.00 111.48 ? 134 LYS A CB  1 
ATOM   1045 C CG  . LYS A 1 134 ? 10.973  42.928 10.672  1.00 111.86 ? 134 LYS A CG  1 
ATOM   1046 C CD  . LYS A 1 134 ? 10.308  43.868 11.672  1.00 112.26 ? 134 LYS A CD  1 
ATOM   1047 C CE  . LYS A 1 134 ? 11.276  44.959 12.129  1.00 112.24 ? 134 LYS A CE  1 
ATOM   1048 N NZ  . LYS A 1 134 ? 10.670  45.877 13.136  1.00 111.95 ? 134 LYS A NZ  1 
ATOM   1049 N N   . LEU A 1 135 ? 11.969  39.729 11.425  1.00 111.01 ? 135 LEU A N   1 
ATOM   1050 C CA  . LEU A 1 135 ? 13.235  38.990 11.501  1.00 110.83 ? 135 LEU A CA  1 
ATOM   1051 C C   . LEU A 1 135 ? 13.048  37.530 11.091  1.00 110.62 ? 135 LEU A C   1 
ATOM   1052 O O   . LEU A 1 135 ? 13.987  36.873 10.635  1.00 110.53 ? 135 LEU A O   1 
ATOM   1053 C CB  . LEU A 1 135 ? 13.819  39.061 12.917  1.00 110.92 ? 135 LEU A CB  1 
ATOM   1054 C CG  . LEU A 1 135 ? 14.684  40.271 13.291  1.00 110.96 ? 135 LEU A CG  1 
ATOM   1055 C CD1 . LEU A 1 135 ? 14.616  40.544 14.790  1.00 110.99 ? 135 LEU A CD1 1 
ATOM   1056 C CD2 . LEU A 1 135 ? 16.135  40.081 12.840  1.00 110.76 ? 135 LEU A CD2 1 
ATOM   1057 N N   . CYS A 1 136 ? 11.823  37.041 11.263  1.00 110.38 ? 136 CYS A N   1 
ATOM   1058 C CA  . CYS A 1 136 ? 11.449  35.692 10.865  1.00 110.14 ? 136 CYS A CA  1 
ATOM   1059 C C   . CYS A 1 136 ? 10.928  35.663 9.434   1.00 109.84 ? 136 CYS A C   1 
ATOM   1060 O O   . CYS A 1 136 ? 11.515  34.997 8.581   1.00 109.88 ? 136 CYS A O   1 
ATOM   1061 C CB  . CYS A 1 136 ? 10.400  35.120 11.822  1.00 110.21 ? 136 CYS A CB  1 
ATOM   1062 S SG  . CYS A 1 136 ? 10.983  34.917 13.512  1.00 110.42 ? 136 CYS A SG  1 
ATOM   1063 N N   . ARG A 1 137 ? 9.839   36.395 9.178   1.00 109.42 ? 137 ARG A N   1 
ATOM   1064 C CA  . ARG A 1 137 ? 9.166   36.405 7.868   1.00 109.01 ? 137 ARG A CA  1 
ATOM   1065 C C   . ARG A 1 137 ? 10.123  36.541 6.684   1.00 108.61 ? 137 ARG A C   1 
ATOM   1066 O O   . ARG A 1 137 ? 9.892   35.967 5.617   1.00 108.58 ? 137 ARG A O   1 
ATOM   1067 C CB  . ARG A 1 137 ? 8.076   37.476 7.820   1.00 109.06 ? 137 ARG A CB  1 
ATOM   1068 C CG  . ARG A 1 137 ? 6.702   36.949 8.186   1.00 109.35 ? 137 ARG A CG  1 
ATOM   1069 C CD  . ARG A 1 137 ? 5.654   38.047 8.174   1.00 110.12 ? 137 ARG A CD  1 
ATOM   1070 N NE  . ARG A 1 137 ? 5.546   38.727 9.465   1.00 110.89 ? 137 ARG A NE  1 
ATOM   1071 C CZ  . ARG A 1 137 ? 6.139   39.878 9.773   1.00 111.42 ? 137 ARG A CZ  1 
ATOM   1072 N NH1 . ARG A 1 137 ? 6.899   40.508 8.883   1.00 111.78 ? 137 ARG A NH1 1 
ATOM   1073 N NH2 . ARG A 1 137 ? 5.966   40.407 10.979  1.00 111.58 ? 137 ARG A NH2 1 
ATOM   1074 N N   . THR A 1 138 ? 11.182  37.321 6.885   1.00 108.13 ? 138 THR A N   1 
ATOM   1075 C CA  . THR A 1 138 ? 12.346  37.318 6.006   1.00 107.62 ? 138 THR A CA  1 
ATOM   1076 C C   . THR A 1 138 ? 13.525  36.885 6.872   1.00 107.22 ? 138 THR A C   1 
ATOM   1077 O O   . THR A 1 138 ? 14.059  37.678 7.652   1.00 107.05 ? 138 THR A O   1 
ATOM   1078 C CB  . THR A 1 138 ? 12.611  38.705 5.367   1.00 107.71 ? 138 THR A CB  1 
ATOM   1079 O OG1 . THR A 1 138 ? 12.956  39.651 6.389   1.00 107.61 ? 138 THR A OG1 1 
ATOM   1080 C CG2 . THR A 1 138 ? 11.381  39.202 4.587   1.00 107.45 ? 138 THR A CG2 1 
ATOM   1081 N N   . ASN A 1 139 ? 13.902  35.614 6.739   1.00 106.72 ? 139 ASN A N   1 
ATOM   1082 C CA  . ASN A 1 139 ? 14.836  34.947 7.656   1.00 106.28 ? 139 ASN A CA  1 
ATOM   1083 C C   . ASN A 1 139 ? 16.130  35.721 7.940   1.00 105.93 ? 139 ASN A C   1 
ATOM   1084 O O   . ASN A 1 139 ? 17.204  35.394 7.421   1.00 106.04 ? 139 ASN A O   1 
ATOM   1085 C CB  . ASN A 1 139 ? 15.133  33.510 7.178   1.00 106.26 ? 139 ASN A CB  1 
ATOM   1086 C CG  . ASN A 1 139 ? 15.919  32.690 8.204   1.00 106.22 ? 139 ASN A CG  1 
ATOM   1087 O OD1 . ASN A 1 139 ? 15.715  32.816 9.413   1.00 106.11 ? 139 ASN A OD1 1 
ATOM   1088 N ND2 . ASN A 1 139 ? 16.819  31.841 7.716   1.00 106.17 ? 139 ASN A ND2 1 
ATOM   1089 N N   . GLN A 1 140 ? 16.009  36.753 8.769   1.00 105.28 ? 140 GLN A N   1 
ATOM   1090 C CA  . GLN A 1 140 ? 17.160  37.536 9.199   1.00 104.70 ? 140 GLN A CA  1 
ATOM   1091 C C   . GLN A 1 140 ? 17.672  37.015 10.534  1.00 104.06 ? 140 GLN A C   1 
ATOM   1092 O O   . GLN A 1 140 ? 18.846  37.193 10.875  1.00 104.05 ? 140 GLN A O   1 
ATOM   1093 C CB  . GLN A 1 140 ? 16.797  39.015 9.315   1.00 104.86 ? 140 GLN A CB  1 
ATOM   1094 C CG  . GLN A 1 140 ? 16.530  39.700 7.986   1.00 105.38 ? 140 GLN A CG  1 
ATOM   1095 C CD  . GLN A 1 140 ? 16.562  41.208 8.100   1.00 106.03 ? 140 GLN A CD  1 
ATOM   1096 O OE1 . GLN A 1 140 ? 15.518  41.857 8.171   1.00 106.34 ? 140 GLN A OE1 1 
ATOM   1097 N NE2 . GLN A 1 140 ? 17.765  41.777 8.130   1.00 106.21 ? 140 GLN A NE2 1 
ATOM   1098 N N   . ILE A 1 141 ? 16.779  36.367 11.277  1.00 103.15 ? 141 ILE A N   1 
ATOM   1099 C CA  . ILE A 1 141 ? 17.104  35.807 12.584  1.00 102.15 ? 141 ILE A CA  1 
ATOM   1100 C C   . ILE A 1 141 ? 17.922  34.508 12.471  1.00 101.45 ? 141 ILE A C   1 
ATOM   1101 O O   . ILE A 1 141 ? 18.688  34.169 13.377  1.00 101.39 ? 141 ILE A O   1 
ATOM   1102 C CB  . ILE A 1 141 ? 15.827  35.661 13.471  1.00 102.22 ? 141 ILE A CB  1 
ATOM   1103 C CG1 . ILE A 1 141 ? 16.203  35.330 14.920  1.00 102.17 ? 141 ILE A CG1 1 
ATOM   1104 C CG2 . ILE A 1 141 ? 14.825  34.662 12.866  1.00 102.15 ? 141 ILE A CG2 1 
ATOM   1105 C CD1 . ILE A 1 141 ? 15.364  36.045 15.942  1.00 101.93 ? 141 ILE A CD1 1 
ATOM   1106 N N   . GLY A 1 142 ? 17.765  33.802 11.350  1.00 100.58 ? 142 GLY A N   1 
ATOM   1107 C CA  . GLY A 1 142 ? 18.564  32.608 11.046  1.00 99.43  ? 142 GLY A CA  1 
ATOM   1108 C C   . GLY A 1 142 ? 18.224  31.355 11.837  1.00 98.61  ? 142 GLY A C   1 
ATOM   1109 O O   . GLY A 1 142 ? 19.034  30.423 11.906  1.00 98.67  ? 142 GLY A O   1 
ATOM   1110 N N   . THR A 1 143 ? 17.031  31.331 12.435  1.00 97.64  ? 143 THR A N   1 
ATOM   1111 C CA  . THR A 1 143 ? 16.555  30.173 13.202  1.00 96.54  ? 143 THR A CA  1 
ATOM   1112 C C   . THR A 1 143 ? 15.498  29.367 12.446  1.00 95.86  ? 143 THR A C   1 
ATOM   1113 O O   . THR A 1 143 ? 15.298  28.184 12.731  1.00 95.75  ? 143 THR A O   1 
ATOM   1114 C CB  . THR A 1 143 ? 16.004  30.565 14.602  1.00 96.54  ? 143 THR A CB  1 
ATOM   1115 O OG1 . THR A 1 143 ? 15.188  31.739 14.500  1.00 96.09  ? 143 THR A OG1 1 
