data_3FTN
# 
_entry.id   3FTN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3FTN         pdb_00003ftn 10.2210/pdb3ftn/pdb 
RCSB  RCSB051027   ?            ?                   
WWPDB D_1000051027 ?            ?                   
# 
_pdbx_database_status.entry_id                        3FTN 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2009-01-13 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Frolow, F.'   1 
'Goihberg, E.' 2 
'Shimon, L.'   3 
'Burstein, Y.' 4 
# 
_citation.id                        primary 
_citation.title                     
;Biochemical and structural properties of chimeras constructed by exchange of cofactor-binding domains in alcohol dehydrogenases from thermophilic and mesophilic microorganisms.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            49 
_citation.page_first                1943 
_citation.page_last                 1953 
_citation.year                      2010 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20102159 
_citation.pdbx_database_id_DOI      10.1021/bi901730x 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Goihberg, E.' 1 ? 
primary 'Peretz, M.'   2 ? 
primary 'Tel-Or, S.'   3 ? 
primary 'Dym, O.'      4 ? 
primary 'Shimon, L.'   5 ? 
primary 'Frolow, F.'   6 ? 
primary 'Burstein, Y.' 7 ? 
# 
_cell.entry_id           3FTN 
_cell.length_a           79.376 
_cell.length_b           83.003 
_cell.length_c           119.691 
_cell.angle_alpha        90.00 
_cell.angle_beta         99.93 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3FTN 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'NADP-dependent alcohol dehydrogenase' 37854.195 4   1.1.1.2 'Q165E, S254K' ? 
'Residues 153-295 inserted from alcohol dehydrogenase of Clostridium beijerinckii' 
2 non-polymer syn 'ZINC ION'                             65.409    4   ?       ?              ? ? 
3 non-polymer syn 'ACETATE ION'                          59.044    4   ?       ?              ? ? 
4 non-polymer syn 1,2-ETHANEDIOL                         62.068    11  ?       ?              ? ? 
5 non-polymer syn 'CHLORIDE ION'                         35.453    6   ?       ?              ? ? 
6 water       nat water                                  18.015    905 ?       ?              ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKGFAMLSIGKVGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGHEAVGEVVEVGSEVKDFKPGDR
VVVPAITPDWRTSEVQRGYHQHSGGMLAGWKFSNVKDGVFGEFFHVNDADMNLAHLPKEIPLEAAVMIPDMMTTGFHGAE
LADIEMGSSVVVIGIGAVGLMGIAGAKLRGAGRIIGVGSRPICVEAAKFYGATDILNYKNGHIVDQVMKLTNGKGVDRVI
MAGGGSETLSQAVKMVKPGGIISNINYHGSGDALLIPRVEWGCGMAHKTIKGGLCPGGRLRMERLIDLVFYKRVDPSKLV
THVFRGFDNIEKAFMLMKDKPKDLIKPVVILA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKGFAMLSIGKVGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGHEAVGEVVEVGSEVKDFKPGDR
VVVPAITPDWRTSEVQRGYHQHSGGMLAGWKFSNVKDGVFGEFFHVNDADMNLAHLPKEIPLEAAVMIPDMMTTGFHGAE
LADIEMGSSVVVIGIGAVGLMGIAGAKLRGAGRIIGVGSRPICVEAAKFYGATDILNYKNGHIVDQVMKLTNGKGVDRVI
MAGGGSETLSQAVKMVKPGGIISNINYHGSGDALLIPRVEWGCGMAHKTIKGGLCPGGRLRMERLIDLVFYKRVDPSKLV
THVFRGFDNIEKAFMLMKDKPKDLIKPVVILA
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   GLY n 
1 4   PHE n 
1 5   ALA n 
1 6   MET n 
1 7   LEU n 
1 8   SER n 
1 9   ILE n 
1 10  GLY n 
1 11  LYS n 
1 12  VAL n 
1 13  GLY n 
1 14  TRP n 
1 15  ILE n 
1 16  GLU n 
1 17  LYS n 
1 18  GLU n 
1 19  LYS n 
1 20  PRO n 
1 21  ALA n 
1 22  PRO n 
1 23  GLY n 
1 24  PRO n 
1 25  PHE n 
1 26  ASP n 
1 27  ALA n 
1 28  ILE n 
1 29  VAL n 
1 30  ARG n 
1 31  PRO n 
1 32  LEU n 
1 33  ALA n 
1 34  VAL n 
1 35  ALA n 
1 36  PRO n 
1 37  CYS n 
1 38  THR n 
1 39  SER n 
1 40  ASP n 
1 41  ILE n 
1 42  HIS n 
1 43  THR n 
1 44  VAL n 
1 45  PHE n 
1 46  GLU n 
1 47  GLY n 
1 48  ALA n 
1 49  ILE n 
1 50  GLY n 
1 51  GLU n 
1 52  ARG n 
1 53  HIS n 
1 54  ASN n 
1 55  MET n 
1 56  ILE n 
1 57  LEU n 
1 58  GLY n 
1 59  HIS n 
1 60  GLU n 
1 61  ALA n 
1 62  VAL n 
1 63  GLY n 
1 64  GLU n 
1 65  VAL n 
1 66  VAL n 
1 67  GLU n 
1 68  VAL n 
1 69  GLY n 
1 70  SER n 
1 71  GLU n 
1 72  VAL n 
1 73  LYS n 
1 74  ASP n 
1 75  PHE n 
1 76  LYS n 
1 77  PRO n 
1 78  GLY n 
1 79  ASP n 
1 80  ARG n 
1 81  VAL n 
1 82  VAL n 
1 83  VAL n 
1 84  PRO n 
1 85  ALA n 
1 86  ILE n 
1 87  THR n 
1 88  PRO n 
1 89  ASP n 
1 90  TRP n 
1 91  ARG n 
1 92  THR n 
1 93  SER n 
1 94  GLU n 
1 95  VAL n 
1 96  GLN n 
1 97  ARG n 
1 98  GLY n 
1 99  TYR n 
1 100 HIS n 
1 101 GLN n 
1 102 HIS n 
1 103 SER n 
1 104 GLY n 
1 105 GLY n 
1 106 MET n 
1 107 LEU n 
1 108 ALA n 
1 109 GLY n 
1 110 TRP n 
1 111 LYS n 
1 112 PHE n 
1 113 SER n 
1 114 ASN n 
1 115 VAL n 
1 116 LYS n 
1 117 ASP n 
1 118 GLY n 
1 119 VAL n 
1 120 PHE n 
1 121 GLY n 
1 122 GLU n 
1 123 PHE n 
1 124 PHE n 
1 125 HIS n 
1 126 VAL n 
1 127 ASN n 
1 128 ASP n 
1 129 ALA n 
1 130 ASP n 
1 131 MET n 
1 132 ASN n 
1 133 LEU n 
1 134 ALA n 
1 135 HIS n 
1 136 LEU n 
1 137 PRO n 
1 138 LYS n 
1 139 GLU n 
1 140 ILE n 
1 141 PRO n 
1 142 LEU n 
1 143 GLU n 
1 144 ALA n 
1 145 ALA n 
1 146 VAL n 
1 147 MET n 
1 148 ILE n 
1 149 PRO n 
1 150 ASP n 
1 151 MET n 
1 152 MET n 
1 153 THR n 
1 154 THR n 
1 155 GLY n 
1 156 PHE n 
1 157 HIS n 
1 158 GLY n 
1 159 ALA n 
1 160 GLU n 
1 161 LEU n 
1 162 ALA n 
1 163 ASP n 
1 164 ILE n 
1 165 GLU n 
1 166 MET n 
1 167 GLY n 
1 168 SER n 
1 169 SER n 
1 170 VAL n 
1 171 VAL n 
1 172 VAL n 
1 173 ILE n 
1 174 GLY n 
1 175 ILE n 
1 176 GLY n 
1 177 ALA n 
1 178 VAL n 
1 179 GLY n 
1 180 LEU n 
1 181 MET n 
1 182 GLY n 
1 183 ILE n 
1 184 ALA n 
1 185 GLY n 
1 186 ALA n 
1 187 LYS n 
1 188 LEU n 
1 189 ARG n 
1 190 GLY n 
1 191 ALA n 
1 192 GLY n 
1 193 ARG n 
1 194 ILE n 
1 195 ILE n 
1 196 GLY n 
1 197 VAL n 
1 198 GLY n 
1 199 SER n 
1 200 ARG n 
1 201 PRO n 
1 202 ILE n 
1 203 CYS n 
1 204 VAL n 
1 205 GLU n 
1 206 ALA n 
1 207 ALA n 
1 208 LYS n 
1 209 PHE n 
1 210 TYR n 
1 211 GLY n 
1 212 ALA n 
1 213 THR n 
1 214 ASP n 
1 215 ILE n 
1 216 LEU n 
1 217 ASN n 
1 218 TYR n 
1 219 LYS n 
1 220 ASN n 
1 221 GLY n 
1 222 HIS n 
1 223 ILE n 
1 224 VAL n 
1 225 ASP n 
1 226 GLN n 
1 227 VAL n 
1 228 MET n 
1 229 LYS n 
1 230 LEU n 
1 231 THR n 
1 232 ASN n 
1 233 GLY n 
1 234 LYS n 
1 235 GLY n 
1 236 VAL n 
1 237 ASP n 
1 238 ARG n 
1 239 VAL n 
1 240 ILE n 
1 241 MET n 
1 242 ALA n 
1 243 GLY n 
1 244 GLY n 
1 245 GLY n 
1 246 SER n 
1 247 GLU n 
1 248 THR n 
1 249 LEU n 
1 250 SER n 
1 251 GLN n 
1 252 ALA n 
1 253 VAL n 
1 254 LYS n 
1 255 MET n 
1 256 VAL n 
1 257 LYS n 
1 258 PRO n 
1 259 GLY n 
1 260 GLY n 
1 261 ILE n 
1 262 ILE n 
1 263 SER n 
1 264 ASN n 
1 265 ILE n 
1 266 ASN n 
1 267 TYR n 
1 268 HIS n 
1 269 GLY n 
1 270 SER n 
1 271 GLY n 
1 272 ASP n 
1 273 ALA n 
1 274 LEU n 
1 275 LEU n 
1 276 ILE n 
1 277 PRO n 
1 278 ARG n 
1 279 VAL n 
1 280 GLU n 
1 281 TRP n 
1 282 GLY n 
1 283 CYS n 
1 284 GLY n 
1 285 MET n 
1 286 ALA n 
1 287 HIS n 
1 288 LYS n 
1 289 THR n 
1 290 ILE n 
1 291 LYS n 
1 292 GLY n 
1 293 GLY n 
1 294 LEU n 
1 295 CYS n 
1 296 PRO n 
1 297 GLY n 
1 298 GLY n 
1 299 ARG n 
1 300 LEU n 
1 301 ARG n 
1 302 MET n 
1 303 GLU n 
1 304 ARG n 
1 305 LEU n 
1 306 ILE n 
1 307 ASP n 
1 308 LEU n 
1 309 VAL n 
1 310 PHE n 
1 311 TYR n 
1 312 LYS n 
1 313 ARG n 
1 314 VAL n 
1 315 ASP n 
1 316 PRO n 
1 317 SER n 
1 318 LYS n 
1 319 LEU n 
1 320 VAL n 
1 321 THR n 
1 322 HIS n 
1 323 VAL n 
1 324 PHE n 
1 325 ARG n 
1 326 GLY n 
1 327 PHE n 
1 328 ASP n 
1 329 ASN n 
1 330 ILE n 
1 331 GLU n 
1 332 LYS n 
1 333 ALA n 
1 334 PHE n 
1 335 MET n 
1 336 LEU n 
1 337 MET n 
1 338 LYS n 
1 339 ASP n 
1 340 LYS n 
1 341 PRO n 
1 342 LYS n 
1 343 ASP n 
1 344 LEU n 
1 345 ILE n 
1 346 LYS n 
1 347 PRO n 
1 348 VAL n 
1 349 VAL n 
1 350 ILE n 
1 351 LEU n 
1 352 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 1   152 ? ? 'adh, ADH1' ? ? ? ? ? ? 'Thermoanaerobacter brockii' 29323 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? 
? ? TG-I ? ? ? ? ? ? ? plasmid ? ? ? BS-P58 ? ? 
1 3 sample ? 296 352 ? ? 'adh, ADH1' ? ? ? ? ? ? 'Thermoanaerobacter brockii' 29323 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? 
? ? TG-I ? ? ? ? ? ? ? plasmid ? ? ? BS-P58 ? ? 
1 2 sample ? 153 295 ? ? 'adh, ADH1' ? ? ? ? ? ? 'Clostridium beijerinckii'   1520  ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? 
? ? TG-I ? ? ? ? ? ? ? plasmid ? ? ? BS-P58 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP ADH_THEBR P14941 1 
;MKGFAMLSIGKVGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGHEAVGEVVEVGSEVKDFKPGDR
VVVPAITPDWRTSEVQRGYHQHSGGMLAGWKFSNVKDGVFGEFFHVNDADMNLAHLPKEIPLEAAVMIPDMM
;
1   ? 
2 UNP ADH_CLOBE P25984 1 
;TTGFHGAELADIQMGSSVVVIGIGAVGLMGIAGAKLRGAGRIIGVGSRPICVEAAKFYGATDILNYKNGHIVDQVMKLTN
GKGVDRVIMAGGGSETLSQAVSMVKPGGIISNINYHGSGDALLIPRVEWGCGMAHKTIKGGLC
;
153 ? 
3 UNP ADH_THEBR P14941 1 PGGRLRMERLIDLVFYKRVDPSKLVTHVFRGFDNIEKAFMLMKDKPKDLIKPVVILA 296 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3FTN A 1   ? 152 ? P14941 1   ? 152 ? 1   152 
2  2 3FTN A 153 ? 295 ? P25984 153 ? 295 ? 153 295 
3  3 3FTN A 296 ? 352 ? P14941 296 ? 352 ? 296 352 
4  1 3FTN B 1   ? 152 ? P14941 1   ? 152 ? 1   152 
5  2 3FTN B 153 ? 295 ? P25984 153 ? 295 ? 153 295 
6  3 3FTN B 296 ? 352 ? P14941 296 ? 352 ? 296 352 
7  1 3FTN C 1   ? 152 ? P14941 1   ? 152 ? 1   152 
8  2 3FTN C 153 ? 295 ? P25984 153 ? 295 ? 153 295 
9  3 3FTN C 296 ? 352 ? P14941 296 ? 352 ? 296 352 
10 1 3FTN D 1   ? 152 ? P14941 1   ? 152 ? 1   152 
11 2 3FTN D 153 ? 295 ? P25984 153 ? 295 ? 153 295 
12 3 3FTN D 296 ? 352 ? P14941 296 ? 352 ? 296 352 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2  3FTN GLU A 165 ? UNP P25984 GLN 165 'engineered mutation' 165 1 
2  3FTN LYS A 254 ? UNP P25984 SER 254 'engineered mutation' 254 2 
5  3FTN GLU B 165 ? UNP P25984 GLN 165 'engineered mutation' 165 3 
5  3FTN LYS B 254 ? UNP P25984 SER 254 'engineered mutation' 254 4 
8  3FTN GLU C 165 ? UNP P25984 GLN 165 'engineered mutation' 165 5 
8  3FTN LYS C 254 ? UNP P25984 SER 254 'engineered mutation' 254 6 
11 3FTN GLU D 165 ? UNP P25984 GLN 165 'engineered mutation' 165 7 
11 3FTN LYS D 254 ? UNP P25984 SER 254 'engineered mutation' 254 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer         . 'ACETATE ION'   ?                 'C2 H3 O2 -1'    59.044  
ALA 'L-peptide linking' y ALANINE         ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ?                 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL  'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE       ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ?                 'Zn 2'           65.409  
# 
_exptl.entry_id          3FTN 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.57 
_exptl_crystal.density_percent_sol   52.07 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;8 mg/mL protein, 25 mM Tris-HCl, 50 mM NaCl, 0.1 mM DTT, 50 mM ZnCl2 (pH=7.5)] was mixed with 1 microliter of reservoir solution [16% (w/v) PEG8K, 200 mM magnesium acetate tetrahydrate, 100 mM Cacodylate buffer (pH 6.5), vapor diffusion, hanging drop, temperature 298K
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2003-06-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.933 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.933 
# 
_reflns.entry_id                     3FTN 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.200 
_reflns.number_obs                   76750 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.800 
_reflns.pdbx_Rmerge_I_obs            0.092 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.597 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.percent_possible_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
2.20 2.24  99.10 0.349 ? ? ? ? ? ? ? ? ? ? 1  
2.24 2.28  99.40 0.323 ? ? ? ? ? ? ? ? ? ? 2  
2.28 2.32  99.20 0.292 ? ? ? ? ? ? ? ? ? ? 3  
2.32 2.37  99.20 0.271 ? ? ? ? ? ? ? ? ? ? 4  
2.37 2.42  99.20 0.248 ? ? ? ? ? ? ? ? ? ? 5  
2.42 2.48  99.10 0.228 ? ? ? ? ? ? ? ? ? ? 6  
2.48 2.54  98.90 0.205 ? ? ? ? ? ? ? ? ? ? 7  
2.54 2.61  98.80 0.190 ? ? ? ? ? ? ? ? ? ? 8  
2.61 2.69  98.70 0.172 ? ? ? ? ? ? ? ? ? ? 9  
2.69 2.77  98.40 0.156 ? ? ? ? ? ? ? ? ? ? 10 
2.77 2.87  98.70 0.140 ? ? ? ? ? ? ? ? ? ? 11 
2.87 2.99  98.70 0.126 ? ? ? ? ? ? ? ? ? ? 12 
2.99 3.12  98.10 0.111 ? ? ? ? ? ? ? ? ? ? 13 
3.12 3.29  97.90 0.102 ? ? ? ? ? ? ? ? ? ? 14 
3.29 3.49  97.20 0.093 ? ? ? ? ? ? ? ? ? ? 15 
3.49 3.76  96.80 0.086 ? ? ? ? ? ? ? ? ? ? 16 
3.76 4.14  95.30 0.079 ? ? ? ? ? ? ? ? ? ? 17 
4.14 4.74  91.70 0.070 ? ? ? ? ? ? ? ? ? ? 18 
4.74 5.97  97.40 0.066 ? ? ? ? ? ? ? ? ? ? 19 
5.97 50.00 95.40 0.058 ? ? ? ? ? ? ? ? ? ? 20 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3FTN 
_refine.ls_number_reflns_obs                     74329 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.02 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             39.180 
_refine.ls_d_res_high                            2.192 
_refine.ls_percent_reflns_obs                    94.40 
_refine.ls_R_factor_obs                          0.1663 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1647 
_refine.ls_R_factor_R_free                       0.2282 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.61 
_refine.ls_number_reflns_R_free                  1942 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            0.35 
_refine.occupancy_max                            1.00 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               43.563 
_refine.aniso_B[1][1]                            1.834 
_refine.aniso_B[2][2]                            -9.302 
_refine.aniso_B[3][3]                            7.429 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            -13.613 
_refine.aniso_B[2][3]                            -0.000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.359 
_refine.solvent_model_param_bsol                 82.419 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            1.37 
_refine.pdbx_overall_phase_error                 22.96 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10604 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         70 
_refine_hist.number_atoms_solvent             905 
_refine_hist.number_atoms_total               11579 
_refine_hist.d_res_high                       2.192 
_refine_hist.d_res_low                        39.180 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.008  ? ? 10879 'X-RAY DIFFRACTION' ? 
f_angle_d          1.090  ? ? 14646 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 15.738 ? ? 3997  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.071  ? ? 1616  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 1892  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.1920 2.2703  6638 0.1954 87.00 0.2957 . . 181 . . . . 
'X-RAY DIFFRACTION' . 2.2703 2.3612  7029 0.1734 92.00 0.2556 . . 193 . . . . 
'X-RAY DIFFRACTION' . 2.3612 2.4687  7145 0.1602 93.00 0.2676 . . 187 . . . . 
'X-RAY DIFFRACTION' . 2.4687 2.5988  7254 0.1562 95.00 0.2406 . . 192 . . . . 
'X-RAY DIFFRACTION' . 2.5988 2.7616  7321 0.1489 96.00 0.2321 . . 197 . . . . 
'X-RAY DIFFRACTION' . 2.7616 2.9747  7420 0.1578 97.00 0.2275 . . 198 . . . . 
'X-RAY DIFFRACTION' . 2.9747 3.2740  7404 0.1650 97.00 0.2346 . . 200 . . . . 
'X-RAY DIFFRACTION' . 3.2740 3.7474  7431 0.1519 97.00 0.2081 . . 198 . . . . 
'X-RAY DIFFRACTION' . 3.7474 4.7201  7204 0.1397 93.00 0.1984 . . 194 . . . . 
'X-RAY DIFFRACTION' . 4.7201 39.1862 7541 0.1645 96.00 0.2180 . . 202 . . . . 
# 
_struct.entry_id                  3FTN 
_struct.title                     
;Q165E/S254K Double Mutant Chimera of alcohol dehydrogenase by exchange of the cofactor binding domain res 153-295 of T. brockii ADH by C. beijerinckii ADH
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3FTN 
_struct_keywords.text            
'oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, Metal-binding, NADP, Oxidoreductase, Zinc' 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 2 ? 
F  N N 3 ? 
G  N N 4 ? 
H  N N 4 ? 
I  N N 4 ? 
J  N N 4 ? 
K  N N 4 ? 
L  N N 5 ? 
M  N N 2 ? 
N  N N 3 ? 
O  N N 4 ? 
P  N N 5 ? 
Q  N N 4 ? 
R  N N 5 ? 
S  N N 5 ? 
T  N N 4 ? 
U  N N 4 ? 
V  N N 2 ? 
W  N N 3 ? 
X  N N 3 ? 
Y  N N 5 ? 
Z  N N 4 ? 
AA N N 4 ? 
BA N N 2 ? 
CA N N 5 ? 
DA N N 6 ? 
EA N N 6 ? 
FA N N 6 ? 
GA N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  CYS A 37  ? GLY A 47  ? CYS A 37  GLY A 47  1 ? 11 
HELX_P HELX_P2  2  THR A 92  ? GLY A 98  ? THR A 92  GLY A 98  1 ? 7  
HELX_P HELX_P3  3  TYR A 99  ? SER A 103 ? TYR A 99  SER A 103 5 ? 5  
HELX_P HELX_P4  4  ASP A 128 ? LEU A 133 ? ASP A 128 LEU A 133 1 ? 6  
HELX_P HELX_P5  5  PRO A 141 ? VAL A 146 ? PRO A 141 VAL A 146 1 ? 6  
HELX_P HELX_P6  6  ASP A 150 ? ALA A 162 ? ASP A 150 ALA A 162 1 ? 13 
HELX_P HELX_P7  7  GLY A 176 ? LEU A 188 ? GLY A 176 LEU A 188 1 ? 13 
HELX_P HELX_P8  8  ARG A 200 ? GLY A 211 ? ARG A 200 GLY A 211 1 ? 12 
HELX_P HELX_P9  9  ASN A 217 ? GLY A 221 ? ASN A 217 GLY A 221 5 ? 5  
HELX_P HELX_P10 10 HIS A 222 ? THR A 231 ? HIS A 222 THR A 231 1 ? 10 
HELX_P HELX_P11 11 SER A 246 ? MET A 255 ? SER A 246 MET A 255 1 ? 10 
HELX_P HELX_P12 12 TRP A 281 ? MET A 285 ? TRP A 281 MET A 285 5 ? 5  
HELX_P HELX_P13 13 GLY A 297 ? TYR A 311 ? GLY A 297 TYR A 311 1 ? 15 
HELX_P HELX_P14 14 ASP A 315 ? LYS A 318 ? ASP A 315 LYS A 318 5 ? 4  
HELX_P HELX_P15 15 ASP A 328 ? LYS A 340 ? ASP A 328 LYS A 340 1 ? 13 
HELX_P HELX_P16 16 CYS B 37  ? GLY B 47  ? CYS B 37  GLY B 47  1 ? 11 
HELX_P HELX_P17 17 THR B 92  ? ARG B 97  ? THR B 92  ARG B 97  1 ? 6  
HELX_P HELX_P18 18 TYR B 99  ? SER B 103 ? TYR B 99  SER B 103 5 ? 5  
HELX_P HELX_P19 19 ASP B 128 ? LEU B 133 ? ASP B 128 LEU B 133 1 ? 6  
HELX_P HELX_P20 20 PRO B 141 ? VAL B 146 ? PRO B 141 VAL B 146 1 ? 6  
HELX_P HELX_P21 21 ASP B 150 ? ALA B 162 ? ASP B 150 ALA B 162 1 ? 13 
HELX_P HELX_P22 22 GLY B 176 ? ARG B 189 ? GLY B 176 ARG B 189 1 ? 14 
HELX_P HELX_P23 23 ARG B 200 ? TYR B 210 ? ARG B 200 TYR B 210 1 ? 11 
HELX_P HELX_P24 24 ASN B 217 ? GLY B 221 ? ASN B 217 GLY B 221 5 ? 5  
HELX_P HELX_P25 25 HIS B 222 ? THR B 231 ? HIS B 222 THR B 231 1 ? 10 
HELX_P HELX_P26 26 SER B 246 ? MET B 255 ? SER B 246 MET B 255 1 ? 10 
HELX_P HELX_P27 27 VAL B 279 ? MET B 285 ? VAL B 279 MET B 285 5 ? 7  
HELX_P HELX_P28 28 GLY B 297 ? TYR B 311 ? GLY B 297 TYR B 311 1 ? 15 
HELX_P HELX_P29 29 ASP B 315 ? LYS B 318 ? ASP B 315 LYS B 318 5 ? 4  
HELX_P HELX_P30 30 ASP B 328 ? ASP B 339 ? ASP B 328 ASP B 339 1 ? 12 
HELX_P HELX_P31 31 CYS C 37  ? GLU C 46  ? CYS C 37  GLU C 46  1 ? 10 
HELX_P HELX_P32 32 THR C 92  ? GLY C 98  ? THR C 92  GLY C 98  1 ? 7  
HELX_P HELX_P33 33 TYR C 99  ? SER C 103 ? TYR C 99  SER C 103 5 ? 5  
HELX_P HELX_P34 34 ASP C 128 ? LEU C 133 ? ASP C 128 LEU C 133 1 ? 6  
HELX_P HELX_P35 35 PRO C 141 ? VAL C 146 ? PRO C 141 VAL C 146 1 ? 6  
HELX_P HELX_P36 36 ASP C 150 ? ALA C 162 ? ASP C 150 ALA C 162 1 ? 13 
HELX_P HELX_P37 37 GLY C 176 ? LEU C 188 ? GLY C 176 LEU C 188 1 ? 13 
HELX_P HELX_P38 38 ARG C 200 ? GLY C 211 ? ARG C 200 GLY C 211 1 ? 12 
HELX_P HELX_P39 39 HIS C 222 ? THR C 231 ? HIS C 222 THR C 231 1 ? 10 
HELX_P HELX_P40 40 SER C 246 ? MET C 255 ? SER C 246 MET C 255 1 ? 10 
HELX_P HELX_P41 41 VAL C 279 ? MET C 285 ? VAL C 279 MET C 285 5 ? 7  
HELX_P HELX_P42 42 GLY C 297 ? TYR C 311 ? GLY C 297 TYR C 311 1 ? 15 
HELX_P HELX_P43 43 ASP C 315 ? LYS C 318 ? ASP C 315 LYS C 318 5 ? 4  
HELX_P HELX_P44 44 ASP C 328 ? LYS C 340 ? ASP C 328 LYS C 340 1 ? 13 
HELX_P HELX_P45 45 CYS D 37  ? GLY D 47  ? CYS D 37  GLY D 47  1 ? 11 
HELX_P HELX_P46 46 THR D 92  ? GLY D 98  ? THR D 92  GLY D 98  1 ? 7  
HELX_P HELX_P47 47 TYR D 99  ? SER D 103 ? TYR D 99  SER D 103 5 ? 5  
HELX_P HELX_P48 48 ASP D 128 ? LEU D 133 ? ASP D 128 LEU D 133 1 ? 6  
HELX_P HELX_P49 49 PRO D 141 ? VAL D 146 ? PRO D 141 VAL D 146 1 ? 6  
HELX_P HELX_P50 50 ASP D 150 ? ALA D 162 ? ASP D 150 ALA D 162 1 ? 13 
HELX_P HELX_P51 51 GLY D 176 ? ARG D 189 ? GLY D 176 ARG D 189 1 ? 14 
HELX_P HELX_P52 52 ARG D 200 ? GLY D 211 ? ARG D 200 GLY D 211 1 ? 12 
HELX_P HELX_P53 53 HIS D 222 ? THR D 231 ? HIS D 222 THR D 231 1 ? 10 
HELX_P HELX_P54 54 SER D 246 ? MET D 255 ? SER D 246 MET D 255 1 ? 10 
HELX_P HELX_P55 55 TRP D 281 ? MET D 285 ? TRP D 281 MET D 285 5 ? 5  
HELX_P HELX_P56 56 GLY D 297 ? TYR D 311 ? GLY D 297 TYR D 311 1 ? 15 
HELX_P HELX_P57 57 ASP D 315 ? LYS D 318 ? ASP D 315 LYS D 318 5 ? 4  
HELX_P HELX_P58 58 ASP D 328 ? LYS D 340 ? ASP D 328 LYS D 340 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A  CYS 37  SG  ? ? ? 1_555 E  ZN  . ZN ? ? A CYS 37  A ZN  354 1_555 ? ? ? ? ? ? ? 2.359 ? ? 
metalc2  metalc ? ? A  HIS 59  NE2 ? ? ? 1_555 E  ZN  . ZN ? ? A HIS 59  A ZN  354 1_555 ? ? ? ? ? ? ? 2.126 ? ? 
metalc3  metalc ? ? A  ASP 150 OD2 ? ? ? 1_555 E  ZN  . ZN ? ? A ASP 150 A ZN  354 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
metalc4  metalc ? ? F  ACT .   OXT ? ? ? 1_555 E  ZN  . ZN ? ? A ACT 353 A ZN  354 1_555 ? ? ? ? ? ? ? 2.306 ? ? 
metalc5  metalc ? ? B  CYS 37  SG  ? ? ? 1_555 M  ZN  . ZN ? ? B CYS 37  B ZN  355 1_555 ? ? ? ? ? ? ? 2.335 ? ? 
metalc6  metalc ? ? B  HIS 59  NE2 ? ? ? 1_555 M  ZN  . ZN ? ? B HIS 59  B ZN  355 1_555 ? ? ? ? ? ? ? 2.200 ? ? 
metalc7  metalc ? ? B  ASP 150 OD2 ? ? ? 1_555 M  ZN  . ZN ? ? B ASP 150 B ZN  355 1_555 ? ? ? ? ? ? ? 1.933 ? ? 
metalc8  metalc ? ? N  ACT .   OXT ? ? ? 1_555 M  ZN  . ZN ? ? B ACT 353 B ZN  355 1_555 ? ? ? ? ? ? ? 2.502 ? ? 
metalc9  metalc ? ? C  CYS 37  SG  ? ? ? 1_555 V  ZN  . ZN ? ? C CYS 37  C ZN  353 1_555 ? ? ? ? ? ? ? 2.382 ? ? 
metalc10 metalc ? ? C  HIS 59  NE2 ? ? ? 1_555 V  ZN  . ZN ? ? C HIS 59  C ZN  353 1_555 ? ? ? ? ? ? ? 2.106 ? ? 
metalc11 metalc ? ? C  ASP 150 OD2 ? ? ? 1_555 V  ZN  . ZN ? ? C ASP 150 C ZN  353 1_555 ? ? ? ? ? ? ? 2.002 ? ? 
metalc12 metalc ? ? V  ZN  .   ZN  ? ? ? 1_555 X  ACT . O  ? ? C ZN  353 C ACT 355 1_555 ? ? ? ? ? ? ? 2.615 ? ? 
metalc13 metalc ? ? D  CYS 37  SG  ? ? ? 1_555 BA ZN  . ZN ? ? D CYS 37  D ZN  357 1_555 ? ? ? ? ? ? ? 2.320 ? ? 
metalc14 metalc ? ? D  HIS 59  NE2 ? ? ? 1_555 BA ZN  . ZN ? ? D HIS 59  D ZN  357 1_555 ? ? ? ? ? ? ? 2.226 ? ? 
metalc15 metalc ? ? D  ASP 150 OD2 ? ? ? 1_555 BA ZN  . ZN ? ? D ASP 150 D ZN  357 1_555 ? ? ? ? ? ? ? 2.082 ? ? 
metalc16 metalc ? ? BA ZN  .   ZN  ? ? ? 1_555 GA HOH . O  ? ? D ZN  357 D HOH 395 1_555 ? ? ? ? ? ? ? 2.271 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 5 ? 
C ? 4 ? 
D ? 6 ? 
E ? 2 ? 
F ? 3 ? 
G ? 5 ? 
H ? 4 ? 
I ? 6 ? 
J ? 2 ? 
K ? 3 ? 
L ? 5 ? 
M ? 4 ? 
N ? 6 ? 
O ? 3 ? 
P ? 5 ? 
Q ? 4 ? 
R ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? parallel      
I 1 2 ? parallel      
I 2 3 ? parallel      
I 3 4 ? parallel      
I 4 5 ? parallel      
I 5 6 ? parallel      
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
L 4 5 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
M 3 4 ? parallel      
N 1 2 ? parallel      
N 2 3 ? parallel      
N 3 4 ? parallel      
N 4 5 ? parallel      
N 5 6 ? parallel      
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
P 3 4 ? anti-parallel 
P 4 5 ? anti-parallel 
Q 1 2 ? anti-parallel 
Q 2 3 ? anti-parallel 
Q 3 4 ? parallel      
R 1 2 ? parallel      
R 2 3 ? parallel      
R 3 4 ? parallel      
R 4 5 ? parallel      
R 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 11  ? GLU A 16  ? LYS A 11  GLU A 16  
A 2 LYS A 2   ? SER A 8   ? LYS A 2   SER A 8   
A 3 MET A 55  ? ILE A 56  ? MET A 55  ILE A 56  
B 1 PHE A 124 ? VAL A 126 ? PHE A 124 VAL A 126 
B 2 ALA A 27  ? ALA A 35  ? ALA A 27  ALA A 35  
B 3 GLU A 60  ? VAL A 68  ? GLU A 60  VAL A 68  
B 4 ARG A 80  ? VAL A 83  ? ARG A 80  VAL A 83  
B 5 ALA A 134 ? HIS A 135 ? ALA A 134 HIS A 135 
C 1 PHE A 124 ? VAL A 126 ? PHE A 124 VAL A 126 
C 2 ALA A 27  ? ALA A 35  ? ALA A 27  ALA A 35  
C 3 LYS A 346 ? ILE A 350 ? LYS A 346 ILE A 350 
C 4 VAL A 320 ? ARG A 325 ? VAL A 320 ARG A 325 
D 1 ASP A 214 ? LEU A 216 ? ASP A 214 LEU A 216 
D 2 ILE A 194 ? VAL A 197 ? ILE A 194 VAL A 197 
D 3 VAL A 170 ? ILE A 173 ? VAL A 170 ILE A 173 
D 4 VAL A 236 ? MET A 241 ? VAL A 236 MET A 241 
D 5 VAL A 256 ? ASN A 264 ? VAL A 256 ASN A 264 
D 6 THR A 289 ? GLY A 292 ? THR A 289 GLY A 292 
E 1 ALA A 273 ? PRO A 277 ? ALA A 273 PRO A 277 
E 2 ALA C 273 ? PRO C 277 ? ALA C 273 PRO C 277 
F 1 LYS B 11  ? GLU B 16  ? LYS B 11  GLU B 16  
F 2 LYS B 2   ? SER B 8   ? LYS B 2   SER B 8   
F 3 MET B 55  ? ILE B 56  ? MET B 55  ILE B 56  
G 1 PHE B 124 ? VAL B 126 ? PHE B 124 VAL B 126 
G 2 ALA B 27  ? VAL B 34  ? ALA B 27  VAL B 34  
G 3 ALA B 61  ? VAL B 68  ? ALA B 61  VAL B 68  
G 4 ARG B 80  ? VAL B 83  ? ARG B 80  VAL B 83  
G 5 ALA B 134 ? HIS B 135 ? ALA B 134 HIS B 135 
H 1 PHE B 124 ? VAL B 126 ? PHE B 124 VAL B 126 
H 2 ALA B 27  ? VAL B 34  ? ALA B 27  VAL B 34  
H 3 LYS B 346 ? ILE B 350 ? LYS B 346 ILE B 350 
H 4 VAL B 320 ? ARG B 325 ? VAL B 320 ARG B 325 
I 1 ASP B 214 ? LEU B 216 ? ASP B 214 LEU B 216 
I 2 ILE B 194 ? VAL B 197 ? ILE B 194 VAL B 197 
I 3 VAL B 170 ? ILE B 173 ? VAL B 170 ILE B 173 
I 4 VAL B 236 ? MET B 241 ? VAL B 236 MET B 241 
I 5 VAL B 256 ? ASN B 264 ? VAL B 256 ASN B 264 
I 6 THR B 289 ? GLY B 292 ? THR B 289 GLY B 292 
J 1 ALA B 273 ? PRO B 277 ? ALA B 273 PRO B 277 
J 2 ALA D 273 ? PRO D 277 ? ALA D 273 PRO D 277 
K 1 LYS C 11  ? GLU C 16  ? LYS C 11  GLU C 16  
K 2 LYS C 2   ? SER C 8   ? LYS C 2   SER C 8   
K 3 MET C 55  ? ILE C 56  ? MET C 55  ILE C 56  
L 1 PHE C 124 ? VAL C 126 ? PHE C 124 VAL C 126 
L 2 ALA C 27  ? ALA C 35  ? ALA C 27  ALA C 35  
L 3 GLU C 60  ? VAL C 68  ? GLU C 60  VAL C 68  
L 4 ARG C 80  ? VAL C 83  ? ARG C 80  VAL C 83  
L 5 ALA C 134 ? HIS C 135 ? ALA C 134 HIS C 135 
M 1 PHE C 124 ? VAL C 126 ? PHE C 124 VAL C 126 
M 2 ALA C 27  ? ALA C 35  ? ALA C 27  ALA C 35  
M 3 LYS C 346 ? ILE C 350 ? LYS C 346 ILE C 350 
M 4 VAL C 320 ? ARG C 325 ? VAL C 320 ARG C 325 
N 1 ASP C 214 ? LEU C 216 ? ASP C 214 LEU C 216 
N 2 ILE C 194 ? VAL C 197 ? ILE C 194 VAL C 197 
N 3 VAL C 170 ? ILE C 173 ? VAL C 170 ILE C 173 
N 4 VAL C 236 ? MET C 241 ? VAL C 236 MET C 241 
N 5 VAL C 256 ? ASN C 264 ? VAL C 256 ASN C 264 
N 6 THR C 289 ? GLY C 292 ? THR C 289 GLY C 292 
O 1 LYS D 11  ? GLU D 16  ? LYS D 11  GLU D 16  
O 2 LYS D 2   ? SER D 8   ? LYS D 2   SER D 8   
O 3 MET D 55  ? ILE D 56  ? MET D 55  ILE D 56  
P 1 PHE D 124 ? VAL D 126 ? PHE D 124 VAL D 126 
P 2 ALA D 27  ? VAL D 34  ? ALA D 27  VAL D 34  
P 3 ALA D 61  ? VAL D 68  ? ALA D 61  VAL D 68  
P 4 ARG D 80  ? VAL D 83  ? ARG D 80  VAL D 83  
P 5 ALA D 134 ? HIS D 135 ? ALA D 134 HIS D 135 
Q 1 PHE D 124 ? VAL D 126 ? PHE D 124 VAL D 126 
Q 2 ALA D 27  ? VAL D 34  ? ALA D 27  VAL D 34  
Q 3 LYS D 346 ? ILE D 350 ? LYS D 346 ILE D 350 
Q 4 VAL D 320 ? ARG D 325 ? VAL D 320 ARG D 325 
R 1 ASP D 214 ? LEU D 216 ? ASP D 214 LEU D 216 
R 2 ILE D 194 ? VAL D 197 ? ILE D 194 VAL D 197 
R 3 VAL D 170 ? ILE D 173 ? VAL D 170 ILE D 173 
R 4 VAL D 236 ? MET D 241 ? VAL D 236 MET D 241 
R 5 VAL D 256 ? ASN D 264 ? VAL D 256 ASN D 264 
R 6 THR D 289 ? GLY D 292 ? THR D 289 GLY D 292 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LYS A 11  ? O LYS A 11  N SER A 8   ? N SER A 8   
A 2 3 N MET A 6   ? N MET A 6   O MET A 55  ? O MET A 55  
B 1 2 O PHE A 124 ? O PHE A 124 N VAL A 29  ? N VAL A 29  
B 2 3 N LEU A 32  ? N LEU A 32  O VAL A 62  ? O VAL A 62  
B 3 4 N GLY A 63  ? N GLY A 63  O VAL A 81  ? O VAL A 81  
B 4 5 N VAL A 82  ? N VAL A 82  O ALA A 134 ? O ALA A 134 
C 1 2 O PHE A 124 ? O PHE A 124 N VAL A 29  ? N VAL A 29  
C 2 3 N VAL A 34  ? N VAL A 34  O VAL A 349 ? O VAL A 349 
C 3 4 O ILE A 350 ? O ILE A 350 N PHE A 324 ? N PHE A 324 
D 1 2 O LEU A 216 ? O LEU A 216 N GLY A 196 ? N GLY A 196 
D 2 3 O ILE A 195 ? O ILE A 195 N VAL A 170 ? N VAL A 170 
D 3 4 N VAL A 171 ? N VAL A 171 O ILE A 240 ? O ILE A 240 
D 4 5 N VAL A 239 ? N VAL A 239 O SER A 263 ? O SER A 263 
D 5 6 N ILE A 262 ? N ILE A 262 O LYS A 291 ? O LYS A 291 
E 1 2 N LEU A 274 ? N LEU A 274 O ILE C 276 ? O ILE C 276 
F 1 2 O GLY B 13  ? O GLY B 13  N ALA B 5   ? N ALA B 5   
F 2 3 N MET B 6   ? N MET B 6   O MET B 55  ? O MET B 55  
G 1 2 O VAL B 126 ? O VAL B 126 N ALA B 27  ? N ALA B 27  
G 2 3 N LEU B 32  ? N LEU B 32  O VAL B 62  ? O VAL B 62  
G 3 4 N GLY B 63  ? N GLY B 63  O VAL B 81  ? O VAL B 81  
G 4 5 N VAL B 82  ? N VAL B 82  O ALA B 134 ? O ALA B 134 
H 1 2 O VAL B 126 ? O VAL B 126 N ALA B 27  ? N ALA B 27  
H 2 3 N VAL B 34  ? N VAL B 34  O VAL B 349 ? O VAL B 349 
H 3 4 O VAL B 348 ? O VAL B 348 N PHE B 324 ? N PHE B 324 
I 1 2 O LEU B 216 ? O LEU B 216 N GLY B 196 ? N GLY B 196 
I 2 3 O ILE B 195 ? O ILE B 195 N VAL B 170 ? N VAL B 170 
I 3 4 N VAL B 171 ? N VAL B 171 O ILE B 240 ? O ILE B 240 
I 4 5 N VAL B 239 ? N VAL B 239 O SER B 263 ? O SER B 263 
I 5 6 N ILE B 262 ? N ILE B 262 O THR B 289 ? O THR B 289 
J 1 2 N ILE B 276 ? N ILE B 276 O LEU D 274 ? O LEU D 274 
K 1 2 O LYS C 11  ? O LYS C 11  N SER C 8   ? N SER C 8   
K 2 3 N MET C 6   ? N MET C 6   O MET C 55  ? O MET C 55  
L 1 2 O VAL C 126 ? O VAL C 126 N ALA C 27  ? N ALA C 27  
L 2 3 N LEU C 32  ? N LEU C 32  O VAL C 62  ? O VAL C 62  
L 3 4 N GLY C 63  ? N GLY C 63  O VAL C 81  ? O VAL C 81  
L 4 5 N VAL C 82  ? N VAL C 82  O ALA C 134 ? O ALA C 134 
M 1 2 O VAL C 126 ? O VAL C 126 N ALA C 27  ? N ALA C 27  
M 2 3 N VAL C 34  ? N VAL C 34  O VAL C 349 ? O VAL C 349 
M 3 4 O ILE C 350 ? O ILE C 350 N PHE C 324 ? N PHE C 324 
N 1 2 O ASP C 214 ? O ASP C 214 N GLY C 196 ? N GLY C 196 
N 2 3 O ILE C 195 ? O ILE C 195 N VAL C 172 ? N VAL C 172 
N 3 4 N VAL C 171 ? N VAL C 171 O ILE C 240 ? O ILE C 240 
N 4 5 N VAL C 239 ? N VAL C 239 O SER C 263 ? O SER C 263 
N 5 6 N ASN C 264 ? N ASN C 264 O LYS C 291 ? O LYS C 291 
O 1 2 O LYS D 11  ? O LYS D 11  N SER D 8   ? N SER D 8   
O 2 3 N MET D 6   ? N MET D 6   O MET D 55  ? O MET D 55  
P 1 2 O VAL D 126 ? O VAL D 126 N ALA D 27  ? N ALA D 27  
P 2 3 N ILE D 28  ? N ILE D 28  O VAL D 66  ? O VAL D 66  
P 3 4 N GLY D 63  ? N GLY D 63  O VAL D 81  ? O VAL D 81  
P 4 5 N VAL D 82  ? N VAL D 82  O ALA D 134 ? O ALA D 134 
Q 1 2 O VAL D 126 ? O VAL D 126 N ALA D 27  ? N ALA D 27  
Q 2 3 N VAL D 34  ? N VAL D 34  O VAL D 349 ? O VAL D 349 
Q 3 4 O ILE D 350 ? O ILE D 350 N PHE D 324 ? N PHE D 324 
R 1 2 O LEU D 216 ? O LEU D 216 N GLY D 196 ? N GLY D 196 
R 2 3 O ILE D 195 ? O ILE D 195 N VAL D 170 ? N VAL D 170 
R 3 4 N VAL D 171 ? N VAL D 171 O ILE D 240 ? O ILE D 240 
R 4 5 N VAL D 239 ? N VAL D 239 O SER D 263 ? O SER D 263 
R 5 6 N ILE D 262 ? N ILE D 262 O THR D 289 ? O THR D 289 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN  354 ? 5 'BINDING SITE FOR RESIDUE ZN A 354'  
AC2 Software A ACT 353 ? 7 'BINDING SITE FOR RESIDUE ACT A 353' 
AC3 Software A EDO 355 ? 7 'BINDING SITE FOR RESIDUE EDO A 355' 
AC4 Software A EDO 356 ? 5 'BINDING SITE FOR RESIDUE EDO A 356' 
AC5 Software A EDO 358 ? 3 'BINDING SITE FOR RESIDUE EDO A 358' 
AC6 Software A EDO 359 ? 2 'BINDING SITE FOR RESIDUE EDO A 359' 
AC7 Software A EDO 360 ? 6 'BINDING SITE FOR RESIDUE EDO A 360' 
AC8 Software B ZN  355 ? 5 'BINDING SITE FOR RESIDUE ZN B 355'  
AC9 Software B ACT 353 ? 7 'BINDING SITE FOR RESIDUE ACT B 353' 
BC1 Software B EDO 354 ? 4 'BINDING SITE FOR RESIDUE EDO B 354' 
BC2 Software B EDO 358 ? 7 'BINDING SITE FOR RESIDUE EDO B 358' 
BC3 Software B CL  359 ? 1 'BINDING SITE FOR RESIDUE CL B 359'  
BC4 Software B CL  360 ? 3 'BINDING SITE FOR RESIDUE CL B 360'  
BC5 Software C EDO 356 ? 5 'BINDING SITE FOR RESIDUE EDO C 356' 
BC6 Software C EDO 359 ? 2 'BINDING SITE FOR RESIDUE EDO C 359' 
BC7 Software C ZN  353 ? 5 'BINDING SITE FOR RESIDUE ZN C 353'  
BC8 Software C ACT 354 ? 2 'BINDING SITE FOR RESIDUE ACT C 354' 
BC9 Software C ACT 355 ? 7 'BINDING SITE FOR RESIDUE ACT C 355' 
CC1 Software C EDO 358 ? 5 'BINDING SITE FOR RESIDUE EDO C 358' 
CC2 Software C EDO 360 ? 5 'BINDING SITE FOR RESIDUE EDO C 360' 
CC3 Software D ZN  357 ? 5 'BINDING SITE FOR RESIDUE ZN D 357'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 CYS A  37  ? CYS A 37  . ? 1_555 ? 
2  AC1 5 SER A  39  ? SER A 39  . ? 1_555 ? 
3  AC1 5 HIS A  59  ? HIS A 59  . ? 1_555 ? 
4  AC1 5 ASP A  150 ? ASP A 150 . ? 1_555 ? 
5  AC1 5 ACT F  .   ? ACT A 353 . ? 1_555 ? 
6  AC2 7 SER A  39  ? SER A 39  . ? 1_555 ? 
7  AC2 7 TRP A  110 ? TRP A 110 . ? 1_555 ? 
8  AC2 7 ASP A  150 ? ASP A 150 . ? 1_555 ? 
9  AC2 7 LEU A  294 ? LEU A 294 . ? 1_555 ? 
10 AC2 7 ZN  E  .   ? ZN  A 354 . ? 1_555 ? 
11 AC2 7 HOH DA .   ? HOH A 366 . ? 1_555 ? 
12 AC2 7 HOH DA .   ? HOH A 393 . ? 1_555 ? 
13 AC3 7 GLY A  174 ? GLY A 174 . ? 1_555 ? 
14 AC3 7 ILE A  175 ? ILE A 175 . ? 1_555 ? 
15 AC3 7 GLY A  176 ? GLY A 176 . ? 1_555 ? 
16 AC3 7 GLY A  198 ? GLY A 198 . ? 1_555 ? 
17 AC3 7 SER A  199 ? SER A 199 . ? 1_555 ? 
18 AC3 7 ARG A  200 ? ARG A 200 . ? 1_555 ? 
19 AC3 7 HOH DA .   ? HOH A 469 . ? 1_555 ? 
20 AC4 5 ASP A  163 ? ASP A 163 . ? 1_555 ? 
21 AC4 5 ILE A  261 ? ILE A 261 . ? 1_555 ? 
22 AC4 5 LYS A  291 ? LYS A 291 . ? 1_555 ? 
23 AC4 5 HOH DA .   ? HOH A 394 . ? 1_555 ? 
24 AC4 5 LYS C  291 ? LYS C 291 . ? 1_555 ? 
25 AC5 3 ARG A  301 ? ARG A 301 . ? 1_555 ? 
26 AC5 3 ARG A  304 ? ARG A 304 . ? 1_555 ? 
27 AC5 3 HOH DA .   ? HOH A 521 . ? 1_555 ? 
28 AC6 2 PHE A  327 ? PHE A 327 . ? 1_555 ? 
29 AC6 2 HOH DA .   ? HOH A 622 . ? 1_555 ? 
30 AC7 6 ARG A  304 ? ARG A 304 . ? 1_555 ? 
31 AC7 6 HOH DA .   ? HOH A 550 . ? 1_555 ? 
32 AC7 6 GLY B  167 ? GLY B 167 . ? 1_555 ? 
33 AC7 6 ASP B  237 ? ASP B 237 . ? 1_555 ? 
34 AC7 6 LYS B  257 ? LYS B 257 . ? 1_555 ? 
35 AC7 6 HOH EA .   ? HOH B 530 . ? 1_555 ? 
36 AC8 5 CYS B  37  ? CYS B 37  . ? 1_555 ? 
37 AC8 5 SER B  39  ? SER B 39  . ? 1_555 ? 
38 AC8 5 HIS B  59  ? HIS B 59  . ? 1_555 ? 
39 AC8 5 ASP B  150 ? ASP B 150 . ? 1_555 ? 
40 AC8 5 ACT N  .   ? ACT B 353 . ? 1_555 ? 
41 AC9 7 SER B  39  ? SER B 39  . ? 1_555 ? 
42 AC9 7 TRP B  110 ? TRP B 110 . ? 1_555 ? 
43 AC9 7 ASP B  150 ? ASP B 150 . ? 1_555 ? 
44 AC9 7 LEU B  294 ? LEU B 294 . ? 1_555 ? 
45 AC9 7 ZN  M  .   ? ZN  B 355 . ? 1_555 ? 
46 AC9 7 HOH EA .   ? HOH B 363 . ? 1_555 ? 
47 AC9 7 HOH EA .   ? HOH B 480 . ? 1_555 ? 
48 BC1 4 GLU B  139 ? GLU B 139 . ? 1_555 ? 
49 BC1 4 PHE B  310 ? PHE B 310 . ? 1_555 ? 
50 BC1 4 LYS B  312 ? LYS B 312 . ? 1_555 ? 
51 BC1 4 HOH EA .   ? HOH B 544 . ? 1_555 ? 
52 BC2 7 ASP B  130 ? ASP B 130 . ? 1_555 ? 
53 BC2 7 ARG B  299 ? ARG B 299 . ? 1_555 ? 
54 BC2 7 GLU B  303 ? GLU B 303 . ? 1_555 ? 
55 BC2 7 HOH EA .   ? HOH B 483 . ? 1_555 ? 
56 BC2 7 HOH EA .   ? HOH B 493 . ? 1_555 ? 
57 BC2 7 HOH EA .   ? HOH B 539 . ? 1_555 ? 
58 BC2 7 SER C  93  ? SER C 93  . ? 1_555 ? 
59 BC3 1 ASP B  307 ? ASP B 307 . ? 1_555 ? 
60 BC4 3 GLY B  69  ? GLY B 69  . ? 1_555 ? 
61 BC4 3 SER B  70  ? SER B 70  . ? 1_555 ? 
62 BC4 3 HOH EA .   ? HOH B 495 . ? 1_555 ? 
63 BC5 5 SER B  93  ? SER B 93  . ? 1_555 ? 
64 BC5 5 GLN B  96  ? GLN B 96  . ? 1_555 ? 
65 BC5 5 ARG C  299 ? ARG C 299 . ? 1_555 ? 
66 BC5 5 GLU C  303 ? GLU C 303 . ? 1_555 ? 
67 BC5 5 HOH FA .   ? HOH C 462 . ? 1_555 ? 
68 BC6 2 HOH FA .   ? HOH C 514 . ? 1_555 ? 
69 BC6 2 HOH FA .   ? HOH C 585 . ? 1_555 ? 
70 BC7 5 CYS C  37  ? CYS C 37  . ? 1_555 ? 
71 BC7 5 SER C  39  ? SER C 39  . ? 1_555 ? 
72 BC7 5 HIS C  59  ? HIS C 59  . ? 1_555 ? 
73 BC7 5 ASP C  150 ? ASP C 150 . ? 1_555 ? 
74 BC7 5 ACT X  .   ? ACT C 355 . ? 1_555 ? 
75 BC8 2 GLY C  271 ? GLY C 271 . ? 1_555 ? 
76 BC8 2 ASP C  272 ? ASP C 272 . ? 1_555 ? 
77 BC9 7 MET A  285 ? MET A 285 . ? 1_555 ? 
78 BC9 7 SER C  39  ? SER C 39  . ? 1_555 ? 
79 BC9 7 HIS C  59  ? HIS C 59  . ? 1_555 ? 
80 BC9 7 ASP C  150 ? ASP C 150 . ? 1_555 ? 
81 BC9 7 LEU C  294 ? LEU C 294 . ? 1_555 ? 
82 BC9 7 ZN  V  .   ? ZN  C 353 . ? 1_555 ? 
83 BC9 7 HOH FA .   ? HOH C 465 . ? 1_555 ? 
84 CC1 5 HIS C  157 ? HIS C 157 . ? 1_555 ? 
85 CC1 5 GLU C  160 ? GLU C 160 . ? 1_555 ? 
86 CC1 5 EDO AA .   ? EDO C 360 . ? 1_555 ? 
87 CC1 5 HOH FA .   ? HOH C 429 . ? 1_555 ? 
88 CC1 5 HOH FA .   ? HOH C 513 . ? 1_555 ? 
89 CC2 5 GLY C  98  ? GLY C 98  . ? 1_555 ? 
90 CC2 5 TYR C  99  ? TYR C 99  . ? 1_555 ? 
91 CC2 5 GLN C  101 ? GLN C 101 . ? 1_555 ? 
92 CC2 5 HIS C  157 ? HIS C 157 . ? 1_555 ? 
93 CC2 5 EDO Z  .   ? EDO C 358 . ? 1_555 ? 
94 CC3 5 CYS D  37  ? CYS D 37  . ? 1_555 ? 
95 CC3 5 SER D  39  ? SER D 39  . ? 1_555 ? 
96 CC3 5 HIS D  59  ? HIS D 59  . ? 1_555 ? 
97 CC3 5 ASP D  150 ? ASP D 150 . ? 1_555 ? 
98 CC3 5 HOH GA .   ? HOH D 395 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3FTN 
_atom_sites.fract_transf_matrix[1][1]   0.012598 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002206 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012048 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008482 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . MET A  1 1   ? 43.943  34.987  -2.572  1.00 52.17  ? 1   MET A N   1 
ATOM   2     C  CA  . MET A  1 1   ? 44.336  34.043  -1.530  1.00 47.02  ? 1   MET A CA  1 
ATOM   3     C  C   . MET A  1 1   ? 43.982  32.637  -1.977  1.00 45.16  ? 1   MET A C   1 
ATOM   4     O  O   . MET A  1 1   ? 43.183  32.456  -2.889  1.00 46.21  ? 1   MET A O   1 
ATOM   5     C  CB  . MET A  1 1   ? 43.615  34.356  -0.219  1.00 46.51  ? 1   MET A CB  1 
ATOM   6     C  CG  . MET A  1 1   ? 42.136  33.993  -0.240  1.00 50.22  ? 1   MET A CG  1 
ATOM   7     S  SD  . MET A  1 1   ? 41.311  34.197  1.348   1.00 45.88  ? 1   MET A SD  1 
ATOM   8     C  CE  . MET A  1 1   ? 39.648  33.703  0.911   1.00 52.21  ? 1   MET A CE  1 
ATOM   9     N  N   . LYS A  1 2   ? 44.573  31.642  -1.329  1.00 49.08  ? 2   LYS A N   1 
ATOM   10    C  CA  . LYS A  1 2   ? 44.338  30.247  -1.684  1.00 52.16  ? 2   LYS A CA  1 
ATOM   11    C  C   . LYS A  1 2   ? 43.151  29.665  -0.919  1.00 49.03  ? 2   LYS A C   1 
ATOM   12    O  O   . LYS A  1 2   ? 42.967  29.944  0.271   1.00 49.84  ? 2   LYS A O   1 
ATOM   13    C  CB  . LYS A  1 2   ? 45.595  29.413  -1.416  1.00 62.71  ? 2   LYS A CB  1 
ATOM   14    C  CG  . LYS A  1 2   ? 46.664  29.516  -2.500  1.00 74.70  ? 2   LYS A CG  1 
ATOM   15    C  CD  . LYS A  1 2   ? 46.195  28.847  -3.792  1.00 84.67  ? 2   LYS A CD  1 
ATOM   16    C  CE  . LYS A  1 2   ? 47.345  28.611  -4.767  1.00 89.82  ? 2   LYS A CE  1 
ATOM   17    N  NZ  . LYS A  1 2   ? 46.928  27.785  -5.941  1.00 90.72  ? 2   LYS A NZ  1 
ATOM   18    N  N   . GLY A  1 3   ? 42.351  28.857  -1.610  1.00 39.01  ? 3   GLY A N   1 
ATOM   19    C  CA  . GLY A  1 3   ? 41.257  28.145  -0.978  1.00 44.13  ? 3   GLY A CA  1 
ATOM   20    C  C   . GLY A  1 3   ? 41.050  26.768  -1.574  1.00 46.46  ? 3   GLY A C   1 
ATOM   21    O  O   . GLY A  1 3   ? 41.290  26.570  -2.765  1.00 45.86  ? 3   GLY A O   1 
ATOM   22    N  N   . PHE A  1 4   ? 40.618  25.811  -0.749  1.00 41.87  ? 4   PHE A N   1 
ATOM   23    C  CA  . PHE A  1 4   ? 40.219  24.497  -1.251  1.00 44.37  ? 4   PHE A CA  1 
ATOM   24    C  C   . PHE A  1 4   ? 38.707  24.476  -1.375  1.00 46.37  ? 4   PHE A C   1 
ATOM   25    O  O   . PHE A  1 4   ? 38.000  24.752  -0.404  1.00 44.57  ? 4   PHE A O   1 
ATOM   26    C  CB  . PHE A  1 4   ? 40.694  23.376  -0.321  1.00 44.76  ? 4   PHE A CB  1 
ATOM   27    C  CG  . PHE A  1 4   ? 40.460  21.987  -0.869  1.00 45.77  ? 4   PHE A CG  1 
ATOM   28    C  CD1 . PHE A  1 4   ? 41.273  21.473  -1.869  1.00 45.14  ? 4   PHE A CD1 1 
ATOM   29    C  CD2 . PHE A  1 4   ? 39.440  21.189  -0.366  1.00 40.25  ? 4   PHE A CD2 1 
ATOM   30    C  CE1 . PHE A  1 4   ? 41.071  20.190  -2.359  1.00 44.25  ? 4   PHE A CE1 1 
ATOM   31    C  CE2 . PHE A  1 4   ? 39.237  19.904  -0.841  1.00 35.76  ? 4   PHE A CE2 1 
ATOM   32    C  CZ  . PHE A  1 4   ? 40.048  19.404  -1.845  1.00 41.10  ? 4   PHE A CZ  1 
ATOM   33    N  N   . ALA A  1 5   ? 38.211  24.153  -2.569  1.00 50.10  ? 5   ALA A N   1 
ATOM   34    C  CA  . ALA A  1 5   ? 36.812  24.418  -2.894  1.00 48.48  ? 5   ALA A CA  1 
ATOM   35    C  C   . ALA A  1 5   ? 36.129  23.381  -3.778  1.00 47.71  ? 5   ALA A C   1 
ATOM   36    O  O   . ALA A  1 5   ? 36.768  22.650  -4.524  1.00 47.08  ? 5   ALA A O   1 
ATOM   37    C  CB  . ALA A  1 5   ? 36.682  25.799  -3.543  1.00 49.48  ? 5   ALA A CB  1 
ATOM   38    N  N   . MET A  1 6   ? 34.805  23.359  -3.694  1.00 48.45  ? 6   MET A N   1 
ATOM   39    C  CA  . MET A  1 6   ? 33.987  22.628  -4.631  1.00 46.65  ? 6   MET A CA  1 
ATOM   40    C  C   . MET A  1 6   ? 33.862  23.410  -5.937  1.00 52.67  ? 6   MET A C   1 
ATOM   41    O  O   . MET A  1 6   ? 33.257  24.478  -5.982  1.00 50.30  ? 6   MET A O   1 
ATOM   42    C  CB  . MET A  1 6   ? 32.608  22.400  -4.043  1.00 40.76  ? 6   MET A CB  1 
ATOM   43    C  CG  . MET A  1 6   ? 31.628  21.795  -5.033  1.00 38.84  ? 6   MET A CG  1 
ATOM   44    S  SD  . MET A  1 6   ? 30.055  21.584  -4.213  1.00 53.47  ? 6   MET A SD  1 
ATOM   45    C  CE  . MET A  1 6   ? 30.137  22.907  -3.010  1.00 190.74 ? 6   MET A CE  1 
ATOM   46    N  N   . LEU A  1 7   ? 34.448  22.871  -6.998  1.00 54.83  ? 7   LEU A N   1 
ATOM   47    C  CA  . LEU A  1 7   ? 34.367  23.489  -8.308  1.00 48.95  ? 7   LEU A CA  1 
ATOM   48    C  C   . LEU A  1 7   ? 32.943  23.336  -8.838  1.00 57.66  ? 7   LEU A C   1 
ATOM   49    O  O   . LEU A  1 7   ? 32.284  24.321  -9.163  1.00 58.82  ? 7   LEU A O   1 
ATOM   50    C  CB  . LEU A  1 7   ? 35.393  22.858  -9.248  1.00 43.11  ? 7   LEU A CB  1 
ATOM   51    C  CG  . LEU A  1 7   ? 36.804  22.783  -8.635  1.00 45.70  ? 7   LEU A CG  1 
ATOM   52    C  CD1 . LEU A  1 7   ? 37.855  22.461  -9.683  1.00 46.51  ? 7   LEU A CD1 1 
ATOM   53    C  CD2 . LEU A  1 7   ? 37.162  24.077  -7.924  1.00 42.51  ? 7   LEU A CD2 1 
ATOM   54    N  N   . SER A  1 8   ? 32.470  22.095  -8.904  1.00 58.28  ? 8   SER A N   1 
ATOM   55    C  CA  . SER A  1 8   ? 31.073  21.815  -9.214  1.00 59.65  ? 8   SER A CA  1 
ATOM   56    C  C   . SER A  1 8   ? 30.762  20.453  -8.642  1.00 55.74  ? 8   SER A C   1 
ATOM   57    O  O   . SER A  1 8   ? 31.666  19.768  -8.190  1.00 54.47  ? 8   SER A O   1 
ATOM   58    C  CB  . SER A  1 8   ? 30.817  21.824  -10.725 1.00 58.36  ? 8   SER A CB  1 
ATOM   59    O  OG  . SER A  1 8   ? 31.345  20.670  -11.357 1.00 52.61  ? 8   SER A OG  1 
ATOM   60    N  N   . ILE A  1 9   ? 29.493  20.058  -8.666  1.00 55.92  ? 9   ILE A N   1 
ATOM   61    C  CA  . ILE A  1 9   ? 29.098  18.748  -8.157  1.00 52.13  ? 9   ILE A CA  1 
ATOM   62    C  C   . ILE A  1 9   ? 30.102  17.680  -8.565  1.00 55.21  ? 9   ILE A C   1 
ATOM   63    O  O   . ILE A  1 9   ? 30.394  17.518  -9.749  1.00 57.45  ? 9   ILE A O   1 
ATOM   64    C  CB  . ILE A  1 9   ? 27.709  18.333  -8.664  1.00 51.11  ? 9   ILE A CB  1 
ATOM   65    C  CG1 . ILE A  1 9   ? 26.627  19.250  -8.083  1.00 50.33  ? 9   ILE A CG1 1 
ATOM   66    C  CG2 . ILE A  1 9   ? 27.431  16.876  -8.310  1.00 45.56  ? 9   ILE A CG2 1 
ATOM   67    C  CD1 . ILE A  1 9   ? 25.199  18.837  -8.440  1.00 45.51  ? 9   ILE A CD1 1 
ATOM   68    N  N   . GLY A  1 10  ? 30.635  16.966  -7.576  1.00 54.90  ? 10  GLY A N   1 
ATOM   69    C  CA  . GLY A  1 10  ? 31.592  15.899  -7.813  1.00 50.92  ? 10  GLY A CA  1 
ATOM   70    C  C   . GLY A  1 10  ? 33.015  16.354  -8.088  1.00 49.31  ? 10  GLY A C   1 
ATOM   71    O  O   . GLY A  1 10  ? 33.877  15.543  -8.416  1.00 52.00  ? 10  GLY A O   1 
ATOM   72    N  N   . LYS A  1 11  ? 33.273  17.649  -7.960  1.00 49.37  ? 11  LYS A N   1 
ATOM   73    C  CA  . LYS A  1 11  ? 34.605  18.181  -8.242  1.00 50.68  ? 11  LYS A CA  1 
ATOM   74    C  C   . LYS A  1 11  ? 35.107  19.118  -7.147  1.00 51.70  ? 11  LYS A C   1 
ATOM   75    O  O   . LYS A  1 11  ? 34.390  20.031  -6.722  1.00 50.11  ? 11  LYS A O   1 
ATOM   76    C  CB  . LYS A  1 11  ? 34.616  18.909  -9.590  1.00 60.30  ? 11  LYS A CB  1 
ATOM   77    C  CG  . LYS A  1 11  ? 34.477  17.992  -10.789 1.00 68.79  ? 11  LYS A CG  1 
ATOM   78    C  CD  . LYS A  1 11  ? 34.494  18.784  -12.084 1.00 81.09  ? 11  LYS A CD  1 
ATOM   79    C  CE  . LYS A  1 11  ? 34.124  17.914  -13.279 1.00 90.77  ? 11  LYS A CE  1 
ATOM   80    N  NZ  . LYS A  1 11  ? 33.977  18.714  -14.529 1.00 96.04  ? 11  LYS A NZ  1 
ATOM   81    N  N   . VAL A  1 12  ? 36.343  18.881  -6.704  1.00 51.74  ? 12  VAL A N   1 
ATOM   82    C  CA  . VAL A  1 12  ? 37.022  19.734  -5.727  1.00 52.81  ? 12  VAL A CA  1 
ATOM   83    C  C   . VAL A  1 12  ? 38.414  20.078  -6.230  1.00 51.90  ? 12  VAL A C   1 
ATOM   84    O  O   . VAL A  1 12  ? 38.995  19.330  -7.011  1.00 56.51  ? 12  VAL A O   1 
ATOM   85    C  CB  . VAL A  1 12  ? 37.194  19.034  -4.371  1.00 49.31  ? 12  VAL A CB  1 
ATOM   86    C  CG1 . VAL A  1 12  ? 35.837  18.667  -3.773  1.00 49.44  ? 12  VAL A CG1 1 
ATOM   87    C  CG2 . VAL A  1 12  ? 38.063  17.801  -4.533  1.00 44.91  ? 12  VAL A CG2 1 
ATOM   88    N  N   . GLY A  1 13  ? 38.942  21.214  -5.782  1.00 49.45  ? 13  GLY A N   1 
ATOM   89    C  CA  . GLY A  1 13  ? 40.286  21.639  -6.136  1.00 39.96  ? 13  GLY A CA  1 
ATOM   90    C  C   . GLY A  1 13  ? 40.662  22.934  -5.440  1.00 45.37  ? 13  GLY A C   1 
ATOM   91    O  O   . GLY A  1 13  ? 39.795  23.621  -4.886  1.00 43.86  ? 13  GLY A O   1 
ATOM   92    N  N   . TRP A  1 14  ? 41.957  23.255  -5.447  1.00 47.62  ? 14  TRP A N   1 
ATOM   93    C  CA  . TRP A  1 14  ? 42.443  24.548  -4.967  1.00 44.71  ? 14  TRP A CA  1 
ATOM   94    C  C   . TRP A  1 14  ? 42.101  25.641  -5.982  1.00 54.63  ? 14  TRP A C   1 
ATOM   95    O  O   . TRP A  1 14  ? 42.130  25.413  -7.197  1.00 57.47  ? 14  TRP A O   1 
ATOM   96    C  CB  . TRP A  1 14  ? 43.953  24.498  -4.737  1.00 43.78  ? 14  TRP A CB  1 
ATOM   97    C  CG  . TRP A  1 14  ? 44.343  23.596  -3.583  1.00 48.71  ? 14  TRP A CG  1 
ATOM   98    C  CD1 . TRP A  1 14  ? 44.761  22.295  -3.659  1.00 46.27  ? 14  TRP A CD1 1 
ATOM   99    C  CD2 . TRP A  1 14  ? 44.320  23.927  -2.191  1.00 43.94  ? 14  TRP A CD2 1 
ATOM   100   N  NE1 . TRP A  1 14  ? 44.999  21.799  -2.401  1.00 43.33  ? 14  TRP A NE1 1 
ATOM   101   C  CE2 . TRP A  1 14  ? 44.733  22.780  -1.481  1.00 47.48  ? 14  TRP A CE2 1 
ATOM   102   C  CE3 . TRP A  1 14  ? 43.993  25.078  -1.475  1.00 44.51  ? 14  TRP A CE3 1 
ATOM   103   C  CZ2 . TRP A  1 14  ? 44.829  22.759  -0.092  1.00 47.04  ? 14  TRP A CZ2 1 
ATOM   104   C  CZ3 . TRP A  1 14  ? 44.086  25.052  -0.092  1.00 47.36  ? 14  TRP A CZ3 1 
ATOM   105   C  CH2 . TRP A  1 14  ? 44.503  23.903  0.582   1.00 47.25  ? 14  TRP A CH2 1 
ATOM   106   N  N   . ILE A  1 15  ? 41.755  26.824  -5.488  1.00 55.33  ? 15  ILE A N   1 
ATOM   107   C  CA  . ILE A  1 15  ? 41.435  27.949  -6.362  1.00 51.81  ? 15  ILE A CA  1 
ATOM   108   C  C   . ILE A  1 15  ? 41.906  29.210  -5.674  1.00 54.14  ? 15  ILE A C   1 
ATOM   109   O  O   . ILE A  1 15  ? 42.104  29.218  -4.467  1.00 50.99  ? 15  ILE A O   1 
ATOM   110   C  CB  . ILE A  1 15  ? 39.920  28.070  -6.631  1.00 44.22  ? 15  ILE A CB  1 
ATOM   111   C  CG1 . ILE A  1 15  ? 39.181  28.437  -5.341  1.00 41.28  ? 15  ILE A CG1 1 
ATOM   112   C  CG2 . ILE A  1 15  ? 39.370  26.774  -7.198  1.00 45.87  ? 15  ILE A CG2 1 
ATOM   113   C  CD1 . ILE A  1 15  ? 37.701  28.632  -5.513  1.00 38.71  ? 15  ILE A CD1 1 
ATOM   114   N  N   . GLU A  1 16  ? 42.082  30.278  -6.441  1.00 57.52  ? 16  GLU A N   1 
ATOM   115   C  CA  . GLU A  1 16  ? 42.490  31.549  -5.872  1.00 63.97  ? 16  GLU A CA  1 
ATOM   116   C  C   . GLU A  1 16  ? 41.277  32.480  -5.818  1.00 61.69  ? 16  GLU A C   1 
ATOM   117   O  O   . GLU A  1 16  ? 40.488  32.547  -6.760  1.00 57.72  ? 16  GLU A O   1 
ATOM   118   C  CB  . GLU A  1 16  ? 43.636  32.152  -6.688  1.00 72.51  ? 16  GLU A CB  1 
ATOM   119   C  CG  . GLU A  1 16  ? 44.692  32.859  -5.852  1.00 86.83  ? 16  GLU A CG  1 
ATOM   120   C  CD  . GLU A  1 16  ? 46.061  32.870  -6.518  1.00 94.95  ? 16  GLU A CD  1 
ATOM   121   O  OE1 . GLU A  1 16  ? 46.119  33.002  -7.760  1.00 98.67  ? 16  GLU A OE1 1 
ATOM   122   O  OE2 . GLU A  1 16  ? 47.079  32.747  -5.799  1.00 94.00  ? 16  GLU A OE2 1 
ATOM   123   N  N   . LYS A  1 17  ? 41.114  33.172  -4.697  1.00 57.30  ? 17  LYS A N   1 
ATOM   124   C  CA  . LYS A  1 17  ? 39.981  34.066  -4.509  1.00 56.74  ? 17  LYS A CA  1 
ATOM   125   C  C   . LYS A  1 17  ? 40.421  35.344  -3.820  1.00 58.63  ? 17  LYS A C   1 
ATOM   126   O  O   . LYS A  1 17  ? 41.386  35.357  -3.055  1.00 64.56  ? 17  LYS A O   1 
ATOM   127   C  CB  . LYS A  1 17  ? 38.887  33.398  -3.668  1.00 59.48  ? 17  LYS A CB  1 
ATOM   128   C  CG  . LYS A  1 17  ? 37.767  32.748  -4.463  1.00 65.27  ? 17  LYS A CG  1 
ATOM   129   C  CD  . LYS A  1 17  ? 36.688  32.234  -3.524  1.00 66.25  ? 17  LYS A CD  1 
ATOM   130   C  CE  . LYS A  1 17  ? 35.308  32.188  -4.182  1.00 63.42  ? 17  LYS A CE  1 
ATOM   131   N  NZ  . LYS A  1 17  ? 35.191  31.104  -5.188  1.00 65.38  ? 17  LYS A NZ  1 
ATOM   132   N  N   . GLU A  1 18  ? 39.696  36.419  -4.096  1.00 55.11  ? 18  GLU A N   1 
ATOM   133   C  CA  . GLU A  1 18  ? 39.859  37.669  -3.380  1.00 54.25  ? 18  GLU A CA  1 
ATOM   134   C  C   . GLU A  1 18  ? 39.747  37.420  -1.876  1.00 51.99  ? 18  GLU A C   1 
ATOM   135   O  O   . GLU A  1 18  ? 38.875  36.675  -1.423  1.00 50.02  ? 18  GLU A O   1 
ATOM   136   C  CB  . GLU A  1 18  ? 38.759  38.638  -3.822  1.00 67.21  ? 18  GLU A CB  1 
ATOM   137   C  CG  . GLU A  1 18  ? 39.170  40.090  -3.866  1.00 80.27  ? 18  GLU A CG  1 
ATOM   138   C  CD  . GLU A  1 18  ? 40.219  40.361  -4.926  1.00 92.38  ? 18  GLU A CD  1 
ATOM   139   O  OE1 . GLU A  1 18  ? 40.550  39.425  -5.689  1.00 90.67  ? 18  GLU A OE1 1 
ATOM   140   O  OE2 . GLU A  1 18  ? 40.711  41.509  -4.994  1.00 100.14 ? 18  GLU A OE2 1 
ATOM   141   N  N   . LYS A  1 19  ? 40.627  38.044  -1.104  1.00 47.41  ? 19  LYS A N   1 
ATOM   142   C  CA  . LYS A  1 19  ? 40.549  37.994  0.350   1.00 47.21  ? 19  LYS A CA  1 
ATOM   143   C  C   . LYS A  1 19  ? 39.382  38.873  0.797   1.00 53.55  ? 19  LYS A C   1 
ATOM   144   O  O   . LYS A  1 19  ? 39.287  40.021  0.392   1.00 53.54  ? 19  LYS A O   1 
ATOM   145   C  CB  . LYS A  1 19  ? 41.858  38.496  0.942   1.00 45.61  ? 19  LYS A CB  1 
ATOM   146   C  CG  . LYS A  1 19  ? 41.828  38.801  2.425   1.00 51.83  ? 19  LYS A CG  1 
ATOM   147   C  CD  . LYS A  1 19  ? 43.213  39.253  2.875   1.00 52.00  ? 19  LYS A CD  1 
ATOM   148   C  CE  . LYS A  1 19  ? 43.198  39.797  4.282   1.00 53.19  ? 19  LYS A CE  1 
ATOM   149   N  NZ  . LYS A  1 19  ? 44.551  40.264  4.711   1.00 61.03  ? 19  LYS A NZ  1 
ATOM   150   N  N   . PRO A  1 20  ? 38.483  38.338  1.636   1.00 55.08  ? 20  PRO A N   1 
ATOM   151   C  CA  . PRO A  1 20  ? 37.271  39.108  1.934   1.00 46.97  ? 20  PRO A CA  1 
ATOM   152   C  C   . PRO A  1 20  ? 37.585  40.256  2.870   1.00 46.50  ? 20  PRO A C   1 
ATOM   153   O  O   . PRO A  1 20  ? 38.590  40.201  3.589   1.00 45.14  ? 20  PRO A O   1 
ATOM   154   C  CB  . PRO A  1 20  ? 36.367  38.097  2.655   1.00 45.77  ? 20  PRO A CB  1 
ATOM   155   C  CG  . PRO A  1 20  ? 37.143  36.786  2.690   1.00 51.00  ? 20  PRO A CG  1 
ATOM   156   C  CD  . PRO A  1 20  ? 38.578  37.119  2.453   1.00 49.96  ? 20  PRO A CD  1 
ATOM   157   N  N   . ALA A  1 21  ? 36.732  41.278  2.852   1.00 46.29  ? 21  ALA A N   1 
ATOM   158   C  CA  . ALA A  1 21  ? 36.851  42.424  3.748   1.00 46.62  ? 21  ALA A CA  1 
ATOM   159   C  C   . ALA A  1 21  ? 35.643  42.459  4.672   1.00 44.07  ? 21  ALA A C   1 
ATOM   160   O  O   . ALA A  1 21  ? 34.549  42.041  4.287   1.00 48.04  ? 21  ALA A O   1 
ATOM   161   C  CB  . ALA A  1 21  ? 36.944  43.723  2.942   1.00 50.53  ? 21  ALA A CB  1 
ATOM   162   N  N   . PRO A  1 22  ? 35.827  42.976  5.888   1.00 42.82  ? 22  PRO A N   1 
ATOM   163   C  CA  . PRO A  1 22  ? 34.771  42.988  6.904   1.00 47.90  ? 22  PRO A CA  1 
ATOM   164   C  C   . PRO A  1 22  ? 33.839  44.179  6.742   1.00 51.09  ? 22  PRO A C   1 
ATOM   165   O  O   . PRO A  1 22  ? 34.296  45.271  6.410   1.00 49.17  ? 22  PRO A O   1 
ATOM   166   C  CB  . PRO A  1 22  ? 35.545  43.187  8.215   1.00 48.32  ? 22  PRO A CB  1 
ATOM   167   C  CG  . PRO A  1 22  ? 36.980  43.515  7.826   1.00 43.00  ? 22  PRO A CG  1 
ATOM   168   C  CD  . PRO A  1 22  ? 37.023  43.695  6.342   1.00 43.33  ? 22  PRO A CD  1 
ATOM   169   N  N   . GLY A  1 23  ? 32.552  43.968  6.986   1.00 49.92  ? 23  GLY A N   1 
ATOM   170   C  CA  . GLY A  1 23  ? 31.640  45.066  7.241   1.00 44.68  ? 23  GLY A CA  1 
ATOM   171   C  C   . GLY A  1 23  ? 31.895  45.535  8.661   1.00 44.04  ? 23  GLY A C   1 
ATOM   172   O  O   . GLY A  1 23  ? 32.699  44.945  9.375   1.00 42.30  ? 23  GLY A O   1 
ATOM   173   N  N   . PRO A  1 24  ? 31.204  46.597  9.082   1.00 44.93  ? 24  PRO A N   1 
ATOM   174   C  CA  . PRO A  1 24  ? 31.437  47.225  10.386  1.00 44.48  ? 24  PRO A CA  1 
ATOM   175   C  C   . PRO A  1 24  ? 31.184  46.286  11.569  1.00 42.03  ? 24  PRO A C   1 
ATOM   176   O  O   . PRO A  1 24  ? 31.666  46.576  12.664  1.00 47.51  ? 24  PRO A O   1 
ATOM   177   C  CB  . PRO A  1 24  ? 30.418  48.374  10.416  1.00 42.31  ? 24  PRO A CB  1 
ATOM   178   C  CG  . PRO A  1 24  ? 30.022  48.589  8.993   1.00 44.84  ? 24  PRO A CG  1 
ATOM   179   C  CD  . PRO A  1 24  ? 30.113  47.246  8.337   1.00 41.72  ? 24  PRO A CD  1 
ATOM   180   N  N   . PHE A  1 25  ? 30.434  45.206  11.369  1.00 42.61  ? 25  PHE A N   1 
ATOM   181   C  CA  . PHE A  1 25  ? 30.150  44.269  12.470  1.00 46.25  ? 25  PHE A CA  1 
ATOM   182   C  C   . PHE A  1 25  ? 30.900  42.944  12.330  1.00 40.68  ? 25  PHE A C   1 
ATOM   183   O  O   . PHE A  1 25  ? 30.743  42.026  13.148  1.00 32.52  ? 25  PHE A O   1 
ATOM   184   C  CB  . PHE A  1 25  ? 28.643  44.004  12.574  1.00 42.40  ? 25  PHE A CB  1 
ATOM   185   C  CG  . PHE A  1 25  ? 27.842  45.230  12.880  1.00 43.26  ? 25  PHE A CG  1 
ATOM   186   C  CD1 . PHE A  1 25  ? 27.577  45.589  14.191  1.00 40.28  ? 25  PHE A CD1 1 
ATOM   187   C  CD2 . PHE A  1 25  ? 27.366  46.033  11.858  1.00 36.47  ? 25  PHE A CD2 1 
ATOM   188   C  CE1 . PHE A  1 25  ? 26.846  46.718  14.474  1.00 42.00  ? 25  PHE A CE1 1 
ATOM   189   C  CE2 . PHE A  1 25  ? 26.635  47.186  12.135  1.00 43.58  ? 25  PHE A CE2 1 
ATOM   190   C  CZ  . PHE A  1 25  ? 26.370  47.526  13.441  1.00 45.03  ? 25  PHE A CZ  1 
ATOM   191   N  N   . ASP A  1 26  ? 31.709  42.846  11.283  1.00 39.91  ? 26  ASP A N   1 
ATOM   192   C  CA  . ASP A  1 26  ? 32.286  41.565  10.897  1.00 40.29  ? 26  ASP A CA  1 
ATOM   193   C  C   . ASP A  1 26  ? 33.754  41.469  11.309  1.00 40.91  ? 26  ASP A C   1 
ATOM   194   O  O   . ASP A  1 26  ? 34.382  42.483  11.647  1.00 43.57  ? 26  ASP A O   1 
ATOM   195   C  CB  . ASP A  1 26  ? 32.151  41.381  9.383   1.00 38.05  ? 26  ASP A CB  1 
ATOM   196   C  CG  . ASP A  1 26  ? 30.717  41.499  8.910   1.00 43.96  ? 26  ASP A CG  1 
ATOM   197   O  OD1 . ASP A  1 26  ? 29.808  41.119  9.689   1.00 44.69  ? 26  ASP A OD1 1 
ATOM   198   O  OD2 . ASP A  1 26  ? 30.502  41.957  7.760   1.00 41.77  ? 26  ASP A OD2 1 
ATOM   199   N  N   . ALA A  1 27  ? 34.282  40.247  11.291  1.00 31.52  ? 27  ALA A N   1 
ATOM   200   C  CA  . ALA A  1 27  ? 35.703  40.008  11.485  1.00 36.44  ? 27  ALA A CA  1 
ATOM   201   C  C   . ALA A  1 27  ? 36.252  39.193  10.319  1.00 40.24  ? 27  ALA A C   1 
ATOM   202   O  O   . ALA A  1 27  ? 35.534  38.409  9.700   1.00 44.80  ? 27  ALA A O   1 
ATOM   203   C  CB  . ALA A  1 27  ? 35.948  39.280  12.787  1.00 39.73  ? 27  ALA A CB  1 
ATOM   204   N  N   . ILE A  1 28  ? 37.518  39.408  9.998   1.00 38.49  ? 28  ILE A N   1 
ATOM   205   C  CA  . ILE A  1 28  ? 38.230  38.510  9.109   1.00 44.28  ? 28  ILE A CA  1 
ATOM   206   C  C   . ILE A  1 28  ? 39.157  37.651  9.972   1.00 42.49  ? 28  ILE A C   1 
ATOM   207   O  O   . ILE A  1 28  ? 39.869  38.161  10.847  1.00 40.22  ? 28  ILE A O   1 
ATOM   208   C  CB  . ILE A  1 28  ? 39.030  39.258  8.031   1.00 41.70  ? 28  ILE A CB  1 
ATOM   209   C  CG1 . ILE A  1 28  ? 38.126  40.251  7.287   1.00 42.30  ? 28  ILE A CG1 1 
ATOM   210   C  CG2 . ILE A  1 28  ? 39.666  38.255  7.061   1.00 41.56  ? 28  ILE A CG2 1 
ATOM   211   C  CD1 . ILE A  1 28  ? 36.877  39.626  6.654   1.00 38.54  ? 28  ILE A CD1 1 
ATOM   212   N  N   . VAL A  1 29  ? 39.114  36.346  9.741   1.00 39.49  ? 29  VAL A N   1 
ATOM   213   C  CA  . VAL A  1 29  ? 39.822  35.388  10.581  1.00 39.02  ? 29  VAL A CA  1 
ATOM   214   C  C   . VAL A  1 29  ? 40.739  34.519  9.728   1.00 39.70  ? 29  VAL A C   1 
ATOM   215   O  O   . VAL A  1 29  ? 40.393  34.161  8.600   1.00 41.13  ? 29  VAL A O   1 
ATOM   216   C  CB  . VAL A  1 29  ? 38.813  34.471  11.315  1.00 42.45  ? 29  VAL A CB  1 
ATOM   217   C  CG1 . VAL A  1 29  ? 39.542  33.424  12.186  1.00 39.93  ? 29  VAL A CG1 1 
ATOM   218   C  CG2 . VAL A  1 29  ? 37.827  35.310  12.142  1.00 33.22  ? 29  VAL A CG2 1 
ATOM   219   N  N   . ARG A  1 30  ? 41.911  34.173  10.254  1.00 41.51  ? 30  ARG A N   1 
ATOM   220   C  CA  . ARG A  1 30  ? 42.729  33.162  9.590   1.00 37.98  ? 30  ARG A CA  1 
ATOM   221   C  C   . ARG A  1 30  ? 42.729  31.896  10.443  1.00 39.97  ? 30  ARG A C   1 
ATOM   222   O  O   . ARG A  1 30  ? 42.855  31.960  11.666  1.00 40.75  ? 30  ARG A O   1 
ATOM   223   C  CB  . ARG A  1 30  ? 44.152  33.658  9.286   1.00 40.12  ? 30  ARG A CB  1 
ATOM   224   C  CG  . ARG A  1 30  ? 44.976  33.998  10.493  1.00 46.31  ? 30  ARG A CG  1 
ATOM   225   C  CD  . ARG A  1 30  ? 46.473  33.876  10.187  1.00 61.99  ? 30  ARG A CD  1 
ATOM   226   N  NE  . ARG A  1 30  ? 47.302  34.535  11.200  1.00 75.30  ? 30  ARG A NE  1 
ATOM   227   C  CZ  . ARG A  1 30  ? 47.844  35.745  11.056  1.00 87.18  ? 30  ARG A CZ  1 
ATOM   228   N  NH1 . ARG A  1 30  ? 47.653  36.433  9.937   1.00 93.07  ? 30  ARG A NH1 1 
ATOM   229   N  NH2 . ARG A  1 30  ? 48.582  36.275  12.027  1.00 86.76  ? 30  ARG A NH2 1 
ATOM   230   N  N   . PRO A  1 31  ? 42.558  30.737  9.796   1.00 35.31  ? 31  PRO A N   1 
ATOM   231   C  CA  . PRO A  1 31  ? 42.410  29.462  10.505  1.00 34.64  ? 31  PRO A CA  1 
ATOM   232   C  C   . PRO A  1 31  ? 43.712  29.026  11.181  1.00 37.97  ? 31  PRO A C   1 
ATOM   233   O  O   . PRO A  1 31  ? 44.769  29.146  10.582  1.00 42.70  ? 31  PRO A O   1 
ATOM   234   C  CB  . PRO A  1 31  ? 42.066  28.491  9.373   1.00 27.48  ? 31  PRO A CB  1 
ATOM   235   C  CG  . PRO A  1 31  ? 42.728  29.117  8.165   1.00 34.93  ? 31  PRO A CG  1 
ATOM   236   C  CD  . PRO A  1 31  ? 42.433  30.567  8.338   1.00 33.97  ? 31  PRO A CD  1 
ATOM   237   N  N   . LEU A  1 32  ? 43.632  28.512  12.400  1.00 38.30  ? 32  LEU A N   1 
ATOM   238   C  CA  . LEU A  1 32  ? 44.807  27.936  13.052  1.00 39.16  ? 32  LEU A CA  1 
ATOM   239   C  C   . LEU A  1 32  ? 44.703  26.416  13.043  1.00 40.88  ? 32  LEU A C   1 
ATOM   240   O  O   . LEU A  1 32  ? 45.706  25.703  13.068  1.00 41.52  ? 32  LEU A O   1 
ATOM   241   C  CB  . LEU A  1 32  ? 44.924  28.422  14.491  1.00 33.85  ? 32  LEU A CB  1 
ATOM   242   C  CG  . LEU A  1 32  ? 45.141  29.917  14.706  1.00 41.94  ? 32  LEU A CG  1 
ATOM   243   C  CD1 . LEU A  1 32  ? 45.152  30.220  16.195  1.00 39.26  ? 32  LEU A CD1 1 
ATOM   244   C  CD2 . LEU A  1 32  ? 46.456  30.361  14.074  1.00 48.83  ? 32  LEU A CD2 1 
ATOM   245   N  N   . ALA A  1 33  ? 43.474  25.923  13.038  1.00 32.32  ? 33  ALA A N   1 
ATOM   246   C  CA  . ALA A  1 33  ? 43.229  24.498  12.959  1.00 31.12  ? 33  ALA A CA  1 
ATOM   247   C  C   . ALA A  1 33  ? 41.871  24.300  12.302  1.00 37.20  ? 33  ALA A C   1 
ATOM   248   O  O   . ALA A  1 33  ? 40.928  25.032  12.607  1.00 41.34  ? 33  ALA A O   1 
ATOM   249   C  CB  . ALA A  1 33  ? 43.263  23.876  14.365  1.00 27.32  ? 33  ALA A CB  1 
ATOM   250   N  N   . VAL A  1 34  ? 41.777  23.348  11.375  1.00 34.83  ? 34  VAL A N   1 
ATOM   251   C  CA  . VAL A  1 34  ? 40.486  23.043  10.747  1.00 36.83  ? 34  VAL A CA  1 
ATOM   252   C  C   . VAL A  1 34  ? 40.257  21.550  10.617  1.00 37.15  ? 34  VAL A C   1 
ATOM   253   O  O   . VAL A  1 34  ? 41.196  20.749  10.666  1.00 31.27  ? 34  VAL A O   1 
ATOM   254   C  CB  . VAL A  1 34  ? 40.322  23.669  9.327   1.00 35.85  ? 34  VAL A CB  1 
ATOM   255   C  CG1 . VAL A  1 34  ? 40.489  25.185  9.365   1.00 35.71  ? 34  VAL A CG1 1 
ATOM   256   C  CG2 . VAL A  1 34  ? 41.298  23.033  8.343   1.00 38.66  ? 34  VAL A CG2 1 
ATOM   257   N  N   . ALA A  1 35  ? 38.997  21.186  10.425  1.00 33.47  ? 35  ALA A N   1 
ATOM   258   C  CA  . ALA A  1 35  ? 38.610  19.800  10.196  1.00 37.65  ? 35  ALA A CA  1 
ATOM   259   C  C   . ALA A  1 35  ? 37.598  19.705  9.045   1.00 37.96  ? 35  ALA A C   1 
ATOM   260   O  O   . ALA A  1 35  ? 36.844  20.650  8.801   1.00 33.75  ? 35  ALA A O   1 
ATOM   261   C  CB  . ALA A  1 35  ? 38.031  19.202  11.475  1.00 26.78  ? 35  ALA A CB  1 
ATOM   262   N  N   . PRO A  1 36  ? 37.587  18.574  8.320   1.00 35.06  ? 36  PRO A N   1 
ATOM   263   C  CA  . PRO A  1 36  ? 36.543  18.411  7.311   1.00 34.59  ? 36  PRO A CA  1 
ATOM   264   C  C   . PRO A  1 36  ? 35.350  17.692  7.912   1.00 29.83  ? 36  PRO A C   1 
ATOM   265   O  O   . PRO A  1 36  ? 35.470  17.020  8.948   1.00 26.54  ? 36  PRO A O   1 
ATOM   266   C  CB  . PRO A  1 36  ? 37.198  17.509  6.263   1.00 33.83  ? 36  PRO A CB  1 
ATOM   267   C  CG  . PRO A  1 36  ? 38.427  16.897  6.960   1.00 41.35  ? 36  PRO A CG  1 
ATOM   268   C  CD  . PRO A  1 36  ? 38.482  17.412  8.364   1.00 38.70  ? 36  PRO A CD  1 
ATOM   269   N  N   . CYS A  1 37  ? 34.214  17.803  7.236   1.00 24.60  ? 37  CYS A N   1 
ATOM   270   C  CA  . CYS A  1 37  ? 32.961  17.236  7.706   1.00 31.53  ? 37  CYS A CA  1 
ATOM   271   C  C   . CYS A  1 37  ? 32.377  16.345  6.621   1.00 32.49  ? 37  CYS A C   1 
ATOM   272   O  O   . CYS A  1 37  ? 32.475  16.657  5.431   1.00 31.58  ? 37  CYS A O   1 
ATOM   273   C  CB  . CYS A  1 37  ? 31.954  18.346  8.036   1.00 37.73  ? 37  CYS A CB  1 
ATOM   274   S  SG  . CYS A  1 37  ? 30.352  17.753  8.715   1.00 36.24  ? 37  CYS A SG  1 
ATOM   275   N  N   . THR A  1 38  ? 31.780  15.235  7.043   1.00 33.40  ? 38  THR A N   1 
ATOM   276   C  CA  . THR A  1 38  ? 31.021  14.363  6.144   1.00 40.30  ? 38  THR A CA  1 
ATOM   277   C  C   . THR A  1 38  ? 29.977  15.130  5.346   1.00 40.17  ? 38  THR A C   1 
ATOM   278   O  O   . THR A  1 38  ? 29.690  14.776  4.203   1.00 37.83  ? 38  THR A O   1 
ATOM   279   C  CB  . THR A  1 38  ? 30.292  13.257  6.912   1.00 43.01  ? 38  THR A CB  1 
ATOM   280   O  OG1 . THR A  1 38  ? 29.371  13.854  7.835   1.00 54.64  ? 38  THR A OG1 1 
ATOM   281   C  CG2 . THR A  1 38  ? 31.284  12.399  7.677   1.00 41.50  ? 38  THR A CG2 1 
ATOM   282   N  N   . SER A  1 39  ? 29.410  16.180  5.942   1.00 38.44  ? 39  SER A N   1 
ATOM   283   C  CA  . SER A  1 39  ? 28.415  16.994  5.232   1.00 34.18  ? 39  SER A CA  1 
ATOM   284   C  C   . SER A  1 39  ? 28.988  17.542  3.933   1.00 36.07  ? 39  SER A C   1 
ATOM   285   O  O   . SER A  1 39  ? 28.311  17.543  2.917   1.00 29.48  ? 39  SER A O   1 
ATOM   286   C  CB  . SER A  1 39  ? 27.902  18.145  6.094   1.00 34.09  ? 39  SER A CB  1 
ATOM   287   O  OG  . SER A  1 39  ? 28.891  19.157  6.211   1.00 44.70  ? 39  SER A OG  1 
ATOM   288   N  N   . ASP A  1 40  ? 30.236  18.004  3.945   1.00 35.61  ? 40  ASP A N   1 
ATOM   289   C  CA  . ASP A  1 40  ? 30.807  18.491  2.688   1.00 40.82  ? 40  ASP A CA  1 
ATOM   290   C  C   . ASP A  1 40  ? 30.943  17.365  1.657   1.00 43.13  ? 40  ASP A C   1 
ATOM   291   O  O   . ASP A  1 40  ? 30.957  17.614  0.452   1.00 40.85  ? 40  ASP A O   1 
ATOM   292   C  CB  . ASP A  1 40  ? 32.147  19.199  2.906   1.00 38.02  ? 40  ASP A CB  1 
ATOM   293   C  CG  . ASP A  1 40  ? 31.976  20.617  3.397   1.00 37.83  ? 40  ASP A CG  1 
ATOM   294   O  OD1 . ASP A  1 40  ? 30.808  21.056  3.493   1.00 31.81  ? 40  ASP A OD1 1 
ATOM   295   O  OD2 . ASP A  1 40  ? 33.000  21.287  3.692   1.00 35.39  ? 40  ASP A OD2 1 
ATOM   296   N  N   . ILE A  1 41  ? 31.061  16.126  2.126   1.00 42.66  ? 41  ILE A N   1 
ATOM   297   C  CA  . ILE A  1 41  ? 31.130  15.010  1.197   1.00 42.35  ? 41  ILE A CA  1 
ATOM   298   C  C   . ILE A  1 41  ? 29.788  14.837  0.469   1.00 38.63  ? 41  ILE A C   1 
ATOM   299   O  O   . ILE A  1 41  ? 29.755  14.640  -0.739  1.00 34.45  ? 41  ILE A O   1 
ATOM   300   C  CB  . ILE A  1 41  ? 31.498  13.704  1.903   1.00 43.35  ? 41  ILE A CB  1 
ATOM   301   C  CG1 . ILE A  1 41  ? 32.862  13.830  2.596   1.00 40.28  ? 41  ILE A CG1 1 
ATOM   302   C  CG2 . ILE A  1 41  ? 31.446  12.516  0.908   1.00 32.89  ? 41  ILE A CG2 1 
ATOM   303   C  CD1 . ILE A  1 41  ? 33.975  14.346  1.709   1.00 37.47  ? 41  ILE A CD1 1 
ATOM   304   N  N   . HIS A  1 42  ? 28.692  14.912  1.223   1.00 33.15  ? 42  HIS A N   1 
ATOM   305   C  CA  . HIS A  1 42  ? 27.353  14.824  0.669   1.00 34.37  ? 42  HIS A CA  1 
ATOM   306   C  C   . HIS A  1 42  ? 27.090  15.952  -0.327  1.00 45.95  ? 42  HIS A C   1 
ATOM   307   O  O   . HIS A  1 42  ? 26.522  15.718  -1.400  1.00 45.94  ? 42  HIS A O   1 
ATOM   308   C  CB  . HIS A  1 42  ? 26.283  14.867  1.773   1.00 39.68  ? 42  HIS A CB  1 
ATOM   309   C  CG  . HIS A  1 42  ? 26.313  13.694  2.704   1.00 49.75  ? 42  HIS A CG  1 
ATOM   310   N  ND1 . HIS A  1 42  ? 26.654  12.422  2.293   1.00 56.38  ? 42  HIS A ND1 1 
ATOM   311   C  CD2 . HIS A  1 42  ? 26.019  13.596  4.023   1.00 49.27  ? 42  HIS A CD2 1 
ATOM   312   C  CE1 . HIS A  1 42  ? 26.584  11.595  3.323   1.00 50.83  ? 42  HIS A CE1 1 
ATOM   313   N  NE2 . HIS A  1 42  ? 26.195  12.281  4.383   1.00 50.06  ? 42  HIS A NE2 1 
ATOM   314   N  N   . THR A  1 43  ? 27.478  17.178  0.020   1.00 39.53  ? 43  THR A N   1 
ATOM   315   C  CA  . THR A  1 43  ? 27.163  18.289  -0.864  1.00 38.36  ? 43  THR A CA  1 
ATOM   316   C  C   . THR A  1 43  ? 27.952  18.205  -2.169  1.00 45.40  ? 43  THR A C   1 
ATOM   317   O  O   . THR A  1 43  ? 27.402  18.420  -3.251  1.00 48.21  ? 43  THR A O   1 
ATOM   318   C  CB  . THR A  1 43  ? 27.349  19.657  -0.193  1.00 40.77  ? 43  THR A CB  1 
ATOM   319   O  OG1 . THR A  1 43  ? 28.735  20.006  -0.195  1.00 62.80  ? 43  THR A OG1 1 
ATOM   320   C  CG2 . THR A  1 43  ? 26.807  19.617  1.234   1.00 25.57  ? 43  THR A CG2 1 
ATOM   321   N  N   . VAL A  1 44  ? 29.228  17.859  -2.072  1.00 41.08  ? 44  VAL A N   1 
ATOM   322   C  CA  . VAL A  1 44  ? 30.075  17.784  -3.258  1.00 43.49  ? 44  VAL A CA  1 
ATOM   323   C  C   . VAL A  1 44  ? 29.686  16.645  -4.210  1.00 52.21  ? 44  VAL A C   1 
ATOM   324   O  O   . VAL A  1 44  ? 29.370  16.880  -5.378  1.00 50.30  ? 44  VAL A O   1 
ATOM   325   C  CB  . VAL A  1 44  ? 31.555  17.661  -2.860  1.00 49.43  ? 44  VAL A CB  1 
ATOM   326   C  CG1 . VAL A  1 44  ? 32.421  17.369  -4.072  1.00 50.46  ? 44  VAL A CG1 1 
ATOM   327   C  CG2 . VAL A  1 44  ? 32.013  18.941  -2.164  1.00 48.23  ? 44  VAL A CG2 1 
ATOM   328   N  N   . PHE A  1 45  ? 29.678  15.418  -3.694  1.00 52.98  ? 45  PHE A N   1 
ATOM   329   C  CA  . PHE A  1 45  ? 29.542  14.225  -4.528  1.00 48.50  ? 45  PHE A CA  1 
ATOM   330   C  C   . PHE A  1 45  ? 28.114  13.698  -4.686  1.00 47.28  ? 45  PHE A C   1 
ATOM   331   O  O   . PHE A  1 45  ? 27.823  12.968  -5.631  1.00 50.61  ? 45  PHE A O   1 
ATOM   332   C  CB  . PHE A  1 45  ? 30.464  13.118  -4.010  1.00 47.44  ? 45  PHE A CB  1 
ATOM   333   C  CG  . PHE A  1 45  ? 31.907  13.539  -3.911  1.00 48.40  ? 45  PHE A CG  1 
ATOM   334   C  CD1 . PHE A  1 45  ? 32.715  13.550  -5.037  1.00 49.02  ? 45  PHE A CD1 1 
ATOM   335   C  CD2 . PHE A  1 45  ? 32.446  13.946  -2.699  1.00 37.67  ? 45  PHE A CD2 1 
ATOM   336   C  CE1 . PHE A  1 45  ? 34.034  13.936  -4.952  1.00 44.66  ? 45  PHE A CE1 1 
ATOM   337   C  CE2 . PHE A  1 45  ? 33.759  14.338  -2.611  1.00 38.06  ? 45  PHE A CE2 1 
ATOM   338   C  CZ  . PHE A  1 45  ? 34.558  14.329  -3.738  1.00 44.45  ? 45  PHE A CZ  1 
ATOM   339   N  N   . GLU A  1 46  ? 27.229  14.056  -3.767  1.00 41.63  ? 46  GLU A N   1 
ATOM   340   C  CA  . GLU A  1 46  ? 25.824  13.711  -3.919  1.00 43.23  ? 46  GLU A CA  1 
ATOM   341   C  C   . GLU A  1 46  ? 24.942  14.911  -4.294  1.00 54.29  ? 46  GLU A C   1 
ATOM   342   O  O   . GLU A  1 46  ? 23.727  14.763  -4.462  1.00 53.68  ? 46  GLU A O   1 
ATOM   343   C  CB  . GLU A  1 46  ? 25.307  13.019  -2.666  1.00 42.77  ? 46  GLU A CB  1 
ATOM   344   C  CG  . GLU A  1 46  ? 26.045  11.720  -2.394  1.00 57.63  ? 46  GLU A CG  1 
ATOM   345   C  CD  . GLU A  1 46  ? 25.624  11.058  -1.104  1.00 71.96  ? 46  GLU A CD  1 
ATOM   346   O  OE1 . GLU A  1 46  ? 24.627  11.505  -0.496  1.00 77.20  ? 46  GLU A OE1 1 
ATOM   347   O  OE2 . GLU A  1 46  ? 26.295  10.084  -0.700  1.00 79.78  ? 46  GLU A OE2 1 
ATOM   348   N  N   . GLY A  1 47  ? 25.552  16.087  -4.446  1.00 49.96  ? 47  GLY A N   1 
ATOM   349   C  CA  . GLY A  1 47  ? 24.807  17.288  -4.789  1.00 43.06  ? 47  GLY A CA  1 
ATOM   350   C  C   . GLY A  1 47  ? 23.604  17.455  -3.884  1.00 43.64  ? 47  GLY A C   1 
ATOM   351   O  O   . GLY A  1 47  ? 22.539  17.905  -4.315  1.00 43.67  ? 47  GLY A O   1 
ATOM   352   N  N   . ALA A  1 48  ? 23.790  17.103  -2.616  1.00 40.07  ? 48  ALA A N   1 
ATOM   353   C  CA  . ALA A  1 48  ? 22.705  17.001  -1.638  1.00 44.57  ? 48  ALA A CA  1 
ATOM   354   C  C   . ALA A  1 48  ? 21.914  18.294  -1.426  1.00 52.94  ? 48  ALA A C   1 
ATOM   355   O  O   . ALA A  1 48  ? 20.715  18.254  -1.123  1.00 60.24  ? 48  ALA A O   1 
ATOM   356   C  CB  . ALA A  1 48  ? 23.257  16.491  -0.296  1.00 41.60  ? 48  ALA A CB  1 
ATOM   357   N  N   . ILE A  1 49  ? 22.590  19.430  -1.566  1.00 46.77  ? 49  ILE A N   1 
ATOM   358   C  CA  . ILE A  1 49  ? 21.937  20.730  -1.430  1.00 52.23  ? 49  ILE A CA  1 
ATOM   359   C  C   . ILE A  1 49  ? 22.076  21.602  -2.691  1.00 54.29  ? 49  ILE A C   1 
ATOM   360   O  O   . ILE A  1 49  ? 22.018  22.844  -2.628  1.00 48.93  ? 49  ILE A O   1 
ATOM   361   C  CB  . ILE A  1 49  ? 22.457  21.500  -0.193  1.00 51.25  ? 49  ILE A CB  1 
ATOM   362   C  CG1 . ILE A  1 49  ? 23.974  21.366  -0.087  1.00 49.56  ? 49  ILE A CG1 1 
ATOM   363   C  CG2 . ILE A  1 49  ? 21.769  21.004  1.080   1.00 53.28  ? 49  ILE A CG2 1 
ATOM   364   C  CD1 . ILE A  1 49  ? 24.575  22.182  1.049   1.00 60.71  ? 49  ILE A CD1 1 
ATOM   365   N  N   . GLY A  1 50  ? 22.266  20.947  -3.833  1.00 54.18  ? 50  GLY A N   1 
ATOM   366   C  CA  . GLY A  1 50  ? 22.289  21.643  -5.104  1.00 54.29  ? 50  GLY A CA  1 
ATOM   367   C  C   . GLY A  1 50  ? 23.657  22.003  -5.638  1.00 52.79  ? 50  GLY A C   1 
ATOM   368   O  O   . GLY A  1 50  ? 24.672  21.740  -5.006  1.00 53.54  ? 50  GLY A O   1 
ATOM   369   N  N   . GLU A  1 51  ? 23.666  22.617  -6.818  1.00 49.54  ? 51  GLU A N   1 
ATOM   370   C  CA  . GLU A  1 51  ? 24.889  22.996  -7.511  1.00 49.51  ? 51  GLU A CA  1 
ATOM   371   C  C   . GLU A  1 51  ? 25.653  24.100  -6.773  1.00 47.96  ? 51  GLU A C   1 
ATOM   372   O  O   . GLU A  1 51  ? 25.068  24.843  -5.995  1.00 49.90  ? 51  GLU A O   1 
ATOM   373   C  CB  . GLU A  1 51  ? 24.538  23.464  -8.928  1.00 50.16  ? 51  GLU A CB  1 
ATOM   374   C  CG  . GLU A  1 51  ? 25.724  23.588  -9.864  1.00 55.02  ? 51  GLU A CG  1 
ATOM   375   C  CD  . GLU A  1 51  ? 26.560  22.322  -9.909  1.00 65.81  ? 51  GLU A CD  1 
ATOM   376   O  OE1 . GLU A  1 51  ? 26.447  21.570  -10.901 1.00 69.38  ? 51  GLU A OE1 1 
ATOM   377   O  OE2 . GLU A  1 51  ? 27.322  22.073  -8.947  1.00 68.25  ? 51  GLU A OE2 1 
ATOM   378   N  N   . ARG A  1 52  ? 26.958  24.194  -7.020  1.00 48.20  ? 52  ARG A N   1 
ATOM   379   C  CA  . ARG A  1 52  ? 27.803  25.254  -6.467  1.00 49.23  ? 52  ARG A CA  1 
ATOM   380   C  C   . ARG A  1 52  ? 28.993  25.443  -7.389  1.00 52.53  ? 52  ARG A C   1 
ATOM   381   O  O   . ARG A  1 52  ? 29.492  24.482  -7.968  1.00 57.43  ? 52  ARG A O   1 
ATOM   382   C  CB  . ARG A  1 52  ? 28.346  24.901  -5.067  1.00 43.56  ? 52  ARG A CB  1 
ATOM   383   C  CG  . ARG A  1 52  ? 27.314  24.730  -3.960  1.00 37.24  ? 52  ARG A CG  1 
ATOM   384   C  CD  . ARG A  1 52  ? 26.613  26.024  -3.647  1.00 38.56  ? 52  ARG A CD  1 
ATOM   385   N  NE  . ARG A  1 52  ? 25.779  25.913  -2.455  1.00 41.97  ? 52  ARG A NE  1 
ATOM   386   C  CZ  . ARG A  1 52  ? 24.564  25.373  -2.423  1.00 46.67  ? 52  ARG A CZ  1 
ATOM   387   N  NH1 . ARG A  1 52  ? 24.026  24.864  -3.524  1.00 44.80  ? 52  ARG A NH1 1 
ATOM   388   N  NH2 . ARG A  1 52  ? 23.887  25.336  -1.281  1.00 49.16  ? 52  ARG A NH2 1 
ATOM   389   N  N   . HIS A  1 53  ? 29.478  26.670  -7.503  1.00 55.81  ? 53  HIS A N   1 
ATOM   390   C  CA  . HIS A  1 53  ? 30.672  26.900  -8.304  1.00 62.34  ? 53  HIS A CA  1 
ATOM   391   C  C   . HIS A  1 53  ? 31.765  27.634  -7.538  1.00 58.00  ? 53  HIS A C   1 
ATOM   392   O  O   . HIS A  1 53  ? 31.548  28.716  -6.989  1.00 57.97  ? 53  HIS A O   1 
ATOM   393   C  CB  . HIS A  1 53  ? 30.319  27.586  -9.628  1.00 70.87  ? 53  HIS A CB  1 
ATOM   394   C  CG  . HIS A  1 53  ? 29.503  26.722  -10.541 1.00 83.39  ? 53  HIS A CG  1 
ATOM   395   N  ND1 . HIS A  1 53  ? 30.056  25.716  -11.305 1.00 89.57  ? 53  HIS A ND1 1 
ATOM   396   C  CD2 . HIS A  1 53  ? 28.170  26.693  -10.790 1.00 85.67  ? 53  HIS A CD2 1 
ATOM   397   C  CE1 . HIS A  1 53  ? 29.102  25.114  -11.996 1.00 91.13  ? 53  HIS A CE1 1 
ATOM   398   N  NE2 . HIS A  1 53  ? 27.949  25.689  -11.702 1.00 86.85  ? 53  HIS A NE2 1 
ATOM   399   N  N   . ASN A  1 54  ? 32.940  27.019  -7.493  1.00 53.40  ? 54  ASN A N   1 
ATOM   400   C  CA  . ASN A  1 54  ? 34.056  27.566  -6.743  1.00 50.81  ? 54  ASN A CA  1 
ATOM   401   C  C   . ASN A  1 54  ? 33.662  27.986  -5.326  1.00 38.74  ? 54  ASN A C   1 
ATOM   402   O  O   . ASN A  1 54  ? 33.912  29.105  -4.899  1.00 40.13  ? 54  ASN A O   1 
ATOM   403   C  CB  . ASN A  1 54  ? 34.676  28.731  -7.510  1.00 58.55  ? 54  ASN A CB  1 
ATOM   404   C  CG  . ASN A  1 54  ? 35.187  28.313  -8.864  1.00 61.62  ? 54  ASN A CG  1 
ATOM   405   O  OD1 . ASN A  1 54  ? 35.404  27.128  -9.115  1.00 62.39  ? 54  ASN A OD1 1 
ATOM   406   N  ND2 . ASN A  1 54  ? 35.377  29.279  -9.752  1.00 66.29  ? 54  ASN A ND2 1 
ATOM   407   N  N   . MET A  1 55  ? 33.035  27.079  -4.597  1.00 38.51  ? 55  MET A N   1 
ATOM   408   C  CA  . MET A  1 55  ? 32.713  27.352  -3.213  1.00 38.43  ? 55  MET A CA  1 
ATOM   409   C  C   . MET A  1 55  ? 33.765  26.761  -2.283  1.00 42.43  ? 55  MET A C   1 
ATOM   410   O  O   . MET A  1 55  ? 33.884  25.542  -2.172  1.00 35.21  ? 55  MET A O   1 
ATOM   411   C  CB  . MET A  1 55  ? 31.379  26.746  -2.863  1.00 32.53  ? 55  MET A CB  1 
ATOM   412   C  CG  . MET A  1 55  ? 30.806  27.344  -1.625  1.00 30.79  ? 55  MET A CG  1 
ATOM   413   S  SD  . MET A  1 55  ? 29.465  26.350  -0.989  1.00 41.32  ? 55  MET A SD  1 
ATOM   414   C  CE  . MET A  1 55  ? 28.784  27.549  0.144   1.00 124.90 ? 55  MET A CE  1 
ATOM   415   N  N   . ILE A  1 56  ? 34.532  27.616  -1.618  1.00 40.40  ? 56  ILE A N   1 
ATOM   416   C  CA  . ILE A  1 56  ? 35.495  27.118  -0.647  1.00 34.89  ? 56  ILE A CA  1 
ATOM   417   C  C   . ILE A  1 56  ? 34.771  26.301  0.416   1.00 37.83  ? 56  ILE A C   1 
ATOM   418   O  O   . ILE A  1 56  ? 33.775  26.747  1.003   1.00 39.62  ? 56  ILE A O   1 
ATOM   419   C  CB  . ILE A  1 56  ? 36.270  28.254  0.014   1.00 39.57  ? 56  ILE A CB  1 
ATOM   420   C  CG1 . ILE A  1 56  ? 36.930  29.130  -1.054  1.00 34.87  ? 56  ILE A CG1 1 
ATOM   421   C  CG2 . ILE A  1 56  ? 37.296  27.692  1.003   1.00 45.21  ? 56  ILE A CG2 1 
ATOM   422   C  CD1 . ILE A  1 56  ? 37.692  30.318  -0.480  1.00 38.67  ? 56  ILE A CD1 1 
ATOM   423   N  N   . LEU A  1 57  ? 35.272  25.096  0.652   1.00 35.27  ? 57  LEU A N   1 
ATOM   424   C  CA  . LEU A  1 57  ? 34.650  24.171  1.581   1.00 39.00  ? 57  LEU A CA  1 
ATOM   425   C  C   . LEU A  1 57  ? 35.096  24.391  3.037   1.00 40.89  ? 57  LEU A C   1 
ATOM   426   O  O   . LEU A  1 57  ? 35.911  25.274  3.321   1.00 37.40  ? 57  LEU A O   1 
ATOM   427   C  CB  . LEU A  1 57  ? 34.946  22.747  1.123   1.00 40.37  ? 57  LEU A CB  1 
ATOM   428   C  CG  . LEU A  1 57  ? 34.348  22.444  -0.260  1.00 38.77  ? 57  LEU A CG  1 
ATOM   429   C  CD1 . LEU A  1 57  ? 35.108  21.342  -0.980  1.00 42.10  ? 57  LEU A CD1 1 
ATOM   430   C  CD2 . LEU A  1 57  ? 32.877  22.082  -0.116  1.00 32.27  ? 57  LEU A CD2 1 
ATOM   431   N  N   . GLY A  1 58  ? 34.536  23.596  3.950   1.00 39.17  ? 58  GLY A N   1 
ATOM   432   C  CA  . GLY A  1 58  ? 34.918  23.622  5.357   1.00 29.03  ? 58  GLY A CA  1 
ATOM   433   C  C   . GLY A  1 58  ? 34.141  24.601  6.224   1.00 31.80  ? 58  GLY A C   1 
ATOM   434   O  O   . GLY A  1 58  ? 33.937  25.769  5.847   1.00 30.89  ? 58  GLY A O   1 
ATOM   435   N  N   . HIS A  1 59  ? 33.715  24.137  7.394   1.00 28.55  ? 59  HIS A N   1 
ATOM   436   C  CA  . HIS A  1 59  ? 33.013  24.996  8.344   1.00 33.29  ? 59  HIS A CA  1 
ATOM   437   C  C   . HIS A  1 59  ? 33.376  24.673  9.792   1.00 34.65  ? 59  HIS A C   1 
ATOM   438   O  O   . HIS A  1 59  ? 32.615  24.969  10.709  1.00 37.58  ? 59  HIS A O   1 
ATOM   439   C  CB  . HIS A  1 59  ? 31.499  24.902  8.158   1.00 30.50  ? 59  HIS A CB  1 
ATOM   440   C  CG  . HIS A  1 59  ? 30.996  23.498  8.049   1.00 34.16  ? 59  HIS A CG  1 
ATOM   441   N  ND1 . HIS A  1 59  ? 30.677  22.916  6.839   1.00 31.34  ? 59  HIS A ND1 1 
ATOM   442   C  CD2 . HIS A  1 59  ? 30.766  22.556  8.995   1.00 33.21  ? 59  HIS A CD2 1 
ATOM   443   C  CE1 . HIS A  1 59  ? 30.271  21.677  7.045   1.00 27.52  ? 59  HIS A CE1 1 
ATOM   444   N  NE2 . HIS A  1 59  ? 30.324  21.430  8.342   1.00 27.75  ? 59  HIS A NE2 1 
ATOM   445   N  N   . GLU A  1 60  ? 34.542  24.076  9.993   1.00 30.87  ? 60  GLU A N   1 
ATOM   446   C  CA  . GLU A  1 60  ? 35.040  23.818  11.340  1.00 29.15  ? 60  GLU A CA  1 
ATOM   447   C  C   . GLU A  1 60  ? 36.450  24.390  11.515  1.00 35.27  ? 60  GLU A C   1 
ATOM   448   O  O   . GLU A  1 60  ? 37.411  23.859  10.968  1.00 37.85  ? 60  GLU A O   1 
ATOM   449   C  CB  . GLU A  1 60  ? 35.060  22.322  11.629  1.00 26.95  ? 60  GLU A CB  1 
ATOM   450   C  CG  . GLU A  1 60  ? 33.683  21.671  11.693  1.00 32.14  ? 60  GLU A CG  1 
ATOM   451   C  CD  . GLU A  1 60  ? 33.774  20.188  11.459  1.00 34.32  ? 60  GLU A CD  1 
ATOM   452   O  OE1 . GLU A  1 60  ? 33.821  19.431  12.458  1.00 26.60  ? 60  GLU A OE1 1 
ATOM   453   O  OE2 . GLU A  1 60  ? 33.860  19.786  10.279  1.00 37.01  ? 60  GLU A OE2 1 
ATOM   454   N  N   . ALA A  1 61  ? 36.562  25.468  12.285  1.00 27.58  ? 61  ALA A N   1 
ATOM   455   C  CA  . ALA A  1 61  ? 37.831  26.153  12.450  1.00 29.08  ? 61  ALA A CA  1 
ATOM   456   C  C   . ALA A  1 61  ? 37.976  26.800  13.811  1.00 32.57  ? 61  ALA A C   1 
ATOM   457   O  O   . ALA A  1 61  ? 37.006  27.278  14.414  1.00 33.41  ? 61  ALA A O   1 
ATOM   458   C  CB  . ALA A  1 61  ? 38.040  27.213  11.354  1.00 25.03  ? 61  ALA A CB  1 
ATOM   459   N  N   . VAL A  1 62  ? 39.215  26.791  14.280  1.00 37.07  ? 62  VAL A N   1 
ATOM   460   C  CA  . VAL A  1 62  ? 39.669  27.671  15.343  1.00 38.67  ? 62  VAL A CA  1 
ATOM   461   C  C   . VAL A  1 62  ? 40.636  28.609  14.655  1.00 37.91  ? 62  VAL A C   1 
ATOM   462   O  O   . VAL A  1 62  ? 41.412  28.185  13.790  1.00 35.31  ? 62  VAL A O   1 
ATOM   463   C  CB  . VAL A  1 62  ? 40.401  26.908  16.468  1.00 36.60  ? 62  VAL A CB  1 
ATOM   464   C  CG1 . VAL A  1 62  ? 41.010  27.892  17.456  1.00 39.85  ? 62  VAL A CG1 1 
ATOM   465   C  CG2 . VAL A  1 62  ? 39.426  25.986  17.187  1.00 36.18  ? 62  VAL A CG2 1 
ATOM   466   N  N   . GLY A  1 63  ? 40.582  29.887  15.001  1.00 35.18  ? 63  GLY A N   1 
ATOM   467   C  CA  . GLY A  1 63  ? 41.349  30.857  14.251  1.00 35.58  ? 63  GLY A CA  1 
ATOM   468   C  C   . GLY A  1 63  ? 41.862  32.028  15.071  1.00 38.92  ? 63  GLY A C   1 
ATOM   469   O  O   . GLY A  1 63  ? 41.604  32.130  16.279  1.00 30.25  ? 63  GLY A O   1 
ATOM   470   N  N   . GLU A  1 64  ? 42.599  32.909  14.393  1.00 29.94  ? 64  GLU A N   1 
ATOM   471   C  CA  . GLU A  1 64  ? 43.054  34.156  14.970  1.00 36.70  ? 64  GLU A CA  1 
ATOM   472   C  C   . GLU A  1 64  ? 42.402  35.320  14.227  1.00 33.78  ? 64  GLU A C   1 
ATOM   473   O  O   . GLU A  1 64  ? 42.445  35.395  13.002  1.00 35.62  ? 64  GLU A O   1 
ATOM   474   C  CB  . GLU A  1 64  ? 44.572  34.262  14.857  1.00 37.04  ? 64  GLU A CB  1 
ATOM   475   C  CG  . GLU A  1 64  ? 45.109  35.634  15.167  1.00 44.11  ? 64  GLU A CG  1 
ATOM   476   C  CD  . GLU A  1 64  ? 46.563  35.785  14.763  1.00 58.17  ? 64  GLU A CD  1 
ATOM   477   O  OE1 . GLU A  1 64  ? 46.959  35.198  13.736  1.00 59.62  ? 64  GLU A OE1 1 
ATOM   478   O  OE2 . GLU A  1 64  ? 47.310  36.486  15.476  1.00 64.34  ? 64  GLU A OE2 1 
ATOM   479   N  N   . VAL A  1 65  ? 41.798  36.230  14.969  1.00 36.31  ? 65  VAL A N   1 
ATOM   480   C  CA  . VAL A  1 65  ? 41.204  37.397  14.340  1.00 34.97  ? 65  VAL A CA  1 
ATOM   481   C  C   . VAL A  1 65  ? 42.320  38.247  13.752  1.00 41.45  ? 65  VAL A C   1 
ATOM   482   O  O   . VAL A  1 65  ? 43.316  38.514  14.434  1.00 41.63  ? 65  VAL A O   1 
ATOM   483   C  CB  . VAL A  1 65  ? 40.382  38.186  15.356  1.00 40.29  ? 65  VAL A CB  1 
ATOM   484   C  CG1 . VAL A  1 65  ? 39.798  39.453  14.722  1.00 30.30  ? 65  VAL A CG1 1 
ATOM   485   C  CG2 . VAL A  1 65  ? 39.276  37.291  15.940  1.00 36.81  ? 65  VAL A CG2 1 
ATOM   486   N  N   . VAL A  1 66  ? 42.181  38.642  12.484  1.00 42.54  ? 66  VAL A N   1 
ATOM   487   C  CA  . VAL A  1 66  ? 43.175  39.531  11.858  1.00 45.51  ? 66  VAL A CA  1 
ATOM   488   C  C   . VAL A  1 66  ? 42.630  40.919  11.520  1.00 48.22  ? 66  VAL A C   1 
ATOM   489   O  O   . VAL A  1 66  ? 43.398  41.855  11.276  1.00 44.08  ? 66  VAL A O   1 
ATOM   490   C  CB  . VAL A  1 66  ? 43.826  38.935  10.590  1.00 41.63  ? 66  VAL A CB  1 
ATOM   491   C  CG1 . VAL A  1 66  ? 44.668  37.696  10.940  1.00 38.54  ? 66  VAL A CG1 1 
ATOM   492   C  CG2 . VAL A  1 66  ? 42.773  38.642  9.526   1.00 39.96  ? 66  VAL A CG2 1 
ATOM   493   N  N   . GLU A  1 67  ? 41.311  41.051  11.494  1.00 47.90  ? 67  GLU A N   1 
ATOM   494   C  CA  . GLU A  1 67  ? 40.700  42.375  11.448  1.00 51.35  ? 67  GLU A CA  1 
ATOM   495   C  C   . GLU A  1 67  ? 39.243  42.355  11.830  1.00 47.80  ? 67  GLU A C   1 
ATOM   496   O  O   . GLU A  1 67  ? 38.538  41.368  11.611  1.00 40.94  ? 67  GLU A O   1 
ATOM   497   C  CB  . GLU A  1 67  ? 40.867  43.046  10.086  1.00 56.50  ? 67  GLU A CB  1 
ATOM   498   C  CG  . GLU A  1 67  ? 40.810  42.116  8.926   1.00 62.66  ? 67  GLU A CG  1 
ATOM   499   C  CD  . GLU A  1 67  ? 41.062  42.830  7.617   1.00 73.04  ? 67  GLU A CD  1 
ATOM   500   O  OE1 . GLU A  1 67  ? 40.381  43.854  7.349   1.00 65.01  ? 67  GLU A OE1 1 
ATOM   501   O  OE2 . GLU A  1 67  ? 41.942  42.356  6.862   1.00 78.79  ? 67  GLU A OE2 1 
ATOM   502   N  N   . VAL A  1 68  ? 38.804  43.463  12.412  1.00 46.97  ? 68  VAL A N   1 
ATOM   503   C  CA  . VAL A  1 68  ? 37.416  43.634  12.795  1.00 44.63  ? 68  VAL A CA  1 
ATOM   504   C  C   . VAL A  1 68  ? 36.872  44.907  12.196  1.00 44.04  ? 68  VAL A C   1 
ATOM   505   O  O   . VAL A  1 68  ? 37.633  45.802  11.809  1.00 44.94  ? 68  VAL A O   1 
ATOM   506   C  CB  . VAL A  1 68  ? 37.259  43.669  14.323  1.00 45.24  ? 68  VAL A CB  1 
ATOM   507   C  CG1 . VAL A  1 68  ? 37.747  42.353  14.919  1.00 36.43  ? 68  VAL A CG1 1 
ATOM   508   C  CG2 . VAL A  1 68  ? 38.022  44.845  14.916  1.00 45.93  ? 68  VAL A CG2 1 
ATOM   509   N  N   . GLY A  1 69  ? 35.551  44.981  12.118  1.00 45.68  ? 69  GLY A N   1 
ATOM   510   C  CA  . GLY A  1 69  ? 34.883  46.169  11.618  1.00 43.83  ? 69  GLY A CA  1 
ATOM   511   C  C   . GLY A  1 69  ? 34.809  47.216  12.707  1.00 42.87  ? 69  GLY A C   1 
ATOM   512   O  O   . GLY A  1 69  ? 35.013  46.909  13.892  1.00 39.44  ? 69  GLY A O   1 
ATOM   513   N  N   . SER A  1 70  ? 34.513  48.453  12.309  1.00 50.19  ? 70  SER A N   1 
ATOM   514   C  CA  . SER A  1 70  ? 34.537  49.589  13.231  1.00 46.14  ? 70  SER A CA  1 
ATOM   515   C  C   . SER A  1 70  ? 33.490  49.504  14.345  1.00 47.98  ? 70  SER A C   1 
ATOM   516   O  O   . SER A  1 70  ? 33.581  50.231  15.333  1.00 55.05  ? 70  SER A O   1 
ATOM   517   C  CB  . SER A  1 70  ? 34.376  50.895  12.455  1.00 51.75  ? 70  SER A CB  1 
ATOM   518   O  OG  . SER A  1 70  ? 33.239  50.844  11.619  1.00 50.31  ? 70  SER A OG  1 
ATOM   519   N  N   . GLU A  1 71  ? 32.508  48.611  14.201  1.00 45.77  ? 71  GLU A N   1 
ATOM   520   C  CA  . GLU A  1 71  ? 31.476  48.445  15.225  1.00 42.33  ? 71  GLU A CA  1 
ATOM   521   C  C   . GLU A  1 71  ? 31.702  47.246  16.162  1.00 48.00  ? 71  GLU A C   1 
ATOM   522   O  O   . GLU A  1 71  ? 30.936  47.048  17.109  1.00 44.01  ? 71  GLU A O   1 
ATOM   523   C  CB  . GLU A  1 71  ? 30.090  48.353  14.583  1.00 40.95  ? 71  GLU A CB  1 
ATOM   524   C  CG  . GLU A  1 71  ? 29.630  49.635  13.881  1.00 46.33  ? 71  GLU A CG  1 
ATOM   525   C  CD  . GLU A  1 71  ? 29.629  50.846  14.810  1.00 57.79  ? 71  GLU A CD  1 
ATOM   526   O  OE1 . GLU A  1 71  ? 29.133  50.724  15.956  1.00 57.31  ? 71  GLU A OE1 1 
ATOM   527   O  OE2 . GLU A  1 71  ? 30.122  51.921  14.393  1.00 63.87  ? 71  GLU A OE2 1 
ATOM   528   N  N   . VAL A  1 72  ? 32.753  46.465  15.898  1.00 46.42  ? 72  VAL A N   1 
ATOM   529   C  CA  . VAL A  1 72  ? 33.066  45.268  16.680  1.00 40.36  ? 72  VAL A CA  1 
ATOM   530   C  C   . VAL A  1 72  ? 33.678  45.630  18.034  1.00 46.36  ? 72  VAL A C   1 
ATOM   531   O  O   . VAL A  1 72  ? 34.659  46.372  18.096  1.00 46.94  ? 72  VAL A O   1 
ATOM   532   C  CB  . VAL A  1 72  ? 34.018  44.337  15.893  1.00 39.01  ? 72  VAL A CB  1 
ATOM   533   C  CG1 . VAL A  1 72  ? 34.518  43.191  16.770  1.00 33.79  ? 72  VAL A CG1 1 
ATOM   534   C  CG2 . VAL A  1 72  ? 33.322  43.805  14.650  1.00 39.91  ? 72  VAL A CG2 1 
ATOM   535   N  N   . LYS A  1 73  ? 33.105  45.111  19.119  1.00 44.28  ? 73  LYS A N   1 
ATOM   536   C  CA  . LYS A  1 73  ? 33.517  45.550  20.458  1.00 44.69  ? 73  LYS A CA  1 
ATOM   537   C  C   . LYS A  1 73  ? 34.353  44.540  21.247  1.00 46.86  ? 73  LYS A C   1 
ATOM   538   O  O   . LYS A  1 73  ? 35.200  44.929  22.056  1.00 41.25  ? 73  LYS A O   1 
ATOM   539   C  CB  . LYS A  1 73  ? 32.297  45.918  21.310  1.00 47.67  ? 73  LYS A CB  1 
ATOM   540   C  CG  . LYS A  1 73  ? 31.294  46.824  20.653  1.00 60.35  ? 73  LYS A CG  1 
ATOM   541   C  CD  . LYS A  1 73  ? 30.144  47.110  21.611  1.00 75.19  ? 73  LYS A CD  1 
ATOM   542   C  CE  . LYS A  1 73  ? 29.458  48.438  21.291  1.00 86.25  ? 73  LYS A CE  1 
ATOM   543   N  NZ  . LYS A  1 73  ? 28.451  48.823  22.327  1.00 88.25  ? 73  LYS A NZ  1 
ATOM   544   N  N   . ASP A  1 74  ? 34.101  43.247  21.044  1.00 39.80  ? 74  ASP A N   1 
ATOM   545   C  CA  . ASP A  1 74  ? 34.647  42.261  21.967  1.00 39.07  ? 74  ASP A CA  1 
ATOM   546   C  C   . ASP A  1 74  ? 35.810  41.475  21.399  1.00 37.11  ? 74  ASP A C   1 
ATOM   547   O  O   . ASP A  1 74  ? 36.371  40.633  22.080  1.00 40.31  ? 74  ASP A O   1 
ATOM   548   C  CB  . ASP A  1 74  ? 33.556  41.297  22.426  1.00 42.81  ? 74  ASP A CB  1 
ATOM   549   C  CG  . ASP A  1 74  ? 32.396  42.006  23.078  1.00 42.14  ? 74  ASP A CG  1 
ATOM   550   O  OD1 . ASP A  1 74  ? 32.600  43.133  23.567  1.00 41.16  ? 74  ASP A OD1 1 
ATOM   551   O  OD2 . ASP A  1 74  ? 31.278  41.442  23.101  1.00 36.17  ? 74  ASP A OD2 1 
ATOM   552   N  N   . PHE A  1 75  ? 36.174  41.751  20.155  1.00 40.37  ? 75  PHE A N   1 
ATOM   553   C  CA  . PHE A  1 75  ? 37.249  41.006  19.518  1.00 37.79  ? 75  PHE A CA  1 
ATOM   554   C  C   . PHE A  1 75  ? 38.195  41.944  18.804  1.00 41.05  ? 75  PHE A C   1 
ATOM   555   O  O   . PHE A  1 75  ? 37.775  42.947  18.231  1.00 40.86  ? 75  PHE A O   1 
ATOM   556   C  CB  . PHE A  1 75  ? 36.671  39.992  18.527  1.00 37.73  ? 75  PHE A CB  1 
ATOM   557   C  CG  . PHE A  1 75  ? 35.795  38.973  19.174  1.00 40.82  ? 75  PHE A CG  1 
ATOM   558   C  CD1 . PHE A  1 75  ? 36.347  37.825  19.728  1.00 41.19  ? 75  PHE A CD1 1 
ATOM   559   C  CD2 . PHE A  1 75  ? 34.425  39.178  19.272  1.00 33.04  ? 75  PHE A CD2 1 
ATOM   560   C  CE1 . PHE A  1 75  ? 35.548  36.878  20.353  1.00 38.42  ? 75  PHE A CE1 1 
ATOM   561   C  CE2 . PHE A  1 75  ? 33.616  38.244  19.903  1.00 34.37  ? 75  PHE A CE2 1 
ATOM   562   C  CZ  . PHE A  1 75  ? 34.177  37.089  20.443  1.00 40.57  ? 75  PHE A CZ  1 
ATOM   563   N  N   . LYS A  1 76  ? 39.475  41.603  18.820  1.00 43.78  ? 76  LYS A N   1 
ATOM   564   C  CA  . LYS A  1 76  ? 40.484  42.421  18.165  1.00 41.55  ? 76  LYS A CA  1 
ATOM   565   C  C   . LYS A  1 76  ? 41.500  41.511  17.481  1.00 43.18  ? 76  LYS A C   1 
ATOM   566   O  O   . LYS A  1 76  ? 41.606  40.337  17.821  1.00 38.69  ? 76  LYS A O   1 
ATOM   567   C  CB  . LYS A  1 76  ? 41.173  43.324  19.198  1.00 37.28  ? 76  LYS A CB  1 
ATOM   568   C  CG  . LYS A  1 76  ? 41.749  42.553  20.387  1.00 43.23  ? 76  LYS A CG  1 
ATOM   569   C  CD  . LYS A  1 76  ? 42.745  43.407  21.185  1.00 48.19  ? 76  LYS A CD  1 
ATOM   570   C  CE  . LYS A  1 76  ? 43.611  42.538  22.105  1.00 47.96  ? 76  LYS A CE  1 
ATOM   571   N  NZ  . LYS A  1 76  ? 42.793  41.559  22.883  1.00 50.42  ? 76  LYS A NZ  1 
ATOM   572   N  N   . PRO A  1 77  ? 42.242  42.044  16.504  1.00 47.78  ? 77  PRO A N   1 
ATOM   573   C  CA  . PRO A  1 77  ? 43.277  41.240  15.856  1.00 46.55  ? 77  PRO A CA  1 
ATOM   574   C  C   . PRO A  1 77  ? 44.195  40.614  16.894  1.00 47.83  ? 77  PRO A C   1 
ATOM   575   O  O   . PRO A  1 77  ? 44.538  41.262  17.889  1.00 44.16  ? 77  PRO A O   1 
ATOM   576   C  CB  . PRO A  1 77  ? 44.041  42.274  15.028  1.00 46.83  ? 77  PRO A CB  1 
ATOM   577   C  CG  . PRO A  1 77  ? 42.986  43.296  14.670  1.00 44.40  ? 77  PRO A CG  1 
ATOM   578   C  CD  . PRO A  1 77  ? 42.125  43.387  15.904  1.00 50.18  ? 77  PRO A CD  1 
ATOM   579   N  N   . GLY A  1 78  ? 44.572  39.359  16.671  1.00 43.98  ? 78  GLY A N   1 
ATOM   580   C  CA  . GLY A  1 78  ? 45.405  38.641  17.614  1.00 36.76  ? 78  GLY A CA  1 
ATOM   581   C  C   . GLY A  1 78  ? 44.591  37.717  18.492  1.00 41.97  ? 78  GLY A C   1 
ATOM   582   O  O   . GLY A  1 78  ? 45.113  36.742  19.029  1.00 46.27  ? 78  GLY A O   1 
ATOM   583   N  N   . ASP A  1 79  ? 43.307  38.014  18.649  1.00 36.71  ? 79  ASP A N   1 
ATOM   584   C  CA  . ASP A  1 79  ? 42.456  37.150  19.458  1.00 40.41  ? 79  ASP A CA  1 
ATOM   585   C  C   . ASP A  1 79  ? 42.273  35.777  18.836  1.00 39.76  ? 79  ASP A C   1 
ATOM   586   O  O   . ASP A  1 79  ? 41.927  35.675  17.654  1.00 41.30  ? 79  ASP A O   1 
ATOM   587   C  CB  . ASP A  1 79  ? 41.088  37.781  19.686  1.00 44.75  ? 79  ASP A CB  1 
ATOM   588   C  CG  . ASP A  1 79  ? 41.138  38.906  20.686  1.00 47.40  ? 79  ASP A CG  1 
ATOM   589   O  OD1 . ASP A  1 79  ? 42.217  39.106  21.288  1.00 47.42  ? 79  ASP A OD1 1 
ATOM   590   O  OD2 . ASP A  1 79  ? 40.102  39.586  20.859  1.00 45.35  ? 79  ASP A OD2 1 
ATOM   591   N  N   . ARG A  1 80  ? 42.498  34.732  19.642  1.00 30.75  ? 80  ARG A N   1 
ATOM   592   C  CA  . ARG A  1 80  ? 42.209  33.356  19.238  1.00 37.83  ? 80  ARG A CA  1 
ATOM   593   C  C   . ARG A  1 80  ? 40.751  33.007  19.530  1.00 38.54  ? 80  ARG A C   1 
ATOM   594   O  O   . ARG A  1 80  ? 40.250  33.229  20.641  1.00 43.19  ? 80  ARG A O   1 
ATOM   595   C  CB  . ARG A  1 80  ? 43.117  32.359  19.971  1.00 43.88  ? 80  ARG A CB  1 
ATOM   596   C  CG  . ARG A  1 80  ? 44.589  32.463  19.618  1.00 49.77  ? 80  ARG A CG  1 
ATOM   597   C  CD  . ARG A  1 80  ? 45.386  31.314  20.236  1.00 52.17  ? 80  ARG A CD  1 
ATOM   598   N  NE  . ARG A  1 80  ? 46.574  31.034  19.436  1.00 59.33  ? 80  ARG A NE  1 
ATOM   599   C  CZ  . ARG A  1 80  ? 47.221  29.874  19.430  1.00 56.25  ? 80  ARG A CZ  1 
ATOM   600   N  NH1 . ARG A  1 80  ? 46.795  28.871  20.191  1.00 50.56  ? 80  ARG A NH1 1 
ATOM   601   N  NH2 . ARG A  1 80  ? 48.292  29.719  18.658  1.00 56.65  ? 80  ARG A NH2 1 
ATOM   602   N  N   . VAL A  1 81  ? 40.076  32.425  18.548  1.00 33.47  ? 81  VAL A N   1 
ATOM   603   C  CA  . VAL A  1 81  ? 38.641  32.219  18.667  1.00 32.50  ? 81  VAL A CA  1 
ATOM   604   C  C   . VAL A  1 81  ? 38.188  30.848  18.169  1.00 35.14  ? 81  VAL A C   1 
ATOM   605   O  O   . VAL A  1 81  ? 38.787  30.264  17.256  1.00 33.23  ? 81  VAL A O   1 
ATOM   606   C  CB  . VAL A  1 81  ? 37.863  33.309  17.902  1.00 29.63  ? 81  VAL A CB  1 
ATOM   607   C  CG1 . VAL A  1 81  ? 38.109  34.680  18.519  1.00 29.38  ? 81  VAL A CG1 1 
ATOM   608   C  CG2 . VAL A  1 81  ? 38.263  33.306  16.434  1.00 33.48  ? 81  VAL A CG2 1 
ATOM   609   N  N   . VAL A  1 82  ? 37.134  30.342  18.805  1.00 33.87  ? 82  VAL A N   1 
ATOM   610   C  CA  . VAL A  1 82  ? 36.367  29.212  18.295  1.00 28.24  ? 82  VAL A CA  1 
ATOM   611   C  C   . VAL A  1 82  ? 35.263  29.801  17.426  1.00 32.89  ? 82  VAL A C   1 
ATOM   612   O  O   . VAL A  1 82  ? 34.502  30.668  17.885  1.00 31.21  ? 82  VAL A O   1 
ATOM   613   C  CB  . VAL A  1 82  ? 35.711  28.397  19.426  1.00 32.32  ? 82  VAL A CB  1 
ATOM   614   C  CG1 . VAL A  1 82  ? 34.842  27.271  18.842  1.00 27.00  ? 82  VAL A CG1 1 
ATOM   615   C  CG2 . VAL A  1 82  ? 36.760  27.825  20.386  1.00 25.90  ? 82  VAL A CG2 1 
ATOM   616   N  N   . VAL A  1 83  ? 35.213  29.367  16.169  1.00 31.01  ? 83  VAL A N   1 
ATOM   617   C  CA  . VAL A  1 83  ? 34.217  29.842  15.210  1.00 28.41  ? 83  VAL A CA  1 
ATOM   618   C  C   . VAL A  1 83  ? 33.142  28.771  15.070  1.00 25.95  ? 83  VAL A C   1 
ATOM   619   O  O   . VAL A  1 83  ? 33.453  27.646  14.701  1.00 26.94  ? 83  VAL A O   1 
ATOM   620   C  CB  . VAL A  1 83  ? 34.858  30.081  13.834  1.00 28.69  ? 83  VAL A CB  1 
ATOM   621   C  CG1 . VAL A  1 83  ? 33.833  30.631  12.824  1.00 28.92  ? 83  VAL A CG1 1 
ATOM   622   C  CG2 . VAL A  1 83  ? 36.031  31.027  13.948  1.00 24.72  ? 83  VAL A CG2 1 
ATOM   623   N  N   . PRO A  1 84  ? 31.875  29.107  15.384  1.00 32.66  ? 84  PRO A N   1 
ATOM   624   C  CA  . PRO A  1 84  ? 30.811  28.100  15.239  1.00 24.96  ? 84  PRO A CA  1 
ATOM   625   C  C   . PRO A  1 84  ? 30.609  27.776  13.773  1.00 29.13  ? 84  PRO A C   1 
ATOM   626   O  O   . PRO A  1 84  ? 30.834  28.665  12.951  1.00 32.44  ? 84  PRO A O   1 
ATOM   627   C  CB  . PRO A  1 84  ? 29.550  28.802  15.758  1.00 29.13  ? 84  PRO A CB  1 
ATOM   628   C  CG  . PRO A  1 84  ? 29.906  30.247  15.976  1.00 28.61  ? 84  PRO A CG  1 
ATOM   629   C  CD  . PRO A  1 84  ? 31.353  30.466  15.605  1.00 32.62  ? 84  PRO A CD  1 
ATOM   630   N  N   . ALA A  1 85  ? 30.177  26.551  13.458  1.00 30.96  ? 85  ALA A N   1 
ATOM   631   C  CA  . ALA A  1 85  ? 29.808  26.193  12.084  1.00 33.30  ? 85  ALA A CA  1 
ATOM   632   C  C   . ALA A  1 85  ? 28.621  27.020  11.613  1.00 32.36  ? 85  ALA A C   1 
ATOM   633   O  O   . ALA A  1 85  ? 28.531  27.393  10.446  1.00 30.30  ? 85  ALA A O   1 
ATOM   634   C  CB  . ALA A  1 85  ? 29.464  24.698  11.977  1.00 22.48  ? 85  ALA A CB  1 
ATOM   635   N  N   . ILE A  1 86  ? 27.696  27.266  12.531  1.00 28.78  ? 86  ILE A N   1 
ATOM   636   C  CA  . ILE A  1 86  ? 26.504  28.035  12.237  1.00 28.68  ? 86  ILE A CA  1 
ATOM   637   C  C   . ILE A  1 86  ? 26.693  29.480  12.718  1.00 33.19  ? 86  ILE A C   1 
ATOM   638   O  O   . ILE A  1 86  ? 26.851  29.737  13.911  1.00 29.45  ? 86  ILE A O   1 
ATOM   639   C  CB  . ILE A  1 86  ? 25.262  27.373  12.871  1.00 32.11  ? 86  ILE A CB  1 
ATOM   640   C  CG1 . ILE A  1 86  ? 24.694  26.316  11.920  1.00 32.33  ? 86  ILE A CG1 1 
ATOM   641   C  CG2 . ILE A  1 86  ? 24.185  28.393  13.194  1.00 33.53  ? 86  ILE A CG2 1 
ATOM   642   C  CD1 . ILE A  1 86  ? 25.657  25.217  11.574  1.00 29.59  ? 86  ILE A CD1 1 
ATOM   643   N  N   . THR A  1 87  ? 26.711  30.412  11.772  1.00 39.29  ? 87  THR A N   1 
ATOM   644   C  CA  . THR A  1 87  ? 26.893  31.832  12.078  1.00 38.24  ? 87  THR A CA  1 
ATOM   645   C  C   . THR A  1 87  ? 25.727  32.628  11.501  1.00 37.23  ? 87  THR A C   1 
ATOM   646   O  O   . THR A  1 87  ? 25.808  33.139  10.390  1.00 39.95  ? 87  THR A O   1 
ATOM   647   C  CB  . THR A  1 87  ? 28.213  32.375  11.493  1.00 35.39  ? 87  THR A CB  1 
ATOM   648   O  OG1 . THR A  1 87  ? 28.242  32.140  10.077  1.00 34.23  ? 87  THR A OG1 1 
ATOM   649   C  CG2 . THR A  1 87  ? 29.421  31.691  12.148  1.00 21.88  ? 87  THR A CG2 1 
ATOM   650   N  N   . PRO A  1 88  ? 24.635  32.737  12.268  1.00 32.40  ? 88  PRO A N   1 
ATOM   651   C  CA  . PRO A  1 88  ? 23.380  33.304  11.781  1.00 34.89  ? 88  PRO A CA  1 
ATOM   652   C  C   . PRO A  1 88  ? 23.454  34.817  11.669  1.00 42.93  ? 88  PRO A C   1 
ATOM   653   O  O   . PRO A  1 88  ? 24.231  35.467  12.373  1.00 43.71  ? 88  PRO A O   1 
ATOM   654   C  CB  . PRO A  1 88  ? 22.375  32.967  12.897  1.00 29.10  ? 88  PRO A CB  1 
ATOM   655   C  CG  . PRO A  1 88  ? 23.122  32.243  13.939  1.00 31.23  ? 88  PRO A CG  1 
ATOM   656   C  CD  . PRO A  1 88  ? 24.582  32.455  13.707  1.00 32.27  ? 88  PRO A CD  1 
ATOM   657   N  N   . ASP A  1 89  ? 22.634  35.365  10.784  1.00 41.86  ? 89  ASP A N   1 
ATOM   658   C  CA  . ASP A  1 89  ? 22.282  36.770  10.857  1.00 44.13  ? 89  ASP A CA  1 
ATOM   659   C  C   . ASP A  1 89  ? 21.303  36.895  12.024  1.00 38.49  ? 89  ASP A C   1 
ATOM   660   O  O   . ASP A  1 89  ? 20.248  36.285  12.027  1.00 33.16  ? 89  ASP A O   1 
ATOM   661   C  CB  . ASP A  1 89  ? 21.632  37.215  9.541   1.00 44.45  ? 89  ASP A CB  1 
ATOM   662   C  CG  . ASP A  1 89  ? 22.585  37.096  8.355   1.00 47.18  ? 89  ASP A CG  1 
ATOM   663   O  OD1 . ASP A  1 89  ? 23.685  37.682  8.429   1.00 48.69  ? 89  ASP A OD1 1 
ATOM   664   O  OD2 . ASP A  1 89  ? 22.245  36.424  7.352   1.00 50.07  ? 89  ASP A OD2 1 
ATOM   665   N  N   . TRP A  1 90  ? 21.642  37.690  13.020  1.00 35.42  ? 90  TRP A N   1 
ATOM   666   C  CA  . TRP A  1 90  ? 20.851  37.678  14.241  1.00 36.14  ? 90  TRP A CA  1 
ATOM   667   C  C   . TRP A  1 90  ? 19.563  38.493  14.238  1.00 36.93  ? 90  TRP A C   1 
ATOM   668   O  O   . TRP A  1 90  ? 18.705  38.267  15.077  1.00 41.81  ? 90  TRP A O   1 
ATOM   669   C  CB  . TRP A  1 90  ? 21.737  38.013  15.453  1.00 27.78  ? 90  TRP A CB  1 
ATOM   670   C  CG  . TRP A  1 90  ? 22.545  36.809  15.821  1.00 35.42  ? 90  TRP A CG  1 
ATOM   671   C  CD1 . TRP A  1 90  ? 23.789  36.483  15.360  1.00 32.99  ? 90  TRP A CD1 1 
ATOM   672   C  CD2 . TRP A  1 90  ? 22.135  35.733  16.670  1.00 35.38  ? 90  TRP A CD2 1 
ATOM   673   N  NE1 . TRP A  1 90  ? 24.192  35.288  15.900  1.00 32.82  ? 90  TRP A NE1 1 
ATOM   674   C  CE2 . TRP A  1 90  ? 23.197  34.807  16.711  1.00 34.83  ? 90  TRP A CE2 1 
ATOM   675   C  CE3 . TRP A  1 90  ? 20.979  35.473  17.419  1.00 36.49  ? 90  TRP A CE3 1 
ATOM   676   C  CZ2 . TRP A  1 90  ? 23.136  33.627  17.466  1.00 34.48  ? 90  TRP A CZ2 1 
ATOM   677   C  CZ3 . TRP A  1 90  ? 20.920  34.297  18.178  1.00 33.37  ? 90  TRP A CZ3 1 
ATOM   678   C  CH2 . TRP A  1 90  ? 21.994  33.393  18.192  1.00 30.61  ? 90  TRP A CH2 1 
ATOM   679   N  N   . ARG A  1 91  ? 19.408  39.422  13.300  1.00 38.87  ? 91  ARG A N   1 
ATOM   680   C  CA  . ARG A  1 91  ? 18.217  40.265  13.310  1.00 35.33  ? 91  ARG A CA  1 
ATOM   681   C  C   . ARG A  1 91  ? 17.199  39.806  12.274  1.00 36.55  ? 91  ARG A C   1 
ATOM   682   O  O   . ARG A  1 91  ? 17.050  40.413  11.228  1.00 33.31  ? 91  ARG A O   1 
ATOM   683   C  CB  . ARG A  1 91  ? 18.585  41.745  13.134  1.00 34.73  ? 91  ARG A CB  1 
ATOM   684   C  CG  . ARG A  1 91  ? 19.523  42.283  14.237  1.00 40.43  ? 91  ARG A CG  1 
ATOM   685   C  CD  . ARG A  1 91  ? 19.783  43.783  14.058  1.00 48.90  ? 91  ARG A CD  1 
ATOM   686   N  NE  . ARG A  1 91  ? 20.132  44.069  12.674  1.00 53.14  ? 91  ARG A NE  1 
ATOM   687   C  CZ  . ARG A  1 91  ? 19.362  44.730  11.820  1.00 43.53  ? 91  ARG A CZ  1 
ATOM   688   N  NH1 . ARG A  1 91  ? 18.197  45.236  12.203  1.00 42.25  ? 91  ARG A NH1 1 
ATOM   689   N  NH2 . ARG A  1 91  ? 19.775  44.902  10.575  1.00 54.47  ? 91  ARG A NH2 1 
ATOM   690   N  N   . THR A  1 92  ? 16.515  38.708  12.574  1.00 36.05  ? 92  THR A N   1 
ATOM   691   C  CA  . THR A  1 92  ? 15.526  38.138  11.667  1.00 40.25  ? 92  THR A CA  1 
ATOM   692   C  C   . THR A  1 92  ? 14.342  37.627  12.468  1.00 43.33  ? 92  THR A C   1 
ATOM   693   O  O   . THR A  1 92  ? 14.434  37.463  13.689  1.00 40.03  ? 92  THR A O   1 
ATOM   694   C  CB  . THR A  1 92  ? 16.125  36.968  10.884  1.00 39.48  ? 92  THR A CB  1 
ATOM   695   O  OG1 . THR A  1 92  ? 16.520  35.937  11.805  1.00 36.78  ? 92  THR A OG1 1 
ATOM   696   C  CG2 . THR A  1 92  ? 17.366  37.450  10.111  1.00 41.30  ? 92  THR A CG2 1 
ATOM   697   N  N   . SER A  1 93  ? 13.228  37.372  11.788  1.00 39.88  ? 93  SER A N   1 
ATOM   698   C  CA  . SER A  1 93  ? 12.038  36.881  12.472  1.00 34.42  ? 93  SER A CA  1 
ATOM   699   C  C   . SER A  1 93  ? 12.319  35.503  13.079  1.00 31.96  ? 93  SER A C   1 
ATOM   700   O  O   . SER A  1 93  ? 11.860  35.187  14.187  1.00 38.36  ? 93  SER A O   1 
ATOM   701   C  CB  . SER A  1 93  ? 10.834  36.828  11.512  1.00 34.84  ? 93  SER A CB  1 
ATOM   702   O  OG  . SER A  1 93  ? 11.045  35.845  10.503  1.00 39.63  ? 93  SER A OG  1 
ATOM   703   N  N   . GLU A  1 94  ? 13.089  34.682  12.376  1.00 29.60  ? 94  GLU A N   1 
ATOM   704   C  CA  . GLU A  1 94  ? 13.367  33.341  12.901  1.00 32.24  ? 94  GLU A CA  1 
ATOM   705   C  C   . GLU A  1 94  ? 14.078  33.404  14.244  1.00 29.32  ? 94  GLU A C   1 
ATOM   706   O  O   . GLU A  1 94  ? 13.864  32.552  15.115  1.00 31.31  ? 94  GLU A O   1 
ATOM   707   C  CB  . GLU A  1 94  ? 14.164  32.490  11.914  1.00 33.90  ? 94  GLU A CB  1 
ATOM   708   C  CG  . GLU A  1 94  ? 13.390  32.138  10.662  1.00 26.45  ? 94  GLU A CG  1 
ATOM   709   C  CD  . GLU A  1 94  ? 13.580  33.168  9.559   1.00 35.62  ? 94  GLU A CD  1 
ATOM   710   O  OE1 . GLU A  1 94  ? 14.308  34.169  9.775   1.00 33.46  ? 94  GLU A OE1 1 
ATOM   711   O  OE2 . GLU A  1 94  ? 13.009  32.969  8.475   1.00 43.08  ? 94  GLU A OE2 1 
ATOM   712   N  N   . VAL A  1 95  ? 14.930  34.410  14.419  1.00 38.27  ? 95  VAL A N   1 
ATOM   713   C  CA  . VAL A  1 95  ? 15.577  34.610  15.719  1.00 26.69  ? 95  VAL A CA  1 
ATOM   714   C  C   . VAL A  1 95  ? 14.519  34.991  16.752  1.00 29.08  ? 95  VAL A C   1 
ATOM   715   O  O   . VAL A  1 95  ? 14.531  34.497  17.872  1.00 33.60  ? 95  VAL A O   1 
ATOM   716   C  CB  . VAL A  1 95  ? 16.726  35.637  15.651  1.00 33.62  ? 95  VAL A CB  1 
ATOM   717   C  CG1 . VAL A  1 95  ? 17.060  36.205  17.047  1.00 27.51  ? 95  VAL A CG1 1 
ATOM   718   C  CG2 . VAL A  1 95  ? 17.947  34.978  15.035  1.00 31.69  ? 95  VAL A CG2 1 
ATOM   719   N  N   . GLN A  1 96  ? 13.561  35.829  16.358  1.00 32.65  ? 96  GLN A N   1 
ATOM   720   C  CA  . GLN A  1 96  ? 12.504  36.191  17.292  1.00 32.88  ? 96  GLN A CA  1 
ATOM   721   C  C   . GLN A  1 96  ? 11.680  34.961  17.644  1.00 33.37  ? 96  GLN A C   1 
ATOM   722   O  O   . GLN A  1 96  ? 11.168  34.860  18.750  1.00 32.50  ? 96  GLN A O   1 
ATOM   723   C  CB  . GLN A  1 96  ? 11.631  37.342  16.750  1.00 39.44  ? 96  GLN A CB  1 
ATOM   724   C  CG  . GLN A  1 96  ? 12.426  38.641  16.547  1.00 39.56  ? 96  GLN A CG  1 
ATOM   725   C  CD  . GLN A  1 96  ? 11.577  39.903  16.516  1.00 38.78  ? 96  GLN A CD  1 
ATOM   726   O  OE1 . GLN A  1 96  ? 10.442  39.938  16.993  1.00 43.02  ? 96  GLN A OE1 1 
ATOM   727   N  NE2 . GLN A  1 96  ? 12.142  40.955  15.962  1.00 33.34  ? 96  GLN A NE2 1 
ATOM   728   N  N   . ARG A  1 97  ? 11.566  34.024  16.702  1.00 31.55  ? 97  ARG A N   1 
ATOM   729   C  CA  . ARG A  1 97  ? 10.814  32.800  16.943  1.00 35.05  ? 97  ARG A CA  1 
ATOM   730   C  C   . ARG A  1 97  ? 11.611  31.758  17.749  1.00 34.45  ? 97  ARG A C   1 
ATOM   731   O  O   . ARG A  1 97  ? 11.057  30.762  18.183  1.00 32.73  ? 97  ARG A O   1 
ATOM   732   C  CB  . ARG A  1 97  ? 10.324  32.201  15.625  1.00 30.67  ? 97  ARG A CB  1 
ATOM   733   C  CG  . ARG A  1 97  ? 9.133   32.911  15.039  1.00 36.60  ? 97  ARG A CG  1 
ATOM   734   C  CD  . ARG A  1 97  ? 8.416   32.050  14.044  1.00 47.91  ? 97  ARG A CD  1 
ATOM   735   N  NE  . ARG A  1 97  ? 9.293   31.608  12.970  1.00 51.34  ? 97  ARG A NE  1 
ATOM   736   C  CZ  . ARG A  1 97  ? 9.555   30.335  12.691  1.00 40.73  ? 97  ARG A CZ  1 
ATOM   737   N  NH1 . ARG A  1 97  ? 9.001   29.360  13.405  1.00 40.74  ? 97  ARG A NH1 1 
ATOM   738   N  NH2 . ARG A  1 97  ? 10.369  30.040  11.683  1.00 26.45  ? 97  ARG A NH2 1 
ATOM   739   N  N   . GLY A  1 98  ? 12.907  31.993  17.946  1.00 37.29  ? 98  GLY A N   1 
ATOM   740   C  CA  . GLY A  1 98  ? 13.749  31.069  18.700  1.00 33.88  ? 98  GLY A CA  1 
ATOM   741   C  C   . GLY A  1 98  ? 14.504  30.015  17.889  1.00 31.65  ? 98  GLY A C   1 
ATOM   742   O  O   . GLY A  1 98  ? 14.932  28.995  18.427  1.00 29.28  ? 98  GLY A O   1 
ATOM   743   N  N   . TYR A  1 99  ? 14.684  30.265  16.599  1.00 30.55  ? 99  TYR A N   1 
ATOM   744   C  CA  . TYR A  1 99  ? 15.284  29.290  15.696  1.00 29.12  ? 99  TYR A CA  1 
ATOM   745   C  C   . TYR A  1 99  ? 16.366  29.933  14.825  1.00 34.26  ? 99  TYR A C   1 
ATOM   746   O  O   . TYR A  1 99  ? 16.253  29.993  13.599  1.00 36.78  ? 99  TYR A O   1 
ATOM   747   C  CB  . TYR A  1 99  ? 14.181  28.604  14.845  1.00 28.75  ? 99  TYR A CB  1 
ATOM   748   C  CG  . TYR A  1 99  ? 13.391  27.599  15.660  1.00 28.74  ? 99  TYR A CG  1 
ATOM   749   C  CD1 . TYR A  1 99  ? 13.913  26.332  15.922  1.00 31.84  ? 99  TYR A CD1 1 
ATOM   750   C  CD2 . TYR A  1 99  ? 12.159  27.931  16.216  1.00 30.72  ? 99  TYR A CD2 1 
ATOM   751   C  CE1 . TYR A  1 99  ? 13.221  25.409  16.703  1.00 31.75  ? 99  TYR A CE1 1 
ATOM   752   C  CE2 . TYR A  1 99  ? 11.448  27.017  16.992  1.00 28.36  ? 99  TYR A CE2 1 
ATOM   753   C  CZ  . TYR A  1 99  ? 11.998  25.758  17.236  1.00 37.37  ? 99  TYR A CZ  1 
ATOM   754   O  OH  . TYR A  1 99  ? 11.325  24.837  17.997  1.00 36.05  ? 99  TYR A OH  1 
ATOM   755   N  N   . HIS A  1 100 ? 17.422  30.411  15.471  1.00 25.59  ? 100 HIS A N   1 
ATOM   756   C  CA  . HIS A  1 100 ? 18.509  31.072  14.750  1.00 33.49  ? 100 HIS A CA  1 
ATOM   757   C  C   . HIS A  1 100 ? 19.103  30.216  13.623  1.00 37.94  ? 100 HIS A C   1 
ATOM   758   O  O   . HIS A  1 100 ? 19.579  30.767  12.629  1.00 37.73  ? 100 HIS A O   1 
ATOM   759   C  CB  . HIS A  1 100 ? 19.603  31.571  15.717  1.00 33.89  ? 100 HIS A CB  1 
ATOM   760   C  CG  . HIS A  1 100 ? 20.476  30.486  16.275  1.00 35.23  ? 100 HIS A CG  1 
ATOM   761   N  ND1 . HIS A  1 100 ? 20.355  30.022  17.568  1.00 33.61  ? 100 HIS A ND1 1 
ATOM   762   C  CD2 . HIS A  1 100 ? 21.488  29.778  15.717  1.00 38.53  ? 100 HIS A CD2 1 
ATOM   763   C  CE1 . HIS A  1 100 ? 21.249  29.072  17.780  1.00 35.32  ? 100 HIS A CE1 1 
ATOM   764   N  NE2 . HIS A  1 100 ? 21.946  28.902  16.671  1.00 36.25  ? 100 HIS A NE2 1 
ATOM   765   N  N   . GLN A  1 101 ? 19.066  28.882  13.763  1.00 27.86  ? 101 GLN A N   1 
ATOM   766   C  CA  . GLN A  1 101 ? 19.598  28.004  12.711  1.00 28.21  ? 101 GLN A CA  1 
ATOM   767   C  C   . GLN A  1 101 ? 18.967  28.257  11.349  1.00 32.36  ? 101 GLN A C   1 
ATOM   768   O  O   . GLN A  1 101 ? 19.538  27.915  10.313  1.00 35.47  ? 101 GLN A O   1 
ATOM   769   C  CB  . GLN A  1 101 ? 19.410  26.519  13.061  1.00 32.79  ? 101 GLN A CB  1 
ATOM   770   C  CG  . GLN A  1 101 ? 20.159  26.044  14.295  1.00 32.94  ? 101 GLN A CG  1 
ATOM   771   C  CD  . GLN A  1 101 ? 19.298  26.068  15.540  1.00 32.64  ? 101 GLN A CD  1 
ATOM   772   O  OE1 . GLN A  1 101 ? 18.549  27.020  15.781  1.00 38.53  ? 101 GLN A OE1 1 
ATOM   773   N  NE2 . GLN A  1 101 ? 19.413  25.029  16.349  1.00 23.88  ? 101 GLN A NE2 1 
ATOM   774   N  N   . HIS A  1 102 ? 17.775  28.842  11.350  1.00 32.66  ? 102 HIS A N   1 
ATOM   775   C  CA  . HIS A  1 102 ? 17.061  29.078  10.105  1.00 32.46  ? 102 HIS A CA  1 
ATOM   776   C  C   . HIS A  1 102 ? 16.833  30.564  9.872   1.00 32.13  ? 102 HIS A C   1 
ATOM   777   O  O   . HIS A  1 102 ? 15.875  30.974  9.236   1.00 29.09  ? 102 HIS A O   1 
ATOM   778   C  CB  . HIS A  1 102 ? 15.760  28.272  10.105  1.00 29.27  ? 102 HIS A CB  1 
ATOM   779   C  CG  . HIS A  1 102 ? 15.968  26.861  10.564  1.00 29.86  ? 102 HIS A CG  1 
ATOM   780   N  ND1 . HIS A  1 102 ? 16.626  25.923  9.796   1.00 26.60  ? 102 HIS A ND1 1 
ATOM   781   C  CD2 . HIS A  1 102 ? 15.698  26.256  11.748  1.00 31.82  ? 102 HIS A CD2 1 
ATOM   782   C  CE1 . HIS A  1 102 ? 16.703  24.786  10.466  1.00 28.07  ? 102 HIS A CE1 1 
ATOM   783   N  NE2 . HIS A  1 102 ? 16.144  24.962  11.653  1.00 28.76  ? 102 HIS A NE2 1 
ATOM   784   N  N   . SER A  1 103 ? 17.746  31.370  10.388  1.00 34.77  ? 103 SER A N   1 
ATOM   785   C  CA  . SER A  1 103 ? 17.631  32.808  10.222  1.00 37.22  ? 103 SER A CA  1 
ATOM   786   C  C   . SER A  1 103 ? 17.789  33.146  8.753   1.00 37.57  ? 103 SER A C   1 
ATOM   787   O  O   . SER A  1 103 ? 18.819  32.831  8.139   1.00 33.89  ? 103 SER A O   1 
ATOM   788   C  CB  . SER A  1 103 ? 18.697  33.533  11.041  1.00 39.72  ? 103 SER A CB  1 
ATOM   789   O  OG  . SER A  1 103 ? 18.553  34.931  10.861  1.00 55.43  ? 103 SER A OG  1 
ATOM   790   N  N   . GLY A  1 104 ? 16.764  33.784  8.192   1.00 38.63  ? 104 GLY A N   1 
ATOM   791   C  CA  . GLY A  1 104 ? 16.752  34.104  6.780   1.00 38.33  ? 104 GLY A CA  1 
ATOM   792   C  C   . GLY A  1 104 ? 16.357  32.921  5.918   1.00 42.32  ? 104 GLY A C   1 
ATOM   793   O  O   . GLY A  1 104 ? 16.493  32.983  4.707   1.00 38.51  ? 104 GLY A O   1 
ATOM   794   N  N   . GLY A  1 105 ? 15.895  31.835  6.539   1.00 43.00  ? 105 GLY A N   1 
ATOM   795   C  CA  . GLY A  1 105 ? 15.450  30.663  5.801   1.00 37.87  ? 105 GLY A CA  1 
ATOM   796   C  C   . GLY A  1 105 ? 15.934  29.318  6.336   1.00 37.28  ? 105 GLY A C   1 
ATOM   797   O  O   . GLY A  1 105 ? 16.799  29.250  7.199   1.00 35.09  ? 105 GLY A O   1 
ATOM   798   N  N   . MET A  1 106 ? 15.375  28.238  5.801   1.00 37.68  ? 106 MET A N   1 
ATOM   799   C  CA  . MET A  1 106 ? 15.706  26.881  6.239   1.00 36.59  ? 106 MET A CA  1 
ATOM   800   C  C   . MET A  1 106 ? 17.205  26.618  6.103   1.00 37.24  ? 106 MET A C   1 
ATOM   801   O  O   . MET A  1 106 ? 17.761  26.721  5.002   1.00 33.35  ? 106 MET A O   1 
ATOM   802   C  CB  . MET A  1 106 ? 14.910  25.852  5.419   1.00 35.70  ? 106 MET A CB  1 
ATOM   803   C  CG  . MET A  1 106 ? 14.748  24.520  6.126   1.00 41.51  ? 106 MET A CG  1 
ATOM   804   S  SD  . MET A  1 106 ? 13.834  23.293  5.171   1.00 42.77  ? 106 MET A SD  1 
ATOM   805   C  CE  . MET A  1 106 ? 14.905  23.146  3.741   1.00 61.07  ? 106 MET A CE  1 
ATOM   806   N  N   . LEU A  1 107 ? 17.853  26.292  7.222   1.00 32.78  ? 107 LEU A N   1 
ATOM   807   C  CA  . LEU A  1 107 ? 19.283  25.968  7.236   1.00 31.45  ? 107 LEU A CA  1 
ATOM   808   C  C   . LEU A  1 107 ? 20.184  27.185  7.013   1.00 34.19  ? 107 LEU A C   1 
ATOM   809   O  O   . LEU A  1 107 ? 21.409  27.059  7.007   1.00 37.50  ? 107 LEU A O   1 
ATOM   810   C  CB  . LEU A  1 107 ? 19.624  24.882  6.207   1.00 28.20  ? 107 LEU A CB  1 
ATOM   811   C  CG  . LEU A  1 107 ? 18.798  23.586  6.275   1.00 38.55  ? 107 LEU A CG  1 
ATOM   812   C  CD1 . LEU A  1 107 ? 19.420  22.480  5.413   1.00 33.10  ? 107 LEU A CD1 1 
ATOM   813   C  CD2 . LEU A  1 107 ? 18.657  23.114  7.716   1.00 35.51  ? 107 LEU A CD2 1 
ATOM   814   N  N   . ALA A  1 108 ? 19.583  28.357  6.844   1.00 35.96  ? 108 ALA A N   1 
ATOM   815   C  CA  . ALA A  1 108 ? 20.343  29.553  6.465   1.00 32.29  ? 108 ALA A CA  1 
ATOM   816   C  C   . ALA A  1 108 ? 21.297  30.063  7.549   1.00 33.45  ? 108 ALA A C   1 
ATOM   817   O  O   . ALA A  1 108 ? 22.198  30.848  7.269   1.00 32.05  ? 108 ALA A O   1 
ATOM   818   C  CB  . ALA A  1 108 ? 19.408  30.663  6.000   1.00 34.89  ? 108 ALA A CB  1 
ATOM   819   N  N   . GLY A  1 109 ? 21.111  29.625  8.788   1.00 36.32  ? 109 GLY A N   1 
ATOM   820   C  CA  . GLY A  1 109 ? 22.065  29.965  9.828   1.00 31.82  ? 109 GLY A CA  1 
ATOM   821   C  C   . GLY A  1 109 ? 23.408  29.304  9.535   1.00 29.91  ? 109 GLY A C   1 
ATOM   822   O  O   . GLY A  1 109 ? 24.449  29.753  9.997   1.00 34.87  ? 109 GLY A O   1 
ATOM   823   N  N   . TRP A  1 110 ? 23.378  28.225  8.762   1.00 33.56  ? 110 TRP A N   1 
ATOM   824   C  CA  . TRP A  1 110 ? 24.596  27.539  8.347   1.00 37.43  ? 110 TRP A CA  1 
ATOM   825   C  C   . TRP A  1 110 ? 25.110  28.175  7.056   1.00 33.32  ? 110 TRP A C   1 
ATOM   826   O  O   . TRP A  1 110 ? 24.549  27.979  5.983   1.00 38.34  ? 110 TRP A O   1 
ATOM   827   C  CB  . TRP A  1 110 ? 24.330  26.026  8.190   1.00 33.49  ? 110 TRP A CB  1 
ATOM   828   C  CG  . TRP A  1 110 ? 25.347  25.266  7.371   1.00 33.79  ? 110 TRP A CG  1 
ATOM   829   C  CD1 . TRP A  1 110 ? 26.679  25.555  7.232   1.00 39.91  ? 110 TRP A CD1 1 
ATOM   830   C  CD2 . TRP A  1 110 ? 25.115  24.074  6.606   1.00 40.05  ? 110 TRP A CD2 1 
ATOM   831   N  NE1 . TRP A  1 110 ? 27.282  24.628  6.412   1.00 36.97  ? 110 TRP A NE1 1 
ATOM   832   C  CE2 . TRP A  1 110 ? 26.344  23.711  6.015   1.00 40.45  ? 110 TRP A CE2 1 
ATOM   833   C  CE3 . TRP A  1 110 ? 23.978  23.295  6.336   1.00 42.70  ? 110 TRP A CE3 1 
ATOM   834   C  CZ2 . TRP A  1 110 ? 26.467  22.602  5.174   1.00 43.17  ? 110 TRP A CZ2 1 
ATOM   835   C  CZ3 . TRP A  1 110 ? 24.102  22.191  5.504   1.00 36.93  ? 110 TRP A CZ3 1 
ATOM   836   C  CH2 . TRP A  1 110 ? 25.338  21.857  4.932   1.00 42.69  ? 110 TRP A CH2 1 
ATOM   837   N  N   . LYS A  1 111 ? 26.178  28.946  7.156   1.00 32.46  ? 111 LYS A N   1 
ATOM   838   C  CA  . LYS A  1 111 ? 26.663  29.688  5.996   1.00 30.57  ? 111 LYS A CA  1 
ATOM   839   C  C   . LYS A  1 111 ? 27.913  29.100  5.349   1.00 32.30  ? 111 LYS A C   1 
ATOM   840   O  O   . LYS A  1 111 ? 27.928  28.853  4.142   1.00 33.99  ? 111 LYS A O   1 
ATOM   841   C  CB  . LYS A  1 111 ? 26.921  31.148  6.365   1.00 30.49  ? 111 LYS A CB  1 
ATOM   842   C  CG  . LYS A  1 111 ? 25.700  31.948  6.762   1.00 31.57  ? 111 LYS A CG  1 
ATOM   843   C  CD  . LYS A  1 111 ? 26.071  33.430  6.895   1.00 34.66  ? 111 LYS A CD  1 
ATOM   844   C  CE  . LYS A  1 111 ? 24.859  34.318  7.164   1.00 41.94  ? 111 LYS A CE  1 
ATOM   845   N  NZ  . LYS A  1 111 ? 24.093  34.634  5.906   1.00 49.53  ? 111 LYS A NZ  1 
ATOM   846   N  N   . PHE A  1 112 ? 28.964  28.889  6.150   1.00 31.08  ? 112 PHE A N   1 
ATOM   847   C  CA  . PHE A  1 112 ? 30.213  28.338  5.628   1.00 35.49  ? 112 PHE A CA  1 
ATOM   848   C  C   . PHE A  1 112 ? 29.955  27.028  4.868   1.00 36.84  ? 112 PHE A C   1 
ATOM   849   O  O   . PHE A  1 112 ? 29.392  26.099  5.428   1.00 35.52  ? 112 PHE A O   1 
ATOM   850   C  CB  . PHE A  1 112 ? 31.203  28.033  6.756   1.00 34.01  ? 112 PHE A CB  1 
ATOM   851   C  CG  . PHE A  1 112 ? 31.736  29.244  7.481   1.00 35.42  ? 112 PHE A CG  1 
ATOM   852   C  CD1 . PHE A  1 112 ? 32.312  30.298  6.794   1.00 33.40  ? 112 PHE A CD1 1 
ATOM   853   C  CD2 . PHE A  1 112 ? 31.713  29.292  8.870   1.00 34.88  ? 112 PHE A CD2 1 
ATOM   854   C  CE1 . PHE A  1 112 ? 32.833  31.402  7.483   1.00 35.19  ? 112 PHE A CE1 1 
ATOM   855   C  CE2 . PHE A  1 112 ? 32.239  30.396  9.562   1.00 39.52  ? 112 PHE A CE2 1 
ATOM   856   C  CZ  . PHE A  1 112 ? 32.803  31.440  8.868   1.00 30.61  ? 112 PHE A CZ  1 
ATOM   857   N  N   . SER A  1 113 ? 30.408  26.965  3.615   1.00 30.38  ? 113 SER A N   1 
ATOM   858   C  CA  . SER A  1 113 ? 30.283  25.786  2.757   1.00 35.06  ? 113 SER A CA  1 
ATOM   859   C  C   . SER A  1 113 ? 28.829  25.395  2.457   1.00 38.95  ? 113 SER A C   1 
ATOM   860   O  O   . SER A  1 113 ? 28.576  24.325  1.918   1.00 38.99  ? 113 SER A O   1 
ATOM   861   C  CB  . SER A  1 113 ? 31.117  24.588  3.275   1.00 34.92  ? 113 SER A CB  1 
ATOM   862   O  OG  . SER A  1 113 ? 30.401  23.759  4.178   1.00 35.57  ? 113 SER A OG  1 
ATOM   863   N  N   . ASN A  1 114 ? 27.880  26.260  2.811   1.00 43.22  ? 114 ASN A N   1 
ATOM   864   C  CA  . ASN A  1 114 ? 26.492  26.107  2.341   1.00 39.34  ? 114 ASN A CA  1 
ATOM   865   C  C   . ASN A  1 114 ? 26.126  27.217  1.357   1.00 46.01  ? 114 ASN A C   1 
ATOM   866   O  O   . ASN A  1 114 ? 25.858  26.937  0.189   1.00 52.61  ? 114 ASN A O   1 
ATOM   867   C  CB  . ASN A  1 114 ? 25.492  26.071  3.495   1.00 37.09  ? 114 ASN A CB  1 
ATOM   868   C  CG  . ASN A  1 114 ? 24.046  26.025  3.016   1.00 38.64  ? 114 ASN A CG  1 
ATOM   869   O  OD1 . ASN A  1 114 ? 23.768  25.681  1.869   1.00 45.87  ? 114 ASN A OD1 1 
ATOM   870   N  ND2 . ASN A  1 114 ? 23.122  26.373  3.899   1.00 36.64  ? 114 ASN A ND2 1 
ATOM   871   N  N   . VAL A  1 115 ? 26.137  28.471  1.818   1.00 32.96  ? 115 VAL A N   1 
ATOM   872   C  CA  . VAL A  1 115 ? 25.865  29.609  0.936   1.00 40.49  ? 115 VAL A CA  1 
ATOM   873   C  C   . VAL A  1 115 ? 26.899  30.722  1.144   1.00 47.51  ? 115 VAL A C   1 
ATOM   874   O  O   . VAL A  1 115 ? 26.620  31.902  0.919   1.00 48.21  ? 115 VAL A O   1 
ATOM   875   C  CB  . VAL A  1 115 ? 24.439  30.171  1.142   1.00 38.66  ? 115 VAL A CB  1 
ATOM   876   C  CG1 . VAL A  1 115 ? 23.380  29.090  0.833   1.00 34.75  ? 115 VAL A CG1 1 
ATOM   877   C  CG2 . VAL A  1 115 ? 24.277  30.702  2.561   1.00 40.69  ? 115 VAL A CG2 1 
ATOM   878   N  N   . LYS A  1 116 ? 28.094  30.323  1.572   1.00 43.98  ? 116 LYS A N   1 
ATOM   879   C  CA  . LYS A  1 116 ? 29.198  31.241  1.824   1.00 40.01  ? 116 LYS A CA  1 
ATOM   880   C  C   . LYS A  1 116 ? 30.514  30.462  1.781   1.00 43.36  ? 116 LYS A C   1 
ATOM   881   O  O   . LYS A  1 116 ? 30.581  29.296  2.206   1.00 42.32  ? 116 LYS A O   1 
ATOM   882   C  CB  . LYS A  1 116 ? 29.011  31.898  3.195   1.00 39.11  ? 116 LYS A CB  1 
ATOM   883   C  CG  . LYS A  1 116 ? 30.048  32.944  3.592   1.00 34.79  ? 116 LYS A CG  1 
ATOM   884   C  CD  . LYS A  1 116 ? 29.740  33.462  4.999   1.00 34.36  ? 116 LYS A CD  1 
ATOM   885   C  CE  . LYS A  1 116 ? 30.698  34.563  5.447   1.00 34.04  ? 116 LYS A CE  1 
ATOM   886   N  NZ  . LYS A  1 116 ? 30.205  35.173  6.704   1.00 32.72  ? 116 LYS A NZ  1 
ATOM   887   N  N   . ASP A  1 117 ? 31.555  31.089  1.248   1.00 43.33  ? 117 ASP A N   1 
ATOM   888   C  CA  . ASP A  1 117 ? 32.881  30.483  1.289   1.00 42.18  ? 117 ASP A CA  1 
ATOM   889   C  C   . ASP A  1 117 ? 33.215  30.030  2.708   1.00 39.00  ? 117 ASP A C   1 
ATOM   890   O  O   . ASP A  1 117 ? 33.070  30.794  3.667   1.00 37.59  ? 117 ASP A O   1 
ATOM   891   C  CB  . ASP A  1 117 ? 33.937  31.473  0.801   1.00 41.05  ? 117 ASP A CB  1 
ATOM   892   C  CG  . ASP A  1 117 ? 33.978  31.570  -0.707  1.00 42.78  ? 117 ASP A CG  1 
ATOM   893   O  OD1 . ASP A  1 117 ? 33.698  30.549  -1.364  1.00 42.16  ? 117 ASP A OD1 1 
ATOM   894   O  OD2 . ASP A  1 117 ? 34.299  32.654  -1.235  1.00 45.26  ? 117 ASP A OD2 1 
ATOM   895   N  N   . GLY A  1 118 ? 33.662  28.785  2.836   1.00 36.12  ? 118 GLY A N   1 
ATOM   896   C  CA  . GLY A  1 118 ? 33.971  28.225  4.134   1.00 30.42  ? 118 GLY A CA  1 
ATOM   897   C  C   . GLY A  1 118 ? 35.369  28.552  4.638   1.00 37.00  ? 118 GLY A C   1 
ATOM   898   O  O   . GLY A  1 118 ? 36.024  29.480  4.153   1.00 34.08  ? 118 GLY A O   1 
ATOM   899   N  N   . VAL A  1 119 ? 35.837  27.758  5.605   1.00 33.01  ? 119 VAL A N   1 
ATOM   900   C  CA  . VAL A  1 119 ? 37.050  28.081  6.334   1.00 33.54  ? 119 VAL A CA  1 
ATOM   901   C  C   . VAL A  1 119 ? 38.320  27.511  5.714   1.00 37.09  ? 119 VAL A C   1 
ATOM   902   O  O   . VAL A  1 119 ? 39.410  27.764  6.217   1.00 32.63  ? 119 VAL A O   1 
ATOM   903   C  CB  . VAL A  1 119 ? 36.957  27.607  7.801   1.00 38.44  ? 119 VAL A CB  1 
ATOM   904   C  CG1 . VAL A  1 119 ? 35.824  28.315  8.503   1.00 33.79  ? 119 VAL A CG1 1 
ATOM   905   C  CG2 . VAL A  1 119 ? 36.768  26.092  7.866   1.00 41.71  ? 119 VAL A CG2 1 
ATOM   906   N  N   . PHE A  1 120 ? 38.189  26.735  4.639   1.00 37.27  ? 120 PHE A N   1 
ATOM   907   C  CA  . PHE A  1 120 ? 39.363  26.146  3.989   1.00 29.00  ? 120 PHE A CA  1 
ATOM   908   C  C   . PHE A  1 120 ? 40.094  27.111  3.042   1.00 34.65  ? 120 PHE A C   1 
ATOM   909   O  O   . PHE A  1 120 ? 40.396  26.757  1.900   1.00 37.09  ? 120 PHE A O   1 
ATOM   910   C  CB  . PHE A  1 120 ? 38.980  24.889  3.214   1.00 33.58  ? 120 PHE A CB  1 
ATOM   911   C  CG  . PHE A  1 120 ? 38.567  23.733  4.078   1.00 33.63  ? 120 PHE A CG  1 
ATOM   912   C  CD1 . PHE A  1 120 ? 38.852  23.717  5.431   1.00 34.46  ? 120 PHE A CD1 1 
ATOM   913   C  CD2 . PHE A  1 120 ? 37.927  22.640  3.520   1.00 35.00  ? 120 PHE A CD2 1 
ATOM   914   C  CE1 . PHE A  1 120 ? 38.486  22.621  6.219   1.00 36.40  ? 120 PHE A CE1 1 
ATOM   915   C  CE2 . PHE A  1 120 ? 37.556  21.552  4.294   1.00 32.28  ? 120 PHE A CE2 1 
ATOM   916   C  CZ  . PHE A  1 120 ? 37.838  21.540  5.646   1.00 40.97  ? 120 PHE A CZ  1 
ATOM   917   N  N   . GLY A  1 121 ? 40.389  28.320  3.519   1.00 32.68  ? 121 GLY A N   1 
ATOM   918   C  CA  . GLY A  1 121 ? 41.124  29.304  2.734   1.00 38.87  ? 121 GLY A CA  1 
ATOM   919   C  C   . GLY A  1 121 ? 42.141  29.981  3.641   1.00 39.93  ? 121 GLY A C   1 
ATOM   920   O  O   . GLY A  1 121 ? 42.122  29.743  4.841   1.00 41.68  ? 121 GLY A O   1 
ATOM   921   N  N   . GLU A  1 122 ? 43.022  30.819  3.105   1.00 39.95  ? 122 GLU A N   1 
ATOM   922   C  CA  . GLU A  1 122 ? 44.003  31.485  3.977   1.00 43.27  ? 122 GLU A CA  1 
ATOM   923   C  C   . GLU A  1 122 ? 43.310  32.446  4.942   1.00 38.70  ? 122 GLU A C   1 
ATOM   924   O  O   . GLU A  1 122 ? 43.807  32.733  6.020   1.00 44.05  ? 122 GLU A O   1 
ATOM   925   C  CB  . GLU A  1 122 ? 45.079  32.208  3.171   1.00 46.25  ? 122 GLU A CB  1 
ATOM   926   C  CG  . GLU A  1 122 ? 45.775  31.327  2.150   1.00 55.45  ? 122 GLU A CG  1 
ATOM   927   C  CD  . GLU A  1 122 ? 46.804  32.083  1.333   1.00 59.49  ? 122 GLU A CD  1 
ATOM   928   O  OE1 . GLU A  1 122 ? 46.771  32.003  0.083   1.00 57.40  ? 122 GLU A OE1 1 
ATOM   929   O  OE2 . GLU A  1 122 ? 47.643  32.768  1.948   1.00 65.06  ? 122 GLU A OE2 1 
ATOM   930   N  N   . PHE A  1 123 ? 42.140  32.925  4.546   1.00 42.61  ? 123 PHE A N   1 
ATOM   931   C  CA  . PHE A  1 123 ? 41.342  33.773  5.409   1.00 36.94  ? 123 PHE A CA  1 
ATOM   932   C  C   . PHE A  1 123 ? 39.903  33.409  5.201   1.00 37.35  ? 123 PHE A C   1 
ATOM   933   O  O   . PHE A  1 123 ? 39.550  32.797  4.200   1.00 34.00  ? 123 PHE A O   1 
ATOM   934   C  CB  . PHE A  1 123 ? 41.547  35.247  5.057   1.00 32.88  ? 123 PHE A CB  1 
ATOM   935   C  CG  . PHE A  1 123 ? 42.969  35.703  5.196   1.00 39.23  ? 123 PHE A CG  1 
ATOM   936   C  CD1 . PHE A  1 123 ? 43.505  35.958  6.445   1.00 37.30  ? 123 PHE A CD1 1 
ATOM   937   C  CD2 . PHE A  1 123 ? 43.771  35.861  4.084   1.00 42.06  ? 123 PHE A CD2 1 
ATOM   938   C  CE1 . PHE A  1 123 ? 44.813  36.369  6.589   1.00 40.93  ? 123 PHE A CE1 1 
ATOM   939   C  CE2 . PHE A  1 123 ? 45.084  36.282  4.219   1.00 39.35  ? 123 PHE A CE2 1 
ATOM   940   C  CZ  . PHE A  1 123 ? 45.607  36.527  5.474   1.00 40.93  ? 123 PHE A CZ  1 
ATOM   941   N  N   . PHE A  1 124 ? 39.062  33.782  6.151   1.00 42.44  ? 124 PHE A N   1 
ATOM   942   C  CA  . PHE A  1 124 ? 37.637  33.680  5.930   1.00 42.19  ? 124 PHE A CA  1 
ATOM   943   C  C   . PHE A  1 124 ? 36.896  34.783  6.677   1.00 42.07  ? 124 PHE A C   1 
ATOM   944   O  O   . PHE A  1 124 ? 37.483  35.495  7.504   1.00 41.87  ? 124 PHE A O   1 
ATOM   945   C  CB  . PHE A  1 124 ? 37.113  32.272  6.256   1.00 37.52  ? 124 PHE A CB  1 
ATOM   946   C  CG  . PHE A  1 124 ? 37.330  31.838  7.682   1.00 38.86  ? 124 PHE A CG  1 
ATOM   947   C  CD1 . PHE A  1 124 ? 36.418  32.187  8.672   1.00 36.07  ? 124 PHE A CD1 1 
ATOM   948   C  CD2 . PHE A  1 124 ? 38.426  31.057  8.028   1.00 38.63  ? 124 PHE A CD2 1 
ATOM   949   C  CE1 . PHE A  1 124 ? 36.601  31.785  9.980   1.00 28.08  ? 124 PHE A CE1 1 
ATOM   950   C  CE2 . PHE A  1 124 ? 38.619  30.638  9.338   1.00 33.49  ? 124 PHE A CE2 1 
ATOM   951   C  CZ  . PHE A  1 124 ? 37.708  30.998  10.315  1.00 34.82  ? 124 PHE A CZ  1 
ATOM   952   N  N   . HIS A  1 125 ? 35.612  34.915  6.370   1.00 34.26  ? 125 HIS A N   1 
ATOM   953   C  CA  . HIS A  1 125 ? 34.810  36.039  6.818   1.00 35.89  ? 125 HIS A CA  1 
ATOM   954   C  C   . HIS A  1 125 ? 33.791  35.554  7.830   1.00 32.11  ? 125 HIS A C   1 
ATOM   955   O  O   . HIS A  1 125 ? 33.097  34.573  7.590   1.00 40.14  ? 125 HIS A O   1 
ATOM   956   C  CB  . HIS A  1 125 ? 34.113  36.652  5.590   1.00 35.24  ? 125 HIS A CB  1 
ATOM   957   C  CG  . HIS A  1 125 ? 33.103  37.712  5.909   1.00 41.94  ? 125 HIS A CG  1 
ATOM   958   N  ND1 . HIS A  1 125 ? 31.904  37.438  6.536   1.00 44.26  ? 125 HIS A ND1 1 
ATOM   959   C  CD2 . HIS A  1 125 ? 33.089  39.040  5.632   1.00 38.07  ? 125 HIS A CD2 1 
ATOM   960   C  CE1 . HIS A  1 125 ? 31.211  38.557  6.660   1.00 47.58  ? 125 HIS A CE1 1 
ATOM   961   N  NE2 . HIS A  1 125 ? 31.909  39.543  6.123   1.00 46.01  ? 125 HIS A NE2 1 
ATOM   962   N  N   . VAL A  1 126 ? 33.706  36.230  8.969   1.00 33.47  ? 126 VAL A N   1 
ATOM   963   C  CA  . VAL A  1 126 ? 32.686  35.917  9.961   1.00 33.95  ? 126 VAL A CA  1 
ATOM   964   C  C   . VAL A  1 126 ? 31.724  37.082  10.157  1.00 38.51  ? 126 VAL A C   1 
ATOM   965   O  O   . VAL A  1 126 ? 32.124  38.142  10.643  1.00 36.88  ? 126 VAL A O   1 
ATOM   966   C  CB  . VAL A  1 126 ? 33.304  35.563  11.325  1.00 38.23  ? 126 VAL A CB  1 
ATOM   967   C  CG1 . VAL A  1 126 ? 32.204  35.210  12.318  1.00 32.82  ? 126 VAL A CG1 1 
ATOM   968   C  CG2 . VAL A  1 126 ? 34.290  34.414  11.181  1.00 41.24  ? 126 VAL A CG2 1 
ATOM   969   N  N   . ASN A  1 127 ? 30.461  36.888  9.779   1.00 36.37  ? 127 ASN A N   1 
ATOM   970   C  CA  . ASN A  1 127 ? 29.448  37.917  9.976   1.00 37.14  ? 127 ASN A CA  1 
ATOM   971   C  C   . ASN A  1 127 ? 29.149  38.099  11.456  1.00 39.46  ? 127 ASN A C   1 
ATOM   972   O  O   . ASN A  1 127 ? 29.036  37.116  12.206  1.00 40.37  ? 127 ASN A O   1 
ATOM   973   C  CB  . ASN A  1 127 ? 28.155  37.618  9.181   1.00 30.72  ? 127 ASN A CB  1 
ATOM   974   C  CG  . ASN A  1 127 ? 27.581  36.214  9.475   1.00 35.74  ? 127 ASN A CG  1 
ATOM   975   O  OD1 . ASN A  1 127 ? 28.151  35.198  9.078   1.00 34.42  ? 127 ASN A OD1 1 
ATOM   976   N  ND2 . ASN A  1 127 ? 26.442  36.169  10.158  1.00 34.30  ? 127 ASN A ND2 1 
ATOM   977   N  N   . ASP A  1 128 ? 29.054  39.361  11.872  1.00 36.61  ? 128 ASP A N   1 
ATOM   978   C  CA  . ASP A  1 128 ? 28.668  39.720  13.232  1.00 38.74  ? 128 ASP A CA  1 
ATOM   979   C  C   . ASP A  1 128 ? 29.563  39.069  14.306  1.00 39.38  ? 128 ASP A C   1 
ATOM   980   O  O   . ASP A  1 128 ? 29.122  38.212  15.080  1.00 41.22  ? 128 ASP A O   1 
ATOM   981   C  CB  . ASP A  1 128 ? 27.195  39.376  13.450  1.00 39.03  ? 128 ASP A CB  1 
ATOM   982   C  CG  . ASP A  1 128 ? 26.610  40.058  14.664  1.00 39.97  ? 128 ASP A CG  1 
ATOM   983   O  OD1 . ASP A  1 128 ? 27.388  40.515  15.519  1.00 33.15  ? 128 ASP A OD1 1 
ATOM   984   O  OD2 . ASP A  1 128 ? 25.371  40.144  14.761  1.00 35.46  ? 128 ASP A OD2 1 
ATOM   985   N  N   . ALA A  1 129 ? 30.818  39.505  14.354  1.00 41.45  ? 129 ALA A N   1 
ATOM   986   C  CA  . ALA A  1 129 ? 31.821  38.946  15.263  1.00 37.92  ? 129 ALA A CA  1 
ATOM   987   C  C   . ALA A  1 129 ? 31.346  38.831  16.707  1.00 41.20  ? 129 ALA A C   1 
ATOM   988   O  O   . ALA A  1 129 ? 31.492  37.782  17.343  1.00 37.21  ? 129 ALA A O   1 
ATOM   989   C  CB  . ALA A  1 129 ? 33.094  39.767  15.201  1.00 37.15  ? 129 ALA A CB  1 
ATOM   990   N  N   . ASP A  1 130 ? 30.769  39.907  17.222  1.00 37.24  ? 130 ASP A N   1 
ATOM   991   C  CA  . ASP A  1 130 ? 30.365  39.952  18.626  1.00 38.08  ? 130 ASP A CA  1 
ATOM   992   C  C   . ASP A  1 130 ? 29.256  38.947  18.978  1.00 38.07  ? 130 ASP A C   1 
ATOM   993   O  O   . ASP A  1 130 ? 29.126  38.532  20.129  1.00 35.51  ? 130 ASP A O   1 
ATOM   994   C  CB  . ASP A  1 130 ? 29.926  41.374  18.995  1.00 36.44  ? 130 ASP A CB  1 
ATOM   995   C  CG  . ASP A  1 130 ? 31.102  42.342  19.098  1.00 42.89  ? 130 ASP A CG  1 
ATOM   996   O  OD1 . ASP A  1 130 ? 32.274  41.889  19.097  1.00 42.07  ? 130 ASP A OD1 1 
ATOM   997   O  OD2 . ASP A  1 130 ? 30.850  43.559  19.197  1.00 42.20  ? 130 ASP A OD2 1 
ATOM   998   N  N   . MET A  1 131 ? 28.444  38.575  17.996  1.00 28.44  ? 131 MET A N   1 
ATOM   999   C  CA  . MET A  1 131 ? 27.387  37.591  18.243  1.00 37.01  ? 131 MET A CA  1 
ATOM   1000  C  C   . MET A  1 131 ? 27.800  36.161  17.890  1.00 35.92  ? 131 MET A C   1 
ATOM   1001  O  O   . MET A  1 131 ? 27.166  35.198  18.328  1.00 32.82  ? 131 MET A O   1 
ATOM   1002  C  CB  . MET A  1 131 ? 26.104  37.971  17.480  1.00 35.78  ? 131 MET A CB  1 
ATOM   1003  C  CG  . MET A  1 131 ? 25.484  39.301  17.960  1.00 37.69  ? 131 MET A CG  1 
ATOM   1004  S  SD  . MET A  1 131 ? 24.651  39.082  19.547  1.00 35.64  ? 131 MET A SD  1 
ATOM   1005  C  CE  . MET A  1 131 ? 23.174  38.216  19.011  1.00 33.65  ? 131 MET A CE  1 
ATOM   1006  N  N   . ASN A  1 132 ? 28.847  36.026  17.084  1.00 31.83  ? 132 ASN A N   1 
ATOM   1007  C  CA  . ASN A  1 132 ? 29.158  34.734  16.486  1.00 37.59  ? 132 ASN A CA  1 
ATOM   1008  C  C   . ASN A  1 132 ? 30.557  34.170  16.757  1.00 41.26  ? 132 ASN A C   1 
ATOM   1009  O  O   . ASN A  1 132 ? 30.888  33.105  16.250  1.00 44.72  ? 132 ASN A O   1 
ATOM   1010  C  CB  . ASN A  1 132 ? 28.883  34.761  14.979  1.00 31.54  ? 132 ASN A CB  1 
ATOM   1011  C  CG  . ASN A  1 132 ? 27.402  34.763  14.663  1.00 37.37  ? 132 ASN A CG  1 
ATOM   1012  O  OD1 . ASN A  1 132 ? 26.620  34.108  15.346  1.00 43.66  ? 132 ASN A OD1 1 
ATOM   1013  N  ND2 . ASN A  1 132 ? 27.006  35.509  13.631  1.00 25.14  ? 132 ASN A ND2 1 
ATOM   1014  N  N   . LEU A  1 133 ? 31.366  34.879  17.541  1.00 31.93  ? 133 LEU A N   1 
ATOM   1015  C  CA  . LEU A  1 133 ? 32.687  34.384  17.923  1.00 31.70  ? 133 LEU A CA  1 
ATOM   1016  C  C   . LEU A  1 133 ? 32.748  34.115  19.420  1.00 34.17  ? 133 LEU A C   1 
ATOM   1017  O  O   . LEU A  1 133 ? 32.040  34.740  20.207  1.00 32.38  ? 133 LEU A O   1 
ATOM   1018  C  CB  . LEU A  1 133 ? 33.789  35.374  17.528  1.00 34.21  ? 133 LEU A CB  1 
ATOM   1019  C  CG  . LEU A  1 133 ? 34.132  35.549  16.040  1.00 37.62  ? 133 LEU A CG  1 
ATOM   1020  C  CD1 . LEU A  1 133 ? 35.255  36.565  15.850  1.00 32.51  ? 133 LEU A CD1 1 
ATOM   1021  C  CD2 . LEU A  1 133 ? 34.514  34.223  15.411  1.00 40.60  ? 133 LEU A CD2 1 
ATOM   1022  N  N   . ALA A  1 134 ? 33.588  33.169  19.815  1.00 35.61  ? 134 ALA A N   1 
ATOM   1023  C  CA  . ALA A  1 134 ? 33.875  32.984  21.229  1.00 34.66  ? 134 ALA A CA  1 
ATOM   1024  C  C   . ALA A  1 134 ? 35.387  32.953  21.439  1.00 33.86  ? 134 ALA A C   1 
ATOM   1025  O  O   . ALA A  1 134 ? 36.126  32.439  20.599  1.00 37.42  ? 134 ALA A O   1 
ATOM   1026  C  CB  . ALA A  1 134 ? 33.208  31.707  21.750  1.00 32.47  ? 134 ALA A CB  1 
ATOM   1027  N  N   . HIS A  1 135 ? 35.852  33.510  22.554  1.00 34.72  ? 135 HIS A N   1 
ATOM   1028  C  CA  . HIS A  1 135 ? 37.284  33.490  22.861  1.00 38.41  ? 135 HIS A CA  1 
ATOM   1029  C  C   . HIS A  1 135 ? 37.733  32.074  23.242  1.00 37.82  ? 135 HIS A C   1 
ATOM   1030  O  O   . HIS A  1 135 ? 37.062  31.395  24.007  1.00 34.90  ? 135 HIS A O   1 
ATOM   1031  C  CB  . HIS A  1 135 ? 37.614  34.480  23.983  1.00 34.64  ? 135 HIS A CB  1 
ATOM   1032  C  CG  . HIS A  1 135 ? 37.446  35.911  23.582  1.00 36.40  ? 135 HIS A CG  1 
ATOM   1033  N  ND1 . HIS A  1 135 ? 38.379  36.583  22.823  1.00 36.22  ? 135 HIS A ND1 1 
ATOM   1034  C  CD2 . HIS A  1 135 ? 36.435  36.785  23.800  1.00 37.32  ? 135 HIS A CD2 1 
ATOM   1035  C  CE1 . HIS A  1 135 ? 37.952  37.813  22.595  1.00 42.55  ? 135 HIS A CE1 1 
ATOM   1036  N  NE2 . HIS A  1 135 ? 36.774  37.960  23.176  1.00 41.63  ? 135 HIS A NE2 1 
ATOM   1037  N  N   . LEU A  1 136 ? 38.868  31.642  22.702  1.00 34.62  ? 136 LEU A N   1 
ATOM   1038  C  CA  . LEU A  1 136 ? 39.432  30.339  23.036  1.00 38.24  ? 136 LEU A CA  1 
ATOM   1039  C  C   . LEU A  1 136 ? 40.334  30.390  24.275  1.00 33.95  ? 136 LEU A C   1 
ATOM   1040  O  O   . LEU A  1 136 ? 41.417  30.967  24.235  1.00 38.08  ? 136 LEU A O   1 
ATOM   1041  C  CB  . LEU A  1 136 ? 40.238  29.806  21.853  1.00 38.73  ? 136 LEU A CB  1 
ATOM   1042  C  CG  . LEU A  1 136 ? 40.956  28.473  22.078  1.00 36.87  ? 136 LEU A CG  1 
ATOM   1043  C  CD1 . LEU A  1 136 ? 39.938  27.361  22.319  1.00 30.46  ? 136 LEU A CD1 1 
ATOM   1044  C  CD2 . LEU A  1 136 ? 41.819  28.137  20.874  1.00 40.67  ? 136 LEU A CD2 1 
ATOM   1045  N  N   . PRO A  1 137 ? 39.891  29.787  25.382  1.00 36.61  ? 137 PRO A N   1 
ATOM   1046  C  CA  . PRO A  1 137 ? 40.788  29.722  26.541  1.00 40.73  ? 137 PRO A CA  1 
ATOM   1047  C  C   . PRO A  1 137 ? 42.078  28.993  26.171  1.00 40.93  ? 137 PRO A C   1 
ATOM   1048  O  O   . PRO A  1 137 ? 42.063  27.972  25.471  1.00 33.68  ? 137 PRO A O   1 
ATOM   1049  C  CB  . PRO A  1 137 ? 39.987  28.908  27.563  1.00 39.68  ? 137 PRO A CB  1 
ATOM   1050  C  CG  . PRO A  1 137 ? 38.554  29.134  27.174  1.00 41.45  ? 137 PRO A CG  1 
ATOM   1051  C  CD  . PRO A  1 137 ? 38.556  29.239  25.675  1.00 38.45  ? 137 PRO A CD  1 
ATOM   1052  N  N   . LYS A  1 138 ? 43.194  29.527  26.644  1.00 35.27  ? 138 LYS A N   1 
ATOM   1053  C  CA  . LYS A  1 138 ? 44.507  28.952  26.364  1.00 37.67  ? 138 LYS A CA  1 
ATOM   1054  C  C   . LYS A  1 138 ? 44.659  27.507  26.889  1.00 34.81  ? 138 LYS A C   1 