ATOM   1116 C CG2 . THR A 1 143 ? 17.142  30.819 15.575  1.00 96.24  ? 143 THR A CG2 1 
ATOM   1117 N N   . VAL A 1 144 ? 14.832  30.016 11.490  1.00 94.93  ? 144 VAL A N   1 
ATOM   1118 C CA  . VAL A 1 144 ? 13.849  29.362 10.624  1.00 94.05  ? 144 VAL A CA  1 
ATOM   1119 C C   . VAL A 1 144 ? 14.486  28.136 9.968   1.00 93.55  ? 144 VAL A C   1 
ATOM   1120 O O   . VAL A 1 144 ? 15.652  28.182 9.555   1.00 93.46  ? 144 VAL A O   1 
ATOM   1121 C CB  . VAL A 1 144 ? 13.304  30.335 9.545   1.00 94.03  ? 144 VAL A CB  1 
ATOM   1122 C CG1 . VAL A 1 144 ? 12.177  29.696 8.748   1.00 93.86  ? 144 VAL A CG1 1 
ATOM   1123 C CG2 . VAL A 1 144 ? 12.814  31.627 10.182  1.00 94.05  ? 144 VAL A CG2 1 
ATOM   1124 N N   . ASN A 1 145 ? 13.727  27.042 9.894   1.00 92.86  ? 145 ASN A N   1 
ATOM   1125 C CA  . ASN A 1 145 ? 14.248  25.765 9.400   1.00 92.11  ? 145 ASN A CA  1 
ATOM   1126 C C   . ASN A 1 145 ? 14.501  25.756 7.893   1.00 91.70  ? 145 ASN A C   1 
ATOM   1127 O O   . ASN A 1 145 ? 13.585  25.997 7.096   1.00 91.53  ? 145 ASN A O   1 
ATOM   1128 C CB  . ASN A 1 145 ? 13.337  24.601 9.802   1.00 92.00  ? 145 ASN A CB  1 
ATOM   1129 C CG  . ASN A 1 145 ? 13.992  23.248 9.582   1.00 91.68  ? 145 ASN A CG  1 
ATOM   1130 O OD1 . ASN A 1 145 ? 13.655  22.537 8.641   1.00 91.77  ? 145 ASN A OD1 1 
ATOM   1131 N ND2 . ASN A 1 145 ? 14.944  22.896 10.439  1.00 91.14  ? 145 ASN A ND2 1 
ATOM   1132 N N   . ASP A 1 146 ? 15.751  25.466 7.528   1.00 91.12  ? 146 ASP A N   1 
ATOM   1133 C CA  . ASP A 1 146 ? 16.217  25.497 6.138   1.00 90.65  ? 146 ASP A CA  1 
ATOM   1134 C C   . ASP A 1 146 ? 15.498  24.499 5.232   1.00 90.16  ? 146 ASP A C   1 
ATOM   1135 O O   . ASP A 1 146 ? 15.095  24.838 4.115   1.00 90.18  ? 146 ASP A O   1 
ATOM   1136 C CB  . ASP A 1 146 ? 17.731  25.262 6.074   1.00 90.73  ? 146 ASP A CB  1 
ATOM   1137 C CG  . ASP A 1 146 ? 18.529  26.333 6.808   1.00 91.12  ? 146 ASP A CG  1 
ATOM   1138 O OD1 . ASP A 1 146 ? 18.047  27.482 6.930   1.00 91.62  ? 146 ASP A OD1 1 
ATOM   1139 O OD2 . ASP A 1 146 ? 19.653  26.022 7.259   1.00 91.46  ? 146 ASP A OD2 1 
ATOM   1140 N N   . ARG A 1 147 ? 15.341  23.273 5.724   1.00 89.54  ? 147 ARG A N   1 
ATOM   1141 C CA  . ARG A 1 147 ? 14.688  22.208 4.969   1.00 88.80  ? 147 ARG A CA  1 
ATOM   1142 C C   . ARG A 1 147 ? 13.213  22.511 4.736   1.00 88.47  ? 147 ARG A C   1 
ATOM   1143 O O   . ARG A 1 147 ? 12.665  22.116 3.710   1.00 88.42  ? 147 ARG A O   1 
ATOM   1144 C CB  . ARG A 1 147 ? 14.861  20.857 5.669   1.00 88.68  ? 147 ARG A CB  1 
ATOM   1145 C CG  . ARG A 1 147 ? 16.290  20.577 6.104   1.00 88.25  ? 147 ARG A CG  1 
ATOM   1146 C CD  . ARG A 1 147 ? 16.438  19.202 6.716   1.00 88.01  ? 147 ARG A CD  1 
ATOM   1147 N NE  . ARG A 1 147 ? 16.823  18.203 5.722   1.00 87.97  ? 147 ARG A NE  1 
ATOM   1148 C CZ  . ARG A 1 147 ? 15.974  17.409 5.075   1.00 88.12  ? 147 ARG A CZ  1 
ATOM   1149 N NH1 . ARG A 1 147 ? 14.669  17.484 5.311   1.00 88.07  ? 147 ARG A NH1 1 
ATOM   1150 N NH2 . ARG A 1 147 ? 16.434  16.533 4.188   1.00 87.75  ? 147 ARG A NH2 1 
ATOM   1151 N N   . LEU A 1 148 ? 12.583  23.219 5.676   1.00 88.06  ? 148 LEU A N   1 
ATOM   1152 C CA  . LEU A 1 148 ? 11.177  23.596 5.535   1.00 87.84  ? 148 LEU A CA  1 
ATOM   1153 C C   . LEU A 1 148 ? 10.976  24.677 4.484   1.00 87.87  ? 148 LEU A C   1 
ATOM   1154 O O   . LEU A 1 148 ? 10.076  24.579 3.645   1.00 87.89  ? 148 LEU A O   1 
ATOM   1155 C CB  . LEU A 1 148 ? 10.569  24.076 6.850   1.00 87.66  ? 148 LEU A CB  1 
ATOM   1156 C CG  . LEU A 1 148 ? 9.141   24.538 6.538   1.00 87.32  ? 148 LEU A CG  1 
ATOM   1157 C CD1 . LEU A 1 148 ? 8.107   23.518 6.968   1.00 86.94  ? 148 LEU A CD1 1 
ATOM   1158 C CD2 . LEU A 1 148 ? 8.845   25.901 7.116   1.00 87.19  ? 148 LEU A CD2 1 
ATOM   1159 N N   . MET A 1 149 ? 11.793  25.723 4.558   1.00 87.94  ? 149 MET A N   1 
ATOM   1160 C CA  . MET A 1 149 ? 11.751  26.794 3.571   1.00 87.96  ? 149 MET A CA  1 
ATOM   1161 C C   . MET A 1 149 ? 11.954  26.212 2.178   1.00 87.99  ? 149 MET A C   1 
ATOM   1162 O O   . MET A 1 149 ? 11.200  26.526 1.254   1.00 87.86  ? 149 MET A O   1 
ATOM   1163 C CB  . MET A 1 149 ? 12.821  27.846 3.864   1.00 87.94  ? 149 MET A CB  1 
ATOM   1164 C CG  . MET A 1 149 ? 12.661  28.547 5.200   1.00 88.02  ? 149 MET A CG  1 
ATOM   1165 S SD  . MET A 1 149 ? 13.888  29.840 5.470   1.00 88.00  ? 149 MET A SD  1 
ATOM   1166 C CE  . MET A 1 149 ? 15.398  28.896 5.681   1.00 86.89  ? 149 MET A CE  1 
ATOM   1167 N N   . HIS A 1 150 ? 12.956  25.342 2.050   1.00 88.05  ? 150 HIS A N   1 
ATOM   1168 C CA  . HIS A 1 150 ? 13.264  24.694 0.781   1.00 88.28  ? 150 HIS A CA  1 
ATOM   1169 C C   . HIS A 1 150 ? 12.065  23.936 0.197   1.00 88.09  ? 150 HIS A C   1 
ATOM   1170 O O   . HIS A 1 150 ? 11.818  24.000 -1.009  1.00 88.14  ? 150 HIS A O   1 
ATOM   1171 C CB  . HIS A 1 150 ? 14.480  23.775 0.908   1.00 88.42  ? 150 HIS A CB  1 
ATOM   1172 C CG  . HIS A 1 150 ? 14.877  23.137 -0.386  1.00 89.69  ? 150 HIS A CG  1 
ATOM   1173 N ND1 . HIS A 1 150 ? 14.319  21.958 -0.837  1.00 90.57  ? 150 HIS A ND1 1 
ATOM   1174 C CD2 . HIS A 1 150 ? 15.752  23.528 -1.342  1.00 90.78  ? 150 HIS A CD2 1 
ATOM   1175 C CE1 . HIS A 1 150 ? 14.844  21.644 -2.008  1.00 91.02  ? 150 HIS A CE1 1 
ATOM   1176 N NE2 . HIS A 1 150 ? 15.717  22.580 -2.337  1.00 91.24  ? 150 HIS A NE2 1 
ATOM   1177 N N   . LYS A 1 151 ? 11.328  23.225 1.050   1.00 87.83  ? 151 LYS A N   1 
ATOM   1178 C CA  . LYS A 1 151 ? 10.144  22.481 0.616   1.00 87.57  ? 151 LYS A CA  1 
ATOM   1179 C C   . LYS A 1 151 ? 9.039   23.407 0.125   1.00 87.67  ? 151 LYS A C   1 
ATOM   1180 O O   . LYS A 1 151 ? 8.206   23.005 -0.686  1.00 87.69  ? 151 LYS A O   1 
ATOM   1181 C CB  . LYS A 1 151 ? 9.622   21.576 1.734   1.00 87.40  ? 151 LYS A CB  1 
ATOM   1182 C CG  . LYS A 1 151 ? 10.534  20.406 2.040   1.00 86.92  ? 151 LYS A CG  1 
ATOM   1183 C CD  . LYS A 1 151 ? 10.060  19.624 3.244   1.00 85.72  ? 151 LYS A CD  1 
ATOM   1184 C CE  . LYS A 1 151 ? 11.203  18.844 3.876   1.00 85.34  ? 151 LYS A CE  1 
ATOM   1185 N NZ  . LYS A 1 151 ? 11.764  17.791 2.989   1.00 84.99  ? 151 LYS A NZ  1 
ATOM   1186 N N   . LEU A 1 152 ? 9.037   24.644 0.614   1.00 87.83  ? 152 LEU A N   1 
ATOM   1187 C CA  . LEU A 1 152 ? 8.069   25.644 0.167   1.00 88.05  ? 152 LEU A CA  1 