ATOM   1055  O  O   . LYS A  1 138 ? 45.512  26.759  26.422  1.00 35.42  ? 138 LYS A O   1 
ATOM   1056  C  CB  . LYS A  1 138 ? 45.594  29.852  26.965  1.00 40.26  ? 138 LYS A CB  1 
ATOM   1057  C  CG  . LYS A  1 138 ? 45.575  29.882  28.488  1.00 39.89  ? 138 LYS A CG  1 
ATOM   1058  C  CD  . LYS A  1 138 ? 46.660  30.794  29.044  1.00 53.15  ? 138 LYS A CD  1 
ATOM   1059  C  CE  . LYS A  1 138 ? 46.599  30.834  30.556  1.00 57.62  ? 138 LYS A CE  1 
ATOM   1060  N  NZ  . LYS A  1 138 ? 47.765  31.556  31.125  1.00 67.41  ? 138 LYS A NZ  1 
ATOM   1061  N  N   . GLU A  1 139 ? 43.828  27.117  27.851  1.00 33.54  ? 139 GLU A N   1 
ATOM   1062  C  CA  . GLU A  1 139 ? 43.912  25.780  28.436  1.00 37.53  ? 139 GLU A CA  1 
ATOM   1063  C  C   . GLU A  1 139 ? 43.430  24.697  27.468  1.00 43.14  ? 139 GLU A C   1 
ATOM   1064  O  O   . GLU A  1 139 ? 43.697  23.512  27.675  1.00 37.95  ? 139 GLU A O   1 
ATOM   1065  C  CB  . GLU A  1 139 ? 43.080  25.707  29.718  1.00 43.30  ? 139 GLU A CB  1 
ATOM   1066  C  CG  . GLU A  1 139 ? 43.657  26.476  30.899  1.00 48.10  ? 139 GLU A CG  1 
ATOM   1067  C  CD  . GLU A  1 139 ? 43.485  27.979  30.787  1.00 46.87  ? 139 GLU A CD  1 
ATOM   1068  O  OE1 . GLU A  1 139 ? 42.679  28.455  29.956  1.00 43.08  ? 139 GLU A OE1 1 
ATOM   1069  O  OE2 . GLU A  1 139 ? 44.157  28.690  31.550  1.00 50.44  ? 139 GLU A OE2 1 
ATOM   1070  N  N   . ILE A  1 140 ? 42.723  25.096  26.414  1.00 34.88  ? 140 ILE A N   1 
ATOM   1071  C  CA  . ILE A  1 140 ? 42.181  24.115  25.480  1.00 35.12  ? 140 ILE A CA  1 
ATOM   1072  C  C   . ILE A  1 140 ? 43.022  23.991  24.210  1.00 30.60  ? 140 ILE A C   1 
ATOM   1073  O  O   . ILE A  1 140 ? 43.156  24.934  23.450  1.00 33.92  ? 140 ILE A O   1 
ATOM   1074  C  CB  . ILE A  1 140 ? 40.711  24.428  25.133  1.00 36.84  ? 140 ILE A CB  1 
ATOM   1075  C  CG1 . ILE A  1 140 ? 39.871  24.446  26.415  1.00 35.71  ? 140 ILE A CG1 1 
ATOM   1076  C  CG2 . ILE A  1 140 ? 40.183  23.421  24.128  1.00 35.15  ? 140 ILE A CG2 1 
ATOM   1077  C  CD1 . ILE A  1 140 ? 38.450  24.885  26.218  1.00 33.22  ? 140 ILE A CD1 1 
ATOM   1078  N  N   . PRO A  1 141 ? 43.593  22.807  23.979  1.00 36.34  ? 141 PRO A N   1 
ATOM   1079  C  CA  . PRO A  1 141 ? 44.419  22.589  22.791  1.00 35.80  ? 141 PRO A CA  1 
ATOM   1080  C  C   . PRO A  1 141 ? 43.585  22.685  21.515  1.00 34.75  ? 141 PRO A C   1 
ATOM   1081  O  O   . PRO A  1 141 ? 42.373  22.414  21.517  1.00 31.90  ? 141 PRO A O   1 
ATOM   1082  C  CB  . PRO A  1 141 ? 44.917  21.154  22.959  1.00 36.65  ? 141 PRO A CB  1 
ATOM   1083  C  CG  . PRO A  1 141 ? 44.474  20.713  24.298  1.00 39.22  ? 141 PRO A CG  1 
ATOM   1084  C  CD  . PRO A  1 141 ? 43.366  21.573  24.740  1.00 35.93  ? 141 PRO A CD  1 
ATOM   1085  N  N   . LEU A  1 142 ? 44.249  23.051  20.428  1.00 34.24  ? 142 LEU A N   1 
ATOM   1086  C  CA  . LEU A  1 142 ? 43.583  23.316  19.165  1.00 36.05  ? 142 LEU A CA  1 
ATOM   1087  C  C   . LEU A  1 142 ? 42.736  22.133  18.681  1.00 39.51  ? 142 LEU A C   1 
ATOM   1088  O  O   . LEU A  1 142 ? 41.641  22.329  18.142  1.00 35.43  ? 142 LEU A O   1 
ATOM   1089  C  CB  . LEU A  1 142 ? 44.621  23.702  18.112  1.00 36.50  ? 142 LEU A CB  1 
ATOM   1090  C  CG  . LEU A  1 142 ? 45.275  25.065  18.354  1.00 39.30  ? 142 LEU A CG  1 
ATOM   1091  C  CD1 . LEU A  1 142 ? 46.479  25.254  17.446  1.00 35.56  ? 142 LEU A CD1 1 
ATOM   1092  C  CD2 . LEU A  1 142 ? 44.256  26.179  18.146  1.00 36.87  ? 142 LEU A CD2 1 
ATOM   1093  N  N   . GLU A  1 143 ? 43.246  20.916  18.878  1.00 36.48  ? 143 GLU A N   1 
ATOM   1094  C  CA  . GLU A  1 143 ? 42.602  19.718  18.348  1.00 33.96  ? 143 GLU A CA  1 
ATOM   1095  C  C   . GLU A  1 143 ? 41.262  19.499  19.031  1.00 38.74  ? 143 GLU A C   1 
ATOM   1096  O  O   . GLU A  1 143 ? 40.287  19.145  18.384  1.00 39.55  ? 143 GLU A O   1 
ATOM   1097  C  CB  . GLU A  1 143 ? 43.481  18.463  18.507  1.00 36.23  ? 143 GLU A CB  1 
ATOM   1098  C  CG  . GLU A  1 143 ? 44.781  18.469  17.681  1.00 44.59  ? 143 GLU A CG  1 
ATOM   1099  C  CD  . GLU A  1 143 ? 45.942  19.156  18.400  1.00 45.65  ? 143 GLU A CD  1 
ATOM   1100  O  OE1 . GLU A  1 143 ? 45.726  19.675  19.508  1.00 43.18  ? 143 GLU A OE1 1 
ATOM   1101  O  OE2 . GLU A  1 143 ? 47.067  19.178  17.860  1.00 53.75  ? 143 GLU A OE2 1 
ATOM   1102  N  N   . ALA A  1 144 ? 41.212  19.709  20.342  1.00 34.30  ? 144 ALA A N   1 
ATOM   1103  C  CA  . ALA A  1 144 ? 39.957  19.523  21.058  1.00 34.38  ? 144 ALA A CA  1 
ATOM   1104  C  C   . ALA A  1 144 ? 38.952  20.625  20.716  1.00 35.34  ? 144 ALA A C   1 
ATOM   1105  O  O   . ALA A  1 144 ? 37.768  20.352  20.486  1.00 32.74  ? 144 ALA A O   1 
ATOM   1106  C  CB  . ALA A  1 144 ? 40.196  19.442  22.563  1.00 23.52  ? 144 ALA A CB  1 
ATOM   1107  N  N   . ALA A  1 145 ? 39.439  21.863  20.666  1.00 29.84  ? 145 ALA A N   1 
ATOM   1108  C  CA  . ALA A  1 145 ? 38.599  23.032  20.436  1.00 28.83  ? 145 ALA A CA  1 
ATOM   1109  C  C   . ALA A  1 145 ? 37.904  22.992  19.079  1.00 31.86  ? 145 ALA A C   1 
ATOM   1110  O  O   . ALA A  1 145 ? 36.791  23.491  18.924  1.00 32.92  ? 145 ALA A O   1 
ATOM   1111  C  CB  . ALA A  1 145 ? 39.417  24.305  20.569  1.00 28.90  ? 145 ALA A CB  1 
ATOM   1112  N  N   . VAL A  1 146 ? 38.566  22.388  18.104  1.00 31.88  ? 146 VAL A N   1 
ATOM   1113  C  CA  . VAL A  1 146 ? 38.048  22.342  16.755  1.00 29.25  ? 146 VAL A CA  1 
ATOM   1114  C  C   . VAL A  1 146 ? 36.916  21.303  16.628  1.00 33.25  ? 146 VAL A C   1 
ATOM   1115  O  O   . VAL A  1 146 ? 36.227  21.246  15.616  1.00 32.49  ? 146 VAL A O   1 
ATOM   1116  C  CB  . VAL A  1 146 ? 39.180  22.137  15.716  1.00 31.01  ? 146 VAL A CB  1 
ATOM   1117  C  CG1 . VAL A  1 146 ? 39.576  20.705  15.629  1.00 29.36  ? 146 VAL A CG1 1 
ATOM   1118  C  CG2 . VAL A  1 146 ? 38.768  22.683  14.336  1.00 34.82  ? 146 VAL A CG2 1 
ATOM   1119  N  N   . MET A  1 147 ? 36.705  20.527  17.683  1.00 23.34  ? 147 MET A N   1 
ATOM   1120  C  CA  . MET A  1 147 ? 35.591  19.584  17.749  1.00 29.01  ? 147 MET A CA  1 
ATOM   1121  C  C   . MET A  1 147 ? 34.323  20.286  18.223  1.00 31.90  ? 147 MET A C   1 
ATOM   1122  O  O   . MET A  1 147 ? 33.218  19.736  18.172  1.00 32.55  ? 147 MET A O   1 
ATOM   1123  C  CB  . MET A  1 147 ? 35.929  18.429  18.706  1.00 23.23  ? 147 MET A CB  1 
ATOM   1124  C  CG  . MET A  1 147 ? 36.987  17.455  18.148  1.00 25.77  ? 147 MET A CG  1 
ATOM   1125  S  SD  . MET A  1 147 ? 36.575  16.733  16.531  1.00 30.90  ? 147 MET A SD  1 
ATOM   1126  C  CE  . MET A  1 147 ? 37.445  17.826  15.396  1.00 29.34  ? 147 MET A CE  1 
ATOM   1127  N  N   . ILE A  1 148 ? 34.489  21.515  18.685  1.00 28.63  ? 148 ILE A N   1 
ATOM   1128  C  CA  . ILE A  1 148 ? 33.382  22.263  19.254  1.00 27.47  ? 148 ILE A CA  1 
ATOM   1129  C  C   . ILE A  1 148 ? 32.419  22.889  18.214  1.00 29.76  ? 148 ILE A C   1 
ATOM   1130  O  O   . ILE A  1 148 ? 31.209  22.887  18.422  1.00 27.58  ? 148 ILE A O   1 
ATOM   1131  C  CB  . ILE A  1 148 ? 33.909  23.359  20.227  1.00 34.97  ? 148 ILE A CB  1 
ATOM   1132  C  CG1 . ILE A  1 148 ? 34.716  22.723  21.370  1.00 30.47  ? 148 ILE A CG1 1 
ATOM   1133  C  CG2 . ILE A  1 148 ? 32.763  24.206  20.773  1.00 28.24  ? 148 ILE A CG2 1 
ATOM   1134  C  CD1 . ILE A  1 148 ? 35.257  23.752  22.351  1.00 34.45  ? 148 ILE A CD1 1 
ATOM   1135  N  N   . PRO A  1 149 ? 32.949  23.428  17.100  1.00 29.12  ? 149 PRO A N   1 
ATOM   1136  C  CA  . PRO A  1 149 ? 32.085  24.186  16.178  1.00 35.00  ? 149 PRO A CA  1 
ATOM   1137  C  C   . PRO A  1 149 ? 30.941  23.395  15.566  1.00 38.33  ? 149 PRO A C   1 
ATOM   1138  O  O   . PRO A  1 149 ? 29.997  24.002  15.051  1.00 33.69  ? 149 PRO A O   1 
ATOM   1139  C  CB  . PRO A  1 149 ? 33.050  24.598  15.070  1.00 29.39  ? 149 PRO A CB  1 
ATOM   1140  C  CG  . PRO A  1 149 ? 34.361  24.761  15.802  1.00 26.80  ? 149 PRO A CG  1 
ATOM   1141  C  CD  . PRO A  1 149 ? 34.370  23.588  16.759  1.00 27.02  ? 149 PRO A CD  1 
ATOM   1142  N  N   . ASP A  1 150 ? 31.019  22.070  15.609  1.00 33.07  ? 150 ASP A N   1 
ATOM   1143  C  CA  . ASP A  1 150 ? 30.107  21.269  14.787  1.00 30.31  ? 150 ASP A CA  1 
ATOM   1144  C  C   . ASP A  1 150 ? 29.844  19.904  15.407  1.00 29.69  ? 150 ASP A C   1 
ATOM   1145  O  O   . ASP A  1 150 ? 28.710  19.584  15.774  1.00 25.17  ? 150 ASP A O   1 
ATOM   1146  C  CB  . ASP A  1 150 ? 30.690  21.142  13.375  1.00 24.41  ? 150 ASP A CB  1 
ATOM   1147  C  CG  . ASP A  1 150 ? 29.783  20.378  12.416  1.00 32.78  ? 150 ASP A CG  1 
ATOM   1148  O  OD1 . ASP A  1 150 ? 28.791  19.735  12.840  1.00 36.62  ? 150 ASP A OD1 1 
ATOM   1149  O  OD2 . ASP A  1 150 ? 30.088  20.418  11.214  1.00 30.77  ? 150 ASP A OD2 1 
ATOM   1150  N  N   . MET A  1 151 ? 30.901  19.113  15.557  1.00 27.50  ? 151 MET A N   1 
ATOM   1151  C  CA  . MET A  1 151 ? 30.753  17.770  16.126  1.00 27.19  ? 151 MET A CA  1 
ATOM   1152  C  C   . MET A  1 151 ? 30.035  17.795  17.482  1.00 27.85  ? 151 MET A C   1 
ATOM   1153  O  O   . MET A  1 151 ? 29.047  17.091  17.673  1.00 28.61  ? 151 MET A O   1 
ATOM   1154  C  CB  . MET A  1 151 ? 32.113  17.054  16.221  1.00 26.02  ? 151 MET A CB  1 
ATOM   1155  C  CG  . MET A  1 151 ? 32.830  16.888  14.870  1.00 27.74  ? 151 MET A CG  1 
ATOM   1156  S  SD  . MET A  1 151 ? 31.863  15.929  13.665  1.00 28.71  ? 151 MET A SD  1 
ATOM   1157  C  CE  . MET A  1 151 ? 30.955  17.244  12.805  1.00 18.10  ? 151 MET A CE  1 
ATOM   1158  N  N   . MET A  1 152 ? 30.512  18.624  18.409  1.00 28.73  ? 152 MET A N   1 
ATOM   1159  C  CA  . MET A  1 152 ? 29.932  18.675  19.751  1.00 27.46  ? 152 MET A CA  1 
ATOM   1160  C  C   . MET A  1 152 ? 28.538  19.320  19.774  1.00 25.13  ? 152 MET A C   1 
ATOM   1161  O  O   . MET A  1 152 ? 27.623  18.844  20.448  1.00 27.82  ? 152 MET A O   1 
ATOM   1162  C  CB  . MET A  1 152 ? 30.882  19.418  20.714  1.00 31.70  ? 152 MET A CB  1 
ATOM   1163  C  CG  . MET A  1 152 ? 30.535  19.275  22.197  1.00 37.77  ? 152 MET A CG  1 
ATOM   1164  S  SD  . MET A  1 152 ? 31.788  19.957  23.344  1.00 36.15  ? 152 MET A SD  1 
ATOM   1165  C  CE  . MET A  1 152 ? 33.281  19.539  22.426  1.00 22.65  ? 152 MET A CE  1 
ATOM   1166  N  N   . THR A  1 153 ? 28.373  20.419  19.056  1.00 22.53  ? 153 THR A N   1 
ATOM   1167  C  CA  . THR A  1 153 ? 27.099  21.117  19.105  1.00 24.32  ? 153 THR A CA  1 
ATOM   1168  C  C   . THR A  1 153 ? 26.031  20.259  18.421  1.00 22.65  ? 153 THR A C   1 
ATOM   1169  O  O   . THR A  1 153 ? 24.877  20.214  18.851  1.00 27.32  ? 153 THR A O   1 
ATOM   1170  C  CB  . THR A  1 153 ? 27.200  22.566  18.517  1.00 26.75  ? 153 THR A CB  1 
ATOM   1171  O  OG1 . THR A  1 153 ? 25.901  23.160  18.464  1.00 29.66  ? 153 THR A OG1 1 
ATOM   1172  C  CG2 . THR A  1 153 ? 27.817  22.577  17.125  1.00 25.93  ? 153 THR A CG2 1 
ATOM   1173  N  N   . THR A  1 154 ? 26.438  19.538  17.382  1.00 23.73  ? 154 THR A N   1 
ATOM   1174  C  CA  . THR A  1 154 ? 25.512  18.668  16.636  1.00 25.95  ? 154 THR A CA  1 
ATOM   1175  C  C   . THR A  1 154 ? 25.110  17.432  17.474  1.00 31.20  ? 154 THR A C   1 
ATOM   1176  O  O   . THR A  1 154 ? 23.910  17.177  17.705  1.00 26.92  ? 154 THR A O   1 
ATOM   1177  C  CB  . THR A  1 154 ? 26.118  18.246  15.280  1.00 25.88  ? 154 THR A CB  1 
ATOM   1178  O  OG1 . THR A  1 154 ? 26.333  19.406  14.468  1.00 25.67  ? 154 THR A OG1 1 
ATOM   1179  C  CG2 . THR A  1 154 ? 25.196  17.276  14.524  1.00 20.58  ? 154 THR A CG2 1 
ATOM   1180  N  N   . GLY A  1 155 ? 26.105  16.687  17.968  1.00 20.75  ? 155 GLY A N   1 
ATOM   1181  C  CA  . GLY A  1 155 ? 25.809  15.521  18.805  1.00 18.49  ? 155 GLY A CA  1 
ATOM   1182  C  C   . GLY A  1 155 ? 25.003  15.882  20.051  1.00 28.94  ? 155 GLY A C   1 
ATOM   1183  O  O   . GLY A  1 155 ? 24.023  15.218  20.395  1.00 26.60  ? 155 GLY A O   1 
ATOM   1184  N  N   . PHE A  1 156 ? 25.405  16.951  20.733  1.00 22.91  ? 156 PHE A N   1 
ATOM   1185  C  CA  . PHE A  1 156 ? 24.686  17.407  21.921  1.00 22.42  ? 156 PHE A CA  1 
ATOM   1186  C  C   . PHE A  1 156 ? 23.250  17.871  21.611  1.00 21.22  ? 156 PHE A C   1 
ATOM   1187  O  O   . PHE A  1 156 ? 22.322  17.610  22.382  1.00 28.78  ? 156 PHE A O   1 
ATOM   1188  C  CB  . PHE A  1 156 ? 25.465  18.523  22.623  1.00 21.35  ? 156 PHE A CB  1 
ATOM   1189  C  CG  . PHE A  1 156 ? 26.696  18.047  23.356  1.00 26.64  ? 156 PHE A CG  1 
ATOM   1190  C  CD1 . PHE A  1 156 ? 27.202  16.773  23.156  1.00 27.43  ? 156 PHE A CD1 1 
ATOM   1191  C  CD2 . PHE A  1 156 ? 27.362  18.893  24.230  1.00 28.02  ? 156 PHE A CD2 1 
ATOM   1192  C  CE1 . PHE A  1 156 ? 28.324  16.341  23.833  1.00 30.64  ? 156 PHE A CE1 1 
ATOM   1193  C  CE2 . PHE A  1 156 ? 28.491  18.464  24.906  1.00 34.62  ? 156 PHE A CE2 1 
ATOM   1194  C  CZ  . PHE A  1 156 ? 28.972  17.183  24.707  1.00 32.97  ? 156 PHE A CZ  1 
ATOM   1195  N  N   . HIS A  1 157 ? 23.063  18.558  20.495  1.00 22.22  ? 157 HIS A N   1 
ATOM   1196  C  CA  . HIS A  1 157 ? 21.713  18.975  20.092  1.00 21.87  ? 157 HIS A CA  1 
ATOM   1197  C  C   . HIS A  1 157 ? 20.812  17.756  19.938  1.00 29.47  ? 157 HIS A C   1 
ATOM   1198  O  O   . HIS A  1 157 ? 19.604  17.810  20.230  1.00 28.58  ? 157 HIS A O   1 
ATOM   1199  C  CB  . HIS A  1 157 ? 21.764  19.772  18.794  1.00 26.98  ? 157 HIS A CB  1 
ATOM   1200  C  CG  . HIS A  1 157 ? 20.531  20.581  18.519  1.00 28.12  ? 157 HIS A CG  1 
ATOM   1201  N  ND1 . HIS A  1 157 ? 19.856  21.272  19.503  1.00 25.00  ? 157 HIS A ND1 1 
ATOM   1202  C  CD2 . HIS A  1 157 ? 19.863  20.822  17.365  1.00 26.45  ? 157 HIS A CD2 1 
ATOM   1203  C  CE1 . HIS A  1 157 ? 18.835  21.914  18.967  1.00 24.46  ? 157 HIS A CE1 1 
ATOM   1204  N  NE2 . HIS A  1 157 ? 18.816  21.656  17.672  1.00 28.02  ? 157 HIS A NE2 1 
ATOM   1205  N  N   . GLY A  1 158 ? 21.404  16.655  19.481  1.00 32.86  ? 158 GLY A N   1 
ATOM   1206  C  CA  . GLY A  1 158 ? 20.672  15.409  19.332  1.00 27.56  ? 158 GLY A CA  1 
ATOM   1207  C  C   . GLY A  1 158 ? 20.157  14.950  20.678  1.00 32.27  ? 158 GLY A C   1 
ATOM   1208  O  O   . GLY A  1 158 ? 19.004  14.540  20.785  1.00 23.09  ? 158 GLY A O   1 
ATOM   1209  N  N   . ALA A  1 159 ? 21.000  15.045  21.714  1.00 20.51  ? 159 ALA A N   1 
ATOM   1210  C  CA  . ALA A  1 159 ? 20.571  14.706  23.063  1.00 22.59  ? 159 ALA A CA  1 
ATOM   1211  C  C   . ALA A  1 159 ? 19.571  15.712  23.634  1.00 25.09  ? 159 ALA A C   1 
ATOM   1212  O  O   . ALA A  1 159 ? 18.673  15.347  24.405  1.00 25.52  ? 159 ALA A O   1 
ATOM   1213  C  CB  . ALA A  1 159 ? 21.810  14.546  24.020  1.00 25.23  ? 159 ALA A CB  1 
ATOM   1214  N  N   . GLU A  1 160 ? 19.723  16.981  23.265  1.00 24.58  ? 160 GLU A N   1 
ATOM   1215  C  CA  . GLU A  1 160 ? 18.809  18.011  23.761  1.00 20.52  ? 160 GLU A CA  1 
ATOM   1216  C  C   . GLU A  1 160 ? 17.408  17.837  23.130  1.00 27.00  ? 160 GLU A C   1 
ATOM   1217  O  O   . GLU A  1 160 ? 16.380  17.854  23.825  1.00 25.60  ? 160 GLU A O   1 
ATOM   1218  C  CB  . GLU A  1 160 ? 19.366  19.412  23.483  1.00 29.32  ? 160 GLU A CB  1 
ATOM   1219  C  CG  . GLU A  1 160 ? 20.725  19.716  24.140  1.00 28.04  ? 160 GLU A CG  1 
ATOM   1220  C  CD  . GLU A  1 160 ? 21.356  21.026  23.627  1.00 32.58  ? 160 GLU A CD  1 
ATOM   1221  O  OE1 . GLU A  1 160 ? 21.491  21.215  22.399  1.00 36.90  ? 160 GLU A OE1 1 
ATOM   1222  O  OE2 . GLU A  1 160 ? 21.726  21.877  24.459  1.00 43.01  ? 160 GLU A OE2 1 
ATOM   1223  N  N   . LEU A  1 161 ? 17.375  17.687  21.813  1.00 25.06  ? 161 LEU A N   1 
ATOM   1224  C  CA  . LEU A  1 161 ? 16.124  17.444  21.105  1.00 25.87  ? 161 LEU A CA  1 
ATOM   1225  C  C   . LEU A  1 161 ? 15.413  16.179  21.619  1.00 27.29  ? 161 LEU A C   1 
ATOM   1226  O  O   . LEU A  1 161 ? 14.197  16.146  21.717  1.00 27.28  ? 161 LEU A O   1 
ATOM   1227  C  CB  . LEU A  1 161 ? 16.384  17.335  19.602  1.00 26.50  ? 161 LEU A CB  1 
ATOM   1228  C  CG  . LEU A  1 161 ? 16.775  18.639  18.900  1.00 31.61  ? 161 LEU A CG  1 
ATOM   1229  C  CD1 . LEU A  1 161 ? 17.184  18.373  17.465  1.00 29.50  ? 161 LEU A CD1 1 
ATOM   1230  C  CD2 . LEU A  1 161 ? 15.651  19.666  18.968  1.00 28.89  ? 161 LEU A CD2 1 
ATOM   1231  N  N   . ALA A  1 162 ? 16.181  15.156  21.967  1.00 29.64  ? 162 ALA A N   1 
ATOM   1232  C  CA  . ALA A  1 162 ? 15.622  13.921  22.520  1.00 28.97  ? 162 ALA A CA  1 
ATOM   1233  C  C   . ALA A  1 162 ? 14.946  14.101  23.879  1.00 29.84  ? 162 ALA A C   1 
ATOM   1234  O  O   . ALA A  1 162 ? 14.251  13.195  24.325  1.00 32.74  ? 162 ALA A O   1 
ATOM   1235  C  CB  . ALA A  1 162 ? 16.709  12.822  22.619  1.00 20.22  ? 162 ALA A CB  1 
ATOM   1236  N  N   . ASP A  1 163 ? 15.169  15.238  24.549  1.00 25.24  ? 163 ASP A N   1 
ATOM   1237  C  CA  . ASP A  1 163 ? 14.485  15.506  25.816  1.00 22.04  ? 163 ASP A CA  1 
ATOM   1238  C  C   . ASP A  1 163 ? 14.578  14.309  26.773  1.00 29.07  ? 163 ASP A C   1 
ATOM   1239  O  O   . ASP A  1 163 ? 13.563  13.774  27.231  1.00 27.87  ? 163 ASP A O   1 
ATOM   1240  C  CB  . ASP A  1 163 ? 13.008  15.793  25.544  1.00 28.82  ? 163 ASP A CB  1 
ATOM   1241  C  CG  . ASP A  1 163 ? 12.368  16.653  26.614  1.00 39.96  ? 163 ASP A CG  1 
ATOM   1242  O  OD1 . ASP A  1 163 ? 13.018  16.944  27.648  1.00 38.22  ? 163 ASP A OD1 1 
ATOM   1243  O  OD2 . ASP A  1 163 ? 11.205  17.050  26.413  1.00 41.00  ? 163 ASP A OD2 1 
ATOM   1244  N  N   . ILE A  1 164 ? 15.803  13.892  27.053  1.00 26.25  ? 164 ILE A N   1 
ATOM   1245  C  CA  . ILE A  1 164 ? 16.080  12.716  27.850  1.00 26.51  ? 164 ILE A CA  1 
ATOM   1246  C  C   . ILE A  1 164 ? 15.653  12.851  29.319  1.00 28.58  ? 164 ILE A C   1 
ATOM   1247  O  O   . ILE A  1 164 ? 15.898  13.870  29.949  1.00 30.43  ? 164 ILE A O   1 
ATOM   1248  C  CB  . ILE A  1 164 ? 17.578  12.434  27.756  1.00 31.20  ? 164 ILE A CB  1 
ATOM   1249  C  CG1 . ILE A  1 164 ? 17.910  11.965  26.328  1.00 28.93  ? 164 ILE A CG1 1 
ATOM   1250  C  CG2 . ILE A  1 164 ? 18.015  11.448  28.815  1.00 21.33  ? 164 ILE A CG2 1 
ATOM   1251  C  CD1 . ILE A  1 164 ? 19.390  12.007  25.970  1.00 25.06  ? 164 ILE A CD1 1 
ATOM   1252  N  N   . GLU A  1 165 ? 15.000  11.818  29.843  1.00 26.51  ? 165 GLU A N   1 
ATOM   1253  C  CA  . GLU A  1 165 ? 14.617  11.744  31.251  1.00 29.75  ? 165 GLU A CA  1 
ATOM   1254  C  C   . GLU A  1 165 ? 15.759  11.080  32.027  1.00 33.66  ? 165 GLU A C   1 
ATOM   1255  O  O   . GLU A  1 165 ? 16.505  10.260  31.490  1.00 31.74  ? 165 GLU A O   1 
ATOM   1256  C  CB  . GLU A  1 165 ? 13.355  10.888  31.438  1.00 26.99  ? 165 GLU A CB  1 
ATOM   1257  C  CG  . GLU A  1 165 ? 12.084  11.322  30.695  1.00 31.96  ? 165 GLU A CG  1 
ATOM   1258  C  CD  . GLU A  1 165 ? 11.143  10.129  30.460  1.00 44.19  ? 165 GLU A CD  1 
ATOM   1259  O  OE1 . GLU A  1 165 ? 11.410  9.301   29.542  1.00 36.14  ? 165 GLU A OE1 1 
ATOM   1260  O  OE2 . GLU A  1 165 ? 10.158  9.994   31.219  1.00 48.87  ? 165 GLU A OE2 1 
ATOM   1261  N  N   . MET A  1 166 ? 15.892  11.406  33.298  1.00 25.19  ? 166 MET A N   1 
ATOM   1262  C  CA  . MET A  1 166 ? 17.031  10.886  34.051  1.00 26.66  ? 166 MET A CA  1 
ATOM   1263  C  C   . MET A  1 166 ? 16.865  9.390   34.262  1.00 21.58  ? 166 MET A C   1 
ATOM   1264  O  O   . MET A  1 166 ? 15.799  8.936   34.688  1.00 25.48  ? 166 MET A O   1 
ATOM   1265  C  CB  . MET A  1 166 ? 17.179  11.608  35.384  1.00 28.01  ? 166 MET A CB  1 
ATOM   1266  C  CG  . MET A  1 166 ? 17.452  13.112  35.227  1.00 32.91  ? 166 MET A CG  1 
ATOM   1267  S  SD  . MET A  1 166 ? 18.287  13.853  36.641  1.00 34.67  ? 166 MET A SD  1 
ATOM   1268  C  CE  . MET A  1 166 ? 19.987  13.531  36.225  1.00 33.85  ? 166 MET A CE  1 
ATOM   1269  N  N   . GLY A  1 167 ? 17.900  8.637   33.909  1.00 23.24  ? 167 GLY A N   1 
ATOM   1270  C  CA  . GLY A  1 167 ? 17.910  7.192   34.067  1.00 26.92  ? 167 GLY A CA  1 
ATOM   1271  C  C   . GLY A  1 167 ? 17.240  6.416   32.949  1.00 35.64  ? 167 GLY A C   1 
ATOM   1272  O  O   . GLY A  1 167 ? 17.144  5.189   33.019  1.00 36.06  ? 167 GLY A O   1 
ATOM   1273  N  N   . SER A  1 168 ? 16.794  7.110   31.907  1.00 33.82  ? 168 SER A N   1 
ATOM   1274  C  CA  . SER A  1 168 ? 16.085  6.443   30.813  1.00 30.86  ? 168 SER A CA  1 
ATOM   1275  C  C   . SER A  1 168 ? 17.042  5.853   29.775  1.00 31.68  ? 168 SER A C   1 
ATOM   1276  O  O   . SER A  1 168 ? 18.231  6.178   29.741  1.00 24.47  ? 168 SER A O   1 
ATOM   1277  C  CB  . SER A  1 168 ? 15.076  7.385   30.148  1.00 28.41  ? 168 SER A CB  1 
ATOM   1278  O  OG  . SER A  1 168 ? 15.701  8.329   29.296  1.00 28.10  ? 168 SER A OG  1 
ATOM   1279  N  N   . SER A  1 169 ? 16.520  4.977   28.928  1.00 23.54  ? 169 SER A N   1 
ATOM   1280  C  CA  . SER A  1 169 ? 17.372  4.255   27.994  1.00 21.17  ? 169 SER A CA  1 
ATOM   1281  C  C   . SER A  1 169 ? 17.431  4.958   26.641  1.00 25.90  ? 169 SER A C   1 
ATOM   1282  O  O   . SER A  1 169 ? 16.427  5.484   26.150  1.00 29.39  ? 169 SER A O   1 
ATOM   1283  C  CB  . SER A  1 169 ? 16.858  2.815   27.826  1.00 22.78  ? 169 SER A CB  1 
ATOM   1284  O  OG  . SER A  1 169 ? 15.524  2.823   27.318  1.00 26.18  ? 169 SER A OG  1 
ATOM   1285  N  N   . VAL A  1 170 ? 18.612  4.967   26.034  1.00 28.91  ? 170 VAL A N   1 
ATOM   1286  C  CA  . VAL A  1 170 ? 18.795  5.649   24.763  1.00 26.56  ? 170 VAL A CA  1 
ATOM   1287  C  C   . VAL A  1 170 ? 19.541  4.751   23.790  1.00 29.73  ? 170 VAL A C   1 
ATOM   1288  O  O   . VAL A  1 170 ? 20.539  4.130   24.161  1.00 31.28  ? 170 VAL A O   1 
ATOM   1289  C  CB  . VAL A  1 170 ? 19.656  6.929   24.931  1.00 28.23  ? 170 VAL A CB  1 
ATOM   1290  C  CG1 . VAL A  1 170 ? 19.794  7.637   23.575  1.00 23.09  ? 170 VAL A CG1 1 
ATOM   1291  C  CG2 . VAL A  1 170 ? 19.058  7.858   25.980  1.00 24.01  ? 170 VAL A CG2 1 
ATOM   1292  N  N   . VAL A  1 171 ? 19.056  4.680   22.552  1.00 27.20  ? 171 VAL A N   1 
ATOM   1293  C  CA  . VAL A  1 171 ? 19.825  4.091   21.464  1.00 26.71  ? 171 VAL A CA  1 
ATOM   1294  C  C   . VAL A  1 171 ? 20.340  5.192   20.557  1.00 26.66  ? 171 VAL A C   1 
ATOM   1295  O  O   . VAL A  1 171 ? 19.588  6.070   20.123  1.00 29.78  ? 171 VAL A O   1 
ATOM   1296  C  CB  . VAL A  1 171 ? 18.983  3.131   20.572  1.00 22.02  ? 171 VAL A CB  1 
ATOM   1297  C  CG1 . VAL A  1 171 ? 19.703  2.883   19.245  1.00 22.02  ? 171 VAL A CG1 1 
ATOM   1298  C  CG2 . VAL A  1 171 ? 18.691  1.833   21.277  1.00 25.35  ? 171 VAL A CG2 1 
ATOM   1299  N  N   . VAL A  1 172 ? 21.620  5.127   20.240  1.00 26.34  ? 172 VAL A N   1 
ATOM   1300  C  CA  . VAL A  1 172 ? 22.200  6.039   19.282  1.00 23.30  ? 172 VAL A CA  1 
ATOM   1301  C  C   . VAL A  1 172 ? 22.607  5.268   18.043  1.00 23.61  ? 172 VAL A C   1 
ATOM   1302  O  O   . VAL A  1 172 ? 23.497  4.415   18.104  1.00 29.28  ? 172 VAL A O   1 
ATOM   1303  C  CB  . VAL A  1 172 ? 23.457  6.706   19.861  1.00 26.22  ? 172 VAL A CB  1 
ATOM   1304  C  CG1 . VAL A  1 172 ? 24.149  7.516   18.777  1.00 21.73  ? 172 VAL A CG1 1 
ATOM   1305  C  CG2 . VAL A  1 172 ? 23.091  7.570   21.075  1.00 29.50  ? 172 VAL A CG2 1 
ATOM   1306  N  N   . ILE A  1 173 ? 21.986  5.581   16.913  1.00 22.73  ? 173 ILE A N   1 
ATOM   1307  C  CA  . ILE A  1 173 ? 22.248  4.845   15.687  1.00 26.74  ? 173 ILE A CA  1 
ATOM   1308  C  C   . ILE A  1 173 ? 23.291  5.606   14.891  1.00 33.82  ? 173 ILE A C   1 
ATOM   1309  O  O   . ILE A  1 173 ? 23.036  6.716   14.392  1.00 31.54  ? 173 ILE A O   1 
ATOM   1310  C  CB  . ILE A  1 173 ? 20.972  4.670   14.836  1.00 34.26  ? 173 ILE A CB  1 
ATOM   1311  C  CG1 . ILE A  1 173 ? 19.848  4.053   15.665  1.00 34.64  ? 173 ILE A CG1 1 
ATOM   1312  C  CG2 . ILE A  1 173 ? 21.248  3.792   13.627  1.00 33.63  ? 173 ILE A CG2 1 
ATOM   1313  C  CD1 . ILE A  1 173 ? 18.548  3.859   14.871  1.00 34.79  ? 173 ILE A CD1 1 
ATOM   1314  N  N   . GLY A  1 174 ? 24.478  5.016   14.795  1.00 28.53  ? 174 GLY A N   1 
ATOM   1315  C  CA  . GLY A  1 174 ? 25.577  5.636   14.088  1.00 27.29  ? 174 GLY A CA  1 
ATOM   1316  C  C   . GLY A  1 174 ? 26.563  6.150   15.118  1.00 34.22  ? 174 GLY A C   1 
ATOM   1317  O  O   . GLY A  1 174 ? 26.216  6.942   15.998  1.00 33.58  ? 174 GLY A O   1 
ATOM   1318  N  N   . ILE A  1 175 ? 27.802  5.695   15.023  1.00 28.31  ? 175 ILE A N   1 
ATOM   1319  C  CA  . ILE A  1 175 ? 28.801  6.105   15.994  1.00 29.56  ? 175 ILE A CA  1 
ATOM   1320  C  C   . ILE A  1 175 ? 30.067  6.642   15.344  1.00 35.25  ? 175 ILE A C   1 
ATOM   1321  O  O   . ILE A  1 175 ? 31.180  6.398   15.826  1.00 34.58  ? 175 ILE A O   1 
ATOM   1322  C  CB  . ILE A  1 175 ? 29.073  5.005   17.033  1.00 31.27  ? 175 ILE A CB  1 
ATOM   1323  C  CG1 . ILE A  1 175 ? 29.544  3.727   16.338  1.00 33.92  ? 175 ILE A CG1 1 
ATOM   1324  C  CG2 . ILE A  1 175 ? 27.786  4.755   17.842  1.00 25.91  ? 175 ILE A CG2 1 
ATOM   1325  C  CD1 . ILE A  1 175 ? 30.041  2.647   17.306  1.00 33.83  ? 175 ILE A CD1 1 
ATOM   1326  N  N   . GLY A  1 176 ? 29.876  7.390   14.252  1.00 32.25  ? 176 GLY A N   1 
ATOM   1327  C  CA  . GLY A  1 176 ? 30.898  8.302   13.754  1.00 28.79  ? 176 GLY A CA  1 
ATOM   1328  C  C   . GLY A  1 176 ? 30.986  9.465   14.727  1.00 29.57  ? 176 GLY A C   1 
ATOM   1329  O  O   . GLY A  1 176 ? 30.358  9.427   15.790  1.00 30.42  ? 176 GLY A O   1 
ATOM   1330  N  N   . ALA A  1 177 ? 31.755  10.496  14.386  1.00 28.14  ? 177 ALA A N   1 
ATOM   1331  C  CA  . ALA A  1 177 ? 32.023  11.586  15.342  1.00 34.01  ? 177 ALA A CA  1 
ATOM   1332  C  C   . ALA A  1 177 ? 30.744  12.181  15.962  1.00 32.52  ? 177 ALA A C   1 
ATOM   1333  O  O   . ALA A  1 177 ? 30.631  12.321  17.183  1.00 33.31  ? 177 ALA A O   1 
ATOM   1334  C  CB  . ALA A  1 177 ? 32.871  12.680  14.693  1.00 27.32  ? 177 ALA A CB  1 
ATOM   1335  N  N   . VAL A  1 178 ? 29.777  12.517  15.115  1.00 29.70  ? 178 VAL A N   1 
ATOM   1336  C  CA  . VAL A  1 178 ? 28.522  13.074  15.606  1.00 29.99  ? 178 VAL A CA  1 
ATOM   1337  C  C   . VAL A  1 178 ? 27.793  12.136  16.586  1.00 27.83  ? 178 VAL A C   1 
ATOM   1338  O  O   . VAL A  1 178 ? 27.354  12.560  17.666  1.00 27.93  ? 178 VAL A O   1 
ATOM   1339  C  CB  . VAL A  1 178 ? 27.622  13.492  14.434  1.00 32.99  ? 178 VAL A CB  1 
ATOM   1340  C  CG1 . VAL A  1 178 ? 26.205  13.757  14.913  1.00 31.42  ? 178 VAL A CG1 1 
ATOM   1341  C  CG2 . VAL A  1 178 ? 28.219  14.729  13.762  1.00 28.98  ? 178 VAL A CG2 1 
ATOM   1342  N  N   . GLY A  1 179 ? 27.683  10.862  16.227  1.00 22.90  ? 179 GLY A N   1 
ATOM   1343  C  CA  . GLY A  1 179 ? 27.044  9.893   17.109  1.00 23.95  ? 179 GLY A CA  1 
ATOM   1344  C  C   . GLY A  1 179 ? 27.765  9.730   18.438  1.00 25.68  ? 179 GLY A C   1 
ATOM   1345  O  O   . GLY A  1 179 ? 27.139  9.531   19.483  1.00 28.45  ? 179 GLY A O   1 
ATOM   1346  N  N   . LEU A  1 180 ? 29.088  9.805   18.405  1.00 28.29  ? 180 LEU A N   1 
ATOM   1347  C  CA  . LEU A  1 180 ? 29.872  9.674   19.638  1.00 27.68  ? 180 LEU A CA  1 
ATOM   1348  C  C   . LEU A  1 180 ? 29.543  10.824  20.586  1.00 22.80  ? 180 LEU A C   1 
ATOM   1349  O  O   . LEU A  1 180 ? 29.360  10.613  21.788  1.00 23.92  ? 180 LEU A O   1 
ATOM   1350  C  CB  . LEU A  1 180 ? 31.362  9.616   19.320  1.00 25.89  ? 180 LEU A CB  1 
ATOM   1351  C  CG  . LEU A  1 180 ? 31.732  8.425   18.430  1.00 27.89  ? 180 LEU A CG  1 
ATOM   1352  C  CD1 . LEU A  1 180 ? 33.149  8.571   17.845  1.00 27.49  ? 180 LEU A CD1 1 
ATOM   1353  C  CD2 . LEU A  1 180 ? 31.602  7.136   19.245  1.00 24.79  ? 180 LEU A CD2 1 
ATOM   1354  N  N   . MET A  1 181 ? 29.424  12.032  20.028  1.00 23.88  ? 181 MET A N   1 
ATOM   1355  C  CA  . MET A  1 181 ? 29.009  13.210  20.805  1.00 22.11  ? 181 MET A CA  1 
ATOM   1356  C  C   . MET A  1 181 ? 27.533  13.104  21.206  1.00 29.10  ? 181 MET A C   1 
ATOM   1357  O  O   . MET A  1 181 ? 27.120  13.657  22.230  1.00 22.81  ? 181 MET A O   1 
ATOM   1358  C  CB  . MET A  1 181 ? 29.281  14.501  20.023  1.00 22.76  ? 181 MET A CB  1 
ATOM   1359  C  CG  . MET A  1 181 ? 30.782  14.811  19.877  1.00 25.89  ? 181 MET A CG  1 
ATOM   1360  S  SD  . MET A  1 181 ? 31.541  15.239  21.454  1.00 30.37  ? 181 MET A SD  1 
ATOM   1361  C  CE  . MET A  1 181 ? 32.247  13.684  22.010  1.00 28.11  ? 181 MET A CE  1 
ATOM   1362  N  N   . GLY A  1 182 ? 26.745  12.380  20.407  1.00 29.21  ? 182 GLY A N   1 
ATOM   1363  C  CA  . GLY A  1 182 ? 25.374  12.061  20.786  1.00 22.70  ? 182 GLY A CA  1 
ATOM   1364  C  C   . GLY A  1 182 ? 25.350  11.173  22.024  1.00 23.57  ? 182 GLY A C   1 
ATOM   1365  O  O   . GLY A  1 182 ? 24.547  11.355  22.946  1.00 28.55  ? 182 GLY A O   1 
ATOM   1366  N  N   . ILE A  1 183 ? 26.250  10.203  22.054  1.00 22.80  ? 183 ILE A N   1 
ATOM   1367  C  CA  . ILE A  1 183 ? 26.411  9.349   23.245  1.00 21.42  ? 183 ILE A CA  1 
ATOM   1368  C  C   . ILE A  1 183 ? 26.845  10.149  24.471  1.00 24.11  ? 183 ILE A C   1 
ATOM   1369  O  O   . ILE A  1 183 ? 26.218  10.069  25.543  1.00 23.83  ? 183 ILE A O   1 
ATOM   1370  C  CB  . ILE A  1 183 ? 27.419  8.222   22.967  1.00 27.84  ? 183 ILE A CB  1 
ATOM   1371  C  CG1 . ILE A  1 183 ? 26.782  7.196   22.016  1.00 27.64  ? 183 ILE A CG1 1 
ATOM   1372  C  CG2 . ILE A  1 183 ? 27.923  7.571   24.286  1.00 24.48  ? 183 ILE A CG2 1 
ATOM   1373  C  CD1 . ILE A  1 183 ? 27.771  6.274   21.349  1.00 29.83  ? 183 ILE A CD1 1 
ATOM   1374  N  N   . ALA A  1 184 ? 27.904  10.942  24.313  1.00 28.66  ? 184 ALA A N   1 
ATOM   1375  C  CA  . ALA A  1 184 ? 28.391  11.789  25.415  1.00 25.06  ? 184 ALA A CA  1 
ATOM   1376  C  C   . ALA A  1 184 ? 27.275  12.725  25.895  1.00 26.59  ? 184 ALA A C   1 
ATOM   1377  O  O   . ALA A  1 184 ? 27.035  12.866  27.091  1.00 28.24  ? 184 ALA A O   1 
ATOM   1378  C  CB  . ALA A  1 184 ? 29.583  12.597  24.963  1.00 23.89  ? 184 ALA A CB  1 
ATOM   1379  N  N   . GLY A  1 185 ? 26.585  13.347  24.939  1.00 30.18  ? 185 GLY A N   1 
ATOM   1380  C  CA  . GLY A  1 185 ? 25.511  14.277  25.230  1.00 23.58  ? 185 GLY A CA  1 
ATOM   1381  C  C   . GLY A  1 185 ? 24.415  13.597  26.013  1.00 24.59  ? 185 GLY A C   1 
ATOM   1382  O  O   . GLY A  1 185 ? 23.909  14.133  26.995  1.00 24.20  ? 185 GLY A O   1 
ATOM   1383  N  N   . ALA A  1 186 ? 24.040  12.399  25.583  1.00 23.30  ? 186 ALA A N   1 
ATOM   1384  C  CA  . ALA A  1 186 ? 22.980  11.684  26.274  1.00 22.95  ? 186 ALA A CA  1 
ATOM   1385  C  C   . ALA A  1 186 ? 23.408  11.328  27.686  1.00 22.51  ? 186 ALA A C   1 
ATOM   1386  O  O   . ALA A  1 186 ? 22.603  11.367  28.612  1.00 23.41  ? 186 ALA A O   1 
ATOM   1387  C  CB  . ALA A  1 186 ? 22.563  10.423  25.489  1.00 25.46  ? 186 ALA A CB  1 
ATOM   1388  N  N   . LYS A  1 187 ? 24.674  10.961  27.864  1.00 24.35  ? 187 LYS A N   1 
ATOM   1389  C  CA  . LYS A  1 187 ? 25.134  10.664  29.220  1.00 22.72  ? 187 LYS A CA  1 
ATOM   1390  C  C   . LYS A  1 187 ? 25.091  11.953  30.046  1.00 26.98  ? 187 LYS A C   1 
ATOM   1391  O  O   . LYS A  1 187 ? 24.701  11.952  31.218  1.00 25.26  ? 187 LYS A O   1 
ATOM   1392  C  CB  . LYS A  1 187 ? 26.543  10.059  29.235  1.00 24.93  ? 187 LYS A CB  1 
ATOM   1393  C  CG  . LYS A  1 187 ? 27.126  9.955   30.662  1.00 35.86  ? 187 LYS A CG  1 
ATOM   1394  C  CD  . LYS A  1 187 ? 28.523  9.368   30.696  1.00 46.15  ? 187 LYS A CD  1 
ATOM   1395  C  CE  . LYS A  1 187 ? 29.484  10.127  29.784  1.00 63.04  ? 187 LYS A CE  1 
ATOM   1396  N  NZ  . LYS A  1 187 ? 29.736  11.542  30.207  1.00 68.38  ? 187 LYS A NZ  1 
ATOM   1397  N  N   . LEU A  1 188 ? 25.452  13.065  29.416  1.00 25.34  ? 188 LEU A N   1 
ATOM   1398  C  CA  . LEU A  1 188 ? 25.390  14.349  30.100  1.00 27.35  ? 188 LEU A CA  1 
ATOM   1399  C  C   . LEU A  1 188 ? 23.957  14.853  30.241  1.00 33.93  ? 188 LEU A C   1 
ATOM   1400  O  O   . LEU A  1 188 ? 23.723  15.907  30.812  1.00 37.73  ? 188 LEU A O   1 
ATOM   1401  C  CB  . LEU A  1 188 ? 26.225  15.374  29.352  1.00 35.30  ? 188 LEU A CB  1 
ATOM   1402  C  CG  . LEU A  1 188 ? 27.704  15.049  29.519  1.00 34.99  ? 188 LEU A CG  1 
ATOM   1403  C  CD1 . LEU A  1 188 ? 28.557  15.840  28.559  1.00 33.33  ? 188 LEU A CD1 1 
ATOM   1404  C  CD2 . LEU A  1 188 ? 28.101  15.271  30.970  1.00 39.20  ? 188 LEU A CD2 1 
ATOM   1405  N  N   . ARG A  1 189 ? 22.983  14.121  29.711  1.00 23.40  ? 189 ARG A N   1 
ATOM   1406  C  CA  . ARG A  1 189 ? 21.613  14.517  30.011  1.00 24.87  ? 189 ARG A CA  1 
ATOM   1407  C  C   . ARG A  1 189 ? 21.023  13.589  31.046  1.00 29.92  ? 189 ARG A C   1 
ATOM   1408  O  O   . ARG A  1 189 ? 19.864  13.735  31.442  1.00 30.37  ? 189 ARG A O   1 
ATOM   1409  C  CB  . ARG A  1 189 ? 20.761  14.608  28.749  1.00 23.21  ? 189 ARG A CB  1 
ATOM   1410  C  CG  . ARG A  1 189 ? 21.154  15.800  27.865  1.00 27.88  ? 189 ARG A CG  1 
ATOM   1411  C  CD  . ARG A  1 189 ? 20.991  17.135  28.620  1.00 26.42  ? 189 ARG A CD  1 
ATOM   1412  N  NE  . ARG A  1 189 ? 19.592  17.557  28.651  1.00 30.71  ? 189 ARG A NE  1 
ATOM   1413  C  CZ  . ARG A  1 189 ? 19.119  18.624  29.303  1.00 38.76  ? 189 ARG A CZ  1 
ATOM   1414  N  NH1 . ARG A  1 189 ? 19.927  19.412  30.028  1.00 26.22  ? 189 ARG A NH1 1 
ATOM   1415  N  NH2 . ARG A  1 189 ? 17.820  18.904  29.223  1.00 32.74  ? 189 ARG A NH2 1 
ATOM   1416  N  N   . GLY A  1 190 ? 21.845  12.647  31.505  1.00 26.46  ? 190 GLY A N   1 
ATOM   1417  C  CA  . GLY A  1 190 ? 21.451  11.772  32.592  1.00 27.45  ? 190 GLY A CA  1 
ATOM   1418  C  C   . GLY A  1 190 ? 20.873  10.462  32.093  1.00 32.44  ? 190 GLY A C   1 
ATOM   1419  O  O   . GLY A  1 190 ? 20.067  9.837   32.791  1.00 30.37  ? 190 GLY A O   1 
ATOM   1420  N  N   . ALA A  1 191 ? 21.266  10.038  30.891  1.00 22.27  ? 191 ALA A N   1 
ATOM   1421  C  CA  . ALA A  1 191 ? 20.772  8.739   30.393  1.00 25.13  ? 191 ALA A CA  1 
ATOM   1422  C  C   . ALA A  1 191 ? 21.339  7.587   31.237  1.00 26.39  ? 191 ALA A C   1 
ATOM   1423  O  O   . ALA A  1 191 ? 22.457  7.676   31.763  1.00 27.35  ? 191 ALA A O   1 
ATOM   1424  C  CB  . ALA A  1 191 ? 21.105  8.548   28.910  1.00 17.13  ? 191 ALA A CB  1 
ATOM   1425  N  N   . GLY A  1 192 ? 20.549  6.527   31.394  1.00 25.91  ? 192 GLY A N   1 
ATOM   1426  C  CA  . GLY A  1 192 ? 20.998  5.327   32.083  1.00 28.33  ? 192 GLY A CA  1 
ATOM   1427  C  C   . GLY A  1 192 ? 21.671  4.449   31.057  1.00 26.49  ? 192 GLY A C   1 
ATOM   1428  O  O   . GLY A  1 192 ? 22.810  4.708   30.652  1.00 31.43  ? 192 GLY A O   1 
ATOM   1429  N  N   . ARG A  1 193 ? 20.949  3.435   30.594  1.00 23.03  ? 193 ARG A N   1 
ATOM   1430  C  CA  . ARG A  1 193 ? 21.464  2.570   29.547  1.00 23.36  ? 193 ARG A CA  1 
ATOM   1431  C  C   . ARG A  1 193 ? 21.670  3.358   28.262  1.00 27.38  ? 193 ARG A C   1 
ATOM   1432  O  O   . ARG A  1 193 ? 20.794  4.131   27.854  1.00 24.35  ? 193 ARG A O   1 
ATOM   1433  C  CB  . ARG A  1 193 ? 20.493  1.402   29.293  1.00 30.57  ? 193 ARG A CB  1 
ATOM   1434  C  CG  . ARG A  1 193 ? 21.126  0.253   28.512  1.00 29.40  ? 193 ARG A CG  1 
ATOM   1435  C  CD  . ARG A  1 193 ? 20.242  -1.011  28.453  1.00 26.85  ? 193 ARG A CD  1 
ATOM   1436  N  NE  . ARG A  1 193 ? 21.043  -2.154  28.017  1.00 26.95  ? 193 ARG A NE  1 
ATOM   1437  C  CZ  . ARG A  1 193 ? 20.658  -3.423  28.100  1.00 33.80  ? 193 ARG A CZ  1 
ATOM   1438  N  NH1 . ARG A  1 193 ? 19.456  -3.730  28.580  1.00 30.91  ? 193 ARG A NH1 1 
ATOM   1439  N  NH2 . ARG A  1 193 ? 21.478  -4.386  27.690  1.00 28.64  ? 193 ARG A NH2 1 
ATOM   1440  N  N   . ILE A  1 194 ? 22.838  3.195   27.643  1.00 25.45  ? 194 ILE A N   1 
ATOM   1441  C  CA  . ILE A  1 194 ? 23.065  3.775   26.324  1.00 29.57  ? 194 ILE A CA  1 
ATOM   1442  C  C   . ILE A  1 194 ? 23.585  2.748   25.331  1.00 33.06  ? 194 ILE A C   1 
ATOM   1443  O  O   . ILE A  1 194 ? 24.693  2.228   25.482  1.00 27.42  ? 194 ILE A O   1 
ATOM   1444  C  CB  . ILE A  1 194 ? 24.046  4.968   26.328  1.00 28.84  ? 194 ILE A CB  1 
ATOM   1445  C  CG1 . ILE A  1 194 ? 23.615  6.045   27.329  1.00 26.36  ? 194 ILE A CG1 1 
ATOM   1446  C  CG2 . ILE A  1 194 ? 24.150  5.559   24.913  1.00 22.54  ? 194 ILE A CG2 1 
ATOM   1447  C  CD1 . ILE A  1 194 ? 24.530  7.265   27.341  1.00 22.79  ? 194 ILE A CD1 1 
ATOM   1448  N  N   . ILE A  1 195 ? 22.786  2.481   24.300  1.00 30.97  ? 195 ILE A N   1 
ATOM   1449  C  CA  . ILE A  1 195 ? 23.134  1.480   23.299  1.00 29.53  ? 195 ILE A CA  1 
ATOM   1450  C  C   . ILE A  1 195 ? 23.636  2.131   22.013  1.00 29.47  ? 195 ILE A C   1 
ATOM   1451  O  O   . ILE A  1 195 ? 22.901  2.870   21.357  1.00 30.31  ? 195 ILE A O   1 
ATOM   1452  C  CB  . ILE A  1 195 ? 21.922  0.552   22.981  1.00 27.81  ? 195 ILE A CB  1 
ATOM   1453  C  CG1 . ILE A  1 195 ? 21.430  -0.146  24.255  1.00 31.12  ? 195 ILE A CG1 1 
ATOM   1454  C  CG2 . ILE A  1 195 ? 22.280  -0.460  21.903  1.00 25.02  ? 195 ILE A CG2 1 
ATOM   1455  C  CD1 . ILE A  1 195 ? 19.989  -0.617  24.207  1.00 38.88  ? 195 ILE A CD1 1 
ATOM   1456  N  N   . GLY A  1 196 ? 24.889  1.858   21.655  1.00 27.24  ? 196 GLY A N   1 
ATOM   1457  C  CA  . GLY A  1 196 ? 25.460  2.374   20.418  1.00 23.91  ? 196 GLY A CA  1 
ATOM   1458  C  C   . GLY A  1 196 ? 25.352  1.371   19.280  1.00 29.03  ? 196 GLY A C   1 
ATOM   1459  O  O   . GLY A  1 196 ? 25.537  0.169   19.468  1.00 31.76  ? 196 GLY A O   1 
ATOM   1460  N  N   . VAL A  1 197 ? 25.031  1.857   18.090  1.00 33.03  ? 197 VAL A N   1 
ATOM   1461  C  CA  . VAL A  1 197 ? 24.919  0.983   16.927  1.00 32.91  ? 197 VAL A CA  1 
ATOM   1462  C  C   . VAL A  1 197 ? 25.996  1.345   15.911  1.00 33.66  ? 197 VAL A C   1 
ATOM   1463  O  O   . VAL A  1 197 ? 26.027  2.483   15.420  1.00 29.39  ? 197 VAL A O   1 
ATOM   1464  C  CB  . VAL A  1 197 ? 23.524  1.092   16.271  1.00 31.15  ? 197 VAL A CB  1 
ATOM   1465  C  CG1 . VAL A  1 197 ? 23.397  0.077   15.145  1.00 29.78  ? 197 VAL A CG1 1 
ATOM   1466  C  CG2 . VAL A  1 197 ? 22.437  0.870   17.311  1.00 31.60  ? 197 VAL A CG2 1 
ATOM   1467  N  N   . GLY A  1 198 ? 26.876  0.384   15.612  1.00 32.82  ? 198 GLY A N   1 
ATOM   1468  C  CA  . GLY A  1 198 ? 27.997  0.588   14.702  1.00 33.16  ? 198 GLY A CA  1 
ATOM   1469  C  C   . GLY A  1 198 ? 29.022  -0.541  14.803  1.00 43.29  ? 198 GLY A C   1 
ATOM   1470  O  O   . GLY A  1 198 ? 28.930  -1.386  15.703  1.00 36.94  ? 198 GLY A O   1 
ATOM   1471  N  N   . SER A  1 199 ? 30.011  -0.540  13.904  1.00 43.79  ? 199 SER A N   1 
ATOM   1472  C  CA  . SER A  1 199 ? 30.939  -1.665  13.770  1.00 45.48  ? 199 SER A CA  1 
ATOM   1473  C  C   . SER A  1 199 ? 32.453  -1.364  13.825  1.00 46.74  ? 199 SER A C   1 
ATOM   1474  O  O   . SER A  1 199 ? 33.229  -2.184  14.335  1.00 46.79  ? 199 SER A O   1 
ATOM   1475  C  CB  . SER A  1 199 ? 30.615  -2.452  12.493  1.00 47.94  ? 199 SER A CB  1 
ATOM   1476  O  OG  . SER A  1 199 ? 30.475  -1.578  11.386  1.00 50.36  ? 199 SER A OG  1 
ATOM   1477  N  N   . ARG A  1 200 ? 32.888  -0.224  13.290  1.00 37.92  ? 200 ARG A N   1 
ATOM   1478  C  CA  . ARG A  1 200 ? 34.328  0.046   13.231  1.00 43.54  ? 200 ARG A CA  1 
ATOM   1479  C  C   . ARG A  1 200 ? 34.939  0.063   14.630  1.00 45.16  ? 200 ARG A C   1 
ATOM   1480  O  O   . ARG A  1 200 ? 34.481  0.798   15.499  1.00 45.34  ? 200 ARG A O   1 
ATOM   1481  C  CB  . ARG A  1 200 ? 34.602  1.351   12.490  1.00 42.69  ? 200 ARG A CB  1 
ATOM   1482  C  CG  . ARG A  1 200 ? 33.896  1.394   11.142  1.00 53.73  ? 200 ARG A CG  1 
ATOM   1483  C  CD  . ARG A  1 200 ? 33.596  2.807   10.728  1.00 70.94  ? 200 ARG A CD  1 
ATOM   1484  N  NE  . ARG A  1 200 ? 34.802  3.486   10.281  1.00 82.22  ? 200 ARG A NE  1 
ATOM   1485  C  CZ  . ARG A  1 200 ? 34.974  4.800   10.320  1.00 90.74  ? 200 ARG A CZ  1 
ATOM   1486  N  NH1 . ARG A  1 200 ? 34.016  5.590   10.799  1.00 91.27  ? 200 ARG A NH1 1 
ATOM   1487  N  NH2 . ARG A  1 200 ? 36.111  5.320   9.884   1.00 95.17  ? 200 ARG A NH2 1 
ATOM   1488  N  N   . PRO A  1 201 ? 35.968  -0.768  14.854  1.00 44.60  ? 201 PRO A N   1 
ATOM   1489  C  CA  . PRO A  1 201 ? 36.538  -0.947  16.194  1.00 45.92  ? 201 PRO A CA  1 
ATOM   1490  C  C   . PRO A  1 201 ? 36.923  0.363   16.874  1.00 41.01  ? 201 PRO A C   1 
ATOM   1491  O  O   . PRO A  1 201 ? 36.717  0.510   18.079  1.00 43.90  ? 201 PRO A O   1 
ATOM   1492  C  CB  . PRO A  1 201 ? 37.782  -1.808  15.932  1.00 41.09  ? 201 PRO A CB  1 
ATOM   1493  C  CG  . PRO A  1 201 ? 37.404  -2.623  14.747  1.00 35.75  ? 201 PRO A CG  1 
ATOM   1494  C  CD  . PRO A  1 201 ? 36.598  -1.667  13.872  1.00 40.92  ? 201 PRO A CD  1 
ATOM   1495  N  N   . ILE A  1 202 ? 37.455  1.314   16.123  1.00 38.13  ? 202 ILE A N   1 
ATOM   1496  C  CA  . ILE A  1 202 ? 37.903  2.539   16.763  1.00 36.75  ? 202 ILE A CA  1 
ATOM   1497  C  C   . ILE A  1 202 ? 36.712  3.344   17.295  1.00 34.68  ? 202 ILE A C   1 
ATOM   1498  O  O   . ILE A  1 202 ? 36.767  3.892   18.408  1.00 35.93  ? 202 ILE A O   1 
ATOM   1499  C  CB  . ILE A  1 202 ? 38.884  3.353   15.883  1.00 38.13  ? 202 ILE A CB  1 
ATOM   1500  C  CG1 . ILE A  1 202 ? 39.700  4.314   16.762  1.00 51.17  ? 202 ILE A CG1 1 
ATOM   1501  C  CG2 . ILE A  1 202 ? 38.155  4.077   14.768  1.00 35.64  ? 202 ILE A CG2 1 
ATOM   1502  C  CD1 . ILE A  1 202 ? 40.953  4.867   16.093  1.00 51.76  ? 202 ILE A CD1 1 
ATOM   1503  N  N   . CYS A  1 203 ? 35.630  3.370   16.518  1.00 34.36  ? 203 CYS A N   1 
ATOM   1504  C  CA  . CYS A  1 203 ? 34.355  3.960   16.946  1.00 31.30  ? 203 CYS A CA  1 
ATOM   1505  C  C   . CYS A  1 203 ? 33.739  3.227   18.138  1.00 29.47  ? 203 CYS A C   1 
ATOM   1506  O  O   . CYS A  1 203 ? 33.201  3.851   19.064  1.00 28.85  ? 203 CYS A O   1 
ATOM   1507  C  CB  . CYS A  1 203 ? 33.357  3.999   15.777  1.00 27.54  ? 203 CYS A CB  1 
ATOM   1508  S  SG  . CYS A  1 203 ? 33.867  5.120   14.436  1.00 35.74  ? 203 CYS A SG  1 
ATOM   1509  N  N   . VAL A  1 204 ? 33.838  1.900   18.121  1.00 33.76  ? 204 VAL A N   1 
ATOM   1510  C  CA  . VAL A  1 204 ? 33.295  1.073   19.193  1.00 33.53  ? 204 VAL A CA  1 
ATOM   1511  C  C   . VAL A  1 204 ? 33.984  1.419   20.524  1.00 34.81  ? 204 VAL A C   1 
ATOM   1512  O  O   . VAL A  1 204 ? 33.328  1.648   21.541  1.00 35.97  ? 204 VAL A O   1 
ATOM   1513  C  CB  . VAL A  1 204 ? 33.426  -0.422  18.846  1.00 40.72  ? 204 VAL A CB  1 
ATOM   1514  C  CG1 . VAL A  1 204 ? 33.186  -1.291  20.080  1.00 37.92  ? 204 VAL A CG1 1 
ATOM   1515  C  CG2 . VAL A  1 204 ? 32.453  -0.778  17.707  1.00 34.90  ? 204 VAL A CG2 1 
ATOM   1516  N  N   . GLU A  1 205 ? 35.307  1.489   20.500  1.00 30.54  ? 205 GLU A N   1 
ATOM   1517  C  CA  . GLU A  1 205 ? 36.075  1.911   21.674  1.00 30.96  ? 205 GLU A CA  1 
ATOM   1518  C  C   . GLU A  1 205 ? 35.714  3.329   22.122  1.00 25.43  ? 205 GLU A C   1 
ATOM   1519  O  O   . GLU A  1 205 ? 35.428  3.550   23.292  1.00 29.07  ? 205 GLU A O   1 
ATOM   1520  C  CB  . GLU A  1 205 ? 37.579  1.803   21.411  1.00 40.56  ? 205 GLU A CB  1 
ATOM   1521  C  CG  . GLU A  1 205 ? 38.073  0.365   21.281  1.00 56.57  ? 205 GLU A CG  1 
ATOM   1522  C  CD  . GLU A  1 205 ? 37.620  -0.529  22.437  1.00 66.36  ? 205 GLU A CD  1 
ATOM   1523  O  OE1 . GLU A  1 205 ? 38.095  -0.313  23.578  1.00 68.07  ? 205 GLU A OE1 1 
ATOM   1524  O  OE2 . GLU A  1 205 ? 36.798  -1.451  22.200  1.00 63.76  ? 205 GLU A OE2 1 
ATOM   1525  N  N   . ALA A  1 206 ? 35.683  4.283   21.196  1.00 30.74  ? 206 ALA A N   1 
ATOM   1526  C  CA  . ALA A  1 206 ? 35.300  5.655   21.568  1.00 28.42  ? 206 ALA A CA  1 
ATOM   1527  C  C   . ALA A  1 206 ? 33.892  5.710   22.165  1.00 28.80  ? 206 ALA A C   1 
ATOM   1528  O  O   . ALA A  1 206 ? 33.650  6.433   23.134  1.00 33.80  ? 206 ALA A O   1 
ATOM   1529  C  CB  . ALA A  1 206 ? 35.431  6.596   20.392  1.00 24.62  ? 206 ALA A CB  1 
ATOM   1530  N  N   . ALA A  1 207 ? 32.980  4.904   21.621  1.00 30.83  ? 207 ALA A N   1 
ATOM   1531  C  CA  . ALA A  1 207 ? 31.595  4.903   22.094  1.00 29.04  ? 207 ALA A CA  1 
ATOM   1532  C  C   . ALA A  1 207 ? 31.528  4.469   23.548  1.00 27.66  ? 207 ALA A C   1 
ATOM   1533  O  O   . ALA A  1 207 ? 30.814  5.065   24.356  1.00 30.55  ? 207 ALA A O   1 
ATOM   1534  C  CB  . ALA A  1 207 ? 30.700  4.013   21.202  1.00 21.39  ? 207 ALA A CB  1 
ATOM   1535  N  N   . LYS A  1 208 ? 32.285  3.430   23.883  1.00 32.23  ? 208 LYS A N   1 
ATOM   1536  C  CA  . LYS A  1 208 ? 32.393  2.979   25.267  1.00 37.04  ? 208 LYS A CA  1 
ATOM   1537  C  C   . LYS A  1 208 ? 32.978  4.080   26.137  1.00 32.15  ? 208 LYS A C   1 
ATOM   1538  O  O   . LYS A  1 208 ? 32.463  4.383   27.215  1.00 32.65  ? 208 LYS A O   1 
ATOM   1539  C  CB  . LYS A  1 208 ? 33.264  1.722   25.356  1.00 44.11  ? 208 LYS A CB  1 
ATOM   1540  C  CG  . LYS A  1 208 ? 32.701  0.525   24.585  1.00 47.58  ? 208 LYS A CG  1 
ATOM   1541  C  CD  . LYS A  1 208 ? 33.642  -0.677  24.645  1.00 51.94  ? 208 LYS A CD  1 
ATOM   1542  C  CE  . LYS A  1 208 ? 33.099  -1.847  23.838  1.00 59.25  ? 208 LYS A CE  1 
ATOM   1543  N  NZ  . LYS A  1 208 ? 33.988  -3.048  23.899  1.00 64.19  ? 208 LYS A NZ  1 
ATOM   1544  N  N   . PHE A  1 209 ? 34.057  4.687   25.663  1.00 25.62  ? 209 PHE A N   1 
ATOM   1545  C  CA  . PHE A  1 209 ? 34.668  5.776   26.400  1.00 31.47  ? 209 PHE A CA  1 
ATOM   1546  C  C   . PHE A  1 209 ? 33.651  6.889   26.701  1.00 32.76  ? 209 PHE A C   1 
ATOM   1547  O  O   . PHE A  1 209 ? 33.640  7.436   27.810  1.00 34.98  ? 209 PHE A O   1 
ATOM   1548  C  CB  . PHE A  1 209 ? 35.852  6.348   25.631  1.00 30.85  ? 209 PHE A CB  1 
ATOM   1549  C  CG  . PHE A  1 209 ? 36.479  7.549   26.295  1.00 33.43  ? 209 PHE A CG  1 
ATOM   1550  C  CD1 . PHE A  1 209 ? 37.451  7.390   27.281  1.00 30.93  ? 209 PHE A CD1 1 
ATOM   1551  C  CD2 . PHE A  1 209 ? 36.122  8.831   25.922  1.00 30.73  ? 209 PHE A CD2 1 
ATOM   1552  C  CE1 . PHE A  1 209 ? 38.036  8.497   27.898  1.00 35.46  ? 209 PHE A CE1 1 
ATOM   1553  C  CE2 . PHE A  1 209 ? 36.711  9.946   26.527  1.00 35.26  ? 209 PHE A CE2 1 
ATOM   1554  C  CZ  . PHE A  1 209 ? 37.668  9.776   27.522  1.00 37.20  ? 209 PHE A CZ  1 
ATOM   1555  N  N   . TYR A  1 210 ? 32.800  7.219   25.724  1.00 24.64  ? 210 TYR A N   1 
ATOM   1556  C  CA  . TYR A  1 210 ? 31.862  8.340   25.895  1.00 26.45  ? 210 TYR A CA  1 
ATOM   1557  C  C   . TYR A  1 210 ? 30.595  7.992   26.670  1.00 31.17  ? 210 TYR A C   1 
ATOM   1558  O  O   . TYR A  1 210 ? 29.853  8.883   27.044  1.00 27.16  ? 210 TYR A O   1 
ATOM   1559  C  CB  . TYR A  1 210 ? 31.513  9.002   24.559  1.00 26.44  ? 210 TYR A CB  1 
ATOM   1560  C  CG  . TYR A  1 210 ? 32.647  9.845   24.028  1.00 28.00  ? 210 TYR A CG  1 
ATOM   1561  C  CD1 . TYR A  1 210 ? 33.149  10.918  24.772  1.00 25.66  ? 210 TYR A CD1 1 
ATOM   1562  C  CD2 . TYR A  1 210 ? 33.241  9.561   22.809  1.00 24.46  ? 210 TYR A CD2 1 
ATOM   1563  C  CE1 . TYR A  1 210 ? 34.174  11.691  24.304  1.00 23.03  ? 210 TYR A CE1 1 
ATOM   1564  C  CE2 . TYR A  1 210 ? 34.300  10.331  22.334  1.00 23.58  ? 210 TYR A CE2 1 
ATOM   1565  C  CZ  . TYR A  1 210 ? 34.745  11.396  23.081  1.00 25.74  ? 210 TYR A CZ  1 
ATOM   1566  O  OH  . TYR A  1 210 ? 35.787  12.153  22.622  1.00 30.44  ? 210 TYR A OH  1 
ATOM   1567  N  N   . GLY A  1 211 ? 30.358  6.706   26.926  1.00 33.26  ? 211 GLY A N   1 
ATOM   1568  C  CA  . GLY A  1 211 ? 29.238  6.308   27.769  1.00 32.02  ? 211 GLY A CA  1 
ATOM   1569  C  C   . GLY A  1 211 ? 28.373  5.124   27.350  1.00 31.00  ? 211 GLY A C   1 
ATOM   1570  O  O   . GLY A  1 211 ? 27.444  4.752   28.075  1.00 29.25  ? 211 GLY A O   1 
ATOM   1571  N  N   . ALA A  1 212 ? 28.656  4.531   26.192  1.00 24.47  ? 212 ALA A N   1 
ATOM   1572  C  CA  . ALA A  1 212 ? 27.809  3.437   25.687  1.00 26.00  ? 212 ALA A CA  1 
ATOM   1573  C  C   . ALA A  1 212 ? 27.982  2.248   26.612  1.00 30.15  ? 212 ALA A C   1 
ATOM   1574  O  O   . ALA A  1 212 ? 29.112  1.857   26.911  1.00 29.50  ? 212 ALA A O   1 
ATOM   1575  C  CB  . ALA A  1 212 ? 28.209  3.057   24.270  1.00 19.72  ? 212 ALA A CB  1 
ATOM   1576  N  N   . THR A  1 213 ? 26.871  1.687   27.081  1.00 28.28  ? 213 THR A N   1 
ATOM   1577  C  CA  . THR A  1 213 ? 26.915  0.532   27.967  1.00 31.24  ? 213 THR A CA  1 
ATOM   1578  C  C   . THR A  1 213 ? 26.733  -0.752  27.143  1.00 35.78  ? 213 THR A C   1 
ATOM   1579  O  O   . THR A  1 213 ? 26.994  -1.843  27.629  1.00 38.14  ? 213 THR A O   1 
ATOM   1580  C  CB  . THR A  1 213 ? 25.798  0.607   28.996  1.00 30.92  ? 213 THR A CB  1 
ATOM   1581  O  OG1 . THR A  1 213 ? 24.560  0.751   28.295  1.00 35.28  ? 213 THR A OG1 1 
ATOM   1582  C  CG2 . THR A  1 213 ? 25.995  1.836   29.937  1.00 27.27  ? 213 THR A CG2 1 
ATOM   1583  N  N   . ASP A  1 214 ? 26.266  -0.605  25.905  1.00 31.26  ? 214 ASP A N   1 
ATOM   1584  C  CA  . ASP A  1 214 ? 26.126  -1.730  24.979  1.00 33.62  ? 214 ASP A CA  1 
ATOM   1585  C  C   . ASP A  1 214 ? 26.459  -1.259  23.576  1.00 36.03  ? 214 ASP A C   1 
ATOM   1586  O  O   . ASP A  1 214 ? 26.296  -0.081  23.248  1.00 39.11  ? 214 ASP A O   1 
ATOM   1587  C  CB  . ASP A  1 214 ? 24.693  -2.280  24.958  1.00 30.32  ? 214 ASP A CB  1 
ATOM   1588  C  CG  . ASP A  1 214 ? 24.168  -2.604  26.330  1.00 33.59  ? 214 ASP A CG  1 
ATOM   1589  O  OD1 . ASP A  1 214 ? 23.889  -1.661  27.105  1.00 29.56  ? 214 ASP A OD1 1 
ATOM   1590  O  OD2 . ASP A  1 214 ? 24.005  -3.809  26.617  1.00 36.75  ? 214 ASP A OD2 1 
ATOM   1591  N  N   . ILE A  1 215 ? 26.905  -2.191  22.746  1.00 30.24  ? 215 ILE A N   1 
ATOM   1592  C  CA  . ILE A  1 215 ? 27.241  -1.899  21.363  1.00 30.68  ? 215 ILE A CA  1 
ATOM   1593  C  C   . ILE A  1 215 ? 26.617  -2.973  20.469  1.00 38.04  ? 215 ILE A C   1 
ATOM   1594  O  O   . ILE A  1 215 ? 26.811  -4.175  20.701  1.00 34.01  ? 215 ILE A O   1 
ATOM   1595  C  CB  . ILE A  1 215 ? 28.754  -1.933  21.147  1.00 35.69  ? 215 ILE A CB  1 
ATOM   1596  C  CG1 . ILE A  1 215 ? 29.445  -0.822  21.956  1.00 33.99  ? 215 ILE A CG1 1 
ATOM   1597  C  CG2 . ILE A  1 215 ? 29.057  -1.816  19.649  1.00 40.94  ? 215 ILE A CG2 1 
ATOM   1598  C  CD1 . ILE A  1 215 ? 29.276  0.556   21.331  1.00 38.00  ? 215 ILE A CD1 1 
ATOM   1599  N  N   . LEU A  1 216 ? 25.863  -2.543  19.461  1.00 30.88  ? 216 LEU A N   1 
ATOM   1600  C  CA  . LEU A  1 216 ? 25.244  -3.473  18.532  1.00 33.42  ? 216 LEU A CA  1 
ATOM   1601  C  C   . LEU A  1 216 ? 25.830  -3.350  17.138  1.00 35.76  ? 216 LEU A C   1 
ATOM   1602  O  O   . LEU A  1 216 ? 26.149  -2.263  16.670  1.00 35.68  ? 216 LEU A O   1 
ATOM   1603  C  CB  . LEU A  1 216 ? 23.741  -3.258  18.471  1.00 29.05  ? 216 LEU A CB  1 
ATOM   1604  C  CG  . LEU A  1 216 ? 22.976  -3.437  19.776  1.00 34.78  ? 216 LEU A CG  1 
ATOM   1605  C  CD1 . LEU A  1 216 ? 21.511  -3.149  19.531  1.00 34.49  ? 216 LEU A CD1 1 
ATOM   1606  C  CD2 . LEU A  1 216 ? 23.165  -4.850  20.304  1.00 44.73  ? 216 LEU A CD2 1 
ATOM   1607  N  N   . ASN A  1 217 ? 25.932  -4.489  16.473  1.00 42.74  ? 217 ASN A N   1 
ATOM   1608  C  CA  . ASN A  1 217 ? 26.472  -4.579  15.129  1.00 51.89  ? 217 ASN A CA  1 
ATOM   1609  C  C   . ASN A  1 217 ? 25.410  -5.157  14.185  1.00 50.60  ? 217 ASN A C   1 
ATOM   1610  O  O   . ASN A  1 217 ? 24.794  -6.185  14.497  1.00 48.55  ? 217 ASN A O   1 
ATOM   1611  C  CB  . ASN A  1 217 ? 27.711  -5.477  15.163  1.00 61.58  ? 217 ASN A CB  1 
ATOM   1612  C  CG  . ASN A  1 217 ? 28.421  -5.548  13.834  1.00 68.08  ? 217 ASN A CG  1 
ATOM   1613  O  OD1 . ASN A  1 217 ? 27.804  -5.420  12.777  1.00 71.05  ? 217 ASN A OD1 1 
ATOM   1614  N  ND2 . ASN A  1 217 ? 29.733  -5.764  13.879  1.00 68.39  ? 217 ASN A ND2 1 
ATOM   1615  N  N   . TYR A  1 218 ? 25.195  -4.496  13.046  1.00 50.34  ? 218 TYR A N   1 
ATOM   1616  C  CA  . TYR A  1 218 ? 24.214  -4.947  12.047  1.00 52.40  ? 218 TYR A CA  1 
ATOM   1617  C  C   . TYR A  1 218 ? 24.404  -6.417  11.662  1.00 52.76  ? 218 TYR A C   1 
ATOM   1618  O  O   . TYR A  1 218 ? 23.461  -7.084  11.258  1.00 51.79  ? 218 TYR A O   1 
ATOM   1619  C  CB  . TYR A  1 218 ? 24.259  -4.075  10.780  1.00 58.72  ? 218 TYR A CB  1 
ATOM   1620  C  CG  . TYR A  1 218 ? 23.529  -2.733  10.877  1.00 69.11  ? 218 TYR A CG  1 
ATOM   1621  C  CD1 . TYR A  1 218 ? 22.159  -2.633  10.618  1.00 74.50  ? 218 TYR A CD1 1 
ATOM   1622  C  CD2 . TYR A  1 218 ? 24.215  -1.565  11.206  1.00 69.72  ? 218 TYR A CD2 1 
ATOM   1623  C  CE1 . TYR A  1 218 ? 21.490  -1.401  10.700  1.00 71.67  ? 218 TYR A CE1 1 
ATOM   1624  C  CE2 . TYR A  1 218 ? 23.559  -0.337  11.289  1.00 70.46  ? 218 TYR A CE2 1 
ATOM   1625  C  CZ  . TYR A  1 218 ? 22.198  -0.257  11.039  1.00 69.85  ? 218 TYR A CZ  1 
ATOM   1626  O  OH  . TYR A  1 218 ? 21.560  0.971   11.125  1.00 60.90  ? 218 TYR A OH  1 
ATOM   1627  N  N   . LYS A  1 219 ? 25.624  -6.918  11.809  1.00 50.17  ? 219 LYS A N   1 
ATOM   1628  C  CA  . LYS A  1 219 ? 25.952  -8.274  11.387  1.00 61.66  ? 219 LYS A CA  1 
ATOM   1629  C  C   . LYS A  1 219 ? 25.186  -9.354  12.154  1.00 63.29  ? 219 LYS A C   1 
ATOM   1630  O  O   . LYS A  1 219 ? 24.851  -10.396 11.599  1.00 65.28  ? 219 LYS A O   1 
ATOM   1631  C  CB  . LYS A  1 219 ? 27.459  -8.510  11.521  1.00 72.24  ? 219 LYS A CB  1 
ATOM   1632  C  CG  . LYS A  1 219 ? 28.307  -7.613  10.631  1.00 79.23  ? 219 LYS A CG  1 
ATOM   1633  C  CD  . LYS A  1 219 ? 29.781  -7.714  10.996  1.00 84.31  ? 219 LYS A CD  1 
ATOM   1634  C  CE  . LYS A  1 219 ? 30.604  -6.639  10.302  1.00 87.72  ? 219 LYS A CE  1 
ATOM   1635  N  NZ  . LYS A  1 219 ? 31.994  -6.583  10.841  1.00 89.41  ? 219 LYS A NZ  1 
ATOM   1636  N  N   . ASN A  1 220 ? 24.911  -9.102  13.427  1.00 57.74  ? 220 ASN A N   1 
ATOM   1637  C  CA  . ASN A  1 220 ? 24.330  -10.117 14.300  1.00 52.84  ? 220 ASN A CA  1 
ATOM   1638  C  C   . ASN A  1 220 ? 22.805  -10.166 14.303  1.00 53.45  ? 220 ASN A C   1 
ATOM   1639  O  O   . ASN A  1 220 ? 22.190  -10.616 15.271  1.00 58.09  ? 220 ASN A O   1 
ATOM   1640  C  CB  . ASN A  1 220 ? 24.856  -9.933  15.722  1.00 57.60  ? 220 ASN A CB  1 
ATOM   1641  C  CG  . ASN A  1 220 ? 26.376  -9.896  15.776  1.00 64.12  ? 220 ASN A CG  1 
ATOM   1642  O  OD1 . ASN A  1 220 ? 27.044  -10.812 15.302  1.00 72.03  ? 220 ASN A OD1 1 
ATOM   1643  N  ND2 . ASN A  1 220 ? 26.926  -8.837  16.354  1.00 61.68  ? 220 ASN A ND2 1 
ATOM   1644  N  N   . GLY A  1 221 ? 22.197  -9.716  13.212  1.00 51.01  ? 221 GLY A N   1 
ATOM   1645  C  CA  . GLY A  1 221 ? 20.747  -9.713  13.100  1.00 53.42  ? 221 GLY A CA  1 
ATOM   1646  C  C   . GLY A  1 221 ? 20.178  -8.312  12.935  1.00 49.88  ? 221 GLY A C   1 
ATOM   1647  O  O   . GLY A  1 221 ? 20.899  -7.318  13.040  1.00 46.28  ? 221 GLY A O   1 
ATOM   1648  N  N   . HIS A  1 222 ? 18.882  -8.219  12.668  1.00 51.90  ? 222 HIS A N   1 
ATOM   1649  C  CA  . HIS A  1 222 ? 18.306  -6.902  12.521  1.00 55.09  ? 222 HIS A CA  1 
ATOM   1650  C  C   . HIS A  1 222 ? 18.397  -6.147  13.833  1.00 47.77  ? 222 HIS A C   1 
ATOM   1651  O  O   . HIS A  1 222 ? 18.150  -6.701  14.920  1.00 40.00  ? 222 HIS A O   1 
ATOM   1652  C  CB  . HIS A  1 222 ? 16.878  -6.911  11.982  1.00 69.62  ? 222 HIS A CB  1 
ATOM   1653  C  CG  . HIS A  1 222 ? 16.513  -5.629  11.300  1.00 89.04  ? 222 HIS A CG  1 
ATOM   1654  N  ND1 . HIS A  1 222 ? 16.279  -4.460  11.994  1.00 93.74  ? 222 HIS A ND1 1 
ATOM   1655  C  CD2 . HIS A  1 222 ? 16.406  -5.315  9.987   1.00 95.22  ? 222 HIS A CD2 1 
ATOM   1656  C  CE1 . HIS A  1 222 ? 16.014  -3.488  11.139  1.00 96.22  ? 222 HIS A CE1 1 
ATOM   1657  N  NE2 . HIS A  1 222 ? 16.085  -3.980  9.915   1.00 97.07  ? 222 HIS A NE2 1 
ATOM   1658  N  N   . ILE A  1 223 ? 18.781  -4.881  13.711  1.00 38.99  ? 223 ILE A N   1 
ATOM   1659  C  CA  . ILE A  1 223 ? 19.031  -4.021  14.857  1.00 35.07  ? 223 ILE A CA  1 
ATOM   1660  C  C   . ILE A  1 223 ? 17.835  -3.995  15.797  1.00 34.04  ? 223 ILE A C   1 
ATOM   1661  O  O   . ILE A  1 223 ? 17.991  -4.022  17.016  1.00 33.83  ? 223 ILE A O   1 
ATOM   1662  C  CB  . ILE A  1 223 ? 19.373  -2.582  14.395  1.00 43.41  ? 223 ILE A CB  1 
ATOM   1663  C  CG1 . ILE A  1 223 ? 20.768  -2.558  13.785  1.00 48.01  ? 223 ILE A CG1 1 
ATOM   1664  C  CG2 . ILE A  1 223 ? 19.368  -1.636  15.562  1.00 45.12  ? 223 ILE A CG2 1 
ATOM   1665  C  CD1 . ILE A  1 223 ? 21.841  -3.016  14.772  1.00 46.06  ? 223 ILE A CD1 1 
ATOM   1666  N  N   . VAL A  1 224 ? 16.637  -3.937  15.223  1.00 28.32  ? 224 VAL A N   1 
ATOM   1667  C  CA  . VAL A  1 224 ? 15.419  -3.857  16.024  1.00 31.72  ? 224 VAL A CA  1 
ATOM   1668  C  C   . VAL A  1 224 ? 15.217  -5.100  16.903  1.00 36.68  ? 224 VAL A C   1 
ATOM   1669  O  O   . VAL A  1 224 ? 14.811  -4.989  18.065  1.00 39.31  ? 224 VAL A O   1 
ATOM   1670  C  CB  . VAL A  1 224 ? 14.172  -3.625  15.124  1.00 39.99  ? 224 VAL A CB  1 
ATOM   1671  C  CG1 . VAL A  1 224 ? 12.885  -3.708  15.943  1.00 39.48  ? 224 VAL A CG1 1 
ATOM   1672  C  CG2 . VAL A  1 224 ? 14.275  -2.271  14.409  1.00 35.85  ? 224 VAL A CG2 1 
ATOM   1673  N  N   . ASP A  1 225 ? 15.495  -6.278  16.344  1.00 37.09  ? 225 ASP A N   1 
ATOM   1674  C  CA  . ASP A  1 225 ? 15.412  -7.535  17.093  1.00 34.06  ? 225 ASP A CA  1 
ATOM   1675  C  C   . ASP A  1 225 ? 16.439  -7.524  18.217  1.00 32.11  ? 225 ASP A C   1 
ATOM   1676  O  O   . ASP A  1 225 ? 16.137  -7.856  19.366  1.00 34.69  ? 225 ASP A O   1 
ATOM   1677  C  CB  . ASP A  1 225 ? 15.681  -8.737  16.169  1.00 34.94  ? 225 ASP A CB  1 
ATOM   1678  C  CG  . ASP A  1 225 ? 14.588  -8.937  15.121  1.00 37.60  ? 225 ASP A CG  1 
ATOM   1679  O  OD1 . ASP A  1 225 ? 13.451  -8.491  15.351  1.00 43.33  ? 225 ASP A OD1 1 
ATOM   1680  O  OD2 . ASP A  1 225 ? 14.868  -9.544  14.068  1.00 48.36  ? 225 ASP A OD2 1 
ATOM   1681  N  N   . GLN A  1 226 ? 17.662  -7.140  17.871  1.00 29.40  ? 226 GLN A N   1 
ATOM   1682  C  CA  . GLN A  1 226 ? 18.727  -7.002  18.858  1.00 36.07  ? 226 GLN A CA  1 
ATOM   1683  C  C   . GLN A  1 226 ? 18.311  -6.095  20.017  1.00 39.90  ? 226 GLN A C   1 
ATOM   1684  O  O   . GLN A  1 226 ? 18.516  -6.441  21.183  1.00 37.32  ? 226 GLN A O   1 
ATOM   1685  C  CB  . GLN A  1 226 ? 20.000  -6.479  18.198  1.00 33.46  ? 226 GLN A CB  1 
ATOM   1686  C  CG  . GLN A  1 226 ? 20.540  -7.382  17.093  1.00 36.11  ? 226 GLN A CG  1 
ATOM   1687  C  CD  . GLN A  1 226 ? 22.010  -7.131  16.796  1.00 38.92  ? 226 GLN A CD  1 
ATOM   1688  O  OE1 . GLN A  1 226 ? 22.841  -7.181  17.691  1.00 42.85  ? 226 GLN A OE1 1 
ATOM   1689  N  NE2 . GLN A  1 226 ? 22.332  -6.860  15.535  1.00 39.44  ? 226 GLN A NE2 1 
ATOM   1690  N  N   . VAL A  1 227 ? 17.708  -4.947  19.701  1.00 30.29  ? 227 VAL A N   1 
ATOM   1691  C  CA  . VAL A  1 227 ? 17.300  -4.016  20.751  1.00 26.50  ? 227 VAL A CA  1 
ATOM   1692  C  C   . VAL A  1 227 ? 16.140  -4.603  21.544  1.00 29.87  ? 227 VAL A C   1 
ATOM   1693  O  O   . VAL A  1 227 ? 16.052  -4.427  22.756  1.00 32.04  ? 227 VAL A O   1 
ATOM   1694  C  CB  . VAL A  1 227 ? 16.916  -2.621  20.158  1.00 30.88  ? 227 VAL A CB  1 
ATOM   1695  C  CG1 . VAL A  1 227 ? 16.204  -1.748  21.191  1.00 28.33  ? 227 VAL A CG1 1 
ATOM   1696  C  CG2 . VAL A  1 227 ? 18.147  -1.918  19.629  1.00 24.76  ? 227 VAL A CG2 1 
ATOM   1697  N  N   . MET A  1 228 ? 15.236  -5.297  20.859  1.00 35.25  ? 228 MET A N   1 
ATOM   1698  C  CA  . MET A  1 228 ? 14.108  -5.914  21.552  1.00 37.07  ? 228 MET A CA  1 
ATOM   1699  C  C   . MET A  1 228 ? 14.639  -6.972  22.492  1.00 34.22  ? 228 MET A C   1 
ATOM   1700  O  O   . MET A  1 228 ? 14.092  -7.210  23.574  1.00 35.84  ? 228 MET A O   1 
ATOM   1701  C  CB  . MET A  1 228 ? 13.122  -6.557  20.571  1.00 33.95  ? 228 MET A CB  1 
ATOM   1702  C  CG  . MET A  1 228 ? 12.439  -5.568  19.634  1.00 41.96  ? 228 MET A CG  1 
ATOM   1703  S  SD  . MET A  1 228 ? 12.184  -3.939  20.353  1.00 67.16  ? 228 MET A SD  1 
ATOM   1704  C  CE  . MET A  1 228 ? 11.127  -4.350  21.692  1.00 19.44  ? 228 MET A CE  1 
ATOM   1705  N  N   . LYS A  1 229 ? 15.714  -7.613  22.061  1.00 26.97  ? 229 LYS A N   1 
ATOM   1706  C  CA  . LYS A  1 229 ? 16.364  -8.625  22.894  1.00 34.69  ? 229 LYS A CA  1 
ATOM   1707  C  C   . LYS A  1 229 ? 17.033  -8.011  24.131  1.00 39.03  ? 229 LYS A C   1 
ATOM   1708  O  O   . LYS A  1 229 ? 16.805  -8.467  25.246  1.00 38.05  ? 229 LYS A O   1 
ATOM   1709  C  CB  . LYS A  1 229 ? 17.381  -9.423  22.083  1.00 31.00  ? 229 LYS A CB  1 
ATOM   1710  C  CG  . LYS A  1 229 ? 18.166  -10.423 22.910  1.00 43.26  ? 229 LYS A CG  1 
ATOM   1711  C  CD  . LYS A  1 229 ? 19.135  -11.185 22.031  1.00 50.47  ? 229 LYS A CD  1 
ATOM   1712  C  CE  . LYS A  1 229 ? 20.062  -12.057 22.856  1.00 62.38  ? 229 LYS A CE  1 
ATOM   1713  N  NZ  . LYS A  1 229 ? 21.110  -12.671 22.000  1.00 69.00  ? 229 LYS A NZ  1 
ATOM   1714  N  N   . LEU A  1 230 ? 17.838  -6.965  23.937  1.00 39.34  ? 230 LEU A N   1 
ATOM   1715  C  CA  . LEU A  1 230 ? 18.498  -6.309  25.071  1.00 30.07  ? 230 LEU A CA  1 
ATOM   1716  C  C   . LEU A  1 230 ? 17.478  -5.784  26.060  1.00 28.13  ? 230 LEU A C   1 
ATOM   1717  O  O   . LEU A  1 230 ? 17.764  -5.661  27.245  1.00 31.16  ? 230 LEU A O   1 
ATOM   1718  C  CB  . LEU A  1 230 ? 19.380  -5.158  24.601  1.00 33.29  ? 230 LEU A CB  1 
ATOM   1719  C  CG  . LEU A  1 230 ? 20.648  -5.569  23.865  1.00 42.17  ? 230 LEU A CG  1 
ATOM   1720  C  CD1 . LEU A  1 230 ? 21.536  -4.352  23.596  1.00 37.86  ? 230 LEU A CD1 1 
ATOM   1721  C  CD2 . LEU A  1 230 ? 21.390  -6.618  24.674  1.00 42.92  ? 230 LEU A CD2 1 
ATOM   1722  N  N   . THR A  1 231 ? 16.277  -5.469  25.579  1.00 27.68  ? 231 THR A N   1 
ATOM   1723  C  CA  . THR A  1 231 ? 15.309  -4.802  26.443  1.00 30.24  ? 231 THR A CA  1 
ATOM   1724  C  C   . THR A  1 231 ? 14.094  -5.631  26.851  1.00 33.00  ? 231 THR A C   1 
ATOM   1725  O  O   . THR A  1 231 ? 13.099  -5.082  27.323  1.00 33.19  ? 231 THR A O   1 
ATOM   1726  C  CB  . THR A  1 231 ? 14.862  -3.438  25.832  1.00 38.57  ? 231 THR A CB  1 
ATOM   1727  O  OG1 . THR A  1 231 ? 14.191  -3.654  24.582  1.00 32.97  ? 231 THR A OG1 1 
ATOM   1728  C  CG2 . THR A  1 231 ? 16.096  -2.533  25.604  1.00 32.25  ? 231 THR A CG2 1 
ATOM   1729  N  N   . ASN A  1 232 ? 14.184  -6.952  26.704  1.00 40.98  ? 232 ASN A N   1 
ATOM   1730  C  CA  . ASN A  1 232 ? 13.057  -7.827  27.017  1.00 36.18  ? 232 ASN A CA  1 
ATOM   1731  C  C   . ASN A  1 232 ? 11.805  -7.396  26.269  1.00 32.49  ? 232 ASN A C   1 
ATOM   1732  O  O   . ASN A  1 232 ? 10.701  -7.380  26.820  1.00 33.66  ? 232 ASN A O   1 
ATOM   1733  C  CB  . ASN A  1 232 ? 12.783  -7.881  28.526  1.00 39.65  ? 232 ASN A CB  1 
ATOM   1734  C  CG  . ASN A  1 232 ? 11.831  -9.035  28.918  1.00 56.36  ? 232 ASN A CG  1 
ATOM   1735  O  OD1 . ASN A  1 232 ? 10.984  -8.886  29.806  1.00 62.56  ? 232 ASN A OD1 1 
ATOM   1736  N  ND2 . ASN A  1 232 ? 11.974  -10.185 28.248  1.00 42.43  ? 232 ASN A ND2 1 
ATOM   1737  N  N   . GLY A  1 233 ? 11.993  -7.018  25.015  1.00 32.92  ? 233 GLY A N   1 
ATOM   1738  C  CA  . GLY A  1 233 ? 10.884  -6.643  24.159  1.00 37.87  ? 233 GLY A CA  1 
ATOM   1739  C  C   . GLY A  1 233 ? 10.241  -5.305  24.484  1.00 38.13  ? 233 GLY A C   1 
ATOM   1740  O  O   . GLY A  1 233 ? 9.227   -4.940  23.897  1.00 33.46  ? 233 GLY A O   1 
ATOM   1741  N  N   . LYS A  1 234 ? 10.832  -4.556  25.405  1.00 38.75  ? 234 LYS A N   1 
ATOM   1742  C  CA  . LYS A  1 234 ? 10.193  -3.335  25.865  1.00 38.11  ? 234 LYS A CA  1 
ATOM   1743  C  C   . LYS A  1 234 ? 10.596  -2.096  25.068  1.00 38.53  ? 234 LYS A C   1 
ATOM   1744  O  O   . LYS A  1 234 ? 9.920   -1.078  25.130  1.00 33.46  ? 234 LYS A O   1 
ATOM   1745  C  CB  . LYS A  1 234 ? 10.385  -3.153  27.369  1.00 44.05  ? 234 LYS A CB  1 
ATOM   1746  C  CG  . LYS A  1 234 ? 9.622   -4.215  28.178  1.00 56.99  ? 234 LYS A CG  1 
ATOM   1747  C  CD  . LYS A  1 234 ? 10.225  -4.434  29.559  1.00 72.59  ? 234 LYS A CD  1 
ATOM   1748  C  CE  . LYS A  1 234 ? 9.578   -5.631  30.281  1.00 78.61  ? 234 LYS A CE  1 
ATOM   1749  N  NZ  . LYS A  1 234 ? 10.330  -6.019  31.523  1.00 72.85  ? 234 LYS A NZ  1 
ATOM   1750  N  N   . GLY A  1 235 ? 11.660  -2.213  24.281  1.00 33.38  ? 235 GLY A N   1 
ATOM   1751  C  CA  . GLY A  1 235 ? 12.153  -1.095  23.511  1.00 29.77  ? 235 GLY A CA  1 
ATOM   1752  C  C   . GLY A  1 235 ? 12.804  -0.064  24.426  1.00 35.44  ? 235 GLY A C   1 
ATOM   1753  O  O   . GLY A  1 235 ? 12.963  -0.301  25.635  1.00 27.75  ? 235 GLY A O   1 
ATOM   1754  N  N   . VAL A  1 236 ? 13.161  1.082   23.847  1.00 26.67  ? 236 VAL A N   1 
ATOM   1755  C  CA  . VAL A  1 236 ? 13.907  2.117   24.560  1.00 30.39  ? 236 VAL A CA  1 
ATOM   1756  C  C   . VAL A  1 236 ? 13.174  3.455   24.617  1.00 28.32  ? 236 VAL A C   1 
ATOM   1757  O  O   . VAL A  1 236 ? 12.246  3.709   23.840  1.00 26.30  ? 236 VAL A O   1 
ATOM   1758  C  CB  . VAL A  1 236 ? 15.285  2.332   23.936  1.00 25.42  ? 236 VAL A CB  1 
ATOM   1759  C  CG1 . VAL A  1 236 ? 16.117  1.028   24.033  1.00 24.99  ? 236 VAL A CG1 1 
ATOM   1760  C  CG2 . VAL A  1 236 ? 15.150  2.786   22.502  1.00 21.49  ? 236 VAL A CG2 1 
ATOM   1761  N  N   . ASP A  1 237 ? 13.598  4.317   25.543  1.00 27.81  ? 237 ASP A N   1 
ATOM   1762  C  CA  . ASP A  1 237 ? 12.887  5.570   25.764  1.00 24.91  ? 237 ASP A CA  1 
ATOM   1763  C  C   . ASP A  1 237 ? 13.105  6.564   24.645  1.00 22.29  ? 237 ASP A C   1 
ATOM   1764  O  O   . ASP A  1 237 ? 12.186  7.315   24.301  1.00 25.39  ? 237 ASP A O   1 
ATOM   1765  C  CB  . ASP A  1 237 ? 13.284  6.179   27.112  1.00 26.54  ? 237 ASP A CB  1 
ATOM   1766  C  CG  . ASP A  1 237 ? 12.817  5.336   28.267  1.00 31.93  ? 237 ASP A CG  1 
ATOM   1767  O  OD1 . ASP A  1 237 ? 11.589  5.127   28.369  1.00 31.98  ? 237 ASP A OD1 1 
ATOM   1768  O  OD2 . ASP A  1 237 ? 13.668  4.857   29.049  1.00 34.01  ? 237 ASP A OD2 1 
ATOM   1769  N  N   . ARG A  1 238 ? 14.318  6.574   24.085  1.00 22.15  ? 238 ARG A N   1 
ATOM   1770  C  CA  . ARG A  1 238 ? 14.727  7.606   23.128  1.00 26.08  ? 238 ARG A CA  1 
ATOM   1771  C  C   . ARG A  1 238 ? 15.653  7.015   22.080  1.00 23.99  ? 238 ARG A C   1 
ATOM   1772  O  O   . ARG A  1 238 ? 16.421  6.098   22.380  1.00 24.23  ? 238 ARG A O   1 
ATOM   1773  C  CB  . ARG A  1 238 ? 15.482  8.747   23.849  1.00 23.55  ? 238 ARG A CB  1 
ATOM   1774  C  CG  . ARG A  1 238 ? 14.681  9.464   24.906  1.00 26.94  ? 238 ARG A CG  1 
ATOM   1775  C  CD  . ARG A  1 238 ? 13.502  10.194  24.302  1.00 20.86  ? 238 ARG A CD  1 
ATOM   1776  N  NE  . ARG A  1 238 ? 12.891  11.061  25.291  1.00 24.35  ? 238 ARG A NE  1 
ATOM   1777  C  CZ  . ARG A  1 238 ? 11.889  10.714  26.085  1.00 25.87  ? 238 ARG A CZ  1 
ATOM   1778  N  NH1 . ARG A  1 238 ? 11.355  9.497   26.015  1.00 28.14  ? 238 ARG A NH1 1 
ATOM   1779  N  NH2 . ARG A  1 238 ? 11.421  11.591  26.958  1.00 23.42  ? 238 ARG A NH2 1 
ATOM   1780  N  N   . VAL A  1 239 ? 15.584  7.534   20.857  1.00 23.84  ? 239 VAL A N   1 
ATOM   1781  C  CA  . VAL A  1 239 ? 16.569  7.180   19.832  1.00 24.07  ? 239 VAL A CA  1 
ATOM   1782  C  C   . VAL A  1 239 ? 17.140  8.437   19.224  1.00 19.80  ? 239 VAL A C   1 
ATOM   1783  O  O   . VAL A  1 239 ? 16.415  9.371   18.946  1.00 28.39  ? 239 VAL A O   1 
ATOM   1784  C  CB  . VAL A  1 239 ? 15.971  6.381   18.676  1.00 27.92  ? 239 VAL A CB  1 
ATOM   1785  C  CG1 . VAL A  1 239 ? 17.070  6.087   17.620  1.00 20.46  ? 239 VAL A CG1 1 
ATOM   1786  C  CG2 . VAL A  1 239 ? 15.351  5.087   19.180  1.00 26.10  ? 239 VAL A CG2 1 
ATOM   1787  N  N   . ILE A  1 240 ? 18.450  8.456   19.037  1.00 25.47  ? 240 ILE A N   1 
ATOM   1788  C  CA  . ILE A  1 240 ? 19.106  9.564   18.381  1.00 25.65  ? 240 ILE A CA  1 
ATOM   1789  C  C   . ILE A  1 240 ? 19.643  9.012   17.091  1.00 27.62  ? 240 ILE A C   1 
ATOM   1790  O  O   . ILE A  1 240 ? 20.364  8.021   17.098  1.00 25.73  ? 240 ILE A O   1 
ATOM   1791  C  CB  . ILE A  1 240 ? 20.296  10.108  19.224  1.00 28.08  ? 240 ILE A CB  1 
ATOM   1792  C  CG1 . ILE A  1 240 ? 19.803  10.622  20.579  1.00 31.67  ? 240 ILE A CG1 1 
ATOM   1793  C  CG2 . ILE A  1 240 ? 21.029  11.207  18.465  1.00 23.51  ? 240 ILE A CG2 1 
ATOM   1794  C  CD1 . ILE A  1 240 ? 20.908  11.250  21.466  1.00 27.62  ? 240 ILE A CD1 1 
ATOM   1795  N  N   . MET A  1 241 ? 19.275  9.635   15.982  1.00 25.64  ? 241 MET A N   1 
ATOM   1796  C  CA  . MET A  1 241 ? 19.718  9.179   14.673  1.00 27.19  ? 241 MET A CA  1 
ATOM   1797  C  C   . MET A  1 241 ? 20.882  10.039  14.245  1.00 27.33  ? 241 MET A C   1 
ATOM   1798  O  O   . MET A  1 241 ? 20.721  11.239  14.022  1.00 30.14  ? 241 MET A O   1 
ATOM   1799  C  CB  . MET A  1 241 ? 18.580  9.272   13.646  1.00 24.76  ? 241 MET A CB  1 
ATOM   1800  C  CG  . MET A  1 241 ? 17.427  8.294   13.886  1.00 25.62  ? 241 MET A CG  1 
ATOM   1801  S  SD  . MET A  1 241 ? 15.917  8.704   12.937  1.00 34.28  ? 241 MET A SD  1 
ATOM   1802  C  CE  . MET A  1 241 ? 16.557  8.740   11.266  1.00 35.59  ? 241 MET A CE  1 
ATOM   1803  N  N   . ALA A  1 242 ? 22.056  9.428   14.136  1.00 26.78  ? 242 ALA A N   1 
ATOM   1804  C  CA  . ALA A  1 242 ? 23.298  10.180  13.956  1.00 30.39  ? 242 ALA A CA  1 
ATOM   1805  C  C   . ALA A  1 242 ? 24.112  9.651   12.789  1.00 36.26  ? 242 ALA A C   1 
ATOM   1806  O  O   . ALA A  1 242 ? 25.268  10.018  12.618  1.00 43.02  ? 242 ALA A O   1 
ATOM   1807  C  CB  . ALA A  1 242 ? 24.143  10.120  15.238  1.00 25.05  ? 242 ALA A CB  1 
ATOM   1808  N  N   . GLY A  1 243 ? 23.521  8.754   12.016  1.00 39.67  ? 243 GLY A N   1 
ATOM   1809  C  CA  . GLY A  1 243 ? 24.197  8.165   10.874  1.00 43.07  ? 243 GLY A CA  1 
ATOM   1810  C  C   . GLY A  1 243 ? 23.391  7.013   10.307  1.00 45.10  ? 243 GLY A C   1 
ATOM   1811  O  O   . GLY A  1 243 ? 22.392  6.596   10.901  1.00 41.54  ? 243 GLY A O   1 
ATOM   1812  N  N   . GLY A  1 244 ? 23.822  6.500   9.156   1.00 51.12  ? 244 GLY A N   1 
ATOM   1813  C  CA  . GLY A  1 244 ? 23.089  5.457   8.453   1.00 49.66  ? 244 GLY A CA  1 
ATOM   1814  C  C   . GLY A  1 244 ? 22.233  6.075   7.360   1.00 55.37  ? 244 GLY A C   1 
ATOM   1815  O  O   . GLY A  1 244 ? 22.242  7.302   7.170   1.00 55.54  ? 244 GLY A O   1 
ATOM   1816  N  N   . GLY A  1 245 ? 21.503  5.229   6.637   1.00 54.33  ? 245 GLY A N   1 
ATOM   1817  C  CA  . GLY A  1 245 ? 20.578  5.691   5.625   1.00 56.32  ? 245 GLY A CA  1 
ATOM   1818  C  C   . GLY A  1 245 ? 19.240  6.041   6.244   1.00 63.15  ? 245 GLY A C   1 
ATOM   1819  O  O   . GLY A  1 245 ? 19.074  5.994   7.463   1.00 61.19  ? 245 GLY A O   1 
ATOM   1820  N  N   . SER A  1 246 ? 18.277  6.388   5.401   1.00 70.86  ? 246 SER A N   1 
ATOM   1821  C  CA  . SER A  1 246 ? 16.965  6.807   5.878   1.00 75.24  ? 246 SER A CA  1 
ATOM   1822  C  C   . SER A  1 246 ? 16.152  5.673   6.515   1.00 76.66  ? 246 SER A C   1 
ATOM   1823  O  O   . SER A  1 246 ? 15.264  5.935   7.326   1.00 83.05  ? 246 SER A O   1 
ATOM   1824  C  CB  . SER A  1 246 ? 16.175  7.478   4.750   1.00 81.07  ? 246 SER A CB  1 
ATOM   1825  O  OG  . SER A  1 246 ? 16.164  6.679   3.578   1.00 84.74  ? 246 SER A OG  1 
ATOM   1826  N  N   . GLU A  1 247 ? 16.458  4.423   6.154   1.00 68.96  ? 247 GLU A N   1 
ATOM   1827  C  CA  . GLU A  1 247 ? 15.798  3.240   6.739   1.00 53.48  ? 247 GLU A CA  1 
ATOM   1828  C  C   . GLU A  1 247 ? 16.001  3.191   8.259   1.00 38.35  ? 247 GLU A C   1 
ATOM   1829  O  O   . GLU A  1 247 ? 15.359  2.434   9.006   1.00 31.22  ? 247 GLU A O   1 
ATOM   1830  C  CB  . GLU A  1 247 ? 16.325  1.960   6.089   1.00 52.32  ? 247 GLU A CB  1 
ATOM   1831  C  CG  . GLU A  1 247 ? 17.807  1.680   6.334   1.00 61.93  ? 247 GLU A CG  1 
ATOM   1832  C  CD  . GLU A  1 247 ? 18.720  2.564   5.500   1.00 72.59  ? 247 GLU A CD  1 
ATOM   1833  O  OE1 . GLU A  1 247 ? 18.230  3.196   4.536   1.00 76.10  ? 247 GLU A OE1 1 
ATOM   1834  O  OE2 . GLU A  1 247 ? 19.930  2.623   5.811   1.00 76.93  ? 247 GLU A OE2 1 
ATOM   1835  N  N   . THR A  1 248 ? 16.923  4.016   8.708   1.00 33.14  ? 248 THR A N   1 
ATOM   1836  C  CA  . THR A  1 248 ? 17.175  4.164   10.122  1.00 33.88  ? 248 THR A CA  1 
ATOM   1837  C  C   . THR A  1 248 ? 15.959  4.720   10.860  1.00 35.12  ? 248 THR A C   1 
ATOM   1838  O  O   . THR A  1 248 ? 15.723  4.377   12.018  1.00 38.49  ? 248 THR A O   1 
ATOM   1839  C  CB  . THR A  1 248 ? 18.395  5.049   10.323  1.00 42.41  ? 248 THR A CB  1 
ATOM   1840  O  OG1 . THR A  1 248 ? 19.570  4.266   10.027  1.00 44.69  ? 248 THR A OG1 1 
ATOM   1841  C  CG2 . THR A  1 248 ? 18.446  5.541   11.740  1.00 48.38  ? 248 THR A CG2 1 
ATOM   1842  N  N   . LEU A  1 249 ? 15.177  5.564   10.185  1.00 29.03  ? 249 LEU A N   1 
ATOM   1843  C  CA  . LEU A  1 249 ? 14.005  6.163   10.811  1.00 25.51  ? 249 LEU A CA  1 
ATOM   1844  C  C   . LEU A  1 249 ? 12.985  5.098   11.169  1.00 27.05  ? 249 LEU A C   1 
ATOM   1845  O  O   . LEU A  1 249 ? 12.425  5.093   12.267  1.00 33.44  ? 249 LEU A O   1 
ATOM   1846  C  CB  . LEU A  1 249 ? 13.370  7.217   9.889   1.00 29.24  ? 249 LEU A CB  1 
ATOM   1847  C  CG  . LEU A  1 249 ? 12.047  7.818   10.377  1.00 36.63  ? 249 LEU A CG  1 
ATOM   1848  C  CD1 . LEU A  1 249 ? 12.203  8.461   11.767  1.00 28.19  ? 249 LEU A CD1 1 
ATOM   1849  C  CD2 . LEU A  1 249 ? 11.495  8.833   9.378   1.00 37.85  ? 249 LEU A CD2 1 
ATOM   1850  N  N   . SER A  1 250 ? 12.737  4.187   10.236  1.00 27.87  ? 250 SER A N   1 
ATOM   1851  C  CA  . SER A  1 250 ? 11.819  3.093   10.493  1.00 34.40  ? 250 SER A CA  1 
ATOM   1852  C  C   . SER A  1 250 ? 12.325  2.207   11.634  1.00 27.60  ? 250 SER A C   1 
ATOM   1853  O  O   . SER A  1 250 ? 11.560  1.795   12.515  1.00 31.22  ? 250 SER A O   1 
ATOM   1854  C  CB  . SER A  1 250 ? 11.604  2.244   9.233   1.00 35.90  ? 250 SER A CB  1 
ATOM   1855  O  OG  . SER A  1 250 ? 10.743  1.160   9.535   1.00 30.90  ? 250 SER A OG  1 
ATOM   1856  N  N   . GLN A  1 251 ? 13.616  1.910   11.610  1.00 28.68  ? 251 GLN A N   1 
ATOM   1857  C  CA  . GLN A  1 251 ? 14.248  1.211   12.729  1.00 28.20  ? 251 GLN A CA  1 
ATOM   1858  C  C   . GLN A  1 251 ? 13.990  1.937   14.043  1.00 31.86  ? 251 GLN A C   1 
ATOM   1859  O  O   . GLN A  1 251 ? 13.670  1.296   15.057  1.00 25.62  ? 251 GLN A O   1 
ATOM   1860  C  CB  . GLN A  1 251 ? 15.755  1.095   12.495  1.00 34.59  ? 251 GLN A CB  1 
ATOM   1861  C  CG  . GLN A  1 251 ? 16.119  0.137   11.362  1.00 46.02  ? 251 GLN A CG  1 
ATOM   1862  C  CD  . GLN A  1 251 ? 17.571  0.277   10.905  1.00 55.83  ? 251 GLN A CD  1 
ATOM   1863  O  OE1 . GLN A  1 251 ? 18.359  1.023   11.492  1.00 51.29  ? 251 GLN A OE1 1 
ATOM   1864  N  NE2 . GLN A  1 251 ? 17.925  -0.446  9.850   1.00 60.03  ? 251 GLN A NE2 1 
ATOM   1865  N  N   . ALA A  1 252 ? 14.116  3.272   14.025  1.00 22.40  ? 252 ALA A N   1 
ATOM   1866  C  CA  . ALA A  1 252 ? 14.020  4.034   15.271  1.00 28.74  ? 252 ALA A CA  1 
ATOM   1867  C  C   . ALA A  1 252 ? 12.603  3.976   15.810  1.00 28.80  ? 252 ALA A C   1 
ATOM   1868  O  O   . ALA A  1 252 ? 12.390  3.825   17.011  1.00 30.74  ? 252 ALA A O   1 
ATOM   1869  C  CB  . ALA A  1 252 ? 14.477  5.482   15.080  1.00 25.18  ? 252 ALA A CB  1 
ATOM   1870  N  N   . VAL A  1 253 ? 11.633  4.063   14.906  1.00 25.96  ? 253 VAL A N   1 
ATOM   1871  C  CA  . VAL A  1 253 ? 10.225  3.990   15.289  1.00 29.45  ? 253 VAL A CA  1 
ATOM   1872  C  C   . VAL A  1 253 ? 9.861   2.627   15.858  1.00 28.76  ? 253 VAL A C   1 
ATOM   1873  O  O   . VAL A  1 253 ? 9.100   2.524   16.825  1.00 27.59  ? 253 VAL A O   1 
ATOM   1874  C  CB  . VAL A  1 253 ? 9.300   4.285   14.093  1.00 32.73  ? 253 VAL A CB  1 
ATOM   1875  C  CG1 . VAL A  1 253 ? 7.849   4.033   14.474  1.00 33.15  ? 253 VAL A CG1 1 
ATOM   1876  C  CG2 . VAL A  1 253 ? 9.490   5.730   13.621  1.00 32.64  ? 253 VAL A CG2 1 
ATOM   1877  N  N   . LYS A  1 254 ? 10.412  1.575   15.265  1.00 23.76  ? 254 LYS A N   1 
ATOM   1878  C  CA  . LYS A  1 254 ? 10.106  0.220   15.741  1.00 31.02  ? 254 LYS A CA  1 
ATOM   1879  C  C   . LYS A  1 254 ? 10.754  -0.051  17.093  1.00 35.14  ? 254 LYS A C   1 
ATOM   1880  O  O   . LYS A  1 254 ? 10.218  -0.763  17.941  1.00 32.40  ? 254 LYS A O   1 
ATOM   1881  C  CB  . LYS A  1 254 ? 10.551  -0.812  14.705  1.00 27.51  ? 254 LYS A CB  1 
ATOM   1882  C  CG  . LYS A  1 254 ? 9.673   -0.786  13.436  1.00 33.05  ? 254 LYS A CG  1 
ATOM   1883  C  CD  . LYS A  1 254 ? 10.298  -1.580  12.303  1.00 38.73  ? 254 LYS A CD  1 
ATOM   1884  C  CE  . LYS A  1 254 ? 9.357   -1.665  11.114  1.00 45.83  ? 254 LYS A CE  1 
ATOM   1885  N  NZ  . LYS A  1 254 ? 9.965   -2.445  10.000  1.00 46.10  ? 254 LYS A NZ  1 
ATOM   1886  N  N   . MET A  1 255 ? 11.907  0.571   17.277  1.00 33.48  ? 255 MET A N   1 
ATOM   1887  C  CA  . MET A  1 255 ? 12.743  0.440   18.457  1.00 38.77  ? 255 MET A CA  1 
ATOM   1888  C  C   . MET A  1 255 ? 12.191  1.186   19.689  1.00 35.76  ? 255 MET A C   1 
ATOM   1889  O  O   . MET A  1 255 ? 12.331  0.708   20.819  1.00 30.04  ? 255 MET A O   1 
ATOM   1890  C  CB  . MET A  1 255 ? 14.078  1.054   18.063  1.00 44.19  ? 255 MET A CB  1 
ATOM   1891  C  CG  . MET A  1 255 ? 15.251  0.733   18.874  1.00 48.82  ? 255 MET A CG  1 
ATOM   1892  S  SD  . MET A  1 255 ? 16.586  1.559   18.016  1.00 36.24  ? 255 MET A SD  1 
ATOM   1893  C  CE  . MET A  1 255 ? 16.794  0.499   16.589  1.00 24.99  ? 255 MET A CE  1 
ATOM   1894  N  N   . VAL A  1 256 ? 11.593  2.366   19.482  1.00 26.90  ? 256 VAL A N   1 
ATOM   1895  C  CA  . VAL A  1 256 ? 11.238  3.235   20.616  1.00 24.48  ? 256 VAL A CA  1 
ATOM   1896  C  C   . VAL A  1 256 ? 9.881   2.890   21.208  1.00 29.23  ? 256 VAL A C   1 
ATOM   1897  O  O   . VAL A  1 256 ? 8.983   2.467   20.482  1.00 29.11  ? 256 VAL A O   1 
ATOM   1898  C  CB  . VAL A  1 256 ? 11.181  4.753   20.237  1.00 38.88  ? 256 VAL A CB  1 
ATOM   1899  C  CG1 . VAL A  1 256 ? 12.477  5.209   19.696  1.00 54.45  ? 256 VAL A CG1 1 
ATOM   1900  C  CG2 . VAL A  1 256 ? 10.033  5.063   19.219  1.00 19.80  ? 256 VAL A CG2 1 
ATOM   1901  N  N   . LYS A  1 257 ? 9.727   3.125   22.508  1.00 24.81  ? 257 LYS A N   1 
ATOM   1902  C  CA  . LYS A  1 257 ? 8.433   2.999   23.171  1.00 30.64  ? 257 LYS A CA  1 
ATOM   1903  C  C   . LYS A  1 257 ? 7.413   4.022   22.683  1.00 36.47  ? 257 LYS A C   1 
ATOM   1904  O  O   . LYS A  1 257 ? 7.775   5.106   22.236  1.00 30.01  ? 257 LYS A O   1 
ATOM   1905  C  CB  . LYS A  1 257 ? 8.594   3.225   24.669  1.00 29.33  ? 257 LYS A CB  1 
ATOM   1906  C  CG  . LYS A  1 257 ? 9.478   2.204   25.363  1.00 30.02  ? 257 LYS A CG  1 
ATOM   1907  C  CD  . LYS A  1 257 ? 9.786   2.667   26.776  1.00 26.02  ? 257 LYS A CD  1 
ATOM   1908  C  CE  . LYS A  1 257 ? 10.902  1.823   27.389  1.00 30.94  ? 257 LYS A CE  1 
ATOM   1909  N  NZ  . LYS A  1 257 ? 11.143  2.249   28.762  1.00 32.32  ? 257 LYS A NZ  1 
ATOM   1910  N  N   . PRO A  1 258 ? 6.124   3.682   22.804  1.00 34.28  ? 258 PRO A N   1 
ATOM   1911  C  CA  . PRO A  1 258 ? 5.076   4.692   22.646  1.00 33.16  ? 258 PRO A CA  1 
ATOM   1912  C  C   . PRO A  1 258 ? 5.305   5.789   23.686  1.00 36.12  ? 258 PRO A C   1 
ATOM   1913  O  O   . PRO A  1 258 ? 5.682   5.501   24.827  1.00 28.39  ? 258 PRO A O   1 
ATOM   1914  C  CB  . PRO A  1 258 ? 3.788   3.917   22.957  1.00 34.42  ? 258 PRO A CB  1 
ATOM   1915  C  CG  . PRO A  1 258 ? 4.170   2.429   22.812  1.00 32.82  ? 258 PRO A CG  1 
ATOM   1916  C  CD  . PRO A  1 258 ? 5.596   2.374   23.245  1.00 30.25  ? 258 PRO A CD  1 
ATOM   1917  N  N   . GLY A  1 259 ? 5.092   7.040   23.297  1.00 29.29  ? 259 GLY A N   1 
ATOM   1918  C  CA  . GLY A  1 259 ? 5.417   8.149   24.180  1.00 29.70  ? 259 GLY A CA  1 
ATOM   1919  C  C   . GLY A  1 259 ? 6.884   8.509   24.108  1.00 31.19  ? 259 GLY A C   1 
ATOM   1920  O  O   . GLY A  1 259 ? 7.346   9.422   24.797  1.00 30.61  ? 259 GLY A O   1 
ATOM   1921  N  N   . GLY A  1 260 ? 7.627   7.787   23.273  1.00 24.51  ? 260 GLY A N   1 
ATOM   1922  C  CA  . GLY A  1 260 ? 9.048   8.032   23.159  1.00 22.80  ? 260 GLY A CA  1 
ATOM   1923  C  C   . GLY A  1 260 ? 9.342   9.179   22.231  1.00 27.21  ? 260 GLY A C   1 
ATOM   1924  O  O   . GLY A  1 260 ? 8.429   9.783   21.657  1.00 26.44  ? 260 GLY A O   1 
ATOM   1925  N  N   . ILE A  1 261 ? 10.626  9.476   22.065  1.00 24.12  ? 261 ILE A N   1 
ATOM   1926  C  CA  . ILE A  1 261 ? 11.045  10.526  21.148  1.00 28.03  ? 261 ILE A CA  1 
ATOM   1927  C  C   . ILE A  1 261 ? 12.196  10.036  20.284  1.00 29.63  ? 261 ILE A C   1 
ATOM   1928  O  O   . ILE A  1 261 ? 13.086  9.332   20.763  1.00 25.38  ? 261 ILE A O   1 
ATOM   1929  C  CB  . ILE A  1 261 ? 11.474  11.826  21.903  1.00 27.25  ? 261 ILE A CB  1 
ATOM   1930  C  CG1 . ILE A  1 261 ? 10.334  12.338  22.789  1.00 34.30  ? 261 ILE A CG1 1 
ATOM   1931  C  CG2 . ILE A  1 261 ? 11.907  12.874  20.921  1.00 13.23  ? 261 ILE A CG2 1 
ATOM   1932  C  CD1 . ILE A  1 261 ? 10.632  13.635  23.529  1.00 34.47  ? 261 ILE A CD1 1 
ATOM   1933  N  N   . ILE A  1 262 ? 12.164  10.410  19.011  1.00 26.93  ? 262 ILE A N   1 
ATOM   1934  C  CA  . ILE A  1 262 ? 13.214  10.067  18.058  1.00 25.62  ? 262 ILE A CA  1 
ATOM   1935  C  C   . ILE A  1 262 ? 13.819  11.385  17.626  1.00 31.88  ? 262 ILE A C   1 
ATOM   1936  O  O   . ILE A  1 262 ? 13.102  12.272  17.136  1.00 27.77  ? 262 ILE A O   1 
ATOM   1937  C  CB  . ILE A  1 262 ? 12.642  9.376   16.798  1.00 32.94  ? 262 ILE A CB  1 
ATOM   1938  C  CG1 . ILE A  1 262 ? 12.071  7.997   17.141  1.00 37.83  ? 262 ILE A CG1 1 
ATOM   1939  C  CG2 . ILE A  1 262 ? 13.700  9.249   15.713  1.00 24.19  ? 262 ILE A CG2 1 
ATOM   1940  C  CD1 . ILE A  1 262 ? 10.987  7.545   16.177  1.00 36.29  ? 262 ILE A CD1 1 
ATOM   1941  N  N   . SER A  1 263 ? 15.129  11.527  17.819  1.00 23.93  ? 263 SER A N   1 
ATOM   1942  C  CA  . SER A  1 263 ? 15.794  12.778  17.516  1.00 27.08  ? 263 SER A CA  1 
ATOM   1943  C  C   . SER A  1 263 ? 16.782  12.594  16.374  1.00 24.80  ? 263 SER A C   1 
ATOM   1944  O  O   . SER A  1 263 ? 17.779  11.898  16.525  1.00 30.29  ? 263 SER A O   1 
ATOM   1945  C  CB  . SER A  1 263 ? 16.496  13.300  18.782  1.00 28.16  ? 263 SER A CB  1 
ATOM   1946  O  OG  . SER A  1 263 ? 17.619  14.087  18.473  1.00 35.35  ? 263 SER A OG  1 
ATOM   1947  N  N   . ASN A  1 264 ? 16.530  13.228  15.236  1.00 25.86  ? 264 ASN A N   1 
ATOM   1948  C  CA  . ASN A  1 264 ? 17.477  13.108  14.126  1.00 26.03  ? 264 ASN A CA  1 
ATOM   1949  C  C   . ASN A  1 264 ? 18.457  14.259  14.054  1.00 27.42  ? 264 ASN A C   1 
ATOM   1950  O  O   . ASN A  1 264 ? 18.069  15.411  14.131  1.00 32.10  ? 264 ASN A O   1 
ATOM   1951  C  CB  . ASN A  1 264 ? 16.777  13.020  12.775  1.00 22.86  ? 264 ASN A CB  1 
ATOM   1952  C  CG  . ASN A  1 264 ? 17.763  12.966  11.636  1.00 28.56  ? 264 ASN A CG  1 
ATOM   1953  O  OD1 . ASN A  1 264 ? 18.254  11.895  11.273  1.00 30.16  ? 264 ASN A OD1 1 
ATOM   1954  N  ND2 . ASN A  1 264 ? 18.082  14.128  11.076  1.00 27.79  ? 264 ASN A ND2 1 
ATOM   1955  N  N   . ILE A  1 265 ? 19.725  13.946  13.856  1.00 26.55  ? 265 ILE A N   1 
ATOM   1956  C  CA  . ILE A  1 265 ? 20.717  14.985  13.623  1.00 28.27  ? 265 ILE A CA  1 
ATOM   1957  C  C   . ILE A  1 265 ? 21.534  14.624  12.408  1.00 32.85  ? 265 ILE A C   1 
ATOM   1958  O  O   . ILE A  1 265 ? 22.398  15.391  11.968  1.00 37.74  ? 265 ILE A O   1 
ATOM   1959  C  CB  . ILE A  1 265 ? 21.662  15.163  14.826  1.00 30.08  ? 265 ILE A CB  1 
ATOM   1960  C  CG1 . ILE A  1 265 ? 22.139  13.791  15.347  1.00 30.45  ? 265 ILE A CG1 1 
ATOM   1961  C  CG2 . ILE A  1 265 ? 20.978  15.983  15.909  1.00 26.41  ? 265 ILE A CG2 1 
ATOM   1962  C  CD1 . ILE A  1 265 ? 23.074  13.878  16.556  1.00 32.48  ? 265 ILE A CD1 1 
ATOM   1963  N  N   . ASN A  1 266 ? 21.262  13.434  11.885  1.00 32.24  ? 266 ASN A N   1 
ATOM   1964  C  CA  . ASN A  1 266 ? 21.864  12.963  10.652  1.00 29.40  ? 266 ASN A CA  1 
ATOM   1965  C  C   . ASN A  1 266 ? 21.503  13.847  9.457   1.00 41.98  ? 266 ASN A C   1 
ATOM   1966  O  O   . ASN A  1 266 ? 20.351  14.290  9.297   1.00 37.64  ? 266 ASN A O   1 
ATOM   1967  C  CB  . ASN A  1 266 ? 21.404  11.537  10.364  1.00 29.19  ? 266 ASN A CB  1 
ATOM   1968  C  CG  . ASN A  1 266 ? 22.230  10.872  9.295   1.00 36.57  ? 266 ASN A CG  1 
ATOM   1969  O  OD1 . ASN A  1 266 ? 23.299  11.359  8.922   1.00 36.84  ? 266 ASN A OD1 1 
ATOM   1970  N  ND2 . ASN A  1 266 ? 21.754  9.742   8.806   1.00 48.63  ? 266 ASN A ND2 1 
ATOM   1971  N  N   . TYR A  1 267 ? 22.495  14.077  8.607   1.00 46.77  ? 267 TYR A N   1 
ATOM   1972  C  CA  . TYR A  1 267 ? 22.305  14.854  7.399   1.00 48.93  ? 267 TYR A CA  1 
ATOM   1973  C  C   . TYR A  1 267 ? 22.097  13.901  6.229   1.00 49.85  ? 267 TYR A C   1 
ATOM   1974  O  O   . TYR A  1 267 ? 23.050  13.422  5.622   1.00 51.39  ? 267 TYR A O   1 
ATOM   1975  C  CB  . TYR A  1 267 ? 23.516  15.767  7.187   1.00 55.56  ? 267 TYR A CB  1 
ATOM   1976  C  CG  . TYR A  1 267 ? 23.577  16.489  5.860   1.00 64.95  ? 267 TYR A CG  1 
ATOM   1977  C  CD1 . TYR A  1 267 ? 22.425  16.746  5.119   1.00 72.74  ? 267 TYR A CD1 1 
ATOM   1978  C  CD2 . TYR A  1 267 ? 24.792  16.941  5.359   1.00 69.81  ? 267 TYR A CD2 1 
ATOM   1979  C  CE1 . TYR A  1 267 ? 22.490  17.420  3.906   1.00 74.11  ? 267 TYR A CE1 1 
ATOM   1980  C  CE2 . TYR A  1 267 ? 24.867  17.618  4.153   1.00 73.38  ? 267 TYR A CE2 1 
ATOM   1981  C  CZ  . TYR A  1 267 ? 23.715  17.855  3.432   1.00 73.02  ? 267 TYR A CZ  1 
ATOM   1982  O  OH  . TYR A  1 267 ? 23.798  18.525  2.238   1.00 71.86  ? 267 TYR A OH  1 
ATOM   1983  N  N   . HIS A  1 268 ? 20.838  13.615  5.925   1.00 51.05  ? 268 HIS A N   1 
ATOM   1984  C  CA  . HIS A  1 268 ? 20.526  12.756  4.791   1.00 58.82  ? 268 HIS A CA  1 
ATOM   1985  C  C   . HIS A  1 268 ? 20.849  13.506  3.497   1.00 59.91  ? 268 HIS A C   1 
ATOM   1986  O  O   . HIS A  1 268 ? 20.495  14.682  3.338   1.00 41.19  ? 268 HIS A O   1 
ATOM   1987  C  CB  . HIS A  1 268 ? 19.069  12.294  4.864   1.00 60.23  ? 268 HIS A CB  1 
ATOM   1988  C  CG  . HIS A  1 268 ? 18.707  11.707  6.195   1.00 65.53  ? 268 HIS A CG  1 
ATOM   1989  N  ND1 . HIS A  1 268 ? 18.442  10.366  6.374   1.00 67.41  ? 268 HIS A ND1 1 
ATOM   1990  C  CD2 . HIS A  1 268 ? 18.619  12.276  7.422   1.00 64.19  ? 268 HIS A CD2 1 
ATOM   1991  C  CE1 . HIS A  1 268 ? 18.181  10.138  7.650   1.00 67.51  ? 268 HIS A CE1 1 
ATOM   1992  N  NE2 . HIS A  1 268 ? 18.282  11.281  8.307   1.00 64.55  ? 268 HIS A NE2 1 
ATOM   1993  N  N   . GLY A  1 269 ? 21.570  12.832  2.603   1.00 57.90  ? 269 GLY A N   1 
ATOM   1994  C  CA  . GLY A  1 269 ? 22.076  13.464  1.402   1.00 49.39  ? 269 GLY A CA  1 
ATOM   1995  C  C   . GLY A  1 269 ? 21.516  12.855  0.131   1.00 55.88  ? 269 GLY A C   1 
ATOM   1996  O  O   . GLY A  1 269 ? 21.912  13.250  -0.968  1.00 61.24  ? 269 GLY A O   1 
ATOM   1997  N  N   . SER A  1 270 ? 20.598  11.897  0.268   1.00 50.81  ? 270 SER A N   1 
ATOM   1998  C  CA  . SER A  1 270 ? 20.042  11.219  -0.907  1.00 58.17  ? 270 SER A CA  1 
ATOM   1999  C  C   . SER A  1 270 ? 18.696  10.540  -0.653  1.00 57.14  ? 270 SER A C   1 
ATOM   2000  O  O   . SER A  1 270 ? 18.438  10.033  0.442   1.00 49.78  ? 270 SER A O   1 
ATOM   2001  C  CB  . SER A  1 270 ? 21.038  10.193  -1.464  1.00 62.21  ? 270 SER A CB  1 
ATOM   2002  O  OG  . SER A  1 270 ? 21.071  9.021   -0.665  1.00 66.67  ? 270 SER A OG  1 
ATOM   2003  N  N   . GLY A  1 271 ? 17.847  10.529  -1.680  1.00 64.24  ? 271 GLY A N   1 
ATOM   2004  C  CA  . GLY A  1 271 ? 16.546  9.883   -1.598  1.00 60.31  ? 271 GLY A CA  1 
ATOM   2005  C  C   . GLY A  1 271 ? 15.414  10.895  -1.584  1.00 58.41  ? 271 GLY A C   1 
ATOM   2006  O  O   . GLY A  1 271 ? 15.595  12.025  -1.145  1.00 54.68  ? 271 GLY A O   1 
ATOM   2007  N  N   . ASP A  1 272 ? 14.242  10.485  -2.055  1.00 60.24  ? 272 ASP A N   1 
ATOM   2008  C  CA  . ASP A  1 272 ? 13.100  11.389  -2.176  1.00 56.67  ? 272 ASP A CA  1 
ATOM   2009  C  C   . ASP A  1 272 ? 12.443  11.642  -0.822  1.00 46.25  ? 272 ASP A C   1 
ATOM   2010  O  O   . ASP A  1 272 ? 12.060  12.768  -0.499  1.00 39.53  ? 272 ASP A O   1 
ATOM   2011  C  CB  . ASP A  1 272 ? 12.078  10.804  -3.159  1.00 64.08  ? 272 ASP A CB  1 
ATOM   2012  C  CG  . ASP A  1 272 ? 10.975  11.783  -3.517  1.00 71.82  ? 272 ASP A CG  1 
ATOM   2013  O  OD1 . ASP A  1 272 ? 11.294  12.942  -3.862  1.00 75.48  ? 272 ASP A OD1 1 
ATOM   2014  O  OD2 . ASP A  1 272 ? 9.788   11.385  -3.467  1.00 73.09  ? 272 ASP A OD2 1 
ATOM   2015  N  N   . ALA A  1 273 ? 12.330  10.587  -0.023  1.00 44.55  ? 273 ALA A N   1 
ATOM   2016  C  CA  . ALA A  1 273 ? 11.588  10.651  1.231   1.00 42.87  ? 273 ALA A CA  1 
ATOM   2017  C  C   . ALA A  1 273 ? 12.253  9.840   2.342   1.00 47.51  ? 273 ALA A C   1 
ATOM   2018  O  O   . ALA A  1 273 ? 13.152  9.038   2.084   1.00 48.32  ? 273 ALA A O   1 
ATOM   2019  C  CB  . ALA A  1 273 ? 10.153  10.150  1.005   1.00 41.59  ? 273 ALA A CB  1 
ATOM   2020  N  N   . LEU A  1 274 ? 11.811  10.070  3.580   1.00 48.29  ? 274 LEU A N   1 
ATOM   2021  C  CA  . LEU A  1 274 ? 12.102  9.172   4.694   1.00 42.29  ? 274 LEU A CA  1 
ATOM   2022  C  C   . LEU A  1 274 ? 10.787  8.501   5.108   1.00 40.34  ? 274 LEU A C   1 
ATOM   2023  O  O   . LEU A  1 274 ? 9.735   9.158   5.143   1.00 35.49  ? 274 LEU A O   1 
ATOM   2024  C  CB  . LEU A  1 274 ? 12.729  9.922   5.885   1.00 39.49  ? 274 LEU A CB  1 
ATOM   2025  C  CG  . LEU A  1 274 ? 14.024  10.741  5.731   1.00 43.77  ? 274 LEU A CG  1 
ATOM   2026  C  CD1 . LEU A  1 274 ? 13.727  12.175  5.356   1.00 39.67  ? 274 LEU A CD1 1 
ATOM   2027  C  CD2 . LEU A  1 274 ? 14.819  10.750  7.022   1.00 45.35  ? 274 LEU A CD2 1 
ATOM   2028  N  N   . LEU A  1 275 ? 10.838  7.204   5.420   1.00 37.23  ? 275 LEU A N   1 
ATOM   2029  C  CA  . LEU A  1 275 ? 9.621   6.448   5.735   1.00 34.97  ? 275 LEU A CA  1 
ATOM   2030  C  C   . LEU A  1 275 ? 9.389   6.198   7.224   1.00 32.00  ? 275 LEU A C   1 
ATOM   2031  O  O   . LEU A  1 275 ? 10.268  5.703   7.931   1.00 31.58  ? 275 LEU A O   1 
ATOM   2032  C  CB  . LEU A  1 275 ? 9.601   5.091   5.019   1.00 42.28  ? 275 LEU A CB  1 
ATOM   2033  C  CG  . LEU A  1 275 ? 10.189  4.914   3.620   1.00 55.14  ? 275 LEU A CG  1 
ATOM   2034  C  CD1 . LEU A  1 275 ? 9.770   3.550   3.072   1.00 58.29  ? 275 LEU A CD1 1 
ATOM   2035  C  CD2 . LEU A  1 275 ? 9.776   6.025   2.672   1.00 47.58  ? 275 LEU A CD2 1 
ATOM   2036  N  N   . ILE A  1 276 ? 8.188   6.524   7.681   1.00 31.79  ? 276 ILE A N   1 
ATOM   2037  C  CA  . ILE A  1 276 ? 7.705   6.123   8.990   1.00 30.55  ? 276 ILE A CA  1 
ATOM   2038  C  C   . ILE A  1 276 ? 6.811   4.893   8.805   1.00 38.76  ? 276 ILE A C   1 
ATOM   2039  O  O   . ILE A  1 276 ? 5.854   4.945   8.033   1.00 40.02  ? 276 ILE A O   1 
ATOM   2040  C  CB  . ILE A  1 276 ? 6.822   7.216   9.578   1.00 32.31  ? 276 ILE A CB  1 
ATOM   2041  C  CG1 . ILE A  1 276 ? 7.616   8.521   9.759   1.00 35.58  ? 276 ILE A CG1 1 
ATOM   2042  C  CG2 . ILE A  1 276 ? 6.190   6.741   10.877  1.00 31.45  ? 276 ILE A CG2 1 
ATOM   2043  C  CD1 . ILE A  1 276 ? 6.753   9.738   10.040  1.00 27.99  ? 276 ILE A CD1 1 
ATOM   2044  N  N   . PRO A  1 277 ? 7.104   3.789   9.517   1.00 31.38  ? 277 PRO A N   1 
ATOM   2045  C  CA  . PRO A  1 277 ? 6.256   2.587   9.406   1.00 31.79  ? 277 PRO A CA  1 
ATOM   2046  C  C   . PRO A  1 277 ? 4.898   2.820   10.060  1.00 37.57  ? 277 PRO A C   1 
ATOM   2047  O  O   . PRO A  1 277 ? 4.849   3.144   11.252  1.00 36.24  ? 277 PRO A O   1 
ATOM   2048  C  CB  . PRO A  1 277 ? 7.023   1.516   10.188  1.00 37.20  ? 277 PRO A CB  1 
ATOM   2049  C  CG  . PRO A  1 277 ? 8.217   2.207   10.833  1.00 29.48  ? 277 PRO A CG  1 
ATOM   2050  C  CD  . PRO A  1 277 ? 8.119   3.684   10.577  1.00 30.80  ? 277 PRO A CD  1 
ATOM   2051  N  N   . ARG A  1 278 ? 3.817   2.661   9.296   1.00 31.71  ? 278 ARG A N   1 
ATOM   2052  C  CA  . ARG A  1 278 ? 2.493   3.071   9.748   1.00 28.09  ? 278 ARG A CA  1 
ATOM   2053  C  C   . ARG A  1 278 ? 2.082   2.363   11.029  1.00 30.69  ? 278 ARG A C   1 
ATOM   2054  O  O   . ARG A  1 278 ? 1.552   2.984   11.953  1.00 35.02  ? 278 ARG A O   1 
ATOM   2055  C  CB  . ARG A  1 278 ? 1.438   2.816   8.649   1.00 33.62  ? 278 ARG A CB  1 
ATOM   2056  C  CG  . ARG A  1 278 ? -0.015  3.132   9.067   1.00 36.28  ? 278 ARG A CG  1 
ATOM   2057  C  CD  . ARG A  1 278 ? -1.042  2.861   7.935   1.00 44.17  ? 278 ARG A CD  1 
ATOM   2058  N  NE  . ARG A  1 278 ? -1.076  1.433   7.609   1.00 43.76  ? 278 ARG A NE  1 
ATOM   2059  C  CZ  . ARG A  1 278 ? -1.804  0.522   8.254   1.00 48.57  ? 278 ARG A CZ  1 
ATOM   2060  N  NH1 . ARG A  1 278 ? -2.604  0.887   9.249   1.00 49.31  ? 278 ARG A NH1 1 
ATOM   2061  N  NH2 . ARG A  1 278 ? -1.736  -0.763  7.901   1.00 46.05  ? 278 ARG A NH2 1 
ATOM   2062  N  N   . VAL A  1 279 ? 2.308   1.054   11.062  1.00 29.17  ? 279 VAL A N   1 
ATOM   2063  C  CA  . VAL A  1 279 ? 1.827   0.200   12.146  1.00 30.56  ? 279 VAL A CA  1 
ATOM   2064  C  C   . VAL A  1 279 ? 2.600   0.441   13.437  1.00 33.36  ? 279 VAL A C   1 
ATOM   2065  O  O   . VAL A  1 279 ? 2.017   0.593   14.512  1.00 35.89  ? 279 VAL A O   1 
ATOM   2066  C  CB  . VAL A  1 279 ? 1.925   -1.299  11.752  1.00 44.77  ? 279 VAL A CB  1 
ATOM   2067  C  CG1 . VAL A  1 279 ? 1.773   -2.193  12.969  1.00 39.33  ? 279 VAL A CG1 1 
ATOM   2068  C  CG2 . VAL A  1 279 ? 0.872   -1.644  10.672  1.00 41.09  ? 279 VAL A CG2 1 
ATOM   2069  N  N   . GLU A  1 280 ? 3.919   0.476   13.336  1.00 30.21  ? 280 GLU A N   1 
ATOM   2070  C  CA  . GLU A  1 280 ? 4.737   0.695   14.526  1.00 33.43  ? 280 GLU A CA  1 
ATOM   2071  C  C   . GLU A  1 280 ? 4.622   2.133   15.065  1.00 30.95  ? 280 GLU A C   1 
ATOM   2072  O  O   . GLU A  1 280 ? 4.895   2.379   16.233  1.00 30.35  ? 280 GLU A O   1 
ATOM   2073  C  CB  . GLU A  1 280 ? 6.179   0.291   14.267  1.00 32.27  ? 280 GLU A CB  1 
ATOM   2074  C  CG  . GLU A  1 280 ? 6.357   -1.221  14.121  1.00 34.52  ? 280 GLU A CG  1 
ATOM   2075  C  CD  . GLU A  1 280 ? 5.987   -1.742  12.739  1.00 44.19  ? 280 GLU A CD  1 
ATOM   2076  O  OE1 . GLU A  1 280 ? 5.655   -0.919  11.845  1.00 39.24  ? 280 GLU A OE1 1 
ATOM   2077  O  OE2 . GLU A  1 280 ? 6.036   -2.984  12.551  1.00 47.21  ? 280 GLU A OE2 1 
ATOM   2078  N  N   . TRP A  1 281 ? 4.161   3.056   14.222  1.00 24.98  ? 281 TRP A N   1 
ATOM   2079  C  CA  . TRP A  1 281 ? 3.893   4.423   14.652  1.00 30.25  ? 281 TRP A CA  1 
ATOM   2080  C  C   . TRP A  1 281 ? 2.452   4.556   15.149  1.00 38.11  ? 281 TRP A C   1 
ATOM   2081  O  O   . TRP A  1 281 ? 1.892   5.653   15.187  1.00 36.41  ? 281 TRP A O   1 
ATOM   2082  C  CB  . TRP A  1 281 ? 4.162   5.401   13.508  1.00 28.46  ? 281 TRP A CB  1 
ATOM   2083  C  CG  . TRP A  1 281 ? 4.504   6.803   13.955  1.00 33.72  ? 281 TRP A CG  1 
ATOM   2084  C  CD1 . TRP A  1 281 ? 5.438   7.178   14.908  1.00 31.80  ? 281 TRP A CD1 1 
ATOM   2085  C  CD2 . TRP A  1 281 ? 3.945   8.021   13.444  1.00 28.49  ? 281 TRP A CD2 1 
ATOM   2086  N  NE1 . TRP A  1 281 ? 5.465   8.551   15.025  1.00 27.45  ? 281 TRP A NE1 1 
ATOM   2087  C  CE2 . TRP A  1 281 ? 4.559   9.091   14.141  1.00 29.83  ? 281 TRP A CE2 1 
ATOM   2088  C  CE3 . TRP A  1 281 ? 2.972   8.310   12.477  1.00 25.63  ? 281 TRP A CE3 1 
ATOM   2089  C  CZ2 . TRP A  1 281 ? 4.236   10.420  13.892  1.00 31.81  ? 281 TRP A CZ2 1 
ATOM   2090  C  CZ3 . TRP A  1 281 ? 2.649   9.626   12.238  1.00 34.16  ? 281 TRP A CZ3 1 
ATOM   2091  C  CH2 . TRP A  1 281 ? 3.279   10.669  12.939  1.00 34.03  ? 281 TRP A CH2 1 
ATOM   2092  N  N   . GLY A  1 282 ? 1.859   3.426   15.526  1.00 37.46  ? 282 GLY A N   1 
ATOM   2093  C  CA  . GLY A  1 282 ? 0.497   3.401   16.025  1.00 29.86  ? 282 GLY A CA  1 
ATOM   2094  C  C   . GLY A  1 282 ? -0.481  4.055   15.068  1.00 35.93  ? 282 GLY A C   1 
ATOM   2095  O  O   . GLY A  1 282 ? -1.400  4.753   15.493  1.00 40.64  ? 282 GLY A O   1 
ATOM   2096  N  N   . CYS A  1 283 ? -0.266  3.848   13.773  1.00 39.30  ? 283 CYS A N   1 
ATOM   2097  C  CA  . CYS A  1 283 ? -1.119  4.434   12.744  1.00 46.52  ? 283 CYS A CA  1 
ATOM   2098  C  C   . CYS A  1 283 ? -1.254  5.938   12.935  1.00 47.20  ? 283 CYS A C   1 
ATOM   2099  O  O   . CYS A  1 283 ? -2.248  6.532   12.505  1.00 46.77  ? 283 CYS A O   1 
ATOM   2100  C  CB  . CYS A  1 283 ? -2.512  3.782   12.738  1.00 46.70  ? 283 CYS A CB  1 
ATOM   2101  S  SG  . CYS A  1 283 ? -2.532  1.988   12.458  1.00 48.07  ? 283 CYS A SG  1 
ATOM   2102  N  N   . GLY A  1 284 ? -0.260  6.535   13.596  1.00 47.02  ? 284 GLY A N   1 
ATOM   2103  C  CA  . GLY A  1 284 ? -0.186  7.978   13.786  1.00 37.27  ? 284 GLY A CA  1 
ATOM   2104  C  C   . GLY A  1 284 ? -0.494  8.420   15.207  1.00 37.47  ? 284 GLY A C   1 
ATOM   2105  O  O   . GLY A  1 284 ? -0.520  9.609   15.506  1.00 39.80  ? 284 GLY A O   1 
ATOM   2106  N  N   . MET A  1 285 ? -0.720  7.456   16.090  1.00 30.92  ? 285 MET A N   1 
ATOM   2107  C  CA  . MET A  1 285 ? -1.280  7.735   17.402  1.00 28.95  ? 285 MET A CA  1 
ATOM   2108  C  C   . MET A  1 285 ? -0.442  7.170   18.567  1.00 26.81  ? 285 MET A C   1 
ATOM   2109  O  O   . MET A  1 285 ? -0.905  7.162   19.702  1.00 24.22  ? 285 MET A O   1 
ATOM   2110  C  CB  . MET A  1 285 ? -2.710  7.165   17.476  1.00 31.78  ? 285 MET A CB  1 
ATOM   2111  C  CG  . MET A  1 285 ? -3.715  7.798   16.491  1.00 27.68  ? 285 MET A CG  1 
ATOM   2112  S  SD  . MET A  1 285 ? -5.362  7.030   16.616  1.00 35.55  ? 285 MET A SD  1 
ATOM   2113  C  CE  . MET A  1 285 ? -5.034  5.422   15.905  1.00 32.80  ? 285 MET A CE  1 
ATOM   2114  N  N   . ALA A  1 286 ? 0.778   6.711   18.289  1.00 24.74  ? 286 ALA A N   1 
ATOM   2115  C  CA  . ALA A  1 286 ? 1.645   6.138   19.337  1.00 28.41  ? 286 ALA A CA  1 
ATOM   2116  C  C   . ALA A  1 286 ? 2.386   7.166   20.194  1.00 28.16  ? 286 ALA A C   1 
ATOM   2117  O  O   . ALA A  1 286 ? 3.122   6.779   21.095  1.00 29.19  ? 286 ALA A O   1 
ATOM   2118  C  CB  . ALA A  1 286 ? 2.669   5.175   18.731  1.00 24.83  ? 286 ALA A CB  1 
ATOM   2119  N  N   . HIS A  1 287 ? 2.223   8.459   19.906  1.00 20.83  ? 287 HIS A N   1 
ATOM   2120  C  CA  . HIS A  1 287 ? 2.966   9.485   20.649  1.00 27.58  ? 287 HIS A CA  1 
ATOM   2121  C  C   . HIS A  1 287 ? 4.462   9.261   20.510  1.00 29.27  ? 287 HIS A C   1 
ATOM   2122  O  O   . HIS A  1 287 ? 5.215   9.430   21.461  1.00 32.28  ? 287 HIS A O   1 
ATOM   2123  C  CB  . HIS A  1 287 ? 2.567   9.514   22.136  1.00 29.49  ? 287 HIS A CB  1 
ATOM   2124  C  CG  . HIS A  1 287 ? 1.232   10.161  22.397  1.00 30.13  ? 287 HIS A CG  1 
ATOM   2125  N  ND1 . HIS A  1 287 ? 0.066   9.435   22.533  1.00 32.67  ? 287 HIS A ND1 1 
ATOM   2126  C  CD2 . HIS A  1 287 ? 0.883   11.464  22.554  1.00 29.45  ? 287 HIS A CD2 1 
ATOM   2127  C  CE1 . HIS A  1 287 ? -0.942  10.261  22.763  1.00 35.35  ? 287 HIS A CE1 1 
ATOM   2128  N  NE2 . HIS A  1 287 ? -0.475  11.497  22.779  1.00 31.48  ? 287 HIS A NE2 1 
ATOM   2129  N  N   . LYS A  1 288 ? 4.881   8.834   19.325  1.00 30.13  ? 288 LYS A N   1 
ATOM   2130  C  CA  . LYS A  1 288 ? 6.299   8.713   19.023  1.00 27.07  ? 288 LYS A CA  1 
ATOM   2131  C  C   . LYS A  1 288 ? 6.737   9.948   18.255  1.00 27.00  ? 288 LYS A C   1 
ATOM   2132  O  O   . LYS A  1 288 ? 6.627   10.011  17.028  1.00 27.64  ? 288 LYS A O   1 
ATOM   2133  C  CB  . LYS A  1 288 ? 6.590   7.439   18.219  1.00 23.63  ? 288 LYS A CB  1 
ATOM   2134  C  CG  . LYS A  1 288 ? 6.238   6.151   18.975  1.00 19.24  ? 288 LYS A CG  1 
ATOM   2135  C  CD  . LYS A  1 288 ? 6.548   4.923   18.163  1.00 24.05  ? 288 LYS A CD  1 
ATOM   2136  C  CE  . LYS A  1 288 ? 6.528   3.661   19.051  1.00 29.63  ? 288 LYS A CE  1 
ATOM   2137  N  NZ  . LYS A  1 288 ? 6.799   2.435   18.258  1.00 21.03  ? 288 LYS A NZ  1 
ATOM   2138  N  N   . THR A  1 289 ? 7.231   10.936  18.991  1.00 24.96  ? 289 THR A N   1 
ATOM   2139  C  CA  . THR A  1 289 ? 7.585   12.225  18.412  1.00 22.97  ? 289 THR A CA  1 
ATOM   2140  C  C   . THR A  1 289 ? 8.858   12.150  17.577  1.00 24.98  ? 289 THR A C   1 
ATOM   2141  O  O   . THR A  1 289 ? 9.849   11.554  17.983  1.00 24.81  ? 289 THR A O   1 
ATOM   2142  C  CB  . THR A  1 289 ? 7.730   13.256  19.532  1.00 27.95  ? 289 THR A CB  1 
ATOM   2143  O  OG1 . THR A  1 289 ? 6.440   13.481  20.110  1.00 27.23  ? 289 THR A OG1 1 
ATOM   2144  C  CG2 . THR A  1 289 ? 8.293   14.558  19.023  1.00 21.70  ? 289 THR A CG2 1 
ATOM   2145  N  N   . ILE A  1 290 ? 8.819   12.734  16.386  1.00 28.78  ? 290 ILE A N   1 
ATOM   2146  C  CA  . ILE A  1 290 ? 10.010  12.778  15.549  1.00 25.84  ? 290 ILE A CA  1 
ATOM   2147  C  C   . ILE A  1 290 ? 10.550  14.214  15.450  1.00 32.30  ? 290 ILE A C   1 
ATOM   2148  O  O   . ILE A  1 290 ? 9.842   15.132  15.019  1.00 26.05  ? 290 ILE A O   1 
ATOM   2149  C  CB  . ILE A  1 290 ? 9.757   12.158  14.167  1.00 29.25  ? 290 ILE A CB  1 
ATOM   2150  C  CG1 . ILE A  1 290 ? 9.233   10.719  14.329  1.00 32.66  ? 290 ILE A CG1 1 
ATOM   2151  C  CG2 . ILE A  1 290 ? 11.037  12.146  13.342  1.00 33.12  ? 290 ILE A CG2 1 
ATOM   2152  C  CD1 . ILE A  1 290 ? 8.516   10.171  13.104  1.00 29.83  ? 290 ILE A CD1 1 
ATOM   2153  N  N   . LYS A  1 291 ? 11.790  14.396  15.895  1.00 30.67  ? 291 LYS A N   1 
ATOM   2154  C  CA  . LYS A  1 291 ? 12.466  15.677  15.789  1.00 30.94  ? 291 LYS A CA  1 
ATOM   2155  C  C   . LYS A  1 291 ? 13.679  15.588  14.859  1.00 33.89  ? 291 LYS A C   1 
ATOM   2156  O  O   . LYS A  1 291 ? 14.187  14.516  14.595  1.00 32.05  ? 291 LYS A O   1 
ATOM   2157  C  CB  . LYS A  1 291 ? 12.901  16.155  17.164  1.00 27.89  ? 291 LYS A CB  1 
ATOM   2158  C  CG  . LYS A  1 291 ? 11.774  16.309  18.165  1.00 30.83  ? 291 LYS A CG  1 
ATOM   2159  C  CD  . LYS A  1 291 ? 12.250  17.148  19.337  1.00 32.50  ? 291 LYS A CD  1 
ATOM   2160  C  CE  . LYS A  1 291 ? 11.296  17.097  20.497  1.00 32.18  ? 291 LYS A CE  1 
ATOM   2161  N  NZ  . LYS A  1 291 ? 11.831  17.882  21.639  1.00 31.58  ? 291 LYS A NZ  1 
ATOM   2162  N  N   . GLY A  1 292 ? 14.133  16.723  14.349  1.00 33.74  ? 292 GLY A N   1 
ATOM   2163  C  CA  . GLY A  1 292 ? 15.317  16.746  13.509  1.00 30.15  ? 292 GLY A CA  1 
ATOM   2164  C  C   . GLY A  1 292 ? 15.797  18.178  13.337  1.00 32.67  ? 292 GLY A C   1 
ATOM   2165  O  O   . GLY A  1 292 ? 15.112  19.002  12.722  1.00 29.93  ? 292 GLY A O   1 
ATOM   2166  N  N   . GLY A  1 293 ? 16.980  18.486  13.852  1.00 26.75  ? 293 GLY A N   1 
ATOM   2167  C  CA  . GLY A  1 293 ? 17.452  19.859  13.785  1.00 23.93  ? 293 GLY A CA  1 
ATOM   2168  C  C   . GLY A  1 293 ? 18.921  20.079  13.476  1.00 30.75  ? 293 GLY A C   1 
ATOM   2169  O  O   . GLY A  1 293 ? 19.798  19.319  13.899  1.00 28.68  ? 293 GLY A O   1 
ATOM   2170  N  N   . LEU A  1 294 ? 19.176  21.150  12.735  1.00 24.14  ? 294 LEU A N   1 
ATOM   2171  C  CA  . LEU A  1 294 ? 20.510  21.663  12.514  1.00 28.75  ? 294 LEU A CA  1 
ATOM   2172  C  C   . LEU A  1 294 ? 21.077  22.140  13.859  1.00 35.31  ? 294 LEU A C   1 
ATOM   2173  O  O   . LEU A  1 294 ? 20.346  22.689  14.695  1.00 34.24  ? 294 LEU A O   1 
ATOM   2174  C  CB  . LEU A  1 294 ? 20.441  22.837  11.532  1.00 29.48  ? 294 LEU A CB  1 
ATOM   2175  C  CG  . LEU A  1 294 ? 21.755  23.521  11.158  1.00 30.45  ? 294 LEU A CG  1 
ATOM   2176  C  CD1 . LEU A  1 294 ? 22.692  22.517  10.471  1.00 29.65  ? 294 LEU A CD1 1 
ATOM   2177  C  CD2 . LEU A  1 294 ? 21.471  24.717  10.247  1.00 34.95  ? 294 LEU A CD2 1 
ATOM   2178  N  N   . CYS A  1 295 ? 22.373  21.926  14.064  1.00 27.35  ? 295 CYS A N   1 
ATOM   2179  C  CA  . CYS A  1 295 ? 23.023  22.285  15.321  1.00 27.05  ? 295 CYS A CA  1 
ATOM   2180  C  C   . CYS A  1 295 ? 22.961  23.780  15.600  1.00 31.17  ? 295 CYS A C   1 
ATOM   2181  O  O   . CYS A  1 295 ? 23.071  24.586  14.677  1.00 28.14  ? 295 CYS A O   1 
ATOM   2182  C  CB  . CYS A  1 295 ? 24.491  21.854  15.307  1.00 24.83  ? 295 CYS A CB  1 
ATOM   2183  S  SG  . CYS A  1 295 ? 25.495  22.585  13.998  1.00 29.77  ? 295 CYS A SG  1 
ATOM   2184  N  N   . PRO A  1 296 ? 22.796  24.154  16.881  1.00 27.39  ? 296 PRO A N   1 
ATOM   2185  C  CA  . PRO A  1 296 ? 22.889  25.568  17.252  1.00 26.04  ? 296 PRO A CA  1 
ATOM   2186  C  C   . PRO A  1 296 ? 24.285  26.100  16.977  1.00 31.15  ? 296 PRO A C   1 
ATOM   2187  O  O   . PRO A  1 296 ? 25.259  25.340  17.012  1.00 29.36  ? 296 PRO A O   1 
ATOM   2188  C  CB  . PRO A  1 296 ? 22.632  25.559  18.766  1.00 23.49  ? 296 PRO A CB  1 
ATOM   2189  C  CG  . PRO A  1 296 ? 21.921  24.254  19.031  1.00 32.17  ? 296 PRO A CG  1 
ATOM   2190  C  CD  . PRO A  1 296 ? 22.555  23.297  18.053  1.00 28.81  ? 296 PRO A CD  1 
ATOM   2191  N  N   . GLY A  1 297 ? 24.371  27.400  16.694  1.00 33.47  ? 297 GLY A N   1 
ATOM   2192  C  CA  . GLY A  1 297 ? 25.640  28.073  16.526  1.00 26.09  ? 297 GLY A CA  1 
ATOM   2193  C  C   . GLY A  1 297 ? 25.646  29.370  17.320  1.00 32.88  ? 297 GLY A C   1 
ATOM   2194  O  O   . GLY A  1 297 ? 24.962  29.493  18.335  1.00 30.03  ? 297 GLY A O   1 
ATOM   2195  N  N   . GLY A  1 298 ? 26.398  30.357  16.848  1.00 30.44  ? 298 GLY A N   1 
ATOM   2196  C  CA  . GLY A  1 298 ? 26.518  31.602  17.579  1.00 31.78  ? 298 GLY A CA  1 
ATOM   2197  C  C   . GLY A  1 298 ? 27.431  31.533  18.787  1.00 37.07  ? 298 GLY A C   1 
ATOM   2198  O  O   . GLY A  1 298 ? 27.891  30.468  19.190  1.00 33.03  ? 298 GLY A O   1 
ATOM   2199  N  N   . ARG A  1 299 ? 27.684  32.695  19.376  1.00 36.68  ? 299 ARG A N   1 
ATOM   2200  C  CA  . ARG A  1 299 ? 28.685  32.831  20.408  1.00 31.56  ? 299 ARG A CA  1 
ATOM   2201  C  C   . ARG A  1 299 ? 28.326  32.082  21.685  1.00 33.66  ? 299 ARG A C   1 
ATOM   2202  O  O   . ARG A  1 299 ? 29.175  31.408  22.282  1.00 34.90  ? 299 ARG A O   1 
ATOM   2203  C  CB  . ARG A  1 299 ? 28.896  34.313  20.719  1.00 31.82  ? 299 ARG A CB  1 
ATOM   2204  C  CG  . ARG A  1 299 ? 29.695  34.590  21.983  1.00 28.83  ? 299 ARG A CG  1 
ATOM   2205  C  CD  . ARG A  1 299 ? 30.011  36.108  22.048  1.00 33.35  ? 299 ARG A CD  1 
ATOM   2206  N  NE  . ARG A  1 299 ? 30.806  36.485  23.215  1.00 25.84  ? 299 ARG A NE  1 
ATOM   2207  C  CZ  . ARG A  1 299 ? 31.223  37.729  23.449  1.00 32.84  ? 299 ARG A CZ  1 
ATOM   2208  N  NH1 . ARG A  1 299 ? 30.900  38.708  22.607  1.00 31.46  ? 299 ARG A NH1 1 
ATOM   2209  N  NH2 . ARG A  1 299 ? 31.946  37.995  24.524  1.00 33.56  ? 299 ARG A NH2 1 
ATOM   2210  N  N   . LEU A  1 300 ? 27.079  32.218  22.119  1.00 31.48  ? 300 LEU A N   1 
ATOM   2211  C  CA  . LEU A  1 300 ? 26.655  31.604  23.378  1.00 35.53  ? 300 LEU A CA  1 
ATOM   2212  C  C   . LEU A  1 300 ? 26.819  30.080  23.348  1.00 32.64  ? 300 LEU A C   1 
ATOM   2213  O  O   . LEU A  1 300 ? 27.289  29.464  24.321  1.00 33.69  ? 300 LEU A O   1 
ATOM   2214  C  CB  . LEU A  1 300 ? 25.201  31.959  23.684  1.00 36.38  ? 300 LEU A CB  1 
ATOM   2215  C  CG  . LEU A  1 300 ? 24.634  31.329  24.958  1.00 39.72  ? 300 LEU A CG  1 
ATOM   2216  C  CD1 . LEU A  1 300 ? 25.356  31.867  26.200  1.00 35.65  ? 300 LEU A CD1 1 
ATOM   2217  C  CD2 . LEU A  1 300 ? 23.147  31.580  25.048  1.00 42.98  ? 300 LEU A CD2 1 
ATOM   2218  N  N   . ARG A  1 301 ? 26.428  29.476  22.229  1.00 34.36  ? 301 ARG A N   1 
ATOM   2219  C  CA  . ARG A  1 301 ? 26.562  28.036  22.084  1.00 32.93  ? 301 ARG A CA  1 
ATOM   2220  C  C   . ARG A  1 301 ? 28.024  27.654  22.279  1.00 35.17  ? 301 ARG A C   1 
ATOM   2221  O  O   . ARG A  1 301 ? 28.327  26.735  23.038  1.00 32.20  ? 301 ARG A O   1 
ATOM   2222  C  CB  . ARG A  1 301 ? 26.081  27.552  20.713  1.00 26.12  ? 301 ARG A CB  1 
ATOM   2223  C  CG  . ARG A  1 301 ? 26.193  26.010  20.517  1.00 23.87  ? 301 ARG A CG  1 
ATOM   2224  C  CD  . ARG A  1 301 ? 25.251  25.239  21.482  1.00 22.50  ? 301 ARG A CD  1 
ATOM   2225  N  NE  . ARG A  1 301 ? 25.006  23.847  21.059  1.00 26.36  ? 301 ARG A NE  1 
ATOM   2226  C  CZ  . ARG A  1 301 ? 24.154  23.022  21.667  1.00 31.07  ? 301 ARG A CZ  1 
ATOM   2227  N  NH1 . ARG A  1 301 ? 23.487  23.445  22.734  1.00 27.72  ? 301 ARG A NH1 1 
ATOM   2228  N  NH2 . ARG A  1 301 ? 23.958  21.778  21.211  1.00 25.61  ? 301 ARG A NH2 1 
ATOM   2229  N  N   . MET A  1 302 ? 28.918  28.353  21.583  1.00 29.75  ? 302 MET A N   1 
ATOM   2230  C  CA  . MET A  1 302 ? 30.345  28.039  21.674  1.00 36.22  ? 302 MET A CA  1 
ATOM   2231  C  C   . MET A  1 302 ? 30.830  28.212  23.102  1.00 35.61  ? 302 MET A C   1 
ATOM   2232  O  O   . MET A  1 302 ? 31.606  27.400  23.606  1.00 38.70  ? 302 MET A O   1 
ATOM   2233  C  CB  . MET A  1 302 ? 31.179  28.915  20.741  1.00 25.16  ? 302 MET A CB  1 
ATOM   2234  C  CG  . MET A  1 302 ? 30.952  28.663  19.261  1.00 29.39  ? 302 MET A CG  1 
ATOM   2235  S  SD  . MET A  1 302 ? 31.262  26.955  18.738  1.00 32.00  ? 302 MET A SD  1 
ATOM   2236  C  CE  . MET A  1 302 ? 29.609  26.248  18.811  1.00 35.43  ? 302 MET A CE  1 
ATOM   2237  N  N   . GLU A  1 303 ? 30.357  29.267  23.755  1.00 31.80  ? 303 GLU A N   1 
ATOM   2238  C  CA  . GLU A  1 303 ? 30.785  29.546  25.118  1.00 32.05  ? 303 GLU A CA  1 
ATOM   2239  C  C   . GLU A  1 303 ? 30.313  28.470  26.081  1.00 31.86  ? 303 GLU A C   1 
ATOM   2240  O  O   . GLU A  1 303 ? 31.034  28.096  26.982  1.00 30.81  ? 303 GLU A O   1 
ATOM   2241  C  CB  . GLU A  1 303 ? 30.350  30.949  25.570  1.00 30.98  ? 303 GLU A CB  1 
ATOM   2242  C  CG  . GLU A  1 303 ? 31.197  32.081  24.928  1.00 35.99  ? 303 GLU A CG  1 
ATOM   2243  C  CD  . GLU A  1 303 ? 30.707  33.484  25.286  1.00 40.49  ? 303 GLU A CD  1 
ATOM   2244  O  OE1 . GLU A  1 303 ? 29.622  33.595  25.896  1.00 38.01  ? 303 GLU A OE1 1 
ATOM   2245  O  OE2 . GLU A  1 303 ? 31.400  34.477  24.946  1.00 38.01  ? 303 GLU A OE2 1 
ATOM   2246  N  N   . ARG A  1 304 ? 29.106  27.956  25.893  1.00 32.95  ? 304 ARG A N   1 
ATOM   2247  C  CA  . ARG A  1 304 ? 28.649  26.895  26.781  1.00 35.78  ? 304 ARG A CA  1 
ATOM   2248  C  C   . ARG A  1 304 ? 29.388  25.578  26.563  1.00 30.29  ? 304 ARG A C   1 
ATOM   2249  O  O   . ARG A  1 304 ? 29.674  24.859  27.512  1.00 28.29  ? 304 ARG A O   1 
ATOM   2250  C  CB  . ARG A  1 304 ? 27.129  26.719  26.702  1.00 38.13  ? 304 ARG A CB  1 
ATOM   2251  C  CG  . ARG A  1 304 ? 26.449  27.497  27.813  1.00 33.27  ? 304 ARG A CG  1 
ATOM   2252  C  CD  . ARG A  1 304 ? 25.144  27.969  27.395  1.00 38.42  ? 304 ARG A CD  1 
ATOM   2253  N  NE  . ARG A  1 304 ? 24.574  28.918  28.336  1.00 36.98  ? 304 ARG A NE  1 
ATOM   2254  C  CZ  . ARG A  1 304 ? 23.277  29.178  28.367  1.00 37.81  ? 304 ARG A CZ  1 
ATOM   2255  N  NH1 . ARG A  1 304 ? 22.478  28.527  27.524  1.00 33.77  ? 304 ARG A NH1 1 
ATOM   2256  N  NH2 . ARG A  1 304 ? 22.779  30.065  29.224  1.00 43.63  ? 304 ARG A NH2 1 
ATOM   2257  N  N   . LEU A  1 305 ? 29.725  25.290  25.314  1.00 26.94  ? 305 LEU A N   1 
ATOM   2258  C  CA  . LEU A  1 305 ? 30.436  24.072  25.000  1.00 28.83  ? 305 LEU A CA  1 
ATOM   2259  C  C   . LEU A  1 305 ? 31.888  24.199  25.442  1.00 34.68  ? 305 LEU A C   1 
ATOM   2260  O  O   . LEU A  1 305 ? 32.527  23.222  25.797  1.00 34.35  ? 305 LEU A O   1 
ATOM   2261  C  CB  . LEU A  1 305 ? 30.338  23.762  23.505  1.00 29.51  ? 305 LEU A CB  1 
ATOM   2262  C  CG  . LEU A  1 305 ? 28.910  23.439  23.054  1.00 36.37  ? 305 LEU A CG  1 
ATOM   2263  C  CD1 . LEU A  1 305 ? 28.924  22.740  21.709  1.00 35.64  ? 305 LEU A CD1 1 
ATOM   2264  C  CD2 . LEU A  1 305 ? 28.187  22.591  24.081  1.00 38.13  ? 305 LEU A CD2 1 
ATOM   2265  N  N   . ILE A  1 306 ? 32.401  25.419  25.420  1.00 34.91  ? 306 ILE A N   1 
ATOM   2266  C  CA  . ILE A  1 306 ? 33.739  25.679  25.916  1.00 29.67  ? 306 ILE A CA  1 
ATOM   2267  C  C   . ILE A  1 306 ? 33.764  25.360  27.415  1.00 29.04  ? 306 ILE A C   1 
ATOM   2268  O  O   . ILE A  1 306 ? 34.665  24.699  27.891  1.00 31.25  ? 306 ILE A O   1 
ATOM   2269  C  CB  . ILE A  1 306 ? 34.161  27.126  25.582  1.00 30.72  ? 306 ILE A CB  1 
ATOM   2270  C  CG1 . ILE A  1 306 ? 34.604  27.213  24.115  1.00 31.52  ? 306 ILE A CG1 1 
ATOM   2271  C  CG2 . ILE A  1 306 ? 35.275  27.631  26.513  1.00 31.85  ? 306 ILE A CG2 1 
ATOM   2272  C  CD1 . ILE A  1 306 ? 34.729  28.665  23.590  1.00 39.46  ? 306 ILE A CD1 1 
ATOM   2273  N  N   . ASP A  1 307 ? 32.752  25.794  28.158  1.00 30.26  ? 307 ASP A N   1 
ATOM   2274  C  CA  . ASP A  1 307 ? 32.675  25.423  29.571  1.00 26.32  ? 307 ASP A CA  1 
ATOM   2275  C  C   . ASP A  1 307 ? 32.668  23.903  29.800  1.00 32.66  ? 307 ASP A C   1 
ATOM   2276  O  O   . ASP A  1 307 ? 33.393  23.379  30.663  1.00 29.01  ? 307 ASP A O   1 
ATOM   2277  C  CB  . ASP A  1 307 ? 31.484  26.114  30.250  1.00 24.49  ? 307 ASP A CB  1 
ATOM   2278  C  CG  . ASP A  1 307 ? 31.876  27.469  30.854  1.00 33.91  ? 307 ASP A CG  1 
ATOM   2279  O  OD1 . ASP A  1 307 ? 32.920  28.017  30.446  1.00 31.36  ? 307 ASP A OD1 1 
ATOM   2280  O  OD2 . ASP A  1 307 ? 31.164  27.978  31.739  1.00 28.73  ? 307 ASP A OD2 1 
ATOM   2281  N  N   . LEU A  1 308 ? 31.862  23.191  29.021  1.00 29.95  ? 308 LEU A N   1 
ATOM   2282  C  CA  . LEU A  1 308 ? 31.817  21.732  29.141  1.00 29.61  ? 308 LEU A CA  1 
ATOM   2283  C  C   . LEU A  1 308 ? 33.206  21.145  28.941  1.00 27.65  ? 308 LEU A C   1 
ATOM   2284  O  O   . LEU A  1 308 ? 33.635  20.258  29.687  1.00 32.81  ? 308 LEU A O   1 
ATOM   2285  C  CB  . LEU A  1 308 ? 30.804  21.131  28.161  1.00 29.62  ? 308 LEU A CB  1 
ATOM   2286  C  CG  . LEU A  1 308 ? 29.363  21.524  28.511  1.00 29.37  ? 308 LEU A CG  1 
ATOM   2287  C  CD1 . LEU A  1 308 ? 28.357  21.017  27.469  1.00 29.46  ? 308 LEU A CD1 1 
ATOM   2288  C  CD2 . LEU A  1 308 ? 29.016  20.996  29.902  1.00 27.42  ? 308 LEU A CD2 1 
ATOM   2289  N  N   . VAL A  1 309 ? 33.935  21.669  27.966  1.00 23.97  ? 309 VAL A N   1 
ATOM   2290  C  CA  . VAL A  1 309 ? 35.304  21.221  27.764  1.00 27.98  ? 309 VAL A CA  1 
ATOM   2291  C  C   . VAL A  1 309 ? 36.234  21.687  28.889  1.00 31.35  ? 309 VAL A C   1 
ATOM   2292  O  O   . VAL A  1 309 ? 36.988  20.891  29.459  1.00 30.95  ? 309 VAL A O   1 
ATOM   2293  C  CB  . VAL A  1 309 ? 35.857  21.683  26.414  1.00 27.69  ? 309 VAL A CB  1 
ATOM   2294  C  CG1 . VAL A  1 309 ? 37.329  21.331  26.314  1.00 25.83  ? 309 VAL A CG1 1 
ATOM   2295  C  CG2 . VAL A  1 309 ? 35.075  21.019  25.277  1.00 27.98  ? 309 VAL A CG2 1 
ATOM   2296  N  N   . PHE A  1 310 ? 36.166  22.975  29.211  1.00 30.03  ? 310 PHE A N   1 
ATOM   2297  C  CA  . PHE A  1 310 ? 37.059  23.566  30.212  1.00 30.34  ? 310 PHE A CA  1 
ATOM   2298  C  C   . PHE A  1 310 ? 36.928  22.862  31.561  1.00 35.83  ? 310 PHE A C   1 
ATOM   2299  O  O   . PHE A  1 310 ? 37.932  22.557  32.222  1.00 34.08  ? 310 PHE A O   1 
ATOM   2300  C  CB  . PHE A  1 310 ? 36.770  25.060  30.366  1.00 32.04  ? 310 PHE A CB  1 
ATOM   2301  C  CG  . PHE A  1 310 ? 37.754  25.777  31.239  1.00 34.94  ? 310 PHE A CG  1 
ATOM   2302  C  CD1 . PHE A  1 310 ? 38.911  26.314  30.700  1.00 30.10  ? 310 PHE A CD1 1 
ATOM   2303  C  CD2 . PHE A  1 310 ? 37.521  25.911  32.603  1.00 40.73  ? 310 PHE A CD2 1 
ATOM   2304  C  CE1 . PHE A  1 310 ? 39.830  26.983  31.514  1.00 40.32  ? 310 PHE A CE1 1 
ATOM   2305  C  CE2 . PHE A  1 310 ? 38.423  26.575  33.420  1.00 41.84  ? 310 PHE A CE2 1 
ATOM   2306  C  CZ  . PHE A  1 310 ? 39.589  27.113  32.875  1.00 36.86  ? 310 PHE A CZ  1 
ATOM   2307  N  N   . TYR A  1 311 ? 35.689  22.597  31.964  1.00 28.46  ? 311 TYR A N   1 
ATOM   2308  C  CA  . TYR A  1 311 ? 35.444  21.961  33.254  1.00 28.98  ? 311 TYR A CA  1 
ATOM   2309  C  C   . TYR A  1 311 ? 35.378  20.430  33.122  1.00 29.84  ? 311 TYR A C   1 
ATOM   2310  O  O   . TYR A  1 311 ? 34.918  19.730  34.020  1.00 36.00  ? 311 TYR A O   1 
ATOM   2311  C  CB  . TYR A  1 311 ? 34.213  22.563  33.951  1.00 29.88  ? 311 TYR A CB  1 
ATOM   2312  C  CG  . TYR A  1 311 ? 34.407  24.016  34.341  1.00 33.51  ? 311 TYR A CG  1 
ATOM   2313  C  CD1 . TYR A  1 311 ? 35.342  24.392  35.329  1.00 41.08  ? 311 TYR A CD1 1 
ATOM   2314  C  CD2 . TYR A  1 311 ? 33.689  25.022  33.713  1.00 33.71  ? 311 TYR A CD2 1 
ATOM   2315  C  CE1 . TYR A  1 311 ? 35.534  25.751  35.678  1.00 28.55  ? 311 TYR A CE1 1 
ATOM   2316  C  CE2 . TYR A  1 311 ? 33.868  26.364  34.051  1.00 38.99  ? 311 TYR A CE2 1 
ATOM   2317  C  CZ  . TYR A  1 311 ? 34.786  26.719  35.034  1.00 36.36  ? 311 TYR A CZ  1 
ATOM   2318  O  OH  . TYR A  1 311 ? 34.943  28.051  35.348  1.00 41.78  ? 311 TYR A OH  1 
ATOM   2319  N  N   . LYS A  1 312 ? 35.866  19.925  31.992  1.00 29.07  ? 312 LYS A N   1 
ATOM   2320  C  CA  . LYS A  1 312 ? 36.125  18.498  31.828  1.00 36.25  ? 312 LYS A CA  1 
ATOM   2321  C  C   . LYS A  1 312 ? 34.875  17.653  31.974  1.00 35.59  ? 312 LYS A C   1 
ATOM   2322  O  O   . LYS A  1 312 ? 34.916  16.550  32.505  1.00 36.67  ? 312 LYS A O   1 
ATOM   2323  C  CB  . LYS A  1 312 ? 37.214  18.039  32.805  1.00 39.30  ? 312 LYS A CB  1 
ATOM   2324  C  CG  . LYS A  1 312 ? 38.458  18.933  32.742  1.00 44.27  ? 312 LYS A CG  1 
ATOM   2325  C  CD  . LYS A  1 312 ? 39.610  18.384  33.565  1.00 53.74  ? 312 LYS A CD  1 
ATOM   2326  C  CE  . LYS A  1 312 ? 40.807  19.333  33.538  1.00 53.05  ? 312 LYS A CE  1 
ATOM   2327  N  NZ  . LYS A  1 312 ? 41.832  18.919  34.540  1.00 56.99  ? 312 LYS A NZ  1 
ATOM   2328  N  N   . ARG A  1 313 ? 33.760  18.178  31.489  1.00 34.73  ? 313 ARG A N   1 
ATOM   2329  C  CA  . ARG A  1 313 ? 32.532  17.406  31.405  1.00 33.22  ? 313 ARG A CA  1 
ATOM   2330  C  C   . ARG A  1 313 ? 32.601  16.432  30.229  1.00 29.51  ? 313 ARG A C   1 
ATOM   2331  O  O   . ARG A  1 313 ? 31.980  15.374  30.243  1.00 32.37  ? 313 ARG A O   1 
ATOM   2332  C  CB  . ARG A  1 313 ? 31.337  18.345  31.235  1.00 33.45  ? 313 ARG A CB  1 
ATOM   2333  C  CG  . ARG A  1 313 ? 31.275  19.409  32.307  1.00 38.21  ? 313 ARG A CG  1 
ATOM   2334  C  CD  . ARG A  1 313 ? 31.351  18.788  33.670  1.00 28.80  ? 313 ARG A CD  1 
ATOM   2335  N  NE  . ARG A  1 313 ? 30.978  19.735  34.717  1.00 31.89  ? 313 ARG A NE  1 
ATOM   2336  C  CZ  . ARG A  1 313 ? 31.378  19.649  35.985  1.00 32.08  ? 313 ARG A CZ  1 
ATOM   2337  N  NH1 . ARG A  1 313 ? 32.189  18.660  36.371  1.00 25.76  ? 313 ARG A NH1 1 
ATOM   2338  N  NH2 . ARG A  1 313 ? 30.973  20.554  36.870  1.00 29.96  ? 313 ARG A NH2 1 
ATOM   2339  N  N   . VAL A  1 314 ? 33.334  16.824  29.197  1.00 30.63  ? 314 VAL A N   1 
ATOM   2340  C  CA  . VAL A  1 314 ? 33.517  15.984  28.023  1.00 29.53  ? 314 VAL A CA  1 
ATOM   2341  C  C   . VAL A  1 314 ? 34.910  16.227  27.472  1.00 34.53  ? 314 VAL A C   1 
ATOM   2342  O  O   . VAL A  1 314 ? 35.422  17.348  27.528  1.00 32.29  ? 314 VAL A O   1 
ATOM   2343  C  CB  . VAL A  1 314 ? 32.500  16.295  26.929  1.00 32.31  ? 314 VAL A CB  1 
ATOM   2344  C  CG1 . VAL A  1 314 ? 32.589  17.756  26.506  1.00 25.93  ? 314 VAL A CG1 1 
ATOM   2345  C  CG2 . VAL A  1 314 ? 32.730  15.391  25.715  1.00 32.45  ? 314 VAL A CG2 1 
ATOM   2346  N  N   . ASP A  1 315 ? 35.538  15.177  26.962  1.00 31.44  ? 315 ASP A N   1 
ATOM   2347  C  CA  . ASP A  1 315 ? 36.862  15.325  26.366  1.00 31.81  ? 315 ASP A CA  1 
ATOM   2348  C  C   . ASP A  1 315 ? 36.805  14.919  24.909  1.00 28.22  ? 315 ASP A C   1 
ATOM   2349  O  O   . ASP A  1 315 ? 36.944  13.737  24.591  1.00 31.95  ? 315 ASP A O   1 
ATOM   2350  C  CB  . ASP A  1 315 ? 37.892  14.457  27.104  1.00 30.80  ? 315 ASP A CB  1 
ATOM   2351  C  CG  . ASP A  1 315 ? 39.239  14.438  26.401  1.00 38.03  ? 315 ASP A CG  1 
ATOM   2352  O  OD1 . ASP A  1 315 ? 39.456  15.261  25.473  1.00 31.05  ? 315 ASP A OD1 1 
ATOM   2353  O  OD2 . ASP A  1 315 ? 40.077  13.590  26.769  1.00 41.66  ? 315 ASP A OD2 1 
ATOM   2354  N  N   . PRO A  1 316 ? 36.608  15.895  24.013  1.00 29.76  ? 316 PRO A N   1 
ATOM   2355  C  CA  . PRO A  1 316 ? 36.400  15.593  22.593  1.00 31.62  ? 316 PRO A CA  1 
ATOM   2356  C  C   . PRO A  1 316 ? 37.698  15.232  21.861  1.00 33.19  ? 316 PRO A C   1 
ATOM   2357  O  O   . PRO A  1 316 ? 37.673  14.911  20.675  1.00 29.99  ? 316 PRO A O   1 
ATOM   2358  C  CB  . PRO A  1 316 ? 35.822  16.916  22.049  1.00 33.34  ? 316 PRO A CB  1 
ATOM   2359  C  CG  . PRO A  1 316 ? 36.419  17.962  22.961  1.00 34.57  ? 316 PRO A CG  1 
ATOM   2360  C  CD  . PRO A  1 316 ? 36.344  17.314  24.315  1.00 34.67  ? 316 PRO A CD  1 
ATOM   2361  N  N   . SER A  1 317 ? 38.827  15.282  22.553  1.00 30.49  ? 317 SER A N   1 
ATOM   2362  C  CA  . SER A  1 317 ? 40.084  14.928  21.907  1.00 31.03  ? 317 SER A CA  1 
ATOM   2363  C  C   . SER A  1 317 ? 40.098  13.480  21.384  1.00 31.11  ? 317 SER A C   1 
ATOM   2364  O  O   . SER A  1 317 ? 40.785  13.174  20.419  1.00 26.53  ? 317 SER A O   1 
ATOM   2365  C  CB  . SER A  1 317 ? 41.277  15.182  22.850  1.00 34.18  ? 317 SER A CB  1 
ATOM   2366  O  OG  . SER A  1 317 ? 41.262  14.290  23.952  1.00 37.17  ? 317 SER A OG  1 
ATOM   2367  N  N   . LYS A  1 318 ? 39.329  12.587  21.995  1.00 31.73  ? 318 LYS A N   1 
ATOM   2368  C  CA  . LYS A  1 318 ? 39.321  11.203  21.520  1.00 34.10  ? 318 LYS A CA  1 
ATOM   2369  C  C   . LYS A  1 318 ? 38.695  11.003  20.130  1.00 33.79  ? 318 LYS A C   1 
ATOM   2370  O  O   . LYS A  1 318 ? 38.857  9.933   19.537  1.00 27.31  ? 318 LYS A O   1 
ATOM   2371  C  CB  . LYS A  1 318 ? 38.650  10.269  22.532  1.00 32.04  ? 318 LYS A CB  1 
ATOM   2372  C  CG  . LYS A  1 318 ? 39.084  10.475  23.972  1.00 33.51  ? 318 LYS A CG  1 
ATOM   2373  C  CD  . LYS A  1 318 ? 40.577  10.284  24.198  1.00 33.60  ? 318 LYS A CD  1 
ATOM   2374  C  CE  . LYS A  1 318 ? 40.910  10.353  25.712  1.00 39.78  ? 318 LYS A CE  1 
ATOM   2375  N  NZ  . LYS A  1 318 ? 42.295  10.873  26.014  1.00 37.61  ? 318 LYS A NZ  1 
ATOM   2376  N  N   . LEU A  1 319 ? 37.982  12.014  19.626  1.00 27.42  ? 319 LEU A N   1 
ATOM   2377  C  CA  . LEU A  1 319 ? 37.382  11.967  18.285  1.00 26.15  ? 319 LEU A CA  1 
ATOM   2378  C  C   . LEU A  1 319 ? 38.449  12.128  17.212  1.00 32.64  ? 319 LEU A C   1 
ATOM   2379  O  O   . LEU A  1 319 ? 38.234  11.772  16.046  1.00 28.66  ? 319 LEU A O   1 
ATOM   2380  C  CB  . LEU A  1 319 ? 36.360  13.106  18.103  1.00 24.71  ? 319 LEU A CB  1 
ATOM   2381  C  CG  . LEU A  1 319 ? 35.156  13.212  19.044  1.00 27.80  ? 319 LEU A CG  1 
ATOM   2382  C  CD1 . LEU A  1 319 ? 34.432  14.581  18.841  1.00 24.95  ? 319 LEU A CD1 1 
ATOM   2383  C  CD2 . LEU A  1 319 ? 34.201  12.042  18.792  1.00 23.88  ? 319 LEU A CD2 1 
ATOM   2384  N  N   . VAL A  1 320 ? 39.591  12.700  17.600  1.00 29.66  ? 320 VAL A N   1 
ATOM   2385  C  CA  . VAL A  1 320 ? 40.603  13.066  16.617  1.00 31.62  ? 320 VAL A CA  1 
ATOM   2386  C  C   . VAL A  1 320 ? 41.584  11.921  16.452  1.00 37.12  ? 320 VAL A C   1 
ATOM   2387  O  O   . VAL A  1 320 ? 42.411  11.654  17.328  1.00 35.75  ? 320 VAL A O   1 
ATOM   2388  C  CB  . VAL A  1 320 ? 41.336  14.371  16.988  1.00 31.00  ? 320 VAL A CB  1 
ATOM   2389  C  CG1 . VAL A  1 320 ? 42.266  14.784  15.865  1.00 31.03  ? 320 VAL A CG1 1 
ATOM   2390  C  CG2 . VAL A  1 320 ? 40.322  15.490  17.283  1.00 32.72  ? 320 VAL A CG2 1 
ATOM   2391  N  N   . THR A  1 321 ? 41.465  11.219  15.334  1.00 38.60  ? 321 THR A N   1 
ATOM   2392  C  CA  . THR A  1 321 ? 42.281  10.037  15.112  1.00 33.36  ? 321 THR A CA  1 
ATOM   2393  C  C   . THR A  1 321 ? 43.465  10.374  14.229  1.00 26.10  ? 321 THR A C   1 
ATOM   2394  O  O   . THR A  1 321 ? 44.396  9.593   14.131  1.00 32.89  ? 321 THR A O   1 
ATOM   2395  C  CB  . THR A  1 321 ? 41.465  8.927   14.431  1.00 28.27  ? 321 THR A CB  1 
ATOM   2396  O  OG1 . THR A  1 321 ? 40.805  9.472   13.288  1.00 29.63  ? 321 THR A OG1 1 
ATOM   2397  C  CG2 . THR A  1 321 ? 40.440  8.371   15.387  1.00 27.27  ? 321 THR A CG2 1 
ATOM   2398  N  N   . HIS A  1 322 ? 43.416  11.535  13.576  1.00 26.13  ? 322 HIS A N   1 
ATOM   2399  C  CA  . HIS A  1 322 ? 44.439  11.912  12.606  1.00 30.13  ? 322 HIS A CA  1 
ATOM   2400  C  C   . HIS A  1 322 ? 44.697  13.401  12.725  1.00 36.53  ? 322 HIS A C   1 
ATOM   2401  O  O   . HIS A  1 322 ? 43.783  14.206  12.545  1.00 32.43  ? 322 HIS A O   1 
ATOM   2402  C  CB  . HIS A  1 322 ? 43.973  11.665  11.168  1.00 29.94  ? 322 HIS A CB  1 
ATOM   2403  C  CG  . HIS A  1 322 ? 43.733  10.230  10.815  1.00 36.98  ? 322 HIS A CG  1 
ATOM   2404  N  ND1 . HIS A  1 322 ? 42.736  9.471   11.397  1.00 39.08  ? 322 HIS A ND1 1 
ATOM   2405  C  CD2 . HIS A  1 322 ? 44.312  9.438   9.881   1.00 33.60  ? 322 HIS A CD2 1 
ATOM   2406  C  CE1 . HIS A  1 322 ? 42.737  8.262   10.860  1.00 35.35  ? 322 HIS A CE1 1 
ATOM   2407  N  NE2 . HIS A  1 322 ? 43.673  8.221   9.927   1.00 35.56  ? 322 HIS A NE2 1 
ATOM   2408  N  N   . VAL A  1 323 ? 45.934  13.772  13.033  1.00 35.83  ? 323 VAL A N   1 
ATOM   2409  C  CA  . VAL A  1 323 ? 46.342  15.169  13.002  1.00 29.11  ? 323 VAL A CA  1 
ATOM   2410  C  C   . VAL A  1 323 ? 47.443  15.332  11.954  1.00 35.48  ? 323 VAL A C   1 
ATOM   2411  O  O   . VAL A  1 323 ? 48.425  14.590  11.955  1.00 43.42  ? 323 VAL A O   1 
ATOM   2412  C  CB  . VAL A  1 323 ? 46.854  15.630  14.376  1.00 29.66  ? 323 VAL A CB  1 
ATOM   2413  C  CG1 . VAL A  1 323 ? 46.998  17.157  14.402  1.00 30.16  ? 323 VAL A CG1 1 
ATOM   2414  C  CG2 . VAL A  1 323 ? 45.912  15.147  15.479  1.00 22.11  ? 323 VAL A CG2 1 
ATOM   2415  N  N   . PHE A  1 324 ? 47.262  16.281  11.047  1.00 37.70  ? 324 PHE A N   1 
ATOM   2416  C  CA  . PHE A  1 324 ? 48.270  16.609  10.051  1.00 35.15  ? 324 PHE A CA  1 
ATOM   2417  C  C   . PHE A  1 324 ? 48.683  18.073  10.220  1.00 38.98  ? 324 PHE A C   1 
ATOM   2418  O  O   . PHE A  1 324 ? 47.897  18.884  10.701  1.00 47.68  ? 324 PHE A O   1 
ATOM   2419  C  CB  . PHE A  1 324 ? 47.708  16.428  8.638   1.00 35.41  ? 324 PHE A CB  1 
ATOM   2420  C  CG  . PHE A  1 324 ? 47.154  15.063  8.368   1.00 39.39  ? 324 PHE A CG  1 
ATOM   2421  C  CD1 . PHE A  1 324 ? 47.911  13.930  8.617   1.00 37.59  ? 324 PHE A CD1 1 
ATOM   2422  C  CD2 . PHE A  1 324 ? 45.880  14.915  7.835   1.00 37.81  ? 324 PHE A CD2 1 
ATOM   2423  C  CE1 . PHE A  1 324 ? 47.401  12.671  8.356   1.00 38.08  ? 324 PHE A CE1 1 
ATOM   2424  C  CE2 . PHE A  1 324 ? 45.364  13.672  7.564   1.00 37.15  ? 324 PHE A CE2 1 
ATOM   2425  C  CZ  . PHE A  1 324 ? 46.122  12.537  7.824   1.00 30.51  ? 324 PHE A CZ  1 
ATOM   2426  N  N   . ARG A  1 325 ? 49.906  18.410  9.815   1.00 37.42  ? 325 ARG A N   1 
ATOM   2427  C  CA  . ARG A  1 325 ? 50.349  19.807  9.799   1.00 40.68  ? 325 ARG A CA  1 
ATOM   2428  C  C   . ARG A  1 325 ? 50.434  20.322  8.365   1.00 44.40  ? 325 ARG A C   1 
ATOM   2429  O  O   . ARG A  1 325 ? 50.772  19.571  7.444   1.00 46.72  ? 325 ARG A O   1 
ATOM   2430  C  CB  . ARG A  1 325 ? 51.717  19.973  10.477  1.00 37.75  ? 325 ARG A CB  1 
ATOM   2431  C  CG  . ARG A  1 325 ? 51.766  19.557  11.927  1.00 39.89  ? 325 ARG A CG  1 
ATOM   2432  C  CD  . ARG A  1 325 ? 53.016  20.093  12.621  1.00 43.75  ? 325 ARG A CD  1 
ATOM   2433  N  NE  . ARG A  1 325 ? 52.829  21.488  12.976  1.00 55.15  ? 325 ARG A NE  1 
ATOM   2434  C  CZ  . ARG A  1 325 ? 52.690  21.935  14.219  1.00 48.97  ? 325 ARG A CZ  1 
ATOM   2435  N  NH1 . ARG A  1 325 ? 52.748  21.101  15.246  1.00 39.13  ? 325 ARG A NH1 1 
ATOM   2436  N  NH2 . ARG A  1 325 ? 52.509  23.229  14.425  1.00 50.61  ? 325 ARG A NH2 1 
ATOM   2437  N  N   . GLY A  1 326 ? 50.124  21.602  8.175   1.00 41.41  ? 326 GLY A N   1 
ATOM   2438  C  CA  . GLY A  1 326 ? 50.297  22.227  6.879   1.00 40.14  ? 326 GLY A CA  1 
ATOM   2439  C  C   . GLY A  1 326 ? 49.011  22.518  6.125   1.00 45.11  ? 326 GLY A C   1 
ATOM   2440  O  O   . GLY A  1 326 ? 48.123  21.676  6.003   1.00 46.48  ? 326 GLY A O   1 
ATOM   2441  N  N   . PHE A  1 327 ? 48.939  23.733  5.603   1.00 45.88  ? 327 PHE A N   1 
ATOM   2442  C  CA  . PHE A  1 327 ? 47.793  24.229  4.862   1.00 45.21  ? 327 PHE A CA  1 
ATOM   2443  C  C   . PHE A  1 327 ? 47.355  23.292  3.720   1.00 46.32  ? 327 PHE A C   1 
ATOM   2444  O  O   . PHE A  1 327 ? 46.164  22.972  3.585   1.00 45.58  ? 327 PHE A O   1 
ATOM   2445  C  CB  . PHE A  1 327 ? 48.143  25.624  4.340   1.00 42.25  ? 327 PHE A CB  1 
ATOM   2446  C  CG  . PHE A  1 327 ? 47.010  26.328  3.673   1.00 44.63  ? 327 PHE A CG  1 
ATOM   2447  C  CD1 . PHE A  1 327 ? 45.906  26.733  4.401   1.00 44.83  ? 327 PHE A CD1 1 
ATOM   2448  C  CD2 . PHE A  1 327 ? 47.063  26.617  2.320   1.00 45.64  ? 327 PHE A CD2 1 
ATOM   2449  C  CE1 . PHE A  1 327 ? 44.858  27.394  3.790   1.00 46.03  ? 327 PHE A CE1 1 
ATOM   2450  C  CE2 . PHE A  1 327 ? 46.022  27.282  1.698   1.00 46.77  ? 327 PHE A CE2 1 
ATOM   2451  C  CZ  . PHE A  1 327 ? 44.913  27.666  2.436   1.00 50.04  ? 327 PHE A CZ  1 
ATOM   2452  N  N   . ASP A  1 328 ? 48.317  22.848  2.915   1.00 42.56  ? 328 ASP A N   1 
ATOM   2453  C  CA  . ASP A  1 328 ? 48.041  21.962  1.781   1.00 45.64  ? 328 ASP A CA  1 
ATOM   2454  C  C   . ASP A  1 328 ? 47.368  20.649  2.206   1.00 50.17  ? 328 ASP A C   1 
ATOM   2455  O  O   . ASP A  1 328 ? 46.672  20.004  1.417   1.00 49.68  ? 328 ASP A O   1 
ATOM   2456  C  CB  . ASP A  1 328 ? 49.334  21.638  1.021   1.00 47.94  ? 328 ASP A CB  1 
ATOM   2457  C  CG  . ASP A  1 328 ? 49.855  22.820  0.213   1.00 56.22  ? 328 ASP A CG  1 
ATOM   2458  O  OD1 . ASP A  1 328 ? 49.233  23.901  0.271   1.00 57.04  ? 328 ASP A OD1 1 
ATOM   2459  O  OD2 . ASP A  1 328 ? 50.884  22.665  -0.485  1.00 56.81  ? 328 ASP A OD2 1 
ATOM   2460  N  N   . ASN A  1 329 ? 47.575  20.248  3.453   1.00 42.41  ? 329 ASN A N   1 
ATOM   2461  C  CA  . ASN A  1 329 ? 47.032  18.974  3.894   1.00 41.61  ? 329 ASN A CA  1 
ATOM   2462  C  C   . ASN A  1 329 ? 45.536  19.021  4.178   1.00 41.88  ? 329 ASN A C   1 
ATOM   2463  O  O   . ASN A  1 329 ? 44.936  18.031  4.591   1.00 38.57  ? 329 ASN A O   1 
ATOM   2464  C  CB  . ASN A  1 329 ? 47.843  18.417  5.063   1.00 38.45  ? 329 ASN A CB  1 
ATOM   2465  C  CG  . ASN A  1 329 ? 49.053  17.650  4.588   1.00 41.32  ? 329 ASN A CG  1 
ATOM   2466  O  OD1 . ASN A  1 329 ? 49.051  17.110  3.479   1.00 42.65  ? 329 ASN A OD1 1 
ATOM   2467  N  ND2 . ASN A  1 329 ? 50.089  17.597  5.409   1.00 38.85  ? 329 ASN A ND2 1 
ATOM   2468  N  N   . ILE A  1 330 ? 44.939  20.182  3.927   1.00 45.95  ? 330 ILE A N   1 
ATOM   2469  C  CA  . ILE A  1 330 ? 43.495  20.323  3.983   1.00 37.14  ? 330 ILE A CA  1 
ATOM   2470  C  C   . ILE A  1 330 ? 42.942  19.354  2.977   1.00 36.53  ? 330 ILE A C   1 
ATOM   2471  O  O   . ILE A  1 330 ? 41.940  18.680  3.226   1.00 43.64  ? 330 ILE A O   1 
ATOM   2472  C  CB  . ILE A  1 330 ? 43.058  21.751  3.617   1.00 40.07  ? 330 ILE A CB  1 
ATOM   2473  C  CG1 . ILE A  1 330 ? 43.233  22.661  4.828   1.00 36.49  ? 330 ILE A CG1 1 
ATOM   2474  C  CG2 . ILE A  1 330 ? 41.601  21.776  3.115   1.00 31.35  ? 330 ILE A CG2 1 
ATOM   2475  C  CD1 . ILE A  1 330 ? 43.244  24.135  4.481   1.00 35.41  ? 330 ILE A CD1 1 
ATOM   2476  N  N   . GLU A  1 331 ? 43.620  19.271  1.839   1.00 37.58  ? 331 GLU A N   1 
ATOM   2477  C  CA  . GLU A  1 331 ? 43.215  18.355  0.782   1.00 41.15  ? 331 GLU A CA  1 
ATOM   2478  C  C   . GLU A  1 331 ? 43.295  16.892  1.255   1.00 44.25  ? 331 GLU A C   1 
ATOM   2479  O  O   . GLU A  1 331 ? 42.362  16.108  1.057   1.00 47.05  ? 331 GLU A O   1 
ATOM   2480  C  CB  . GLU A  1 331 ? 44.081  18.576  -0.456  1.00 38.14  ? 331 GLU A CB  1 
ATOM   2481  C  CG  . GLU A  1 331 ? 43.700  17.708  -1.640  1.00 45.60  ? 331 GLU A CG  1 
ATOM   2482  C  CD  . GLU A  1 331 ? 44.634  17.896  -2.827  1.00 51.61  ? 331 GLU A CD  1 
ATOM   2483  O  OE1 . GLU A  1 331 ? 45.609  18.680  -2.706  1.00 43.07  ? 331 GLU A OE1 1 
ATOM   2484  O  OE2 . GLU A  1 331 ? 44.385  17.254  -3.878  1.00 56.79  ? 331 GLU A OE2 1 
ATOM   2485  N  N   . LYS A  1 332 ? 44.414  16.543  1.887   1.00 41.31  ? 332 LYS A N   1 
ATOM   2486  C  CA  . LYS A  1 332 ? 44.620  15.208  2.447   1.00 43.17  ? 332 LYS A CA  1 
ATOM   2487  C  C   . LYS A  1 332 ? 43.465  14.850  3.368   1.00 43.57  ? 332 LYS A C   1 
ATOM   2488  O  O   . LYS A  1 332 ? 42.845  13.796  3.237   1.00 46.06  ? 332 LYS A O   1 
ATOM   2489  C  CB  . LYS A  1 332 ? 45.924  15.186  3.248   1.00 51.47  ? 332 LYS A CB  1 
ATOM   2490  C  CG  . LYS A  1 332 ? 46.511  13.811  3.522   1.00 59.49  ? 332 LYS A CG  1 
ATOM   2491  C  CD  . LYS A  1 332 ? 47.796  13.915  4.359   1.00 62.75  ? 332 LYS A CD  1 
ATOM   2492  C  CE  . LYS A  1 332 ? 48.590  12.618  4.328   1.00 71.58  ? 332 LYS A CE  1 
ATOM   2493  N  NZ  . LYS A  1 332 ? 49.627  12.529  5.399   1.00 75.43  ? 332 LYS A NZ  1 
ATOM   2494  N  N   . ALA A  1 333 ? 43.177  15.744  4.305   1.00 36.02  ? 333 ALA A N   1 
ATOM   2495  C  CA  . ALA A  1 333 ? 42.154  15.484  5.304   1.00 35.45  ? 333 ALA A CA  1 
ATOM   2496  C  C   . ALA A  1 333 ? 40.778  15.321  4.659   1.00 38.47  ? 333 ALA A C   1 
ATOM   2497  O  O   . ALA A  1 333 ? 40.046  14.380  4.959   1.00 37.13  ? 333 ALA A O   1 
ATOM   2498  C  CB  . ALA A  1 333 ? 42.135  16.597  6.342   1.00 28.77  ? 333 ALA A CB  1 
ATOM   2499  N  N   . PHE A  1 334 ? 40.438  16.231  3.758   1.00 36.20  ? 334 PHE A N   1 
ATOM   2500  C  CA  . PHE A  1 334 ? 39.154  16.161  3.086   1.00 34.30  ? 334 PHE A CA  1 
ATOM   2501  C  C   . PHE A  1 334 ? 38.975  14.807  2.396   1.00 38.88  ? 334 PHE A C   1 
ATOM   2502  O  O   . PHE A  1 334 ? 37.915  14.185  2.517   1.00 32.86  ? 334 PHE A O   1 
ATOM   2503  C  CB  . PHE A  1 334 ? 39.010  17.294  2.072   1.00 35.69  ? 334 PHE A CB  1 
ATOM   2504  C  CG  . PHE A  1 334 ? 37.689  17.295  1.342   1.00 38.10  ? 334 PHE A CG  1 
ATOM   2505  C  CD1 . PHE A  1 334 ? 36.573  17.895  1.901   1.00 34.91  ? 334 PHE A CD1 1 