ATOM   1188 C C   . LEU A 1 152 ? 8.636   26.551 -0.924  1.00 88.31  ? 152 LEU A C   1 
ATOM   1189 O O   . LEU A 1 152 ? 7.918   27.394 -1.472  1.00 88.38  ? 152 LEU A O   1 
ATOM   1190 C CB  . LEU A 1 152 ? 7.540   26.472 1.345   1.00 87.98  ? 152 LEU A CB  1 
ATOM   1191 C CG  . LEU A 1 152 ? 6.627   25.777 2.362   1.00 87.68  ? 152 LEU A CG  1 
ATOM   1192 C CD1 . LEU A 1 152 ? 6.154   26.781 3.399   1.00 87.39  ? 152 LEU A CD1 1 
ATOM   1193 C CD2 . LEU A 1 152 ? 5.436   25.097 1.696   1.00 87.15  ? 152 LEU A CD2 1 
ATOM   1194 N N   . SER A 1 153 ? 9.921   26.372 -1.234  1.00 88.55  ? 153 SER A N   1 
ATOM   1195 C CA  . SER A 1 153 ? 10.561  27.060 -2.356  1.00 88.77  ? 153 SER A CA  1 
ATOM   1196 C C   . SER A 1 153 ? 10.024  26.517 -3.689  1.00 88.87  ? 153 SER A C   1 
ATOM   1197 O O   . SER A 1 153 ? 10.495  25.489 -4.200  1.00 88.90  ? 153 SER A O   1 
ATOM   1198 C CB  . SER A 1 153 ? 12.091  26.934 -2.279  1.00 88.85  ? 153 SER A CB  1 
ATOM   1199 O OG  . SER A 1 153 ? 12.726  27.460 -3.436  1.00 89.03  ? 153 SER A OG  1 
ATOM   1200 N N   . VAL A 1 154 ? 9.026   27.216 -4.231  1.00 88.88  ? 154 VAL A N   1 
ATOM   1201 C CA  . VAL A 1 154 ? 8.397   26.846 -5.501  1.00 88.77  ? 154 VAL A CA  1 
ATOM   1202 C C   . VAL A 1 154 ? 9.286   27.202 -6.704  1.00 88.60  ? 154 VAL A C   1 
ATOM   1203 O O   . VAL A 1 154 ? 8.915   28.006 -7.567  1.00 88.72  ? 154 VAL A O   1 
ATOM   1204 C CB  . VAL A 1 154 ? 6.951   27.427 -5.646  1.00 88.87  ? 154 VAL A CB  1 
ATOM   1205 C CG1 . VAL A 1 154 ? 5.950   26.603 -4.824  1.00 89.02  ? 154 VAL A CG1 1 
ATOM   1206 C CG2 . VAL A 1 154 ? 6.898   28.911 -5.258  1.00 88.89  ? 154 VAL A CG2 1 
ATOM   1207 N N   . GLU A 1 155 ? 10.473  26.604 -6.730  1.00 88.14  ? 155 GLU A N   1 
ATOM   1208 C CA  . GLU A 1 155 ? 11.377  26.695 -7.867  1.00 87.74  ? 155 GLU A CA  1 
ATOM   1209 C C   . GLU A 1 155 ? 11.310  25.392 -8.671  1.00 87.11  ? 155 GLU A C   1 
ATOM   1210 O O   . GLU A 1 155 ? 10.412  24.567 -8.459  1.00 87.12  ? 155 GLU A O   1 
ATOM   1211 C CB  . GLU A 1 155 ? 12.807  26.989 -7.400  1.00 87.99  ? 155 GLU A CB  1 
ATOM   1212 C CG  . GLU A 1 155 ? 13.367  25.980 -6.392  1.00 89.33  ? 155 GLU A CG  1 
ATOM   1213 C CD  . GLU A 1 155 ? 14.887  26.005 -6.296  1.00 91.22  ? 155 GLU A CD  1 
ATOM   1214 O OE1 . GLU A 1 155 ? 15.421  25.639 -5.222  1.00 91.67  ? 155 GLU A OE1 1 
ATOM   1215 O OE2 . GLU A 1 155 ? 15.551  26.384 -7.291  1.00 92.09  ? 155 GLU A OE2 1 
ATOM   1216 N N   . ALA A 1 156 ? 12.256  25.207 -9.587  1.00 86.27  ? 156 ALA A N   1 
ATOM   1217 C CA  . ALA A 1 156 ? 12.246  24.049 -10.474 1.00 85.45  ? 156 ALA A CA  1 
ATOM   1218 C C   . ALA A 1 156 ? 12.912  22.839 -9.825  1.00 84.76  ? 156 ALA A C   1 
ATOM   1219 O O   . ALA A 1 156 ? 13.935  22.983 -9.150  1.00 84.83  ? 156 ALA A O   1 
ATOM   1220 C CB  . ALA A 1 156 ? 12.922  24.387 -11.798 1.00 85.50  ? 156 ALA A CB  1 
ATOM   1221 N N   . PRO A 1 157 ? 12.330  21.641 -10.024 1.00 83.96  ? 157 PRO A N   1 
ATOM   1222 C CA  . PRO A 1 157 ? 12.932  20.408 -9.522  1.00 83.35  ? 157 PRO A CA  1 
ATOM   1223 C C   . PRO A 1 157 ? 14.137  19.990 -10.364 1.00 82.65  ? 157 PRO A C   1 
ATOM   1224 O O   . PRO A 1 157 ? 14.112  20.163 -11.583 1.00 82.76  ? 157 PRO A O   1 
ATOM   1225 C CB  . PRO A 1 157 ? 11.806  19.371 -9.672  1.00 83.40  ? 157 PRO A CB  1 
ATOM   1226 C CG  . PRO A 1 157 ? 10.562  20.155 -9.990  1.00 83.68  ? 157 PRO A CG  1 
ATOM   1227 C CD  . PRO A 1 157 ? 11.033  21.388 -10.674 1.00 83.92  ? 157 PRO A CD  1 
ATOM   1228 N N   . PRO A 1 158 ? 15.188  19.444 -9.721  1.00 81.96  ? 158 PRO A N   1 
ATOM   1229 C CA  . PRO A 1 158 ? 16.367  18.917 -10.412 1.00 81.45  ? 158 PRO A CA  1 
ATOM   1230 C C   . PRO A 1 158 ? 16.023  17.813 -11.409 1.00 81.02  ? 158 PRO A C   1 
ATOM   1231 O O   . PRO A 1 158 ? 15.083  17.045 -11.178 1.00 81.05  ? 158 PRO A O   1 
ATOM   1232 C CB  . PRO A 1 158 ? 17.202  18.328 -9.272  1.00 81.48  ? 158 PRO A CB  1 
ATOM   1233 C CG  . PRO A 1 158 ? 16.794  19.092 -8.079  1.00 81.60  ? 158 PRO A CG  1 
ATOM   1234 C CD  . PRO A 1 158 ? 15.338  19.367 -8.257  1.00 81.88  ? 158 PRO A CD  1 
ATOM   1235 N N   . LYS A 1 159 ? 16.789  17.740 -12.500 1.00 80.42  ? 159 LYS A N   1 
ATOM   1236 C CA  . LYS A 1 159 ? 16.601  16.724 -13.542 1.00 79.75  ? 159 LYS A CA  1 
ATOM   1237 C C   . LYS A 1 159 ? 16.472  15.332 -12.940 1.00 78.88  ? 159 LYS A C   1 
ATOM   1238 O O   . LYS A 1 159 ? 15.524  14.610 -13.239 1.00 78.66  ? 159 LYS A O   1 
ATOM   1239 C CB  . LYS A 1 159 ? 17.760  16.756 -14.557 1.00 80.06  ? 159 LYS A CB  1 
ATOM   1240 C CG  . LYS A 1 159 ? 17.935  15.462 -15.389 1.00 81.09  ? 159 LYS A CG  1 
ATOM   1241 C CD  . LYS A 1 159 ? 19.387  15.264 -15.863 1.00 82.69  ? 159 LYS A CD  1 
ATOM   1242 C CE  . LYS A 1 159 ? 19.828  13.785 -15.810 1.00 83.21  ? 159 LYS A CE  1 
ATOM   1243 N NZ  . LYS A 1 159 ? 19.255  12.915 -16.889 1.00 83.57  ? 159 LYS A NZ  1 
ATOM   1244 N N   . ILE A 1 160 ? 17.421  14.979 -12.075 1.00 77.95  ? 160 ILE A N   1 
ATOM   1245 C CA  . ILE A 1 160 ? 17.510  13.622 -11.546 1.00 77.16  ? 160 ILE A CA  1 
ATOM   1246 C C   . ILE A 1 160 ? 16.371  13.272 -10.579 1.00 76.71  ? 160 ILE A C   1 
ATOM   1247 O O   . ILE A 1 160 ? 15.949  12.120 -10.520 1.00 76.58  ? 160 ILE A O   1 
ATOM   1248 C CB  . ILE A 1 160 ? 18.916  13.323 -10.935 1.00 77.14  ? 160 ILE A CB  1 
ATOM   1249 C CG1 . ILE A 1 160 ? 19.176  11.812 -10.860 1.00 76.92  ? 160 ILE A CG1 1 
ATOM   1250 C CG2 . ILE A 1 160 ? 19.106  14.011 -9.578  1.00 76.92  ? 160 ILE A CG2 1 
ATOM   1251 C CD1 . ILE A 1 160 ? 19.324  11.128 -12.213 1.00 76.50  ? 160 ILE A CD1 1 
ATOM   1252 N N   . LEU A 1 161 ? 15.871  14.268 -9.846  1.00 76.05  ? 161 LEU A N   1 
ATOM   1253 C CA  . LEU A 1 161 ? 14.722  14.077 -8.964  1.00 75.35  ? 161 LEU A CA  1 
ATOM   1254 C C   . LEU A 1 161 ? 13.488  13.681 -9.770  1.00 75.10  ? 161 LEU A C   1 
ATOM   1255 O O   . LEU A 1 161 ? 12.689  12.848 -9.331  1.00 75.30  ? 161 LEU A O   1 
ATOM   1256 C CB  . LEU A 1 161 ? 14.443  15.343 -8.147  1.00 75.20  ? 161 LEU A CB  1 
ATOM   1257 C CG  . LEU A 1 161 ? 13.143  15.413 -7.333  1.00 74.75  ? 161 LEU A CG  1 
ATOM   1258 C CD1 . LEU A 1 161 ? 13.041  14.288 -6.312  1.00 73.94  ? 161 LEU A CD1 1 