ATOM   2506  C  CD2 . PHE A  1 334 ? 37.572  16.704  0.097   1.00 39.61  ? 334 PHE A CD2 1 
ATOM   2507  C  CE1 . PHE A  1 334 ? 35.357  17.900  1.228   1.00 42.12  ? 334 PHE A CE1 1 
ATOM   2508  C  CE2 . PHE A  1 334 ? 36.358  16.704  -0.583  1.00 42.39  ? 334 PHE A CE2 1 
ATOM   2509  C  CZ  . PHE A  1 334 ? 35.249  17.303  -0.017  1.00 40.35  ? 334 PHE A CZ  1 
ATOM   2510  N  N   . MET A  1 335 ? 40.007  14.348  1.684   1.00 40.02  ? 335 MET A N   1 
ATOM   2511  C  CA  . MET A  1 335 ? 39.901  13.092  0.931   1.00 37.77  ? 335 MET A CA  1 
ATOM   2512  C  C   . MET A  1 335 ? 39.769  11.894  1.857   1.00 38.96  ? 335 MET A C   1 
ATOM   2513  O  O   . MET A  1 335 ? 39.173  10.883  1.488   1.00 40.16  ? 335 MET A O   1 
ATOM   2514  C  CB  . MET A  1 335 ? 41.075  12.909  -0.039  1.00 39.77  ? 335 MET A CB  1 
ATOM   2515  C  CG  . MET A  1 335 ? 41.119  13.950  -1.167  1.00 42.14  ? 335 MET A CG  1 
ATOM   2516  S  SD  . MET A  1 335 ? 39.613  14.013  -2.169  1.00 53.59  ? 335 MET A SD  1 
ATOM   2517  C  CE  . MET A  1 335 ? 39.890  12.627  -3.270  1.00 76.74  ? 335 MET A CE  1 
ATOM   2518  N  N   . LEU A  1 336 ? 40.325  12.011  3.062   1.00 39.39  ? 336 LEU A N   1 
ATOM   2519  C  CA  . LEU A  1 336 ? 40.097  11.007  4.094   1.00 41.64  ? 336 LEU A CA  1 
ATOM   2520  C  C   . LEU A  1 336 ? 38.625  10.858  4.389   1.00 42.44  ? 336 LEU A C   1 
ATOM   2521  O  O   . LEU A  1 336 ? 38.132  9.744   4.541   1.00 53.49  ? 336 LEU A O   1 
ATOM   2522  C  CB  . LEU A  1 336 ? 40.811  11.370  5.391   1.00 41.96  ? 336 LEU A CB  1 
ATOM   2523  C  CG  . LEU A  1 336 ? 42.068  10.568  5.664   1.00 46.83  ? 336 LEU A CG  1 
ATOM   2524  C  CD1 . LEU A  1 336 ? 42.790  10.339  4.356   1.00 53.23  ? 336 LEU A CD1 1 
ATOM   2525  C  CD2 . LEU A  1 336 ? 42.930  11.315  6.665   1.00 44.55  ? 336 LEU A CD2 1 
ATOM   2526  N  N   . MET A  1 337 ? 37.923  11.980  4.497   1.00 40.41  ? 337 MET A N   1 
ATOM   2527  C  CA  . MET A  1 337 ? 36.491  11.928  4.776   1.00 42.94  ? 337 MET A CA  1 
ATOM   2528  C  C   . MET A  1 337 ? 35.749  11.228  3.654   1.00 39.89  ? 337 MET A C   1 
ATOM   2529  O  O   . MET A  1 337 ? 34.655  10.709  3.854   1.00 47.08  ? 337 MET A O   1 
ATOM   2530  C  CB  . MET A  1 337 ? 35.912  13.327  4.994   1.00 42.28  ? 337 MET A CB  1 
ATOM   2531  C  CG  . MET A  1 337 ? 36.436  14.005  6.234   1.00 46.24  ? 337 MET A CG  1 
ATOM   2532  S  SD  . MET A  1 337 ? 36.268  12.989  7.711   1.00 43.88  ? 337 MET A SD  1 
ATOM   2533  C  CE  . MET A  1 337 ? 34.536  13.256  8.088   1.00 37.27  ? 337 MET A CE  1 
ATOM   2534  N  N   . LYS A  1 338 ? 36.336  11.227  2.467   1.00 41.52  ? 338 LYS A N   1 
ATOM   2535  C  CA  . LYS A  1 338 ? 35.671  10.602  1.340   1.00 50.79  ? 338 LYS A CA  1 
ATOM   2536  C  C   . LYS A  1 338 ? 35.905  9.110   1.362   1.00 57.14  ? 338 LYS A C   1 
ATOM   2537  O  O   . LYS A  1 338 ? 34.981  8.335   1.140   1.00 54.85  ? 338 LYS A O   1 
ATOM   2538  C  CB  . LYS A  1 338 ? 36.156  11.165  0.011   1.00 50.29  ? 338 LYS A CB  1 
ATOM   2539  C  CG  . LYS A  1 338 ? 35.285  10.711  -1.146  1.00 48.63  ? 338 LYS A CG  1 
ATOM   2540  C  CD  . LYS A  1 338 ? 35.927  11.026  -2.476  1.00 51.85  ? 338 LYS A CD  1 
ATOM   2541  C  CE  . LYS A  1 338 ? 34.997  10.658  -3.608  1.00 52.84  ? 338 LYS A CE  1 
ATOM   2542  N  NZ  . LYS A  1 338 ? 35.756  10.512  -4.871  1.00 58.00  ? 338 LYS A NZ  1 
ATOM   2543  N  N   . ASP A  1 339 ? 37.146  8.717   1.641   1.00 59.59  ? 339 ASP A N   1 
ATOM   2544  C  CA  . ASP A  1 339 ? 37.552  7.317   1.554   1.00 58.38  ? 339 ASP A CA  1 
ATOM   2545  C  C   . ASP A  1 339 ? 37.230  6.550   2.823   1.00 49.80  ? 339 ASP A C   1 
ATOM   2546  O  O   . ASP A  1 339 ? 37.142  5.328   2.815   1.00 52.47  ? 339 ASP A O   1 
ATOM   2547  C  CB  . ASP A  1 339 ? 39.052  7.215   1.266   1.00 68.52  ? 339 ASP A CB  1 
ATOM   2548  C  CG  . ASP A  1 339 ? 39.474  8.017   0.040   1.00 71.83  ? 339 ASP A CG  1 
ATOM   2549  O  OD1 . ASP A  1 339 ? 38.743  8.015   -0.978  1.00 65.69  ? 339 ASP A OD1 1 
ATOM   2550  O  OD2 . ASP A  1 339 ? 40.554  8.641   0.096   1.00 76.87  ? 339 ASP A OD2 1 
ATOM   2551  N  N   . LYS A  1 340 ? 37.074  7.277   3.918   1.00 46.02  ? 340 LYS A N   1 
ATOM   2552  C  CA  . LYS A  1 340 ? 36.734  6.686   5.205   1.00 43.15  ? 340 LYS A CA  1 
ATOM   2553  C  C   . LYS A  1 340 ? 37.463  5.386   5.556   1.00 41.77  ? 340 LYS A C   1 
ATOM   2554  O  O   . LYS A  1 340 ? 36.835  4.330   5.650   1.00 40.42  ? 340 LYS A O   1 
ATOM   2555  C  CB  . LYS A  1 340 ? 35.220  6.490   5.301   1.00 53.97  ? 340 LYS A CB  1 
ATOM   2556  C  CG  . LYS A  1 340 ? 34.497  7.647   5.991   1.00 62.89  ? 340 LYS A CG  1 
ATOM   2557  C  CD  . LYS A  1 340 ? 34.749  7.629   7.506   1.00 66.51  ? 340 LYS A CD  1 
ATOM   2558  C  CE  . LYS A  1 340 ? 34.477  8.988   8.161   1.00 69.54  ? 340 LYS A CE  1 
ATOM   2559  N  NZ  . LYS A  1 340 ? 33.059  9.433   8.058   1.00 71.48  ? 340 LYS A NZ  1 
ATOM   2560  N  N   . PRO A  1 341 ? 38.787  5.464   5.782   1.00 44.44  ? 341 PRO A N   1 
ATOM   2561  C  CA  . PRO A  1 341 ? 39.546  4.296   6.266   1.00 43.90  ? 341 PRO A CA  1 
ATOM   2562  C  C   . PRO A  1 341 ? 38.978  3.822   7.598   1.00 37.12  ? 341 PRO A C   1 
ATOM   2563  O  O   . PRO A  1 341 ? 38.373  4.619   8.307   1.00 39.24  ? 341 PRO A O   1 
ATOM   2564  C  CB  . PRO A  1 341 ? 40.962  4.846   6.480   1.00 47.94  ? 341 PRO A CB  1 
ATOM   2565  C  CG  . PRO A  1 341 ? 40.996  6.188   5.786   1.00 47.34  ? 341 PRO A CG  1 
ATOM   2566  C  CD  . PRO A  1 341 ? 39.595  6.696   5.767   1.00 44.94  ? 341 PRO A CD  1 
ATOM   2567  N  N   . LYS A  1 342 ? 39.183  2.556   7.940   1.00 39.67  ? 342 LYS A N   1 
ATOM   2568  C  CA  . LYS A  1 342 ? 38.530  1.943   9.100   1.00 41.31  ? 342 LYS A CA  1 
ATOM   2569  C  C   . LYS A  1 342 ? 38.944  2.510   10.459  1.00 43.13  ? 342 LYS A C   1 
ATOM   2570  O  O   . LYS A  1 342 ? 38.241  2.297   11.451  1.00 41.15  ? 342 LYS A O   1 
ATOM   2571  C  CB  . LYS A  1 342 ? 38.768  0.432   9.099   1.00 46.91  ? 342 LYS A CB  1 
ATOM   2572  C  CG  . LYS A  1 342 ? 40.233  0.056   9.028   1.00 59.91  ? 342 LYS A CG  1 
ATOM   2573  C  CD  . LYS A  1 342 ? 40.476  -1.432  9.299   1.00 65.09  ? 342 LYS A CD  1 
ATOM   2574  C  CE  . LYS A  1 342 ? 41.963  -1.759  9.225   1.00 64.15  ? 342 LYS A CE  1 
ATOM   2575  N  NZ  . LYS A  1 342 ? 42.220  -3.224  9.247   1.00 70.16  ? 342 LYS A NZ  1 
ATOM   2576  N  N   . ASP A  1 343 ? 40.084  3.201   10.514  1.00 40.96  ? 343 ASP A N   1 
ATOM   2577  C  CA  . ASP A  1 343 ? 40.584  3.762   11.780  1.00 38.91  ? 343 ASP A CA  1 
ATOM   2578  C  C   . ASP A  1 343 ? 40.282  5.266   11.925  1.00 36.22  ? 343 ASP A C   1 
ATOM   2579  O  O   . ASP A  1 343 ? 40.679  5.919   12.888  1.00 35.47  ? 343 ASP A O   1 
ATOM   2580  C  CB  . ASP A  1 343 ? 42.086  3.501   11.928  1.00 39.46  ? 343 ASP A CB  1 
ATOM   2581  C  CG  . ASP A  1 343 ? 42.899  4.083   10.782  1.00 45.56  ? 343 ASP A CG  1 
ATOM   2582  O  OD1 . ASP A  1 343 ? 42.298  4.554   9.793   1.00 47.12  ? 343 ASP A OD1 1 
ATOM   2583  O  OD2 . ASP A  1 343 ? 44.143  4.067   10.870  1.00 51.95  ? 343 ASP A OD2 1 
ATOM   2584  N  N   . LEU A  1 344 ? 39.570  5.820   10.963  1.00 35.21  ? 344 LEU A N   1 
ATOM   2585  C  CA  . LEU A  1 344 ? 39.270  7.246   11.013  1.00 31.97  ? 344 LEU A CA  1 
ATOM   2586  C  C   . LEU A  1 344 ? 38.011  7.574   11.814  1.00 35.72  ? 344 LEU A C   1 
ATOM   2587  O  O   . LEU A  1 344 ? 36.987  6.906   11.681  1.00 36.45  ? 344 LEU A O   1 
ATOM   2588  C  CB  . LEU A  1 344 ? 39.098  7.777   9.604   1.00 30.16  ? 344 LEU A CB  1 
ATOM   2589  C  CG  . LEU A  1 344 ? 38.639  9.228   9.501   1.00 36.29  ? 344 LEU A CG  1 
ATOM   2590  C  CD1 . LEU A  1 344 ? 39.793  10.168  9.820   1.00 34.19  ? 344 LEU A CD1 1 
ATOM   2591  C  CD2 . LEU A  1 344 ? 38.061  9.496   8.120   1.00 30.78  ? 344 LEU A CD2 1 
ATOM   2592  N  N   . ILE A  1 345 ? 38.099  8.593   12.658  1.00 30.92  ? 345 ILE A N   1 
ATOM   2593  C  CA  . ILE A  1 345 ? 36.910  9.241   13.199  1.00 29.18  ? 345 ILE A CA  1 
ATOM   2594  C  C   . ILE A  1 345 ? 36.893  10.677  12.675  1.00 39.88  ? 345 ILE A C   1 
ATOM   2595  O  O   . ILE A  1 345 ? 36.116  11.000  11.775  1.00 33.75  ? 345 ILE A O   1 
ATOM   2596  C  CB  . ILE A  1 345 ? 36.856  9.182   14.749  1.00 36.35  ? 345 ILE A CB  1 
ATOM   2597  C  CG1 . ILE A  1 345 ? 36.822  7.723   15.213  1.00 35.33  ? 345 ILE A CG1 1 
ATOM   2598  C  CG2 . ILE A  1 345 ? 35.617  9.894   15.265  1.00 28.28  ? 345 ILE A CG2 1 
ATOM   2599  C  CD1 . ILE A  1 345 ? 36.895  7.539   16.710  1.00 29.27  ? 345 ILE A CD1 1 
ATOM   2600  N  N   . LYS A  1 346 ? 37.778  11.529  13.197  1.00 35.59  ? 346 LYS A N   1 
ATOM   2601  C  CA  . LYS A  1 346 ? 37.867  12.894  12.686  1.00 34.18  ? 346 LYS A CA  1 
ATOM   2602  C  C   . LYS A  1 346 ? 39.335  13.285  12.442  1.00 33.46  ? 346 LYS A C   1 
ATOM   2603  O  O   . LYS A  1 346 ? 40.209  13.012  13.276  1.00 30.83  ? 346 LYS A O   1 
ATOM   2604  C  CB  . LYS A  1 346 ? 37.170  13.842  13.662  1.00 34.54  ? 346 LYS A CB  1 
ATOM   2605  C  CG  . LYS A  1 346 ? 36.803  15.198  13.096  1.00 47.17  ? 346 LYS A CG  1 
ATOM   2606  C  CD  . LYS A  1 346 ? 35.452  15.214  12.343  1.00 38.51  ? 346 LYS A CD  1 
ATOM   2607  C  CE  . LYS A  1 346 ? 35.146  16.653  11.952  1.00 34.48  ? 346 LYS A CE  1 
ATOM   2608  N  NZ  . LYS A  1 346 ? 33.880  16.843  11.216  1.00 32.53  ? 346 LYS A NZ  1 
ATOM   2609  N  N   . PRO A  1 347 ? 39.631  13.869  11.275  1.00 31.17  ? 347 PRO A N   1 
ATOM   2610  C  CA  . PRO A  1 347 ? 40.987  14.392  11.033  1.00 36.20  ? 347 PRO A CA  1 
ATOM   2611  C  C   . PRO A  1 347 ? 41.055  15.855  11.442  1.00 39.96  ? 347 PRO A C   1 
ATOM   2612  O  O   . PRO A  1 347 ? 40.025  16.531  11.396  1.00 46.72  ? 347 PRO A O   1 
ATOM   2613  C  CB  . PRO A  1 347 ? 41.129  14.327  9.499   1.00 35.83  ? 347 PRO A CB  1 
ATOM   2614  C  CG  . PRO A  1 347 ? 39.757  13.915  8.967   1.00 33.85  ? 347 PRO A CG  1 
ATOM   2615  C  CD  . PRO A  1 347 ? 38.776  14.020  10.091  1.00 30.93  ? 347 PRO A CD  1 
ATOM   2616  N  N   . VAL A  1 348 ? 42.237  16.342  11.806  1.00 35.30  ? 348 VAL A N   1 
ATOM   2617  C  CA  . VAL A  1 348 ? 42.431  17.758  12.083  1.00 30.16  ? 348 VAL A CA  1 
ATOM   2618  C  C   . VAL A  1 348 ? 43.700  18.208  11.386  1.00 36.30  ? 348 VAL A C   1 
ATOM   2619  O  O   . VAL A  1 348 ? 44.706  17.488  11.366  1.00 37.04  ? 348 VAL A O   1 
ATOM   2620  C  CB  . VAL A  1 348 ? 42.510  18.056  13.599  1.00 32.45  ? 348 VAL A CB  1 
ATOM   2621  C  CG1 . VAL A  1 348 ? 43.017  19.497  13.876  1.00 27.59  ? 348 VAL A CG1 1 
ATOM   2622  C  CG2 . VAL A  1 348 ? 41.171  17.816  14.260  1.00 33.07  ? 348 VAL A CG2 1 
ATOM   2623  N  N   . VAL A  1 349 ? 43.639  19.383  10.775  1.00 31.68  ? 349 VAL A N   1 
ATOM   2624  C  CA  . VAL A  1 349 ? 44.812  19.970  10.161  1.00 36.64  ? 349 VAL A CA  1 
ATOM   2625  C  C   . VAL A  1 349 ? 45.268  21.160  10.997  1.00 40.70  ? 349 VAL A C   1 
ATOM   2626  O  O   . VAL A  1 349 ? 44.509  22.109  11.197  1.00 37.22  ? 349 VAL A O   1 
ATOM   2627  C  CB  . VAL A  1 349 ? 44.535  20.424  8.724   1.00 32.40  ? 349 VAL A CB  1 
ATOM   2628  C  CG1 . VAL A  1 349 ? 45.824  20.936  8.073   1.00 35.53  ? 349 VAL A CG1 1 
ATOM   2629  C  CG2 . VAL A  1 349 ? 43.969  19.287  7.940   1.00 32.88  ? 349 VAL A CG2 1 
ATOM   2630  N  N   . ILE A  1 350 ? 46.501  21.088  11.493  1.00 37.81  ? 350 ILE A N   1 
ATOM   2631  C  CA  . ILE A  1 350 ? 47.075  22.155  12.299  1.00 35.48  ? 350 ILE A CA  1 
ATOM   2632  C  C   . ILE A  1 350 ? 47.782  23.127  11.356  1.00 40.95  ? 350 ILE A C   1 
ATOM   2633  O  O   . ILE A  1 350 ? 48.552  22.712  10.484  1.00 40.64  ? 350 ILE A O   1 
ATOM   2634  C  CB  . ILE A  1 350 ? 48.059  21.589  13.353  1.00 44.04  ? 350 ILE A CB  1 
ATOM   2635  C  CG1 . ILE A  1 350 ? 47.331  20.666  14.343  1.00 41.23  ? 350 ILE A CG1 1 
ATOM   2636  C  CG2 . ILE A  1 350 ? 48.794  22.705  14.088  1.00 42.77  ? 350 ILE A CG2 1 
ATOM   2637  C  CD1 . ILE A  1 350 ? 46.171  21.312  15.078  1.00 36.03  ? 350 ILE A CD1 1 
ATOM   2638  N  N   . LEU A  1 351 ? 47.497  24.417  11.514  1.00 41.43  ? 351 LEU A N   1 
ATOM   2639  C  CA  . LEU A  1 351 ? 48.000  25.436  10.595  1.00 44.24  ? 351 LEU A CA  1 
ATOM   2640  C  C   . LEU A  1 351 ? 48.967  26.431  11.251  1.00 51.53  ? 351 LEU A C   1 
ATOM   2641  O  O   . LEU A  1 351 ? 49.306  27.447  10.645  1.00 54.03  ? 351 LEU A O   1 
ATOM   2642  C  CB  . LEU A  1 351 ? 46.834  26.183  9.932   1.00 45.14  ? 351 LEU A CB  1 
ATOM   2643  C  CG  . LEU A  1 351 ? 45.897  25.316  9.075   1.00 48.27  ? 351 LEU A CG  1 
ATOM   2644  C  CD1 . LEU A  1 351 ? 44.583  26.026  8.724   1.00 41.83  ? 351 LEU A CD1 1 
ATOM   2645  C  CD2 . LEU A  1 351 ? 46.618  24.874  7.816   1.00 51.38  ? 351 LEU A CD2 1 
ATOM   2646  N  N   . ALA A  1 352 ? 49.411  26.135  12.475  1.00 53.97  ? 352 ALA A N   1 
ATOM   2647  C  CA  . ALA A  1 352 ? 50.347  27.010  13.185  1.00 56.75  ? 352 ALA A CA  1 
ATOM   2648  C  C   . ALA A  1 352 ? 51.265  26.262  14.167  1.00 64.23  ? 352 ALA A C   1 
ATOM   2649  O  O   . ALA A  1 352 ? 52.464  26.547  14.271  1.00 73.49  ? 352 ALA A O   1 
ATOM   2650  C  CB  . ALA A  1 352 ? 49.591  28.102  13.910  1.00 56.74  ? 352 ALA A CB  1 
ATOM   2651  O  OXT . ALA A  1 352 ? 50.844  25.366  14.899  1.00 49.26  ? 352 ALA A OXT 1 
ATOM   2652  N  N   . MET B  1 1   ? 5.806   -6.536  67.111  1.00 49.34  ? 1   MET B N   1 
ATOM   2653  C  CA  . MET B  1 1   ? 7.150   -6.155  66.683  1.00 48.74  ? 1   MET B CA  1 
ATOM   2654  C  C   . MET B  1 1   ? 7.616   -4.869  67.368  1.00 48.40  ? 1   MET B C   1 
ATOM   2655  O  O   . MET B  1 1   ? 6.817   -4.136  67.953  1.00 51.62  ? 1   MET B O   1 
ATOM   2656  C  CB  . MET B  1 1   ? 7.196   -5.980  65.156  1.00 48.46  ? 1   MET B CB  1 
ATOM   2657  C  CG  . MET B  1 1   ? 6.258   -4.896  64.621  1.00 46.11  ? 1   MET B CG  1 
ATOM   2658  S  SD  . MET B  1 1   ? 6.612   -4.351  62.921  1.00 43.24  ? 1   MET B SD  1 
ATOM   2659  C  CE  . MET B  1 1   ? 5.641   -2.856  62.874  1.00 45.33  ? 1   MET B CE  1 
ATOM   2660  N  N   . LYS B  1 2   ? 8.912   -4.590  67.288  1.00 49.26  ? 2   LYS B N   1 
ATOM   2661  C  CA  . LYS B  1 2   ? 9.441   -3.325  67.796  1.00 51.72  ? 2   LYS B CA  1 
ATOM   2662  C  C   . LYS B  1 2   ? 9.840   -2.373  66.667  1.00 49.13  ? 2   LYS B C   1 
ATOM   2663  O  O   . LYS B  1 2   ? 10.270  -2.805  65.593  1.00 46.09  ? 2   LYS B O   1 
ATOM   2664  C  CB  . LYS B  1 2   ? 10.636  -3.568  68.719  1.00 64.82  ? 2   LYS B CB  1 
ATOM   2665  C  CG  . LYS B  1 2   ? 10.289  -4.279  70.022  1.00 77.58  ? 2   LYS B CG  1 
ATOM   2666  C  CD  . LYS B  1 2   ? 11.441  -4.196  71.013  1.00 88.14  ? 2   LYS B CD  1 
ATOM   2667  C  CE  . LYS B  1 2   ? 11.024  -4.646  72.405  1.00 95.24  ? 2   LYS B CE  1 
ATOM   2668  N  NZ  . LYS B  1 2   ? 12.042  -4.250  73.423  1.00 99.02  ? 2   LYS B NZ  1 
ATOM   2669  N  N   . GLY B  1 3   ? 9.695   -1.075  66.920  1.00 49.29  ? 3   GLY B N   1 
ATOM   2670  C  CA  . GLY B  1 3   ? 10.117  -0.049  65.980  1.00 47.00  ? 3   GLY B CA  1 
ATOM   2671  C  C   . GLY B  1 3   ? 10.569  1.190   66.729  1.00 47.36  ? 3   GLY B C   1 
ATOM   2672  O  O   . GLY B  1 3   ? 10.095  1.450   67.834  1.00 47.10  ? 3   GLY B O   1 
ATOM   2673  N  N   . PHE B  1 4   ? 11.491  1.948   66.144  1.00 45.97  ? 4   PHE B N   1 
ATOM   2674  C  CA  . PHE B  1 4   ? 11.955  3.186   66.760  1.00 44.72  ? 4   PHE B CA  1 
ATOM   2675  C  C   . PHE B  1 4   ? 11.014  4.324   66.405  1.00 47.76  ? 4   PHE B C   1 
ATOM   2676  O  O   . PHE B  1 4   ? 10.867  4.680   65.236  1.00 48.84  ? 4   PHE B O   1 
ATOM   2677  C  CB  . PHE B  1 4   ? 13.381  3.514   66.323  1.00 47.14  ? 4   PHE B CB  1 
ATOM   2678  C  CG  . PHE B  1 4   ? 13.992  4.662   67.074  1.00 48.08  ? 4   PHE B CG  1 
ATOM   2679  C  CD1 . PHE B  1 4   ? 14.231  4.566   68.434  1.00 50.13  ? 4   PHE B CD1 1 
ATOM   2680  C  CD2 . PHE B  1 4   ? 14.328  5.834   66.425  1.00 49.47  ? 4   PHE B CD2 1 
ATOM   2681  C  CE1 . PHE B  1 4   ? 14.792  5.623   69.129  1.00 49.72  ? 4   PHE B CE1 1 
ATOM   2682  C  CE2 . PHE B  1 4   ? 14.893  6.890   67.120  1.00 50.18  ? 4   PHE B CE2 1 
ATOM   2683  C  CZ  . PHE B  1 4   ? 15.121  6.782   68.473  1.00 47.08  ? 4   PHE B CZ  1 
ATOM   2684  N  N   . ALA B  1 5   ? 10.387  4.909   67.418  1.00 45.21  ? 5   ALA B N   1 
ATOM   2685  C  CA  . ALA B  1 5   ? 9.239   5.767   67.177  1.00 39.21  ? 5   ALA B CA  1 
ATOM   2686  C  C   . ALA B  1 5   ? 9.331   7.173   67.741  1.00 45.39  ? 5   ALA B C   1 
ATOM   2687  O  O   . ALA B  1 5   ? 10.000  7.416   68.741  1.00 49.70  ? 5   ALA B O   1 
ATOM   2688  C  CB  . ALA B  1 5   ? 7.985   5.091   67.712  1.00 40.43  ? 5   ALA B CB  1 
ATOM   2689  N  N   . MET B  1 6   ? 8.628   8.097   67.093  1.00 45.68  ? 6   MET B N   1 
ATOM   2690  C  CA  . MET B  1 6   ? 8.368   9.396   67.683  1.00 49.61  ? 6   MET B CA  1 
ATOM   2691  C  C   . MET B  1 6   ? 7.249   9.266   68.704  1.00 55.94  ? 6   MET B C   1 
ATOM   2692  O  O   . MET B  1 6   ? 6.080   9.203   68.327  1.00 58.07  ? 6   MET B O   1 
ATOM   2693  C  CB  . MET B  1 6   ? 7.946   10.387  66.611  1.00 46.51  ? 6   MET B CB  1 
ATOM   2694  C  CG  . MET B  1 6   ? 7.258   11.619  67.162  1.00 46.34  ? 6   MET B CG  1 
ATOM   2695  S  SD  . MET B  1 6   ? 7.156   12.882  65.910  1.00 56.33  ? 6   MET B SD  1 
ATOM   2696  C  CE  . MET B  1 6   ? 6.490   14.249  66.853  1.00 168.05 ? 6   MET B CE  1 
ATOM   2697  N  N   . LEU B  1 7   ? 7.604   9.225   69.988  1.00 59.78  ? 7   LEU B N   1 
ATOM   2698  C  CA  . LEU B  1 7   ? 6.613   9.090   71.058  1.00 58.70  ? 7   LEU B CA  1 
ATOM   2699  C  C   . LEU B  1 7   ? 5.684   10.302  71.121  1.00 66.26  ? 7   LEU B C   1 
ATOM   2700  O  O   . LEU B  1 7   ? 4.483   10.174  71.359  1.00 70.50  ? 7   LEU B O   1 
ATOM   2701  C  CB  . LEU B  1 7   ? 7.301   8.882   72.410  1.00 51.98  ? 7   LEU B CB  1 
ATOM   2702  C  CG  . LEU B  1 7   ? 8.359   7.783   72.484  1.00 51.97  ? 7   LEU B CG  1 
ATOM   2703  C  CD1 . LEU B  1 7   ? 9.014   7.744   73.863  1.00 52.37  ? 7   LEU B CD1 1 
ATOM   2704  C  CD2 . LEU B  1 7   ? 7.765   6.427   72.131  1.00 51.19  ? 7   LEU B CD2 1 
ATOM   2705  N  N   . SER B  1 8   ? 6.261   11.477  70.914  1.00 70.94  ? 8   SER B N   1 
ATOM   2706  C  CA  . SER B  1 8   ? 5.514   12.725  70.863  1.00 77.27  ? 8   SER B CA  1 
ATOM   2707  C  C   . SER B  1 8   ? 6.549   13.792  70.605  1.00 76.82  ? 8   SER B C   1 
ATOM   2708  O  O   . SER B  1 8   ? 7.746   13.518  70.674  1.00 77.52  ? 8   SER B O   1 
ATOM   2709  C  CB  . SER B  1 8   ? 4.802   13.006  72.185  1.00 82.90  ? 8   SER B CB  1 
ATOM   2710  O  OG  . SER B  1 8   ? 5.706   13.512  73.155  1.00 87.33  ? 8   SER B OG  1 
ATOM   2711  N  N   . ILE B  1 9   ? 6.107   15.006  70.311  1.00 74.91  ? 9   ILE B N   1 
ATOM   2712  C  CA  . ILE B  1 9   ? 7.060   16.063  70.012  1.00 74.69  ? 9   ILE B CA  1 
ATOM   2713  C  C   . ILE B  1 9   ? 8.189   16.103  71.041  1.00 74.90  ? 9   ILE B C   1 
ATOM   2714  O  O   . ILE B  1 9   ? 7.950   16.188  72.246  1.00 76.97  ? 9   ILE B O   1 
ATOM   2715  C  CB  . ILE B  1 9   ? 6.388   17.430  69.908  1.00 72.63  ? 9   ILE B CB  1 
ATOM   2716  C  CG1 . ILE B  1 9   ? 5.451   17.455  68.698  1.00 71.19  ? 9   ILE B CG1 1 
ATOM   2717  C  CG2 . ILE B  1 9   ? 7.442   18.508  69.782  1.00 72.97  ? 9   ILE B CG2 1 
ATOM   2718  C  CD1 . ILE B  1 9   ? 4.906   18.825  68.363  1.00 69.71  ? 9   ILE B CD1 1 
ATOM   2719  N  N   . GLY B  1 10  ? 9.419   16.010  70.548  1.00 72.35  ? 10  GLY B N   1 
ATOM   2720  C  CA  . GLY B  1 10  ? 10.598  16.079  71.388  1.00 70.71  ? 10  GLY B CA  1 
ATOM   2721  C  C   . GLY B  1 10  ? 11.042  14.740  71.947  1.00 72.91  ? 10  GLY B C   1 
ATOM   2722  O  O   . GLY B  1 10  ? 12.153  14.622  72.459  1.00 77.33  ? 10  GLY B O   1 
ATOM   2723  N  N   . LYS B  1 11  ? 10.185  13.727  71.852  1.00 69.40  ? 11  LYS B N   1 
ATOM   2724  C  CA  . LYS B  1 11  ? 10.477  12.433  72.465  1.00 68.13  ? 11  LYS B CA  1 
ATOM   2725  C  C   . LYS B  1 11  ? 10.527  11.303  71.439  1.00 63.60  ? 11  LYS B C   1 
ATOM   2726  O  O   . LYS B  1 11  ? 9.611   11.143  70.633  1.00 61.92  ? 11  LYS B O   1 
ATOM   2727  C  CB  . LYS B  1 11  ? 9.432   12.098  73.535  1.00 74.27  ? 11  LYS B CB  1 
ATOM   2728  C  CG  . LYS B  1 11  ? 9.167   13.205  74.551  1.00 80.78  ? 11  LYS B CG  1 
ATOM   2729  C  CD  . LYS B  1 11  ? 10.278  13.294  75.589  1.00 84.30  ? 11  LYS B CD  1 
ATOM   2730  C  CE  . LYS B  1 11  ? 9.996   14.381  76.624  1.00 86.15  ? 11  LYS B CE  1 
ATOM   2731  N  NZ  . LYS B  1 11  ? 10.963  14.342  77.766  1.00 82.36  ? 11  LYS B NZ  1 
ATOM   2732  N  N   . VAL B  1 12  ? 11.594  10.514  71.485  1.00 58.46  ? 12  VAL B N   1 
ATOM   2733  C  CA  . VAL B  1 12  ? 11.695  9.315   70.662  1.00 54.07  ? 12  VAL B CA  1 
ATOM   2734  C  C   . VAL B  1 12  ? 12.004  8.121   71.535  1.00 51.26  ? 12  VAL B C   1 
ATOM   2735  O  O   . VAL B  1 12  ? 12.468  8.275   72.667  1.00 47.26  ? 12  VAL B O   1 
ATOM   2736  C  CB  . VAL B  1 12  ? 12.804  9.427   69.611  1.00 52.63  ? 12  VAL B CB  1 
ATOM   2737  C  CG1 . VAL B  1 12  ? 12.425  10.448  68.537  1.00 47.73  ? 12  VAL B CG1 1 
ATOM   2738  C  CG2 . VAL B  1 12  ? 14.149  9.764   70.284  1.00 47.72  ? 12  VAL B CG2 1 
ATOM   2739  N  N   . GLY B  1 13  ? 11.752  6.927   71.008  1.00 51.54  ? 13  GLY B N   1 
ATOM   2740  C  CA  . GLY B  1 13  ? 12.038  5.707   71.739  1.00 52.06  ? 13  GLY B CA  1 
ATOM   2741  C  C   . GLY B  1 13  ? 11.531  4.464   71.037  1.00 54.60  ? 13  GLY B C   1 
ATOM   2742  O  O   . GLY B  1 13  ? 10.790  4.547   70.051  1.00 54.33  ? 13  GLY B O   1 
ATOM   2743  N  N   . TRP B  1 14  ? 11.939  3.306   71.549  1.00 52.39  ? 14  TRP B N   1 
ATOM   2744  C  CA  . TRP B  1 14  ? 11.480  2.025   71.035  1.00 52.43  ? 14  TRP B CA  1 
ATOM   2745  C  C   . TRP B  1 14  ? 10.112  1.684   71.582  1.00 57.26  ? 14  TRP B C   1 
ATOM   2746  O  O   . TRP B  1 14  ? 9.848   1.865   72.765  1.00 61.55  ? 14  TRP B O   1 
ATOM   2747  C  CB  . TRP B  1 14  ? 12.473  0.914   71.386  1.00 50.91  ? 14  TRP B CB  1 
ATOM   2748  C  CG  . TRP B  1 14  ? 13.751  1.057   70.639  1.00 50.95  ? 14  TRP B CG  1 
ATOM   2749  C  CD1 . TRP B  1 14  ? 14.877  1.689   71.063  1.00 47.38  ? 14  TRP B CD1 1 
ATOM   2750  C  CD2 . TRP B  1 14  ? 14.028  0.585   69.317  1.00 49.14  ? 14  TRP B CD2 1 
ATOM   2751  N  NE1 . TRP B  1 14  ? 15.842  1.633   70.094  1.00 47.28  ? 14  TRP B NE1 1 
ATOM   2752  C  CE2 . TRP B  1 14  ? 15.343  0.965   69.009  1.00 44.12  ? 14  TRP B CE2 1 
ATOM   2753  C  CE3 . TRP B  1 14  ? 13.290  -0.121  68.366  1.00 52.05  ? 14  TRP B CE3 1 
ATOM   2754  C  CZ2 . TRP B  1 14  ? 15.942  0.656   67.797  1.00 48.11  ? 14  TRP B CZ2 1 
ATOM   2755  C  CZ3 . TRP B  1 14  ? 13.885  -0.428  67.165  1.00 52.32  ? 14  TRP B CZ3 1 
ATOM   2756  C  CH2 . TRP B  1 14  ? 15.201  -0.041  66.890  1.00 48.90  ? 14  TRP B CH2 1 
ATOM   2757  N  N   . ILE B  1 15  ? 9.244   1.187   70.709  1.00 55.11  ? 15  ILE B N   1 
ATOM   2758  C  CA  . ILE B  1 15  ? 7.914   0.774   71.116  1.00 51.45  ? 15  ILE B CA  1 
ATOM   2759  C  C   . ILE B  1 15  ? 7.584   -0.609  70.569  1.00 52.76  ? 15  ILE B C   1 
ATOM   2760  O  O   . ILE B  1 15  ? 8.261   -1.121  69.678  1.00 45.35  ? 15  ILE B O   1 
ATOM   2761  C  CB  . ILE B  1 15  ? 6.842   1.767   70.630  1.00 49.05  ? 15  ILE B CB  1 
ATOM   2762  C  CG1 . ILE B  1 15  ? 7.001   2.039   69.138  1.00 52.59  ? 15  ILE B CG1 1 
ATOM   2763  C  CG2 . ILE B  1 15  ? 6.926   3.076   71.383  1.00 42.60  ? 15  ILE B CG2 1 
ATOM   2764  C  CD1 . ILE B  1 15  ? 5.834   2.796   68.552  1.00 54.49  ? 15  ILE B CD1 1 
ATOM   2765  N  N   . GLU B  1 16  ? 6.540   -1.214  71.118  1.00 57.44  ? 16  GLU B N   1 
ATOM   2766  C  CA  . GLU B  1 16  ? 6.027   -2.459  70.583  1.00 64.98  ? 16  GLU B CA  1 
ATOM   2767  C  C   . GLU B  1 16  ? 4.750   -2.151  69.807  1.00 64.97  ? 16  GLU B C   1 
ATOM   2768  O  O   . GLU B  1 16  ? 3.855   -1.460  70.302  1.00 66.86  ? 16  GLU B O   1 
ATOM   2769  C  CB  . GLU B  1 16  ? 5.751   -3.460  71.706  1.00 71.91  ? 16  GLU B CB  1 
ATOM   2770  C  CG  . GLU B  1 16  ? 5.431   -4.875  71.231  1.00 78.86  ? 16  GLU B CG  1 
ATOM   2771  C  CD  . GLU B  1 16  ? 6.675   -5.723  71.016  1.00 85.74  ? 16  GLU B CD  1 
ATOM   2772  O  OE1 . GLU B  1 16  ? 7.761   -5.314  71.480  1.00 91.93  ? 16  GLU B OE1 1 
ATOM   2773  O  OE2 . GLU B  1 16  ? 6.565   -6.802  70.391  1.00 82.07  ? 16  GLU B OE2 1 
ATOM   2774  N  N   . LYS B  1 17  ? 4.687   -2.645  68.578  1.00 65.78  ? 17  LYS B N   1 
ATOM   2775  C  CA  . LYS B  1 17  ? 3.497   -2.510  67.737  1.00 64.60  ? 17  LYS B CA  1 
ATOM   2776  C  C   . LYS B  1 17  ? 3.157   -3.847  67.104  1.00 62.86  ? 17  LYS B C   1 
ATOM   2777  O  O   . LYS B  1 17  ? 4.010   -4.735  66.997  1.00 60.33  ? 17  LYS B O   1 
ATOM   2778  C  CB  . LYS B  1 17  ? 3.714   -1.470  66.635  1.00 63.36  ? 17  LYS B CB  1 
ATOM   2779  C  CG  . LYS B  1 17  ? 2.965   -0.167  66.854  1.00 69.39  ? 17  LYS B CG  1 
ATOM   2780  C  CD  . LYS B  1 17  ? 3.271   0.834   65.755  1.00 71.38  ? 17  LYS B CD  1 
ATOM   2781  C  CE  . LYS B  1 17  ? 2.295   2.004   65.767  1.00 70.87  ? 17  LYS B CE  1 
ATOM   2782  N  NZ  . LYS B  1 17  ? 2.292   2.715   67.066  1.00 74.41  ? 17  LYS B NZ  1 
ATOM   2783  N  N   . GLU B  1 18  ? 1.912   -3.995  66.675  1.00 62.57  ? 18  GLU B N   1 
ATOM   2784  C  CA  . GLU B  1 18  ? 1.535   -5.206  65.973  1.00 62.21  ? 18  GLU B CA  1 
ATOM   2785  C  C   . GLU B  1 18  ? 2.137   -5.145  64.576  1.00 53.90  ? 18  GLU B C   1 
ATOM   2786  O  O   . GLU B  1 18  ? 2.252   -4.059  63.979  1.00 44.73  ? 18  GLU B O   1 
ATOM   2787  C  CB  . GLU B  1 18  ? 0.015   -5.347  65.902  1.00 72.47  ? 18  GLU B CB  1 
ATOM   2788  C  CG  . GLU B  1 18  ? -0.463  -6.791  65.878  1.00 81.01  ? 18  GLU B CG  1 
ATOM   2789  C  CD  . GLU B  1 18  ? -0.139  -7.528  67.163  1.00 88.62  ? 18  GLU B CD  1 
ATOM   2790  O  OE1 . GLU B  1 18  ? -0.589  -7.072  68.238  1.00 89.10  ? 18  GLU B OE1 1 
ATOM   2791  O  OE2 . GLU B  1 18  ? 0.563   -8.561  67.097  1.00 91.89  ? 18  GLU B OE2 1 
ATOM   2792  N  N   . LYS B  1 19  ? 2.540   -6.308  64.074  1.00 47.05  ? 19  LYS B N   1 
ATOM   2793  C  CA  . LYS B  1 19  ? 3.040   -6.437  62.708  1.00 50.68  ? 19  LYS B CA  1 
ATOM   2794  C  C   . LYS B  1 19  ? 1.911   -6.156  61.713  1.00 52.23  ? 19  LYS B C   1 
ATOM   2795  O  O   . LYS B  1 19  ? 0.850   -6.779  61.794  1.00 56.40  ? 19  LYS B O   1 
ATOM   2796  C  CB  . LYS B  1 19  ? 3.582   -7.850  62.508  1.00 52.07  ? 19  LYS B CB  1 
ATOM   2797  C  CG  . LYS B  1 19  ? 4.057   -8.184  61.108  1.00 54.51  ? 19  LYS B CG  1 
ATOM   2798  C  CD  . LYS B  1 19  ? 4.517   -9.634  61.067  1.00 49.88  ? 19  LYS B CD  1 
ATOM   2799  C  CE  . LYS B  1 19  ? 4.881   -10.069 59.666  1.00 54.76  ? 19  LYS B CE  1 
ATOM   2800  N  NZ  . LYS B  1 19  ? 5.449   -11.451 59.658  1.00 53.21  ? 19  LYS B NZ  1 
ATOM   2801  N  N   . PRO B  1 20  ? 2.131   -5.221  60.769  1.00 43.97  ? 20  PRO B N   1 
ATOM   2802  C  CA  . PRO B  1 20  ? 1.068   -4.869  59.816  1.00 43.67  ? 20  PRO B CA  1 
ATOM   2803  C  C   . PRO B  1 20  ? 0.762   -6.036  58.879  1.00 41.25  ? 20  PRO B C   1 
ATOM   2804  O  O   . PRO B  1 20  ? 1.660   -6.810  58.588  1.00 41.73  ? 20  PRO B O   1 
ATOM   2805  C  CB  . PRO B  1 20  ? 1.676   -3.710  59.001  1.00 42.75  ? 20  PRO B CB  1 
ATOM   2806  C  CG  . PRO B  1 20  ? 2.969   -3.368  59.652  1.00 45.51  ? 20  PRO B CG  1 
ATOM   2807  C  CD  . PRO B  1 20  ? 3.403   -4.554  60.452  1.00 41.46  ? 20  PRO B CD  1 
ATOM   2808  N  N   . ALA B  1 21  ? -0.478  -6.154  58.415  1.00 42.75  ? 21  ALA B N   1 
ATOM   2809  C  CA  . ALA B  1 21  ? -0.833  -7.150  57.401  1.00 46.55  ? 21  ALA B CA  1 
ATOM   2810  C  C   . ALA B  1 21  ? -1.239  -6.454  56.094  1.00 47.23  ? 21  ALA B C   1 
ATOM   2811  O  O   . ALA B  1 21  ? -1.799  -5.361  56.118  1.00 42.09  ? 21  ALA B O   1 
ATOM   2812  C  CB  . ALA B  1 21  ? -1.962  -8.048  57.900  1.00 47.83  ? 21  ALA B CB  1 
ATOM   2813  N  N   . PRO B  1 22  ? -0.979  -7.103  54.950  1.00 44.89  ? 22  PRO B N   1 
ATOM   2814  C  CA  . PRO B  1 22  ? -1.180  -6.463  53.650  1.00 40.94  ? 22  PRO B CA  1 
ATOM   2815  C  C   . PRO B  1 22  ? -2.618  -6.554  53.167  1.00 49.09  ? 22  PRO B C   1 
ATOM   2816  O  O   . PRO B  1 22  ? -3.317  -7.526  53.455  1.00 52.79  ? 22  PRO B O   1 
ATOM   2817  C  CB  . PRO B  1 22  ? -0.315  -7.300  52.707  1.00 40.44  ? 22  PRO B CB  1 
ATOM   2818  C  CG  . PRO B  1 22  ? -0.000  -8.591  53.459  1.00 39.97  ? 22  PRO B CG  1 
ATOM   2819  C  CD  . PRO B  1 22  ? -0.626  -8.525  54.817  1.00 41.51  ? 22  PRO B CD  1 
ATOM   2820  N  N   . GLY B  1 23  ? -3.048  -5.540  52.428  1.00 44.85  ? 23  GLY B N   1 
ATOM   2821  C  CA  . GLY B  1 23  ? -4.256  -5.638  51.634  1.00 42.33  ? 23  GLY B CA  1 
ATOM   2822  C  C   . GLY B  1 23  ? -3.935  -6.402  50.362  1.00 43.50  ? 23  GLY B C   1 
ATOM   2823  O  O   . GLY B  1 23  ? -2.787  -6.782  50.134  1.00 46.02  ? 23  GLY B O   1 
ATOM   2824  N  N   . PRO B  1 24  ? -4.953  -6.635  49.525  1.00 42.18  ? 24  PRO B N   1 
ATOM   2825  C  CA  . PRO B  1 24  ? -4.801  -7.366  48.263  1.00 42.09  ? 24  PRO B CA  1 
ATOM   2826  C  C   . PRO B  1 24  ? -3.677  -6.819  47.388  1.00 40.00  ? 24  PRO B C   1 
ATOM   2827  O  O   . PRO B  1 24  ? -3.032  -7.601  46.686  1.00 39.34  ? 24  PRO B O   1 
ATOM   2828  C  CB  . PRO B  1 24  ? -6.159  -7.160  47.576  1.00 46.08  ? 24  PRO B CB  1 
ATOM   2829  C  CG  . PRO B  1 24  ? -7.118  -6.979  48.705  1.00 45.51  ? 24  PRO B CG  1 
ATOM   2830  C  CD  . PRO B  1 24  ? -6.350  -6.238  49.776  1.00 42.99  ? 24  PRO B CD  1 
ATOM   2831  N  N   . PHE B  1 25  ? -3.444  -5.509  47.432  1.00 34.71  ? 25  PHE B N   1 
ATOM   2832  C  CA  . PHE B  1 25  ? -2.444  -4.882  46.565  1.00 38.15  ? 25  PHE B CA  1 
ATOM   2833  C  C   . PHE B  1 25  ? -1.126  -4.531  47.269  1.00 39.60  ? 25  PHE B C   1 
ATOM   2834  O  O   . PHE B  1 25  ? -0.220  -3.980  46.658  1.00 35.71  ? 25  PHE B O   1 
ATOM   2835  C  CB  . PHE B  1 25  ? -3.019  -3.622  45.930  1.00 35.04  ? 25  PHE B CB  1 
ATOM   2836  C  CG  . PHE B  1 25  ? -4.164  -3.887  45.012  1.00 30.43  ? 25  PHE B CG  1 
ATOM   2837  C  CD1 . PHE B  1 25  ? -3.937  -4.233  43.688  1.00 27.03  ? 25  PHE B CD1 1 
ATOM   2838  C  CD2 . PHE B  1 25  ? -5.472  -3.805  45.476  1.00 29.71  ? 25  PHE B CD2 1 
ATOM   2839  C  CE1 . PHE B  1 25  ? -5.013  -4.486  42.827  1.00 33.17  ? 25  PHE B CE1 1 
ATOM   2840  C  CE2 . PHE B  1 25  ? -6.547  -4.054  44.622  1.00 35.47  ? 25  PHE B CE2 1 
ATOM   2841  C  CZ  . PHE B  1 25  ? -6.314  -4.405  43.299  1.00 31.22  ? 25  PHE B CZ  1 
ATOM   2842  N  N   . ASP B  1 26  ? -1.025  -4.883  48.541  1.00 39.65  ? 26  ASP B N   1 
ATOM   2843  C  CA  . ASP B  1 26  ? 0.088   -4.443  49.377  1.00 37.54  ? 26  ASP B CA  1 
ATOM   2844  C  C   . ASP B  1 26  ? 1.164   -5.501  49.614  1.00 35.12  ? 26  ASP B C   1 
ATOM   2845  O  O   . ASP B  1 26  ? 1.015   -6.657  49.218  1.00 40.95  ? 26  ASP B O   1 
ATOM   2846  C  CB  . ASP B  1 26  ? -0.466  -3.952  50.715  1.00 35.29  ? 26  ASP B CB  1 
ATOM   2847  C  CG  . ASP B  1 26  ? -1.577  -2.923  50.532  1.00 37.72  ? 26  ASP B CG  1 
ATOM   2848  O  OD1 . ASP B  1 26  ? -1.443  -2.061  49.626  1.00 35.60  ? 26  ASP B OD1 1 
ATOM   2849  O  OD2 . ASP B  1 26  ? -2.564  -2.971  51.296  1.00 36.14  ? 26  ASP B OD2 1 
ATOM   2850  N  N   . ALA B  1 27  ? 2.255   -5.078  50.251  1.00 31.31  ? 27  ALA B N   1 
ATOM   2851  C  CA  . ALA B  1 27  ? 3.343   -5.967  50.647  1.00 30.67  ? 27  ALA B CA  1 
ATOM   2852  C  C   . ALA B  1 27  ? 3.809   -5.616  52.046  1.00 32.46  ? 27  ALA B C   1 
ATOM   2853  O  O   . ALA B  1 27  ? 3.779   -4.449  52.450  1.00 36.45  ? 27  ALA B O   1 
ATOM   2854  C  CB  . ALA B  1 27  ? 4.521   -5.881  49.675  1.00 24.73  ? 27  ALA B CB  1 
ATOM   2855  N  N   . ILE B  1 28  ? 4.207   -6.640  52.788  1.00 28.60  ? 28  ILE B N   1 
ATOM   2856  C  CA  . ILE B  1 28  ? 4.917   -6.464  54.051  1.00 31.12  ? 28  ILE B CA  1 
ATOM   2857  C  C   . ILE B  1 28  ? 6.406   -6.698  53.782  1.00 34.70  ? 28  ILE B C   1 
ATOM   2858  O  O   . ILE B  1 28  ? 6.795   -7.694  53.171  1.00 32.83  ? 28  ILE B O   1 
ATOM   2859  C  CB  . ILE B  1 28  ? 4.432   -7.438  55.139  1.00 25.57  ? 28  ILE B CB  1 
ATOM   2860  C  CG1 . ILE B  1 28  ? 2.911   -7.397  55.253  1.00 32.45  ? 28  ILE B CG1 1 
ATOM   2861  C  CG2 . ILE B  1 28  ? 5.054   -7.086  56.487  1.00 34.33  ? 28  ILE B CG2 1 
ATOM   2862  C  CD1 . ILE B  1 28  ? 2.367   -5.995  55.451  1.00 37.76  ? 28  ILE B CD1 1 
ATOM   2863  N  N   . VAL B  1 29  ? 7.237   -5.764  54.222  1.00 34.76  ? 29  VAL B N   1 
ATOM   2864  C  CA  . VAL B  1 29  ? 8.665   -5.814  53.924  1.00 31.81  ? 29  VAL B CA  1 
ATOM   2865  C  C   . VAL B  1 29  ? 9.475   -5.742  55.207  1.00 35.08  ? 29  VAL B C   1 
ATOM   2866  O  O   . VAL B  1 29  ? 9.080   -5.058  56.168  1.00 39.66  ? 29  VAL B O   1 
ATOM   2867  C  CB  . VAL B  1 29  ? 9.054   -4.630  52.985  1.00 31.00  ? 29  VAL B CB  1 
ATOM   2868  C  CG1 . VAL B  1 29  ? 10.549  -4.577  52.737  1.00 24.61  ? 29  VAL B CG1 1 
ATOM   2869  C  CG2 . VAL B  1 29  ? 8.285   -4.728  51.670  1.00 29.42  ? 29  VAL B CG2 1 
ATOM   2870  N  N   . ARG B  1 30  ? 10.607  -6.442  55.231  1.00 34.66  ? 30  ARG B N   1 
ATOM   2871  C  CA  . ARG B  1 30  ? 11.561  -6.285  56.325  1.00 26.56  ? 30  ARG B CA  1 
ATOM   2872  C  C   . ARG B  1 30  ? 12.803  -5.546  55.840  1.00 30.74  ? 30  ARG B C   1 
ATOM   2873  O  O   . ARG B  1 30  ? 13.301  -5.808  54.753  1.00 31.09  ? 30  ARG B O   1 
ATOM   2874  C  CB  . ARG B  1 30  ? 11.913  -7.630  57.004  1.00 31.00  ? 30  ARG B CB  1 
ATOM   2875  C  CG  . ARG B  1 30  ? 12.857  -8.543  56.243  1.00 32.39  ? 30  ARG B CG  1 
ATOM   2876  C  CD  . ARG B  1 30  ? 13.212  -9.786  57.089  1.00 42.94  ? 30  ARG B CD  1 
ATOM   2877  N  NE  . ARG B  1 30  ? 14.324  -10.553 56.517  1.00 52.95  ? 30  ARG B NE  1 
ATOM   2878  C  CZ  . ARG B  1 30  ? 15.615  -10.301 56.755  1.00 59.95  ? 30  ARG B CZ  1 
ATOM   2879  N  NH1 . ARG B  1 30  ? 15.967  -9.307  57.561  1.00 60.61  ? 30  ARG B NH1 1 
ATOM   2880  N  NH2 . ARG B  1 30  ? 16.560  -11.043 56.190  1.00 62.28  ? 30  ARG B NH2 1 
ATOM   2881  N  N   . PRO B  1 31  ? 13.281  -4.577  56.631  1.00 30.43  ? 31  PRO B N   1 
ATOM   2882  C  CA  . PRO B  1 31  ? 14.398  -3.734  56.181  1.00 26.87  ? 31  PRO B CA  1 
ATOM   2883  C  C   . PRO B  1 31  ? 15.697  -4.520  56.187  1.00 28.74  ? 31  PRO B C   1 
ATOM   2884  O  O   . PRO B  1 31  ? 15.929  -5.280  57.115  1.00 30.77  ? 31  PRO B O   1 
ATOM   2885  C  CB  . PRO B  1 31  ? 14.452  -2.626  57.243  1.00 29.88  ? 31  PRO B CB  1 
ATOM   2886  C  CG  . PRO B  1 31  ? 13.777  -3.246  58.461  1.00 37.72  ? 31  PRO B CG  1 
ATOM   2887  C  CD  . PRO B  1 31  ? 12.654  -4.055  57.856  1.00 29.45  ? 31  PRO B CD  1 
ATOM   2888  N  N   . LEU B  1 32  ? 16.514  -4.346  55.154  1.00 26.13  ? 32  LEU B N   1 
ATOM   2889  C  CA  . LEU B  1 32  ? 17.847  -4.934  55.103  1.00 32.68  ? 32  LEU B CA  1 
ATOM   2890  C  C   . LEU B  1 32  ? 18.894  -3.842  55.336  1.00 36.31  ? 32  LEU B C   1 
ATOM   2891  O  O   . LEU B  1 32  ? 19.980  -4.106  55.836  1.00 32.25  ? 32  LEU B O   1 
ATOM   2892  C  CB  . LEU B  1 32  ? 18.083  -5.592  53.744  1.00 34.37  ? 32  LEU B CB  1 
ATOM   2893  C  CG  . LEU B  1 32  ? 17.208  -6.789  53.370  1.00 33.31  ? 32  LEU B CG  1 
ATOM   2894  C  CD1 . LEU B  1 32  ? 17.595  -7.295  51.977  1.00 31.49  ? 32  LEU B CD1 1 
ATOM   2895  C  CD2 . LEU B  1 32  ? 17.309  -7.912  54.415  1.00 25.03  ? 32  LEU B CD2 1 
ATOM   2896  N  N   . ALA B  1 33  ? 18.547  -2.614  54.946  1.00 35.34  ? 33  ALA B N   1 
ATOM   2897  C  CA  . ALA B  1 33  ? 19.358  -1.438  55.216  1.00 38.06  ? 33  ALA B CA  1 
ATOM   2898  C  C   . ALA B  1 33  ? 18.447  -0.210  55.349  1.00 38.42  ? 33  ALA B C   1 
ATOM   2899  O  O   . ALA B  1 33  ? 17.431  -0.095  54.656  1.00 36.90  ? 33  ALA B O   1 
ATOM   2900  C  CB  . ALA B  1 33  ? 20.404  -1.236  54.113  1.00 29.52  ? 33  ALA B CB  1 
ATOM   2901  N  N   . VAL B  1 34  ? 18.783  0.682   56.275  1.00 33.03  ? 34  VAL B N   1 
ATOM   2902  C  CA  . VAL B  1 34  ? 18.022  1.916   56.445  1.00 30.89  ? 34  VAL B CA  1 
ATOM   2903  C  C   . VAL B  1 34  ? 18.921  3.100   56.770  1.00 34.71  ? 34  VAL B C   1 
ATOM   2904  O  O   . VAL B  1 34  ? 20.094  2.936   57.123  1.00 28.63  ? 34  VAL B O   1 
ATOM   2905  C  CB  . VAL B  1 34  ? 16.950  1.809   57.550  1.00 28.94  ? 34  VAL B CB  1 
ATOM   2906  C  CG1 . VAL B  1 34  ? 16.074  0.581   57.336  1.00 26.92  ? 34  VAL B CG1 1 
ATOM   2907  C  CG2 . VAL B  1 34  ? 17.593  1.818   58.944  1.00 24.64  ? 34  VAL B CG2 1 
ATOM   2908  N  N   . ALA B  1 35  ? 18.355  4.294   56.641  1.00 37.52  ? 35  ALA B N   1 
ATOM   2909  C  CA  . ALA B  1 35  ? 19.056  5.518   56.991  1.00 34.05  ? 35  ALA B CA  1 
ATOM   2910  C  C   . ALA B  1 35  ? 18.067  6.545   57.527  1.00 38.17  ? 35  ALA B C   1 
ATOM   2911  O  O   . ALA B  1 35  ? 16.883  6.523   57.183  1.00 39.24  ? 35  ALA B O   1 
ATOM   2912  C  CB  . ALA B  1 35  ? 19.811  6.064   55.788  1.00 30.44  ? 35  ALA B CB  1 
ATOM   2913  N  N   . PRO B  1 36  ? 18.548  7.436   58.400  1.00 37.78  ? 36  PRO B N   1 
ATOM   2914  C  CA  . PRO B  1 36  ? 17.752  8.528   58.971  1.00 31.94  ? 36  PRO B CA  1 
ATOM   2915  C  C   . PRO B  1 36  ? 17.756  9.756   58.047  1.00 27.40  ? 36  PRO B C   1 
ATOM   2916  O  O   . PRO B  1 36  ? 18.731  10.003  57.339  1.00 30.38  ? 36  PRO B O   1 
ATOM   2917  C  CB  . PRO B  1 36  ? 18.503  8.870   60.268  1.00 31.85  ? 36  PRO B CB  1 
ATOM   2918  C  CG  . PRO B  1 36  ? 19.751  7.979   60.289  1.00 39.38  ? 36  PRO B CG  1 
ATOM   2919  C  CD  . PRO B  1 36  ? 19.925  7.433   58.913  1.00 35.05  ? 36  PRO B CD  1 
ATOM   2920  N  N   . CYS B  1 37  ? 16.687  10.534  58.077  1.00 27.86  ? 37  CYS B N   1 
ATOM   2921  C  CA  . CYS B  1 37  ? 16.624  11.757  57.274  1.00 32.46  ? 37  CYS B CA  1 
ATOM   2922  C  C   . CYS B  1 37  ? 16.573  12.990  58.174  1.00 35.35  ? 37  CYS B C   1 
ATOM   2923  O  O   . CYS B  1 37  ? 15.945  12.971  59.229  1.00 35.21  ? 37  CYS B O   1 
ATOM   2924  C  CB  . CYS B  1 37  ? 15.392  11.746  56.363  1.00 29.37  ? 37  CYS B CB  1 
ATOM   2925  S  SG  . CYS B  1 37  ? 15.251  13.238  55.281  1.00 33.99  ? 37  CYS B SG  1 
ATOM   2926  N  N   . THR B  1 38  ? 17.240  14.060  57.754  1.00 35.54  ? 38  THR B N   1 
ATOM   2927  C  CA  . THR B  1 38  ? 17.120  15.346  58.433  1.00 40.08  ? 38  THR B CA  1 
ATOM   2928  C  C   . THR B  1 38  ? 15.654  15.707  58.663  1.00 44.37  ? 38  THR B C   1 
ATOM   2929  O  O   . THR B  1 38  ? 15.305  16.290  59.694  1.00 47.99  ? 38  THR B O   1 
ATOM   2930  C  CB  . THR B  1 38  ? 17.768  16.481  57.617  1.00 47.39  ? 38  THR B CB  1 
ATOM   2931  O  OG1 . THR B  1 38  ? 17.029  16.676  56.402  1.00 56.07  ? 38  THR B OG1 1 
ATOM   2932  C  CG2 . THR B  1 38  ? 19.235  16.158  57.293  1.00 42.41  ? 38  THR B CG2 1 
ATOM   2933  N  N   . SER B  1 39  ? 14.794  15.357  57.705  1.00 38.84  ? 39  SER B N   1 
ATOM   2934  C  CA  . SER B  1 39  ? 13.368  15.681  57.810  1.00 42.93  ? 39  SER B CA  1 
ATOM   2935  C  C   . SER B  1 39  ? 12.750  15.140  59.091  1.00 41.61  ? 39  SER B C   1 
ATOM   2936  O  O   . SER B  1 39  ? 11.896  15.783  59.688  1.00 41.12  ? 39  SER B O   1 
ATOM   2937  C  CB  . SER B  1 39  ? 12.583  15.137  56.612  1.00 43.45  ? 39  SER B CB  1 
ATOM   2938  O  OG  . SER B  1 39  ? 12.448  13.723  56.693  1.00 44.99  ? 39  SER B OG  1 
ATOM   2939  N  N   . ASP B  1 40  ? 13.175  13.953  59.511  1.00 40.29  ? 40  ASP B N   1 
ATOM   2940  C  CA  . ASP B  1 40  ? 12.624  13.361  60.727  1.00 41.63  ? 40  ASP B CA  1 
ATOM   2941  C  C   . ASP B  1 40  ? 13.061  14.126  61.970  1.00 38.58  ? 40  ASP B C   1 
ATOM   2942  O  O   . ASP B  1 40  ? 12.325  14.194  62.953  1.00 44.13  ? 40  ASP B O   1 
ATOM   2943  C  CB  . ASP B  1 40  ? 12.999  11.883  60.852  1.00 41.67  ? 40  ASP B CB  1 
ATOM   2944  C  CG  . ASP B  1 40  ? 12.006  10.963  60.155  1.00 47.88  ? 40  ASP B CG  1 
ATOM   2945  O  OD1 . ASP B  1 40  ? 10.994  11.465  59.610  1.00 51.91  ? 40  ASP B OD1 1 
ATOM   2946  O  OD2 . ASP B  1 40  ? 12.244  9.735   60.149  1.00 41.53  ? 40  ASP B OD2 1 
ATOM   2947  N  N   . ILE B  1 41  ? 14.261  14.688  61.933  1.00 43.59  ? 41  ILE B N   1 
ATOM   2948  C  CA  . ILE B  1 41  ? 14.745  15.495  63.055  1.00 49.38  ? 41  ILE B CA  1 
ATOM   2949  C  C   . ILE B  1 41  ? 13.842  16.727  63.252  1.00 50.33  ? 41  ILE B C   1 
ATOM   2950  O  O   . ILE B  1 41  ? 13.442  17.033  64.373  1.00 49.90  ? 41  ILE B O   1 
ATOM   2951  C  CB  . ILE B  1 41  ? 16.208  15.924  62.853  1.00 47.38  ? 41  ILE B CB  1 
ATOM   2952  C  CG1 . ILE B  1 41  ? 17.103  14.700  62.697  1.00 46.01  ? 41  ILE B CG1 1 
ATOM   2953  C  CG2 . ILE B  1 41  ? 16.698  16.752  64.033  1.00 48.99  ? 41  ILE B CG2 1 
ATOM   2954  C  CD1 . ILE B  1 41  ? 17.149  13.832  63.937  1.00 44.11  ? 41  ILE B CD1 1 
ATOM   2955  N  N   . HIS B  1 42  ? 13.517  17.408  62.152  1.00 47.17  ? 42  HIS B N   1 
ATOM   2956  C  CA  . HIS B  1 42  ? 12.563  18.522  62.161  1.00 56.08  ? 42  HIS B CA  1 
ATOM   2957  C  C   . HIS B  1 42  ? 11.212  18.104  62.732  1.00 60.08  ? 42  HIS B C   1 
ATOM   2958  O  O   . HIS B  1 42  ? 10.632  18.800  63.561  1.00 64.06  ? 42  HIS B O   1 
ATOM   2959  C  CB  . HIS B  1 42  ? 12.327  19.064  60.745  1.00 54.07  ? 42  HIS B CB  1 
ATOM   2960  C  CG  . HIS B  1 42  ? 13.525  19.713  60.126  1.00 61.72  ? 42  HIS B CG  1 
ATOM   2961  N  ND1 . HIS B  1 42  ? 13.744  19.718  58.765  1.00 65.71  ? 42  HIS B ND1 1 
ATOM   2962  C  CD2 . HIS B  1 42  ? 14.564  20.384  60.678  1.00 64.91  ? 42  HIS B CD2 1 
ATOM   2963  C  CE1 . HIS B  1 42  ? 14.868  20.363  58.505  1.00 71.34  ? 42  HIS B CE1 1 
ATOM   2964  N  NE2 . HIS B  1 42  ? 15.387  20.774  59.649  1.00 67.96  ? 42  HIS B NE2 1 
ATOM   2965  N  N   . THR B  1 43  ? 10.700  16.976  62.259  1.00 55.01  ? 43  THR B N   1 
ATOM   2966  C  CA  . THR B  1 43  ? 9.413   16.482  62.710  1.00 50.16  ? 43  THR B CA  1 
ATOM   2967  C  C   . THR B  1 43  ? 9.408   16.263  64.217  1.00 51.84  ? 43  THR B C   1 
ATOM   2968  O  O   . THR B  1 43  ? 8.501   16.702  64.922  1.00 59.43  ? 43  THR B O   1 
ATOM   2969  C  CB  . THR B  1 43  ? 9.050   15.163  61.999  1.00 48.67  ? 43  THR B CB  1 
ATOM   2970  O  OG1 . THR B  1 43  ? 8.723   15.434  60.631  1.00 45.02  ? 43  THR B OG1 1 
ATOM   2971  C  CG2 . THR B  1 43  ? 7.864   14.492  62.680  1.00 45.43  ? 43  THR B CG2 1 
ATOM   2972  N  N   . VAL B  1 44  ? 10.435  15.596  64.714  1.00 47.69  ? 44  VAL B N   1 
ATOM   2973  C  CA  . VAL B  1 44  ? 10.442  15.191  66.113  1.00 53.82  ? 44  VAL B CA  1 
ATOM   2974  C  C   . VAL B  1 44  ? 10.731  16.341  67.079  1.00 55.43  ? 44  VAL B C   1 
ATOM   2975  O  O   . VAL B  1 44  ? 10.086  16.455  68.118  1.00 51.38  ? 44  VAL B O   1 
ATOM   2976  C  CB  . VAL B  1 44  ? 11.424  14.025  66.359  1.00 51.20  ? 44  VAL B CB  1 
ATOM   2977  C  CG1 . VAL B  1 44  ? 11.715  13.854  67.857  1.00 49.28  ? 44  VAL B CG1 1 
ATOM   2978  C  CG2 . VAL B  1 44  ? 10.866  12.744  65.763  1.00 48.71  ? 44  VAL B CG2 1 
ATOM   2979  N  N   . PHE B  1 45  ? 11.688  17.197  66.736  1.00 58.78  ? 45  PHE B N   1 
ATOM   2980  C  CA  . PHE B  1 45  ? 12.155  18.207  67.685  1.00 61.21  ? 45  PHE B CA  1 
ATOM   2981  C  C   . PHE B  1 45  ? 11.664  19.627  67.397  1.00 66.73  ? 45  PHE B C   1 
ATOM   2982  O  O   . PHE B  1 45  ? 11.921  20.539  68.179  1.00 71.01  ? 45  PHE B O   1 
ATOM   2983  C  CB  . PHE B  1 45  ? 13.682  18.184  67.790  1.00 52.91  ? 45  PHE B CB  1 
ATOM   2984  C  CG  . PHE B  1 45  ? 14.240  16.863  68.243  1.00 52.12  ? 45  PHE B CG  1 
ATOM   2985  C  CD1 . PHE B  1 45  ? 14.311  16.549  69.592  1.00 57.33  ? 45  PHE B CD1 1 
ATOM   2986  C  CD2 . PHE B  1 45  ? 14.707  15.939  67.323  1.00 53.76  ? 45  PHE B CD2 1 
ATOM   2987  C  CE1 . PHE B  1 45  ? 14.833  15.330  70.016  1.00 58.45  ? 45  PHE B CE1 1 
ATOM   2988  C  CE2 . PHE B  1 45  ? 15.229  14.714  67.733  1.00 49.68  ? 45  PHE B CE2 1 
ATOM   2989  C  CZ  . PHE B  1 45  ? 15.293  14.409  69.082  1.00 56.73  ? 45  PHE B CZ  1 
ATOM   2990  N  N   . GLU B  1 46  ? 10.962  19.807  66.283  1.00 64.79  ? 46  GLU B N   1 
ATOM   2991  C  CA  . GLU B  1 46  ? 10.427  21.113  65.912  1.00 66.47  ? 46  GLU B CA  1 
ATOM   2992  C  C   . GLU B  1 46  ? 8.943   21.052  65.558  1.00 67.38  ? 46  GLU B C   1 
ATOM   2993  O  O   . GLU B  1 46  ? 8.349   22.066  65.187  1.00 67.31  ? 46  GLU B O   1 
ATOM   2994  C  CB  . GLU B  1 46  ? 11.200  21.699  64.728  1.00 68.90  ? 46  GLU B CB  1 
ATOM   2995  C  CG  . GLU B  1 46  ? 12.663  21.977  65.007  1.00 75.25  ? 46  GLU B CG  1 
ATOM   2996  C  CD  . GLU B  1 46  ? 13.391  22.491  63.780  1.00 82.15  ? 46  GLU B CD  1 
ATOM   2997  O  OE1 . GLU B  1 46  ? 12.726  22.688  62.734  1.00 79.88  ? 46  GLU B OE1 1 
ATOM   2998  O  OE2 . GLU B  1 46  ? 14.624  22.694  63.862  1.00 84.91  ? 46  GLU B OE2 1 
ATOM   2999  N  N   . GLY B  1 47  ? 8.352   19.864  65.661  1.00 68.51  ? 47  GLY B N   1 
ATOM   3000  C  CA  . GLY B  1 47  ? 6.951   19.666  65.316  1.00 59.30  ? 47  GLY B CA  1 
ATOM   3001  C  C   . GLY B  1 47  ? 6.579   20.281  63.981  1.00 54.84  ? 47  GLY B C   1 
ATOM   3002  O  O   . GLY B  1 47  ? 5.549   20.930  63.864  1.00 59.12  ? 47  GLY B O   1 
ATOM   3003  N  N   . ALA B  1 48  ? 7.411   20.058  62.968  1.00 57.94  ? 48  ALA B N   1 
ATOM   3004  C  CA  . ALA B  1 48  ? 7.252   20.705  61.667  1.00 62.23  ? 48  ALA B CA  1 
ATOM   3005  C  C   . ALA B  1 48  ? 6.106   20.153  60.808  1.00 63.97  ? 48  ALA B C   1 
ATOM   3006  O  O   . ALA B  1 48  ? 5.733   20.759  59.797  1.00 64.80  ? 48  ALA B O   1 
ATOM   3007  C  CB  . ALA B  1 48  ? 8.568   20.663  60.892  1.00 62.87  ? 48  ALA B CB  1 
ATOM   3008  N  N   . ILE B  1 49  ? 5.555   19.009  61.196  1.00 63.97  ? 49  ILE B N   1 
ATOM   3009  C  CA  . ILE B  1 49  ? 4.383   18.478  60.497  1.00 68.50  ? 49  ILE B CA  1 
ATOM   3010  C  C   . ILE B  1 49  ? 3.262   18.182  61.482  1.00 68.67  ? 49  ILE B C   1 
ATOM   3011  O  O   . ILE B  1 49  ? 2.345   17.412  61.194  1.00 70.96  ? 49  ILE B O   1 
ATOM   3012  C  CB  . ILE B  1 49  ? 4.700   17.199  59.691  1.00 70.94  ? 49  ILE B CB  1 
ATOM   3013  C  CG1 . ILE B  1 49  ? 5.194   16.084  60.619  1.00 74.88  ? 49  ILE B CG1 1 
ATOM   3014  C  CG2 . ILE B  1 49  ? 5.706   17.493  58.591  1.00 70.26  ? 49  ILE B CG2 1 
ATOM   3015  C  CD1 . ILE B  1 49  ? 5.306   14.726  59.945  1.00 73.21  ? 49  ILE B CD1 1 
ATOM   3016  N  N   . GLY B  1 50  ? 3.340   18.801  62.650  1.00 65.87  ? 50  GLY B N   1 
ATOM   3017  C  CA  . GLY B  1 50  ? 2.336   18.597  63.671  1.00 67.52  ? 50  GLY B CA  1 
ATOM   3018  C  C   . GLY B  1 50  ? 2.794   17.545  64.651  1.00 72.89  ? 50  GLY B C   1 
ATOM   3019  O  O   . GLY B  1 50  ? 3.835   16.912  64.456  1.00 78.56  ? 50  GLY B O   1 
ATOM   3020  N  N   . GLU B  1 51  ? 2.019   17.358  65.711  1.00 71.40  ? 51  GLU B N   1 
ATOM   3021  C  CA  . GLU B  1 51  ? 2.361   16.366  66.711  1.00 75.16  ? 51  GLU B CA  1 
ATOM   3022  C  C   . GLU B  1 51  ? 2.007   14.977  66.202  1.00 74.49  ? 51  GLU B C   1 
ATOM   3023  O  O   . GLU B  1 51  ? 1.138   14.824  65.340  1.00 77.27  ? 51  GLU B O   1 
ATOM   3024  C  CB  . GLU B  1 51  ? 1.646   16.660  68.030  1.00 82.53  ? 51  GLU B CB  1 
ATOM   3025  C  CG  . GLU B  1 51  ? 2.333   16.060  69.248  1.00 89.68  ? 51  GLU B CG  1 
ATOM   3026  C  CD  . GLU B  1 51  ? 2.152   16.908  70.493  1.00 96.36  ? 51  GLU B CD  1 
ATOM   3027  O  OE1 . GLU B  1 51  ? 1.416   17.919  70.433  1.00 100.49 ? 51  GLU B OE1 1 
ATOM   3028  O  OE2 . GLU B  1 51  ? 2.751   16.566  71.532  1.00 96.30  ? 51  GLU B OE2 1 
ATOM   3029  N  N   . ARG B  1 52  ? 2.707   13.975  66.722  1.00 69.92  ? 52  ARG B N   1 
ATOM   3030  C  CA  . ARG B  1 52  ? 2.432   12.581  66.401  1.00 68.09  ? 52  ARG B CA  1 
ATOM   3031  C  C   . ARG B  1 52  ? 2.507   11.760  67.676  1.00 78.43  ? 52  ARG B C   1 
ATOM   3032  O  O   . ARG B  1 52  ? 3.147   12.164  68.650  1.00 83.37  ? 52  ARG B O   1 
ATOM   3033  C  CB  . ARG B  1 52  ? 3.447   12.034  65.393  1.00 58.23  ? 52  ARG B CB  1 
ATOM   3034  C  CG  . ARG B  1 52  ? 3.377   12.651  64.023  1.00 53.60  ? 52  ARG B CG  1 
ATOM   3035  C  CD  . ARG B  1 52  ? 2.050   12.358  63.341  1.00 50.45  ? 52  ARG B CD  1 
ATOM   3036  N  NE  . ARG B  1 52  ? 2.062   12.830  61.959  1.00 52.39  ? 52  ARG B NE  1 
ATOM   3037  C  CZ  . ARG B  1 52  ? 1.797   14.082  61.595  1.00 53.89  ? 52  ARG B CZ  1 
ATOM   3038  N  NH1 . ARG B  1 52  ? 1.494   14.997  62.512  1.00 58.43  ? 52  ARG B NH1 1 
ATOM   3039  N  NH2 . ARG B  1 52  ? 1.842   14.424  60.315  1.00 50.00  ? 52  ARG B NH2 1 
ATOM   3040  N  N   . HIS B  1 53  ? 1.858   10.601  67.664  1.00 81.24  ? 53  HIS B N   1 
ATOM   3041  C  CA  . HIS B  1 53  ? 1.892   9.699   68.802  1.00 84.75  ? 53  HIS B CA  1 
ATOM   3042  C  C   . HIS B  1 53  ? 2.281   8.296   68.344  1.00 74.72  ? 53  HIS B C   1 
ATOM   3043  O  O   . HIS B  1 53  ? 1.608   7.690   67.509  1.00 73.08  ? 53  HIS B O   1 
ATOM   3044  C  CB  . HIS B  1 53  ? 0.538   9.688   69.516  1.00 100.69 ? 53  HIS B CB  1 
ATOM   3045  C  CG  . HIS B  1 53  ? 0.594   9.152   70.913  1.00 117.76 ? 53  HIS B CG  1 
ATOM   3046  N  ND1 . HIS B  1 53  ? 1.105   9.878   71.968  1.00 126.50 ? 53  HIS B ND1 1 
ATOM   3047  C  CD2 . HIS B  1 53  ? 0.197   7.965   71.430  1.00 124.70 ? 53  HIS B CD2 1 
ATOM   3048  C  CE1 . HIS B  1 53  ? 1.026   9.159   73.074  1.00 130.20 ? 53  HIS B CE1 1 
ATOM   3049  N  NE2 . HIS B  1 53  ? 0.478   7.995   72.775  1.00 129.54 ? 53  HIS B NE2 1 
ATOM   3050  N  N   . ASN B  1 54  ? 3.385   7.795   68.887  1.00 67.76  ? 54  ASN B N   1 
ATOM   3051  C  CA  . ASN B  1 54  ? 3.870   6.464   68.558  1.00 60.88  ? 54  ASN B CA  1 
ATOM   3052  C  C   . ASN B  1 54  ? 3.904   6.172   67.061  1.00 55.28  ? 54  ASN B C   1 
ATOM   3053  O  O   . ASN B  1 54  ? 3.425   5.141   66.601  1.00 55.29  ? 54  ASN B O   1 
ATOM   3054  C  CB  . ASN B  1 54  ? 3.047   5.421   69.292  1.00 66.29  ? 54  ASN B CB  1 
ATOM   3055  C  CG  . ASN B  1 54  ? 3.233   5.501   70.782  1.00 74.04  ? 54  ASN B CG  1 
ATOM   3056  O  OD1 . ASN B  1 54  ? 4.351   5.671   71.267  1.00 74.24  ? 54  ASN B OD1 1 
ATOM   3057  N  ND2 . ASN B  1 54  ? 2.139   5.389   71.523  1.00 80.42  ? 54  ASN B ND2 1 
ATOM   3058  N  N   . MET B  1 55  ? 4.476   7.094   66.304  1.00 51.33  ? 55  MET B N   1 
ATOM   3059  C  CA  . MET B  1 55  ? 4.673   6.883   64.886  1.00 46.00  ? 55  MET B CA  1 
ATOM   3060  C  C   . MET B  1 55  ? 6.108   6.426   64.620  1.00 46.83  ? 55  MET B C   1 
ATOM   3061  O  O   . MET B  1 55  ? 7.071   7.162   64.886  1.00 40.57  ? 55  MET B O   1 
ATOM   3062  C  CB  . MET B  1 55  ? 4.378   8.164   64.118  1.00 43.57  ? 55  MET B CB  1 
ATOM   3063  C  CG  . MET B  1 55  ? 4.765   8.104   62.654  1.00 48.83  ? 55  MET B CG  1 
ATOM   3064  S  SD  . MET B  1 55  ? 4.569   9.686   61.803  1.00 52.05  ? 55  MET B SD  1 
ATOM   3065  C  CE  . MET B  1 55  ? 5.891   10.635  62.567  1.00 43.53  ? 55  MET B CE  1 
ATOM   3066  N  N   . ILE B  1 56  ? 6.247   5.209   64.101  1.00 43.83  ? 56  ILE B N   1 
ATOM   3067  C  CA  . ILE B  1 56  ? 7.559   4.683   63.737  1.00 46.00  ? 56  ILE B CA  1 
ATOM   3068  C  C   . ILE B  1 56  ? 8.271   5.617   62.745  1.00 45.38  ? 56  ILE B C   1 
ATOM   3069  O  O   . ILE B  1 56  ? 7.682   6.063   61.760  1.00 42.06  ? 56  ILE B O   1 
ATOM   3070  C  CB  . ILE B  1 56  ? 7.453   3.230   63.200  1.00 42.72  ? 56  ILE B CB  1 
ATOM   3071  C  CG1 . ILE B  1 56  ? 6.922   2.306   64.309  1.00 41.70  ? 56  ILE B CG1 1 
ATOM   3072  C  CG2 . ILE B  1 56  ? 8.806   2.732   62.680  1.00 38.56  ? 56  ILE B CG2 1 
ATOM   3073  C  CD1 . ILE B  1 56  ? 6.642   0.876   63.873  1.00 38.78  ? 56  ILE B CD1 1 
ATOM   3074  N  N   . LEU B  1 57  ? 9.532   5.933   63.025  1.00 42.88  ? 57  LEU B N   1 
ATOM   3075  C  CA  . LEU B  1 57  ? 10.276  6.881   62.195  1.00 38.84  ? 57  LEU B CA  1 
ATOM   3076  C  C   . LEU B  1 57  ? 10.913  6.230   60.964  1.00 39.24  ? 57  LEU B C   1 
ATOM   3077  O  O   . LEU B  1 57  ? 10.842  5.005   60.774  1.00 39.27  ? 57  LEU B O   1 
ATOM   3078  C  CB  . LEU B  1 57  ? 11.348  7.589   63.031  1.00 39.95  ? 57  LEU B CB  1 
ATOM   3079  C  CG  . LEU B  1 57  ? 10.790  8.579   64.054  1.00 43.42  ? 57  LEU B CG  1 
ATOM   3080  C  CD1 . LEU B  1 57  ? 11.824  8.941   65.098  1.00 45.82  ? 57  LEU B CD1 1 
ATOM   3081  C  CD2 . LEU B  1 57  ? 10.275  9.824   63.348  1.00 37.00  ? 57  LEU B CD2 1 
ATOM   3082  N  N   . GLY B  1 58  ? 11.527  7.061   60.129  1.00 33.60  ? 58  GLY B N   1 
ATOM   3083  C  CA  . GLY B  1 58  ? 12.311  6.587   59.002  1.00 31.67  ? 58  GLY B CA  1 
ATOM   3084  C  C   . GLY B  1 58  ? 11.526  6.335   57.726  1.00 31.61  ? 58  GLY B C   1 
ATOM   3085  O  O   . GLY B  1 58  ? 10.367  5.912   57.758  1.00 30.21  ? 58  GLY B O   1 
ATOM   3086  N  N   . HIS B  1 59  ? 12.168  6.580   56.589  1.00 28.17  ? 59  HIS B N   1 
ATOM   3087  C  CA  . HIS B  1 59  ? 11.515  6.366   55.309  1.00 36.38  ? 59  HIS B CA  1 
ATOM   3088  C  C   . HIS B  1 59  ? 12.536  6.134   54.209  1.00 34.17  ? 59  HIS B C   1 
ATOM   3089  O  O   . HIS B  1 59  ? 12.282  6.422   53.048  1.00 33.64  ? 59  HIS B O   1 
ATOM   3090  C  CB  . HIS B  1 59  ? 10.581  7.540   54.955  1.00 36.42  ? 59  HIS B CB  1 
ATOM   3091  C  CG  . HIS B  1 59  ? 11.238  8.883   55.030  1.00 31.75  ? 59  HIS B CG  1 
ATOM   3092  N  ND1 . HIS B  1 59  ? 10.954  9.798   56.024  1.00 37.16  ? 59  HIS B ND1 1 
ATOM   3093  C  CD2 . HIS B  1 59  ? 12.176  9.462   54.241  1.00 28.04  ? 59  HIS B CD2 1 
ATOM   3094  C  CE1 . HIS B  1 59  ? 11.684  10.885  55.840  1.00 26.69  ? 59  HIS B CE1 1 
ATOM   3095  N  NE2 . HIS B  1 59  ? 12.436  10.705  54.768  1.00 28.20  ? 59  HIS B NE2 1 
ATOM   3096  N  N   . GLU B  1 60  ? 13.700  5.622   54.579  1.00 31.93  ? 60  GLU B N   1 
ATOM   3097  C  CA  . GLU B  1 60  ? 14.668  5.197   53.574  1.00 29.96  ? 60  GLU B CA  1 
ATOM   3098  C  C   . GLU B  1 60  ? 15.111  3.765   53.842  1.00 37.94  ? 60  GLU B C   1 
ATOM   3099  O  O   . GLU B  1 60  ? 15.836  3.500   54.801  1.00 38.25  ? 60  GLU B O   1 
ATOM   3100  C  CB  . GLU B  1 60  ? 15.876  6.119   53.561  1.00 24.75  ? 60  GLU B CB  1 
ATOM   3101  C  CG  . GLU B  1 60  ? 15.562  7.586   53.228  1.00 33.83  ? 60  GLU B CG  1 
ATOM   3102  C  CD  . GLU B  1 60  ? 16.624  8.522   53.779  1.00 39.23  ? 60  GLU B CD  1 
ATOM   3103  O  OE1 . GLU B  1 60  ? 17.628  8.773   53.071  1.00 33.99  ? 60  GLU B OE1 1 
ATOM   3104  O  OE2 . GLU B  1 60  ? 16.474  8.968   54.939  1.00 38.87  ? 60  GLU B OE2 1 
ATOM   3105  N  N   . ALA B  1 61  ? 14.676  2.839   52.993  1.00 30.84  ? 61  ALA B N   1 
ATOM   3106  C  CA  . ALA B  1 61  ? 14.965  1.435   53.230  1.00 22.97  ? 61  ALA B CA  1 
ATOM   3107  C  C   . ALA B  1 61  ? 15.196  0.661   51.946  1.00 28.46  ? 61  ALA B C   1 
ATOM   3108  O  O   . ALA B  1 61  ? 14.613  0.963   50.898  1.00 32.71  ? 61  ALA B O   1 
ATOM   3109  C  CB  . ALA B  1 61  ? 13.834  0.788   54.035  1.00 24.40  ? 61  ALA B CB  1 
ATOM   3110  N  N   . VAL B  1 62  ? 16.099  -0.302  52.043  1.00 28.28  ? 62  VAL B N   1 
ATOM   3111  C  CA  . VAL B  1 62  ? 16.186  -1.410  51.122  1.00 30.91  ? 62  VAL B CA  1 
ATOM   3112  C  C   . VAL B  1 62  ? 15.660  -2.571  51.958  1.00 35.71  ? 62  VAL B C   1 
ATOM   3113  O  O   . VAL B  1 62  ? 15.968  -2.672  53.154  1.00 35.00  ? 62  VAL B O   1 
ATOM   3114  C  CB  . VAL B  1 62  ? 17.637  -1.689  50.712  1.00 37.84  ? 62  VAL B CB  1 
ATOM   3115  C  CG1 . VAL B  1 62  ? 17.738  -3.046  50.004  1.00 41.32  ? 62  VAL B CG1 1 
ATOM   3116  C  CG2 . VAL B  1 62  ? 18.167  -0.568  49.832  1.00 34.28  ? 62  VAL B CG2 1 
ATOM   3117  N  N   . GLY B  1 63  ? 14.844  -3.428  51.361  1.00 33.10  ? 63  GLY B N   1 
ATOM   3118  C  CA  . GLY B  1 63  ? 14.128  -4.417  52.145  1.00 33.27  ? 63  GLY B CA  1 
ATOM   3119  C  C   . GLY B  1 63  ? 13.944  -5.756  51.460  1.00 30.76  ? 63  GLY B C   1 
ATOM   3120  O  O   . GLY B  1 63  ? 14.313  -5.938  50.293  1.00 30.79  ? 63  GLY B O   1 
ATOM   3121  N  N   . GLU B  1 64  ? 13.388  -6.706  52.200  1.00 30.96  ? 64  GLU B N   1 
ATOM   3122  C  CA  . GLU B  1 64  ? 13.094  -8.020  51.656  1.00 25.76  ? 64  GLU B CA  1 
ATOM   3123  C  C   . GLU B  1 64  ? 11.612  -8.212  51.825  1.00 29.97  ? 64  GLU B C   1 
ATOM   3124  O  O   . GLU B  1 64  ? 11.081  -8.055  52.929  1.00 34.62  ? 64  GLU B O   1 
ATOM   3125  C  CB  . GLU B  1 64  ? 13.850  -9.107  52.409  1.00 28.33  ? 64  GLU B CB  1 
ATOM   3126  C  CG  . GLU B  1 64  ? 13.683  -10.495 51.793  1.00 33.78  ? 64  GLU B CG  1 
ATOM   3127  C  CD  . GLU B  1 64  ? 14.083  -11.614 52.756  1.00 49.29  ? 64  GLU B CD  1 
ATOM   3128  O  OE1 . GLU B  1 64  ? 14.551  -12.665 52.284  1.00 46.99  ? 64  GLU B OE1 1 
ATOM   3129  O  OE2 . GLU B  1 64  ? 13.930  -11.442 53.984  1.00 56.82  ? 64  GLU B OE2 1 
ATOM   3130  N  N   . VAL B  1 65  ? 10.925  -8.509  50.728  1.00 34.00  ? 65  VAL B N   1 
ATOM   3131  C  CA  . VAL B  1 65  ? 9.501   -8.725  50.815  1.00 30.10  ? 65  VAL B CA  1 
ATOM   3132  C  C   . VAL B  1 65  ? 9.279   -9.987  51.625  1.00 35.51  ? 65  VAL B C   1 
ATOM   3133  O  O   . VAL B  1 65  ? 9.929   -11.008 51.381  1.00 35.26  ? 65  VAL B O   1 
ATOM   3134  C  CB  . VAL B  1 65  ? 8.879   -8.875  49.428  1.00 38.51  ? 65  VAL B CB  1 
ATOM   3135  C  CG1 . VAL B  1 65  ? 7.402   -9.276  49.540  1.00 40.80  ? 65  VAL B CG1 1 
ATOM   3136  C  CG2 . VAL B  1 65  ? 9.027   -7.582  48.655  1.00 34.13  ? 65  VAL B CG2 1 
ATOM   3137  N  N   . VAL B  1 66  ? 8.381   -9.929  52.604  1.00 33.62  ? 66  VAL B N   1 
ATOM   3138  C  CA  . VAL B  1 66  ? 8.055   -11.151 53.338  1.00 38.88  ? 66  VAL B CA  1 
ATOM   3139  C  C   . VAL B  1 66  ? 6.616   -11.624 53.112  1.00 41.86  ? 66  VAL B C   1 
ATOM   3140  O  O   . VAL B  1 66  ? 6.284   -12.769 53.387  1.00 43.63  ? 66  VAL B O   1 
ATOM   3141  C  CB  . VAL B  1 66  ? 8.340   -11.029 54.850  1.00 39.04  ? 66  VAL B CB  1 
ATOM   3142  C  CG1 . VAL B  1 66  ? 9.843   -10.864 55.097  1.00 36.27  ? 66  VAL B CG1 1 
ATOM   3143  C  CG2 . VAL B  1 66  ? 7.536   -9.883  55.465  1.00 32.37  ? 66  VAL B CG2 1 
ATOM   3144  N  N   . GLU B  1 67  ? 5.762   -10.746 52.607  1.00 37.55  ? 67  GLU B N   1 
ATOM   3145  C  CA  . GLU B  1 67  ? 4.372   -11.119 52.394  1.00 34.69  ? 67  GLU B CA  1 
ATOM   3146  C  C   . GLU B  1 67  ? 3.726   -10.164 51.389  1.00 40.01  ? 67  GLU B C   1 
ATOM   3147  O  O   . GLU B  1 67  ? 4.014   -8.969  51.397  1.00 39.61  ? 67  GLU B O   1 
ATOM   3148  C  CB  . GLU B  1 67  ? 3.603   -11.099 53.717  1.00 34.33  ? 67  GLU B CB  1 
ATOM   3149  C  CG  . GLU B  1 67  ? 2.224   -11.742 53.637  1.00 46.90  ? 67  GLU B CG  1 
ATOM   3150  C  CD  . GLU B  1 67  ? 1.367   -11.509 54.877  1.00 57.80  ? 67  GLU B CD  1 
ATOM   3151  O  OE1 . GLU B  1 67  ? 1.918   -11.092 55.920  1.00 56.72  ? 67  GLU B OE1 1 
ATOM   3152  O  OE2 . GLU B  1 67  ? 0.136   -11.750 54.800  1.00 60.91  ? 67  GLU B OE2 1 
ATOM   3153  N  N   . VAL B  1 68  ? 2.869   -10.705 50.522  1.00 32.85  ? 68  VAL B N   1 
ATOM   3154  C  CA  . VAL B  1 68  ? 2.160   -9.913  49.528  1.00 43.84  ? 68  VAL B CA  1 
ATOM   3155  C  C   . VAL B  1 68  ? 0.695   -10.298 49.526  1.00 42.25  ? 68  VAL B C   1 
ATOM   3156  O  O   . VAL B  1 68  ? 0.335   -11.444 49.811  1.00 36.49  ? 68  VAL B O   1 
ATOM   3157  C  CB  . VAL B  1 68  ? 2.695   -10.137 48.100  1.00 40.60  ? 68  VAL B CB  1 
ATOM   3158  C  CG1 . VAL B  1 68  ? 4.181   -9.790  48.009  1.00 39.15  ? 68  VAL B CG1 1 
ATOM   3159  C  CG2 . VAL B  1 68  ? 2.437   -11.566 47.665  1.00 40.40  ? 68  VAL B CG2 1 
ATOM   3160  N  N   . GLY B  1 69  ? -0.148  -9.326  49.205  1.00 41.13  ? 69  GLY B N   1 
ATOM   3161  C  CA  . GLY B  1 69  ? -1.569  -9.566  49.078  1.00 39.53  ? 69  GLY B CA  1 
ATOM   3162  C  C   . GLY B  1 69  ? -1.867  -10.362 47.821  1.00 37.71  ? 69  GLY B C   1 
ATOM   3163  O  O   . GLY B  1 69  ? -1.015  -10.472 46.931  1.00 32.79  ? 69  GLY B O   1 
ATOM   3164  N  N   . SER B  1 70  ? -3.085  -10.893 47.751  1.00 36.41  ? 70  SER B N   1 
ATOM   3165  C  CA  . SER B  1 70  ? -3.534  -11.732 46.639  1.00 42.05  ? 70  SER B CA  1 
ATOM   3166  C  C   . SER B  1 70  ? -3.457  -11.108 45.241  1.00 46.88  ? 70  SER B C   1 
ATOM   3167  O  O   . SER B  1 70  ? -3.358  -11.837 44.255  1.00 43.10  ? 70  SER B O   1 
ATOM   3168  C  CB  . SER B  1 70  ? -4.962  -12.224 46.898  1.00 43.56  ? 70  SER B CB  1 
ATOM   3169  O  OG  . SER B  1 70  ? -5.842  -11.125 47.045  1.00 48.99  ? 70  SER B OG  1 
ATOM   3170  N  N   . GLU B  1 71  ? -3.501  -9.776  45.140  1.00 49.80  ? 71  GLU B N   1 
ATOM   3171  C  CA  . GLU B  1 71  ? -3.475  -9.123  43.820  1.00 44.85  ? 71  GLU B CA  1 
ATOM   3172  C  C   . GLU B  1 71  ? -2.087  -8.678  43.369  1.00 38.17  ? 71  GLU B C   1 
ATOM   3173  O  O   . GLU B  1 71  ? -1.938  -8.120  42.292  1.00 36.57  ? 71  GLU B O   1 
ATOM   3174  C  CB  . GLU B  1 71  ? -4.454  -7.949  43.750  1.00 37.52  ? 71  GLU B CB  1 
ATOM   3175  C  CG  . GLU B  1 71  ? -5.905  -8.372  43.925  1.00 42.41  ? 71  GLU B CG  1 
ATOM   3176  C  CD  . GLU B  1 71  ? -6.366  -9.329  42.837  1.00 53.43  ? 71  GLU B CD  1 
ATOM   3177  O  OE1 . GLU B  1 71  ? -6.051  -9.094  41.650  1.00 57.99  ? 71  GLU B OE1 1 
ATOM   3178  O  OE2 . GLU B  1 71  ? -7.049  -10.319 43.168  1.00 61.91  ? 71  GLU B OE2 1 
ATOM   3179  N  N   . VAL B  1 72  ? -1.075  -8.938  44.185  1.00 36.21  ? 72  VAL B N   1 
ATOM   3180  C  CA  . VAL B  1 72  ? 0.281   -8.549  43.847  1.00 32.25  ? 72  VAL B CA  1 
ATOM   3181  C  C   . VAL B  1 72  ? 0.902   -9.505  42.837  1.00 37.86  ? 72  VAL B C   1 
ATOM   3182  O  O   . VAL B  1 72  ? 0.879   -10.715 43.030  1.00 42.21  ? 72  VAL B O   1 
ATOM   3183  C  CB  . VAL B  1 72  ? 1.162   -8.475  45.093  1.00 36.06  ? 72  VAL B CB  1 
ATOM   3184  C  CG1 . VAL B  1 72  ? 2.613   -8.315  44.684  1.00 29.92  ? 72  VAL B CG1 1 
ATOM   3185  C  CG2 . VAL B  1 72  ? 0.704   -7.322  45.994  1.00 31.55  ? 72  VAL B CG2 1 
ATOM   3186  N  N   . LYS B  1 73  ? 1.464   -8.951  41.763  1.00 37.01  ? 73  LYS B N   1 
ATOM   3187  C  CA  . LYS B  1 73  ? 1.892   -9.749  40.618  1.00 35.95  ? 73  LYS B CA  1 
ATOM   3188  C  C   . LYS B  1 73  ? 3.406   -9.804  40.411  1.00 38.38  ? 73  LYS B C   1 
ATOM   3189  O  O   . LYS B  1 73  ? 3.929   -10.825 39.966  1.00 29.67  ? 73  LYS B O   1 
ATOM   3190  C  CB  . LYS B  1 73  ? 1.243   -9.221  39.329  1.00 47.52  ? 73  LYS B CB  1 
ATOM   3191  C  CG  . LYS B  1 73  ? -0.273  -8.985  39.400  1.00 48.62  ? 73  LYS B CG  1 
ATOM   3192  C  CD  . LYS B  1 73  ? -1.061  -10.290 39.323  1.00 60.09  ? 73  LYS B CD  1 
ATOM   3193  C  CE  . LYS B  1 73  ? -2.565  -10.017 39.165  1.00 69.98  ? 73  LYS B CE  1 
ATOM   3194  N  NZ  . LYS B  1 73  ? -3.361  -11.250 38.851  1.00 74.49  ? 73  LYS B NZ  1 
ATOM   3195  N  N   . ASP B  1 74  ? 4.109   -8.711  40.709  1.00 30.42  ? 74  ASP B N   1 
ATOM   3196  C  CA  . ASP B  1 74  ? 5.521   -8.604  40.343  1.00 30.88  ? 74  ASP B CA  1 
ATOM   3197  C  C   . ASP B  1 74  ? 6.495   -8.808  41.512  1.00 33.06  ? 74  ASP B C   1 
ATOM   3198  O  O   . ASP B  1 74  ? 7.711   -8.833  41.317  1.00 34.41  ? 74  ASP B O   1 
ATOM   3199  C  CB  . ASP B  1 74  ? 5.782   -7.246  39.664  1.00 34.18  ? 74  ASP B CB  1 
ATOM   3200  C  CG  . ASP B  1 74  ? 5.058   -7.113  38.335  1.00 38.15  ? 74  ASP B CG  1 
ATOM   3201  O  OD1 . ASP B  1 74  ? 4.545   -8.142  37.844  1.00 37.22  ? 74  ASP B OD1 1 
ATOM   3202  O  OD2 . ASP B  1 74  ? 5.009   -5.990  37.779  1.00 38.45  ? 74  ASP B OD2 1 
ATOM   3203  N  N   . PHE B  1 75  ? 5.964   -8.947  42.723  1.00 33.45  ? 75  PHE B N   1 
ATOM   3204  C  CA  . PHE B  1 75  ? 6.818   -9.162  43.890  1.00 38.12  ? 75  PHE B CA  1 
ATOM   3205  C  C   . PHE B  1 75  ? 6.344   -10.327 44.750  1.00 40.69  ? 75  PHE B C   1 
ATOM   3206  O  O   . PHE B  1 75  ? 5.144   -10.561 44.898  1.00 41.47  ? 75  PHE B O   1 
ATOM   3207  C  CB  . PHE B  1 75  ? 6.921   -7.878  44.716  1.00 35.10  ? 75  PHE B CB  1 
ATOM   3208  C  CG  . PHE B  1 75  ? 7.451   -6.725  43.932  1.00 34.46  ? 75  PHE B CG  1 
ATOM   3209  C  CD1 . PHE B  1 75  ? 8.810   -6.501  43.855  1.00 29.17  ? 75  PHE B CD1 1 
ATOM   3210  C  CD2 . PHE B  1 75  ? 6.591   -5.917  43.196  1.00 33.28  ? 75  PHE B CD2 1 
ATOM   3211  C  CE1 . PHE B  1 75  ? 9.308   -5.468  43.097  1.00 35.23  ? 75  PHE B CE1 1 
ATOM   3212  C  CE2 . PHE B  1 75  ? 7.082   -4.870  42.430  1.00 31.35  ? 75  PHE B CE2 1 
ATOM   3213  C  CZ  . PHE B  1 75  ? 8.444   -4.648  42.380  1.00 31.05  ? 75  PHE B CZ  1 
ATOM   3214  N  N   . LYS B  1 76  ? 7.297   -11.038 45.331  1.00 39.15  ? 76  LYS B N   1 
ATOM   3215  C  CA  . LYS B  1 76  ? 6.996   -12.217 46.132  1.00 45.24  ? 76  LYS B CA  1 
ATOM   3216  C  C   . LYS B  1 76  ? 7.950   -12.286 47.331  1.00 42.15  ? 76  LYS B C   1 
ATOM   3217  O  O   . LYS B  1 76  ? 9.027   -11.682 47.308  1.00 41.55  ? 76  LYS B O   1 
ATOM   3218  C  CB  . LYS B  1 76  ? 7.158   -13.471 45.272  1.00 47.31  ? 76  LYS B CB  1 
ATOM   3219  C  CG  . LYS B  1 76  ? 8.518   -13.530 44.610  1.00 59.03  ? 76  LYS B CG  1 
ATOM   3220  C  CD  . LYS B  1 76  ? 8.918   -14.934 44.186  1.00 70.55  ? 76  LYS B CD  1 
ATOM   3221  C  CE  . LYS B  1 76  ? 10.318  -14.911 43.578  1.00 78.49  ? 76  LYS B CE  1 
ATOM   3222  N  NZ  . LYS B  1 76  ? 10.744  -16.243 43.077  1.00 83.87  ? 76  LYS B NZ  1 
ATOM   3223  N  N   . PRO B  1 77  ? 7.553   -13.020 48.385  1.00 34.95  ? 77  PRO B N   1 
ATOM   3224  C  CA  . PRO B  1 77  ? 8.418   -13.212 49.550  1.00 35.03  ? 77  PRO B CA  1 
ATOM   3225  C  C   . PRO B  1 77  ? 9.823   -13.580 49.110  1.00 39.46  ? 77  PRO B C   1 
ATOM   3226  O  O   . PRO B  1 77  ? 9.982   -14.459 48.266  1.00 36.92  ? 77  PRO B O   1 
ATOM   3227  C  CB  . PRO B  1 77  ? 7.762   -14.401 50.271  1.00 34.51  ? 77  PRO B CB  1 
ATOM   3228  C  CG  . PRO B  1 77  ? 6.308   -14.226 49.973  1.00 36.71  ? 77  PRO B CG  1 
ATOM   3229  C  CD  . PRO B  1 77  ? 6.264   -13.722 48.539  1.00 36.80  ? 77  PRO B CD  1 
ATOM   3230  N  N   . GLY B  1 78  ? 10.827  -12.913 49.674  1.00 36.07  ? 78  GLY B N   1 
ATOM   3231  C  CA  . GLY B  1 78  ? 12.204  -13.179 49.319  1.00 31.51  ? 78  GLY B CA  1 
ATOM   3232  C  C   . GLY B  1 78  ? 12.787  -12.163 48.347  1.00 36.77  ? 78  GLY B C   1 
ATOM   3233  O  O   . GLY B  1 78  ? 14.004  -12.045 48.222  1.00 37.81  ? 78  GLY B O   1 
ATOM   3234  N  N   . ASP B  1 79  ? 11.934  -11.426 47.647  1.00 30.90  ? 79  ASP B N   1 
ATOM   3235  C  CA  . ASP B  1 79  ? 12.448  -10.410 46.730  1.00 29.78  ? 79  ASP B CA  1 
ATOM   3236  C  C   . ASP B  1 79  ? 13.158  -9.310  47.508  1.00 32.59  ? 79  ASP B C   1 
ATOM   3237  O  O   . ASP B  1 79  ? 12.633  -8.801  48.504  1.00 28.48  ? 79  ASP B O   1 
ATOM   3238  C  CB  . ASP B  1 79  ? 11.321  -9.818  45.868  1.00 30.75  ? 79  ASP B CB  1 
ATOM   3239  C  CG  . ASP B  1 79  ? 10.840  -10.782 44.789  1.00 35.52  ? 79  ASP B CG  1 
ATOM   3240  O  OD1 . ASP B  1 79  ? 11.561  -11.754 44.461  1.00 35.31  ? 79  ASP B OD1 1 
ATOM   3241  O  OD2 . ASP B  1 79  ? 9.732   -10.573 44.274  1.00 37.21  ? 79  ASP B OD2 1 
ATOM   3242  N  N   . ARG B  1 80  ? 14.368  -8.977  47.070  1.00 31.27  ? 80  ARG B N   1 
ATOM   3243  C  CA  . ARG B  1 80  ? 15.082  -7.827  47.591  1.00 30.60  ? 80  ARG B CA  1 
ATOM   3244  C  C   . ARG B  1 80  ? 14.651  -6.617  46.784  1.00 34.42  ? 80  ARG B C   1 
ATOM   3245  O  O   . ARG B  1 80  ? 14.712  -6.644  45.556  1.00 32.49  ? 80  ARG B O   1 
ATOM   3246  C  CB  . ARG B  1 80  ? 16.583  -8.009  47.430  1.00 35.00  ? 80  ARG B CB  1 
ATOM   3247  C  CG  . ARG B  1 80  ? 17.234  -8.874  48.503  1.00 48.19  ? 80  ARG B CG  1 
ATOM   3248  C  CD  . ARG B  1 80  ? 18.751  -8.800  48.411  1.00 58.78  ? 80  ARG B CD  1 
ATOM   3249  N  NE  . ARG B  1 80  ? 19.364  -9.904  49.132  1.00 76.31  ? 80  ARG B NE  1 
ATOM   3250  C  CZ  . ARG B  1 80  ? 19.532  -11.123 48.623  1.00 93.55  ? 80  ARG B CZ  1 
ATOM   3251  N  NH1 . ARG B  1 80  ? 19.133  -11.392 47.384  1.00 98.33  ? 80  ARG B NH1 1 
ATOM   3252  N  NH2 . ARG B  1 80  ? 20.100  -12.076 49.350  1.00 98.55  ? 80  ARG B NH2 1 
ATOM   3253  N  N   . VAL B  1 81  ? 14.242  -5.548  47.463  1.00 24.98  ? 81  VAL B N   1 
ATOM   3254  C  CA  . VAL B  1 81  ? 13.677  -4.398  46.767  1.00 27.15  ? 81  VAL B CA  1 
ATOM   3255  C  C   . VAL B  1 81  ? 14.168  -3.054  47.300  1.00 34.23  ? 81  VAL B C   1 
ATOM   3256  O  O   . VAL B  1 81  ? 14.515  -2.925  48.478  1.00 38.28  ? 81  VAL B O   1 
ATOM   3257  C  CB  . VAL B  1 81  ? 12.138  -4.396  46.872  1.00 29.39  ? 81  VAL B CB  1 
ATOM   3258  C  CG1 . VAL B  1 81  ? 11.526  -5.630  46.148  1.00 19.34  ? 81  VAL B CG1 1 
ATOM   3259  C  CG2 . VAL B  1 81  ? 11.716  -4.326  48.341  1.00 28.39  ? 81  VAL B CG2 1 
ATOM   3260  N  N   . VAL B  1 82  ? 14.185  -2.058  46.420  1.00 32.79  ? 82  VAL B N   1 
ATOM   3261  C  CA  . VAL B  1 82  ? 14.374  -0.683  46.831  1.00 30.97  ? 82  VAL B CA  1 
ATOM   3262  C  C   . VAL B  1 82  ? 12.985  -0.076  47.062  1.00 33.25  ? 82  VAL B C   1 
ATOM   3263  O  O   . VAL B  1 82  ? 12.109  -0.143  46.194  1.00 36.38  ? 82  VAL B O   1 
ATOM   3264  C  CB  . VAL B  1 82  ? 15.162  0.128   45.781  1.00 27.03  ? 82  VAL B CB  1 
ATOM   3265  C  CG1 . VAL B  1 82  ? 15.301  1.592   46.217  1.00 25.19  ? 82  VAL B CG1 1 
ATOM   3266  C  CG2 . VAL B  1 82  ? 16.529  -0.464  45.558  1.00 23.74  ? 82  VAL B CG2 1 
ATOM   3267  N  N   . VAL B  1 83  ? 12.784  0.480   48.252  1.00 26.24  ? 83  VAL B N   1 
ATOM   3268  C  CA  . VAL B  1 83  ? 11.532  1.118   48.637  1.00 20.78  ? 83  VAL B CA  1 
ATOM   3269  C  C   . VAL B  1 83  ? 11.662  2.654   48.540  1.00 27.80  ? 83  VAL B C   1 
ATOM   3270  O  O   . VAL B  1 83  ? 12.513  3.250   49.197  1.00 29.35  ? 83  VAL B O   1 
ATOM   3271  C  CB  . VAL B  1 83  ? 11.172  0.747   50.085  1.00 25.21  ? 83  VAL B CB  1 
ATOM   3272  C  CG1 . VAL B  1 83  ? 9.860   1.350   50.475  1.00 22.10  ? 83  VAL B CG1 1 
ATOM   3273  C  CG2 . VAL B  1 83  ? 11.143  -0.788  50.273  1.00 28.71  ? 83  VAL B CG2 1 
ATOM   3274  N  N   . PRO B  1 84  ? 10.817  3.303   47.720  1.00 30.20  ? 84  PRO B N   1 
ATOM   3275  C  CA  . PRO B  1 84  ? 10.931  4.769   47.622  1.00 29.42  ? 84  PRO B CA  1 
ATOM   3276  C  C   . PRO B  1 84  ? 10.348  5.408   48.866  1.00 28.05  ? 84  PRO B C   1 
ATOM   3277  O  O   . PRO B  1 84  ? 9.400   4.868   49.447  1.00 31.87  ? 84  PRO B O   1 
ATOM   3278  C  CB  . PRO B  1 84  ? 10.041  5.128   46.415  1.00 24.20  ? 84  PRO B CB  1 
ATOM   3279  C  CG  . PRO B  1 84  ? 9.103   3.936   46.204  1.00 27.49  ? 84  PRO B CG  1 
ATOM   3280  C  CD  . PRO B  1 84  ? 9.601   2.776   47.076  1.00 22.52  ? 84  PRO B CD  1 
ATOM   3281  N  N   . ALA B  1 85  ? 10.897  6.543   49.275  1.00 25.60  ? 85  ALA B N   1 
ATOM   3282  C  CA  . ALA B  1 85  ? 10.369  7.248   50.433  1.00 26.77  ? 85  ALA B CA  1 
ATOM   3283  C  C   . ALA B  1 85  ? 8.935   7.712   50.165  1.00 31.00  ? 85  ALA B C   1 
ATOM   3284  O  O   . ALA B  1 85  ? 8.109   7.808   51.071  1.00 34.19  ? 85  ALA B O   1 
ATOM   3285  C  CB  . ALA B  1 85  ? 11.262  8.431   50.791  1.00 23.63  ? 85  ALA B CB  1 
ATOM   3286  N  N   . ILE B  1 86  ? 8.639   7.990   48.906  1.00 33.32  ? 86  ILE B N   1 
ATOM   3287  C  CA  . ILE B  1 86  ? 7.297   8.391   48.525  1.00 27.65  ? 86  ILE B CA  1 
ATOM   3288  C  C   . ILE B  1 86  ? 6.538   7.193   47.919  1.00 29.49  ? 86  ILE B C   1 
ATOM   3289  O  O   . ILE B  1 86  ? 6.951   6.631   46.917  1.00 27.71  ? 86  ILE B O   1 
ATOM   3290  C  CB  . ILE B  1 86  ? 7.367   9.612   47.565  1.00 31.57  ? 86  ILE B CB  1 
ATOM   3291  C  CG1 . ILE B  1 86  ? 7.502   10.918  48.372  1.00 28.60  ? 86  ILE B CG1 1 
ATOM   3292  C  CG2 . ILE B  1 86  ? 6.174   9.642   46.615  1.00 33.05  ? 86  ILE B CG2 1 
ATOM   3293  C  CD1 . ILE B  1 86  ? 8.514   10.848  49.497  1.00 36.18  ? 86  ILE B CD1 1 
ATOM   3294  N  N   . THR B  1 87  ? 5.443   6.786   48.554  1.00 34.64  ? 87  THR B N   1 
ATOM   3295  C  CA  . THR B  1 87  ? 4.639   5.667   48.062  1.00 28.23  ? 87  THR B CA  1 
ATOM   3296  C  C   . THR B  1 87  ? 3.180   6.078   47.894  1.00 33.36  ? 87  THR B C   1 
ATOM   3297  O  O   . THR B  1 87  ? 2.353   5.814   48.773  1.00 27.59  ? 87  THR B O   1 
ATOM   3298  C  CB  . THR B  1 87  ? 4.704   4.490   49.034  1.00 32.73  ? 87  THR B CB  1 
ATOM   3299  O  OG1 . THR B  1 87  ? 4.229   4.905   50.325  1.00 27.91  ? 87  THR B OG1 1 
ATOM   3300  C  CG2 . THR B  1 87  ? 6.142   3.999   49.156  1.00 34.46  ? 87  THR B CG2 1 
ATOM   3301  N  N   . PRO B  1 88  ? 2.857   6.732   46.758  1.00 35.65  ? 88  PRO B N   1 
ATOM   3302  C  CA  . PRO B  1 88  ? 1.539   7.344   46.567  1.00 32.22  ? 88  PRO B CA  1 
ATOM   3303  C  C   . PRO B  1 88  ? 0.419   6.331   46.393  1.00 31.30  ? 88  PRO B C   1 
ATOM   3304  O  O   . PRO B  1 88  ? 0.636   5.204   45.953  1.00 34.83  ? 88  PRO B O   1 
ATOM   3305  C  CB  . PRO B  1 88  ? 1.683   8.114   45.242  1.00 29.48  ? 88  PRO B CB  1 
ATOM   3306  C  CG  . PRO B  1 88  ? 3.114   7.990   44.831  1.00 35.07  ? 88  PRO B CG  1 
ATOM   3307  C  CD  . PRO B  1 88  ? 3.686   6.819   45.544  1.00 31.52  ? 88  PRO B CD  1 
ATOM   3308  N  N   . ASP B  1 89  ? -0.790  6.755   46.727  1.00 34.25  ? 89  ASP B N   1 
ATOM   3309  C  CA  . ASP B  1 89  ? -1.974  6.081   46.235  1.00 43.64  ? 89  ASP B CA  1 
ATOM   3310  C  C   . ASP B  1 89  ? -2.062  6.455   44.760  1.00 42.64  ? 89  ASP B C   1 
ATOM   3311  O  O   . ASP B  1 89  ? -2.041  7.630   44.411  1.00 38.19  ? 89  ASP B O   1 
ATOM   3312  C  CB  . ASP B  1 89  ? -3.192  6.541   47.030  1.00 48.69  ? 89  ASP B CB  1 
ATOM   3313  C  CG  . ASP B  1 89  ? -3.151  6.043   48.472  1.00 51.49  ? 89  ASP B CG  1 
ATOM   3314  O  OD1 . ASP B  1 89  ? -2.942  4.816   48.660  1.00 48.12  ? 89  ASP B OD1 1 
ATOM   3315  O  OD2 . ASP B  1 89  ? -3.314  6.862   49.409  1.00 42.93  ? 89  ASP B OD2 1 
ATOM   3316  N  N   . TRP B  1 90  ? -2.109  5.467   43.878  1.00 34.83  ? 90  TRP B N   1 
ATOM   3317  C  CA  . TRP B  1 90  ? -1.951  5.781   42.464  1.00 36.39  ? 90  TRP B CA  1 
ATOM   3318  C  C   . TRP B  1 90  ? -3.242  6.144   41.726  1.00 37.11  ? 90  TRP B C   1 
ATOM   3319  O  O   . TRP B  1 90  ? -3.199  6.666   40.621  1.00 43.89  ? 90  TRP B O   1 
ATOM   3320  C  CB  . TRP B  1 90  ? -1.167  4.684   41.737  1.00 33.25  ? 90  TRP B CB  1 
ATOM   3321  C  CG  . TRP B  1 90  ? 0.308   4.845   41.964  1.00 35.49  ? 90  TRP B CG  1 
ATOM   3322  C  CD1 . TRP B  1 90  ? 1.056   4.272   42.958  1.00 32.60  ? 90  TRP B CD1 1 
ATOM   3323  C  CD2 . TRP B  1 90  ? 1.212   5.655   41.199  1.00 36.98  ? 90  TRP B CD2 1 
ATOM   3324  N  NE1 . TRP B  1 90  ? 2.368   4.666   42.848  1.00 33.91  ? 90  TRP B NE1 1 
ATOM   3325  C  CE2 . TRP B  1 90  ? 2.490   5.515   41.779  1.00 35.57  ? 90  TRP B CE2 1 
ATOM   3326  C  CE3 . TRP B  1 90  ? 1.064   6.477   40.074  1.00 32.72  ? 90  TRP B CE3 1 
ATOM   3327  C  CZ2 . TRP B  1 90  ? 3.610   6.169   41.278  1.00 39.00  ? 90  TRP B CZ2 1 
ATOM   3328  C  CZ3 . TRP B  1 90  ? 2.176   7.132   39.581  1.00 36.26  ? 90  TRP B CZ3 1 
ATOM   3329  C  CH2 . TRP B  1 90  ? 3.435   6.975   40.182  1.00 35.55  ? 90  TRP B CH2 1 
ATOM   3330  N  N   . ARG B  1 91  ? -4.384  5.894   42.349  1.00 33.64  ? 91  ARG B N   1 
ATOM   3331  C  CA  . ARG B  1 91  ? -5.651  6.072   41.659  1.00 37.18  ? 91  ARG B CA  1 
ATOM   3332  C  C   . ARG B  1 91  ? -6.375  7.297   42.177  1.00 39.52  ? 91  ARG B C   1 
ATOM   3333  O  O   . ARG B  1 91  ? -7.374  7.185   42.891  1.00 41.71  ? 91  ARG B O   1 
ATOM   3334  C  CB  . ARG B  1 91  ? -6.508  4.798   41.775  1.00 33.78  ? 91  ARG B CB  1 
ATOM   3335  C  CG  . ARG B  1 91  ? -6.036  3.637   40.871  1.00 39.02  ? 91  ARG B CG  1 
ATOM   3336  C  CD  . ARG B  1 91  ? -7.084  2.500   40.813  1.00 43.72  ? 91  ARG B CD  1 
ATOM   3337  N  NE  . ARG B  1 91  ? -7.680  2.358   42.132  1.00 48.74  ? 91  ARG B NE  1 
ATOM   3338  C  CZ  . ARG B  1 91  ? -8.951  2.594   42.427  1.00 45.29  ? 91  ARG B CZ  1 
ATOM   3339  N  NH1 . ARG B  1 91  ? -9.816  2.931   41.487  1.00 38.73  ? 91  ARG B NH1 1 
ATOM   3340  N  NH2 . ARG B  1 91  ? -9.360  2.458   43.677  1.00 55.55  ? 91  ARG B NH2 1 
ATOM   3341  N  N   . THR B  1 92  ? -5.852  8.473   41.820  1.00 35.91  ? 92  THR B N   1 
ATOM   3342  C  CA  . THR B  1 92  ? -6.373  9.743   42.305  1.00 29.44  ? 92  THR B CA  1 
ATOM   3343  C  C   . THR B  1 92  ? -6.300  10.802  41.212  1.00 36.48  ? 92  THR B C   1 
ATOM   3344  O  O   . THR B  1 92  ? -5.550  10.661  40.244  1.00 37.42  ? 92  THR B O   1 
ATOM   3345  C  CB  . THR B  1 92  ? -5.549  10.278  43.509  1.00 43.17  ? 92  THR B CB  1 
ATOM   3346  O  OG1 . THR B  1 92  ? -4.184  10.464  43.105  1.00 40.39  ? 92  THR B OG1 1 
ATOM   3347  C  CG2 . THR B  1 92  ? -5.590  9.295   44.687  1.00 44.35  ? 92  THR B CG2 1 
ATOM   3348  N  N   . SER B  1 93  ? -7.061  11.878  41.395  1.00 36.10  ? 93  SER B N   1 
ATOM   3349  C  CA  . SER B  1 93  ? -7.040  13.007  40.475  1.00 40.81  ? 93  SER B CA  1 
ATOM   3350  C  C   . SER B  1 93  ? -5.646  13.629  40.335  1.00 39.34  ? 93  SER B C   1 
ATOM   3351  O  O   . SER B  1 93  ? -5.243  13.989  39.235  1.00 43.79  ? 93  SER B O   1 
ATOM   3352  C  CB  . SER B  1 93  ? -8.046  14.071  40.925  1.00 44.62  ? 93  SER B CB  1 
ATOM   3353  O  OG  . SER B  1 93  ? -7.825  14.394  42.288  1.00 56.26  ? 93  SER B OG  1 
ATOM   3354  N  N   . GLU B  1 94  ? -4.914  13.764  41.438  1.00 37.21  ? 94  GLU B N   1 
ATOM   3355  C  CA  . GLU B  1 94  ? -3.550  14.297  41.356  1.00 40.37  ? 94  GLU B CA  1 
ATOM   3356  C  C   . GLU B  1 94  ? -2.657  13.474  40.434  1.00 35.94  ? 94  GLU B C   1 
ATOM   3357  O  O   . GLU B  1 94  ? -1.819  14.026  39.713  1.00 37.32  ? 94  GLU B O   1 
ATOM   3358  C  CB  . GLU B  1 94  ? -2.908  14.435  42.739  1.00 43.24  ? 94  GLU B CB  1 
ATOM   3359  C  CG  . GLU B  1 94  ? -3.564  15.496  43.602  1.00 44.74  ? 94  GLU B CG  1 
ATOM   3360  C  CD  . GLU B  1 94  ? -4.735  14.957  44.398  1.00 52.39  ? 94  GLU B CD  1 
ATOM   3361  O  OE1 . GLU B  1 94  ? -4.995  13.731  44.332  1.00 51.01  ? 94  GLU B OE1 1 
ATOM   3362  O  OE2 . GLU B  1 94  ? -5.388  15.760  45.098  1.00 51.25  ? 94  GLU B OE2 1 
ATOM   3363  N  N   . VAL B  1 95  ? -2.834  12.156  40.456  1.00 27.47  ? 95  VAL B N   1 
ATOM   3364  C  CA  . VAL B  1 95  ? -2.111  11.294  39.526  1.00 30.50  ? 95  VAL B CA  1 
ATOM   3365  C  C   . VAL B  1 95  ? -2.489  11.591  38.079  1.00 35.79  ? 95  VAL B C   1 
ATOM   3366  O  O   . VAL B  1 95  ? -1.627  11.712  37.206  1.00 35.49  ? 95  VAL B O   1 
ATOM   3367  C  CB  . VAL B  1 95  ? -2.348  9.821   39.843  1.00 35.10  ? 95  VAL B CB  1 
ATOM   3368  C  CG1 . VAL B  1 95  ? -1.709  8.933   38.780  1.00 33.23  ? 95  VAL B CG1 1 
ATOM   3369  C  CG2 . VAL B  1 95  ? -1.771  9.508   41.220  1.00 42.24  ? 95  VAL B CG2 1 
ATOM   3370  N  N   . GLN B  1 96  ? -3.788  11.712  37.825  1.00 36.23  ? 96  GLN B N   1 
ATOM   3371  C  CA  . GLN B  1 96  ? -4.249  12.059  36.494  1.00 31.14  ? 96  GLN B CA  1 
ATOM   3372  C  C   . GLN B  1 96  ? -3.722  13.441  36.084  1.00 35.21  ? 96  GLN B C   1 
ATOM   3373  O  O   . GLN B  1 96  ? -3.472  13.680  34.899  1.00 28.68  ? 96  GLN B O   1 
ATOM   3374  C  CB  . GLN B  1 96  ? -5.779  11.974  36.414  1.00 28.27  ? 96  GLN B CB  1 
ATOM   3375  C  CG  . GLN B  1 96  ? -6.314  10.535  36.635  1.00 37.31  ? 96  GLN B CG  1 
ATOM   3376  C  CD  . GLN B  1 96  ? -7.714  10.302  36.059  1.00 42.63  ? 96  GLN B CD  1 
ATOM   3377  O  OE1 . GLN B  1 96  ? -8.136  10.981  35.125  1.00 43.91  ? 96  GLN B OE1 1 
ATOM   3378  N  NE2 . GLN B  1 96  ? -8.427  9.328   36.609  1.00 40.37  ? 96  GLN B NE2 1 
ATOM   3379  N  N   . ARG B  1 97  ? -3.526  14.331  37.065  1.00 30.96  ? 97  ARG B N   1 
ATOM   3380  C  CA  . ARG B  1 97  ? -2.960  15.656  36.810  1.00 34.16  ? 97  ARG B CA  1 
ATOM   3381  C  C   . ARG B  1 97  ? -1.439  15.621  36.632  1.00 35.56  ? 97  ARG B C   1 
ATOM   3382  O  O   . ARG B  1 97  ? -0.830  16.631  36.297  1.00 34.85  ? 97  ARG B O   1 
ATOM   3383  C  CB  . ARG B  1 97  ? -3.323  16.652  37.923  1.00 34.01  ? 97  ARG B CB  1 
ATOM   3384  C  CG  . ARG B  1 97  ? -4.777  17.131  37.923  1.00 38.16  ? 97  ARG B CG  1 
ATOM   3385  C  CD  . ARG B  1 97  ? -4.950  18.500  38.627  1.00 41.38  ? 97  ARG B CD  1 
ATOM   3386  N  NE  . ARG B  1 97  ? -4.696  18.417  40.062  1.00 49.22  ? 97  ARG B NE  1 
ATOM   3387  C  CZ  . ARG B  1 97  ? -3.643  18.952  40.676  1.00 46.36  ? 97  ARG B CZ  1 
ATOM   3388  N  NH1 . ARG B  1 97  ? -2.741  19.635  39.984  1.00 37.48  ? 97  ARG B NH1 1 
ATOM   3389  N  NH2 . ARG B  1 97  ? -3.491  18.803  41.986  1.00 46.19  ? 97  ARG B NH2 1 
ATOM   3390  N  N   . GLY B  1 98  ? -0.825  14.466  36.869  1.00 35.78  ? 98  GLY B N   1 
ATOM   3391  C  CA  . GLY B  1 98  ? 0.623   14.339  36.735  1.00 34.12  ? 98  GLY B CA  1 
ATOM   3392  C  C   . GLY B  1 98  ? 1.469   14.633  37.972  1.00 36.12  ? 98  GLY B C   1 
ATOM   3393  O  O   . GLY B  1 98  ? 2.680   14.884  37.850  1.00 33.71  ? 98  GLY B O   1 
ATOM   3394  N  N   . TYR B  1 99  ? 0.852   14.611  39.156  1.00 32.26  ? 99  TYR B N   1 
ATOM   3395  C  CA  . TYR B  1 99  ? 1.573   14.892  40.408  1.00 34.08  ? 99  TYR B CA  1 
ATOM   3396  C  C   . TYR B  1 99  ? 1.324   13.864  41.497  1.00 29.10  ? 99  TYR B C   1 
ATOM   3397  O  O   . TYR B  1 99  ? 0.613   14.136  42.460  1.00 28.14  ? 99  TYR B O   1 
ATOM   3398  C  CB  . TYR B  1 99  ? 1.236   16.298  40.931  1.00 38.07  ? 99  TYR B CB  1 
ATOM   3399  C  CG  . TYR B  1 99  ? 1.847   17.371  40.078  1.00 34.72  ? 99  TYR B CG  1 
ATOM   3400  C  CD1 . TYR B  1 99  ? 3.130   17.840  40.333  1.00 30.02  ? 99  TYR B CD1 1 
ATOM   3401  C  CD2 . TYR B  1 99  ? 1.152   17.894  38.987  1.00 32.33  ? 99  TYR B CD2 1 
ATOM   3402  C  CE1 . TYR B  1 99  ? 3.702   18.819  39.526  1.00 39.23  ? 99  TYR B CE1 1 
ATOM   3403  C  CE2 . TYR B  1 99  ? 1.708   18.875  38.180  1.00 28.04  ? 99  TYR B CE2 1 
ATOM   3404  C  CZ  . TYR B  1 99  ? 2.977   19.331  38.450  1.00 41.19  ? 99  TYR B CZ  1 
ATOM   3405  O  OH  . TYR B  1 99  ? 3.523   20.290  37.641  1.00 47.01  ? 99  TYR B OH  1 
ATOM   3406  N  N   . HIS B  1 100 ? 1.914   12.682  41.353  1.00 31.05  ? 100 HIS B N   1 
ATOM   3407  C  CA  . HIS B  1 100 ? 1.733   11.640  42.359  1.00 30.75  ? 100 HIS B CA  1 
ATOM   3408  C  C   . HIS B  1 100 ? 2.186   12.073  43.755  1.00 32.61  ? 100 HIS B C   1 
ATOM   3409  O  O   . HIS B  1 100 ? 1.595   11.649  44.742  1.00 38.35  ? 100 HIS B O   1 
ATOM   3410  C  CB  . HIS B  1 100 ? 2.419   10.341  41.941  1.00 27.63  ? 100 HIS B CB  1 
ATOM   3411  C  CG  . HIS B  1 100 ? 3.914   10.391  42.018  1.00 28.12  ? 100 HIS B CG  1 
ATOM   3412  N  ND1 . HIS B  1 100 ? 4.711   10.547  40.905  1.00 27.63  ? 100 HIS B ND1 1 
ATOM   3413  C  CD2 . HIS B  1 100 ? 4.759   10.280  43.072  1.00 30.59  ? 100 HIS B CD2 1 
ATOM   3414  C  CE1 . HIS B  1 100 ? 5.982   10.555  41.272  1.00 30.45  ? 100 HIS B CE1 1 
ATOM   3415  N  NE2 . HIS B  1 100 ? 6.038   10.389  42.582  1.00 28.22  ? 100 HIS B NE2 1 
ATOM   3416  N  N   . GLN B  1 101 ? 3.204   12.934  43.843  1.00 31.39  ? 101 GLN B N   1 
ATOM   3417  C  CA  . GLN B  1 101 ? 3.716   13.364  45.155  1.00 33.78  ? 101 GLN B CA  1 
ATOM   3418  C  C   . GLN B  1 101 ? 2.602   13.936  46.010  1.00 40.74  ? 101 GLN B C   1 
ATOM   3419  O  O   . GLN B  1 101 ? 2.712   13.961  47.244  1.00 37.66  ? 101 GLN B O   1 
ATOM   3420  C  CB  . GLN B  1 101 ? 4.797   14.445  45.024  1.00 40.22  ? 101 GLN B CB  1 
ATOM   3421  C  CG  . GLN B  1 101 ? 6.088   13.998  44.378  1.00 38.75  ? 101 GLN B CG  1 
ATOM   3422  C  CD  . GLN B  1 101 ? 6.120   14.262  42.890  1.00 34.45  ? 101 GLN B CD  1 
ATOM   3423  O  OE1 . GLN B  1 101 ? 5.118   14.079  42.187  1.00 28.90  ? 101 GLN B OE1 1 
ATOM   3424  N  NE2 . GLN B  1 101 ? 7.281   14.681  42.395  1.00 28.52  ? 101 GLN B NE2 1 
ATOM   3425  N  N   . HIS B  1 102 ? 1.547   14.414  45.341  1.00 33.88  ? 102 HIS B N   1 
ATOM   3426  C  CA  . HIS B  1 102 ? 0.449   15.121  45.998  1.00 35.63  ? 102 HIS B CA  1 
ATOM   3427  C  C   . HIS B  1 102 ? -0.866  14.354  45.896  1.00 36.58  ? 102 HIS B C   1 
ATOM   3428  O  O   . HIS B  1 102 ? -1.954  14.909  46.039  1.00 34.75  ? 102 HIS B O   1 
ATOM   3429  C  CB  . HIS B  1 102 ? 0.357   16.540  45.440  1.00 37.95  ? 102 HIS B CB  1 
ATOM   3430  C  CG  . HIS B  1 102 ? 1.667   17.263  45.501  1.00 37.27  ? 102 HIS B CG  1 
ATOM   3431  N  ND1 . HIS B  1 102 ? 2.235   17.655  46.695  1.00 35.40  ? 102 HIS B ND1 1 
ATOM   3432  C  CD2 . HIS B  1 102 ? 2.563   17.580  44.535  1.00 37.23  ? 102 HIS B CD2 1 
ATOM   3433  C  CE1 . HIS B  1 102 ? 3.405   18.223  46.458  1.00 37.71  ? 102 HIS B CE1 1 
ATOM   3434  N  NE2 . HIS B  1 102 ? 3.632   18.188  45.157  1.00 32.27  ? 102 HIS B NE2 1 
ATOM   3435  N  N   . SER B  1 103 ? -0.738  13.047  45.706  1.00 35.54  ? 103 SER B N   1 
ATOM   3436  C  CA  . SER B  1 103 ? -1.896  12.181  45.576  1.00 40.96  ? 103 SER B CA  1 
ATOM   3437  C  C   . SER B  1 103 ? -2.673  12.079  46.876  1.00 42.04  ? 103 SER B C   1 
ATOM   3438  O  O   . SER B  1 103 ? -2.240  11.408  47.822  1.00 43.35  ? 103 SER B O   1 
ATOM   3439  C  CB  . SER B  1 103 ? -1.480  10.788  45.126  1.00 35.52  ? 103 SER B CB  1 
ATOM   3440  O  OG  . SER B  1 103 ? -2.640  10.001  44.987  1.00 46.92  ? 103 SER B OG  1 
ATOM   3441  N  N   . GLY B  1 104 ? -3.821  12.746  46.912  1.00 39.87  ? 104 GLY B N   1 
ATOM   3442  C  CA  . GLY B  1 104 ? -4.688  12.726  48.071  1.00 40.09  ? 104 GLY B CA  1 
ATOM   3443  C  C   . GLY B  1 104 ? -4.502  13.955  48.939  1.00 46.14  ? 104 GLY B C   1 
ATOM   3444  O  O   . GLY B  1 104 ? -5.072  14.046  50.027  1.00 49.80  ? 104 GLY B O   1 
ATOM   3445  N  N   . GLY B  1 105 ? -3.702  14.906  48.467  1.00 42.31  ? 105 GLY B N   1 
ATOM   3446  C  CA  . GLY B  1 105 ? -3.411  16.077  49.270  1.00 40.55  ? 105 GLY B CA  1 
ATOM   3447  C  C   . GLY B  1 105 ? -1.954  16.476  49.211  1.00 40.21  ? 105 GLY B C   1 
ATOM   3448  O  O   . GLY B  1 105 ? -1.100  15.703  48.783  1.00 36.02  ? 105 GLY B O   1 
ATOM   3449  N  N   . MET B  1 106 ? -1.674  17.704  49.627  1.00 40.24  ? 106 MET B N   1 
ATOM   3450  C  CA  . MET B  1 106 ? -0.326  18.252  49.555  1.00 38.28  ? 106 MET B CA  1 
ATOM   3451  C  C   . MET B  1 106 ? 0.676   17.354  50.302  1.00 39.48  ? 106 MET B C   1 
ATOM   3452  O  O   . MET B  1 106 ? 0.537   17.127  51.501  1.00 39.61  ? 106 MET B O   1 
ATOM   3453  C  CB  . MET B  1 106 ? -0.314  19.683  50.117  1.00 27.56  ? 106 MET B CB  1 
ATOM   3454  C  CG  . MET B  1 106 ? 1.012   20.423  49.901  1.00 32.88  ? 106 MET B CG  1 
ATOM   3455  S  SD  . MET B  1 106 ? 0.938   22.174  50.356  1.00 48.92  ? 106 MET B SD  1 
ATOM   3456  C  CE  . MET B  1 106 ? 0.618   22.025  52.108  1.00 54.49  ? 106 MET B CE  1 
ATOM   3457  N  N   . LEU B  1 107 ? 1.677   16.855  49.578  1.00 38.44  ? 107 LEU B N   1 
ATOM   3458  C  CA  . LEU B  1 107 ? 2.700   15.942  50.115  1.00 38.82  ? 107 LEU B CA  1 
ATOM   3459  C  C   . LEU B  1 107 ? 2.180   14.554  50.534  1.00 38.87  ? 107 LEU B C   1 
ATOM   3460  O  O   . LEU B  1 107 ? 2.916   13.778  51.137  1.00 38.24  ? 107 LEU B O   1 
ATOM   3461  C  CB  . LEU B  1 107 ? 3.472   16.568  51.289  1.00 38.62  ? 107 LEU B CB  1 
ATOM   3462  C  CG  . LEU B  1 107 ? 3.953   18.031  51.298  1.00 43.64  ? 107 LEU B CG  1 
ATOM   3463  C  CD1 . LEU B  1 107 ? 5.018   18.196  52.367  1.00 46.72  ? 107 LEU B CD1 1 
ATOM   3464  C  CD2 . LEU B  1 107 ? 4.507   18.496  49.964  1.00 39.80  ? 107 LEU B CD2 1 
ATOM   3465  N  N   . ALA B  1 108 ? 0.925   14.239  50.222  1.00 38.95  ? 108 ALA B N   1 
ATOM   3466  C  CA  . ALA B  1 108 ? 0.323   12.978  50.688  1.00 38.82  ? 108 ALA B CA  1 
ATOM   3467  C  C   . ALA B  1 108 ? 0.954   11.730  50.068  1.00 41.18  ? 108 ALA B C   1 
ATOM   3468  O  O   . ALA B  1 108 ? 0.772   10.621  50.569  1.00 42.97  ? 108 ALA B O   1 
ATOM   3469  C  CB  . ALA B  1 108 ? -1.202  12.971  50.494  1.00 33.53  ? 108 ALA B CB  1 
ATOM   3470  N  N   . GLY B  1 109 ? 1.700   11.912  48.985  1.00 39.77  ? 109 GLY B N   1 
ATOM   3471  C  CA  . GLY B  1 109 ? 2.482   10.826  48.425  1.00 34.98  ? 109 GLY B CA  1 
ATOM   3472  C  C   . GLY B  1 109 ? 3.570   10.352  49.388  1.00 36.67  ? 109 GLY B C   1 
ATOM   3473  O  O   . GLY B  1 109 ? 4.019   9.210   49.310  1.00 36.58  ? 109 GLY B O   1 
ATOM   3474  N  N   . TRP B  1 110 ? 4.002   11.231  50.291  1.00 41.22  ? 110 TRP B N   1 
ATOM   3475  C  CA  . TRP B  1 110 ? 4.993   10.870  51.314  1.00 36.33  ? 110 TRP B CA  1 
ATOM   3476  C  C   . TRP B  1 110 ? 4.252   10.341  52.536  1.00 39.29  ? 110 TRP B C   1 
ATOM   3477  O  O   . TRP B  1 110 ? 3.687   11.113  53.321  1.00 36.20  ? 110 TRP B O   1 
ATOM   3478  C  CB  . TRP B  1 110 ? 5.869   12.075  51.681  1.00 27.59  ? 110 TRP B CB  1 
ATOM   3479  C  CG  . TRP B  1 110 ? 6.622   11.938  52.993  1.00 40.87  ? 110 TRP B CG  1 
ATOM   3480  C  CD1 . TRP B  1 110 ? 7.094   10.781  53.557  1.00 41.39  ? 110 TRP B CD1 1 
ATOM   3481  C  CD2 . TRP B  1 110 ? 7.017   12.997  53.876  1.00 45.85  ? 110 TRP B CD2 1 
ATOM   3482  N  NE1 . TRP B  1 110 ? 7.742   11.056  54.737  1.00 40.00  ? 110 TRP B NE1 1 
ATOM   3483  C  CE2 . TRP B  1 110 ? 7.712   12.407  54.955  1.00 45.74  ? 110 TRP B CE2 1 
ATOM   3484  C  CE3 . TRP B  1 110 ? 6.853   14.385  53.859  1.00 50.55  ? 110 TRP B CE3 1 
ATOM   3485  C  CZ2 . TRP B  1 110 ? 8.231   13.155  56.008  1.00 41.62  ? 110 TRP B CZ2 1 
ATOM   3486  C  CZ3 . TRP B  1 110 ? 7.372   15.128  54.910  1.00 48.16  ? 110 TRP B CZ3 1 
ATOM   3487  C  CH2 . TRP B  1 110 ? 8.049   14.508  55.968  1.00 42.33  ? 110 TRP B CH2 1 
ATOM   3488  N  N   . LYS B  1 111 ? 4.240   9.020   52.682  1.00 31.33  ? 111 LYS B N   1 
ATOM   3489  C  CA  . LYS B  1 111 ? 3.519   8.375   53.779  1.00 37.79  ? 111 LYS B CA  1 
ATOM   3490  C  C   . LYS B  1 111 ? 4.414   8.046   54.985  1.00 36.46  ? 111 LYS B C   1 
ATOM   3491  O  O   . LYS B  1 111 ? 4.173   8.531   56.093  1.00 34.38  ? 111 LYS B O   1 
ATOM   3492  C  CB  . LYS B  1 111 ? 2.787   7.116   53.278  1.00 37.58  ? 111 LYS B CB  1 
ATOM   3493  C  CG  . LYS B  1 111 ? 1.548   7.422   52.419  1.00 32.76  ? 111 LYS B CG  1 
ATOM   3494  C  CD  . LYS B  1 111 ? 0.937   6.140   51.814  1.00 34.79  ? 111 LYS B CD  1 
ATOM   3495  C  CE  . LYS B  1 111 ? -0.101  6.480   50.723  1.00 35.64  ? 111 LYS B CE  1 
ATOM   3496  N  NZ  . LYS B  1 111 ? -1.399  6.943   51.303  1.00 37.45  ? 111 LYS B NZ  1 
ATOM   3497  N  N   . PHE B  1 112 ? 5.427   7.211   54.758  1.00 37.24  ? 112 PHE B N   1 
ATOM   3498  C  CA  . PHE B  1 112 ? 6.365   6.778   55.801  1.00 35.20  ? 112 PHE B CA  1 
ATOM   3499  C  C   . PHE B  1 112 ? 6.858   7.911   56.711  1.00 32.20  ? 112 PHE B C   1 
ATOM   3500  O  O   . PHE B  1 112 ? 7.515   8.823   56.242  1.00 32.25  ? 112 PHE B O   1 
ATOM   3501  C  CB  . PHE B  1 112 ? 7.598   6.143   55.145  1.00 28.00  ? 112 PHE B CB  1 
ATOM   3502  C  CG  . PHE B  1 112 ? 7.345   4.800   54.513  1.00 34.50  ? 112 PHE B CG  1 
ATOM   3503  C  CD1 . PHE B  1 112 ? 6.525   3.868   55.131  1.00 34.32  ? 112 PHE B CD1 1 
ATOM   3504  C  CD2 . PHE B  1 112 ? 7.966   4.455   53.325  1.00 29.57  ? 112 PHE B CD2 1 
ATOM   3505  C  CE1 . PHE B  1 112 ? 6.304   2.628   54.564  1.00 31.51  ? 112 PHE B CE1 1 
ATOM   3506  C  CE2 . PHE B  1 112 ? 7.757   3.216   52.758  1.00 39.60  ? 112 PHE B CE2 1 
ATOM   3507  C  CZ  . PHE B  1 112 ? 6.921   2.299   53.379  1.00 40.36  ? 112 PHE B CZ  1 
ATOM   3508  N  N   . SER B  1 113 ? 6.576   7.823   58.007  1.00 37.15  ? 113 SER B N   1 
ATOM   3509  C  CA  . SER B  1 113 ? 7.044   8.808   59.009  1.00 43.75  ? 113 SER B CA  1 
ATOM   3510  C  C   . SER B  1 113 ? 6.437   10.195  58.818  1.00 48.78  ? 113 SER B C   1 
ATOM   3511  O  O   . SER B  1 113 ? 6.908   11.176  59.413  1.00 44.68  ? 113 SER B O   1 
ATOM   3512  C  CB  . SER B  1 113 ? 8.584   8.897   59.097  1.00 42.15  ? 113 SER B CB  1 
ATOM   3513  O  OG  . SER B  1 113 ? 9.139   9.852   58.197  1.00 38.93  ? 113 SER B OG  1 
ATOM   3514  N  N   . ASN B  1 114 ? 5.398   10.261  57.985  1.00 42.84  ? 114 ASN B N   1 
ATOM   3515  C  CA  . ASN B  1 114 ? 4.582   11.463  57.851  1.00 43.13  ? 114 ASN B CA  1 
ATOM   3516  C  C   . ASN B  1 114 ? 3.168   11.185  58.353  1.00 47.92  ? 114 ASN B C   1 
ATOM   3517  O  O   . ASN B  1 114 ? 2.748   11.707  59.382  1.00 50.85  ? 114 ASN B O   1 
ATOM   3518  C  CB  . ASN B  1 114 ? 4.556   11.962  56.400  1.00 42.79  ? 114 ASN B CB  1 
ATOM   3519  C  CG  . ASN B  1 114 ? 3.679   13.197  56.223  1.00 47.14  ? 114 ASN B CG  1 
ATOM   3520  O  OD1 . ASN B  1 114 ? 3.342   13.871  57.193  1.00 48.00  ? 114 ASN B OD1 1 
ATOM   3521  N  ND2 . ASN B  1 114 ? 3.302   13.492  54.985  1.00 47.16  ? 114 ASN B ND2 1 
ATOM   3522  N  N   . VAL B  1 115 ? 2.438   10.351  57.621  1.00 43.96  ? 115 VAL B N   1 
ATOM   3523  C  CA  . VAL B  1 115 ? 1.100   9.953   58.031  1.00 42.85  ? 115 VAL B CA  1 
ATOM   3524  C  C   . VAL B  1 115 ? 1.019   8.432   58.231  1.00 47.75  ? 115 VAL B C   1 
ATOM   3525  O  O   . VAL B  1 115 ? -0.057  7.880   58.476  1.00 51.20  ? 115 VAL B O   1 
ATOM   3526  C  CB  . VAL B  1 115 ? 0.012   10.426  57.009  1.00 44.23  ? 115 VAL B CB  1 
ATOM   3527  C  CG1 . VAL B  1 115 ? -0.092  11.952  56.989  1.00 38.35  ? 115 VAL B CG1 1 
ATOM   3528  C  CG2 . VAL B  1 115 ? 0.295   9.897   55.613  1.00 37.63  ? 115 VAL B CG2 1 
ATOM   3529  N  N   . LYS B  1 116 ? 2.166   7.764   58.140  1.00 40.10  ? 116 LYS B N   1 
ATOM   3530  C  CA  . LYS B  1 116 ? 2.203   6.313   58.195  1.00 39.43  ? 116 LYS B CA  1 
ATOM   3531  C  C   . LYS B  1 116 ? 3.461   5.821   58.903  1.00 38.95  ? 116 LYS B C   1 
ATOM   3532  O  O   . LYS B  1 116 ? 4.535   6.411   58.772  1.00 37.21  ? 116 LYS B O   1 
ATOM   3533  C  CB  . LYS B  1 116 ? 2.152   5.756   56.771  1.00 44.08  ? 116 LYS B CB  1 
ATOM   3534  C  CG  . LYS B  1 116 ? 2.284   4.249   56.654  1.00 44.73  ? 116 LYS B CG  1 
ATOM   3535  C  CD  . LYS B  1 116 ? 2.241   3.828   55.182  1.00 40.91  ? 116 LYS B CD  1 
ATOM   3536  C  CE  . LYS B  1 116 ? 2.056   2.322   55.022  1.00 37.89  ? 116 LYS B CE  1 
ATOM   3537  N  NZ  . LYS B  1 116 ? 1.899   1.911   53.590  1.00 29.94  ? 116 LYS B NZ  1 
ATOM   3538  N  N   . ASP B  1 117 ? 3.324   4.737   59.658  1.00 44.52  ? 117 ASP B N   1 
ATOM   3539  C  CA  . ASP B  1 117 ? 4.481   4.104   60.284  1.00 36.35  ? 117 ASP B CA  1 
ATOM   3540  C  C   . ASP B  1 117 ? 5.594   3.904   59.270  1.00 34.58  ? 117 ASP B C   1 
ATOM   3541  O  O   . ASP B  1 117 ? 5.369   3.361   58.191  1.00 35.12  ? 117 ASP B O   1 
ATOM   3542  C  CB  . ASP B  1 117 ? 4.085   2.779   60.909  1.00 39.30  ? 117 ASP B CB  1 
ATOM   3543  C  CG  . ASP B  1 117 ? 3.578   2.947   62.320  1.00 50.93  ? 117 ASP B CG  1 
ATOM   3544  O  OD1 . ASP B  1 117 ? 3.840   4.018   62.914  1.00 57.94  ? 117 ASP B OD1 1 
ATOM   3545  O  OD2 . ASP B  1 117 ? 2.921   2.022   62.836  1.00 49.09  ? 117 ASP B OD2 1 
ATOM   3546  N  N   . GLY B  1 118 ? 6.787   4.378   59.614  1.00 37.30  ? 118 GLY B N   1 
ATOM   3547  C  CA  . GLY B  1 118 ? 7.940   4.291   58.735  1.00 38.07  ? 118 GLY B CA  1 
ATOM   3548  C  C   . GLY B  1 118 ? 8.749   3.005   58.830  1.00 37.11  ? 118 GLY B C   1 
ATOM   3549  O  O   . GLY B  1 118 ? 8.297   2.018   59.400  1.00 37.03  ? 118 GLY B O   1 
ATOM   3550  N  N   . VAL B  1 119 ? 9.964   3.034   58.290  1.00 31.17  ? 119 VAL B N   1 
ATOM   3551  C  CA  . VAL B  1 119 ? 10.703  1.818   58.014  1.00 31.72  ? 119 VAL B CA  1 
ATOM   3552  C  C   . VAL B  1 119 ? 11.584  1.339   59.184  1.00 34.30  ? 119 VAL B C   1 
ATOM   3553  O  O   . VAL B  1 119 ? 12.133  0.257   59.139  1.00 29.91  ? 119 VAL B O   1 
ATOM   3554  C  CB  . VAL B  1 119 ? 11.568  1.973   56.757  1.00 31.55  ? 119 VAL B CB  1 
ATOM   3555  C  CG1 . VAL B  1 119 ? 10.683  2.278   55.537  1.00 28.16  ? 119 VAL B CG1 1 
ATOM   3556  C  CG2 . VAL B  1 119 ? 12.632  3.048   56.967  1.00 30.65  ? 119 VAL B CG2 1 
ATOM   3557  N  N   . PHE B  1 120 ? 11.708  2.156   60.220  1.00 34.89  ? 120 PHE B N   1 
ATOM   3558  C  CA  . PHE B  1 120 ? 12.507  1.796   61.385  1.00 33.74  ? 120 PHE B CA  1 
ATOM   3559  C  C   . PHE B  1 120 ? 11.784  0.753   62.251  1.00 40.96  ? 120 PHE B C   1 
ATOM   3560  O  O   . PHE B  1 120 ? 11.614  0.942   63.453  1.00 40.30  ? 120 PHE B O   1 
ATOM   3561  C  CB  . PHE B  1 120 ? 12.830  3.046   62.219  1.00 33.31  ? 120 PHE B CB  1 
ATOM   3562  C  CG  . PHE B  1 120 ? 13.757  4.019   61.536  1.00 31.88  ? 120 PHE B CG  1 
ATOM   3563  C  CD1 . PHE B  1 120 ? 14.481  3.646   60.406  1.00 29.92  ? 120 PHE B CD1 1 
ATOM   3564  C  CD2 . PHE B  1 120 ? 13.940  5.298   62.051  1.00 35.30  ? 120 PHE B CD2 1 
ATOM   3565  C  CE1 . PHE B  1 120 ? 15.356  4.547   59.783  1.00 26.01  ? 120 PHE B CE1 1 
ATOM   3566  C  CE2 . PHE B  1 120 ? 14.815  6.197   61.441  1.00 27.81  ? 120 PHE B CE2 1 
ATOM   3567  C  CZ  . PHE B  1 120 ? 15.520  5.818   60.301  1.00 27.60  ? 120 PHE B CZ  1 
ATOM   3568  N  N   . GLY B  1 121 ? 11.336  -0.334  61.630  1.00 44.45  ? 121 GLY B N   1 
ATOM   3569  C  CA  . GLY B  1 121 ? 10.628  -1.384  62.345  1.00 41.25  ? 121 GLY B CA  1 
ATOM   3570  C  C   . GLY B  1 121 ? 11.072  -2.755  61.863  1.00 39.18  ? 121 GLY B C   1 
ATOM   3571  O  O   . GLY B  1 121 ? 11.727  -2.852  60.834  1.00 37.25  ? 121 GLY B O   1 
ATOM   3572  N  N   . GLU B  1 122 ? 10.754  -3.811  62.610  1.00 39.19  ? 122 GLU B N   1 
ATOM   3573  C  CA  . GLU B  1 122 ? 11.111  -5.160  62.176  1.00 39.36  ? 122 GLU B CA  1 
ATOM   3574  C  C   . GLU B  1 122 ? 10.409  -5.484  60.855  1.00 40.23  ? 122 GLU B C   1 
ATOM   3575  O  O   . GLU B  1 122 ? 10.950  -6.196  60.014  1.00 42.73  ? 122 GLU B O   1 
ATOM   3576  C  CB  . GLU B  1 122 ? 10.725  -6.192  63.231  1.00 34.00  ? 122 GLU B CB  1 
ATOM   3577  C  CG  . GLU B  1 122 ? 11.460  -6.033  64.549  1.00 42.86  ? 122 GLU B CG  1 
ATOM   3578  C  CD  . GLU B  1 122 ? 11.187  -7.190  65.483  1.00 47.40  ? 122 GLU B CD  1 
ATOM   3579  O  OE1 . GLU B  1 122 ? 10.341  -7.039  66.391  1.00 44.26  ? 122 GLU B OE1 1 
ATOM   3580  O  OE2 . GLU B  1 122 ? 11.794  -8.260  65.274  1.00 52.46  ? 122 GLU B OE2 1 
ATOM   3581  N  N   . PHE B  1 123 ? 9.199   -4.956  60.690  1.00 32.54  ? 123 PHE B N   1 
ATOM   3582  C  CA  . PHE B  1 123 ? 8.504   -4.997  59.408  1.00 39.82  ? 123 PHE B CA  1 
ATOM   3583  C  C   . PHE B  1 123 ? 7.851   -3.655  59.142  1.00 43.47  ? 123 PHE B C   1 
ATOM   3584  O  O   . PHE B  1 123 ? 7.633   -2.861  60.071  1.00 37.98  ? 123 PHE B O   1 
ATOM   3585  C  CB  . PHE B  1 123 ? 7.418   -6.078  59.390  1.00 35.99  ? 123 PHE B CB  1 
ATOM   3586  C  CG  . PHE B  1 123 ? 7.907   -7.423  59.830  1.00 41.98  ? 123 PHE B CG  1 
ATOM   3587  C  CD1 . PHE B  1 123 ? 8.501   -8.291  58.921  1.00 44.04  ? 123 PHE B CD1 1 
ATOM   3588  C  CD2 . PHE B  1 123 ? 7.772   -7.823  61.153  1.00 41.15  ? 123 PHE B CD2 1 
ATOM   3589  C  CE1 . PHE B  1 123 ? 8.955   -9.537  59.323  1.00 42.38  ? 123 PHE B CE1 1 
ATOM   3590  C  CE2 . PHE B  1 123 ? 8.225   -9.078  61.567  1.00 44.44  ? 123 PHE B CE2 1 
ATOM   3591  C  CZ  . PHE B  1 123 ? 8.818   -9.931  60.655  1.00 39.59  ? 123 PHE B CZ  1 
ATOM   3592  N  N   . PHE B  1 124 ? 7.543   -3.405  57.871  1.00 33.70  ? 124 PHE B N   1 
ATOM   3593  C  CA  . PHE B  1 124 ? 6.731   -2.254  57.518  1.00 35.23  ? 124 PHE B CA  1 
ATOM   3594  C  C   . PHE B  1 124 ? 5.819   -2.588  56.324  1.00 40.15  ? 124 PHE B C   1 
ATOM   3595  O  O   . PHE B  1 124 ? 5.965   -3.636  55.686  1.00 31.08  ? 124 PHE B O   1 
ATOM   3596  C  CB  . PHE B  1 124 ? 7.601   -1.006  57.287  1.00 35.21  ? 124 PHE B CB  1 
ATOM   3597  C  CG  . PHE B  1 124 ? 8.638   -1.151  56.181  1.00 29.79  ? 124 PHE B CG  1 
ATOM   3598  C  CD1 . PHE B  1 124 ? 8.314   -0.856  54.867  1.00 25.01  ? 124 PHE B CD1 1 
ATOM   3599  C  CD2 . PHE B  1 124 ? 9.938   -1.537  56.469  1.00 36.68  ? 124 PHE B CD2 1 
ATOM   3600  C  CE1 . PHE B  1 124 ? 9.256   -0.974  53.843  1.00 27.44  ? 124 PHE B CE1 1 
ATOM   3601  C  CE2 . PHE B  1 124 ? 10.896  -1.650  55.458  1.00 33.95  ? 124 PHE B CE2 1 
ATOM   3602  C  CZ  . PHE B  1 124 ? 10.544  -1.365  54.133  1.00 31.44  ? 124 PHE B CZ  1 
ATOM   3603  N  N   . HIS B  1 125 ? 4.878   -1.690  56.048  1.00 42.63  ? 125 HIS B N   1 
ATOM   3604  C  CA  . HIS B  1 125 ? 3.813   -1.890  55.069  1.00 37.52  ? 125 HIS B CA  1 
ATOM   3605  C  C   . HIS B  1 125 ? 4.064   -1.008  53.840  1.00 36.02  ? 125 HIS B C   1 
ATOM   3606  O  O   . HIS B  1 125 ? 4.265   0.205   53.952  1.00 30.56  ? 125 HIS B O   1 
ATOM   3607  C  CB  . HIS B  1 125 ? 2.474   -1.508  55.726  1.00 33.93  ? 125 HIS B CB  1 
ATOM   3608  C  CG  . HIS B  1 125 ? 1.278   -1.615  54.827  1.00 40.47  ? 125 HIS B CG  1 
ATOM   3609  N  ND1 . HIS B  1 125 ? 1.072   -0.777  53.752  1.00 39.06  ? 125 HIS B ND1 1 
ATOM   3610  C  CD2 . HIS B  1 125 ? 0.198   -2.438  54.873  1.00 42.00  ? 125 HIS B CD2 1 
ATOM   3611  C  CE1 . HIS B  1 125 ? -0.074  -1.085  53.167  1.00 40.09  ? 125 HIS B CE1 1 
ATOM   3612  N  NE2 . HIS B  1 125 ? -0.624  -2.088  53.828  1.00 38.94  ? 125 HIS B NE2 1 
ATOM   3613  N  N   . VAL B  1 126 ? 4.066   -1.608  52.659  1.00 37.32  ? 126 VAL B N   1 
ATOM   3614  C  CA  . VAL B  1 126 ? 4.158   -0.818  51.438  1.00 30.02  ? 126 VAL B CA  1 
ATOM   3615  C  C   . VAL B  1 126 ? 2.844   -0.931  50.682  1.00 37.98  ? 126 VAL B C   1 
ATOM   3616  O  O   . VAL B  1 126 ? 2.447   -2.030  50.285  1.00 40.01  ? 126 VAL B O   1 
ATOM   3617  C  CB  . VAL B  1 126 ? 5.301   -1.301  50.548  1.00 29.45  ? 126 VAL B CB  1 
ATOM   3618  C  CG1 . VAL B  1 126 ? 5.369   -0.451  49.282  1.00 30.77  ? 126 VAL B CG1 1 
ATOM   3619  C  CG2 . VAL B  1 126 ? 6.612   -1.261  51.322  1.00 28.40  ? 126 VAL B CG2 1 
ATOM   3620  N  N   . ASN B  1 127 ? 2.143   0.186   50.514  1.00 37.49  ? 127 ASN B N   1 
ATOM   3621  C  CA  . ASN B  1 127 ? 0.896   0.158   49.746  1.00 34.18  ? 127 ASN B CA  1 
ATOM   3622  C  C   . ASN B  1 127 ? 1.189   0.006   48.268  1.00 31.13  ? 127 ASN B C   1 
ATOM   3623  O  O   . ASN B  1 127 ? 2.150   0.575   47.759  1.00 28.44  ? 127 ASN B O   1 
ATOM   3624  C  CB  . ASN B  1 127 ? 0.052   1.410   49.977  1.00 35.07  ? 127 ASN B CB  1 
ATOM   3625  C  CG  . ASN B  1 127 ? 0.858   2.691   49.833  1.00 40.94  ? 127 ASN B CG  1 
ATOM   3626  O  OD1 . ASN B  1 127 ? 1.841   2.901   50.553  1.00 42.00  ? 127 ASN B OD1 1 
ATOM   3627  N  ND2 . ASN B  1 127 ? 0.449   3.555   48.897  1.00 36.68  ? 127 ASN B ND2 1 
ATOM   3628  N  N   . ASP B  1 128 ? 0.365   -0.784  47.590  1.00 32.69  ? 128 ASP B N   1 
ATOM   3629  C  CA  . ASP B  1 128 ? 0.476   -0.958  46.151  1.00 33.65  ? 128 ASP B CA  1 
ATOM   3630  C  C   . ASP B  1 128 ? 1.877   -1.395  45.737  1.00 37.02  ? 128 ASP B C   1 
ATOM   3631  O  O   . ASP B  1 128 ? 2.631   -0.636  45.123  1.00 38.98  ? 128 ASP B O   1 
ATOM   3632  C  CB  . ASP B  1 128 ? 0.058   0.318   45.415  1.00 36.81  ? 128 ASP B CB  1 
ATOM   3633  C  CG  . ASP B  1 128 ? -0.450  0.032   44.007  1.00 36.92  ? 128 ASP B CG  1 
ATOM   3634  O  OD1 . ASP B  1 128 ? -0.092  -1.038  43.462  1.00 29.22  ? 128 ASP B OD1 1 
ATOM   3635  O  OD2 . ASP B  1 128 ? -1.187  0.876   43.441  1.00 33.64  ? 128 ASP B OD2 1 
ATOM   3636  N  N   . ALA B  1 129 ? 2.209   -2.636  46.072  1.00 33.08  ? 129 ALA B N   1 
ATOM   3637  C  CA  . ALA B  1 129 ? 3.539   -3.168  45.827  1.00 33.84  ? 129 ALA B CA  1 
ATOM   3638  C  C   . ALA B  1 129 ? 3.980   -3.055  44.360  1.00 31.54  ? 129 ALA B C   1 
ATOM   3639  O  O   . ALA B  1 129 ? 5.114   -2.677  44.076  1.00 32.63  ? 129 ALA B O   1 
ATOM   3640  C  CB  . ALA B  1 129 ? 3.614   -4.621  46.300  1.00 27.95  ? 129 ALA B CB  1 
ATOM   3641  N  N   . ASP B  1 130 ? 3.099   -3.410  43.431  1.00 26.35  ? 130 ASP B N   1 
ATOM   3642  C  CA  . ASP B  1 130 ? 3.463   -3.413  42.010  1.00 30.48  ? 130 ASP B CA  1 
ATOM   3643  C  C   . ASP B  1 130 ? 3.790   -2.019  41.454  1.00 28.16  ? 130 ASP B C   1 
ATOM   3644  O  O   . ASP B  1 130 ? 4.605   -1.878  40.543  1.00 32.12  ? 130 ASP B O   1 
ATOM   3645  C  CB  . ASP B  1 130 ? 2.351   -4.044  41.178  1.00 27.06  ? 130 ASP B CB  1 
ATOM   3646  C  CG  . ASP B  1 130 ? 2.334   -5.556  41.273  1.00 37.24  ? 130 ASP B CG  1 
ATOM   3647  O  OD1 . ASP B  1 130 ? 3.382   -6.155  41.626  1.00 34.67  ? 130 ASP B OD1 1 
ATOM   3648  O  OD2 . ASP B  1 130 ? 1.269   -6.141  40.971  1.00 34.40  ? 130 ASP B OD2 1 
ATOM   3649  N  N   . MET B  1 131 ? 3.134   -0.998  41.993  1.00 23.18  ? 131 MET B N   1 
ATOM   3650  C  CA  . MET B  1 131 ? 3.336   0.376   41.533  1.00 25.87  ? 131 MET B CA  1 
ATOM   3651  C  C   . MET B  1 131 ? 4.445   1.053   42.349  1.00 34.50  ? 131 MET B C   1 
ATOM   3652  O  O   . MET B  1 131 ? 5.056   2.035   41.901  1.00 33.39  ? 131 MET B O   1 
ATOM   3653  C  CB  . MET B  1 131 ? 2.031   1.159   41.691  1.00 35.01  ? 131 MET B CB  1 
ATOM   3654  C  CG  . MET B  1 131 ? 1.634   2.030   40.504  1.00 56.76  ? 131 MET B CG  1 
ATOM   3655  S  SD  . MET B  1 131 ? 1.308   1.061   39.028  1.00 31.97  ? 131 MET B SD  1 
ATOM   3656  C  CE  . MET B  1 131 ? 0.659   -0.424  39.787  1.00 116.84 ? 131 MET B CE  1 
ATOM   3657  N  N   . ASN B  1 132 ? 4.703   0.536   43.549  1.00 26.74  ? 132 ASN B N   1 
ATOM   3658  C  CA  . ASN B  1 132 ? 5.563   1.256   44.501  1.00 38.41  ? 132 ASN B CA  1 
ATOM   3659  C  C   . ASN B  1 132 ? 6.895   0.598   44.894  1.00 38.97  ? 132 ASN B C   1 
ATOM   3660  O  O   . ASN B  1 132 ? 7.717   1.234   45.521  1.00 42.70  ? 132 ASN B O   1 
ATOM   3661  C  CB  . ASN B  1 132 ? 4.766   1.686   45.751  1.00 38.41  ? 132 ASN B CB  1 
ATOM   3662  C  CG  . ASN B  1 132 ? 3.938   2.952   45.514  1.00 35.25  ? 132 ASN B CG  1 
ATOM   3663  O  OD1 . ASN B  1 132 ? 4.337   3.818   44.747  1.00 40.04  ? 132 ASN B OD1 1 
ATOM   3664  N  ND2 . ASN B  1 132 ? 2.796   3.062   46.181  1.00 26.93  ? 132 ASN B ND2 1 
ATOM   3665  N  N   . LEU B  1 133 ? 7.114   -0.660  44.517  1.00 30.24  ? 133 LEU B N   1 
ATOM   3666  C  CA  . LEU B  1 133 ? 8.396   -1.318  44.770  1.00 26.07  ? 133 LEU B CA  1 
ATOM   3667  C  C   . LEU B  1 133 ? 9.248   -1.451  43.506  1.00 29.48  ? 133 LEU B C   1 
ATOM   3668  O  O   . LEU B  1 133 ? 8.718   -1.466  42.390  1.00 29.73  ? 133 LEU B O   1 
ATOM   3669  C  CB  . LEU B  1 133 ? 8.163   -2.717  45.361  1.00 23.88  ? 133 LEU B CB  1 
ATOM   3670  C  CG  . LEU B  1 133 ? 7.556   -2.736  46.763  1.00 30.95  ? 133 LEU B CG  1 
ATOM   3671  C  CD1 . LEU B  1 133 ? 7.242   -4.163  47.207  1.00 26.10  ? 133 LEU B CD1 1 
ATOM   3672  C  CD2 . LEU B  1 133 ? 8.522   -2.066  47.766  1.00 30.95  ? 133 LEU B CD2 1 
ATOM   3673  N  N   . ALA B  1 134 ? 10.561  -1.588  43.690  1.00 26.01  ? 134 ALA B N   1 
ATOM   3674  C  CA  . ALA B  1 134 ? 11.475  -1.882  42.582  1.00 31.26  ? 134 ALA B CA  1 
ATOM   3675  C  C   . ALA B  1 134 ? 12.494  -2.942  42.984  1.00 27.75  ? 134 ALA B C   1 
ATOM   3676  O  O   . ALA B  1 134 ? 13.026  -2.900  44.098  1.00 27.22  ? 134 ALA B O   1 
ATOM   3677  C  CB  . ALA B  1 134 ? 12.194  -0.612  42.115  1.00 30.40  ? 134 ALA B CB  1 
ATOM   3678  N  N   . HIS B  1 135 ? 12.781  -3.871  42.070  1.00 30.09  ? 135 HIS B N   1 
ATOM   3679  C  CA  . HIS B  1 135 ? 13.773  -4.925  42.307  1.00 34.65  ? 135 HIS B CA  1 
ATOM   3680  C  C   . HIS B  1 135 ? 15.198  -4.371  42.412  1.00 35.76  ? 135 HIS B C   1 
ATOM   3681  O  O   . HIS B  1 135 ? 15.601  -3.497  41.643  1.00 36.87  ? 135 HIS B O   1 
ATOM   3682  C  CB  . HIS B  1 135 ? 13.682  -6.020  41.231  1.00 29.29  ? 135 HIS B CB  1 
ATOM   3683  C  CG  . HIS B  1 135 ? 12.429  -6.837  41.315  1.00 34.85  ? 135 HIS B CG  1 
ATOM   3684  N  ND1 . HIS B  1 135 ? 11.417  -6.754  40.380  1.00 37.16  ? 135 HIS B ND1 1 
ATOM   3685  C  CD2 . HIS B  1 135 ? 12.016  -7.740  42.237  1.00 33.46  ? 135 HIS B CD2 1 
ATOM   3686  C  CE1 . HIS B  1 135 ? 10.436  -7.570  40.722  1.00 31.24  ? 135 HIS B CE1 1 
ATOM   3687  N  NE2 . HIS B  1 135 ? 10.773  -8.180  41.846  1.00 37.52  ? 135 HIS B NE2 1 
ATOM   3688  N  N   . LEU B  1 136 ? 15.954  -4.870  43.382  1.00 33.34  ? 136 LEU B N   1 
ATOM   3689  C  CA  . LEU B  1 136 ? 17.309  -4.387  43.609  1.00 30.71  ? 136 LEU B CA  1 
ATOM   3690  C  C   . LEU B  1 136 ? 18.289  -5.326  42.934  1.00 34.22  ? 136 LEU B C   1 
ATOM   3691  O  O   . LEU B  1 136 ? 18.356  -6.501  43.269  1.00 34.23  ? 136 LEU B O   1 
ATOM   3692  C  CB  . LEU B  1 136 ? 17.615  -4.324  45.105  1.00 32.87  ? 136 LEU B CB  1 
ATOM   3693  C  CG  . LEU B  1 136 ? 19.106  -4.165  45.450  1.00 33.45  ? 136 LEU B CG  1 
ATOM   3694  C  CD1 . LEU B  1 136 ? 19.658  -2.897  44.835  1.00 39.17  ? 136 LEU B CD1 1 
ATOM   3695  C  CD2 . LEU B  1 136 ? 19.329  -4.140  46.955  1.00 35.20  ? 136 LEU B CD2 1 
ATOM   3696  N  N   . PRO B  1 137 ? 19.049  -4.818  41.963  1.00 32.28  ? 137 PRO B N   1 
ATOM   3697  C  CA  . PRO B  1 137 ? 20.057  -5.708  41.374  1.00 28.58  ? 137 PRO B CA  1 
ATOM   3698  C  C   . PRO B  1 137 ? 21.110  -6.098  42.412  1.00 35.88  ? 137 PRO B C   1 
ATOM   3699  O  O   . PRO B  1 137 ? 21.535  -5.267  43.241  1.00 35.50  ? 137 PRO B O   1 
ATOM   3700  C  CB  . PRO B  1 137 ? 20.674  -4.853  40.265  1.00 26.62  ? 137 PRO B CB  1 
ATOM   3701  C  CG  . PRO B  1 137 ? 19.564  -3.820  39.927  1.00 28.12  ? 137 PRO B CG  1 
ATOM   3702  C  CD  . PRO B  1 137 ? 18.924  -3.534  41.252  1.00 32.94  ? 137 PRO B CD  1 
ATOM   3703  N  N   . LYS B  1 138 ? 21.515  -7.362  42.363  1.00 32.20  ? 138 LYS B N   1 
ATOM   3704  C  CA  . LYS B  1 138 ? 22.467  -7.926  43.321  1.00 39.12  ? 138 LYS B CA  1 
ATOM   3705  C  C   . LYS B  1 138 ? 23.795  -7.199  43.259  1.00 35.41  ? 138 LYS B C   1 
ATOM   3706  O  O   . LYS B  1 138 ? 24.518  -7.140  44.245  1.00 41.44  ? 138 LYS B O   1 
ATOM   3707  C  CB  . LYS B  1 138 ? 22.693  -9.416  43.024  1.00 40.94  ? 138 LYS B CB  1 
ATOM   3708  C  CG  . LYS B  1 138 ? 23.171  -9.666  41.602  1.00 50.58  ? 138 LYS B CG  1 
ATOM   3709  C  CD  . LYS B  1 138 ? 23.422  -11.139 41.317  1.00 60.69  ? 138 LYS B CD  1 
ATOM   3710  C  CE  . LYS B  1 138 ? 23.677  -11.344 39.831  1.00 64.42  ? 138 LYS B CE  1 
ATOM   3711  N  NZ  . LYS B  1 138 ? 24.633  -12.455 39.591  1.00 72.28  ? 138 LYS B NZ  1 
ATOM   3712  N  N   . GLU B  1 139 ? 24.115  -6.642  42.096  1.00 37.53  ? 139 GLU B N   1 
ATOM   3713  C  CA  . GLU B  1 139 ? 25.392  -5.940  41.908  1.00 40.50  ? 139 GLU B CA  1 
ATOM   3714  C  C   . GLU B  1 139 ? 25.503  -4.582  42.635  1.00 41.00  ? 139 GLU B C   1 
ATOM   3715  O  O   . GLU B  1 139 ? 26.577  -3.974  42.675  1.00 38.39  ? 139 GLU B O   1 
ATOM   3716  C  CB  . GLU B  1 139 ? 25.691  -5.751  40.417  1.00 37.75  ? 139 GLU B CB  1 
ATOM   3717  C  CG  . GLU B  1 139 ? 25.870  -7.054  39.637  1.00 35.90  ? 139 GLU B CG  1 
ATOM   3718  C  CD  . GLU B  1 139 ? 24.555  -7.667  39.140  1.00 40.41  ? 139 GLU B CD  1 
ATOM   3719  O  OE1 . GLU B  1 139 ? 23.473  -7.065  39.308  1.00 37.08  ? 139 GLU B OE1 1 
ATOM   3720  O  OE2 . GLU B  1 139 ? 24.610  -8.764  38.561  1.00 53.08  ? 139 GLU B OE2 1 
ATOM   3721  N  N   . ILE B  1 140 ? 24.410  -4.103  43.219  1.00 32.26  ? 140 ILE B N   1 
ATOM   3722  C  CA  . ILE B  1 140 ? 24.495  -2.835  43.948  1.00 36.59  ? 140 ILE B CA  1 
ATOM   3723  C  C   . ILE B  1 140 ? 24.517  -3.030  45.464  1.00 38.76  ? 140 ILE B C   1 
ATOM   3724  O  O   . ILE B  1 140 ? 23.544  -3.521  46.033  1.00 41.52  ? 140 ILE B O   1 
ATOM   3725  C  CB  . ILE B  1 140 ? 23.323  -1.900  43.606  1.00 33.50  ? 140 ILE B CB  1 
ATOM   3726  C  CG1 . ILE B  1 140 ? 23.222  -1.691  42.091  1.00 32.29  ? 140 ILE B CG1 1 
ATOM   3727  C  CG2 . ILE B  1 140 ? 23.458  -0.587  44.370  1.00 29.25  ? 140 ILE B CG2 1 
ATOM   3728  C  CD1 . ILE B  1 140 ? 21.926  -0.961  41.643  1.00 27.47  ? 140 ILE B CD1 1 
ATOM   3729  N  N   . PRO B  1 141 ? 25.612  -2.609  46.124  1.00 36.81  ? 141 PRO B N   1 
ATOM   3730  C  CA  . PRO B  1 141 ? 25.750  -2.711  47.584  1.00 41.89  ? 141 PRO B CA  1 
ATOM   3731  C  C   . PRO B  1 141 ? 24.591  -2.050  48.310  1.00 37.52  ? 141 PRO B C   1 
ATOM   3732  O  O   . PRO B  1 141 ? 24.049  -1.044  47.837  1.00 34.83  ? 141 PRO B O   1 
ATOM   3733  C  CB  . PRO B  1 141 ? 27.038  -1.930  47.876  1.00 43.34  ? 141 PRO B CB  1 
ATOM   3734  C  CG  . PRO B  1 141 ? 27.797  -1.956  46.609  1.00 40.06  ? 141 PRO B CG  1 
ATOM   3735  C  CD  . PRO B  1 141 ? 26.772  -1.947  45.506  1.00 34.51  ? 141 PRO B CD  1 
ATOM   3736  N  N   . LEU B  1 142 ? 24.222  -2.603  49.458  1.00 32.39  ? 142 LEU B N   1 
ATOM   3737  C  CA  . LEU B  1 142 ? 23.078  -2.087  50.195  1.00 33.26  ? 142 LEU B CA  1 
ATOM   3738  C  C   . LEU B  1 142 ? 23.250  -0.617  50.558  1.00 35.72  ? 142 LEU B C   1 
ATOM   3739  O  O   . LEU B  1 142 ? 22.301  0.150   50.479  1.00 36.83  ? 142 LEU B O   1 
ATOM   3740  C  CB  . LEU B  1 142 ? 22.831  -2.900  51.466  1.00 30.78  ? 142 LEU B CB  1 
ATOM   3741  C  CG  . LEU B  1 142 ? 22.382  -4.336  51.250  1.00 33.96  ? 142 LEU B CG  1 
ATOM   3742  C  CD1 . LEU B  1 142 ? 22.316  -5.055  52.582  1.00 30.69  ? 142 LEU B CD1 1 
ATOM   3743  C  CD2 . LEU B  1 142 ? 21.036  -4.365  50.547  1.00 32.54  ? 142 LEU B CD2 1 
ATOM   3744  N  N   . GLU B  1 143 ? 24.456  -0.222  50.962  1.00 33.04  ? 143 GLU B N   1 
ATOM   3745  C  CA  . GLU B  1 143 ? 24.653  1.139   51.441  1.00 34.29  ? 143 GLU B CA  1 
ATOM   3746  C  C   . GLU B  1 143 ? 24.497  2.164   50.322  1.00 39.33  ? 143 GLU B C   1 
ATOM   3747  O  O   . GLU B  1 143 ? 24.023  3.272   50.553  1.00 37.62  ? 143 GLU B O   1 
ATOM   3748  C  CB  . GLU B  1 143 ? 25.984  1.329   52.185  1.00 33.66  ? 143 GLU B CB  1 
ATOM   3749  C  CG  . GLU B  1 143 ? 27.205  0.736   51.526  1.00 44.20  ? 143 GLU B CG  1 
ATOM   3750  C  CD  . GLU B  1 143 ? 27.450  -0.698  51.973  1.00 54.68  ? 143 GLU B CD  1 
ATOM   3751  O  OE1 . GLU B  1 143 ? 26.781  -1.609  51.453  1.00 44.14  ? 143 GLU B OE1 1 
ATOM   3752  O  OE2 . GLU B  1 143 ? 28.314  -0.920  52.852  1.00 70.56  ? 143 GLU B OE2 1 
ATOM   3753  N  N   . ALA B  1 144 ? 24.895  1.796   49.113  1.00 33.45  ? 144 ALA B N   1 
ATOM   3754  C  CA  . ALA B  1 144 ? 24.682  2.682   47.987  1.00 31.78  ? 144 ALA B CA  1 
ATOM   3755  C  C   . ALA B  1 144 ? 23.181  2.700   47.676  1.00 30.54  ? 144 ALA B C   1 
ATOM   3756  O  O   . ALA B  1 144 ? 22.583  3.759   47.528  1.00 28.23  ? 144 ALA B O   1 
ATOM   3757  C  CB  . ALA B  1 144 ? 25.477  2.220   46.778  1.00 30.88  ? 144 ALA B CB  1 
ATOM   3758  N  N   . ALA B  1 145 ? 22.578  1.517   47.622  1.00 28.55  ? 145 ALA B N   1 
ATOM   3759  C  CA  . ALA B  1 145 ? 21.171  1.367   47.255  1.00 28.29  ? 145 ALA B CA  1 
ATOM   3760  C  C   . ALA B  1 145 ? 20.235  2.160   48.164  1.00 29.48  ? 145 ALA B C   1 
ATOM   3761  O  O   . ALA B  1 145 ? 19.216  2.646   47.724  1.00 26.47  ? 145 ALA B O   1 
ATOM   3762  C  CB  . ALA B  1 145 ? 20.766  -0.132  47.251  1.00 30.81  ? 145 ALA B CB  1 
ATOM   3763  N  N   . VAL B  1 146 ? 20.580  2.290   49.436  1.00 29.14  ? 146 VAL B N   1 
ATOM   3764  C  CA  . VAL B  1 146 ? 19.695  2.977   50.372  1.00 29.43  ? 146 VAL B CA  1 
ATOM   3765  C  C   . VAL B  1 146 ? 19.780  4.512   50.237  1.00 26.34  ? 146 VAL B C   1 
ATOM   3766  O  O   . VAL B  1 146 ? 19.024  5.239   50.889  1.00 29.96  ? 146 VAL B O   1 
ATOM   3767  C  CB  . VAL B  1 146 ? 19.925  2.501   51.853  1.00 29.55  ? 146 VAL B CB  1 
ATOM   3768  C  CG1 . VAL B  1 146 ? 21.214  3.085   52.413  1.00 28.93  ? 146 VAL B CG1 1 
ATOM   3769  C  CG2 . VAL B  1 146 ? 18.721  2.844   52.740  1.00 28.04  ? 146 VAL B CG2 1 
ATOM   3770  N  N   . MET B  1 147 ? 20.690  5.000   49.390  1.00 24.13  ? 147 MET B N   1 
ATOM   3771  C  CA  . MET B  1 147 ? 20.737  6.436   49.071  1.00 29.22  ? 147 MET B CA  1 
ATOM   3772  C  C   . MET B  1 147 ? 19.713  6.808   47.993  1.00 35.00  ? 147 MET B C   1 
ATOM   3773  O  O   . MET B  1 147 ? 19.462  7.994   47.738  1.00 33.43  ? 147 MET B O   1 
ATOM   3774  C  CB  . MET B  1 147 ? 22.130  6.863   48.603  1.00 28.83  ? 147 MET B CB  1 
ATOM   3775  C  CG  . MET B  1 147 ? 23.236  6.834   49.688  1.00 23.42  ? 147 MET B CG  1 
ATOM   3776  S  SD  . MET B  1 147 ? 22.848  7.892   51.094  1.00 31.21  ? 147 MET B SD  1 
ATOM   3777  C  CE  . MET B  1 147 ? 22.025  6.762   52.215  1.00 29.57  ? 147 MET B CE  1 
ATOM   3778  N  N   . ILE B  1 148 ? 19.120  5.791   47.372  1.00 29.17  ? 148 ILE B N   1 
ATOM   3779  C  CA  . ILE B  1 148 ? 18.214  6.000   46.237  1.00 24.99  ? 148 ILE B CA  1 
ATOM   3780  C  C   . ILE B  1 148 ? 16.812  6.477   46.625  1.00 25.14  ? 148 ILE B C   1 
ATOM   3781  O  O   . ILE B  1 148 ? 16.287  7.379   46.012  1.00 30.86  ? 148 ILE B O   1 
ATOM   3782  C  CB  . ILE B  1 148 ? 18.110  4.736   45.380  1.00 30.13  ? 148 ILE B CB  1 
ATOM   3783  C  CG1 . ILE B  1 148 ? 19.486  4.405   44.782  1.00 28.12  ? 148 ILE B CG1 1 
ATOM   3784  C  CG2 . ILE B  1 148 ? 17.010  4.897   44.298  1.00 27.96  ? 148 ILE B CG2 1 
ATOM   3785  C  CD1 . ILE B  1 148 ? 19.526  3.061   44.048  1.00 33.65  ? 148 ILE B CD1 1 
ATOM   3786  N  N   . PRO B  1 149 ? 16.204  5.864   47.654  1.00 31.33  ? 149 PRO B N   1 
ATOM   3787  C  CA  . PRO B  1 149 ? 14.843  6.192   48.102  1.00 30.70  ? 149 PRO B CA  1 
ATOM   3788  C  C   . PRO B  1 149 ? 14.543  7.666   48.345  1.00 33.03  ? 149 PRO B C   1 
ATOM   3789  O  O   . PRO B  1 149 ? 13.370  8.053   48.268  1.00 27.51  ? 149 PRO B O   1 
ATOM   3790  C  CB  . PRO B  1 149 ? 14.733  5.440   49.428  1.00 31.58  ? 149 PRO B CB  1 
ATOM   3791  C  CG  . PRO B  1 149 ? 15.566  4.222   49.202  1.00 32.40  ? 149 PRO B CG  1 
ATOM   3792  C  CD  . PRO B  1 149 ? 16.745  4.696   48.376  1.00 26.14  ? 149 PRO B CD  1 
ATOM   3793  N  N   . ASP B  1 150 ? 15.564  8.464   48.645  1.00 32.99  ? 150 ASP B N   1 
ATOM   3794  C  CA  . ASP B  1 150 ? 15.343  9.828   49.118  1.00 35.52  ? 150 ASP B CA  1 
ATOM   3795  C  C   . ASP B  1 150 ? 16.438  10.777  48.669  1.00 32.54  ? 150 ASP B C   1 
ATOM   3796  O  O   . ASP B  1 150 ? 16.175  11.748  47.962  1.00 30.76  ? 150 ASP B O   1 
ATOM   3797  C  CB  . ASP B  1 150 ? 15.232  9.844   50.644  1.00 27.78  ? 150 ASP B CB  1 
ATOM   3798  C  CG  . ASP B  1 150 ? 14.800  11.186  51.193  1.00 32.00  ? 150 ASP B CG  1 
ATOM   3799  O  OD1 . ASP B  1 150 ? 14.845  12.213  50.476  1.00 35.79  ? 150 ASP B OD1 1 
ATOM   3800  O  OD2 . ASP B  1 150 ? 14.406  11.209  52.368  1.00 30.20  ? 150 ASP B OD2 1 
ATOM   3801  N  N   . MET B  1 151 ? 17.669  10.493  49.066  1.00 29.30  ? 151 MET B N   1 
ATOM   3802  C  CA  . MET B  1 151 ? 18.754  11.418  48.768  1.00 29.03  ? 151 MET B CA  1 
ATOM   3803  C  C   . MET B  1 151 ? 18.889  11.651  47.271  1.00 29.93  ? 151 MET B C   1 
ATOM   3804  O  O   . MET B  1 151 ? 18.903  12.794  46.807  1.00 25.82  ? 151 MET B O   1 
ATOM   3805  C  CB  . MET B  1 151 ? 20.077  10.922  49.360  1.00 22.41  ? 151 MET B CB  1 
ATOM   3806  C  CG  . MET B  1 151 ? 20.041  10.772  50.883  1.00 32.89  ? 151 MET B CG  1 
ATOM   3807  S  SD  . MET B  1 151 ? 19.699  12.323  51.774  1.00 35.39  ? 151 MET B SD  1 
ATOM   3808  C  CE  . MET B  1 151 ? 17.920  12.231  52.005  1.00 24.79  ? 151 MET B CE  1 
ATOM   3809  N  N   . MET B  1 152 ? 18.990  10.569  46.509  1.00 29.52  ? 152 MET B N   1 
ATOM   3810  C  CA  . MET B  1 152 ? 19.211  10.705  45.082  1.00 29.85  ? 152 MET B CA  1 
ATOM   3811  C  C   . MET B  1 152 ? 17.973  11.276  44.346  1.00 30.34  ? 152 MET B C   1 
ATOM   3812  O  O   . MET B  1 152 ? 18.103  12.205  43.546  1.00 23.59  ? 152 MET B O   1 
ATOM   3813  C  CB  . MET B  1 152 ? 19.655  9.369   44.485  1.00 32.20  ? 152 MET B CB  1 
ATOM   3814  C  CG  . MET B  1 152 ? 20.202  9.491   43.086  1.00 34.22  ? 152 MET B CG  1 
ATOM   3815  S  SD  . MET B  1 152 ? 20.738  7.917   42.398  1.00 37.06  ? 152 MET B SD  1 
ATOM   3816  C  CE  . MET B  1 152 ? 21.729  7.294   43.721  1.00 25.12  ? 152 MET B CE  1 
ATOM   3817  N  N   . THR B  1 153 ? 16.784  10.738  44.628  1.00 29.57  ? 153 THR B N   1 
ATOM   3818  C  CA  . THR B  1 153 ? 15.566  11.238  43.979  1.00 33.11  ? 153 THR B CA  1 
ATOM   3819  C  C   . THR B  1 153 ? 15.298  12.721  44.311  1.00 29.93  ? 153 THR B C   1 
ATOM   3820  O  O   . THR B  1 153 ? 14.898  13.491  43.444  1.00 29.68  ? 153 THR B O   1 
ATOM   3821  C  CB  . THR B  1 153 ? 14.312  10.348  44.259  1.00 26.01  ? 153 THR B CB  1 
ATOM   3822  O  OG1 . THR B  1 153 ? 13.147  10.942  43.662  1.00 29.10  ? 153 THR B OG1 1 
ATOM   3823  C  CG2 . THR B  1 153 ? 14.069  10.184  45.732  1.00 23.12  ? 153 THR B CG2 1 
ATOM   3824  N  N   . THR B  1 154 ? 15.560  13.116  45.552  1.00 31.96  ? 154 THR B N   1 
ATOM   3825  C  CA  . THR B  1 154 ? 15.400  14.505  45.972  1.00 30.55  ? 154 THR B CA  1 
ATOM   3826  C  C   . THR B  1 154 ? 16.437  15.397  45.293  1.00 32.37  ? 154 THR B C   1 
ATOM   3827  O  O   . THR B  1 154 ? 16.101  16.378  44.628  1.00 26.48  ? 154 THR B O   1 
ATOM   3828  C  CB  . THR B  1 154 ? 15.503  14.643  47.504  1.00 31.55  ? 154 THR B CB  1 
ATOM   3829  O  OG1 . THR B  1 154 ? 14.413  13.928  48.109  1.00 29.91  ? 154 THR B OG1 1 
ATOM   3830  C  CG2 . THR B  1 154 ? 15.463  16.139  47.941  1.00 24.71  ? 154 THR B CG2 1 
ATOM   3831  N  N   . GLY B  1 155 ? 17.706  15.049  45.463  1.00 32.93  ? 155 GLY B N   1 
ATOM   3832  C  CA  . GLY B  1 155 ? 18.776  15.803  44.842  1.00 27.75  ? 155 GLY B CA  1 
ATOM   3833  C  C   . GLY B  1 155 ? 18.575  15.929  43.342  1.00 31.56  ? 155 GLY B C   1 
ATOM   3834  O  O   . GLY B  1 155 ? 18.715  17.013  42.783  1.00 29.38  ? 155 GLY B O   1 
ATOM   3835  N  N   . PHE B  1 156 ? 18.236  14.819  42.691  1.00 28.56  ? 156 PHE B N   1 
ATOM   3836  C  CA  . PHE B  1 156 ? 18.087  14.815  41.241  1.00 26.79  ? 156 PHE B CA  1 
ATOM   3837  C  C   . PHE B  1 156 ? 16.874  15.608  40.795  1.00 26.56  ? 156 PHE B C   1 
ATOM   3838  O  O   . PHE B  1 156 ? 16.906  16.238  39.755  1.00 25.92  ? 156 PHE B O   1 
ATOM   3839  C  CB  . PHE B  1 156 ? 18.048  13.395  40.687  1.00 24.42  ? 156 PHE B CB  1 
ATOM   3840  C  CG  . PHE B  1 156 ? 19.403  12.746  40.605  1.00 33.68  ? 156 PHE B CG  1 
ATOM   3841  C  CD1 . PHE B  1 156 ? 20.466  13.227  41.367  1.00 30.23  ? 156 PHE B CD1 1 
ATOM   3842  C  CD2 . PHE B  1 156 ? 19.611  11.637  39.805  1.00 36.09  ? 156 PHE B CD2 1 
ATOM   3843  C  CE1 . PHE B  1 156 ? 21.708  12.641  41.299  1.00 23.51  ? 156 PHE B CE1 1 
ATOM   3844  C  CE2 . PHE B  1 156 ? 20.856  11.036  39.745  1.00 38.05  ? 156 PHE B CE2 1 
ATOM   3845  C  CZ  . PHE B  1 156 ? 21.908  11.544  40.495  1.00 32.21  ? 156 PHE B CZ  1 
ATOM   3846  N  N   . HIS B  1 157 ? 15.816  15.578  41.596  1.00 25.12  ? 157 HIS B N   1 
ATOM   3847  C  CA  . HIS B  1 157 ? 14.627  16.370  41.317  1.00 30.27  ? 157 HIS B CA  1 
ATOM   3848  C  C   . HIS B  1 157 ? 14.973  17.860  41.334  1.00 31.60  ? 157 HIS B C   1 
ATOM   3849  O  O   . HIS B  1 157 ? 14.408  18.653  40.555  1.00 23.73  ? 157 HIS B O   1 
ATOM   3850  C  CB  . HIS B  1 157 ? 13.535  16.072  42.338  1.00 26.53  ? 157 HIS B CB  1 
ATOM   3851  C  CG  . HIS B  1 157 ? 12.177  16.532  41.919  1.00 24.79  ? 157 HIS B CG  1 
ATOM   3852  N  ND1 . HIS B  1 157 ? 11.626  16.206  40.695  1.00 27.23  ? 157 HIS B ND1 1 
ATOM   3853  C  CD2 . HIS B  1 157 ? 11.234  17.244  42.583  1.00 21.31  ? 157 HIS B CD2 1 
ATOM   3854  C  CE1 . HIS B  1 157 ? 10.412  16.727  40.611  1.00 28.17  ? 157 HIS B CE1 1 
ATOM   3855  N  NE2 . HIS B  1 157 ? 10.148  17.359  41.742  1.00 31.62  ? 157 HIS B NE2 1 
ATOM   3856  N  N   . GLY B  1 158 ? 15.912  18.234  42.201  1.00 30.57  ? 158 GLY B N   1 
ATOM   3857  C  CA  . GLY B  1 158 ? 16.393  19.609  42.222  1.00 30.42  ? 158 GLY B CA  1 
ATOM   3858  C  C   . GLY B  1 158 ? 16.974  19.990  40.876  1.00 28.73  ? 158 GLY B C   1 
ATOM   3859  O  O   . GLY B  1 158 ? 16.683  21.061  40.351  1.00 26.69  ? 158 GLY B O   1 
ATOM   3860  N  N   . ALA B  1 159 ? 17.770  19.096  40.294  1.00 26.00  ? 159 ALA B N   1 
ATOM   3861  C  CA  . ALA B  1 159 ? 18.321  19.346  38.959  1.00 30.96  ? 159 ALA B CA  1 
ATOM   3862  C  C   . ALA B  1 159 ? 17.260  19.268  37.848  1.00 31.56  ? 159 ALA B C   1 
ATOM   3863  O  O   . ALA B  1 159 ? 17.330  20.001  36.856  1.00 29.66  ? 159 ALA B O   1 
ATOM   3864  C  CB  . ALA B  1 159 ? 19.477  18.397  38.667  1.00 34.47  ? 159 ALA B CB  1 
ATOM   3865  N  N   . GLU B  1 160 ? 16.272  18.392  38.015  1.00 26.50  ? 160 GLU B N   1 
ATOM   3866  C  CA  . GLU B  1 160 ? 15.196  18.295  37.023  1.00 27.79  ? 160 GLU B CA  1 
ATOM   3867  C  C   . GLU B  1 160 ? 14.319  19.558  36.979  1.00 26.22  ? 160 GLU B C   1 
ATOM   3868  O  O   . GLU B  1 160 ? 14.055  20.089  35.912  1.00 30.43  ? 160 GLU B O   1 
ATOM   3869  C  CB  . GLU B  1 160 ? 14.323  17.067  37.290  1.00 27.30  ? 160 GLU B CB  1 
ATOM   3870  C  CG  . GLU B  1 160 ? 15.049  15.736  37.142  1.00 26.61  ? 160 GLU B CG  1 
ATOM   3871  C  CD  . GLU B  1 160 ? 14.247  14.576  37.711  1.00 32.76  ? 160 GLU B CD  1 
ATOM   3872  O  OE1 . GLU B  1 160 ? 13.521  14.766  38.715  1.00 32.93  ? 160 GLU B OE1 1 
ATOM   3873  O  OE2 . GLU B  1 160 ? 14.348  13.468  37.147  1.00 37.91  ? 160 GLU B OE2 1 
ATOM   3874  N  N   . LEU B  1 161 ? 13.853  20.018  38.138  1.00 28.52  ? 161 LEU B N   1 
ATOM   3875  C  CA  . LEU B  1 161 ? 13.068  21.236  38.211  1.00 26.01  ? 161 LEU B CA  1 
ATOM   3876  C  C   . LEU B  1 161 ? 13.867  22.438  37.696  1.00 28.51  ? 161 LEU B C   1 
ATOM   3877  O  O   . LEU B  1 161 ? 13.303  23.345  37.088  1.00 24.90  ? 161 LEU B O   1 
ATOM   3878  C  CB  . LEU B  1 161 ? 12.573  21.487  39.640  1.00 32.82  ? 161 LEU B CB  1 
ATOM   3879  C  CG  . LEU B  1 161 ? 11.598  20.464  40.245  1.00 38.24  ? 161 LEU B CG  1 
ATOM   3880  C  CD1 . LEU B  1 161 ? 11.319  20.741  41.725  1.00 31.19  ? 161 LEU B CD1 1 
ATOM   3881  C  CD2 . LEU B  1 161 ? 10.278  20.382  39.460  1.00 31.77  ? 161 LEU B CD2 1 
ATOM   3882  N  N   . ALA B  1 162 ? 15.177  22.435  37.930  1.00 27.13  ? 162 ALA B N   1 
ATOM   3883  C  CA  . ALA B  1 162 ? 16.053  23.529  37.463  1.00 31.63  ? 162 ALA B CA  1 
ATOM   3884  C  C   . ALA B  1 162 ? 16.085  23.699  35.938  1.00 31.34  ? 162 ALA B C   1 
ATOM   3885  O  O   . ALA B  1 162 ? 16.541  24.724  35.441  1.00 24.94  ? 162 ALA B O   1 
ATOM   3886  C  CB  . ALA B  1 162 ? 17.477  23.347  37.987  1.00 28.42  ? 162 ALA B CB  1 
ATOM   3887  N  N   . ASP B  1 163 ? 15.644  22.677  35.204  1.00 27.46  ? 163 ASP B N   1 
ATOM   3888  C  CA  . ASP B  1 163 ? 15.571  22.760  33.753  1.00 25.55  ? 163 ASP B CA  1 
ATOM   3889  C  C   . ASP B  1 163 ? 16.878  23.296  33.154  1.00 25.34  ? 163 ASP B C   1 
ATOM   3890  O  O   . ASP B  1 163 ? 16.897  24.305  32.436  1.00 29.78  ? 163 ASP B O   1 
ATOM   3891  C  CB  . ASP B  1 163 ? 14.411  23.675  33.374  1.00 26.82  ? 163 ASP B CB  1 
ATOM   3892  C  CG  . ASP B  1 163 ? 13.921  23.448  31.955  1.00 39.55  ? 163 ASP B CG  1 
ATOM   3893  O  OD1 . ASP B  1 163 ? 14.519  22.624  31.228  1.00 42.88  ? 163 ASP B OD1 1 
ATOM   3894  O  OD2 . ASP B  1 163 ? 12.933  24.111  31.564  1.00 43.09  ? 163 ASP B OD2 1 
ATOM   3895  N  N   . ILE B  1 164 ? 17.959  22.592  33.431  1.00 28.23  ? 164 ILE B N   1 
ATOM   3896  C  CA  . ILE B  1 164 ? 19.310  23.070  33.165  1.00 27.73  ? 164 ILE B CA  1 
ATOM   3897  C  C   . ILE B  1 164 ? 19.666  23.022  31.686  1.00 26.69  ? 164 ILE B C   1 
ATOM   3898  O  O   . ILE B  1 164 ? 19.347  22.063  31.006  1.00 26.76  ? 164 ILE B O   1 
ATOM   3899  C  CB  . ILE B  1 164 ? 20.310  22.204  33.950  1.00 28.18  ? 164 ILE B CB  1 
ATOM   3900  C  CG1 . ILE B  1 164 ? 20.122  22.433  35.452  1.00 29.97  ? 164 ILE B CG1 1 
ATOM   3901  C  CG2 . ILE B  1 164 ? 21.750  22.477  33.507  1.00 31.10  ? 164 ILE B CG2 1 
ATOM   3902  C  CD1 . ILE B  1 164 ? 20.889  21.435  36.329  1.00 25.60  ? 164 ILE B CD1 1 
ATOM   3903  N  N   . GLU B  1 165 ? 20.374  24.034  31.204  1.00 29.55  ? 165 GLU B N   1 
ATOM   3904  C  CA  . GLU B  1 165 ? 20.844  24.034  29.824  1.00 35.29  ? 165 GLU B CA  1 
ATOM   3905  C  C   . GLU B  1 165 ? 22.281  23.516  29.779  1.00 34.17  ? 165 GLU B C   1 
ATOM   3906  O  O   . GLU B  1 165 ? 23.049  23.744  30.696  1.00 30.06  ? 165 GLU B O   1 
ATOM   3907  C  CB  . GLU B  1 165 ? 20.798  25.457  29.250  1.00 28.65  ? 165 GLU B CB  1 
ATOM   3908  C  CG  . GLU B  1 165 ? 19.435  26.165  29.332  1.00 33.06  ? 165 GLU B CG  1 
ATOM   3909  C  CD  . GLU B  1 165 ? 19.583  27.697  29.299  1.00 45.98  ? 165 GLU B CD  1 
ATOM   3910  O  OE1 . GLU B  1 165 ? 19.775  28.328  30.374  1.00 45.51  ? 165 GLU B OE1 1 
ATOM   3911  O  OE2 . GLU B  1 165 ? 19.526  28.271  28.194  1.00 53.93  ? 165 GLU B OE2 1 
ATOM   3912  N  N   . MET B  1 166 ? 22.663  22.844  28.707  1.00 31.44  ? 166 MET B N   1 
ATOM   3913  C  CA  . MET B  1 166 ? 24.016  22.301  28.637  1.00 27.31  ? 166 MET B CA  1 
ATOM   3914  C  C   . MET B  1 166 ? 25.076  23.396  28.679  1.00 30.52  ? 166 MET B C   1 
ATOM   3915  O  O   . MET B  1 166 ? 25.026  24.350  27.909  1.00 30.30  ? 166 MET B O   1 
ATOM   3916  C  CB  . MET B  1 166 ? 24.167  21.440  27.390  1.00 27.00  ? 166 MET B CB  1 
ATOM   3917  C  CG  . MET B  1 166 ? 23.173  20.272  27.365  1.00 28.06  ? 166 MET B CG  1 
ATOM   3918  S  SD  . MET B  1 166 ? 23.557  18.946  26.200  1.00 31.53  ? 166 MET B SD  1 
ATOM   3919  C  CE  . MET B  1 166 ? 24.772  17.993  27.088  1.00 24.32  ? 166 MET B CE  1 
ATOM   3920  N  N   . GLY B  1 167 ? 26.027  23.260  29.598  1.00 38.43  ? 167 GLY B N   1 
ATOM   3921  C  CA  . GLY B  1 167 ? 27.139  24.192  29.713  1.00 29.21  ? 167 GLY B CA  1 
ATOM   3922  C  C   . GLY B  1 167 ? 26.828  25.382  30.589  1.00 28.88  ? 167 GLY B C   1 
ATOM   3923  O  O   . GLY B  1 167 ? 27.666  26.259  30.793  1.00 35.27  ? 167 GLY B O   1 
ATOM   3924  N  N   . SER B  1 168 ? 25.614  25.431  31.117  1.00 28.07  ? 168 SER B N   1 
ATOM   3925  C  CA  . SER B  1 168 ? 25.235  26.595  31.904  1.00 30.76  ? 168 SER B CA  1 
ATOM   3926  C  C   . SER B  1 168 ? 25.804  26.467  33.317  1.00 31.01  ? 168 SER B C   1 
ATOM   3927  O  O   . SER B  1 168 ? 26.247  25.390  33.722  1.00 29.71  ? 168 SER B O   1 
ATOM   3928  C  CB  . SER B  1 168 ? 23.715  26.775  31.923  1.00 33.04  ? 168 SER B CB  1 
ATOM   3929  O  OG  . SER B  1 168 ? 23.092  25.715  32.616  1.00 29.55  ? 168 SER B OG  1 
ATOM   3930  N  N   . SER B  1 169 ? 25.816  27.578  34.047  1.00 26.99  ? 169 SER B N   1 
ATOM   3931  C  CA  . SER B  1 169 ? 26.401  27.618  35.379  1.00 28.88  ? 169 SER B CA  1 
ATOM   3932  C  C   . SER B  1 169 ? 25.289  27.379  36.382  1.00 34.26  ? 169 SER B C   1 
ATOM   3933  O  O   . SER B  1 169 ? 24.173  27.883  36.211  1.00 32.35  ? 169 SER B O   1 
ATOM   3934  C  CB  . SER B  1 169 ? 27.033  28.987  35.637  1.00 30.62  ? 169 SER B CB  1 
ATOM   3935  O  OG  . SER B  1 169 ? 26.078  30.005  35.385  1.00 33.56  ? 169 SER B OG  1 
ATOM   3936  N  N   . VAL B  1 170 ? 25.590  26.586  37.409  1.00 28.54  ? 170 VAL B N   1 
ATOM   3937  C  CA  . VAL B  1 170 ? 24.617  26.244  38.437  1.00 23.38  ? 170 VAL B CA  1 
ATOM   3938  C  C   . VAL B  1 170 ? 25.239  26.452  39.821  1.00 35.66  ? 170 VAL B C   1 
ATOM   3939  O  O   . VAL B  1 170 ? 26.399  26.114  40.049  1.00 29.59  ? 170 VAL B O   1 
ATOM   3940  C  CB  . VAL B  1 170 ? 24.183  24.775  38.291  1.00 24.70  ? 170 VAL B CB  1 
ATOM   3941  C  CG1 . VAL B  1 170 ? 23.148  24.420  39.338  1.00 26.22  ? 170 VAL B CG1 1 
ATOM   3942  C  CG2 . VAL B  1 170 ? 23.651  24.511  36.858  1.00 19.02  ? 170 VAL B CG2 1 
ATOM   3943  N  N   . VAL B  1 171 ? 24.473  27.023  40.739  1.00 32.96  ? 171 VAL B N   1 
ATOM   3944  C  CA  . VAL B  1 171 ? 24.904  27.116  42.113  1.00 29.35  ? 171 VAL B CA  1 
ATOM   3945  C  C   . VAL B  1 171 ? 24.032  26.183  42.918  1.00 38.77  ? 171 VAL B C   1 
ATOM   3946  O  O   . VAL B  1 171 ? 22.804  26.217  42.794  1.00 29.10  ? 171 VAL B O   1 
ATOM   3947  C  CB  . VAL B  1 171 ? 24.695  28.521  42.711  1.00 32.49  ? 171 VAL B CB  1 
ATOM   3948  C  CG1 . VAL B  1 171 ? 24.906  28.468  44.221  1.00 34.55  ? 171 VAL B CG1 1 
ATOM   3949  C  CG2 . VAL B  1 171 ? 25.604  29.552  42.049  1.00 24.50  ? 171 VAL B CG2 1 
ATOM   3950  N  N   . VAL B  1 172 ? 24.651  25.372  43.771  1.00 35.82  ? 172 VAL B N   1 
ATOM   3951  C  CA  . VAL B  1 172 ? 23.876  24.550  44.683  1.00 30.58  ? 172 VAL B CA  1 
ATOM   3952  C  C   . VAL B  1 172 ? 24.161  25.009  46.104  1.00 33.61  ? 172 VAL B C   1 
ATOM   3953  O  O   . VAL B  1 172 ? 25.297  24.908  46.575  1.00 31.40  ? 172 VAL B O   1 
ATOM   3954  C  CB  . VAL B  1 172 ? 24.223  23.066  44.548  1.00 26.02  ? 172 VAL B CB  1 
ATOM   3955  C  CG1 . VAL B  1 172 ? 23.397  22.263  45.528  1.00 26.63  ? 172 VAL B CG1 1 
ATOM   3956  C  CG2 . VAL B  1 172 ? 23.989  22.592  43.093  1.00 30.02  ? 172 VAL B CG2 1 