ATOM   1259 C CD2 . LEU A 1 161 ? 13.016  16.761 -6.655  1.00 74.54  ? 161 LEU A CD2 1 
ATOM   1260 N N   . VAL A 1 162 ? 13.355  14.276 -10.954 1.00 74.52  ? 162 VAL A N   1 
ATOM   1261 C CA  . VAL A 1 162 ? 12.249  14.002 -11.867 1.00 74.00  ? 162 VAL A CA  1 
ATOM   1262 C C   . VAL A 1 162 ? 12.300  12.573 -12.440 1.00 73.86  ? 162 VAL A C   1 
ATOM   1263 O O   . VAL A 1 162 ? 11.299  12.068 -12.944 1.00 73.75  ? 162 VAL A O   1 
ATOM   1264 C CB  . VAL A 1 162 ? 12.213  15.071 -13.008 1.00 73.94  ? 162 VAL A CB  1 
ATOM   1265 C CG1 . VAL A 1 162 ? 11.211  14.718 -14.098 1.00 73.89  ? 162 VAL A CG1 1 
ATOM   1266 C CG2 . VAL A 1 162 ? 11.899  16.448 -12.442 1.00 73.40  ? 162 VAL A CG2 1 
ATOM   1267 N N   . GLU A 1 163 ? 13.437  11.897 -12.297 1.00 73.75  ? 163 GLU A N   1 
ATOM   1268 C CA  . GLU A 1 163 ? 13.735  10.766 -13.175 1.00 73.61  ? 163 GLU A CA  1 
ATOM   1269 C C   . GLU A 1 163 ? 13.586  9.279  -12.794 1.00 73.41  ? 163 GLU A C   1 
ATOM   1270 O O   . GLU A 1 163 ? 12.994  8.556  -13.594 1.00 73.69  ? 163 GLU A O   1 
ATOM   1271 C CB  . GLU A 1 163 ? 15.107  10.949 -13.859 1.00 73.65  ? 163 GLU A CB  1 
ATOM   1272 C CG  . GLU A 1 163 ? 15.211  12.103 -14.875 1.00 74.37  ? 163 GLU A CG  1 
ATOM   1273 C CD  . GLU A 1 163 ? 14.417  11.899 -16.172 1.00 75.44  ? 163 GLU A CD  1 
ATOM   1274 O OE1 . GLU A 1 163 ? 13.904  12.910 -16.711 1.00 75.36  ? 163 GLU A OE1 1 
ATOM   1275 O OE2 . GLU A 1 163 ? 14.309  10.750 -16.663 1.00 75.39  ? 163 GLU A OE2 1 
ATOM   1276 N N   . ARG A 1 164 ? 14.007  8.758  -11.635 1.00 72.95  ? 164 ARG A N   1 
ATOM   1277 C CA  . ARG A 1 164 ? 13.590  9.045  -10.249 1.00 72.28  ? 164 ARG A CA  1 
ATOM   1278 C C   . ARG A 1 164 ? 12.111  9.020  -9.928  1.00 71.77  ? 164 ARG A C   1 
ATOM   1279 O O   . ARG A 1 164 ? 11.589  7.935  -9.674  1.00 71.69  ? 164 ARG A O   1 
ATOM   1280 C CB  . ARG A 1 164 ? 14.439  10.001 -9.424  1.00 72.46  ? 164 ARG A CB  1 
ATOM   1281 C CG  . ARG A 1 164 ? 15.289  9.183  -8.425  1.00 72.69  ? 164 ARG A CG  1 
ATOM   1282 C CD  . ARG A 1 164 ? 15.407  9.825  -7.052  1.00 72.95  ? 164 ARG A CD  1 
ATOM   1283 N NE  . ARG A 1 164 ? 14.287  9.498  -6.175  1.00 73.30  ? 164 ARG A NE  1 
ATOM   1284 C CZ  . ARG A 1 164 ? 13.903  10.241 -5.136  1.00 73.39  ? 164 ARG A CZ  1 
ATOM   1285 N NH1 . ARG A 1 164 ? 14.544  11.367 -4.844  1.00 73.12  ? 164 ARG A NH1 1 
ATOM   1286 N NH2 . ARG A 1 164 ? 12.867  9.865  -4.392  1.00 73.01  ? 164 ARG A NH2 1 
ATOM   1287 N N   . TYR A 1 165 ? 11.422  10.154 -9.929  1.00 70.98  ? 165 TYR A N   1 
ATOM   1288 C CA  . TYR A 1 165 ? 9.984   10.072 -9.740  1.00 70.37  ? 165 TYR A CA  1 
ATOM   1289 C C   . TYR A 1 165 ? 9.368   9.188  -10.823 1.00 70.19  ? 165 TYR A C   1 
ATOM   1290 O O   . TYR A 1 165 ? 8.522   8.336  -10.531 1.00 70.15  ? 165 TYR A O   1 
ATOM   1291 C CB  . TYR A 1 165 ? 9.341   11.451 -9.683  1.00 70.29  ? 165 TYR A CB  1 
ATOM   1292 C CG  . TYR A 1 165 ? 9.045   11.902 -8.273  1.00 70.15  ? 165 TYR A CG  1 
ATOM   1293 C CD1 . TYR A 1 165 ? 7.734   12.140 -7.858  1.00 70.01  ? 165 TYR A CD1 1 
ATOM   1294 C CD2 . TYR A 1 165 ? 10.074  12.071 -7.343  1.00 70.01  ? 165 TYR A CD2 1 
ATOM   1295 C CE1 . TYR A 1 165 ? 7.456   12.555 -6.560  1.00 70.04  ? 165 TYR A CE1 1 
ATOM   1296 C CE2 . TYR A 1 165 ? 9.807   12.480 -6.042  1.00 69.66  ? 165 TYR A CE2 1 
ATOM   1297 C CZ  . TYR A 1 165 ? 8.500   12.723 -5.658  1.00 69.93  ? 165 TYR A CZ  1 
ATOM   1298 O OH  . TYR A 1 165 ? 8.237   13.132 -4.371  1.00 69.82  ? 165 TYR A OH  1 
ATOM   1299 N N   . LEU A 1 166 ? 9.843   9.356  -12.057 1.00 69.80  ? 166 LEU A N   1 
ATOM   1300 C CA  . LEU A 1 166 ? 9.363   8.573  -13.192 1.00 69.40  ? 166 LEU A CA  1 
ATOM   1301 C C   . LEU A 1 166 ? 9.741   7.088  -13.110 1.00 69.29  ? 166 LEU A C   1 
ATOM   1302 O O   . LEU A 1 166 ? 8.896   6.226  -13.348 1.00 69.14  ? 166 LEU A O   1 
ATOM   1303 C CB  . LEU A 1 166 ? 9.818   9.192  -14.522 1.00 69.40  ? 166 LEU A CB  1 
ATOM   1304 C CG  . LEU A 1 166 ? 9.289   10.584 -14.904 1.00 68.84  ? 166 LEU A CG  1 
ATOM   1305 C CD1 . LEU A 1 166 ? 10.103  11.161 -16.051 1.00 68.10  ? 166 LEU A CD1 1 
ATOM   1306 C CD2 . LEU A 1 166 ? 7.798   10.571 -15.241 1.00 68.00  ? 166 LEU A CD2 1 
ATOM   1307 N N   . ILE A 1 167 ? 10.990  6.784  -12.763 1.00 69.27  ? 167 ILE A N   1 
ATOM   1308 C CA  . ILE A 1 167 ? 11.412  5.382  -12.644 1.00 69.42  ? 167 ILE A CA  1 
ATOM   1309 C C   . ILE A 1 167 ? 10.732  4.661  -11.473 1.00 69.65  ? 167 ILE A C   1 
ATOM   1310 O O   . ILE A 1 167 ? 10.578  3.441  -11.501 1.00 69.78  ? 167 ILE A O   1 
ATOM   1311 C CB  . ILE A 1 167 ? 12.960  5.214  -12.565 1.00 69.42  ? 167 ILE A CB  1 
ATOM   1312 C CG1 . ILE A 1 167 ? 13.368  3.822  -13.059 1.00 69.01  ? 167 ILE A CG1 1 
ATOM   1313 C CG2 . ILE A 1 167 ? 13.484  5.479  -11.144 1.00 69.28  ? 167 ILE A CG2 1 
ATOM   1314 C CD1 . ILE A 1 167 ? 14.864  3.590  -13.125 1.00 68.70  ? 167 ILE A CD1 1 
ATOM   1315 N N   . GLU A 1 168 ? 10.331  5.415  -10.452 1.00 69.89  ? 168 GLU A N   1 
ATOM   1316 C CA  . GLU A 1 168 ? 9.658   4.840  -9.293  1.00 70.13  ? 168 GLU A CA  1 
ATOM   1317 C C   . GLU A 1 168 ? 8.216   4.511  -9.626  1.00 70.53  ? 168 GLU A C   1 
ATOM   1318 O O   . GLU A 1 168 ? 7.747   3.413  -9.327  1.00 70.38  ? 168 GLU A O   1 
ATOM   1319 C CB  . GLU A 1 168 ? 9.728   5.780  -8.092  1.00 70.04  ? 168 GLU A CB  1 
ATOM   1320 C CG  . GLU A 1 168 ? 11.077  5.763  -7.389  1.00 69.84  ? 168 GLU A CG  1 
ATOM   1321 C CD  . GLU A 1 168 ? 11.209  6.823  -6.307  1.00 69.73  ? 168 GLU A CD  1 
ATOM   1322 O OE1 . GLU A 1 168 ? 10.244  7.590  -6.074  1.00 70.06  ? 168 GLU A OE1 1 
ATOM   1323 O OE2 . GLU A 1 168 ? 12.288  6.889  -5.686  1.00 68.90  ? 168 GLU A OE2 1 
ATOM   1324 N N   . ILE A 1 169 ? 7.523   5.464  -10.251 1.00 71.08  ? 169 ILE A N   1 
ATOM   1325 C CA  . ILE A 1 169 ? 6.162   5.248  -10.736 1.00 71.73  ? 169 ILE A CA  1 
ATOM   1326 C C   . ILE A 1 169 ? 6.143   4.077  -11.722 1.00 72.46  ? 169 ILE A C   1 
ATOM   1327 O O   . ILE A 1 169 ? 5.256   3.221  -11.661 1.00 72.55  ? 169 ILE A O   1 
ATOM   1328 C CB  . ILE A 1 169 ? 5.582   6.525  -11.383 1.00 71.61  ? 169 ILE A CB  1 
ATOM   1329 C CG1 . ILE A 1 169 ? 5.377   7.604  -10.320 1.00 71.31  ? 169 ILE A CG1 1 
ATOM   1330 C CG2 . ILE A 1 169 ? 4.263   6.228  -12.097 1.00 71.50  ? 169 ILE A CG2 1 