ATOM   3957  N  N   . ILE B  1 173 ? 23.127  25.507  46.782  1.00 32.10  ? 173 ILE B N   1 
ATOM   3958  C  CA  . ILE B  1 173 ? 23.288  26.073  48.124  1.00 33.45  ? 173 ILE B CA  1 
ATOM   3959  C  C   . ILE B  1 173 ? 23.005  24.996  49.158  1.00 37.56  ? 173 ILE B C   1 
ATOM   3960  O  O   . ILE B  1 173 ? 21.877  24.518  49.277  1.00 32.75  ? 173 ILE B O   1 
ATOM   3961  C  CB  . ILE B  1 173 ? 22.358  27.297  48.358  1.00 33.69  ? 173 ILE B CB  1 
ATOM   3962  C  CG1 . ILE B  1 173 ? 22.651  28.409  47.339  1.00 34.67  ? 173 ILE B CG1 1 
ATOM   3963  C  CG2 . ILE B  1 173 ? 22.492  27.815  49.775  1.00 26.40  ? 173 ILE B CG2 1 
ATOM   3964  C  CD1 . ILE B  1 173 ? 21.716  29.633  47.443  1.00 28.91  ? 173 ILE B CD1 1 
ATOM   3965  N  N   . GLY B  1 174 ? 24.039  24.612  49.899  1.00 35.56  ? 174 GLY B N   1 
ATOM   3966  C  CA  . GLY B  1 174 ? 23.924  23.523  50.850  1.00 34.11  ? 174 GLY B CA  1 
ATOM   3967  C  C   . GLY B  1 174 ? 24.512  22.263  50.241  1.00 39.77  ? 174 GLY B C   1 
ATOM   3968  O  O   . GLY B  1 174 ? 24.080  21.813  49.165  1.00 35.23  ? 174 GLY B O   1 
ATOM   3969  N  N   . ILE B  1 175 ? 25.510  21.700  50.920  1.00 33.28  ? 175 ILE B N   1 
ATOM   3970  C  CA  . ILE B  1 175 ? 26.174  20.506  50.429  1.00 33.28  ? 175 ILE B CA  1 
ATOM   3971  C  C   . ILE B  1 175 ? 26.144  19.356  51.435  1.00 34.20  ? 175 ILE B C   1 
ATOM   3972  O  O   . ILE B  1 175 ? 27.130  18.641  51.599  1.00 35.34  ? 175 ILE B O   1 
ATOM   3973  C  CB  . ILE B  1 175 ? 27.633  20.790  50.004  1.00 38.18  ? 175 ILE B CB  1 
ATOM   3974  C  CG1 . ILE B  1 175 ? 28.408  21.487  51.122  1.00 41.11  ? 175 ILE B CG1 1 
ATOM   3975  C  CG2 . ILE B  1 175 ? 27.671  21.637  48.759  1.00 33.50  ? 175 ILE B CG2 1 
ATOM   3976  C  CD1 . ILE B  1 175 ? 29.826  21.787  50.729  1.00 40.44  ? 175 ILE B CD1 1 
ATOM   3977  N  N   . GLY B  1 176 ? 25.013  19.193  52.110  1.00 29.10  ? 176 GLY B N   1 
ATOM   3978  C  CA  . GLY B  1 176 ? 24.718  17.954  52.805  1.00 26.70  ? 176 GLY B CA  1 
ATOM   3979  C  C   . GLY B  1 176 ? 24.339  16.897  51.756  1.00 35.33  ? 176 GLY B C   1 
ATOM   3980  O  O   . GLY B  1 176 ? 24.470  17.124  50.552  1.00 34.33  ? 176 GLY B O   1 
ATOM   3981  N  N   . ALA B  1 177 ? 23.874  15.740  52.203  1.00 27.85  ? 177 ALA B N   1 
ATOM   3982  C  CA  . ALA B  1 177 ? 23.565  14.648  51.293  1.00 31.40  ? 177 ALA B CA  1 
ATOM   3983  C  C   . ALA B  1 177 ? 22.702  15.096  50.098  1.00 30.09  ? 177 ALA B C   1 
ATOM   3984  O  O   . ALA B  1 177 ? 23.027  14.815  48.943  1.00 29.17  ? 177 ALA B O   1 
ATOM   3985  C  CB  . ALA B  1 177 ? 22.896  13.496  52.057  1.00 31.34  ? 177 ALA B CB  1 
ATOM   3986  N  N   . VAL B  1 178 ? 21.616  15.813  50.362  1.00 30.24  ? 178 VAL B N   1 
ATOM   3987  C  CA  . VAL B  1 178 ? 20.744  16.228  49.259  1.00 35.92  ? 178 VAL B CA  1 
ATOM   3988  C  C   . VAL B  1 178 ? 21.429  17.150  48.241  1.00 30.76  ? 178 VAL B C   1 
ATOM   3989  O  O   . VAL B  1 178 ? 21.262  16.992  47.018  1.00 29.36  ? 178 VAL B O   1 
ATOM   3990  C  CB  . VAL B  1 178 ? 19.459  16.885  49.775  1.00 38.51  ? 178 VAL B CB  1 
ATOM   3991  C  CG1 . VAL B  1 178 ? 18.730  17.577  48.632  1.00 32.95  ? 178 VAL B CG1 1 
ATOM   3992  C  CG2 . VAL B  1 178 ? 18.567  15.830  50.448  1.00 36.50  ? 178 VAL B CG2 1 
ATOM   3993  N  N   . GLY B  1 179 ? 22.199  18.110  48.746  1.00 25.87  ? 179 GLY B N   1 
ATOM   3994  C  CA  . GLY B  1 179 ? 22.867  19.080  47.890  1.00 23.68  ? 179 GLY B CA  1 
ATOM   3995  C  C   . GLY B  1 179 ? 23.952  18.433  47.056  1.00 28.24  ? 179 GLY B C   1 
ATOM   3996  O  O   . GLY B  1 179 ? 24.182  18.820  45.910  1.00 28.31  ? 179 GLY B O   1 
ATOM   3997  N  N   . LEU B  1 180 ? 24.621  17.442  47.640  1.00 25.48  ? 180 LEU B N   1 
ATOM   3998  C  CA  . LEU B  1 180 ? 25.648  16.684  46.939  1.00 31.01  ? 180 LEU B CA  1 
ATOM   3999  C  C   . LEU B  1 180 ? 25.026  15.937  45.765  1.00 27.21  ? 180 LEU B C   1 
ATOM   4000  O  O   . LEU B  1 180 ? 25.593  15.875  44.680  1.00 31.53  ? 180 LEU B O   1 
ATOM   4001  C  CB  . LEU B  1 180 ? 26.354  15.706  47.906  1.00 29.21  ? 180 LEU B CB  1 
ATOM   4002  C  CG  . LEU B  1 180 ? 27.181  16.380  49.017  1.00 30.77  ? 180 LEU B CG  1 
ATOM   4003  C  CD1 . LEU B  1 180 ? 27.627  15.398  50.108  1.00 29.37  ? 180 LEU B CD1 1 
ATOM   4004  C  CD2 . LEU B  1 180 ? 28.402  17.140  48.451  1.00 22.40  ? 180 LEU B CD2 1 
ATOM   4005  N  N   . MET B  1 181 ? 23.859  15.354  45.999  1.00 24.92  ? 181 MET B N   1 
ATOM   4006  C  CA  . MET B  1 181 ? 23.095  14.741  44.919  1.00 32.71  ? 181 MET B CA  1 
ATOM   4007  C  C   . MET B  1 181 ? 22.553  15.814  43.950  1.00 30.55  ? 181 MET B C   1 
ATOM   4008  O  O   . MET B  1 181 ? 22.405  15.556  42.763  1.00 31.87  ? 181 MET B O   1 
ATOM   4009  C  CB  . MET B  1 181 ? 21.964  13.879  45.484  1.00 35.34  ? 181 MET B CB  1 
ATOM   4010  C  CG  . MET B  1 181 ? 22.440  12.558  46.102  1.00 35.66  ? 181 MET B CG  1 
ATOM   4011  S  SD  . MET B  1 181 ? 23.147  11.426  44.886  1.00 25.75  ? 181 MET B SD  1 
ATOM   4012  C  CE  . MET B  1 181 ? 24.914  11.765  44.972  1.00 23.24  ? 181 MET B CE  1 
ATOM   4013  N  N   . GLY B  1 182 ? 22.297  17.020  44.456  1.00 27.58  ? 182 GLY B N   1 
ATOM   4014  C  CA  . GLY B  1 182 ? 21.925  18.136  43.595  1.00 25.34  ? 182 GLY B CA  1 
ATOM   4015  C  C   . GLY B  1 182 ? 23.073  18.435  42.652  1.00 30.74  ? 182 GLY B C   1 
ATOM   4016  O  O   . GLY B  1 182 ? 22.883  18.703  41.458  1.00 25.21  ? 182 GLY B O   1 
ATOM   4017  N  N   . ILE B  1 183 ? 24.284  18.360  43.195  1.00 24.50  ? 183 ILE B N   1 
ATOM   4018  C  CA  . ILE B  1 183 ? 25.478  18.660  42.426  1.00 29.73  ? 183 ILE B CA  1 
ATOM   4019  C  C   . ILE B  1 183 ? 25.633  17.598  41.353  1.00 30.95  ? 183 ILE B C   1 
ATOM   4020  O  O   . ILE B  1 183 ? 25.845  17.906  40.172  1.00 29.17  ? 183 ILE B O   1 
ATOM   4021  C  CB  . ILE B  1 183 ? 26.732  18.726  43.356  1.00 27.60  ? 183 ILE B CB  1 
ATOM   4022  C  CG1 . ILE B  1 183 ? 26.764  20.070  44.091  1.00 30.26  ? 183 ILE B CG1 1 
ATOM   4023  C  CG2 . ILE B  1 183 ? 28.013  18.531  42.578  1.00 21.04  ? 183 ILE B CG2 1 
ATOM   4024  C  CD1 . ILE B  1 183 ? 27.823  20.160  45.198  1.00 29.71  ? 183 ILE B CD1 1 
ATOM   4025  N  N   . ALA B  1 184 ? 25.494  16.341  41.770  1.00 27.00  ? 184 ALA B N   1 
ATOM   4026  C  CA  . ALA B  1 184 ? 25.626  15.206  40.856  1.00 28.27  ? 184 ALA B CA  1 
ATOM   4027  C  C   . ALA B  1 184 ? 24.544  15.267  39.769  1.00 25.48  ? 184 ALA B C   1 
ATOM   4028  O  O   . ALA B  1 184 ? 24.813  15.044  38.586  1.00 22.63  ? 184 ALA B O   1 
ATOM   4029  C  CB  . ALA B  1 184 ? 25.523  13.915  41.622  1.00 19.56  ? 184 ALA B CB  1 
ATOM   4030  N  N   . GLY B  1 185 ? 23.318  15.560  40.186  1.00 25.71  ? 185 GLY B N   1 
ATOM   4031  C  CA  . GLY B  1 185 ? 22.211  15.688  39.245  1.00 24.14  ? 185 GLY B CA  1 
ATOM   4032  C  C   . GLY B  1 185 ? 22.463  16.798  38.230  1.00 27.07  ? 185 GLY B C   1 
ATOM   4033  O  O   . GLY B  1 185 ? 22.161  16.660  37.041  1.00 27.88  ? 185 GLY B O   1 
ATOM   4034  N  N   . ALA B  1 186 ? 23.027  17.906  38.699  1.00 24.56  ? 186 ALA B N   1 
ATOM   4035  C  CA  . ALA B  1 186 ? 23.275  19.031  37.808  1.00 24.53  ? 186 ALA B CA  1 
ATOM   4036  C  C   . ALA B  1 186 ? 24.319  18.645  36.787  1.00 24.49  ? 186 ALA B C   1 
ATOM   4037  O  O   . ALA B  1 186 ? 24.236  19.038  35.628  1.00 24.56  ? 186 ALA B O   1 
ATOM   4038  C  CB  . ALA B  1 186 ? 23.720  20.279  38.596  1.00 21.21  ? 186 ALA B CB  1 
ATOM   4039  N  N   . LYS B  1 187 ? 25.328  17.894  37.221  1.00 25.11  ? 187 LYS B N   1 
ATOM   4040  C  CA  . LYS B  1 187 ? 26.374  17.478  36.300  1.00 25.56  ? 187 LYS B CA  1 
ATOM   4041  C  C   . LYS B  1 187 ? 25.760  16.523  35.270  1.00 29.81  ? 187 LYS B C   1 
ATOM   4042  O  O   . LYS B  1 187 ? 26.016  16.622  34.072  1.00 31.98  ? 187 LYS B O   1 
ATOM   4043  C  CB  . LYS B  1 187 ? 27.548  16.827  37.046  1.00 25.17  ? 187 LYS B CB  1 
ATOM   4044  C  CG  . LYS B  1 187 ? 28.634  16.314  36.102  1.00 36.63  ? 187 LYS B CG  1 
ATOM   4045  C  CD  . LYS B  1 187 ? 29.789  15.689  36.843  1.00 46.50  ? 187 LYS B CD  1 
ATOM   4046  C  CE  . LYS B  1 187 ? 30.883  15.229  35.887  1.00 55.55  ? 187 LYS B CE  1 
ATOM   4047  N  NZ  . LYS B  1 187 ? 32.042  14.605  36.614  1.00 58.46  ? 187 LYS B NZ  1 
ATOM   4048  N  N   . LEU B  1 188 ? 24.930  15.604  35.744  1.00 22.69  ? 188 LEU B N   1 
ATOM   4049  C  CA  . LEU B  1 188 ? 24.240  14.695  34.848  1.00 25.64  ? 188 LEU B CA  1 
ATOM   4050  C  C   . LEU B  1 188 ? 23.229  15.394  33.927  1.00 31.30  ? 188 LEU B C   1 
ATOM   4051  O  O   . LEU B  1 188 ? 22.784  14.793  32.959  1.00 34.58  ? 188 LEU B O   1 
ATOM   4052  C  CB  . LEU B  1 188 ? 23.553  13.568  35.620  1.00 27.62  ? 188 LEU B CB  1 
ATOM   4053  C  CG  . LEU B  1 188 ? 24.535  12.580  36.243  1.00 42.05  ? 188 LEU B CG  1 
ATOM   4054  C  CD1 . LEU B  1 188 ? 23.781  11.494  36.969  1.00 45.85  ? 188 LEU B CD1 1 
ATOM   4055  C  CD2 . LEU B  1 188 ? 25.435  11.990  35.172  1.00 44.11  ? 188 LEU B CD2 1 
ATOM   4056  N  N   . ARG B  1 189 ? 22.870  16.648  34.202  1.00 27.75  ? 189 ARG B N   1 
ATOM   4057  C  CA  . ARG B  1 189 ? 22.019  17.370  33.251  1.00 23.77  ? 189 ARG B CA  1 
ATOM   4058  C  C   . ARG B  1 189 ? 22.856  18.200  32.297  1.00 29.32  ? 189 ARG B C   1 
ATOM   4059  O  O   . ARG B  1 189 ? 22.320  18.979  31.508  1.00 30.15  ? 189 ARG B O   1 
ATOM   4060  C  CB  . ARG B  1 189 ? 20.981  18.235  33.969  1.00 22.19  ? 189 ARG B CB  1 
ATOM   4061  C  CG  . ARG B  1 189 ? 19.934  17.403  34.710  1.00 23.04  ? 189 ARG B CG  1 
ATOM   4062  C  CD  . ARG B  1 189 ? 19.157  16.474  33.746  1.00 26.78  ? 189 ARG B CD  1 
ATOM   4063  N  NE  . ARG B  1 189 ? 18.095  17.185  33.033  1.00 34.12  ? 189 ARG B NE  1 
ATOM   4064  C  CZ  . ARG B  1 189 ? 17.387  16.678  32.022  1.00 34.85  ? 189 ARG B CZ  1 
ATOM   4065  N  NH1 . ARG B  1 189 ? 17.629  15.449  31.574  1.00 30.66  ? 189 ARG B NH1 1 
ATOM   4066  N  NH2 . ARG B  1 189 ? 16.441  17.411  31.445  1.00 30.36  ? 189 ARG B NH2 1 
ATOM   4067  N  N   . GLY B  1 190 ? 24.178  18.041  32.388  1.00 26.79  ? 190 GLY B N   1 
ATOM   4068  C  CA  . GLY B  1 190 ? 25.098  18.731  31.504  1.00 27.63  ? 190 GLY B CA  1 
ATOM   4069  C  C   . GLY B  1 190 ? 25.501  20.148  31.929  1.00 28.63  ? 190 GLY B C   1 
ATOM   4070  O  O   . GLY B  1 190 ? 25.903  20.960  31.099  1.00 25.41  ? 190 GLY B O   1 
ATOM   4071  N  N   . ALA B  1 191 ? 25.423  20.464  33.211  1.00 33.73  ? 191 ALA B N   1 
ATOM   4072  C  CA  . ALA B  1 191 ? 25.936  21.767  33.652  1.00 29.90  ? 191 ALA B CA  1 
ATOM   4073  C  C   . ALA B  1 191 ? 27.428  21.916  33.381  1.00 30.92  ? 191 ALA B C   1 
ATOM   4074  O  O   . ALA B  1 191 ? 28.194  20.944  33.452  1.00 25.02  ? 191 ALA B O   1 
ATOM   4075  C  CB  . ALA B  1 191 ? 25.648  21.998  35.113  1.00 19.56  ? 191 ALA B CB  1 
ATOM   4076  N  N   . GLY B  1 192 ? 27.836  23.146  33.069  1.00 31.98  ? 192 GLY B N   1 
ATOM   4077  C  CA  . GLY B  1 192 ? 29.247  23.478  32.947  1.00 32.57  ? 192 GLY B CA  1 
ATOM   4078  C  C   . GLY B  1 192 ? 29.822  23.738  34.334  1.00 29.52  ? 192 GLY B C   1 
ATOM   4079  O  O   . GLY B  1 192 ? 30.152  22.804  35.058  1.00 32.60  ? 192 GLY B O   1 
ATOM   4080  N  N   . ARG B  1 193 ? 29.901  25.009  34.722  1.00 24.83  ? 193 ARG B N   1 
ATOM   4081  C  CA  . ARG B  1 193 ? 30.413  25.363  36.041  1.00 25.59  ? 193 ARG B CA  1 
ATOM   4082  C  C   . ARG B  1 193 ? 29.395  24.990  37.109  1.00 26.69  ? 193 ARG B C   1 
ATOM   4083  O  O   . ARG B  1 193 ? 28.227  25.366  37.020  1.00 30.31  ? 193 ARG B O   1 
ATOM   4084  C  CB  . ARG B  1 193 ? 30.705  26.876  36.121  1.00 22.23  ? 193 ARG B CB  1 
ATOM   4085  C  CG  . ARG B  1 193 ? 31.544  27.279  37.322  1.00 27.35  ? 193 ARG B CG  1 
ATOM   4086  C  CD  . ARG B  1 193 ? 32.074  28.710  37.181  1.00 34.84  ? 193 ARG B CD  1 
ATOM   4087  N  NE  . ARG B  1 193 ? 33.112  29.019  38.165  1.00 31.91  ? 193 ARG B NE  1 
ATOM   4088  C  CZ  . ARG B  1 193 ? 33.755  30.185  38.248  1.00 33.07  ? 193 ARG B CZ  1 
ATOM   4089  N  NH1 . ARG B  1 193 ? 33.455  31.167  37.406  1.00 32.17  ? 193 ARG B NH1 1 
ATOM   4090  N  NH2 . ARG B  1 193 ? 34.698  30.370  39.179  1.00 32.97  ? 193 ARG B NH2 1 
ATOM   4091  N  N   . ILE B  1 194 ? 29.829  24.254  38.124  1.00 27.01  ? 194 ILE B N   1 
ATOM   4092  C  CA  . ILE B  1 194 ? 28.947  23.968  39.254  1.00 24.96  ? 194 ILE B CA  1 
ATOM   4093  C  C   . ILE B  1 194 ? 29.557  24.514  40.535  1.00 32.23  ? 194 ILE B C   1 
ATOM   4094  O  O   . ILE B  1 194 ? 30.680  24.166  40.908  1.00 31.57  ? 194 ILE B O   1 
ATOM   4095  C  CB  . ILE B  1 194 ? 28.643  22.459  39.404  1.00 24.54  ? 194 ILE B CB  1 
ATOM   4096  C  CG1 . ILE B  1 194 ? 27.856  21.926  38.184  1.00 21.91  ? 194 ILE B CG1 1 
ATOM   4097  C  CG2 . ILE B  1 194 ? 27.852  22.219  40.673  1.00 26.07  ? 194 ILE B CG2 1 
ATOM   4098  C  CD1 . ILE B  1 194 ? 27.850  20.322  38.070  1.00 19.20  ? 194 ILE B CD1 1 
ATOM   4099  N  N   . ILE B  1 195 ? 28.815  25.379  41.207  1.00 33.68  ? 195 ILE B N   1 
ATOM   4100  C  CA  . ILE B  1 195 ? 29.342  26.079  42.365  1.00 33.85  ? 195 ILE B CA  1 
ATOM   4101  C  C   . ILE B  1 195 ? 28.588  25.625  43.604  1.00 31.94  ? 195 ILE B C   1 
ATOM   4102  O  O   . ILE B  1 195 ? 27.395  25.878  43.745  1.00 32.54  ? 195 ILE B O   1 
ATOM   4103  C  CB  . ILE B  1 195 ? 29.227  27.614  42.161  1.00 24.21  ? 195 ILE B CB  1 
ATOM   4104  C  CG1 . ILE B  1 195 ? 30.057  28.038  40.950  1.00 24.93  ? 195 ILE B CG1 1 
ATOM   4105  C  CG2 . ILE B  1 195 ? 29.652  28.389  43.410  1.00 22.94  ? 195 ILE B CG2 1 
ATOM   4106  C  CD1 . ILE B  1 195 ? 29.818  29.478  40.511  1.00 31.12  ? 195 ILE B CD1 1 
ATOM   4107  N  N   . GLY B  1 196 ? 29.288  24.916  44.484  1.00 29.75  ? 196 GLY B N   1 
ATOM   4108  C  CA  . GLY B  1 196 ? 28.675  24.382  45.687  1.00 26.13  ? 196 GLY B CA  1 
ATOM   4109  C  C   . GLY B  1 196 ? 28.898  25.323  46.852  1.00 37.01  ? 196 GLY B C   1 
ATOM   4110  O  O   . GLY B  1 196 ? 29.955  25.967  46.943  1.00 37.15  ? 196 GLY B O   1 
ATOM   4111  N  N   . VAL B  1 197 ? 27.908  25.411  47.736  1.00 28.36  ? 197 VAL B N   1 
ATOM   4112  C  CA  . VAL B  1 197 ? 27.996  26.311  48.876  1.00 32.92  ? 197 VAL B CA  1 
ATOM   4113  C  C   . VAL B  1 197 ? 27.913  25.565  50.199  1.00 34.38  ? 197 VAL B C   1 
ATOM   4114  O  O   . VAL B  1 197 ? 26.865  25.028  50.553  1.00 36.99  ? 197 VAL B O   1 
ATOM   4115  C  CB  . VAL B  1 197 ? 26.905  27.387  48.837  1.00 37.40  ? 197 VAL B CB  1 
ATOM   4116  C  CG1 . VAL B  1 197 ? 27.029  28.325  50.046  1.00 36.55  ? 197 VAL B CG1 1 
ATOM   4117  C  CG2 . VAL B  1 197 ? 26.995  28.178  47.541  1.00 37.10  ? 197 VAL B CG2 1 
ATOM   4118  N  N   . GLY B  1 198 ? 29.024  25.548  50.929  1.00 36.33  ? 198 GLY B N   1 
ATOM   4119  C  CA  . GLY B  1 198 ? 29.086  24.924  52.242  1.00 38.09  ? 198 GLY B CA  1 
ATOM   4120  C  C   . GLY B  1 198 ? 30.494  25.004  52.807  1.00 40.53  ? 198 GLY B C   1 
ATOM   4121  O  O   . GLY B  1 198 ? 31.404  25.464  52.120  1.00 44.67  ? 198 GLY B O   1 
ATOM   4122  N  N   . SER B  1 199 ? 30.692  24.535  54.039  1.00 45.40  ? 199 SER B N   1 
ATOM   4123  C  CA  . SER B  1 199 ? 31.990  24.709  54.707  1.00 48.20  ? 199 SER B CA  1 
ATOM   4124  C  C   . SER B  1 199 ? 32.606  23.444  55.347  1.00 50.79  ? 199 SER B C   1 
ATOM   4125  O  O   . SER B  1 199 ? 33.835  23.343  55.455  1.00 46.99  ? 199 SER B O   1 
ATOM   4126  C  CB  . SER B  1 199 ? 31.910  25.847  55.733  1.00 44.10  ? 199 SER B CB  1 
ATOM   4127  O  OG  . SER B  1 199 ? 30.812  25.670  56.615  1.00 44.36  ? 199 SER B OG  1 
ATOM   4128  N  N   . ARG B  1 200 ? 31.762  22.500  55.772  1.00 48.19  ? 200 ARG B N   1 
ATOM   4129  C  CA  . ARG B  1 200 ? 32.230  21.242  56.363  1.00 52.58  ? 200 ARG B CA  1 
ATOM   4130  C  C   . ARG B  1 200 ? 33.120  20.462  55.410  1.00 48.02  ? 200 ARG B C   1 
ATOM   4131  O  O   . ARG B  1 200 ? 32.670  20.046  54.351  1.00 51.32  ? 200 ARG B O   1 
ATOM   4132  C  CB  . ARG B  1 200 ? 31.050  20.366  56.759  1.00 62.58  ? 200 ARG B CB  1 
ATOM   4133  C  CG  . ARG B  1 200 ? 30.415  20.740  58.072  1.00 75.43  ? 200 ARG B CG  1 
ATOM   4134  C  CD  . ARG B  1 200 ? 28.960  20.312  58.090  1.00 87.21  ? 200 ARG B CD  1 
ATOM   4135  N  NE  . ARG B  1 200 ? 28.488  20.077  59.447  1.00 93.75  ? 200 ARG B NE  1 
ATOM   4136  C  CZ  . ARG B  1 200 ? 28.538  18.896  60.052  1.00 98.19  ? 200 ARG B CZ  1 
ATOM   4137  N  NH1 . ARG B  1 200 ? 29.037  17.845  59.412  1.00 99.08  ? 200 ARG B NH1 1 
ATOM   4138  N  NH2 . ARG B  1 200 ? 28.087  18.768  61.292  1.00 100.53 ? 200 ARG B NH2 1 
ATOM   4139  N  N   . PRO B  1 201 ? 34.383  20.249  55.805  1.00 47.20  ? 201 PRO B N   1 
ATOM   4140  C  CA  . PRO B  1 201 ? 35.455  19.646  55.005  1.00 42.00  ? 201 PRO B CA  1 
ATOM   4141  C  C   . PRO B  1 201 ? 35.042  18.360  54.319  1.00 38.58  ? 201 PRO B C   1 
ATOM   4142  O  O   . PRO B  1 201 ? 35.385  18.151  53.153  1.00 41.64  ? 201 PRO B O   1 
ATOM   4143  C  CB  . PRO B  1 201 ? 36.535  19.326  56.055  1.00 45.78  ? 201 PRO B CB  1 
ATOM   4144  C  CG  . PRO B  1 201 ? 36.336  20.342  57.109  1.00 51.13  ? 201 PRO B CG  1 
ATOM   4145  C  CD  . PRO B  1 201 ? 34.852  20.634  57.149  1.00 53.93  ? 201 PRO B CD  1 
ATOM   4146  N  N   . ILE B  1 202 ? 34.351  17.489  55.048  1.00 36.47  ? 202 ILE B N   1 
ATOM   4147  C  CA  . ILE B  1 202 ? 33.976  16.198  54.482  1.00 40.75  ? 202 ILE B CA  1 
ATOM   4148  C  C   . ILE B  1 202 ? 32.956  16.395  53.363  1.00 33.85  ? 202 ILE B C   1 
ATOM   4149  O  O   . ILE B  1 202 ? 33.043  15.747  52.322  1.00 37.65  ? 202 ILE B O   1 
ATOM   4150  C  CB  . ILE B  1 202 ? 33.465  15.209  55.557  1.00 44.45  ? 202 ILE B CB  1 
ATOM   4151  C  CG1 . ILE B  1 202 ? 33.493  13.779  55.017  1.00 40.62  ? 202 ILE B CG1 1 
ATOM   4152  C  CG2 . ILE B  1 202 ? 32.082  15.622  56.095  1.00 39.10  ? 202 ILE B CG2 1 
ATOM   4153  C  CD1 . ILE B  1 202 ? 33.690  12.760  56.083  1.00 49.77  ? 202 ILE B CD1 1 
ATOM   4154  N  N   . CYS B  1 203 ? 32.025  17.323  53.565  1.00 32.69  ? 203 CYS B N   1 
ATOM   4155  C  CA  . CYS B  1 203 ? 31.045  17.651  52.521  1.00 40.75  ? 203 CYS B CA  1 
ATOM   4156  C  C   . CYS B  1 203 ? 31.746  18.338  51.365  1.00 37.25  ? 203 CYS B C   1 
ATOM   4157  O  O   . CYS B  1 203 ? 31.406  18.122  50.205  1.00 37.29  ? 203 CYS B O   1 
ATOM   4158  C  CB  . CYS B  1 203 ? 29.927  18.548  53.059  1.00 35.67  ? 203 CYS B CB  1 
ATOM   4159  S  SG  . CYS B  1 203 ? 28.949  17.812  54.392  1.00 44.99  ? 203 CYS B SG  1 
ATOM   4160  N  N   . VAL B  1 204 ? 32.743  19.162  51.688  1.00 37.68  ? 204 VAL B N   1 
ATOM   4161  C  CA  . VAL B  1 204 ? 33.508  19.874  50.664  1.00 33.42  ? 204 VAL B CA  1 
ATOM   4162  C  C   . VAL B  1 204 ? 34.209  18.913  49.697  1.00 38.61  ? 204 VAL B C   1 
ATOM   4163  O  O   . VAL B  1 204 ? 34.189  19.116  48.487  1.00 36.35  ? 204 VAL B O   1 
ATOM   4164  C  CB  . VAL B  1 204 ? 34.536  20.848  51.299  1.00 37.14  ? 204 VAL B CB  1 
ATOM   4165  C  CG1 . VAL B  1 204 ? 35.587  21.254  50.279  1.00 38.60  ? 204 VAL B CG1 1 
ATOM   4166  C  CG2 . VAL B  1 204 ? 33.823  22.079  51.873  1.00 33.06  ? 204 VAL B CG2 1 
ATOM   4167  N  N   . GLU B  1 205 ? 34.831  17.862  50.233  1.00 37.13  ? 205 GLU B N   1 
ATOM   4168  C  CA  . GLU B  1 205 ? 35.503  16.881  49.385  1.00 33.94  ? 205 GLU B CA  1 
ATOM   4169  C  C   . GLU B  1 205 ? 34.500  16.092  48.546  1.00 32.87  ? 205 GLU B C   1 
ATOM   4170  O  O   . GLU B  1 205 ? 34.736  15.817  47.363  1.00 34.39  ? 205 GLU B O   1 
ATOM   4171  C  CB  . GLU B  1 205 ? 36.362  15.926  50.223  1.00 39.09  ? 205 GLU B CB  1 
ATOM   4172  C  CG  . GLU B  1 205 ? 37.600  16.592  50.804  1.00 46.41  ? 205 GLU B CG  1 
ATOM   4173  C  CD  . GLU B  1 205 ? 38.471  17.233  49.729  1.00 51.81  ? 205 GLU B CD  1 
ATOM   4174  O  OE1 . GLU B  1 205 ? 38.699  18.467  49.792  1.00 49.83  ? 205 GLU B OE1 1 
ATOM   4175  O  OE2 . GLU B  1 205 ? 38.914  16.503  48.814  1.00 59.60  ? 205 GLU B OE2 1 
ATOM   4176  N  N   . ALA B  1 206 ? 33.385  15.723  49.166  1.00 27.37  ? 206 ALA B N   1 
ATOM   4177  C  CA  . ALA B  1 206 ? 32.350  15.003  48.457  1.00 28.16  ? 206 ALA B CA  1 
ATOM   4178  C  C   . ALA B  1 206 ? 31.781  15.864  47.314  1.00 29.13  ? 206 ALA B C   1 
ATOM   4179  O  O   . ALA B  1 206 ? 31.484  15.349  46.238  1.00 31.98  ? 206 ALA B O   1 
ATOM   4180  C  CB  . ALA B  1 206 ? 31.250  14.547  49.425  1.00 23.39  ? 206 ALA B CB  1 
ATOM   4181  N  N   . ALA B  1 207 ? 31.647  17.168  47.541  1.00 30.13  ? 207 ALA B N   1 
ATOM   4182  C  CA  . ALA B  1 207 ? 31.085  18.061  46.517  1.00 30.43  ? 207 ALA B CA  1 
ATOM   4183  C  C   . ALA B  1 207 ? 31.970  18.047  45.296  1.00 25.44  ? 207 ALA B C   1 
ATOM   4184  O  O   . ALA B  1 207 ? 31.492  17.967  44.168  1.00 31.41  ? 207 ALA B O   1 
ATOM   4185  C  CB  . ALA B  1 207 ? 30.944  19.479  47.051  1.00 30.04  ? 207 ALA B CB  1 
ATOM   4186  N  N   . LYS B  1 208 ? 33.274  18.107  45.538  1.00 29.63  ? 208 LYS B N   1 
ATOM   4187  C  CA  . LYS B  1 208 ? 34.267  18.006  44.482  1.00 33.61  ? 208 LYS B CA  1 
ATOM   4188  C  C   . LYS B  1 208 ? 34.129  16.677  43.762  1.00 32.97  ? 208 LYS B C   1 
ATOM   4189  O  O   . LYS B  1 208 ? 34.189  16.620  42.532  1.00 32.58  ? 208 LYS B O   1 
ATOM   4190  C  CB  . LYS B  1 208 ? 35.677  18.103  45.068  1.00 34.29  ? 208 LYS B CB  1 
ATOM   4191  C  CG  . LYS B  1 208 ? 36.002  19.463  45.697  1.00 43.35  ? 208 LYS B CG  1 
ATOM   4192  C  CD  . LYS B  1 208 ? 37.441  19.491  46.213  1.00 47.79  ? 208 LYS B CD  1 
ATOM   4193  C  CE  . LYS B  1 208 ? 37.821  20.856  46.778  1.00 50.61  ? 208 LYS B CE  1 
ATOM   4194  N  NZ  . LYS B  1 208 ? 39.045  20.750  47.634  1.00 51.25  ? 208 LYS B NZ  1 
ATOM   4195  N  N   . PHE B  1 209 ? 33.963  15.606  44.535  1.00 27.96  ? 209 PHE B N   1 
ATOM   4196  C  CA  . PHE B  1 209 ? 33.861  14.263  43.959  1.00 32.16  ? 209 PHE B CA  1 
ATOM   4197  C  C   . PHE B  1 209 ? 32.682  14.187  42.990  1.00 30.93  ? 209 PHE B C   1 
ATOM   4198  O  O   . PHE B  1 209 ? 32.785  13.630  41.909  1.00 32.82  ? 209 PHE B O   1 
ATOM   4199  C  CB  . PHE B  1 209 ? 33.702  13.224  45.069  1.00 37.26  ? 209 PHE B CB  1 
ATOM   4200  C  CG  . PHE B  1 209 ? 33.492  11.824  44.567  1.00 42.03  ? 209 PHE B CG  1 
ATOM   4201  C  CD1 . PHE B  1 209 ? 34.568  11.052  44.150  1.00 42.02  ? 209 PHE B CD1 1 
ATOM   4202  C  CD2 . PHE B  1 209 ? 32.221  11.273  44.531  1.00 42.32  ? 209 PHE B CD2 1 
ATOM   4203  C  CE1 . PHE B  1 209 ? 34.378  9.764   43.696  1.00 43.98  ? 209 PHE B CE1 1 
ATOM   4204  C  CE2 . PHE B  1 209 ? 32.022  9.991   44.079  1.00 37.10  ? 209 PHE B CE2 1 
ATOM   4205  C  CZ  . PHE B  1 209 ? 33.100  9.229   43.661  1.00 41.75  ? 209 PHE B CZ  1 
ATOM   4206  N  N   . TYR B  1 210 ? 31.568  14.786  43.381  1.00 31.59  ? 210 TYR B N   1 
ATOM   4207  C  CA  . TYR B  1 210 ? 30.357  14.740  42.566  1.00 34.98  ? 210 TYR B CA  1 
ATOM   4208  C  C   . TYR B  1 210 ? 30.282  15.804  41.437  1.00 38.66  ? 210 TYR B C   1 
ATOM   4209  O  O   . TYR B  1 210 ? 29.294  15.861  40.693  1.00 31.61  ? 210 TYR B O   1 
ATOM   4210  C  CB  . TYR B  1 210 ? 29.125  14.807  43.475  1.00 27.51  ? 210 TYR B CB  1 
ATOM   4211  C  CG  . TYR B  1 210 ? 28.883  13.527  44.267  1.00 29.03  ? 210 TYR B CG  1 
ATOM   4212  C  CD1 . TYR B  1 210 ? 28.642  12.313  43.621  1.00 22.02  ? 210 TYR B CD1 1 
ATOM   4213  C  CD2 . TYR B  1 210 ? 28.894  13.536  45.656  1.00 28.14  ? 210 TYR B CD2 1 
ATOM   4214  C  CE1 . TYR B  1 210 ? 28.407  11.161  44.343  1.00 31.94  ? 210 TYR B CE1 1 
ATOM   4215  C  CE2 . TYR B  1 210 ? 28.666  12.394  46.387  1.00 30.17  ? 210 TYR B CE2 1 
ATOM   4216  C  CZ  . TYR B  1 210 ? 28.425  11.203  45.729  1.00 36.78  ? 210 TYR B CZ  1 
ATOM   4217  O  OH  . TYR B  1 210 ? 28.205  10.060  46.467  1.00 28.77  ? 210 TYR B OH  1 
ATOM   4218  N  N   . GLY B  1 211 ? 31.311  16.647  41.318  1.00 30.03  ? 211 GLY B N   1 
ATOM   4219  C  CA  . GLY B  1 211 ? 31.402  17.554  40.188  1.00 30.49  ? 211 GLY B CA  1 
ATOM   4220  C  C   . GLY B  1 211 ? 31.468  19.062  40.416  1.00 34.04  ? 211 GLY B C   1 
ATOM   4221  O  O   . GLY B  1 211 ? 31.472  19.827  39.445  1.00 30.15  ? 211 GLY B O   1 
ATOM   4222  N  N   . ALA B  1 212 ? 31.531  19.510  41.670  1.00 31.40  ? 212 ALA B N   1 
ATOM   4223  C  CA  . ALA B  1 212 ? 31.680  20.947  41.922  1.00 32.44  ? 212 ALA B CA  1 
ATOM   4224  C  C   . ALA B  1 212 ? 33.013  21.441  41.380  1.00 32.16  ? 212 ALA B C   1 
ATOM   4225  O  O   . ALA B  1 212 ? 34.052  20.826  41.612  1.00 31.46  ? 212 ALA B O   1 
ATOM   4226  C  CB  . ALA B  1 212 ? 31.559  21.268  43.405  1.00 31.05  ? 212 ALA B CB  1 
ATOM   4227  N  N   . THR B  1 213 ? 32.978  22.547  40.646  1.00 30.69  ? 213 THR B N   1 
ATOM   4228  C  CA  . THR B  1 213 ? 34.196  23.184  40.161  1.00 32.70  ? 213 THR B CA  1 
ATOM   4229  C  C   . THR B  1 213 ? 34.661  24.261  41.150  1.00 36.66  ? 213 THR B C   1 
ATOM   4230  O  O   . THR B  1 213 ? 35.808  24.697  41.121  1.00 34.81  ? 213 THR B O   1 
ATOM   4231  C  CB  . THR B  1 213 ? 33.935  23.862  38.828  1.00 34.35  ? 213 THR B CB  1 
ATOM   4232  O  OG1 . THR B  1 213 ? 32.785  24.693  38.981  1.00 34.36  ? 213 THR B OG1 1 
ATOM   4233  C  CG2 . THR B  1 213 ? 33.646  22.820  37.749  1.00 38.66  ? 213 THR B CG2 1 
ATOM   4234  N  N   . ASP B  1 214 ? 33.750  24.703  42.009  1.00 35.56  ? 214 ASP B N   1 
ATOM   4235  C  CA  . ASP B  1 214 ? 34.047  25.753  42.969  1.00 35.25  ? 214 ASP B CA  1 
ATOM   4236  C  C   . ASP B  1 214 ? 33.259  25.461  44.223  1.00 37.08  ? 214 ASP B C   1 
ATOM   4237  O  O   . ASP B  1 214 ? 32.137  24.968  44.153  1.00 32.65  ? 214 ASP B O   1 
ATOM   4238  C  CB  . ASP B  1 214 ? 33.650  27.128  42.433  1.00 35.93  ? 214 ASP B CB  1 
ATOM   4239  C  CG  . ASP B  1 214 ? 34.215  27.404  41.058  1.00 39.59  ? 214 ASP B CG  1 
ATOM   4240  O  OD1 . ASP B  1 214 ? 33.635  26.921  40.062  1.00 35.99  ? 214 ASP B OD1 1 
ATOM   4241  O  OD2 . ASP B  1 214 ? 35.227  28.124  40.967  1.00 40.91  ? 214 ASP B OD2 1 
ATOM   4242  N  N   . ILE B  1 215 ? 33.863  25.756  45.365  1.00 31.06  ? 215 ILE B N   1 
ATOM   4243  C  CA  . ILE B  1 215 ? 33.204  25.601  46.651  1.00 47.81  ? 215 ILE B CA  1 
ATOM   4244  C  C   . ILE B  1 215 ? 33.298  26.931  47.381  1.00 52.30  ? 215 ILE B C   1 
ATOM   4245  O  O   . ILE B  1 215 ? 34.393  27.427  47.635  1.00 51.64  ? 215 ILE B O   1 
ATOM   4246  C  CB  . ILE B  1 215 ? 33.889  24.529  47.538  1.00 45.49  ? 215 ILE B CB  1 
ATOM   4247  C  CG1 . ILE B  1 215 ? 33.936  23.166  46.835  1.00 44.25  ? 215 ILE B CG1 1 
ATOM   4248  C  CG2 . ILE B  1 215 ? 33.173  24.427  48.872  1.00 42.23  ? 215 ILE B CG2 1 
ATOM   4249  C  CD1 . ILE B  1 215 ? 32.628  22.468  46.796  1.00 38.88  ? 215 ILE B CD1 1 
ATOM   4250  N  N   . LEU B  1 216 ? 32.146  27.504  47.701  1.00 49.15  ? 216 LEU B N   1 
ATOM   4251  C  CA  . LEU B  1 216 ? 32.085  28.789  48.362  1.00 46.42  ? 216 LEU B CA  1 
ATOM   4252  C  C   . LEU B  1 216 ? 31.723  28.608  49.817  1.00 42.27  ? 216 LEU B C   1 
ATOM   4253  O  O   . LEU B  1 216 ? 30.892  27.781  50.181  1.00 43.20  ? 216 LEU B O   1 
ATOM   4254  C  CB  . LEU B  1 216 ? 31.069  29.702  47.683  1.00 42.92  ? 216 LEU B CB  1 
ATOM   4255  C  CG  . LEU B  1 216 ? 31.393  30.079  46.244  1.00 35.48  ? 216 LEU B CG  1 
ATOM   4256  C  CD1 . LEU B  1 216 ? 30.498  31.237  45.791  1.00 28.99  ? 216 LEU B CD1 1 
ATOM   4257  C  CD2 . LEU B  1 216 ? 32.862  30.418  46.100  1.00 40.79  ? 216 LEU B CD2 1 
ATOM   4258  N  N   . ASN B  1 217 ? 32.375  29.397  50.647  1.00 40.89  ? 217 ASN B N   1 
ATOM   4259  C  CA  . ASN B  1 217 ? 32.250  29.296  52.079  1.00 43.97  ? 217 ASN B CA  1 
ATOM   4260  C  C   . ASN B  1 217 ? 31.884  30.703  52.510  1.00 42.97  ? 217 ASN B C   1 
ATOM   4261  O  O   . ASN B  1 217 ? 32.512  31.664  52.068  1.00 44.95  ? 217 ASN B O   1 
ATOM   4262  C  CB  . ASN B  1 217 ? 33.616  28.877  52.627  1.00 52.53  ? 217 ASN B CB  1 
ATOM   4263  C  CG  . ASN B  1 217 ? 33.653  28.764  54.129  1.00 54.89  ? 217 ASN B CG  1 
ATOM   4264  O  OD1 . ASN B  1 217 ? 33.094  29.584  54.854  1.00 53.98  ? 217 ASN B OD1 1 
ATOM   4265  N  ND2 . ASN B  1 217 ? 34.350  27.745  54.609  1.00 60.77  ? 217 ASN B ND2 1 
ATOM   4266  N  N   . TYR B  1 218 ? 30.852  30.832  53.337  1.00 35.06  ? 218 TYR B N   1 
ATOM   4267  C  CA  . TYR B  1 218 ? 30.414  32.137  53.804  1.00 37.92  ? 218 TYR B CA  1 
ATOM   4268  C  C   . TYR B  1 218 ? 31.525  32.912  54.528  1.00 39.73  ? 218 TYR B C   1 
ATOM   4269  O  O   . TYR B  1 218 ? 31.514  34.141  54.549  1.00 39.85  ? 218 TYR B O   1 
ATOM   4270  C  CB  . TYR B  1 218 ? 29.211  31.982  54.732  1.00 43.16  ? 218 TYR B CB  1 
ATOM   4271  C  CG  . TYR B  1 218 ? 29.581  31.420  56.079  1.00 52.67  ? 218 TYR B CG  1 
ATOM   4272  C  CD1 . TYR B  1 218 ? 29.751  32.257  57.176  1.00 53.33  ? 218 TYR B CD1 1 
ATOM   4273  C  CD2 . TYR B  1 218 ? 29.782  30.056  56.254  1.00 52.70  ? 218 TYR B CD2 1 
ATOM   4274  C  CE1 . TYR B  1 218 ? 30.098  31.753  58.414  1.00 53.82  ? 218 TYR B CE1 1 
ATOM   4275  C  CE2 . TYR B  1 218 ? 30.131  29.539  57.495  1.00 56.94  ? 218 TYR B CE2 1 
ATOM   4276  C  CZ  . TYR B  1 218 ? 30.285  30.398  58.572  1.00 59.56  ? 218 TYR B CZ  1 
ATOM   4277  O  OH  . TYR B  1 218 ? 30.627  29.905  59.811  1.00 65.37  ? 218 TYR B OH  1 
ATOM   4278  N  N   . LYS B  1 219 ? 32.479  32.197  55.119  1.00 38.41  ? 219 LYS B N   1 
ATOM   4279  C  CA  . LYS B  1 219 ? 33.566  32.850  55.842  1.00 43.76  ? 219 LYS B CA  1 
ATOM   4280  C  C   . LYS B  1 219 ? 34.408  33.716  54.903  1.00 44.58  ? 219 LYS B C   1 
ATOM   4281  O  O   . LYS B  1 219 ? 35.198  34.540  55.356  1.00 46.35  ? 219 LYS B O   1 
ATOM   4282  C  CB  . LYS B  1 219 ? 34.446  31.820  56.553  1.00 41.26  ? 219 LYS B CB  1 
ATOM   4283  C  CG  . LYS B  1 219 ? 33.724  31.023  57.627  1.00 51.23  ? 219 LYS B CG  1 
ATOM   4284  C  CD  . LYS B  1 219 ? 34.526  29.779  58.008  1.00 59.20  ? 219 LYS B CD  1 
ATOM   4285  C  CE  . LYS B  1 219 ? 33.838  28.967  59.091  1.00 64.63  ? 219 LYS B CE  1 
ATOM   4286  N  NZ  . LYS B  1 219 ? 33.776  29.710  60.376  1.00 73.42  ? 219 LYS B NZ  1 
ATOM   4287  N  N   . ASN B  1 220 ? 34.230  33.532  53.596  1.00 43.12  ? 220 ASN B N   1 
ATOM   4288  C  CA  . ASN B  1 220 ? 34.956  34.336  52.617  1.00 40.32  ? 220 ASN B CA  1 
ATOM   4289  C  C   . ASN B  1 220 ? 34.149  35.493  52.028  1.00 42.98  ? 220 ASN B C   1 
ATOM   4290  O  O   . ASN B  1 220 ? 34.523  36.045  50.992  1.00 40.40  ? 220 ASN B O   1 
ATOM   4291  C  CB  . ASN B  1 220 ? 35.517  33.458  51.500  1.00 39.28  ? 220 ASN B CB  1 
ATOM   4292  C  CG  . ASN B  1 220 ? 36.556  32.472  52.006  1.00 46.92  ? 220 ASN B CG  1 
ATOM   4293  O  OD1 . ASN B  1 220 ? 37.362  32.799  52.881  1.00 50.27  ? 220 ASN B OD1 1 
ATOM   4294  N  ND2 . ASN B  1 220 ? 36.538  31.258  51.466  1.00 38.85  ? 220 ASN B ND2 1 
ATOM   4295  N  N   . GLY B  1 221 ? 33.055  35.868  52.690  1.00 41.77  ? 221 GLY B N   1 
ATOM   4296  C  CA  . GLY B  1 221 ? 32.234  36.978  52.228  1.00 41.21  ? 221 GLY B CA  1 
ATOM   4297  C  C   . GLY B  1 221 ? 30.793  36.569  51.962  1.00 43.47  ? 221 GLY B C   1 
ATOM   4298  O  O   . GLY B  1 221 ? 30.457  35.382  52.017  1.00 41.62  ? 221 GLY B O   1 
ATOM   4299  N  N   . HIS B  1 222 ? 29.928  37.544  51.692  1.00 37.41  ? 222 HIS B N   1 
ATOM   4300  C  CA  . HIS B  1 222 ? 28.539  37.232  51.380  1.00 39.96  ? 222 HIS B CA  1 
ATOM   4301  C  C   . HIS B  1 222 ? 28.487  36.352  50.122  1.00 38.35  ? 222 HIS B C   1 
ATOM   4302  O  O   . HIS B  1 222 ? 29.159  36.640  49.129  1.00 40.78  ? 222 HIS B O   1 
ATOM   4303  C  CB  . HIS B  1 222 ? 27.717  38.508  51.198  1.00 44.02  ? 222 HIS B CB  1 
ATOM   4304  C  CG  . HIS B  1 222 ? 26.240  38.281  51.253  1.00 71.15  ? 222 HIS B CG  1 
ATOM   4305  N  ND1 . HIS B  1 222 ? 25.567  37.520  50.317  1.00 76.24  ? 222 HIS B ND1 1 
ATOM   4306  C  CD2 . HIS B  1 222 ? 25.305  38.706  52.135  1.00 80.53  ? 222 HIS B CD2 1 
ATOM   4307  C  CE1 . HIS B  1 222 ? 24.282  37.488  50.621  1.00 76.60  ? 222 HIS B CE1 1 
ATOM   4308  N  NE2 . HIS B  1 222 ? 24.096  38.201  51.717  1.00 83.04  ? 222 HIS B NE2 1 
ATOM   4309  N  N   . ILE B  1 223 ? 27.711  35.272  50.178  1.00 33.96  ? 223 ILE B N   1 
ATOM   4310  C  CA  . ILE B  1 223 ? 27.646  34.304  49.066  1.00 37.21  ? 223 ILE B CA  1 
ATOM   4311  C  C   . ILE B  1 223 ? 27.374  34.986  47.715  1.00 38.65  ? 223 ILE B C   1 
ATOM   4312  O  O   . ILE B  1 223 ? 28.048  34.717  46.717  1.00 33.43  ? 223 ILE B O   1 
ATOM   4313  C  CB  . ILE B  1 223 ? 26.561  33.241  49.315  1.00 40.61  ? 223 ILE B CB  1 
ATOM   4314  C  CG1 . ILE B  1 223 ? 26.770  32.588  50.674  1.00 45.38  ? 223 ILE B CG1 1 
ATOM   4315  C  CG2 . ILE B  1 223 ? 26.595  32.173  48.231  1.00 41.12  ? 223 ILE B CG2 1 
ATOM   4316  C  CD1 . ILE B  1 223 ? 28.121  31.937  50.807  1.00 45.77  ? 223 ILE B CD1 1 
ATOM   4317  N  N   . VAL B  1 224 ? 26.380  35.868  47.697  1.00 40.21  ? 224 VAL B N   1 
ATOM   4318  C  CA  . VAL B  1 224 ? 26.056  36.659  46.507  1.00 39.80  ? 224 VAL B CA  1 
ATOM   4319  C  C   . VAL B  1 224 ? 27.280  37.437  45.993  1.00 41.39  ? 224 VAL B C   1 
ATOM   4320  O  O   . VAL B  1 224 ? 27.638  37.330  44.819  1.00 36.32  ? 224 VAL B O   1 
ATOM   4321  C  CB  . VAL B  1 224 ? 24.869  37.605  46.800  1.00 43.22  ? 224 VAL B CB  1 
ATOM   4322  C  CG1 . VAL B  1 224 ? 24.518  38.499  45.581  1.00 34.59  ? 224 VAL B CG1 1 
ATOM   4323  C  CG2 . VAL B  1 224 ? 23.675  36.784  47.254  1.00 33.98  ? 224 VAL B CG2 1 
ATOM   4324  N  N   . ASP B  1 225 ? 27.939  38.194  46.874  1.00 37.96  ? 225 ASP B N   1 
ATOM   4325  C  CA  . ASP B  1 225 ? 29.156  38.914  46.491  1.00 37.04  ? 225 ASP B CA  1 
ATOM   4326  C  C   . ASP B  1 225 ? 30.167  37.992  45.826  1.00 41.61  ? 225 ASP B C   1 
ATOM   4327  O  O   . ASP B  1 225 ? 30.744  38.340  44.784  1.00 36.96  ? 225 ASP B O   1 
ATOM   4328  C  CB  . ASP B  1 225 ? 29.816  39.604  47.705  1.00 40.26  ? 225 ASP B CB  1 
ATOM   4329  C  CG  . ASP B  1 225 ? 28.963  40.716  48.266  1.00 45.69  ? 225 ASP B CG  1 
ATOM   4330  O  OD1 . ASP B  1 225 ? 28.053  41.175  47.543  1.00 44.81  ? 225 ASP B OD1 1 
ATOM   4331  O  OD2 . ASP B  1 225 ? 29.194  41.129  49.424  1.00 50.04  ? 225 ASP B OD2 1 
ATOM   4332  N  N   . GLN B  1 226 ? 30.372  36.820  46.436  1.00 35.88  ? 226 GLN B N   1 
ATOM   4333  C  CA  . GLN B  1 226 ? 31.313  35.833  45.927  1.00 34.25  ? 226 GLN B CA  1 
ATOM   4334  C  C   . GLN B  1 226 ? 30.903  35.292  44.552  1.00 33.65  ? 226 GLN B C   1 
ATOM   4335  O  O   . GLN B  1 226 ? 31.741  35.154  43.662  1.00 32.47  ? 226 GLN B O   1 
ATOM   4336  C  CB  . GLN B  1 226 ? 31.501  34.689  46.935  1.00 32.80  ? 226 GLN B CB  1 
ATOM   4337  C  CG  . GLN B  1 226 ? 32.258  35.102  48.220  1.00 37.05  ? 226 GLN B CG  1 
ATOM   4338  C  CD  . GLN B  1 226 ? 32.542  33.908  49.106  1.00 38.69  ? 226 GLN B CD  1 
ATOM   4339  O  OE1 . GLN B  1 226 ? 33.322  33.031  48.747  1.00 35.43  ? 226 GLN B OE1 1 
ATOM   4340  N  NE2 . GLN B  1 226 ? 31.880  33.849  50.250  1.00 44.12  ? 226 GLN B NE2 1 
ATOM   4341  N  N   . VAL B  1 227 ? 29.619  34.999  44.373  1.00 34.70  ? 227 VAL B N   1 
ATOM   4342  C  CA  . VAL B  1 227 ? 29.144  34.563  43.063  1.00 37.80  ? 227 VAL B CA  1 
ATOM   4343  C  C   . VAL B  1 227 ? 29.309  35.676  42.023  1.00 37.00  ? 227 VAL B C   1 
ATOM   4344  O  O   . VAL B  1 227 ? 29.772  35.440  40.909  1.00 38.97  ? 227 VAL B O   1 
ATOM   4345  C  CB  . VAL B  1 227 ? 27.678  34.072  43.103  1.00 42.19  ? 227 VAL B CB  1 
ATOM   4346  C  CG1 . VAL B  1 227 ? 27.198  33.719  41.697  1.00 38.79  ? 227 VAL B CG1 1 
ATOM   4347  C  CG2 . VAL B  1 227 ? 27.548  32.847  44.022  1.00 41.56  ? 227 VAL B CG2 1 
ATOM   4348  N  N   . MET B  1 228 ? 28.953  36.899  42.395  1.00 33.60  ? 228 MET B N   1 
ATOM   4349  C  CA  . MET B  1 228 ? 29.148  38.014  41.486  1.00 35.45  ? 228 MET B CA  1 
ATOM   4350  C  C   . MET B  1 228 ? 30.617  38.147  41.123  1.00 41.50  ? 228 MET B C   1 
ATOM   4351  O  O   . MET B  1 228 ? 30.947  38.424  39.976  1.00 44.36  ? 228 MET B O   1 
ATOM   4352  C  CB  . MET B  1 228 ? 28.614  39.311  42.081  1.00 32.84  ? 228 MET B CB  1 
ATOM   4353  C  CG  . MET B  1 228 ? 27.094  39.310  42.229  1.00 41.05  ? 228 MET B CG  1 
ATOM   4354  S  SD  . MET B  1 228 ? 26.243  38.837  40.687  1.00 55.54  ? 228 MET B SD  1 
ATOM   4355  C  CE  . MET B  1 228 ? 25.967  40.441  39.944  1.00 127.38 ? 228 MET B CE  1 
ATOM   4356  N  N   . LYS B  1 229 ? 31.500  37.919  42.092  1.00 37.09  ? 229 LYS B N   1 
ATOM   4357  C  CA  . LYS B  1 229 ? 32.928  37.991  41.824  1.00 44.15  ? 229 LYS B CA  1 
ATOM   4358  C  C   . LYS B  1 229 ? 33.386  36.874  40.889  1.00 43.58  ? 229 LYS B C   1 
ATOM   4359  O  O   . LYS B  1 229 ? 34.136  37.124  39.946  1.00 47.10  ? 229 LYS B O   1 
ATOM   4360  C  CB  . LYS B  1 229 ? 33.752  37.962  43.120  1.00 50.94  ? 229 LYS B CB  1 
ATOM   4361  C  CG  . LYS B  1 229 ? 35.191  38.375  42.901  1.00 62.62  ? 229 LYS B CG  1 
ATOM   4362  C  CD  . LYS B  1 229 ? 36.066  38.085  44.111  1.00 70.79  ? 229 LYS B CD  1 
ATOM   4363  C  CE  . LYS B  1 229 ? 37.471  38.629  43.906  1.00 73.69  ? 229 LYS B CE  1 
ATOM   4364  N  NZ  . LYS B  1 229 ? 38.470  37.853  44.691  1.00 78.08  ? 229 LYS B NZ  1 
ATOM   4365  N  N   . LEU B  1 230 ? 32.951  35.642  41.160  1.00 39.86  ? 230 LEU B N   1 
ATOM   4366  C  CA  . LEU B  1 230 ? 33.325  34.497  40.324  1.00 38.86  ? 230 LEU B CA  1 
ATOM   4367  C  C   . LEU B  1 230 ? 32.838  34.654  38.889  1.00 41.05  ? 230 LEU B C   1 
ATOM   4368  O  O   . LEU B  1 230 ? 33.463  34.122  37.957  1.00 37.44  ? 230 LEU B O   1 
ATOM   4369  C  CB  . LEU B  1 230 ? 32.767  33.187  40.893  1.00 36.24  ? 230 LEU B CB  1 
ATOM   4370  C  CG  . LEU B  1 230 ? 33.455  32.671  42.166  1.00 45.94  ? 230 LEU B CG  1 
ATOM   4371  C  CD1 . LEU B  1 230 ? 32.963  31.277  42.508  1.00 48.52  ? 230 LEU B CD1 1 
ATOM   4372  C  CD2 . LEU B  1 230 ? 34.972  32.682  42.021  1.00 43.04  ? 230 LEU B CD2 1 
ATOM   4373  N  N   . THR B  1 231 ? 31.722  35.371  38.715  1.00 30.18  ? 231 THR B N   1 
ATOM   4374  C  CA  . THR B  1 231 ? 31.076  35.441  37.400  1.00 32.86  ? 231 THR B CA  1 
ATOM   4375  C  C   . THR B  1 231 ? 31.224  36.825  36.819  1.00 40.32  ? 231 THR B C   1 
ATOM   4376  O  O   . THR B  1 231 ? 30.514  37.205  35.876  1.00 42.01  ? 231 THR B O   1 
ATOM   4377  C  CB  . THR B  1 231 ? 29.583  35.042  37.456  1.00 32.50  ? 231 THR B CB  1 
ATOM   4378  O  OG1 . THR B  1 231 ? 28.876  35.929  38.336  1.00 34.42  ? 231 THR B OG1 1 
ATOM   4379  C  CG2 . THR B  1 231 ? 29.445  33.608  37.953  1.00 26.60  ? 231 THR B CG2 1 
ATOM   4380  N  N   . ASN B  1 232 ? 32.167  37.570  37.393  1.00 47.17  ? 232 ASN B N   1 
ATOM   4381  C  CA  . ASN B  1 232 ? 32.406  38.955  37.010  1.00 46.18  ? 232 ASN B CA  1 
ATOM   4382  C  C   . ASN B  1 232 ? 31.123  39.773  36.836  1.00 44.87  ? 232 ASN B C   1 
ATOM   4383  O  O   . ASN B  1 232 ? 30.937  40.419  35.811  1.00 46.08  ? 232 ASN B O   1 
ATOM   4384  C  CB  . ASN B  1 232 ? 33.254  39.023  35.739  1.00 50.23  ? 232 ASN B CB  1 
ATOM   4385  C  CG  . ASN B  1 232 ? 33.625  40.447  35.366  1.00 73.71  ? 232 ASN B CG  1 
ATOM   4386  O  OD1 . ASN B  1 232 ? 33.537  40.835  34.201  1.00 80.68  ? 232 ASN B OD1 1 
ATOM   4387  N  ND2 . ASN B  1 232 ? 34.024  41.242  36.364  1.00 80.78  ? 232 ASN B ND2 1 
ATOM   4388  N  N   . GLY B  1 233 ? 30.247  39.742  37.841  1.00 42.04  ? 233 GLY B N   1 
ATOM   4389  C  CA  . GLY B  1 233 ? 29.019  40.529  37.837  1.00 37.89  ? 233 GLY B CA  1 
ATOM   4390  C  C   . GLY B  1 233 ? 27.836  39.942  37.060  1.00 42.31  ? 233 GLY B C   1 
ATOM   4391  O  O   . GLY B  1 233 ? 26.731  40.479  37.107  1.00 40.29  ? 233 GLY B O   1 
ATOM   4392  N  N   . LYS B  1 234 ? 28.047  38.828  36.366  1.00 37.40  ? 234 LYS B N   1 
ATOM   4393  C  CA  . LYS B  1 234 ? 27.008  38.308  35.472  1.00 42.68  ? 234 LYS B CA  1 
ATOM   4394  C  C   . LYS B  1 234 ? 25.985  37.408  36.161  1.00 36.41  ? 234 LYS B C   1 
ATOM   4395  O  O   . LYS B  1 234 ? 24.873  37.243  35.662  1.00 38.57  ? 234 LYS B O   1 
ATOM   4396  C  CB  . LYS B  1 234 ? 27.638  37.584  34.279  1.00 45.72  ? 234 LYS B CB  1 
ATOM   4397  C  CG  . LYS B  1 234 ? 28.520  38.484  33.412  1.00 54.57  ? 234 LYS B CG  1 
ATOM   4398  C  CD  . LYS B  1 234 ? 29.685  37.707  32.822  1.00 65.74  ? 234 LYS B CD  1 
ATOM   4399  C  CE  . LYS B  1 234 ? 30.745  38.638  32.247  1.00 74.80  ? 234 LYS B CE  1 
ATOM   4400  N  NZ  . LYS B  1 234 ? 32.080  37.970  32.163  1.00 78.15  ? 234 LYS B NZ  1 
ATOM   4401  N  N   . GLY B  1 235 ? 26.360  36.828  37.300  1.00 30.25  ? 235 GLY B N   1 
ATOM   4402  C  CA  . GLY B  1 235 ? 25.496  35.884  37.988  1.00 25.66  ? 235 GLY B CA  1 
ATOM   4403  C  C   . GLY B  1 235 ? 25.455  34.536  37.279  1.00 32.88  ? 235 GLY B C   1 
ATOM   4404  O  O   . GLY B  1 235 ? 26.194  34.311  36.318  1.00 36.51  ? 235 GLY B O   1 
ATOM   4405  N  N   . VAL B  1 236 ? 24.582  33.642  37.747  1.00 27.55  ? 236 VAL B N   1 
ATOM   4406  C  CA  . VAL B  1 236 ? 24.539  32.273  37.257  1.00 26.10  ? 236 VAL B CA  1 
ATOM   4407  C  C   . VAL B  1 236 ? 23.175  31.929  36.636  1.00 30.36  ? 236 VAL B C   1 
ATOM   4408  O  O   . VAL B  1 236 ? 22.177  32.585  36.902  1.00 35.66  ? 236 VAL B O   1 
ATOM   4409  C  CB  . VAL B  1 236 ? 24.820  31.268  38.389  1.00 28.87  ? 236 VAL B CB  1 
ATOM   4410  C  CG1 . VAL B  1 236 ? 26.280  31.391  38.879  1.00 26.86  ? 236 VAL B CG1 1 
ATOM   4411  C  CG2 . VAL B  1 236 ? 23.827  31.467  39.532  1.00 25.85  ? 236 VAL B CG2 1 
ATOM   4412  N  N   . ASP B  1 237 ? 23.142  30.887  35.816  1.00 26.41  ? 237 ASP B N   1 
ATOM   4413  C  CA  . ASP B  1 237 ? 21.909  30.518  35.113  1.00 27.87  ? 237 ASP B CA  1 
ATOM   4414  C  C   . ASP B  1 237 ? 20.874  29.852  36.028  1.00 27.53  ? 237 ASP B C   1 
ATOM   4415  O  O   . ASP B  1 237 ? 19.684  30.038  35.851  1.00 27.35  ? 237 ASP B O   1 
ATOM   4416  C  CB  . ASP B  1 237 ? 22.252  29.615  33.927  1.00 23.88  ? 237 ASP B CB  1 
ATOM   4417  C  CG  . ASP B  1 237 ? 23.151  30.307  32.932  1.00 29.43  ? 237 ASP B CG  1 
ATOM   4418  O  OD1 . ASP B  1 237 ? 22.716  31.342  32.390  1.00 28.01  ? 237 ASP B OD1 1 
ATOM   4419  O  OD2 . ASP B  1 237 ? 24.293  29.843  32.708  1.00 34.08  ? 237 ASP B OD2 1 
ATOM   4420  N  N   . ARG B  1 238 ? 21.328  29.087  37.017  1.00 22.84  ? 238 ARG B N   1 
ATOM   4421  C  CA  . ARG B  1 238 ? 20.406  28.300  37.824  1.00 26.21  ? 238 ARG B CA  1 
ATOM   4422  C  C   . ARG B  1 238 ? 20.852  28.213  39.268  1.00 28.61  ? 238 ARG B C   1 
ATOM   4423  O  O   . ARG B  1 238 ? 22.043  28.156  39.552  1.00 25.84  ? 238 ARG B O   1 
ATOM   4424  C  CB  . ARG B  1 238 ? 20.320  26.870  37.268  1.00 24.75  ? 238 ARG B CB  1 
ATOM   4425  C  CG  . ARG B  1 238 ? 19.771  26.789  35.855  1.00 29.12  ? 238 ARG B CG  1 
ATOM   4426  C  CD  . ARG B  1 238 ? 18.286  27.178  35.781  1.00 29.47  ? 238 ARG B CD  1 
ATOM   4427  N  NE  . ARG B  1 238 ? 17.732  26.860  34.469  1.00 34.05  ? 238 ARG B NE  1 
ATOM   4428  C  CZ  . ARG B  1 238 ? 17.801  27.670  33.413  1.00 39.16  ? 238 ARG B CZ  1 
ATOM   4429  N  NH1 . ARG B  1 238 ? 18.398  28.857  33.515  1.00 33.47  ? 238 ARG B NH1 1 
ATOM   4430  N  NH2 . ARG B  1 238 ? 17.276  27.292  32.249  1.00 27.28  ? 238 ARG B NH2 1 
ATOM   4431  N  N   . VAL B  1 239 ? 19.894  28.177  40.183  1.00 28.41  ? 239 VAL B N   1 
ATOM   4432  C  CA  . VAL B  1 239 ? 20.223  27.907  41.571  1.00 23.91  ? 239 VAL B CA  1 
ATOM   4433  C  C   . VAL B  1 239 ? 19.319  26.814  42.114  1.00 33.26  ? 239 VAL B C   1 
ATOM   4434  O  O   . VAL B  1 239 ? 18.090  26.851  41.950  1.00 31.73  ? 239 VAL B O   1 
ATOM   4435  C  CB  . VAL B  1 239 ? 20.064  29.142  42.476  1.00 29.51  ? 239 VAL B CB  1 
ATOM   4436  C  CG1 . VAL B  1 239 ? 20.667  28.852  43.851  1.00 28.00  ? 239 VAL B CG1 1 
ATOM   4437  C  CG2 . VAL B  1 239 ? 20.713  30.395  41.841  1.00 26.75  ? 239 VAL B CG2 1 
ATOM   4438  N  N   . ILE B  1 240 ? 19.946  25.840  42.757  1.00 28.58  ? 240 ILE B N   1 
ATOM   4439  C  CA  . ILE B  1 240 ? 19.236  24.789  43.459  1.00 29.00  ? 240 ILE B CA  1 
ATOM   4440  C  C   . ILE B  1 240 ? 19.421  25.011  44.951  1.00 34.52  ? 240 ILE B C   1 
ATOM   4441  O  O   . ILE B  1 240 ? 20.550  25.054  45.448  1.00 38.75  ? 240 ILE B O   1 
ATOM   4442  C  CB  . ILE B  1 240 ? 19.800  23.409  43.089  1.00 31.31  ? 240 ILE B CB  1 
ATOM   4443  C  CG1 . ILE B  1 240 ? 19.611  23.157  41.595  1.00 28.15  ? 240 ILE B CG1 1 
ATOM   4444  C  CG2 . ILE B  1 240 ? 19.154  22.327  43.946  1.00 30.76  ? 240 ILE B CG2 1 
ATOM   4445  C  CD1 . ILE B  1 240 ? 20.275  21.883  41.067  1.00 26.37  ? 240 ILE B CD1 1 
ATOM   4446  N  N   . MET B  1 241 ? 18.315  25.175  45.661  1.00 29.98  ? 241 MET B N   1 
ATOM   4447  C  CA  . MET B  1 241 ? 18.356  25.427  47.094  1.00 30.85  ? 241 MET B CA  1 
ATOM   4448  C  C   . MET B  1 241 ? 18.182  24.098  47.807  1.00 35.39  ? 241 MET B C   1 
ATOM   4449  O  O   . MET B  1 241 ? 17.114  23.461  47.723  1.00 35.47  ? 241 MET B O   1 
ATOM   4450  C  CB  . MET B  1 241 ? 17.247  26.406  47.504  1.00 28.30  ? 241 MET B CB  1 
ATOM   4451  C  CG  . MET B  1 241 ? 17.344  27.763  46.843  1.00 31.01  ? 241 MET B CG  1 
ATOM   4452  S  SD  . MET B  1 241 ? 15.834  28.731  47.094  1.00 40.06  ? 241 MET B SD  1 
ATOM   4453  C  CE  . MET B  1 241 ? 15.512  28.491  48.830  1.00 33.50  ? 241 MET B CE  1 
ATOM   4454  N  N   . ALA B  1 242 ? 19.242  23.670  48.488  1.00 33.46  ? 242 ALA B N   1 
ATOM   4455  C  CA  . ALA B  1 242 ? 19.274  22.339  49.092  1.00 37.63  ? 242 ALA B CA  1 
ATOM   4456  C  C   . ALA B  1 242 ? 19.559  22.372  50.591  1.00 38.87  ? 242 ALA B C   1 
ATOM   4457  O  O   . ALA B  1 242 ? 19.602  21.332  51.245  1.00 52.75  ? 242 ALA B O   1 
ATOM   4458  C  CB  . ALA B  1 242 ? 20.287  21.440  48.371  1.00 28.94  ? 242 ALA B CB  1 
ATOM   4459  N  N   . GLY B  1 243 ? 19.739  23.565  51.137  1.00 35.69  ? 243 GLY B N   1 
ATOM   4460  C  CA  . GLY B  1 243 ? 20.027  23.697  52.554  1.00 43.70  ? 243 GLY B CA  1 
ATOM   4461  C  C   . GLY B  1 243 ? 20.202  25.144  52.962  1.00 47.78  ? 243 GLY B C   1 
ATOM   4462  O  O   . GLY B  1 243 ? 20.226  26.036  52.107  1.00 47.54  ? 243 GLY B O   1 
ATOM   4463  N  N   . GLY B  1 244 ? 20.338  25.371  54.268  1.00 52.25  ? 244 GLY B N   1 
ATOM   4464  C  CA  . GLY B  1 244 ? 20.425  26.712  54.825  1.00 46.31  ? 244 GLY B CA  1 
ATOM   4465  C  C   . GLY B  1 244 ? 19.047  27.182  55.246  1.00 48.23  ? 244 GLY B C   1 
ATOM   4466  O  O   . GLY B  1 244 ? 18.064  26.466  55.063  1.00 55.28  ? 244 GLY B O   1 
ATOM   4467  N  N   . GLY B  1 245 ? 18.964  28.377  55.815  1.00 52.20  ? 245 GLY B N   1 
ATOM   4468  C  CA  . GLY B  1 245 ? 17.678  28.931  56.192  1.00 61.00  ? 245 GLY B CA  1 
ATOM   4469  C  C   . GLY B  1 245 ? 16.948  29.491  54.983  1.00 66.59  ? 245 GLY B C   1 
ATOM   4470  O  O   . GLY B  1 245 ? 17.461  29.432  53.865  1.00 65.17  ? 245 GLY B O   1 
ATOM   4471  N  N   . SER B  1 246 ? 15.755  30.041  55.204  1.00 71.72  ? 246 SER B N   1 
ATOM   4472  C  CA  . SER B  1 246 ? 14.952  30.593  54.114  1.00 77.01  ? 246 SER B CA  1 
ATOM   4473  C  C   . SER B  1 246 ? 15.564  31.861  53.504  1.00 75.08  ? 246 SER B C   1 
ATOM   4474  O  O   . SER B  1 246 ? 15.080  32.354  52.482  1.00 80.05  ? 246 SER B O   1 
ATOM   4475  C  CB  . SER B  1 246 ? 13.515  30.864  54.574  1.00 86.53  ? 246 SER B CB  1 
ATOM   4476  O  OG  . SER B  1 246 ? 13.384  32.168  55.118  1.00 95.64  ? 246 SER B OG  1 
ATOM   4477  N  N   . GLU B  1 247 ? 16.618  32.391  54.130  1.00 62.95  ? 247 GLU B N   1 
ATOM   4478  C  CA  . GLU B  1 247 ? 17.343  33.533  53.569  1.00 52.95  ? 247 GLU B CA  1 
ATOM   4479  C  C   . GLU B  1 247 ? 18.150  33.111  52.339  1.00 50.90  ? 247 GLU B C   1 
ATOM   4480  O  O   . GLU B  1 247 ? 18.628  33.952  51.576  1.00 52.04  ? 247 GLU B O   1 
ATOM   4481  C  CB  . GLU B  1 247 ? 18.263  34.168  54.604  1.00 52.96  ? 247 GLU B CB  1 
ATOM   4482  C  CG  . GLU B  1 247 ? 19.440  33.296  54.987  1.00 62.24  ? 247 GLU B CG  1 
ATOM   4483  C  CD  . GLU B  1 247 ? 19.047  32.152  55.911  1.00 72.62  ? 247 GLU B CD  1 
ATOM   4484  O  OE1 . GLU B  1 247 ? 17.943  32.208  56.498  1.00 72.79  ? 247 GLU B OE1 1 
ATOM   4485  O  OE2 . GLU B  1 247 ? 19.847  31.200  56.053  1.00 77.41  ? 247 GLU B OE2 1 
ATOM   4486  N  N   . THR B  1 248 ? 18.293  31.802  52.148  1.00 40.38  ? 248 THR B N   1 
ATOM   4487  C  CA  . THR B  1 248 ? 18.857  31.274  50.913  1.00 38.54  ? 248 THR B CA  1 
ATOM   4488  C  C   . THR B  1 248 ? 18.011  31.651  49.688  1.00 34.56  ? 248 THR B C   1 
ATOM   4489  O  O   . THR B  1 248 ? 18.552  31.814  48.597  1.00 36.71  ? 248 THR B O   1 
ATOM   4490  C  CB  . THR B  1 248 ? 19.021  29.737  50.963  1.00 41.93  ? 248 THR B CB  1 
ATOM   4491  O  OG1 . THR B  1 248 ? 17.739  29.140  51.151  1.00 49.98  ? 248 THR B OG1 1 
ATOM   4492  C  CG2 . THR B  1 248 ? 19.960  29.317  52.109  1.00 42.54  ? 248 THR B CG2 1 
ATOM   4493  N  N   . LEU B  1 249 ? 16.693  31.775  49.860  1.00 31.03  ? 249 LEU B N   1 
ATOM   4494  C  CA  . LEU B  1 249 ? 15.829  32.216  48.754  1.00 35.02  ? 249 LEU B CA  1 
ATOM   4495  C  C   . LEU B  1 249 ? 16.263  33.580  48.227  1.00 36.19  ? 249 LEU B C   1 
ATOM   4496  O  O   . LEU B  1 249 ? 16.412  33.772  47.023  1.00 38.89  ? 249 LEU B O   1 
ATOM   4497  C  CB  . LEU B  1 249 ? 14.343  32.264  49.147  1.00 33.43  ? 249 LEU B CB  1 
ATOM   4498  C  CG  . LEU B  1 249 ? 13.403  32.763  48.018  1.00 38.25  ? 249 LEU B CG  1 
ATOM   4499  C  CD1 . LEU B  1 249 ? 13.541  31.914  46.773  1.00 33.54  ? 249 LEU B CD1 1 
ATOM   4500  C  CD2 . LEU B  1 249 ? 11.929  32.823  48.433  1.00 34.53  ? 249 LEU B CD2 1 
ATOM   4501  N  N   . SER B  1 250 ? 16.482  34.530  49.132  1.00 40.10  ? 250 SER B N   1 
ATOM   4502  C  CA  . SER B  1 250 ? 16.909  35.850  48.706  1.00 39.26  ? 250 SER B CA  1 
ATOM   4503  C  C   . SER B  1 250 ? 18.278  35.802  48.025  1.00 36.59  ? 250 SER B C   1 
ATOM   4504  O  O   . SER B  1 250 ? 18.512  36.461  47.007  1.00 34.15  ? 250 SER B O   1 
ATOM   4505  C  CB  . SER B  1 250 ? 16.954  36.812  49.883  1.00 43.21  ? 250 SER B CB  1 
ATOM   4506  O  OG  . SER B  1 250 ? 17.464  38.053  49.445  1.00 42.20  ? 250 SER B OG  1 
ATOM   4507  N  N   . GLN B  1 251 ? 19.180  35.020  48.596  1.00 34.23  ? 251 GLN B N   1 
ATOM   4508  C  CA  . GLN B  1 251 ? 20.498  34.863  48.015  1.00 38.93  ? 251 GLN B CA  1 
ATOM   4509  C  C   . GLN B  1 251 ? 20.349  34.306  46.602  1.00 36.85  ? 251 GLN B C   1 
ATOM   4510  O  O   . GLN B  1 251 ? 20.999  34.772  45.669  1.00 39.47  ? 251 GLN B O   1 
ATOM   4511  C  CB  . GLN B  1 251 ? 21.355  33.927  48.876  1.00 40.76  ? 251 GLN B CB  1 
ATOM   4512  C  CG  . GLN B  1 251 ? 21.643  34.463  50.282  1.00 50.08  ? 251 GLN B CG  1 
ATOM   4513  C  CD  . GLN B  1 251 ? 22.208  33.406  51.243  1.00 54.69  ? 251 GLN B CD  1 
ATOM   4514  O  OE1 . GLN B  1 251 ? 22.621  32.313  50.831  1.00 52.73  ? 251 GLN B OE1 1 
ATOM   4515  N  NE2 . GLN B  1 251 ? 22.228  33.739  52.533  1.00 52.21  ? 251 GLN B NE2 1 
ATOM   4516  N  N   . ALA B  1 252 ? 19.490  33.306  46.449  1.00 30.45  ? 252 ALA B N   1 
ATOM   4517  C  CA  . ALA B  1 252 ? 19.307  32.682  45.143  1.00 33.93  ? 252 ALA B CA  1 
ATOM   4518  C  C   . ALA B  1 252 ? 18.743  33.691  44.136  1.00 31.14  ? 252 ALA B C   1 
ATOM   4519  O  O   . ALA B  1 252 ? 19.236  33.796  43.014  1.00 28.42  ? 252 ALA B O   1 
ATOM   4520  C  CB  . ALA B  1 252 ? 18.412  31.448  45.245  1.00 31.73  ? 252 ALA B CB  1 
ATOM   4521  N  N   . VAL B  1 253 ? 17.726  34.444  44.539  1.00 32.10  ? 253 VAL B N   1 
ATOM   4522  C  CA  . VAL B  1 253 ? 17.168  35.457  43.637  1.00 35.33  ? 253 VAL B CA  1 
ATOM   4523  C  C   . VAL B  1 253 ? 18.240  36.446  43.208  1.00 39.16  ? 253 VAL B C   1 
ATOM   4524  O  O   . VAL B  1 253 ? 18.365  36.753  42.028  1.00 32.37  ? 253 VAL B O   1 
ATOM   4525  C  CB  . VAL B  1 253 ? 15.999  36.218  44.272  1.00 32.78  ? 253 VAL B CB  1 
ATOM   4526  C  CG1 . VAL B  1 253 ? 15.558  37.366  43.372  1.00 37.94  ? 253 VAL B CG1 1 
ATOM   4527  C  CG2 . VAL B  1 253 ? 14.837  35.261  44.547  1.00 29.93  ? 253 VAL B CG2 1 
ATOM   4528  N  N   . LYS B  1 254 ? 19.037  36.914  44.169  1.00 35.55  ? 254 LYS B N   1 
ATOM   4529  C  CA  . LYS B  1 254 ? 20.050  37.925  43.886  1.00 36.46  ? 254 LYS B CA  1 
ATOM   4530  C  C   . LYS B  1 254 ? 21.183  37.405  43.005  1.00 36.14  ? 254 LYS B C   1 
ATOM   4531  O  O   . LYS B  1 254 ? 21.802  38.161  42.271  1.00 35.06  ? 254 LYS B O   1 
ATOM   4532  C  CB  . LYS B  1 254 ? 20.608  38.516  45.185  1.00 37.30  ? 254 LYS B CB  1 
ATOM   4533  C  CG  . LYS B  1 254 ? 19.564  39.263  45.994  1.00 43.65  ? 254 LYS B CG  1 
ATOM   4534  C  CD  . LYS B  1 254 ? 20.167  39.958  47.210  1.00 48.08  ? 254 LYS B CD  1 
ATOM   4535  C  CE  . LYS B  1 254 ? 19.091  40.700  47.995  1.00 49.47  ? 254 LYS B CE  1 
ATOM   4536  N  NZ  . LYS B  1 254 ? 19.646  41.422  49.178  1.00 62.10  ? 254 LYS B NZ  1 
ATOM   4537  N  N   . MET B  1 255 ? 21.449  36.110  43.054  1.00 33.29  ? 255 MET B N   1 
ATOM   4538  C  CA  . MET B  1 255 ? 22.558  35.590  42.252  1.00 40.37  ? 255 MET B CA  1 
ATOM   4539  C  C   . MET B  1 255 ? 22.174  35.056  40.852  1.00 37.59  ? 255 MET B C   1 
ATOM   4540  O  O   . MET B  1 255 ? 23.044  35.000  39.973  1.00 29.23  ? 255 MET B O   1 
ATOM   4541  C  CB  . MET B  1 255 ? 23.395  34.567  43.038  1.00 37.99  ? 255 MET B CB  1 
ATOM   4542  C  CG  . MET B  1 255 ? 22.689  33.250  43.319  1.00 47.65  ? 255 MET B CG  1 
ATOM   4543  S  SD  . MET B  1 255 ? 23.742  32.066  44.217  1.00 39.60  ? 255 MET B SD  1 
ATOM   4544  C  CE  . MET B  1 255 ? 23.795  32.829  45.831  1.00 27.26  ? 255 MET B CE  1 
ATOM   4545  N  N   . VAL B  1 256 ? 20.901  34.696  40.629  1.00 30.20  ? 256 VAL B N   1 
ATOM   4546  C  CA  . VAL B  1 256 ? 20.522  34.145  39.316  1.00 29.45  ? 256 VAL B CA  1 
ATOM   4547  C  C   . VAL B  1 256 ? 20.327  35.259  38.342  1.00 26.65  ? 256 VAL B C   1 
ATOM   4548  O  O   . VAL B  1 256 ? 19.893  36.333  38.720  1.00 30.95  ? 256 VAL B O   1 
ATOM   4549  C  CB  . VAL B  1 256 ? 19.151  33.364  39.249  1.00 38.18  ? 256 VAL B CB  1 
ATOM   4550  C  CG1 . VAL B  1 256 ? 19.319  31.870  39.379  1.00 44.54  ? 256 VAL B CG1 1 
ATOM   4551  C  CG2 . VAL B  1 256 ? 18.066  33.951  40.163  1.00 29.17  ? 256 VAL B CG2 1 
ATOM   4552  N  N   . LYS B  1 257 ? 20.602  34.970  37.078  1.00 26.92  ? 257 LYS B N   1 
ATOM   4553  C  CA  . LYS B  1 257 ? 20.285  35.874  35.987  1.00 33.10  ? 257 LYS B CA  1 
ATOM   4554  C  C   . LYS B  1 257 ? 18.780  36.028  35.796  1.00 35.60  ? 257 LYS B C   1 
ATOM   4555  O  O   . LYS B  1 257 ? 18.006  35.123  36.117  1.00 29.32  ? 257 LYS B O   1 
ATOM   4556  C  CB  . LYS B  1 257 ? 20.880  35.352  34.685  1.00 33.72  ? 257 LYS B CB  1 
ATOM   4557  C  CG  . LYS B  1 257 ? 22.366  35.086  34.761  1.00 37.46  ? 257 LYS B CG  1 
ATOM   4558  C  CD  . LYS B  1 257 ? 22.840  34.543  33.430  1.00 40.43  ? 257 LYS B CD  1 
ATOM   4559  C  CE  . LYS B  1 257 ? 24.346  34.454  33.380  1.00 42.88  ? 257 LYS B CE  1 
ATOM   4560  N  NZ  . LYS B  1 257 ? 24.711  33.402  32.418  1.00 39.12  ? 257 LYS B NZ  1 
ATOM   4561  N  N   . PRO B  1 258 ? 18.362  37.201  35.286  1.00 28.74  ? 258 PRO B N   1 
ATOM   4562  C  CA  . PRO B  1 258 ? 17.016  37.366  34.742  1.00 28.71  ? 258 PRO B CA  1 
ATOM   4563  C  C   . PRO B  1 258 ? 16.762  36.225  33.765  1.00 31.77  ? 258 PRO B C   1 
ATOM   4564  O  O   . PRO B  1 258 ? 17.638  35.940  32.954  1.00 35.31  ? 258 PRO B O   1 
ATOM   4565  C  CB  . PRO B  1 258 ? 17.108  38.709  33.993  1.00 27.52  ? 258 PRO B CB  1 
ATOM   4566  C  CG  . PRO B  1 258 ? 18.184  39.474  34.714  1.00 24.03  ? 258 PRO B CG  1 
ATOM   4567  C  CD  . PRO B  1 258 ? 19.173  38.429  35.187  1.00 30.81  ? 258 PRO B CD  1 
ATOM   4568  N  N   . GLY B  1 259 ? 15.603  35.577  33.847  1.00 31.52  ? 259 GLY B N   1 
ATOM   4569  C  CA  . GLY B  1 259 ? 15.281  34.467  32.958  1.00 26.48  ? 259 GLY B CA  1 
ATOM   4570  C  C   . GLY B  1 259 ? 15.761  33.141  33.536  1.00 33.20  ? 259 GLY B C   1 
ATOM   4571  O  O   . GLY B  1 259 ? 15.473  32.072  33.006  1.00 34.82  ? 259 GLY B O   1 
ATOM   4572  N  N   . GLY B  1 260 ? 16.496  33.219  34.640  1.00 29.56  ? 260 GLY B N   1 
ATOM   4573  C  CA  . GLY B  1 260 ? 17.006  32.037  35.287  1.00 27.23  ? 260 GLY B CA  1 
ATOM   4574  C  C   . GLY B  1 260 ? 15.897  31.332  36.039  1.00 31.57  ? 260 GLY B C   1 
ATOM   4575  O  O   . GLY B  1 260 ? 14.736  31.758  36.021  1.00 28.67  ? 260 GLY B O   1 
ATOM   4576  N  N   . ILE B  1 261 ? 16.272  30.250  36.714  1.00 28.60  ? 261 ILE B N   1 
ATOM   4577  C  CA  . ILE B  1 261 ? 15.353  29.438  37.492  1.00 24.49  ? 261 ILE B CA  1 
ATOM   4578  C  C   . ILE B  1 261 ? 15.990  29.077  38.837  1.00 31.94  ? 261 ILE B C   1 
ATOM   4579  O  O   . ILE B  1 261 ? 17.185  28.781  38.919  1.00 29.89  ? 261 ILE B O   1 
ATOM   4580  C  CB  . ILE B  1 261 ? 15.038  28.111  36.778  1.00 26.03  ? 261 ILE B CB  1 
ATOM   4581  C  CG1 . ILE B  1 261 ? 14.358  28.364  35.430  1.00 35.53  ? 261 ILE B CG1 1 
ATOM   4582  C  CG2 . ILE B  1 261 ? 14.168  27.229  37.661  1.00 25.20  ? 261 ILE B CG2 1 
ATOM   4583  C  CD1 . ILE B  1 261 ? 14.136  27.089  34.612  1.00 33.76  ? 261 ILE B CD1 1 
ATOM   4584  N  N   . ILE B  1 262 ? 15.168  29.094  39.877  1.00 25.75  ? 262 ILE B N   1 
ATOM   4585  C  CA  . ILE B  1 262 ? 15.579  28.732  41.215  1.00 30.35  ? 262 ILE B CA  1 
ATOM   4586  C  C   . ILE B  1 262 ? 14.766  27.513  41.600  1.00 33.33  ? 262 ILE B C   1 
ATOM   4587  O  O   . ILE B  1 262 ? 13.540  27.557  41.600  1.00 29.52  ? 262 ILE B O   1 
ATOM   4588  C  CB  . ILE B  1 262 ? 15.245  29.843  42.215  1.00 30.49  ? 262 ILE B CB  1 
ATOM   4589  C  CG1 . ILE B  1 262 ? 15.950  31.136  41.820  1.00 36.37  ? 262 ILE B CG1 1 
ATOM   4590  C  CG2 . ILE B  1 262 ? 15.625  29.425  43.620  1.00 25.91  ? 262 ILE B CG2 1 
ATOM   4591  C  CD1 . ILE B  1 262 ? 15.507  32.338  42.636  1.00 37.40  ? 262 ILE B CD1 1 
ATOM   4592  N  N   . SER B  1 263 ? 15.456  26.429  41.931  1.00 28.83  ? 263 SER B N   1 
ATOM   4593  C  CA  . SER B  1 263 ? 14.805  25.169  42.232  1.00 29.47  ? 263 SER B CA  1 
ATOM   4594  C  C   . SER B  1 263 ? 14.964  24.818  43.703  1.00 31.90  ? 263 SER B C   1 
ATOM   4595  O  O   . SER B  1 263 ? 16.066  24.510  44.178  1.00 31.00  ? 263 SER B O   1 
ATOM   4596  C  CB  . SER B  1 263 ? 15.440  24.071  41.391  1.00 33.91  ? 263 SER B CB  1 
ATOM   4597  O  OG  . SER B  1 263 ? 14.910  22.820  41.741  1.00 39.94  ? 263 SER B OG  1 
ATOM   4598  N  N   . ASN B  1 264 ? 13.874  24.861  44.448  1.00 29.82  ? 264 ASN B N   1 
ATOM   4599  C  CA  . ASN B  1 264 ? 13.991  24.479  45.841  1.00 35.34  ? 264 ASN B CA  1 
ATOM   4600  C  C   . ASN B  1 264 ? 13.638  23.015  46.100  1.00 34.12  ? 264 ASN B C   1 
ATOM   4601  O  O   . ASN B  1 264 ? 12.564  22.553  45.726  1.00 37.54  ? 264 ASN B O   1 
ATOM   4602  C  CB  . ASN B  1 264 ? 13.150  25.368  46.740  1.00 39.67  ? 264 ASN B CB  1 
ATOM   4603  C  CG  . ASN B  1 264 ? 13.246  24.952  48.196  1.00 47.22  ? 264 ASN B CG  1 
ATOM   4604  O  OD1 . ASN B  1 264 ? 14.205  25.303  48.898  1.00 43.69  ? 264 ASN B OD1 1 
ATOM   4605  N  ND2 . ASN B  1 264 ? 12.262  24.179  48.655  1.00 45.73  ? 264 ASN B ND2 1 
ATOM   4606  N  N   . ILE B  1 265 ? 14.558  22.299  46.739  1.00 31.29  ? 265 ILE B N   1 
ATOM   4607  C  CA  . ILE B  1 265 ? 14.290  20.946  47.218  1.00 36.90  ? 265 ILE B CA  1 
ATOM   4608  C  C   . ILE B  1 265 ? 14.456  20.860  48.730  1.00 37.49  ? 265 ILE B C   1 
ATOM   4609  O  O   . ILE B  1 265 ? 14.233  19.803  49.327  1.00 41.58  ? 265 ILE B O   1 
ATOM   4610  C  CB  . ILE B  1 265 ? 15.198  19.891  46.552  1.00 34.24  ? 265 ILE B CB  1 
ATOM   4611  C  CG1 . ILE B  1 265 ? 16.657  20.353  46.522  1.00 28.48  ? 265 ILE B CG1 1 
ATOM   4612  C  CG2 . ILE B  1 265 ? 14.714  19.598  45.160  1.00 27.29  ? 265 ILE B CG2 1 
ATOM   4613  C  CD1 . ILE B  1 265 ? 17.561  19.377  45.816  1.00 28.97  ? 265 ILE B CD1 1 
ATOM   4614  N  N   . ASN B  1 266 ? 14.844  21.986  49.330  1.00 36.80  ? 266 ASN B N   1 
ATOM   4615  C  CA  . ASN B  1 266 ? 15.026  22.091  50.768  1.00 40.09  ? 266 ASN B CA  1 
ATOM   4616  C  C   . ASN B  1 266 ? 13.706  22.064  51.528  1.00 43.96  ? 266 ASN B C   1 
ATOM   4617  O  O   . ASN B  1 266 ? 12.721  22.684  51.115  1.00 40.39  ? 266 ASN B O   1 
ATOM   4618  C  CB  . ASN B  1 266 ? 15.774  23.377  51.116  1.00 41.83  ? 266 ASN B CB  1 
ATOM   4619  C  CG  . ASN B  1 266 ? 16.056  23.494  52.603  1.00 51.12  ? 266 ASN B CG  1 
ATOM   4620  O  OD1 . ASN B  1 266 ? 16.237  22.490  53.288  1.00 49.78  ? 266 ASN B OD1 1 
ATOM   4621  N  ND2 . ASN B  1 266 ? 16.091  24.721  53.108  1.00 53.91  ? 266 ASN B ND2 1 
ATOM   4622  N  N   . TYR B  1 267 ? 13.696  21.347  52.644  1.00 54.45  ? 267 TYR B N   1 
ATOM   4623  C  CA  . TYR B  1 267 ? 12.549  21.318  53.534  1.00 60.00  ? 267 TYR B CA  1 
ATOM   4624  C  C   . TYR B  1 267 ? 12.702  22.399  54.599  1.00 61.49  ? 267 TYR B C   1 
ATOM   4625  O  O   . TYR B  1 267 ? 13.529  22.293  55.503  1.00 61.85  ? 267 TYR B O   1 
ATOM   4626  C  CB  . TYR B  1 267 ? 12.400  19.932  54.161  1.00 68.73  ? 267 TYR B CB  1 
ATOM   4627  C  CG  . TYR B  1 267 ? 11.291  19.811  55.187  1.00 85.01  ? 267 TYR B CG  1 
ATOM   4628  C  CD1 . TYR B  1 267 ? 10.266  20.747  55.254  1.00 91.16  ? 267 TYR B CD1 1 
ATOM   4629  C  CD2 . TYR B  1 267 ? 11.257  18.740  56.073  1.00 90.68  ? 267 TYR B CD2 1 
ATOM   4630  C  CE1 . TYR B  1 267 ? 9.252   20.632  56.189  1.00 93.31  ? 267 TYR B CE1 1 
ATOM   4631  C  CE2 . TYR B  1 267 ? 10.246  18.616  57.004  1.00 92.95  ? 267 TYR B CE2 1 
ATOM   4632  C  CZ  . TYR B  1 267 ? 9.247   19.563  57.057  1.00 94.28  ? 267 TYR B CZ  1 
ATOM   4633  O  OH  . TYR B  1 267 ? 8.238   19.443  57.982  1.00 95.60  ? 267 TYR B OH  1 
ATOM   4634  N  N   . HIS B  1 268 ? 11.902  23.449  54.462  1.00 60.58  ? 268 HIS B N   1 
ATOM   4635  C  CA  . HIS B  1 268 ? 11.900  24.559  55.395  1.00 64.07  ? 268 HIS B CA  1 
ATOM   4636  C  C   . HIS B  1 268 ? 10.914  24.228  56.493  1.00 73.94  ? 268 HIS B C   1 
ATOM   4637  O  O   . HIS B  1 268 ? 9.705   24.423  56.337  1.00 71.81  ? 268 HIS B O   1 
ATOM   4638  C  CB  . HIS B  1 268 ? 11.499  25.844  54.665  1.00 62.73  ? 268 HIS B CB  1 
ATOM   4639  C  CG  . HIS B  1 268 ? 12.342  26.124  53.461  1.00 60.36  ? 268 HIS B CG  1 
ATOM   4640  N  ND1 . HIS B  1 268 ? 13.417  26.986  53.489  1.00 61.03  ? 268 HIS B ND1 1 
ATOM   4641  C  CD2 . HIS B  1 268 ? 12.302  25.614  52.207  1.00 53.43  ? 268 HIS B CD2 1 
ATOM   4642  C  CE1 . HIS B  1 268 ? 13.992  27.007  52.299  1.00 61.27  ? 268 HIS B CE1 1 
ATOM   4643  N  NE2 . HIS B  1 268 ? 13.337  26.181  51.503  1.00 52.21  ? 268 HIS B NE2 1 
ATOM   4644  N  N   . GLY B  1 269 ? 11.437  23.705  57.600  1.00 80.22  ? 269 GLY B N   1 
ATOM   4645  C  CA  . GLY B  1 269 ? 10.609  23.264  58.708  1.00 78.93  ? 269 GLY B CA  1 
ATOM   4646  C  C   . GLY B  1 269 ? 10.349  24.354  59.731  1.00 79.00  ? 269 GLY B C   1 
ATOM   4647  O  O   . GLY B  1 269 ? 9.776   24.083  60.789  1.00 80.01  ? 269 GLY B O   1 
ATOM   4648  N  N   . SER B  1 270 ? 10.756  25.584  59.414  1.00 74.64  ? 270 SER B N   1 
ATOM   4649  C  CA  . SER B  1 270 ? 10.629  26.705  60.346  1.00 73.46  ? 270 SER B CA  1 
ATOM   4650  C  C   . SER B  1 270 ? 10.383  28.041  59.662  1.00 73.19  ? 270 SER B C   1 
ATOM   4651  O  O   . SER B  1 270 ? 10.872  28.276  58.556  1.00 74.47  ? 270 SER B O   1 
ATOM   4652  C  CB  . SER B  1 270 ? 11.888  26.830  61.207  1.00 72.14  ? 270 SER B CB  1 
ATOM   4653  O  OG  . SER B  1 270 ? 12.027  28.157  61.688  1.00 73.74  ? 270 SER B OG  1 
ATOM   4654  N  N   . GLY B  1 271 ? 9.655   28.920  60.354  1.00 76.83  ? 271 GLY B N   1 
ATOM   4655  C  CA  . GLY B  1 271 ? 9.338   30.255  59.866  1.00 76.64  ? 271 GLY B CA  1 
ATOM   4656  C  C   . GLY B  1 271 ? 7.877   30.406  59.470  1.00 78.54  ? 271 GLY B C   1 
ATOM   4657  O  O   . GLY B  1 271 ? 7.144   29.424  59.394  1.00 83.44  ? 271 GLY B O   1 
ATOM   4658  N  N   . ASP B  1 272 ? 7.441   31.636  59.221  1.00 77.02  ? 272 ASP B N   1 
ATOM   4659  C  CA  . ASP B  1 272 ? 6.081   31.869  58.737  1.00 76.24  ? 272 ASP B CA  1 
ATOM   4660  C  C   . ASP B  1 272 ? 6.055   32.018  57.221  1.00 66.17  ? 272 ASP B C   1 
ATOM   4661  O  O   . ASP B  1 272 ? 5.074   31.662  56.566  1.00 60.12  ? 272 ASP B O   1 
ATOM   4662  C  CB  . ASP B  1 272 ? 5.473   33.117  59.380  1.00 86.51  ? 272 ASP B CB  1 
ATOM   4663  C  CG  . ASP B  1 272 ? 5.097   32.898  60.830  1.00 99.10  ? 272 ASP B CG  1 
ATOM   4664  O  OD1 . ASP B  1 272 ? 5.063   31.724  61.260  1.00 102.45 ? 272 ASP B OD1 1 
ATOM   4665  O  OD2 . ASP B  1 272 ? 4.836   33.897  61.536  1.00 102.52 ? 272 ASP B OD2 1 
ATOM   4666  N  N   . ALA B  1 273 ? 7.147   32.538  56.671  1.00 63.61  ? 273 ALA B N   1 
ATOM   4667  C  CA  . ALA B  1 273 ? 7.193   32.898  55.263  1.00 60.11  ? 273 ALA B CA  1 
ATOM   4668  C  C   . ALA B  1 273 ? 8.615   32.972  54.711  1.00 58.42  ? 273 ALA B C   1 
ATOM   4669  O  O   . ALA B  1 273 ? 9.557   33.350  55.417  1.00 52.26  ? 273 ALA B O   1 
ATOM   4670  C  CB  . ALA B  1 273 ? 6.480   34.227  55.041  1.00 57.90  ? 273 ALA B CB  1 
ATOM   4671  N  N   . LEU B  1 274 ? 8.757   32.604  53.441  1.00 57.50  ? 274 LEU B N   1 
ATOM   4672  C  CA  . LEU B  1 274 ? 9.998   32.820  52.717  1.00 51.64  ? 274 LEU B CA  1 
ATOM   4673  C  C   . LEU B  1 274 ? 9.882   34.158  52.006  1.00 49.98  ? 274 LEU B C   1 
ATOM   4674  O  O   . LEU B  1 274 ? 8.806   34.522  51.533  1.00 50.02  ? 274 LEU B O   1 
ATOM   4675  C  CB  . LEU B  1 274 ? 10.259  31.690  51.718  1.00 47.70  ? 274 LEU B CB  1 
ATOM   4676  C  CG  . LEU B  1 274 ? 10.447  30.296  52.329  1.00 54.55  ? 274 LEU B CG  1 
ATOM   4677  C  CD1 . LEU B  1 274 ? 9.126   29.534  52.405  1.00 55.69  ? 274 LEU B CD1 1 
ATOM   4678  C  CD2 . LEU B  1 274 ? 11.471  29.487  51.546  1.00 55.90  ? 274 LEU B CD2 1 
ATOM   4679  N  N   . LEU B  1 275 ? 10.991  34.882  51.932  1.00 43.29  ? 275 LEU B N   1 
ATOM   4680  C  CA  . LEU B  1 275 ? 11.000  36.224  51.379  1.00 41.02  ? 275 LEU B CA  1 
ATOM   4681  C  C   . LEU B  1 275 ? 11.651  36.337  50.010  1.00 39.90  ? 275 LEU B C   1 
ATOM   4682  O  O   . LEU B  1 275 ? 12.773  35.894  49.801  1.00 40.85  ? 275 LEU B O   1 