ATOM   1331 C CD1 . ILE A 1 169 ? 5.230   9.002  -10.875 1.00 70.90  ? 169 ILE A CD1 1 
ATOM   1332 N N   . ALA A 1 170 ? 7.141   4.035  -12.603 1.00 73.37  ? 170 ALA A N   1 
ATOM   1333 C CA  . ALA A 1 170 ? 7.298   2.940  -13.556 1.00 74.43  ? 170 ALA A CA  1 
ATOM   1334 C C   . ALA A 1 170 ? 7.427   1.587  -12.863 1.00 75.20  ? 170 ALA A C   1 
ATOM   1335 O O   . ALA A 1 170 ? 6.760   0.626  -13.247 1.00 75.24  ? 170 ALA A O   1 
ATOM   1336 C CB  . ALA A 1 170 ? 8.490   3.190  -14.469 1.00 74.34  ? 170 ALA A CB  1 
ATOM   1337 N N   . LYS A 1 171 ? 8.282   1.523  -11.844 1.00 76.29  ? 171 LYS A N   1 
ATOM   1338 C CA  . LYS A 1 171 ? 8.483   0.300  -11.068 1.00 77.39  ? 171 LYS A CA  1 
ATOM   1339 C C   . LYS A 1 171 ? 7.216   -0.106 -10.308 1.00 78.47  ? 171 LYS A C   1 
ATOM   1340 O O   . LYS A 1 171 ? 6.843   -1.279 -10.303 1.00 78.54  ? 171 LYS A O   1 
ATOM   1341 C CB  . LYS A 1 171 ? 9.658   0.461  -10.098 1.00 77.14  ? 171 LYS A CB  1 
ATOM   1342 C CG  . LYS A 1 171 ? 11.033  0.349  -10.736 1.00 76.64  ? 171 LYS A CG  1 
ATOM   1343 C CD  . LYS A 1 171 ? 12.117  0.873  -9.805  1.00 75.76  ? 171 LYS A CD  1 
ATOM   1344 C CE  . LYS A 1 171 ? 13.500  0.788  -10.435 1.00 75.62  ? 171 LYS A CE  1 
ATOM   1345 N NZ  . LYS A 1 171 ? 14.069  -0.591 -10.422 1.00 75.02  ? 171 LYS A NZ  1 
ATOM   1346 N N   . ASN A 1 172 ? 6.559   0.872  -9.684  1.00 79.93  ? 172 ASN A N   1 
ATOM   1347 C CA  . ASN A 1 172 ? 5.362   0.631  -8.875  1.00 81.50  ? 172 ASN A CA  1 
ATOM   1348 C C   . ASN A 1 172 ? 4.188   0.097  -9.683  1.00 82.33  ? 172 ASN A C   1 
ATOM   1349 O O   . ASN A 1 172 ? 3.537   -0.870 -9.277  1.00 82.30  ? 172 ASN A O   1 
ATOM   1350 C CB  . ASN A 1 172 ? 4.939   1.906  -8.133  1.00 81.67  ? 172 ASN A CB  1 
ATOM   1351 C CG  . ASN A 1 172 ? 5.952   2.341  -7.080  1.00 82.78  ? 172 ASN A CG  1 
ATOM   1352 O OD1 . ASN A 1 172 ? 6.746   1.531  -6.584  1.00 83.67  ? 172 ASN A OD1 1 
ATOM   1353 N ND2 . ASN A 1 172 ? 5.930   3.629  -6.732  1.00 83.15  ? 172 ASN A ND2 1 
ATOM   1354 N N   . TYR A 1 173 ? 3.938   0.730  -10.826 1.00 83.47  ? 173 TYR A N   1 
ATOM   1355 C CA  . TYR A 1 173 ? 2.799   0.402  -11.674 1.00 84.73  ? 173 TYR A CA  1 
ATOM   1356 C C   . TYR A 1 173 ? 3.140   -0.565 -12.814 1.00 85.75  ? 173 TYR A C   1 
ATOM   1357 O O   . TYR A 1 173 ? 2.306   -0.821 -13.686 1.00 85.94  ? 173 TYR A O   1 
ATOM   1358 C CB  . TYR A 1 173 ? 2.183   1.682  -12.232 1.00 84.64  ? 173 TYR A CB  1 
ATOM   1359 C CG  . TYR A 1 173 ? 1.419   2.498  -11.213 1.00 84.92  ? 173 TYR A CG  1 
ATOM   1360 C CD1 . TYR A 1 173 ? 0.027   2.423  -11.136 1.00 84.99  ? 173 TYR A CD1 1 
ATOM   1361 C CD2 . TYR A 1 173 ? 2.083   3.352  -10.331 1.00 85.24  ? 173 TYR A CD2 1 
ATOM   1362 C CE1 . TYR A 1 173 ? -0.685  3.174  -10.203 1.00 85.17  ? 173 TYR A CE1 1 
ATOM   1363 C CE2 . TYR A 1 173 ? 1.380   4.107  -9.393  1.00 85.41  ? 173 TYR A CE2 1 
ATOM   1364 C CZ  . TYR A 1 173 ? -0.003  4.013  -9.336  1.00 85.36  ? 173 TYR A CZ  1 
ATOM   1365 O OH  . TYR A 1 173 ? -0.699  4.760  -8.411  1.00 85.53  ? 173 TYR A OH  1 
ATOM   1366 N N   . ASN A 1 174 ? 4.362   -1.096 -12.797 1.00 87.00  ? 174 ASN A N   1 
ATOM   1367 C CA  . ASN A 1 174 ? 4.826   -2.069 -13.794 1.00 88.28  ? 174 ASN A CA  1 
ATOM   1368 C C   . ASN A 1 174 ? 4.715   -1.603 -15.249 1.00 89.08  ? 174 ASN A C   1 
ATOM   1369 O O   . ASN A 1 174 ? 4.398   -2.391 -16.143 1.00 89.22  ? 174 ASN A O   1 
ATOM   1370 C CB  . ASN A 1 174 ? 4.134   -3.425 -13.597 1.00 88.34  ? 174 ASN A CB  1 
ATOM   1371 C CG  . ASN A 1 174 ? 4.517   -4.094 -12.285 1.00 88.96  ? 174 ASN A CG  1 
ATOM   1372 O OD1 . ASN A 1 174 ? 5.686   -4.086 -11.878 1.00 89.40  ? 174 ASN A OD1 1 
ATOM   1373 N ND2 . ASN A 1 174 ? 3.530   -4.686 -11.618 1.00 89.20  ? 174 ASN A ND2 1 
ATOM   1374 N N   . VAL A 1 175 ? 4.975   -0.319 -15.474 1.00 90.15  ? 175 VAL A N   1 
ATOM   1375 C CA  . VAL A 1 175 ? 5.017   0.245  -16.822 1.00 91.21  ? 175 VAL A CA  1 
ATOM   1376 C C   . VAL A 1 175 ? 6.475   0.447  -17.264 1.00 92.18  ? 175 VAL A C   1 
ATOM   1377 O O   . VAL A 1 175 ? 7.363   0.569  -16.415 1.00 92.18  ? 175 VAL A O   1 
ATOM   1378 C CB  . VAL A 1 175 ? 4.196   1.564  -16.936 1.00 91.11  ? 175 VAL A CB  1 
ATOM   1379 C CG1 . VAL A 1 175 ? 2.715   1.287  -16.731 1.00 91.08  ? 175 VAL A CG1 1 
ATOM   1380 C CG2 . VAL A 1 175 ? 4.681   2.610  -15.947 1.00 91.00  ? 175 VAL A CG2 1 
ATOM   1381 N N   . PRO A 1 176 ? 6.731   0.449  -18.591 1.00 93.22  ? 176 PRO A N   1 
ATOM   1382 C CA  . PRO A 1 176 ? 8.082   0.695  -19.120 1.00 93.98  ? 176 PRO A CA  1 
ATOM   1383 C C   . PRO A 1 176 ? 8.591   2.118  -18.886 1.00 94.73  ? 176 PRO A C   1 
ATOM   1384 O O   . PRO A 1 176 ? 7.812   3.076  -18.906 1.00 94.70  ? 176 PRO A O   1 
ATOM   1385 C CB  . PRO A 1 176 ? 7.921   0.439  -20.623 1.00 93.91  ? 176 PRO A CB  1 
ATOM   1386 C CG  . PRO A 1 176 ? 6.758   -0.481 -20.721 1.00 93.74  ? 176 PRO A CG  1 
ATOM   1387 C CD  . PRO A 1 176 ? 5.818   -0.017 -19.652 1.00 93.32  ? 176 PRO A CD  1 
ATOM   1388 N N   . TYR A 1 177 ? 9.896   2.240  -18.667 1.00 95.74  ? 177 TYR A N   1 
ATOM   1389 C CA  . TYR A 1 177 ? 10.515  3.540  -18.467 1.00 96.79  ? 177 TYR A CA  1 
ATOM   1390 C C   . TYR A 1 177 ? 11.519  3.882  -19.570 1.00 97.58  ? 177 TYR A C   1 
ATOM   1391 O O   . TYR A 1 177 ? 12.434  3.103  -19.866 1.00 97.50  ? 177 TYR A O   1 
ATOM   1392 C CB  . TYR A 1 177 ? 11.175  3.636  -17.088 1.00 96.72  ? 177 TYR A CB  1 
ATOM   1393 C CG  . TYR A 1 177 ? 12.027  4.875  -16.940 1.00 97.03  ? 177 TYR A CG  1 
ATOM   1394 C CD1 . TYR A 1 177 ? 11.442  6.142  -16.838 1.00 97.21  ? 177 TYR A CD1 1 
ATOM   1395 C CD2 . TYR A 1 177 ? 13.419  4.785  -16.934 1.00 97.34  ? 177 TYR A CD2 1 
ATOM   1396 C CE1 . TYR A 1 177 ? 12.223  7.287  -16.722 1.00 97.38  ? 177 TYR A CE1 1 
ATOM   1397 C CE2 . TYR A 1 177 ? 14.210  5.922  -16.819 1.00 97.63  ? 177 TYR A CE2 1 
ATOM   1398 C CZ  . TYR A 1 177 ? 13.606  7.169  -16.710 1.00 97.80  ? 177 TYR A CZ  1 
ATOM   1399 O OH  . TYR A 1 177 ? 14.390  8.293  -16.593 1.00 97.82  ? 177 TYR A OH  1 
ATOM   1400 N N   . GLU A 1 178 ? 11.332  5.064  -20.154 1.00 98.68  ? 178 GLU A N   1 
ATOM   1401 C CA  . GLU A 1 178 ? 12.203  5.591  -21.205 1.00 99.75  ? 178 GLU A CA  1 
ATOM   1402 C C   . GLU A 1 178 ? 13.107  6.675  -20.627 1.00 100.22 ? 178 GLU A C   1 
ATOM   1403 O O   . GLU A 1 178 ? 12.613  7.703  -20.153 1.00 100.33 ? 178 GLU A O   1 
ATOM   1404 C CB  . GLU A 1 178 ? 11.376  6.181  -22.358 1.00 99.83  ? 178 GLU A CB  1 
ATOM   1405 C CG  . GLU A 1 178 ? 10.102  5.407  -22.710 1.00 100.93 ? 178 GLU A CG  1 
ATOM   1406 C CD  . GLU A 1 178 ? 10.332  4.226  -23.646 1.00 102.41 ? 178 GLU A CD  1 
ATOM   1407 O OE1 . GLU A 1 178 ? 11.414  3.593  -23.589 1.00 103.06 ? 178 GLU A OE1 1 
ATOM   1408 O OE2 . GLU A 1 178 ? 9.412   3.923  -24.441 1.00 102.93 ? 178 GLU A OE2 1 
ATOM   1409 N N   . PRO A 1 179 ? 14.436  6.449  -20.653 1.00 100.81 ? 179 PRO A N   1 
ATOM   1410 C CA  . PRO A 1 179 ? 15.397  7.472  -20.216 1.00 101.27 ? 179 PRO A CA  1 
ATOM   1411 C C   . PRO A 1 179 ? 15.299  8.767  -21.038 1.00 101.73 ? 179 PRO A C   1 
ATOM   1412 O O   . PRO A 1 179 ? 14.536  8.834  -22.009 1.00 101.87 ? 179 PRO A O   1 
ATOM   1413 C CB  . PRO A 1 179 ? 16.756  6.792  -20.429 1.00 101.22 ? 179 PRO A CB  1 
ATOM   1414 C CG  . PRO A 1 179 ? 16.459  5.331  -20.359 1.00 101.08 ? 179 PRO A CG  1 
ATOM   1415 C CD  . PRO A 1 179 ? 15.099  5.168  -20.966 1.00 100.84 ? 179 PRO A CD  1 
ATOM   1416 N N   . ASP A 1 180 ? 16.059  9.786  -20.642 1.00 102.18 ? 180 ASP A N   1 
ATOM   1417 C CA  . ASP A 1 180 ? 16.035  11.071 -21.333 1.00 102.57 ? 180 ASP A CA  1 
ATOM   1418 C C   . ASP A 1 180 ? 17.061  11.098 -22.462 1.00 102.65 ? 180 ASP A C   1 
ATOM   1419 O O   . ASP A 1 180 ? 16.784  11.589 -23.558 1.00 102.87 ? 180 ASP A O   1 
ATOM   1420 C CB  . ASP A 1 180 ? 16.289  12.217 -20.352 1.00 102.70 ? 180 ASP A CB  1 
ATOM   1421 C CG  . ASP A 1 180 ? 15.747  13.548 -20.853 1.00 103.42 ? 180 ASP A CG  1 
ATOM   1422 O OD1 . ASP A 1 180 ? 16.127  13.981 -21.968 1.00 104.02 ? 180 ASP A OD1 1 
ATOM   1423 O OD2 . ASP A 1 180 ? 14.940  14.167 -20.123 1.00 104.11 ? 180 ASP A OD2 1 
HETATM 1424 C C1  . GOL B 2 .   ? 10.057  -0.423 -14.667 1.00 108.97 ? 190 GOL A C1  1 
HETATM 1425 O O1  . GOL B 2 .   ? 9.038   -1.399 -14.594 1.00 108.85 ? 190 GOL A O1  1 
HETATM 1426 C C2  . GOL B 2 .   ? 11.389  -1.079 -15.019 1.00 108.90 ? 190 GOL A C2  1 
HETATM 1427 O O2  . GOL B 2 .   ? 11.555  -1.093 -16.420 1.00 108.93 ? 190 GOL A O2  1 
HETATM 1428 C C3  . GOL B 2 .   ? 12.538  -0.314 -14.366 1.00 108.80 ? 190 GOL A C3  1 
HETATM 1429 O O3  . GOL B 2 .   ? 12.931  0.765  -15.188 1.00 108.74 ? 190 GOL A O3  1 
HETATM 1430 O O   . HOH C 3 .   ? 2.900   10.708 -3.224  1.00 63.70  ? 191 HOH A O   1 
HETATM 1431 O O   . HOH C 3 .   ? 5.761   11.905 1.337   1.00 60.77  ? 192 HOH A O   1 
HETATM 1432 O O   . HOH C 3 .   ? 11.264  14.553 -1.065  1.00 70.36  ? 193 HOH A O   1 
HETATM 1433 O O   . HOH C 3 .   ? 0.103   20.372 27.247  1.00 77.37  ? 194 HOH A O   1 
HETATM 1434 O O   . HOH C 3 .   ? -3.702  21.938 23.959  1.00 47.59  ? 195 HOH A O   1 
HETATM 1435 O O   . HOH C 3 .   ? 5.069   23.314 29.768  1.00 56.78  ? 196 HOH A O   1 
HETATM 1436 O O   . HOH C 3 .   ? 12.418  16.879 6.029   1.00 36.15  ? 197 HOH A O   1 
HETATM 1437 O O   . HOH C 3 .   ? 14.313  19.618 1.830   1.00 55.93  ? 198 HOH A O   1 
HETATM 1438 O O   . HOH C 3 .   ? 9.934   9.982  -2.861  1.00 60.39  ? 199 HOH A O   1 
HETATM 1439 O O   . HOH C 3 .   ? 14.235  14.992 -1.432  1.00 70.76  ? 200 HOH A O   1 
HETATM 1440 O O   . HOH C 3 .   ? -1.849  22.545 -3.869  1.00 93.23  ? 201 HOH A O   1 
HETATM 1441 O O   . HOH C 3 .   ? 18.095  29.504 8.863   1.00 67.20  ? 202 HOH A O   1 
HETATM 1442 O O   . HOH C 3 .   ? -1.915  2.344  -15.277 1.00 69.39  ? 203 HOH A O   1 
HETATM 1443 O O   . HOH C 3 .   ? 17.962  24.678 9.670   1.00 64.44  ? 204 HOH A O   1 
HETATM 1444 O O   . HOH C 3 .   ? 19.964  16.798 -11.433 1.00 58.32  ? 205 HOH A O   1 
HETATM 1445 O O   . HOH C 3 .   ? -12.097 29.113 25.648  1.00 77.06  ? 206 HOH A O   1 
HETATM 1446 O O   . HOH C 3 .   ? -8.363  18.365 18.544  1.00 64.39  ? 207 HOH A O   1 
HETATM 1447 O O   . HOH C 3 .   ? 4.221   5.441  -7.642  1.00 46.06  ? 208 HOH A O   1 
HETATM 1448 O O   . HOH C 3 .   ? 10.736  15.092 -21.955 1.00 77.66  ? 209 HOH A O   1 
HETATM 1449 O O   . HOH C 3 .   ? 0.278   15.967 15.407  1.00 62.34  ? 210 HOH A O   1 
HETATM 1450 O O   . HOH C 3 .   ? 15.080  26.352 18.327  1.00 70.94  ? 211 HOH A O   1 
HETATM 1451 O O   . HOH C 3 .   ? -0.090  30.829 -1.548  1.00 79.42  ? 212 HOH A O   1 
HETATM 1452 O O   . HOH C 3 .   ? -1.147  27.996 -0.200  1.00 86.35  ? 213 HOH A O   1 
HETATM 1453 O O   . HOH C 3 .   ? 11.363  38.366 21.307  1.00 90.90  ? 214 HOH A O   1 
HETATM 1454 O O   . HOH C 3 .   ? 3.816   -2.258 -6.970  1.00 85.08  ? 215 HOH A O   1 
HETATM 1455 O O   . HOH C 3 .   ? -3.109  20.436 -5.503  1.00 80.23  ? 216 HOH A O   1 
HETATM 1456 O O   . HOH C 3 .   ? 7.179   10.589 -1.011  1.00 71.07  ? 217 HOH A O   1 
HETATM 1457 O O   . HOH C 3 .   ? -4.900  37.520 16.602  1.00 67.34  ? 218 HOH A O   1 
HETATM 1458 O O   . HOH C 3 .   ? 4.365   12.976 -24.808 1.00 52.90  ? 219 HOH A O   1 
HETATM 1459 O O   . HOH C 3 .   ? -1.023  16.698 -21.849 1.00 61.05  ? 220 HOH A O   1 
HETATM 1460 O O   . HOH C 3 .   ? 0.134   41.927 23.916  1.00 77.34  ? 221 HOH A O   1 
HETATM 1461 O O   . HOH C 3 .   ? 17.479  21.575 9.030   1.00 66.97  ? 222 HOH A O   1 
HETATM 1462 O O   . HOH C 3 .   ? 7.094   -4.210 -14.947 1.00 79.17  ? 223 HOH A O   1 
HETATM 1463 O O   . HOH C 3 .   ? 13.461  10.081 -24.094 1.00 89.80  ? 224 HOH A O   1 
HETATM 1464 O O   . HOH C 3 .   ? -10.408 30.177 14.615  1.00 76.38  ? 225 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1   ?   ?   ?   A . n 
A 1 2   HIS 2   2   ?   ?   ?   A . n 
A 1 3   MET 3   3   ?   ?   ?   A . n 
A 1 4   LEU 4   4   ?   ?   ?   A . n 
A 1 5   GLY 5   5   5   GLY GLY A . n 
A 1 6   PHE 6   6   6   PHE PHE A . n 
A 1 7   LYS 7   7   7   LYS LYS A . n 
A 1 8   ALA 8   8   8   ALA ALA A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  ARG 10  10  10  ARG ARG A . n 
A 1 11  LEU 11  11  11  LEU LEU A . n 
A 1 12  ARG 12  12  12  ARG ARG A . n 
A 1 13  VAL 13  13  13  VAL VAL A . n 
A 1 14  ASN 14  14  14  ASN ASN A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  ARG 16  16  16  ARG ARG A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  ILE 19  19  19  ILE ILE A . n 
A 1 20  ASN 20  20  20  ASN ASN A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  LEU 24  24  24  LEU LEU A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  LYS 29  29  29  LYS LYS A . n 
A 1 30  THR 30  30  30  THR THR A . n 
A 1 31  GLU 31  31  31  GLU GLU A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  ALA 33  33  33  ALA ALA A . n 
A 1 34  GLN 34  34  34  GLN GLN A . n 
A 1 35  LYS 35  35  35  LYS LYS A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  LYS 38  38  38  LYS LYS A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  ILE 40  40  40  ILE ILE A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  ASP 42  42  42  ASP ASP A . n 
A 1 43  TYR 43  43  43  TYR TYR A . n 
A 1 44  LEU 44  44  44  LEU LEU A . n 
A 1 45  ALA 45  45  45  ALA ALA A . n 
A 1 46  ALA 46  46  46  ALA ALA A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  LYS 48  48  48  LYS LYS A . n 
A 1 49  ASP 49  49  49  ASP ASP A . n 
A 1 50  GLU 50  50  50  GLU GLU A . n 
A 1 51  ARG 51  51  51  ARG ARG A . n 
A 1 52  ALA 52  52  52  ALA ALA A . n 
A 1 53  ARG 53  53  53  ARG ARG A . n 
A 1 54  ILE 54  54  54  ILE ILE A . n 
A 1 55  ARG 55  55  55  ARG ARG A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  GLU 57  57  57  GLU GLU A . n 
A 1 58  HIS 58  58  58  HIS HIS A . n 
A 1 59  ILE 59  59  59  ILE ILE A . n 
A 1 60  ILE 60  60  60  ILE ILE A . n 
A 1 61  ARG 61  61  61  ARG ARG A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  ASP 63  63  63  ASP ASP A . n 
A 1 64  TYR 64  64  64  TYR TYR A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  VAL 66  66  66  VAL VAL A . n 
A 1 67  GLU 67  67  67  GLU GLU A . n 
A 1 68  ALA 68  68  68  ALA ALA A . n 
A 1 69  MET 69  69  69  MET MET A . n 
A 1 70  GLU 70  70  70  GLU GLU A . n 
A 1 71  ILE 71  71  71  ILE ILE A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  TYR 75  75  75  TYR TYR A . n 
A 1 76  CYS 76  76  76  CYS CYS A . n 
A 1 77  ASP 77  77  77  ASP ASP A . n 
A 1 78  LEU 78  78  78  LEU LEU A . n 
A 1 79  LEU 79  79  79  LEU LEU A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  ARG 82  82  82  ARG ARG A . n 
A 1 83  PHE 83  83  83  PHE PHE A . n 
A 1 84  GLY 84  84  84  GLY GLY A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  ILE 86  86  86  ILE ILE A . n 
A 1 87  GLN 87  87  87  GLN GLN A . n 
A 1 88  SER 88  88  88  SER SER A . n 
A 1 89  MET 89  89  89  MET MET A . n 
A 1 90  LYS 90  90  90  LYS LYS A . n 
A 1 91  GLU 91  91  ?   ?   ?   A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  SER 94  94  94  SER SER A . n 
A 1 95  GLY 95  95  95  GLY GLY A . n 
A 1 96  LEU 96  96  96  LEU LEU A . n 
A 1 97  ALA 97  97  97  ALA ALA A . n 
A 1 98  GLU 98  98  98  GLU GLU A . n 
A 1 99  SER 99  99  99  SER SER A . n 
A 1 100 VAL 100 100 100 VAL VAL A . n 
A 1 101 SER 101 101 101 SER SER A . n 
A 1 102 THR 102 102 102 THR THR A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 ILE 104 104 104 ILE ILE A . n 
A 1 105 TRP 105 105 105 TRP TRP A . n 
A 1 106 ALA 106 106 106 ALA ALA A . n 
A 1 107 ALA 107 107 107 ALA ALA A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 ARG 109 109 109 ARG ARG A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 GLN 111 111 111 GLN GLN A . n 
A 1 112 SER 112 112 112 SER SER A . n 
A 1 113 GLU 113 113 113 GLU GLU A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 ALA 115 115 115 ALA ALA A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 LEU 117 117 117 LEU LEU A . n 
A 1 118 LYS 118 118 118 LYS LYS A . n 
A 1 119 ILE 119 119 119 ILE ILE A . n 
A 1 120 VAL 120 120 120 VAL VAL A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
A 1 122 ASP 122 122 122 ASP ASP A . n 
A 1 123 GLN 123 123 123 GLN GLN A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 CYS 125 125 125 CYS CYS A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 LYS 127 127 127 LYS LYS A . n 
A 1 128 TYR 128 128 128 TYR TYR A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 GLU 131 131 131 GLU GLU A . n 
A 1 132 TYR 132 132 132 TYR TYR A . n 
A 1 133 GLY 133 133 133 GLY GLY A . n 
A 1 134 LYS 134 134 134 LYS LYS A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 CYS 136 136 136 CYS CYS A . n 
A 1 137 ARG 137 137 137 ARG ARG A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 ASN 139 139 139 ASN ASN A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 ILE 141 141 141 ILE ILE A . n 
A 1 142 GLY 142 142 142 GLY GLY A . n 
A 1 143 THR 143 143 143 THR THR A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 ASN 145 145 145 ASN ASN A . n 
A 1 146 ASP 146 146 146 ASP ASP A . n 
A 1 147 ARG 147 147 147 ARG ARG A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 MET 149 149 149 MET MET A . n 
A 1 150 HIS 150 150 150 HIS HIS A . n 
A 1 151 LYS 151 151 151 LYS LYS A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 SER 153 153 153 SER SER A . n 
A 1 154 VAL 154 154 154 VAL VAL A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
A 1 156 ALA 156 156 156 ALA ALA A . n 
A 1 157 PRO 157 157 157 PRO PRO A . n 
A 1 158 PRO 158 158 158 PRO PRO A . n 
A 1 159 LYS 159 159 159 LYS LYS A . n 
A 1 160 ILE 160 160 160 ILE ILE A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 VAL 162 162 162 VAL VAL A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ARG 164 164 164 ARG ARG A . n 
A 1 165 TYR 165 165 165 TYR TYR A . n 
A 1 166 LEU 166 166 166 LEU LEU A . n 
A 1 167 ILE 167 167 167 ILE ILE A . n 
A 1 168 GLU 168 168 168 GLU GLU A . n 
A 1 169 ILE 169 169 169 ILE ILE A . n 
A 1 170 ALA 170 170 170 ALA ALA A . n 
A 1 171 LYS 171 171 171 LYS LYS A . n 
A 1 172 ASN 172 172 172 ASN ASN A . n 
A 1 173 TYR 173 173 173 TYR TYR A . n 
A 1 174 ASN 174 174 174 ASN ASN A . n 
A 1 175 VAL 175 175 175 VAL VAL A . n 
A 1 176 PRO 176 176 176 PRO PRO A . n 
A 1 177 TYR 177 177 177 TYR TYR A . n 
A 1 178 GLU 178 178 178 GLU GLU A . n 
A 1 179 PRO 179 179 179 PRO PRO A . n 
A 1 180 ASP 180 180 180 ASP ASP A . n 
A 1 181 SER 181 181 ?   ?   ?   A . n 
A 1 182 VAL 182 182 ?   ?   ?   A . n 
A 1 183 VAL 183 183 ?   ?   ?   A . n 
A 1 184 MET 184 184 ?   ?   ?   A . n 
A 1 185 ALA 185 185 ?   ?   ?   A . n 
A 1 186 GLU 186 186 ?   ?   ?   A . n 
A 1 187 ALA 187 187 ?   ?   ?   A . n 
A 1 188 PRO 188 188 ?   ?   ?   A . n 
A 1 189 PRO 189 189 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 GOL 1  190 1  GOL GOL A . 
C 3 HOH 1  191 1  HOH HOH A . 
C 3 HOH 2  192 2  HOH HOH A . 
C 3 HOH 3  193 3  HOH HOH A . 
C 3 HOH 4  194 5  HOH HOH A . 
C 3 HOH 5  195 6  HOH HOH A . 
C 3 HOH 6  196 7  HOH HOH A . 
C 3 HOH 7  197 8  HOH HOH A . 
C 3 HOH 8  198 9  HOH HOH A . 
C 3 HOH 9  199 14 HOH HOH A . 
C 3 HOH 10 200 18 HOH HOH A . 
C 3 HOH 11 201 20 HOH HOH A . 
C 3 HOH 12 202 23 HOH HOH A . 
C 3 HOH 13 203 25 HOH HOH A . 
C 3 HOH 14 204 28 HOH HOH A . 
C 3 HOH 15 205 30 HOH HOH A . 
C 3 HOH 16 206 35 HOH HOH A . 
C 3 HOH 17 207 36 HOH HOH A . 
C 3 HOH 18 208 37 HOH HOH A . 
C 3 HOH 19 209 38 HOH HOH A . 
C 3 HOH 20 210 39 HOH HOH A . 
C 3 HOH 21 211 40 HOH HOH A . 
C 3 HOH 22 212 41 HOH HOH A . 
C 3 HOH 23 213 42 HOH HOH A . 
C 3 HOH 24 214 44 HOH HOH A . 
C 3 HOH 25 215 48 HOH HOH A . 
C 3 HOH 26 216 49 HOH HOH A . 
C 3 HOH 27 217 50 HOH HOH A . 
C 3 HOH 28 218 51 HOH HOH A . 
C 3 HOH 29 219 53 HOH HOH A . 
C 3 HOH 30 220 54 HOH HOH A . 
C 3 HOH 31 221 57 HOH HOH A . 
C 3 HOH 32 222 59 HOH HOH A . 
C 3 HOH 33 223 61 HOH HOH A . 
C 3 HOH 34 224 62 HOH HOH A . 
C 3 HOH 35 225 63 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2850  ? 
1 MORE         -11   ? 
1 'SSA (A^2)'  16480 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z  1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-06-30 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-11-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Non-polymer description'   
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_software.classification'       
2 3 'Structure model' '_software.contact_author'       
3 3 'Structure model' '_software.contact_author_email' 
4 3 'Structure model' '_software.date'                 
5 3 'Structure model' '_software.language'             
6 3 'Structure model' '_software.location'             
7 3 'Structure model' '_software.name'                 
8 3 'Structure model' '_software.type'                 
9 3 'Structure model' '_software.version'              
# 
_diffrn_reflns.diffrn_id                   1 
_diffrn_reflns.pdbx_d_res_high             3.400 
_diffrn_reflns.pdbx_d_res_low              40.000 
_diffrn_reflns.pdbx_number_obs             5970 
_diffrn_reflns.pdbx_Rmerge_I_obs           0.074 
_diffrn_reflns.pdbx_Rsym_value             ? 
_diffrn_reflns.pdbx_chi_squared            1.00 
_diffrn_reflns.av_sigmaI_over_netI         13.47 
_diffrn_reflns.pdbx_redundancy             6.70 
_diffrn_reflns.pdbx_percent_possible_obs   88.50 
_diffrn_reflns.number                      40152 
_diffrn_reflns.pdbx_observed_criterion     ? 
_diffrn_reflns.limit_h_max                 ? 
_diffrn_reflns.limit_h_min                 ? 
_diffrn_reflns.limit_k_max                 ? 
_diffrn_reflns.limit_k_min                 ? 
_diffrn_reflns.limit_l_max                 ? 
_diffrn_reflns.limit_l_min                 ? 
# 
loop_
_pdbx_diffrn_reflns_shell.diffrn_id 
_pdbx_diffrn_reflns_shell.d_res_high 
_pdbx_diffrn_reflns_shell.d_res_low 
_pdbx_diffrn_reflns_shell.number_obs 
_pdbx_diffrn_reflns_shell.rejects 
_pdbx_diffrn_reflns_shell.Rmerge_I_obs 
_pdbx_diffrn_reflns_shell.Rsym_value 
_pdbx_diffrn_reflns_shell.chi_squared 
_pdbx_diffrn_reflns_shell.redundancy 
_pdbx_diffrn_reflns_shell.percent_possible_obs 
1 7.31 40.00 ? ? 0.043 ? 0.965 7.00 99.40  
1 5.81 7.31  ? ? 0.067 ? 0.885 7.20 99.90  
1 5.08 5.81  ? ? 0.085 ? 0.993 7.10 100.00 
1 4.61 5.08  ? ? 0.088 ? 0.987 7.10 99.60  
1 4.28 4.61  ? ? 0.098 ? 1.093 6.90 99.90  
1 4.03 4.28  ? ? 0.107 ? 0.911 6.80 95.30  
1 3.83 4.03  ? ? 0.125 ? 1.083 6.40 90.10  
1 3.66 3.83  ? ? 0.128 ? 1.173 6.10 76.10  
1 3.52 3.66  ? ? 0.167 ? 0.992 6.10 68.20  
1 3.40 3.52  ? ? 0.180 ? 1.005 5.80 56.50  
# 
loop_
_pdbx_phasing_MAD_set_site.id 
_pdbx_phasing_MAD_set_site.atom_type_symbol 
_pdbx_phasing_MAD_set_site.occupancy 
_pdbx_phasing_MAD_set_site.fract_x 
_pdbx_phasing_MAD_set_site.fract_y 
_pdbx_phasing_MAD_set_site.fract_z 
_pdbx_phasing_MAD_set_site.b_iso 
1 Se 0.961 0.987 0.366 0.026 60.000 
2 Se 0.696 0.251 0.526 0.034 60.000 
3 Se 0.483 0.709 0.963 0.063 60.000 
# 
_phasing.method   MAD 
# 
_phasing_MAD_clust.id           1 
_phasing_MAD_clust.expt_id      '3 wavelength' 
_phasing_MAD_clust.number_set   ? 
# 
_phasing_MAD_expt.id         '3 wavelength' 
_phasing_MAD_expt.mean_fom   ? 
# 
loop_
_phasing_MAD_set.clust_id 
_phasing_MAD_set.expt_id 
_phasing_MAD_set.set_id 
_phasing_MAD_set.wavelength 
_phasing_MAD_set.pdbx_f_prime_refined 
_phasing_MAD_set.pdbx_f_double_prime_refined 
1 '3 wavelength' 1 0.9785 -6.46 4.78 
1 '3 wavelength' 2 0.9184 -3.20 3.38 
1 '3 wavelength' 3 0.9792 -8.22 1.39 
# 
loop_
_phasing_set.id 
_phasing_set.pdbx_d_res_high 
_phasing_set.pdbx_d_res_low 
1 . . 
2 . . 
3 . . 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .     ?               package 'Zbyszek Otwinowski'    hkl@hkl-xray.com      'data reduction'  http://www.hkl-xray.com/ 
?          ? 1 
SCALEPACK   .     ?               package 'Zbyszek Otwinowski'    hkl@hkl-xray.com      'data scaling'    http://www.hkl-xray.com/ 
?          ? 2 
SOLVE       2.13  2-Jul-2007      program 'Tom Terwilliger'       terwilliger@LANL.gov  phasing           
http://www.solve.lanl.gov/                   ?          ? 3 
RESOLVE     .     ?               program 'Thomas C. Terwilliger' terwilliger@lanl.gov  phasing           
http://www.solve.lanl.gov/                   ?          ? 4 
REFMAC      .     ?               program 'Garib N. Murshudov'    garib@ysbl.york.ac.uk refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 5 
PDB_EXTRACT 3.006 'June 11, 2008' package PDB                     help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 6 
MAR345dtb   .     ?               ?       ?                       ?                     'data collection' ? ?          ? 7 
HKL-2000    .     ?               ?       ?                       ?                     'data reduction'  ? ?          ? 8 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 48  ? ? 88.40   12.61   
2 1 SER A 129 ? ? 81.15   148.09  
3 1 CYS A 136 ? ? -90.30  -60.66  
4 1 ASN A 139 ? ? -49.25  75.63   
5 1 SER A 153 ? ? -69.81  95.57   
6 1 GLU A 155 ? ? -102.75 -167.40 
7 1 ARG A 164 ? ? 50.86   -95.95  
8 1 PRO A 179 ? ? -59.87  174.80  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   GLU 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    163 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   ARG 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    164 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            62.58 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 1   ? A GLY 1   
2  1 Y 1 A HIS 2   ? A HIS 2   
3  1 Y 1 A MET 3   ? A MET 3   
4  1 Y 1 A LEU 4   ? A LEU 4   
5  1 Y 1 A GLU 91  ? A GLU 91  
6  1 Y 1 A SER 181 ? A SER 181 
7  1 Y 1 A VAL 182 ? A VAL 182 
8  1 Y 1 A VAL 183 ? A VAL 183 
9  1 Y 1 A MET 184 ? A MET 184 
10 1 Y 1 A ALA 185 ? A ALA 185 
11 1 Y 1 A GLU 186 ? A GLU 186 
12 1 Y 1 A ALA 187 ? A ALA 187 
13 1 Y 1 A PRO 188 ? A PRO 188 
14 1 Y 1 A PRO 189 ? A PRO 189 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 GLYCEROL GOL 
3 water    HOH 
#