ATOM   4683  C  CB  . LEU B  1 275 ? 11.707  37.183  52.340  1.00 49.45  ? 275 LEU B CB  1 
ATOM   4684  C  CG  . LEU B  1 275 ? 11.220  37.192  53.785  1.00 56.34  ? 275 LEU B CG  1 
ATOM   4685  C  CD1 . LEU B  1 275 ? 11.854  36.034  54.557  1.00 70.42  ? 275 LEU B CD1 1 
ATOM   4686  C  CD2 . LEU B  1 275 ? 11.555  38.526  54.439  1.00 57.18  ? 275 LEU B CD2 1 
ATOM   4687  N  N   . ILE B  1 276 ? 10.947  36.970  49.085  1.00 46.26  ? 276 ILE B N   1 
ATOM   4688  C  CA  . ILE B  1 276 ? 11.516  37.290  47.788  1.00 46.63  ? 276 ILE B CA  1 
ATOM   4689  C  C   . ILE B  1 276 ? 11.965  38.746  47.776  1.00 40.90  ? 276 ILE B C   1 
ATOM   4690  O  O   . ILE B  1 276 ? 11.145  39.636  47.936  1.00 44.23  ? 276 ILE B O   1 
ATOM   4691  C  CB  . ILE B  1 276 ? 10.470  37.123  46.682  1.00 44.08  ? 276 ILE B CB  1 
ATOM   4692  C  CG1 . ILE B  1 276 ? 9.862   35.720  46.730  1.00 46.90  ? 276 ILE B CG1 1 
ATOM   4693  C  CG2 . ILE B  1 276 ? 11.087  37.423  45.323  1.00 43.02  ? 276 ILE B CG2 1 
ATOM   4694  C  CD1 . ILE B  1 276 ? 8.718   35.503  45.719  1.00 44.26  ? 276 ILE B CD1 1 
ATOM   4695  N  N   . PRO B  1 277 ? 13.264  38.999  47.559  1.00 43.84  ? 277 PRO B N   1 
ATOM   4696  C  CA  . PRO B  1 277 ? 13.679  40.411  47.519  1.00 47.01  ? 277 PRO B CA  1 
ATOM   4697  C  C   . PRO B  1 277 ? 13.052  41.105  46.301  1.00 47.55  ? 277 PRO B C   1 
ATOM   4698  O  O   . PRO B  1 277 ? 13.222  40.645  45.176  1.00 39.56  ? 277 PRO B O   1 
ATOM   4699  C  CB  . PRO B  1 277 ? 15.206  40.349  47.383  1.00 44.42  ? 277 PRO B CB  1 
ATOM   4700  C  CG  . PRO B  1 277 ? 15.570  38.875  47.284  1.00 42.65  ? 277 PRO B CG  1 
ATOM   4701  C  CD  . PRO B  1 277 ? 14.332  38.069  47.152  1.00 37.53  ? 277 PRO B CD  1 
ATOM   4702  N  N   . ARG B  1 278 ? 12.348  42.209  46.536  1.00 46.64  ? 278 ARG B N   1 
ATOM   4703  C  CA  . ARG B  1 278 ? 11.536  42.844  45.507  1.00 45.09  ? 278 ARG B CA  1 
ATOM   4704  C  C   . ARG B  1 278 ? 12.346  43.334  44.319  1.00 42.42  ? 278 ARG B C   1 
ATOM   4705  O  O   . ARG B  1 278 ? 12.095  42.944  43.176  1.00 41.36  ? 278 ARG B O   1 
ATOM   4706  C  CB  . ARG B  1 278 ? 10.718  44.004  46.098  1.00 47.05  ? 278 ARG B CB  1 
ATOM   4707  C  CG  . ARG B  1 278 ? 9.645   44.536  45.158  1.00 53.04  ? 278 ARG B CG  1 
ATOM   4708  C  CD  . ARG B  1 278 ? 8.838   45.688  45.774  1.00 60.55  ? 278 ARG B CD  1 
ATOM   4709  N  NE  . ARG B  1 278 ? 9.683   46.782  46.252  1.00 53.76  ? 278 ARG B NE  1 
ATOM   4710  C  CZ  . ARG B  1 278 ? 10.106  47.792  45.500  1.00 59.22  ? 278 ARG B CZ  1 
ATOM   4711  N  NH1 . ARG B  1 278 ? 9.764   47.861  44.224  1.00 52.86  ? 278 ARG B NH1 1 
ATOM   4712  N  NH2 . ARG B  1 278 ? 10.872  48.740  46.027  1.00 68.61  ? 278 ARG B NH2 1 
ATOM   4713  N  N   . VAL B  1 279 ? 13.298  44.214  44.584  1.00 41.74  ? 279 VAL B N   1 
ATOM   4714  C  CA  . VAL B  1 279 ? 14.082  44.807  43.513  1.00 42.30  ? 279 VAL B CA  1 
ATOM   4715  C  C   . VAL B  1 279 ? 14.812  43.741  42.686  1.00 40.42  ? 279 VAL B C   1 
ATOM   4716  O  O   . VAL B  1 279 ? 14.782  43.770  41.464  1.00 42.20  ? 279 VAL B O   1 
ATOM   4717  C  CB  . VAL B  1 279 ? 15.067  45.879  44.059  1.00 46.23  ? 279 VAL B CB  1 
ATOM   4718  C  CG1 . VAL B  1 279 ? 16.003  46.384  42.962  1.00 43.88  ? 279 VAL B CG1 1 
ATOM   4719  C  CG2 . VAL B  1 279 ? 14.294  47.041  44.677  1.00 41.54  ? 279 VAL B CG2 1 
ATOM   4720  N  N   . GLU B  1 280 ? 15.452  42.785  43.348  1.00 41.34  ? 280 GLU B N   1 
ATOM   4721  C  CA  . GLU B  1 280 ? 16.269  41.818  42.625  1.00 41.13  ? 280 GLU B CA  1 
ATOM   4722  C  C   . GLU B  1 280 ? 15.403  40.812  41.895  1.00 41.55  ? 280 GLU B C   1 
ATOM   4723  O  O   . GLU B  1 280 ? 15.881  40.098  41.022  1.00 37.76  ? 280 GLU B O   1 
ATOM   4724  C  CB  . GLU B  1 280 ? 17.254  41.109  43.550  1.00 41.81  ? 280 GLU B CB  1 
ATOM   4725  C  CG  . GLU B  1 280 ? 18.406  41.997  43.998  1.00 51.15  ? 280 GLU B CG  1 
ATOM   4726  C  CD  . GLU B  1 280 ? 18.061  42.836  45.221  1.00 56.91  ? 280 GLU B CD  1 
ATOM   4727  O  OE1 . GLU B  1 280 ? 16.875  42.852  45.632  1.00 46.90  ? 280 GLU B OE1 1 
ATOM   4728  O  OE2 . GLU B  1 280 ? 18.986  43.471  45.778  1.00 65.67  ? 280 GLU B OE2 1 
ATOM   4729  N  N   . TRP B  1 281 ? 14.128  40.760  42.260  1.00 33.86  ? 281 TRP B N   1 
ATOM   4730  C  CA  . TRP B  1 281 ? 13.179  39.932  41.528  1.00 36.64  ? 281 TRP B CA  1 
ATOM   4731  C  C   . TRP B  1 281 ? 12.499  40.780  40.449  1.00 40.14  ? 281 TRP B C   1 
ATOM   4732  O  O   . TRP B  1 281 ? 11.411  40.461  39.990  1.00 45.21  ? 281 TRP B O   1 
ATOM   4733  C  CB  . TRP B  1 281 ? 12.145  39.318  42.479  1.00 31.84  ? 281 TRP B CB  1 
ATOM   4734  C  CG  . TRP B  1 281 ? 11.515  38.071  41.924  1.00 36.02  ? 281 TRP B CG  1 
ATOM   4735  C  CD1 . TRP B  1 281 ? 12.168  36.971  41.429  1.00 35.19  ? 281 TRP B CD1 1 
ATOM   4736  C  CD2 . TRP B  1 281 ? 10.116  37.787  41.818  1.00 36.61  ? 281 TRP B CD2 1 
ATOM   4737  N  NE1 . TRP B  1 281 ? 11.257  36.026  41.011  1.00 39.70  ? 281 TRP B NE1 1 
ATOM   4738  C  CE2 . TRP B  1 281 ? 9.989   36.507  41.231  1.00 42.83  ? 281 TRP B CE2 1 
ATOM   4739  C  CE3 . TRP B  1 281 ? 8.956   38.494  42.148  1.00 38.21  ? 281 TRP B CE3 1 
ATOM   4740  C  CZ2 . TRP B  1 281 ? 8.743   35.918  40.980  1.00 36.12  ? 281 TRP B CZ2 1 
ATOM   4741  C  CZ3 . TRP B  1 281 ? 7.720   37.910  41.893  1.00 35.14  ? 281 TRP B CZ3 1 
ATOM   4742  C  CH2 . TRP B  1 281 ? 7.627   36.635  41.318  1.00 36.35  ? 281 TRP B CH2 1 
ATOM   4743  N  N   . GLY B  1 282 ? 13.162  41.861  40.044  1.00 40.17  ? 282 GLY B N   1 
ATOM   4744  C  CA  . GLY B  1 282 ? 12.619  42.765  39.046  1.00 39.52  ? 282 GLY B CA  1 
ATOM   4745  C  C   . GLY B  1 282 ? 11.215  43.233  39.389  1.00 38.56  ? 282 GLY B C   1 
ATOM   4746  O  O   . GLY B  1 282 ? 10.381  43.438  38.506  1.00 42.90  ? 282 GLY B O   1 
ATOM   4747  N  N   . CYS B  1 283 ? 10.950  43.391  40.680  1.00 39.10  ? 283 CYS B N   1 
ATOM   4748  C  CA  . CYS B  1 283 ? 9.624   43.781  41.143  1.00 43.45  ? 283 CYS B CA  1 
ATOM   4749  C  C   . CYS B  1 283 ? 8.526   42.903  40.523  1.00 47.90  ? 283 CYS B C   1 
ATOM   4750  O  O   . CYS B  1 283 ? 7.392   43.345  40.343  1.00 54.90  ? 283 CYS B O   1 
ATOM   4751  C  CB  . CYS B  1 283 ? 9.376   45.272  40.866  1.00 42.32  ? 283 CYS B CB  1 
ATOM   4752  S  SG  . CYS B  1 283 ? 10.634  46.394  41.635  1.00 57.15  ? 283 CYS B SG  1 
ATOM   4753  N  N   . GLY B  1 284 ? 8.880   41.661  40.204  1.00 43.24  ? 284 GLY B N   1 
ATOM   4754  C  CA  . GLY B  1 284 ? 7.944   40.681  39.665  1.00 43.98  ? 284 GLY B CA  1 
ATOM   4755  C  C   . GLY B  1 284 ? 8.060   40.405  38.173  1.00 37.29  ? 284 GLY B C   1 
ATOM   4756  O  O   . GLY B  1 284 ? 7.220   39.710  37.603  1.00 39.33  ? 284 GLY B O   1 
ATOM   4757  N  N   . MET B  1 285 ? 9.099   40.935  37.535  1.00 37.96  ? 285 MET B N   1 
ATOM   4758  C  CA  . MET B  1 285 ? 9.167   40.960  36.078  1.00 33.79  ? 285 MET B CA  1 
ATOM   4759  C  C   . MET B  1 285 ? 10.502  40.488  35.511  1.00 35.30  ? 285 MET B C   1 
ATOM   4760  O  O   . MET B  1 285 ? 10.791  40.671  34.320  1.00 30.21  ? 285 MET B O   1 
ATOM   4761  C  CB  . MET B  1 285 ? 8.863   42.377  35.585  1.00 39.62  ? 285 MET B CB  1 
ATOM   4762  C  CG  . MET B  1 285 ? 7.393   42.768  35.753  1.00 44.10  ? 285 MET B CG  1 
ATOM   4763  S  SD  . MET B  1 285 ? 7.010   44.468  35.234  1.00 48.23  ? 285 MET B SD  1 
ATOM   4764  C  CE  . MET B  1 285 ? 7.971   45.405  36.422  1.00 50.73  ? 285 MET B CE  1 
ATOM   4765  N  N   . ALA B  1 286 ? 11.309  39.867  36.370  1.00 36.85  ? 286 ALA B N   1 
ATOM   4766  C  CA  . ALA B  1 286 ? 12.651  39.423  35.996  1.00 36.57  ? 286 ALA B CA  1 
ATOM   4767  C  C   . ALA B  1 286 ? 12.705  38.050  35.321  1.00 37.07  ? 286 ALA B C   1 
ATOM   4768  O  O   . ALA B  1 286 ? 13.781  37.600  34.933  1.00 40.10  ? 286 ALA B O   1 
ATOM   4769  C  CB  . ALA B  1 286 ? 13.591  39.460  37.217  1.00 34.05  ? 286 ALA B CB  1 
ATOM   4770  N  N   . HIS B  1 287 ? 11.552  37.403  35.163  1.00 36.37  ? 287 HIS B N   1 
ATOM   4771  C  CA  . HIS B  1 287 ? 11.518  36.023  34.681  1.00 36.96  ? 287 HIS B CA  1 
ATOM   4772  C  C   . HIS B  1 287 ? 12.432  35.114  35.501  1.00 35.32  ? 287 HIS B C   1 
ATOM   4773  O  O   . HIS B  1 287 ? 13.090  34.226  34.961  1.00 32.70  ? 287 HIS B O   1 
ATOM   4774  C  CB  . HIS B  1 287 ? 11.888  35.968  33.204  1.00 28.23  ? 287 HIS B CB  1 
ATOM   4775  C  CG  . HIS B  1 287 ? 10.820  36.508  32.309  1.00 37.09  ? 287 HIS B CG  1 
ATOM   4776  N  ND1 . HIS B  1 287 ? 10.856  37.789  31.796  1.00 39.76  ? 287 HIS B ND1 1 
ATOM   4777  C  CD2 . HIS B  1 287 ? 9.672   35.948  31.852  1.00 34.49  ? 287 HIS B CD2 1 
ATOM   4778  C  CE1 . HIS B  1 287 ? 9.779   37.992  31.054  1.00 37.08  ? 287 HIS B CE1 1 
ATOM   4779  N  NE2 . HIS B  1 287 ? 9.042   36.895  31.077  1.00 38.50  ? 287 HIS B NE2 1 
ATOM   4780  N  N   . LYS B  1 288 ? 12.484  35.355  36.806  1.00 35.95  ? 288 LYS B N   1 
ATOM   4781  C  CA  . LYS B  1 288 ? 13.242  34.488  37.699  1.00 33.02  ? 288 LYS B CA  1 
ATOM   4782  C  C   . LYS B  1 288 ? 12.271  33.521  38.340  1.00 34.33  ? 288 LYS B C   1 
ATOM   4783  O  O   . LYS B  1 288 ? 11.675  33.803  39.390  1.00 33.93  ? 288 LYS B O   1 
ATOM   4784  C  CB  . LYS B  1 288 ? 14.006  35.288  38.759  1.00 28.80  ? 288 LYS B CB  1 
ATOM   4785  C  CG  . LYS B  1 288 ? 15.160  36.106  38.191  1.00 26.93  ? 288 LYS B CG  1 
ATOM   4786  C  CD  . LYS B  1 288 ? 15.859  36.890  39.309  1.00 28.85  ? 288 LYS B CD  1 
ATOM   4787  C  CE  . LYS B  1 288 ? 16.875  37.872  38.753  1.00 26.36  ? 288 LYS B CE  1 
ATOM   4788  N  NZ  . LYS B  1 288 ? 17.768  38.427  39.851  1.00 28.62  ? 288 LYS B NZ  1 
ATOM   4789  N  N   . THR B  1 289 ? 12.107  32.378  37.685  1.00 27.76  ? 289 THR B N   1 
ATOM   4790  C  CA  . THR B  1 289 ? 11.150  31.380  38.116  1.00 24.10  ? 289 THR B CA  1 
ATOM   4791  C  C   . THR B  1 289 ? 11.581  30.679  39.413  1.00 30.27  ? 289 THR B C   1 
ATOM   4792  O  O   . THR B  1 289 ? 12.740  30.302  39.580  1.00 32.36  ? 289 THR B O   1 
ATOM   4793  C  CB  . THR B  1 289 ? 10.879  30.351  36.976  1.00 32.35  ? 289 THR B CB  1 
ATOM   4794  O  OG1 . THR B  1 289 ? 10.307  31.030  35.846  1.00 37.07  ? 289 THR B OG1 1 
ATOM   4795  C  CG2 . THR B  1 289 ? 9.911   29.278  37.438  1.00 25.39  ? 289 THR B CG2 1 
ATOM   4796  N  N   . ILE B  1 290 ? 10.635  30.527  40.332  1.00 32.93  ? 290 ILE B N   1 
ATOM   4797  C  CA  . ILE B  1 290 ? 10.876  29.811  41.572  1.00 32.13  ? 290 ILE B CA  1 
ATOM   4798  C  C   . ILE B  1 290 ? 10.064  28.513  41.616  1.00 38.91  ? 290 ILE B C   1 
ATOM   4799  O  O   . ILE B  1 290 ? 8.831   28.546  41.609  1.00 36.93  ? 290 ILE B O   1 
ATOM   4800  C  CB  . ILE B  1 290 ? 10.489  30.668  42.779  1.00 33.71  ? 290 ILE B CB  1 
ATOM   4801  C  CG1 . ILE B  1 290 ? 11.220  32.008  42.738  1.00 31.66  ? 290 ILE B CG1 1 
ATOM   4802  C  CG2 . ILE B  1 290 ? 10.800  29.944  44.086  1.00 33.91  ? 290 ILE B CG2 1 
ATOM   4803  C  CD1 . ILE B  1 290 ? 10.725  32.990  43.791  1.00 24.28  ? 290 ILE B CD1 1 
ATOM   4804  N  N   . LYS B  1 291 ? 10.760  27.375  41.654  1.00 34.24  ? 291 LYS B N   1 
ATOM   4805  C  CA  . LYS B  1 291 ? 10.109  26.078  41.792  1.00 30.57  ? 291 LYS B CA  1 
ATOM   4806  C  C   . LYS B  1 291 ? 10.456  25.439  43.141  1.00 37.25  ? 291 LYS B C   1 
ATOM   4807  O  O   . LYS B  1 291 ? 11.449  25.806  43.772  1.00 39.02  ? 291 LYS B O   1 
ATOM   4808  C  CB  . LYS B  1 291 ? 10.535  25.156  40.663  1.00 28.84  ? 291 LYS B CB  1 
ATOM   4809  C  CG  . LYS B  1 291 ? 10.221  25.655  39.283  1.00 34.70  ? 291 LYS B CG  1 
ATOM   4810  C  CD  . LYS B  1 291 ? 10.828  24.735  38.251  1.00 41.28  ? 291 LYS B CD  1 
ATOM   4811  C  CE  . LYS B  1 291 ? 10.298  25.019  36.872  1.00 38.32  ? 291 LYS B CE  1 
ATOM   4812  N  NZ  . LYS B  1 291 ? 10.907  24.073  35.908  1.00 34.62  ? 291 LYS B NZ  1 
ATOM   4813  N  N   . GLY B  1 292 ? 9.622   24.498  43.578  1.00 38.51  ? 292 GLY B N   1 
ATOM   4814  C  CA  . GLY B  1 292 ? 9.853   23.747  44.804  1.00 39.83  ? 292 GLY B CA  1 
ATOM   4815  C  C   . GLY B  1 292 ? 9.011   22.478  44.888  1.00 33.13  ? 292 GLY B C   1 
ATOM   4816  O  O   . GLY B  1 292 ? 7.785   22.533  44.960  1.00 29.46  ? 292 GLY B O   1 
ATOM   4817  N  N   . GLY B  1 293 ? 9.660   21.324  44.889  1.00 29.89  ? 293 GLY B N   1 
ATOM   4818  C  CA  . GLY B  1 293 ? 8.924   20.076  44.895  1.00 31.82  ? 293 GLY B CA  1 
ATOM   4819  C  C   . GLY B  1 293 ? 9.452   18.941  45.754  1.00 32.99  ? 293 GLY B C   1 
ATOM   4820  O  O   . GLY B  1 293 ? 10.647  18.685  45.800  1.00 29.64  ? 293 GLY B O   1 
ATOM   4821  N  N   . LEU B  1 294 ? 8.536   18.260  46.433  1.00 35.47  ? 294 LEU B N   1 
ATOM   4822  C  CA  . LEU B  1 294 ? 8.817   16.977  47.060  1.00 30.74  ? 294 LEU B CA  1 
ATOM   4823  C  C   . LEU B  1 294 ? 9.327   15.982  46.013  1.00 33.21  ? 294 LEU B C   1 
ATOM   4824  O  O   . LEU B  1 294 ? 8.821   15.953  44.884  1.00 33.27  ? 294 LEU B O   1 
ATOM   4825  C  CB  . LEU B  1 294 ? 7.528   16.439  47.680  1.00 35.63  ? 294 LEU B CB  1 
ATOM   4826  C  CG  . LEU B  1 294 ? 7.593   15.097  48.408  1.00 35.93  ? 294 LEU B CG  1 
ATOM   4827  C  CD1 . LEU B  1 294 ? 8.346   15.272  49.732  1.00 35.85  ? 294 LEU B CD1 1 
ATOM   4828  C  CD2 . LEU B  1 294 ? 6.193   14.569  48.646  1.00 33.00  ? 294 LEU B CD2 1 
ATOM   4829  N  N   . CYS B  1 295 ? 10.303  15.151  46.384  1.00 32.25  ? 295 CYS B N   1 
ATOM   4830  C  CA  . CYS B  1 295 ? 10.881  14.180  45.452  1.00 27.74  ? 295 CYS B CA  1 
ATOM   4831  C  C   . CYS B  1 295 ? 9.845   13.217  44.868  1.00 29.87  ? 295 CYS B C   1 
ATOM   4832  O  O   . CYS B  1 295 ? 8.878   12.881  45.529  1.00 31.59  ? 295 CYS B O   1 
ATOM   4833  C  CB  . CYS B  1 295 ? 11.986  13.373  46.135  1.00 32.44  ? 295 CYS B CB  1 
ATOM   4834  S  SG  . CYS B  1 295 ? 11.456  12.411  47.593  1.00 30.96  ? 295 CYS B SG  1 
ATOM   4835  N  N   . PRO B  1 296 ? 10.048  12.781  43.614  1.00 29.26  ? 296 PRO B N   1 
ATOM   4836  C  CA  . PRO B  1 296 ? 9.240   11.681  43.063  1.00 30.86  ? 296 PRO B CA  1 
ATOM   4837  C  C   . PRO B  1 296 ? 9.501   10.385  43.826  1.00 35.82  ? 296 PRO B C   1 
ATOM   4838  O  O   . PRO B  1 296 ? 10.596  10.204  44.377  1.00 27.77  ? 296 PRO B O   1 
ATOM   4839  C  CB  . PRO B  1 296 ? 9.782   11.520  41.647  1.00 23.05  ? 296 PRO B CB  1 
ATOM   4840  C  CG  . PRO B  1 296 ? 10.294  12.892  41.289  1.00 27.74  ? 296 PRO B CG  1 
ATOM   4841  C  CD  . PRO B  1 296 ? 10.939  13.369  42.599  1.00 27.86  ? 296 PRO B CD  1 
ATOM   4842  N  N   . GLY B  1 297 ? 8.502   9.510   43.868  1.00 31.92  ? 297 GLY B N   1 
ATOM   4843  C  CA  . GLY B  1 297 ? 8.667   8.175   44.421  1.00 33.38  ? 297 GLY B CA  1 
ATOM   4844  C  C   . GLY B  1 297 ? 8.071   7.151   43.466  1.00 35.70  ? 297 GLY B C   1 
ATOM   4845  O  O   . GLY B  1 297 ? 8.007   7.375   42.249  1.00 33.61  ? 297 GLY B O   1 
ATOM   4846  N  N   . GLY B  1 298 ? 7.630   6.025   44.011  1.00 30.33  ? 298 GLY B N   1 
ATOM   4847  C  CA  . GLY B  1 298 ? 7.077   4.956   43.196  1.00 28.82  ? 298 GLY B CA  1 
ATOM   4848  C  C   . GLY B  1 298 ? 8.093   4.185   42.388  1.00 29.49  ? 298 GLY B C   1 
ATOM   4849  O  O   . GLY B  1 298 ? 9.261   4.557   42.313  1.00 25.23  ? 298 GLY B O   1 
ATOM   4850  N  N   . ARG B  1 299 ? 7.631   3.105   41.765  1.00 31.30  ? 299 ARG B N   1 
ATOM   4851  C  CA  . ARG B  1 299 ? 8.504   2.133   41.100  1.00 29.32  ? 299 ARG B CA  1 
ATOM   4852  C  C   . ARG B  1 299 ? 9.354   2.675   39.942  1.00 31.95  ? 299 ARG B C   1 
ATOM   4853  O  O   . ARG B  1 299 ? 10.560  2.417   39.879  1.00 35.11  ? 299 ARG B O   1 
ATOM   4854  C  CB  . ARG B  1 299 ? 7.667   0.942   40.616  1.00 29.79  ? 299 ARG B CB  1 
ATOM   4855  C  CG  . ARG B  1 299 ? 8.396   -0.042  39.686  1.00 31.68  ? 299 ARG B CG  1 
ATOM   4856  C  CD  . ARG B  1 299 ? 7.562   -1.336  39.531  1.00 30.25  ? 299 ARG B CD  1 
ATOM   4857  N  NE  . ARG B  1 299 ? 8.212   -2.397  38.756  1.00 35.09  ? 299 ARG B NE  1 
ATOM   4858  C  CZ  . ARG B  1 299 ? 7.590   -3.525  38.389  1.00 39.65  ? 299 ARG B CZ  1 
ATOM   4859  N  NH1 . ARG B  1 299 ? 6.325   -3.729  38.725  1.00 31.85  ? 299 ARG B NH1 1 
ATOM   4860  N  NH2 . ARG B  1 299 ? 8.219   -4.451  37.685  1.00 35.13  ? 299 ARG B NH2 1 
ATOM   4861  N  N   . LEU B  1 300 ? 8.731   3.392   39.006  1.00 28.22  ? 300 LEU B N   1 
ATOM   4862  C  CA  . LEU B  1 300 ? 9.476   3.942   37.871  1.00 27.98  ? 300 LEU B CA  1 
ATOM   4863  C  C   . LEU B  1 300 ? 10.676  4.781   38.336  1.00 25.26  ? 300 LEU B C   1 
ATOM   4864  O  O   . LEU B  1 300 ? 11.791  4.624   37.843  1.00 32.16  ? 300 LEU B O   1 
ATOM   4865  C  CB  . LEU B  1 300 ? 8.558   4.800   36.981  1.00 29.27  ? 300 LEU B CB  1 
ATOM   4866  C  CG  . LEU B  1 300 ? 9.188   5.348   35.692  1.00 31.63  ? 300 LEU B CG  1 
ATOM   4867  C  CD1 . LEU B  1 300 ? 9.775   4.250   34.832  1.00 29.69  ? 300 LEU B CD1 1 
ATOM   4868  C  CD2 . LEU B  1 300 ? 8.200   6.187   34.878  1.00 29.39  ? 300 LEU B CD2 1 
ATOM   4869  N  N   . ARG B  1 301 ? 10.436  5.674   39.289  1.00 22.94  ? 301 ARG B N   1 
ATOM   4870  C  CA  . ARG B  1 301 ? 11.485  6.556   39.791  1.00 26.15  ? 301 ARG B CA  1 
ATOM   4871  C  C   . ARG B  1 301 ? 12.646  5.725   40.329  1.00 29.43  ? 301 ARG B C   1 
ATOM   4872  O  O   . ARG B  1 301 ? 13.803  5.950   39.957  1.00 28.60  ? 301 ARG B O   1 
ATOM   4873  C  CB  . ARG B  1 301 ? 10.924  7.477   40.876  1.00 23.79  ? 301 ARG B CB  1 
ATOM   4874  C  CG  . ARG B  1 301 ? 11.915  8.498   41.434  1.00 28.32  ? 301 ARG B CG  1 
ATOM   4875  C  CD  . ARG B  1 301 ? 12.582  9.302   40.332  1.00 22.74  ? 301 ARG B CD  1 
ATOM   4876  N  NE  . ARG B  1 301 ? 13.258  10.480  40.879  1.00 25.68  ? 301 ARG B NE  1 
ATOM   4877  C  CZ  . ARG B  1 301 ? 13.642  11.521  40.149  1.00 31.73  ? 301 ARG B CZ  1 
ATOM   4878  N  NH1 . ARG B  1 301 ? 13.418  11.509  38.838  1.00 28.78  ? 301 ARG B NH1 1 
ATOM   4879  N  NH2 . ARG B  1 301 ? 14.226  12.577  40.725  1.00 24.08  ? 301 ARG B NH2 1 
ATOM   4880  N  N   . MET B  1 302 ? 12.325  4.740   41.169  1.00 28.18  ? 302 MET B N   1 
ATOM   4881  C  CA  . MET B  1 302 ? 13.340  3.850   41.732  1.00 32.07  ? 302 MET B CA  1 
ATOM   4882  C  C   . MET B  1 302 ? 14.099  3.123   40.626  1.00 32.28  ? 302 MET B C   1 
ATOM   4883  O  O   . MET B  1 302 ? 15.329  3.058   40.652  1.00 28.93  ? 302 MET B O   1 
ATOM   4884  C  CB  . MET B  1 302 ? 12.726  2.852   42.731  1.00 31.05  ? 302 MET B CB  1 
ATOM   4885  C  CG  . MET B  1 302 ? 12.158  3.486   44.007  1.00 27.23  ? 302 MET B CG  1 
ATOM   4886  S  SD  . MET B  1 302 ? 13.360  4.501   44.913  1.00 28.94  ? 302 MET B SD  1 
ATOM   4887  C  CE  . MET B  1 302 ? 13.109  6.127   44.138  1.00 21.02  ? 302 MET B CE  1 
ATOM   4888  N  N   . GLU B  1 303 ? 13.368  2.595   39.646  1.00 25.12  ? 303 GLU B N   1 
ATOM   4889  C  CA  . GLU B  1 303 ? 13.992  1.855   38.548  1.00 28.75  ? 303 GLU B CA  1 
ATOM   4890  C  C   . GLU B  1 303 ? 14.910  2.731   37.693  1.00 30.92  ? 303 GLU B C   1 
ATOM   4891  O  O   . GLU B  1 303 ? 15.938  2.276   37.206  1.00 28.45  ? 303 GLU B O   1 
ATOM   4892  C  CB  . GLU B  1 303 ? 12.919  1.199   37.656  1.00 27.13  ? 303 GLU B CB  1 
ATOM   4893  C  CG  . GLU B  1 303 ? 12.199  0.006   38.311  1.00 32.37  ? 303 GLU B CG  1 
ATOM   4894  C  CD  . GLU B  1 303 ? 11.066  -0.563  37.465  1.00 35.40  ? 303 GLU B CD  1 
ATOM   4895  O  OE1 . GLU B  1 303 ? 10.558  0.159   36.575  1.00 32.68  ? 303 GLU B OE1 1 
ATOM   4896  O  OE2 . GLU B  1 303 ? 10.671  -1.728  37.706  1.00 38.31  ? 303 GLU B OE2 1 
ATOM   4897  N  N   . ARG B  1 304 ? 14.535  3.989   37.496  1.00 32.80  ? 304 ARG B N   1 
ATOM   4898  C  CA  . ARG B  1 304 ? 15.398  4.898   36.739  1.00 33.08  ? 304 ARG B CA  1 
ATOM   4899  C  C   . ARG B  1 304 ? 16.683  5.213   37.482  1.00 27.58  ? 304 ARG B C   1 
ATOM   4900  O  O   . ARG B  1 304 ? 17.757  5.188   36.900  1.00 25.95  ? 304 ARG B O   1 
ATOM   4901  C  CB  . ARG B  1 304 ? 14.695  6.203   36.405  1.00 31.13  ? 304 ARG B CB  1 
ATOM   4902  C  CG  . ARG B  1 304 ? 14.335  6.331   34.923  1.00 37.89  ? 304 ARG B CG  1 
ATOM   4903  C  CD  . ARG B  1 304 ? 12.914  6.081   34.739  1.00 32.58  ? 304 ARG B CD  1 
ATOM   4904  N  NE  . ARG B  1 304 ? 12.522  5.947   33.343  1.00 38.50  ? 304 ARG B NE  1 
ATOM   4905  C  CZ  . ARG B  1 304 ? 11.797  6.852   32.699  1.00 38.71  ? 304 ARG B CZ  1 
ATOM   4906  N  NH1 . ARG B  1 304 ? 11.439  7.972   33.318  1.00 28.15  ? 304 ARG B NH1 1 
ATOM   4907  N  NH2 . ARG B  1 304 ? 11.447  6.648   31.438  1.00 47.21  ? 304 ARG B NH2 1 
ATOM   4908  N  N   . LEU B  1 305 ? 16.558  5.530   38.762  1.00 26.32  ? 305 LEU B N   1 
ATOM   4909  C  CA  . LEU B  1 305 ? 17.724  5.789   39.602  1.00 29.17  ? 305 LEU B CA  1 
ATOM   4910  C  C   . LEU B  1 305 ? 18.610  4.548   39.713  1.00 30.94  ? 305 LEU B C   1 
ATOM   4911  O  O   . LEU B  1 305 ? 19.831  4.650   39.700  1.00 33.73  ? 305 LEU B O   1 
ATOM   4912  C  CB  . LEU B  1 305 ? 17.285  6.275   40.986  1.00 31.76  ? 305 LEU B CB  1 
ATOM   4913  C  CG  . LEU B  1 305 ? 16.494  7.593   40.927  1.00 37.17  ? 305 LEU B CG  1 
ATOM   4914  C  CD1 . LEU B  1 305 ? 16.155  8.141   42.299  1.00 36.97  ? 305 LEU B CD1 1 
ATOM   4915  C  CD2 . LEU B  1 305 ? 17.256  8.614   40.133  1.00 39.03  ? 305 LEU B CD2 1 
ATOM   4916  N  N   . ILE B  1 306 ? 17.989  3.376   39.815  1.00 26.22  ? 306 ILE B N   1 
ATOM   4917  C  CA  . ILE B  1 306 ? 18.752  2.136   39.892  1.00 26.19  ? 306 ILE B CA  1 
ATOM   4918  C  C   . ILE B  1 306 ? 19.627  1.990   38.653  1.00 28.11  ? 306 ILE B C   1 
ATOM   4919  O  O   . ILE B  1 306 ? 20.799  1.644   38.757  1.00 22.26  ? 306 ILE B O   1 
ATOM   4920  C  CB  . ILE B  1 306 ? 17.826  0.922   40.037  1.00 30.71  ? 306 ILE B CB  1 
ATOM   4921  C  CG1 . ILE B  1 306 ? 17.303  0.827   41.472  1.00 34.10  ? 306 ILE B CG1 1 
ATOM   4922  C  CG2 . ILE B  1 306 ? 18.545  -0.365  39.648  1.00 30.81  ? 306 ILE B CG2 1 
ATOM   4923  C  CD1 . ILE B  1 306 ? 16.085  -0.074  41.608  1.00 31.08  ? 306 ILE B CD1 1 
ATOM   4924  N  N   . ASP B  1 307 ? 19.065  2.283   37.478  1.00 25.03  ? 307 ASP B N   1 
ATOM   4925  C  CA  . ASP B  1 307 ? 19.835  2.238   36.237  1.00 29.06  ? 307 ASP B CA  1 
ATOM   4926  C  C   . ASP B  1 307 ? 21.028  3.182   36.259  1.00 31.85  ? 307 ASP B C   1 
ATOM   4927  O  O   . ASP B  1 307 ? 22.119  2.828   35.810  1.00 34.22  ? 307 ASP B O   1 
ATOM   4928  C  CB  . ASP B  1 307 ? 18.949  2.531   35.025  1.00 28.31  ? 307 ASP B CB  1 
ATOM   4929  C  CG  . ASP B  1 307 ? 18.346  1.260   34.422  1.00 34.13  ? 307 ASP B CG  1 
ATOM   4930  O  OD1 . ASP B  1 307 ? 18.279  0.262   35.150  1.00 34.72  ? 307 ASP B OD1 1 
ATOM   4931  O  OD2 . ASP B  1 307 ? 17.936  1.266   33.239  1.00 36.95  ? 307 ASP B OD2 1 
ATOM   4932  N  N   . LEU B  1 308 ? 20.816  4.388   36.782  1.00 30.98  ? 308 LEU B N   1 
ATOM   4933  C  CA  . LEU B  1 308 ? 21.905  5.354   36.926  1.00 25.70  ? 308 LEU B CA  1 
ATOM   4934  C  C   . LEU B  1 308 ? 23.025  4.817   37.852  1.00 29.49  ? 308 LEU B C   1 
ATOM   4935  O  O   . LEU B  1 308 ? 24.214  4.957   37.569  1.00 31.34  ? 308 LEU B O   1 
ATOM   4936  C  CB  . LEU B  1 308 ? 21.353  6.696   37.432  1.00 25.73  ? 308 LEU B CB  1 
ATOM   4937  C  CG  . LEU B  1 308 ? 20.434  7.533   36.522  1.00 28.50  ? 308 LEU B CG  1 
ATOM   4938  C  CD1 . LEU B  1 308 ? 19.940  8.818   37.237  1.00 28.21  ? 308 LEU B CD1 1 
ATOM   4939  C  CD2 . LEU B  1 308 ? 21.137  7.897   35.229  1.00 23.42  ? 308 LEU B CD2 1 
ATOM   4940  N  N   . VAL B  1 309 ? 22.652  4.187   38.957  1.00 25.52  ? 309 VAL B N   1 
ATOM   4941  C  CA  . VAL B  1 309 ? 23.655  3.553   39.812  1.00 26.60  ? 309 VAL B CA  1 
ATOM   4942  C  C   . VAL B  1 309 ? 24.272  2.344   39.102  1.00 32.72  ? 309 VAL B C   1 
ATOM   4943  O  O   . VAL B  1 309 ? 25.495  2.173   39.081  1.00 30.93  ? 309 VAL B O   1 
ATOM   4944  C  CB  . VAL B  1 309 ? 23.042  3.114   41.161  1.00 26.08  ? 309 VAL B CB  1 
ATOM   4945  C  CG1 . VAL B  1 309 ? 24.086  2.353   42.019  1.00 24.51  ? 309 VAL B CG1 1 
ATOM   4946  C  CG2 . VAL B  1 309 ? 22.508  4.344   41.899  1.00 26.72  ? 309 VAL B CG2 1 
ATOM   4947  N  N   . PHE B  1 310 ? 23.422  1.517   38.503  1.00 30.40  ? 310 PHE B N   1 
ATOM   4948  C  CA  . PHE B  1 310 ? 23.874  0.264   37.886  1.00 29.04  ? 310 PHE B CA  1 
ATOM   4949  C  C   . PHE B  1 310 ? 24.887  0.510   36.771  1.00 30.19  ? 310 PHE B C   1 
ATOM   4950  O  O   . PHE B  1 310 ? 25.905  -0.170  36.684  1.00 31.85  ? 310 PHE B O   1 
ATOM   4951  C  CB  . PHE B  1 310 ? 22.677  -0.525  37.339  1.00 30.24  ? 310 PHE B CB  1 
ATOM   4952  C  CG  . PHE B  1 310 ? 23.042  -1.889  36.825  1.00 30.97  ? 310 PHE B CG  1 
ATOM   4953  C  CD1 . PHE B  1 310 ? 23.081  -2.980  37.685  1.00 33.51  ? 310 PHE B CD1 1 
ATOM   4954  C  CD2 . PHE B  1 310 ? 23.375  -2.078  35.498  1.00 28.80  ? 310 PHE B CD2 1 
ATOM   4955  C  CE1 . PHE B  1 310 ? 23.431  -4.240  37.230  1.00 39.80  ? 310 PHE B CE1 1 
ATOM   4956  C  CE2 . PHE B  1 310 ? 23.715  -3.345  35.031  1.00 38.45  ? 310 PHE B CE2 1 
ATOM   4957  C  CZ  . PHE B  1 310 ? 23.751  -4.424  35.905  1.00 40.79  ? 310 PHE B CZ  1 
ATOM   4958  N  N   . TYR B  1 311 ? 24.600  1.485   35.917  1.00 29.26  ? 311 TYR B N   1 
ATOM   4959  C  CA  . TYR B  1 311 ? 25.485  1.808   34.797  1.00 28.10  ? 311 TYR B CA  1 
ATOM   4960  C  C   . TYR B  1 311 ? 26.550  2.843   35.182  1.00 32.98  ? 311 TYR B C   1 
ATOM   4961  O  O   . TYR B  1 311 ? 27.257  3.400   34.335  1.00 33.71  ? 311 TYR B O   1 
ATOM   4962  C  CB  . TYR B  1 311 ? 24.662  2.241   33.576  1.00 29.55  ? 311 TYR B CB  1 
ATOM   4963  C  CG  . TYR B  1 311 ? 23.838  1.095   32.998  1.00 34.77  ? 311 TYR B CG  1 
ATOM   4964  C  CD1 . TYR B  1 311 ? 24.464  0.003   32.388  1.00 34.97  ? 311 TYR B CD1 1 
ATOM   4965  C  CD2 . TYR B  1 311 ? 22.447  1.090   33.081  1.00 26.54  ? 311 TYR B CD2 1 
ATOM   4966  C  CE1 . TYR B  1 311 ? 23.726  -1.054  31.859  1.00 29.59  ? 311 TYR B CE1 1 
ATOM   4967  C  CE2 . TYR B  1 311 ? 21.695  0.026   32.552  1.00 27.88  ? 311 TYR B CE2 1 
ATOM   4968  C  CZ  . TYR B  1 311 ? 22.346  -1.037  31.944  1.00 28.56  ? 311 TYR B CZ  1 
ATOM   4969  O  OH  . TYR B  1 311 ? 21.626  -2.095  31.428  1.00 37.57  ? 311 TYR B OH  1 
ATOM   4970  N  N   . LYS B  1 312 ? 26.664  3.084   36.478  1.00 27.06  ? 312 LYS B N   1 
ATOM   4971  C  CA  . LYS B  1 312 ? 27.768  3.865   37.000  1.00 31.28  ? 312 LYS B CA  1 
ATOM   4972  C  C   . LYS B  1 312 ? 27.732  5.327   36.576  1.00 31.86  ? 312 LYS B C   1 
ATOM   4973  O  O   . LYS B  1 312 ? 28.773  5.929   36.367  1.00 32.78  ? 312 LYS B O   1 
ATOM   4974  C  CB  . LYS B  1 312 ? 29.099  3.230   36.584  1.00 28.97  ? 312 LYS B CB  1 
ATOM   4975  C  CG  . LYS B  1 312 ? 29.213  1.753   36.981  1.00 37.44  ? 312 LYS B CG  1 
ATOM   4976  C  CD  . LYS B  1 312 ? 30.657  1.263   36.835  1.00 46.55  ? 312 LYS B CD  1 
ATOM   4977  C  CE  . LYS B  1 312 ? 30.756  -0.259  36.860  1.00 50.59  ? 312 LYS B CE  1 
ATOM   4978  N  NZ  . LYS B  1 312 ? 30.504  -0.781  38.218  1.00 47.14  ? 312 LYS B NZ  1 
ATOM   4979  N  N   . ARG B  1 313 ? 26.542  5.902   36.452  1.00 32.11  ? 313 ARG B N   1 
ATOM   4980  C  CA  . ARG B  1 313 ? 26.439  7.327   36.132  1.00 30.77  ? 313 ARG B CA  1 
ATOM   4981  C  C   . ARG B  1 313 ? 26.694  8.173   37.383  1.00 34.46  ? 313 ARG B C   1 
ATOM   4982  O  O   . ARG B  1 313 ? 27.152  9.306   37.299  1.00 37.74  ? 313 ARG B O   1 
ATOM   4983  C  CB  . ARG B  1 313 ? 25.061  7.655   35.550  1.00 27.15  ? 313 ARG B CB  1 
ATOM   4984  C  CG  . ARG B  1 313 ? 24.673  6.815   34.347  1.00 27.72  ? 313 ARG B CG  1 
ATOM   4985  C  CD  . ARG B  1 313 ? 25.800  6.681   33.310  1.00 23.91  ? 313 ARG B CD  1 
ATOM   4986  N  NE  . ARG B  1 313 ? 25.297  6.069   32.075  1.00 26.65  ? 313 ARG B NE  1 
ATOM   4987  C  CZ  . ARG B  1 313 ? 26.057  5.713   31.045  1.00 25.59  ? 313 ARG B CZ  1 
ATOM   4988  N  NH1 . ARG B  1 313 ? 27.372  5.874   31.107  1.00 28.66  ? 313 ARG B NH1 1 
ATOM   4989  N  NH2 . ARG B  1 313 ? 25.505  5.193   29.955  1.00 29.83  ? 313 ARG B NH2 1 
ATOM   4990  N  N   . VAL B  1 314 ? 26.364  7.615   38.541  1.00 30.31  ? 314 VAL B N   1 
ATOM   4991  C  CA  . VAL B  1 314 ? 26.608  8.271   39.819  1.00 28.49  ? 314 VAL B CA  1 
ATOM   4992  C  C   . VAL B  1 314 ? 27.011  7.195   40.851  1.00 35.58  ? 314 VAL B C   1 
ATOM   4993  O  O   . VAL B  1 314 ? 26.562  6.045   40.758  1.00 29.52  ? 314 VAL B O   1 
ATOM   4994  C  CB  . VAL B  1 314 ? 25.356  8.984   40.316  1.00 27.27  ? 314 VAL B CB  1 
ATOM   4995  C  CG1 . VAL B  1 314 ? 24.197  8.004   40.418  1.00 28.39  ? 314 VAL B CG1 1 
ATOM   4996  C  CG2 . VAL B  1 314 ? 25.616  9.625   41.677  1.00 25.64  ? 314 VAL B CG2 1 
ATOM   4997  N  N   . ASP B  1 315 ? 27.860  7.557   41.811  1.00 34.64  ? 315 ASP B N   1 
ATOM   4998  C  CA  . ASP B  1 315 ? 28.261  6.628   42.877  1.00 26.95  ? 315 ASP B CA  1 
ATOM   4999  C  C   . ASP B  1 315 ? 27.843  7.187   44.230  1.00 30.41  ? 315 ASP B C   1 
ATOM   5000  O  O   . ASP B  1 315 ? 28.593  7.935   44.832  1.00 36.77  ? 315 ASP B O   1 
ATOM   5001  C  CB  . ASP B  1 315 ? 29.772  6.420   42.863  1.00 26.73  ? 315 ASP B CB  1 
ATOM   5002  C  CG  . ASP B  1 315 ? 30.255  5.507   44.009  1.00 34.96  ? 315 ASP B CG  1 
ATOM   5003  O  OD1 . ASP B  1 315 ? 29.426  5.038   44.822  1.00 29.92  ? 315 ASP B OD1 1 
ATOM   5004  O  OD2 . ASP B  1 315 ? 31.474  5.256   44.086  1.00 32.56  ? 315 ASP B OD2 1 
ATOM   5005  N  N   . PRO B  1 316 ? 26.645  6.815   44.715  1.00 31.88  ? 316 PRO B N   1 
ATOM   5006  C  CA  . PRO B  1 316 ? 26.077  7.413   45.931  1.00 33.26  ? 316 PRO B CA  1 
ATOM   5007  C  C   . PRO B  1 316 ? 26.746  6.908   47.204  1.00 34.07  ? 316 PRO B C   1 
ATOM   5008  O  O   . PRO B  1 316 ? 26.380  7.377   48.282  1.00 31.08  ? 316 PRO B O   1 
ATOM   5009  C  CB  . PRO B  1 316 ? 24.619  6.925   45.934  1.00 28.78  ? 316 PRO B CB  1 
ATOM   5010  C  CG  . PRO B  1 316 ? 24.554  5.805   44.928  1.00 24.56  ? 316 PRO B CG  1 
ATOM   5011  C  CD  . PRO B  1 316 ? 25.866  5.661   44.241  1.00 27.33  ? 316 PRO B CD  1 
ATOM   5012  N  N   . SER B  1 317 ? 27.680  5.965   47.096  1.00 32.94  ? 317 SER B N   1 
ATOM   5013  C  CA  . SER B  1 317 ? 28.323  5.439   48.301  1.00 39.96  ? 317 SER B CA  1 
ATOM   5014  C  C   . SER B  1 317 ? 29.147  6.518   49.034  1.00 43.38  ? 317 SER B C   1 
ATOM   5015  O  O   . SER B  1 317 ? 29.373  6.421   50.240  1.00 34.13  ? 317 SER B O   1 
ATOM   5016  C  CB  . SER B  1 317 ? 29.155  4.181   47.999  1.00 32.90  ? 317 SER B CB  1 
ATOM   5017  O  OG  . SER B  1 317 ? 30.314  4.473   47.228  1.00 34.66  ? 317 SER B OG  1 
ATOM   5018  N  N   . LYS B  1 318 ? 29.558  7.569   48.319  1.00 39.60  ? 318 LYS B N   1 
ATOM   5019  C  CA  . LYS B  1 318 ? 30.373  8.596   48.952  1.00 33.91  ? 318 LYS B CA  1 
ATOM   5020  C  C   . LYS B  1 318 ? 29.551  9.485   49.876  1.00 37.77  ? 318 LYS B C   1 
ATOM   5021  O  O   . LYS B  1 318 ? 30.103  10.322  50.577  1.00 36.94  ? 318 LYS B O   1 
ATOM   5022  C  CB  . LYS B  1 318 ? 31.108  9.454   47.917  1.00 42.60  ? 318 LYS B CB  1 
ATOM   5023  C  CG  . LYS B  1 318 ? 31.982  8.664   46.963  1.00 48.52  ? 318 LYS B CG  1 
ATOM   5024  C  CD  . LYS B  1 318 ? 32.776  7.583   47.674  1.00 45.25  ? 318 LYS B CD  1 
ATOM   5025  C  CE  . LYS B  1 318 ? 33.613  6.814   46.682  1.00 49.73  ? 318 LYS B CE  1 
ATOM   5026  N  NZ  . LYS B  1 318 ? 34.479  5.813   47.348  1.00 50.40  ? 318 LYS B NZ  1 
ATOM   5027  N  N   . LEU B  1 319 ? 28.231  9.327   49.855  1.00 34.51  ? 319 LEU B N   1 
ATOM   5028  C  CA  . LEU B  1 319 ? 27.379  10.037  50.802  1.00 35.67  ? 319 LEU B CA  1 
ATOM   5029  C  C   . LEU B  1 319 ? 27.467  9.399   52.194  1.00 33.17  ? 319 LEU B C   1 
ATOM   5030  O  O   . LEU B  1 319 ? 27.103  10.006  53.210  1.00 33.55  ? 319 LEU B O   1 
ATOM   5031  C  CB  . LEU B  1 319 ? 25.926  9.999   50.338  1.00 32.26  ? 319 LEU B CB  1 
ATOM   5032  C  CG  . LEU B  1 319 ? 25.549  10.662  49.017  1.00 32.02  ? 319 LEU B CG  1 
ATOM   5033  C  CD1 . LEU B  1 319 ? 24.066  10.390  48.727  1.00 29.54  ? 319 LEU B CD1 1 
ATOM   5034  C  CD2 . LEU B  1 319 ? 25.836  12.164  49.072  1.00 31.75  ? 319 LEU B CD2 1 
ATOM   5035  N  N   . VAL B  1 320 ? 27.946  8.167   52.224  1.00 31.16  ? 320 VAL B N   1 
ATOM   5036  C  CA  . VAL B  1 320 ? 27.858  7.355   53.421  1.00 36.77  ? 320 VAL B CA  1 
ATOM   5037  C  C   . VAL B  1 320 ? 29.169  7.397   54.194  1.00 34.60  ? 320 VAL B C   1 
ATOM   5038  O  O   . VAL B  1 320 ? 30.166  6.808   53.788  1.00 38.27  ? 320 VAL B O   1 
ATOM   5039  C  CB  . VAL B  1 320 ? 27.449  5.920   53.072  1.00 32.75  ? 320 VAL B CB  1 
ATOM   5040  C  CG1 . VAL B  1 320 ? 27.388  5.069   54.331  1.00 27.40  ? 320 VAL B CG1 1 
ATOM   5041  C  CG2 . VAL B  1 320 ? 26.070  5.930   52.331  1.00 27.99  ? 320 VAL B CG2 1 
ATOM   5042  N  N   . THR B  1 321 ? 29.156  8.130   55.299  1.00 32.73  ? 321 THR B N   1 
ATOM   5043  C  CA  . THR B  1 321 ? 30.340  8.269   56.141  1.00 37.89  ? 321 THR B CA  1 
ATOM   5044  C  C   . THR B  1 321 ? 30.370  7.274   57.320  1.00 44.65  ? 321 THR B C   1 
ATOM   5045  O  O   . THR B  1 321 ? 31.432  7.014   57.891  1.00 39.59  ? 321 THR B O   1 
ATOM   5046  C  CB  . THR B  1 321 ? 30.412  9.679   56.722  1.00 31.11  ? 321 THR B CB  1 
ATOM   5047  O  OG1 . THR B  1 321 ? 29.135  10.005  57.278  1.00 29.36  ? 321 THR B OG1 1 
ATOM   5048  C  CG2 . THR B  1 321 ? 30.771  10.695  55.635  1.00 37.35  ? 321 THR B CG2 1 
ATOM   5049  N  N   . HIS B  1 322 ? 29.200  6.756   57.697  1.00 46.93  ? 322 HIS B N   1 
ATOM   5050  C  CA  . HIS B  1 322 ? 29.081  5.862   58.848  1.00 41.98  ? 322 HIS B CA  1 
ATOM   5051  C  C   . HIS B  1 322 ? 28.215  4.643   58.516  1.00 44.26  ? 322 HIS B C   1 
ATOM   5052  O  O   . HIS B  1 322 ? 27.058  4.788   58.123  1.00 49.32  ? 322 HIS B O   1 
ATOM   5053  C  CB  . HIS B  1 322 ? 28.448  6.587   60.037  1.00 40.03  ? 322 HIS B CB  1 
ATOM   5054  C  CG  . HIS B  1 322 ? 29.244  7.747   60.549  1.00 52.70  ? 322 HIS B CG  1 
ATOM   5055  N  ND1 . HIS B  1 322 ? 29.480  8.879   59.802  1.00 49.67  ? 322 HIS B ND1 1 
ATOM   5056  C  CD2 . HIS B  1 322 ? 29.823  7.966   61.755  1.00 56.60  ? 322 HIS B CD2 1 
ATOM   5057  C  CE1 . HIS B  1 322 ? 30.184  9.740   60.517  1.00 52.58  ? 322 HIS B CE1 1 
ATOM   5058  N  NE2 . HIS B  1 322 ? 30.404  9.209   61.707  1.00 56.44  ? 322 HIS B NE2 1 
ATOM   5059  N  N   . VAL B  1 323 ? 28.767  3.444   58.688  1.00 41.28  ? 323 VAL B N   1 
ATOM   5060  C  CA  . VAL B  1 323 ? 27.994  2.221   58.486  1.00 41.67  ? 323 VAL B CA  1 
ATOM   5061  C  C   . VAL B  1 323 ? 27.866  1.463   59.797  1.00 45.27  ? 323 VAL B C   1 
ATOM   5062  O  O   . VAL B  1 323 ? 28.861  1.004   60.355  1.00 48.32  ? 323 VAL B O   1 
ATOM   5063  C  CB  . VAL B  1 323 ? 28.635  1.297   57.428  1.00 40.05  ? 323 VAL B CB  1 
ATOM   5064  C  CG1 . VAL B  1 323 ? 27.839  0.013   57.298  1.00 44.15  ? 323 VAL B CG1 1 
ATOM   5065  C  CG2 . VAL B  1 323 ? 28.696  2.002   56.087  1.00 44.70  ? 323 VAL B CG2 1 
ATOM   5066  N  N   . PHE B  1 324 ? 26.644  1.341   60.300  1.00 35.81  ? 324 PHE B N   1 
ATOM   5067  C  CA  . PHE B  1 324 ? 26.416  0.534   61.480  1.00 35.36  ? 324 PHE B CA  1 
ATOM   5068  C  C   . PHE B  1 324 ? 25.727  -0.757  61.100  1.00 39.61  ? 324 PHE B C   1 
ATOM   5069  O  O   . PHE B  1 324 ? 25.246  -0.907  59.970  1.00 36.69  ? 324 PHE B O   1 
ATOM   5070  C  CB  . PHE B  1 324 ? 25.552  1.284   62.480  1.00 39.34  ? 324 PHE B CB  1 
ATOM   5071  C  CG  . PHE B  1 324 ? 26.111  2.616   62.872  1.00 43.23  ? 324 PHE B CG  1 
ATOM   5072  C  CD1 . PHE B  1 324 ? 27.218  2.698   63.695  1.00 48.47  ? 324 PHE B CD1 1 
ATOM   5073  C  CD2 . PHE B  1 324 ? 25.535  3.781   62.416  1.00 40.98  ? 324 PHE B CD2 1 
ATOM   5074  C  CE1 . PHE B  1 324 ? 27.743  3.920   64.059  1.00 51.51  ? 324 PHE B CE1 1 
ATOM   5075  C  CE2 . PHE B  1 324 ? 26.047  5.010   62.776  1.00 50.34  ? 324 PHE B CE2 1 
ATOM   5076  C  CZ  . PHE B  1 324 ? 27.152  5.083   63.598  1.00 52.55  ? 324 PHE B CZ  1 
ATOM   5077  N  N   . ARG B  1 325 ? 25.675  -1.686  62.052  1.00 34.30  ? 325 ARG B N   1 
ATOM   5078  C  CA  . ARG B  1 325 ? 24.900  -2.900  61.888  1.00 36.59  ? 325 ARG B CA  1 
ATOM   5079  C  C   . ARG B  1 325 ? 23.986  -3.114  63.091  1.00 39.69  ? 325 ARG B C   1 
ATOM   5080  O  O   . ARG B  1 325 ? 24.357  -2.795  64.227  1.00 41.29  ? 325 ARG B O   1 
ATOM   5081  C  CB  . ARG B  1 325 ? 25.830  -4.098  61.688  1.00 43.81  ? 325 ARG B CB  1 
ATOM   5082  C  CG  . ARG B  1 325 ? 26.852  -3.892  60.576  1.00 50.08  ? 325 ARG B CG  1 
ATOM   5083  C  CD  . ARG B  1 325 ? 27.596  -5.176  60.213  1.00 51.57  ? 325 ARG B CD  1 
ATOM   5084  N  NE  . ARG B  1 325 ? 26.867  -5.952  59.216  1.00 66.53  ? 325 ARG B NE  1 
ATOM   5085  C  CZ  . ARG B  1 325 ? 27.241  -6.088  57.949  1.00 68.59  ? 325 ARG B CZ  1 
ATOM   5086  N  NH1 . ARG B  1 325 ? 28.352  -5.509  57.518  1.00 66.60  ? 325 ARG B NH1 1 
ATOM   5087  N  NH2 . ARG B  1 325 ? 26.507  -6.814  57.116  1.00 71.30  ? 325 ARG B NH2 1 
ATOM   5088  N  N   . GLY B  1 326 ? 22.785  -3.629  62.834  1.00 38.17  ? 326 GLY B N   1 
ATOM   5089  C  CA  . GLY B  1 326 ? 21.874  -4.028  63.891  1.00 33.18  ? 326 GLY B CA  1 
ATOM   5090  C  C   . GLY B  1 326 ? 20.806  -3.006  64.221  1.00 37.17  ? 326 GLY B C   1 
ATOM   5091  O  O   . GLY B  1 326 ? 21.053  -1.809  64.174  1.00 38.88  ? 326 GLY B O   1 
ATOM   5092  N  N   . PHE B  1 327 ? 19.615  -3.490  64.566  1.00 39.09  ? 327 PHE B N   1 
ATOM   5093  C  CA  . PHE B  1 327 ? 18.493  -2.623  64.903  1.00 41.73  ? 327 PHE B CA  1 
ATOM   5094  C  C   . PHE B  1 327 ? 18.786  -1.565  65.950  1.00 48.49  ? 327 PHE B C   1 
ATOM   5095  O  O   . PHE B  1 327 ? 18.324  -0.434  65.825  1.00 50.84  ? 327 PHE B O   1 
ATOM   5096  C  CB  . PHE B  1 327 ? 17.290  -3.447  65.353  1.00 43.80  ? 327 PHE B CB  1 
ATOM   5097  C  CG  . PHE B  1 327 ? 16.496  -3.993  64.225  1.00 49.23  ? 327 PHE B CG  1 
ATOM   5098  C  CD1 . PHE B  1 327 ? 16.697  -5.289  63.785  1.00 57.26  ? 327 PHE B CD1 1 
ATOM   5099  C  CD2 . PHE B  1 327 ? 15.557  -3.202  63.577  1.00 46.58  ? 327 PHE B CD2 1 
ATOM   5100  C  CE1 . PHE B  1 327 ? 15.955  -5.797  62.724  1.00 62.25  ? 327 PHE B CE1 1 
ATOM   5101  C  CE2 . PHE B  1 327 ? 14.823  -3.697  62.517  1.00 47.41  ? 327 PHE B CE2 1 
ATOM   5102  C  CZ  . PHE B  1 327 ? 15.022  -4.999  62.088  1.00 56.26  ? 327 PHE B CZ  1 
ATOM   5103  N  N   . ASP B  1 328 ? 19.529  -1.925  66.990  1.00 43.75  ? 328 ASP B N   1 
ATOM   5104  C  CA  . ASP B  1 328 ? 19.792  -0.970  68.053  1.00 44.96  ? 328 ASP B CA  1 
ATOM   5105  C  C   . ASP B  1 328 ? 20.455  0.282   67.505  1.00 43.61  ? 328 ASP B C   1 
ATOM   5106  O  O   . ASP B  1 328 ? 20.147  1.395   67.937  1.00 51.13  ? 328 ASP B O   1 
ATOM   5107  C  CB  . ASP B  1 328 ? 20.669  -1.585  69.143  1.00 55.37  ? 328 ASP B CB  1 
ATOM   5108  C  CG  . ASP B  1 328 ? 19.965  -2.692  69.897  1.00 63.52  ? 328 ASP B CG  1 
ATOM   5109  O  OD1 . ASP B  1 328 ? 18.739  -2.847  69.718  1.00 65.67  ? 328 ASP B OD1 1 
ATOM   5110  O  OD2 . ASP B  1 328 ? 20.640  -3.406  70.664  1.00 66.56  ? 328 ASP B OD2 1 
ATOM   5111  N  N   . ASN B  1 329 ? 21.368  0.100   66.554  1.00 34.54  ? 329 ASN B N   1 
ATOM   5112  C  CA  . ASN B  1 329 ? 22.108  1.229   65.982  1.00 37.71  ? 329 ASN B CA  1 
ATOM   5113  C  C   . ASN B  1 329 ? 21.252  2.244   65.205  1.00 40.56  ? 329 ASN B C   1 
ATOM   5114  O  O   . ASN B  1 329 ? 21.720  3.334   64.856  1.00 37.26  ? 329 ASN B O   1 
ATOM   5115  C  CB  . ASN B  1 329 ? 23.278  0.729   65.139  1.00 34.32  ? 329 ASN B CB  1 
ATOM   5116  C  CG  . ASN B  1 329 ? 24.513  0.403   65.995  1.00 48.93  ? 329 ASN B CG  1 
ATOM   5117  O  OD1 . ASN B  1 329 ? 24.857  1.150   66.913  1.00 46.51  ? 329 ASN B OD1 1 
ATOM   5118  N  ND2 . ASN B  1 329 ? 25.177  -0.714  65.692  1.00 43.63  ? 329 ASN B ND2 1 
ATOM   5119  N  N   . ILE B  1 330 ? 20.002  1.875   64.941  1.00 40.38  ? 330 ILE B N   1 
ATOM   5120  C  CA  . ILE B  1 330 ? 19.031  2.811   64.390  1.00 39.27  ? 330 ILE B CA  1 
ATOM   5121  C  C   . ILE B  1 330 ? 18.939  4.071   65.256  1.00 47.43  ? 330 ILE B C   1 
ATOM   5122  O  O   . ILE B  1 330 ? 19.017  5.192   64.748  1.00 46.58  ? 330 ILE B O   1 
ATOM   5123  C  CB  . ILE B  1 330 ? 17.642  2.167   64.282  1.00 32.30  ? 330 ILE B CB  1 
ATOM   5124  C  CG1 . ILE B  1 330 ? 17.615  1.171   63.124  1.00 25.93  ? 330 ILE B CG1 1 
ATOM   5125  C  CG2 . ILE B  1 330 ? 16.566  3.232   64.086  1.00 37.03  ? 330 ILE B CG2 1 
ATOM   5126  C  CD1 . ILE B  1 330 ? 16.253  0.545   62.893  1.00 28.81  ? 330 ILE B CD1 1 
ATOM   5127  N  N   . GLU B  1 331 ? 18.780  3.878   66.564  1.00 45.74  ? 331 GLU B N   1 
ATOM   5128  C  CA  . GLU B  1 331 ? 18.683  4.987   67.498  1.00 43.38  ? 331 GLU B CA  1 
ATOM   5129  C  C   . GLU B  1 331 ? 19.971  5.806   67.486  1.00 44.71  ? 331 GLU B C   1 
ATOM   5130  O  O   . GLU B  1 331 ? 19.936  7.034   67.572  1.00 42.40  ? 331 GLU B O   1 
ATOM   5131  C  CB  . GLU B  1 331 ? 18.403  4.472   68.912  1.00 47.75  ? 331 GLU B CB  1 
ATOM   5132  C  CG  . GLU B  1 331 ? 18.410  5.550   70.002  1.00 47.32  ? 331 GLU B CG  1 
ATOM   5133  C  CD  . GLU B  1 331 ? 17.922  5.013   71.337  1.00 53.90  ? 331 GLU B CD  1 
ATOM   5134  O  OE1 . GLU B  1 331 ? 18.202  3.835   71.641  1.00 57.38  ? 331 GLU B OE1 1 
ATOM   5135  O  OE2 . GLU B  1 331 ? 17.248  5.760   72.077  1.00 57.56  ? 331 GLU B OE2 1 
ATOM   5136  N  N   . LYS B  1 332 ? 21.106  5.119   67.386  1.00 40.39  ? 332 LYS B N   1 
ATOM   5137  C  CA  . LYS B  1 332 ? 22.405  5.787   67.353  1.00 41.53  ? 332 LYS B CA  1 
ATOM   5138  C  C   . LYS B  1 332 ? 22.523  6.575   66.056  1.00 39.40  ? 332 LYS B C   1 
ATOM   5139  O  O   . LYS B  1 332 ? 22.989  7.701   66.057  1.00 39.25  ? 332 LYS B O   1 
ATOM   5140  C  CB  . LYS B  1 332 ? 23.537  4.762   67.464  1.00 44.58  ? 332 LYS B CB  1 
ATOM   5141  C  CG  . LYS B  1 332 ? 24.944  5.348   67.483  1.00 55.77  ? 332 LYS B CG  1 
ATOM   5142  C  CD  . LYS B  1 332 ? 25.984  4.240   67.706  1.00 62.83  ? 332 LYS B CD  1 
ATOM   5143  C  CE  . LYS B  1 332 ? 27.331  4.794   68.152  1.00 75.12  ? 332 LYS B CE  1 
ATOM   5144  N  NZ  . LYS B  1 332 ? 28.245  3.722   68.664  1.00 79.32  ? 332 LYS B NZ  1 
ATOM   5145  N  N   . ALA B  1 333 ? 22.078  5.980   64.951  1.00 36.96  ? 333 ALA B N   1 
ATOM   5146  C  CA  . ALA B  1 333 ? 22.116  6.659   63.664  1.00 39.21  ? 333 ALA B CA  1 
ATOM   5147  C  C   . ALA B  1 333 ? 21.229  7.907   63.665  1.00 38.01  ? 333 ALA B C   1 
ATOM   5148  O  O   . ALA B  1 333 ? 21.626  8.952   63.171  1.00 32.82  ? 333 ALA B O   1 
ATOM   5149  C  CB  . ALA B  1 333 ? 21.701  5.707   62.546  1.00 37.47  ? 333 ALA B CB  1 
ATOM   5150  N  N   . PHE B  1 334 ? 20.034  7.779   64.233  1.00 31.74  ? 334 PHE B N   1 
ATOM   5151  C  CA  . PHE B  1 334 ? 19.077  8.865   64.292  1.00 34.29  ? 334 PHE B CA  1 
ATOM   5152  C  C   . PHE B  1 334 ? 19.641  10.049  65.080  1.00 43.35  ? 334 PHE B C   1 
ATOM   5153  O  O   . PHE B  1 334 ? 19.712  11.169  64.570  1.00 53.62  ? 334 PHE B O   1 
ATOM   5154  C  CB  . PHE B  1 334 ? 17.768  8.387   64.929  1.00 33.62  ? 334 PHE B CB  1 
ATOM   5155  C  CG  . PHE B  1 334 ? 16.697  9.457   65.011  1.00 44.59  ? 334 PHE B CG  1 
ATOM   5156  C  CD1 . PHE B  1 334 ? 15.851  9.709   63.928  1.00 43.69  ? 334 PHE B CD1 1 
ATOM   5157  C  CD2 . PHE B  1 334 ? 16.530  10.201  66.172  1.00 50.74  ? 334 PHE B CD2 1 
ATOM   5158  C  CE1 . PHE B  1 334 ? 14.857  10.693  64.008  1.00 41.68  ? 334 PHE B CE1 1 
ATOM   5159  C  CE2 . PHE B  1 334 ? 15.539  11.182  66.259  1.00 51.41  ? 334 PHE B CE2 1 
ATOM   5160  C  CZ  . PHE B  1 334 ? 14.707  11.426  65.175  1.00 46.98  ? 334 PHE B CZ  1 
ATOM   5161  N  N   . MET B  1 335 ? 20.032  9.796   66.324  1.00 39.58  ? 335 MET B N   1 
ATOM   5162  C  CA  . MET B  1 335 ? 20.626  10.830  67.183  1.00 48.43  ? 335 MET B CA  1 
ATOM   5163  C  C   . MET B  1 335 ? 21.862  11.487  66.563  1.00 47.30  ? 335 MET B C   1 
ATOM   5164  O  O   . MET B  1 335 ? 22.152  12.654  66.818  1.00 52.83  ? 335 MET B O   1 
ATOM   5165  C  CB  . MET B  1 335 ? 20.969  10.250  68.562  1.00 47.23  ? 335 MET B CB  1 
ATOM   5166  C  CG  . MET B  1 335 ? 19.758  9.663   69.293  1.00 44.90  ? 335 MET B CG  1 
ATOM   5167  S  SD  . MET B  1 335 ? 18.320  10.774  69.285  1.00 67.84  ? 335 MET B SD  1 
ATOM   5168  C  CE  . MET B  1 335 ? 18.977  12.189  70.164  1.00 93.45  ? 335 MET B CE  1 
ATOM   5169  N  N   . LEU B  1 336 ? 22.583  10.732  65.749  1.00 44.86  ? 336 LEU B N   1 
ATOM   5170  C  CA  . LEU B  1 336 ? 23.719  11.264  65.011  1.00 45.75  ? 336 LEU B CA  1 
ATOM   5171  C  C   . LEU B  1 336 ? 23.262  12.378  64.072  1.00 49.20  ? 336 LEU B C   1 
ATOM   5172  O  O   . LEU B  1 336 ? 23.958  13.375  63.893  1.00 51.66  ? 336 LEU B O   1 
ATOM   5173  C  CB  . LEU B  1 336 ? 24.371  10.147  64.212  1.00 48.47  ? 336 LEU B CB  1 
ATOM   5174  C  CG  . LEU B  1 336 ? 25.880  10.163  64.009  1.00 53.39  ? 336 LEU B CG  1 
ATOM   5175  C  CD1 . LEU B  1 336 ? 26.637  10.371  65.333  1.00 48.67  ? 336 LEU B CD1 1 
ATOM   5176  C  CD2 . LEU B  1 336 ? 26.293  8.861   63.338  1.00 49.22  ? 336 LEU B CD2 1 
ATOM   5177  N  N   . MET B  1 337 ? 22.082  12.215  63.479  1.00 39.78  ? 337 MET B N   1 
ATOM   5178  C  CA  . MET B  1 337 ? 21.528  13.257  62.624  1.00 41.21  ? 337 MET B CA  1 
ATOM   5179  C  C   . MET B  1 337 ? 21.130  14.458  63.467  1.00 48.41  ? 337 MET B C   1 
ATOM   5180  O  O   . MET B  1 337 ? 21.226  15.601  63.022  1.00 48.81  ? 337 MET B O   1 
ATOM   5181  C  CB  . MET B  1 337 ? 20.289  12.755  61.861  1.00 40.19  ? 337 MET B CB  1 
ATOM   5182  C  CG  . MET B  1 337 ? 20.551  11.598  60.924  1.00 34.11  ? 337 MET B CG  1 
ATOM   5183  S  SD  . MET B  1 337 ? 21.691  12.021  59.592  1.00 44.72  ? 337 MET B SD  1 
ATOM   5184  C  CE  . MET B  1 337 ? 20.612  12.946  58.506  1.00 37.58  ? 337 MET B CE  1 
ATOM   5185  N  N   . LYS B  1 338 ? 20.643  14.189  64.673  1.00 52.92  ? 338 LYS B N   1 
ATOM   5186  C  CA  . LYS B  1 338 ? 20.202  15.256  65.563  1.00 56.38  ? 338 LYS B CA  1 
ATOM   5187  C  C   . LYS B  1 338 ? 21.375  16.180  65.883  1.00 63.65  ? 338 LYS B C   1 
ATOM   5188  O  O   . LYS B  1 338 ? 21.439  17.302  65.385  1.00 63.63  ? 338 LYS B O   1 
ATOM   5189  C  CB  . LYS B  1 338 ? 19.583  14.676  66.838  1.00 56.17  ? 338 LYS B CB  1 
ATOM   5190  C  CG  . LYS B  1 338 ? 18.657  15.626  67.592  1.00 63.26  ? 338 LYS B CG  1 
ATOM   5191  C  CD  . LYS B  1 338 ? 19.377  16.343  68.713  1.00 71.70  ? 338 LYS B CD  1 
ATOM   5192  C  CE  . LYS B  1 338 ? 18.422  17.170  69.565  1.00 73.81  ? 338 LYS B CE  1 
ATOM   5193  N  NZ  . LYS B  1 338 ? 19.071  17.576  70.842  1.00 75.52  ? 338 LYS B NZ  1 
ATOM   5194  N  N   . ASP B  1 339 ? 22.312  15.703  66.695  1.00 69.11  ? 339 ASP B N   1 
ATOM   5195  C  CA  . ASP B  1 339 ? 23.474  16.514  67.047  1.00 70.75  ? 339 ASP B CA  1 
ATOM   5196  C  C   . ASP B  1 339 ? 24.607  16.288  66.055  1.00 68.98  ? 339 ASP B C   1 
ATOM   5197  O  O   . ASP B  1 339 ? 25.648  15.725  66.395  1.00 71.71  ? 339 ASP B O   1 
ATOM   5198  C  CB  . ASP B  1 339 ? 23.913  16.268  68.498  1.00 72.16  ? 339 ASP B CB  1 
ATOM   5199  C  CG  . ASP B  1 339 ? 23.743  14.824  68.932  1.00 72.16  ? 339 ASP B CG  1 
ATOM   5200  O  OD1 . ASP B  1 339 ? 24.634  14.005  68.631  1.00 72.53  ? 339 ASP B OD1 1 
ATOM   5201  O  OD2 . ASP B  1 339 ? 22.733  14.515  69.600  1.00 72.69  ? 339 ASP B OD2 1 
ATOM   5202  N  N   . LYS B  1 340 ? 24.379  16.756  64.831  1.00 66.83  ? 340 LYS B N   1 
ATOM   5203  C  CA  . LYS B  1 340 ? 25.224  16.476  63.670  1.00 69.07  ? 340 LYS B CA  1 
ATOM   5204  C  C   . LYS B  1 340 ? 26.706  16.810  63.886  1.00 66.62  ? 340 LYS B C   1 
ATOM   5205  O  O   . LYS B  1 340 ? 27.077  17.981  63.924  1.00 68.29  ? 340 LYS B O   1 
ATOM   5206  C  CB  . LYS B  1 340 ? 24.670  17.236  62.453  1.00 75.70  ? 340 LYS B CB  1 
ATOM   5207  C  CG  . LYS B  1 340 ? 25.013  16.631  61.089  1.00 85.74  ? 340 LYS B CG  1 
ATOM   5208  C  CD  . LYS B  1 340 ? 24.085  17.170  59.993  1.00 94.22  ? 340 LYS B CD  1 
ATOM   5209  C  CE  . LYS B  1 340 ? 24.419  16.606  58.607  1.00 97.36  ? 340 LYS B CE  1 
ATOM   5210  N  NZ  . LYS B  1 340 ? 25.518  17.346  57.910  1.00 96.67  ? 340 LYS B NZ  1 
ATOM   5211  N  N   . PRO B  1 341 ? 27.554  15.773  64.038  1.00 58.06  ? 341 PRO B N   1 
ATOM   5212  C  CA  . PRO B  1 341 ? 29.011  15.925  64.181  1.00 61.70  ? 341 PRO B CA  1 
ATOM   5213  C  C   . PRO B  1 341 ? 29.686  16.343  62.880  1.00 66.07  ? 341 PRO B C   1 
ATOM   5214  O  O   . PRO B  1 341 ? 29.045  16.354  61.829  1.00 63.63  ? 341 PRO B O   1 
ATOM   5215  C  CB  . PRO B  1 341 ? 29.471  14.513  64.564  1.00 58.92  ? 341 PRO B CB  1 
ATOM   5216  C  CG  . PRO B  1 341 ? 28.390  13.620  64.029  1.00 54.13  ? 341 PRO B CG  1 
ATOM   5217  C  CD  . PRO B  1 341 ? 27.137  14.388  64.312  1.00 51.34  ? 341 PRO B CD  1 
ATOM   5218  N  N   . LYS B  1 342 ? 30.980  16.641  62.955  1.00 65.77  ? 342 LYS B N   1 
ATOM   5219  C  CA  . LYS B  1 342 ? 31.701  17.255  61.844  1.00 64.30  ? 342 LYS B CA  1 
ATOM   5220  C  C   . LYS B  1 342 ? 32.151  16.285  60.746  1.00 57.12  ? 342 LYS B C   1 
ATOM   5221  O  O   . LYS B  1 342 ? 32.419  16.708  59.623  1.00 57.85  ? 342 LYS B O   1 
ATOM   5222  C  CB  . LYS B  1 342 ? 32.909  18.035  62.367  1.00 76.10  ? 342 LYS B CB  1 
ATOM   5223  C  CG  . LYS B  1 342 ? 32.552  19.134  63.358  1.00 91.42  ? 342 LYS B CG  1 
ATOM   5224  C  CD  . LYS B  1 342 ? 33.792  19.678  64.060  1.00 102.15 ? 342 LYS B CD  1 
ATOM   5225  C  CE  . LYS B  1 342 ? 33.435  20.762  65.071  1.00 105.35 ? 342 LYS B CE  1 
ATOM   5226  N  NZ  . LYS B  1 342 ? 34.628  21.231  65.830  1.00 104.79 ? 342 LYS B NZ  1 
ATOM   5227  N  N   . ASP B  1 343 ? 32.250  14.998  61.056  1.00 44.35  ? 343 ASP B N   1 
ATOM   5228  C  CA  . ASP B  1 343 ? 32.746  14.042  60.067  1.00 42.85  ? 343 ASP B CA  1 
ATOM   5229  C  C   . ASP B  1 343 ? 31.596  13.366  59.327  1.00 45.06  ? 343 ASP B C   1 
ATOM   5230  O  O   . ASP B  1 343 ? 31.808  12.489  58.488  1.00 46.85  ? 343 ASP B O   1 
ATOM   5231  C  CB  . ASP B  1 343 ? 33.670  12.992  60.710  1.00 44.48  ? 343 ASP B CB  1 
ATOM   5232  C  CG  . ASP B  1 343 ? 33.015  12.260  61.877  1.00 51.70  ? 343 ASP B CG  1 
ATOM   5233  O  OD1 . ASP B  1 343 ? 31.988  12.759  62.386  1.00 52.02  ? 343 ASP B OD1 1 
ATOM   5234  O  OD2 . ASP B  1 343 ? 33.531  11.186  62.291  1.00 54.96  ? 343 ASP B OD2 1 
ATOM   5235  N  N   . LEU B  1 344 ? 30.379  13.798  59.632  1.00 41.28  ? 344 LEU B N   1 
ATOM   5236  C  CA  . LEU B  1 344 ? 29.188  13.091  59.188  1.00 45.65  ? 344 LEU B CA  1 
ATOM   5237  C  C   . LEU B  1 344 ? 28.543  13.673  57.929  1.00 45.63  ? 344 LEU B C   1 
ATOM   5238  O  O   . LEU B  1 344 ? 28.329  14.877  57.838  1.00 50.29  ? 344 LEU B O   1 
ATOM   5239  C  CB  . LEU B  1 344 ? 28.156  13.081  60.314  1.00 46.49  ? 344 LEU B CB  1 
ATOM   5240  C  CG  . LEU B  1 344 ? 26.783  12.568  59.893  1.00 45.29  ? 344 LEU B CG  1 
ATOM   5241  C  CD1 . LEU B  1 344 ? 26.883  11.081  59.661  1.00 46.99  ? 344 LEU B CD1 1 
ATOM   5242  C  CD2 . LEU B  1 344 ? 25.721  12.892  60.933  1.00 42.05  ? 344 LEU B CD2 1 
ATOM   5243  N  N   . ILE B  1 345 ? 28.240  12.810  56.961  1.00 44.69  ? 345 ILE B N   1 
ATOM   5244  C  CA  . ILE B  1 345 ? 27.272  13.157  55.911  1.00 43.89  ? 345 ILE B CA  1 
ATOM   5245  C  C   . ILE B  1 345 ? 25.986  12.344  56.120  1.00 41.12  ? 345 ILE B C   1 
ATOM   5246  O  O   . ILE B  1 345 ? 24.991  12.862  56.616  1.00 38.51  ? 345 ILE B O   1 
ATOM   5247  C  CB  . ILE B  1 345 ? 27.815  12.916  54.490  1.00 37.64  ? 345 ILE B CB  1 
ATOM   5248  C  CG1 . ILE B  1 345 ? 28.973  13.864  54.183  1.00 36.13  ? 345 ILE B CG1 1 
ATOM   5249  C  CG2 . ILE B  1 345 ? 26.704  13.099  53.468  1.00 41.63  ? 345 ILE B CG2 1 
ATOM   5250  C  CD1 . ILE B  1 345 ? 29.925  13.336  53.122  1.00 37.04  ? 345 ILE B CD1 1 
ATOM   5251  N  N   . LYS B  1 346 ? 26.029  11.056  55.783  1.00 34.30  ? 346 LYS B N   1 
ATOM   5252  C  CA  . LYS B  1 346 ? 24.857  10.198  55.923  1.00 35.41  ? 346 LYS B CA  1 
ATOM   5253  C  C   . LYS B  1 346 ? 25.218  8.883   56.640  1.00 37.08  ? 346 LYS B C   1 
ATOM   5254  O  O   . LYS B  1 346 ? 26.194  8.219   56.284  1.00 33.59  ? 346 LYS B O   1 
ATOM   5255  C  CB  . LYS B  1 346 ? 24.279  9.954   54.524  1.00 43.16  ? 346 LYS B CB  1 
ATOM   5256  C  CG  . LYS B  1 346 ? 22.850  9.500   54.469  1.00 46.49  ? 346 LYS B CG  1 
ATOM   5257  C  CD  . LYS B  1 346 ? 21.824  10.618  54.566  1.00 32.25  ? 346 LYS B CD  1 
ATOM   5258  C  CE  . LYS B  1 346 ? 20.430  9.974   54.391  1.00 29.57  ? 346 LYS B CE  1 
ATOM   5259  N  NZ  . LYS B  1 346 ? 19.282  10.799  54.891  1.00 37.90  ? 346 LYS B NZ  1 
ATOM   5260  N  N   . PRO B  1 347 ? 24.446  8.506   57.676  1.00 38.66  ? 347 PRO B N   1 
ATOM   5261  C  CA  . PRO B  1 347 ? 24.688  7.213   58.323  1.00 37.42  ? 347 PRO B CA  1 
ATOM   5262  C  C   . PRO B  1 347 ? 23.768  6.139   57.751  1.00 34.39  ? 347 PRO B C   1 
ATOM   5263  O  O   . PRO B  1 347 ? 22.625  6.447   57.419  1.00 35.43  ? 347 PRO B O   1 
ATOM   5264  C  CB  . PRO B  1 347 ? 24.289  7.469   59.784  1.00 36.01  ? 347 PRO B CB  1 
ATOM   5265  C  CG  . PRO B  1 347 ? 23.526  8.776   59.786  1.00 39.46  ? 347 PRO B CG  1 
ATOM   5266  C  CD  . PRO B  1 347 ? 23.390  9.259   58.365  1.00 35.89  ? 347 PRO B CD  1 
ATOM   5267  N  N   . VAL B  1 348 ? 24.264  4.909   57.644  1.00 31.23  ? 348 VAL B N   1 
ATOM   5268  C  CA  . VAL B  1 348 ? 23.450  3.775   57.223  1.00 37.25  ? 348 VAL B CA  1 
ATOM   5269  C  C   . VAL B  1 348 ? 23.533  2.640   58.240  1.00 37.63  ? 348 VAL B C   1 
ATOM   5270  O  O   . VAL B  1 348 ? 24.608  2.353   58.779  1.00 34.75  ? 348 VAL B O   1 
ATOM   5271  C  CB  . VAL B  1 348 ? 23.854  3.263   55.819  1.00 39.05  ? 348 VAL B CB  1 
ATOM   5272  C  CG1 . VAL B  1 348 ? 23.217  1.912   55.536  1.00 45.05  ? 348 VAL B CG1 1 
ATOM   5273  C  CG2 . VAL B  1 348 ? 23.440  4.274   54.749  1.00 29.75  ? 348 VAL B CG2 1 
ATOM   5274  N  N   . VAL B  1 349 ? 22.385  2.022   58.517  1.00 36.48  ? 349 VAL B N   1 
ATOM   5275  C  CA  . VAL B  1 349 ? 22.327  0.832   59.357  1.00 29.31  ? 349 VAL B CA  1 
ATOM   5276  C  C   . VAL B  1 349 ? 21.921  -0.369  58.518  1.00 32.52  ? 349 VAL B C   1 
ATOM   5277  O  O   . VAL B  1 349 ? 20.832  -0.416  57.943  1.00 31.96  ? 349 VAL B O   1 
ATOM   5278  C  CB  . VAL B  1 349 ? 21.335  0.971   60.525  1.00 23.67  ? 349 VAL B CB  1 
ATOM   5279  C  CG1 . VAL B  1 349 ? 21.502  -0.206  61.494  1.00 29.15  ? 349 VAL B CG1 1 
ATOM   5280  C  CG2 . VAL B  1 349 ? 21.545  2.289   61.247  1.00 29.71  ? 349 VAL B CG2 1 
ATOM   5281  N  N   . ILE B  1 350 ? 22.818  -1.338  58.464  1.00 32.47  ? 350 ILE B N   1 
ATOM   5282  C  CA  . ILE B  1 350 ? 22.618  -2.565  57.726  1.00 35.81  ? 350 ILE B CA  1 
ATOM   5283  C  C   . ILE B  1 350 ? 22.086  -3.642  58.673  1.00 39.96  ? 350 ILE B C   1 
ATOM   5284  O  O   . ILE B  1 350 ? 22.670  -3.876  59.731  1.00 31.64  ? 350 ILE B O   1 
ATOM   5285  C  CB  . ILE B  1 350 ? 23.946  -3.017  57.119  1.00 34.87  ? 350 ILE B CB  1 
ATOM   5286  C  CG1 . ILE B  1 350 ? 24.356  -2.064  55.984  1.00 35.55  ? 350 ILE B CG1 1 
ATOM   5287  C  CG2 . ILE B  1 350 ? 23.843  -4.468  56.642  1.00 34.94  ? 350 ILE B CG2 1 
ATOM   5288  C  CD1 . ILE B  1 350 ? 25.709  -2.404  55.391  1.00 46.32  ? 350 ILE B CD1 1 
ATOM   5289  N  N   . LEU B  1 351 ? 20.985  -4.292  58.295  1.00 38.69  ? 351 LEU B N   1 
ATOM   5290  C  CA  . LEU B  1 351 ? 20.300  -5.203  59.208  1.00 45.41  ? 351 LEU B CA  1 
ATOM   5291  C  C   . LEU B  1 351 ? 20.607  -6.676  58.961  1.00 57.00  ? 351 LEU B C   1 
ATOM   5292  O  O   . LEU B  1 351 ? 20.628  -7.475  59.897  1.00 58.86  ? 351 LEU B O   1 
ATOM   5293  C  CB  . LEU B  1 351 ? 18.801  -4.927  59.231  1.00 39.56  ? 351 LEU B CB  1 
ATOM   5294  C  CG  . LEU B  1 351 ? 18.618  -3.475  59.682  1.00 48.98  ? 351 LEU B CG  1 
ATOM   5295  C  CD1 . LEU B  1 351 ? 17.209  -2.972  59.443  1.00 49.88  ? 351 LEU B CD1 1 
ATOM   5296  C  CD2 . LEU B  1 351 ? 19.026  -3.320  61.151  1.00 49.66  ? 351 LEU B CD2 1 
ATOM   5297  N  N   . ALA B  1 352 ? 20.869  -7.029  57.712  1.00 67.44  ? 352 ALA B N   1 
ATOM   5298  C  CA  . ALA B  1 352 ? 21.362  -8.365  57.412  1.00 88.45  ? 352 ALA B CA  1 
ATOM   5299  C  C   . ALA B  1 352 ? 22.389  -8.311  56.281  1.00 100.22 ? 352 ALA B C   1 
ATOM   5300  O  O   . ALA B  1 352 ? 23.544  -8.720  56.449  1.00 98.75  ? 352 ALA B O   1 
ATOM   5301  C  CB  . ALA B  1 352 ? 20.207  -9.302  57.065  1.00 92.68  ? 352 ALA B CB  1 
ATOM   5302  O  OXT . ALA B  1 352 ? 22.086  -7.837  55.182  1.00 106.19 ? 352 ALA B OXT 1 
ATOM   5303  N  N   . MET C  1 1   ? -27.680 -10.460 26.060  1.00 47.42  ? 1   MET C N   1 
ATOM   5304  C  CA  . MET C  1 1   ? -27.923 -9.154  25.450  1.00 45.23  ? 1   MET C CA  1 
ATOM   5305  C  C   . MET C  1 1   ? -27.477 -9.122  23.992  1.00 42.88  ? 1   MET C C   1 
ATOM   5306  O  O   . MET C  1 1   ? -26.590 -9.889  23.586  1.00 40.05  ? 1   MET C O   1 
ATOM   5307  C  CB  . MET C  1 1   ? -27.174 -8.064  26.225  1.00 43.39  ? 1   MET C CB  1 
ATOM   5308  C  CG  . MET C  1 1   ? -25.675 -8.163  26.072  1.00 43.05  ? 1   MET C CG  1 
ATOM   5309  S  SD  . MET C  1 1   ? -24.771 -6.769  26.777  1.00 41.16  ? 1   MET C SD  1 
ATOM   5310  C  CE  . MET C  1 1   ? -23.155 -7.054  26.057  1.00 32.84  ? 1   MET C CE  1 
ATOM   5311  N  N   . LYS C  1 2   ? -28.077 -8.210  23.228  1.00 33.57  ? 2   LYS C N   1 
ATOM   5312  C  CA  . LYS C  1 2   ? -27.702 -7.946  21.841  1.00 40.89  ? 2   LYS C CA  1 
ATOM   5313  C  C   . LYS C  1 2   ? -26.645 -6.847  21.725  1.00 44.78  ? 2   LYS C C   1 
ATOM   5314  O  O   . LYS C  1 2   ? -26.625 -5.893  22.509  1.00 43.41  ? 2   LYS C O   1 
ATOM   5315  C  CB  . LYS C  1 2   ? -28.932 -7.504  21.033  1.00 47.25  ? 2   LYS C CB  1 
ATOM   5316  C  CG  . LYS C  1 2   ? -29.992 -8.593  20.793  1.00 61.64  ? 2   LYS C CG  1 
ATOM   5317  C  CD  . LYS C  1 2   ? -29.616 -9.491  19.614  1.00 71.61  ? 2   LYS C CD  1 
ATOM   5318  C  CE  . LYS C  1 2   ? -30.670 -10.559 19.326  1.00 73.56  ? 2   LYS C CE  1 
ATOM   5319  N  NZ  . LYS C  1 2   ? -30.277 -11.382 18.144  1.00 71.80  ? 2   LYS C NZ  1 
ATOM   5320  N  N   . GLY C  1 3   ? -25.799 -6.966  20.709  1.00 41.62  ? 3   GLY C N   1 
ATOM   5321  C  CA  . GLY C  1 3   ? -24.869 -5.908  20.364  1.00 45.86  ? 3   GLY C CA  1 
ATOM   5322  C  C   . GLY C  1 3   ? -24.513 -5.955  18.890  1.00 44.65  ? 3   GLY C C   1 
ATOM   5323  O  O   . GLY C  1 3   ? -24.582 -7.016  18.262  1.00 43.84  ? 3   GLY C O   1 
ATOM   5324  N  N   . PHE C  1 4   ? -24.143 -4.800  18.340  1.00 34.10  ? 4   PHE C N   1 
ATOM   5325  C  CA  . PHE C  1 4   ? -23.748 -4.682  16.938  1.00 31.36  ? 4   PHE C CA  1 
ATOM   5326  C  C   . PHE C  1 4   ? -22.240 -4.854  16.845  1.00 37.23  ? 4   PHE C C   1 
ATOM   5327  O  O   . PHE C  1 4   ? -21.483 -4.030  17.349  1.00 34.11  ? 4   PHE C O   1 
ATOM   5328  C  CB  . PHE C  1 4   ? -24.193 -3.321  16.354  1.00 31.26  ? 4   PHE C CB  1 
ATOM   5329  C  CG  . PHE C  1 4   ? -24.009 -3.208  14.866  1.00 32.43  ? 4   PHE C CG  1 
ATOM   5330  C  CD1 . PHE C  1 4   ? -24.850 -3.908  13.991  1.00 40.84  ? 4   PHE C CD1 1 
ATOM   5331  C  CD2 . PHE C  1 4   ? -23.012 -2.404  14.336  1.00 33.71  ? 4   PHE C CD2 1 
ATOM   5332  C  CE1 . PHE C  1 4   ? -24.698 -3.812  12.600  1.00 35.26  ? 4   PHE C CE1 1 
ATOM   5333  C  CE2 . PHE C  1 4   ? -22.852 -2.288  12.958  1.00 36.64  ? 4   PHE C CE2 1 
ATOM   5334  C  CZ  . PHE C  1 4   ? -23.699 -3.007  12.081  1.00 36.23  ? 4   PHE C CZ  1 
ATOM   5335  N  N   . ALA C  1 5   ? -21.807 -5.931  16.195  1.00 47.33  ? 5   ALA C N   1 
ATOM   5336  C  CA  . ALA C  1 5   ? -20.422 -6.371  16.291  1.00 43.48  ? 5   ALA C CA  1 
ATOM   5337  C  C   . ALA C  1 5   ? -19.722 -6.481  14.952  1.00 40.90  ? 5   ALA C C   1 
ATOM   5338  O  O   . ALA C  1 5   ? -20.364 -6.610  13.908  1.00 43.30  ? 5   ALA C O   1 
ATOM   5339  C  CB  . ALA C  1 5   ? -20.354 -7.719  17.014  1.00 44.17  ? 5   ALA C CB  1 
ATOM   5340  N  N   . MET C  1 6   ? -18.394 -6.430  15.010  1.00 33.93  ? 6   MET C N   1 
ATOM   5341  C  CA  . MET C  1 6   ? -17.528 -6.831  13.911  1.00 38.95  ? 6   MET C CA  1 
ATOM   5342  C  C   . MET C  1 6   ? -17.419 -8.347  13.969  1.00 43.04  ? 6   MET C C   1 
ATOM   5343  O  O   . MET C  1 6   ? -16.895 -8.890  14.938  1.00 40.57  ? 6   MET C O   1 
ATOM   5344  C  CB  . MET C  1 6   ? -16.137 -6.233  14.114  1.00 45.88  ? 6   MET C CB  1 
ATOM   5345  C  CG  . MET C  1 6   ? -15.085 -6.691  13.113  1.00 41.53  ? 6   MET C CG  1 
ATOM   5346  S  SD  . MET C  1 6   ? -13.520 -5.836  13.389  1.00 47.02  ? 6   MET C SD  1 
ATOM   5347  C  CE  . MET C  1 6   ? -12.477 -6.614  12.151  1.00 46.49  ? 6   MET C CE  1 
ATOM   5348  N  N   . LEU C  1 7   ? -17.932 -9.036  12.959  1.00 50.64  ? 7   LEU C N   1 
ATOM   5349  C  CA  . LEU C  1 7   ? -17.887 -10.501 12.966  1.00 49.98  ? 7   LEU C CA  1 
ATOM   5350  C  C   . LEU C  1 7   ? -16.518 -10.954 12.480  1.00 51.18  ? 7   LEU C C   1 
ATOM   5351  O  O   . LEU C  1 7   ? -15.983 -11.959 12.930  1.00 60.27  ? 7   LEU C O   1 
ATOM   5352  C  CB  . LEU C  1 7   ? -18.988 -11.076 12.074  1.00 45.04  ? 7   LEU C CB  1 
ATOM   5353  C  CG  . LEU C  1 7   ? -20.341 -10.358 12.132  1.00 46.02  ? 7   LEU C CG  1 
ATOM   5354  C  CD1 . LEU C  1 7   ? -21.257 -10.833 11.001  1.00 47.31  ? 7   LEU C CD1 1 
ATOM   5355  C  CD2 . LEU C  1 7   ? -21.018 -10.539 13.482  1.00 43.30  ? 7   LEU C CD2 1 
ATOM   5356  N  N   . SER C  1 8   ? -15.953 -10.182 11.561  1.00 49.71  ? 8   SER C N   1 
ATOM   5357  C  CA  . SER C  1 8   ? -14.644 -10.461 10.998  1.00 48.25  ? 8   SER C CA  1 
ATOM   5358  C  C   . SER C  1 8   ? -14.349 -9.347  10.023  1.00 47.41  ? 8   SER C C   1 
ATOM   5359  O  O   . SER C  1 8   ? -15.246 -8.588  9.660   1.00 49.79  ? 8   SER C O   1 
ATOM   5360  C  CB  . SER C  1 8   ? -14.670 -11.774 10.240  1.00 50.98  ? 8   SER C CB  1 
ATOM   5361  O  OG  . SER C  1 8   ? -15.273 -11.581 8.978   1.00 53.14  ? 8   SER C OG  1 
ATOM   5362  N  N   . ILE C  1 9   ? -13.103 -9.237  9.588   1.00 42.24  ? 9   ILE C N   1 
ATOM   5363  C  CA  . ILE C  1 9   ? -12.780 -8.193  8.633   1.00 43.19  ? 9   ILE C CA  1 
ATOM   5364  C  C   . ILE C  1 9   ? -13.793 -8.194  7.485   1.00 49.00  ? 9   ILE C C   1 
ATOM   5365  O  O   . ILE C  1 9   ? -14.053 -9.230  6.879   1.00 55.20  ? 9   ILE C O   1 
ATOM   5366  C  CB  . ILE C  1 9   ? -11.342 -8.320  8.115   1.00 47.20  ? 9   ILE C CB  1 
ATOM   5367  C  CG1 . ILE C  1 9   ? -10.354 -7.925  9.217   1.00 51.51  ? 9   ILE C CG1 1 
ATOM   5368  C  CG2 . ILE C  1 9   ? -11.131 -7.424  6.909   1.00 46.56  ? 9   ILE C CG2 1 
ATOM   5369  C  CD1 . ILE C  1 9   ? -8.932  -8.324  8.939   1.00 54.58  ? 9   ILE C CD1 1 
ATOM   5370  N  N   . GLY C  1 10  ? -14.389 -7.032  7.229   1.00 46.46  ? 10  GLY C N   1 
ATOM   5371  C  CA  . GLY C  1 10  ? -15.350 -6.861  6.150   1.00 52.20  ? 10  GLY C CA  1 
ATOM   5372  C  C   . GLY C  1 10  ? -16.797 -7.203  6.475   1.00 51.65  ? 10  GLY C C   1 
ATOM   5373  O  O   . GLY C  1 10  ? -17.690 -7.021  5.642   1.00 52.63  ? 10  GLY C O   1 
ATOM   5374  N  N   . LYS C  1 11  ? -17.041 -7.697  7.682   1.00 48.86  ? 11  LYS C N   1 
ATOM   5375  C  CA  . LYS C  1 11  ? -18.370 -8.195  8.024   1.00 55.00  ? 11  LYS C CA  1 
ATOM   5376  C  C   . LYS C  1 11  ? -18.869 -7.660  9.357   1.00 53.22  ? 11  LYS C C   1 
ATOM   5377  O  O   . LYS C  1 11  ? -18.163 -7.735  10.365  1.00 58.25  ? 11  LYS C O   1 
ATOM   5378  C  CB  . LYS C  1 11  ? -18.359 -9.727  8.071   1.00 63.55  ? 11  LYS C CB  1 
ATOM   5379  C  CG  . LYS C  1 11  ? -17.923 -10.384 6.773   1.00 69.16  ? 11  LYS C CG  1 
ATOM   5380  C  CD  . LYS C  1 11  ? -18.231 -11.871 6.784   1.00 75.47  ? 11  LYS C CD  1 
ATOM   5381  C  CE  . LYS C  1 11  ? -18.196 -12.453 5.376   1.00 83.23  ? 11  LYS C CE  1 
ATOM   5382  N  NZ  . LYS C  1 11  ? -18.934 -13.754 5.280   1.00 86.24  ? 11  LYS C NZ  1 
ATOM   5383  N  N   . VAL C  1 12  ? -20.087 -7.126  9.366   1.00 45.79  ? 12  VAL C N   1 
ATOM   5384  C  CA  . VAL C  1 12  ? -20.709 -6.706  10.617  1.00 46.58  ? 12  VAL C CA  1 
ATOM   5385  C  C   . VAL C  1 12  ? -22.085 -7.320  10.752  1.00 49.88  ? 12  VAL C C   1 
ATOM   5386  O  O   . VAL C  1 12  ? -22.680 -7.749  9.771   1.00 54.16  ? 12  VAL C O   1 
ATOM   5387  C  CB  . VAL C  1 12  ? -20.830 -5.165  10.753  1.00 36.99  ? 12  VAL C CB  1 
ATOM   5388  C  CG1 . VAL C  1 12  ? -19.442 -4.497  10.750  1.00 31.43  ? 12  VAL C CG1 1 
ATOM   5389  C  CG2 . VAL C  1 12  ? -21.749 -4.583  9.666   1.00 34.28  ? 12  VAL C CG2 1 
ATOM   5390  N  N   . GLY C  1 13  ? -22.590 -7.359  11.977  1.00 48.57  ? 13  GLY C N   1 
ATOM   5391  C  CA  . GLY C  1 13  ? -23.930 -7.854  12.212  1.00 41.45  ? 13  GLY C CA  1 
ATOM   5392  C  C   . GLY C  1 13  ? -24.285 -7.841  13.682  1.00 43.67  ? 13  GLY C C   1 
ATOM   5393  O  O   . GLY C  1 13  ? -23.413 -7.699  14.555  1.00 39.76  ? 13  GLY C O   1 
ATOM   5394  N  N   . TRP C  1 14  ? -25.575 -7.982  13.957  1.00 40.19  ? 14  TRP C N   1 
ATOM   5395  C  CA  . TRP C  1 14  ? -26.045 -8.119  15.325  1.00 44.97  ? 14  TRP C CA  1 
ATOM   5396  C  C   . TRP C  1 14  ? -25.715 -9.514  15.835  1.00 51.28  ? 14  TRP C C   1 
ATOM   5397  O  O   . TRP C  1 14  ? -25.822 -10.488 15.087  1.00 54.53  ? 14  TRP C O   1 
ATOM   5398  C  CB  . TRP C  1 14  ? -27.549 -7.861  15.395  1.00 41.52  ? 14  TRP C CB  1 
ATOM   5399  C  CG  . TRP C  1 14  ? -27.897 -6.442  15.085  1.00 50.24  ? 14  TRP C CG  1 
ATOM   5400  C  CD1 . TRP C  1 14  ? -28.274 -5.929  13.870  1.00 48.07  ? 14  TRP C CD1 1 
ATOM   5401  C  CD2 . TRP C  1 14  ? -27.871 -5.338  15.996  1.00 45.91  ? 14  TRP C CD2 1 
ATOM   5402  N  NE1 . TRP C  1 14  ? -28.495 -4.578  13.979  1.00 52.08  ? 14  TRP C NE1 1 
ATOM   5403  C  CE2 . TRP C  1 14  ? -28.253 -4.190  15.272  1.00 47.96  ? 14  TRP C CE2 1 
ATOM   5404  C  CE3 . TRP C  1 14  ? -27.576 -5.213  17.353  1.00 44.17  ? 14  TRP C CE3 1 
ATOM   5405  C  CZ2 . TRP C  1 14  ? -28.356 -2.943  15.860  1.00 39.20  ? 14  TRP C CZ2 1 
ATOM   5406  C  CZ3 . TRP C  1 14  ? -27.671 -3.975  17.934  1.00 43.33  ? 14  TRP C CZ3 1 
ATOM   5407  C  CH2 . TRP C  1 14  ? -28.059 -2.855  17.190  1.00 44.71  ? 14  TRP C CH2 1 
ATOM   5408  N  N   . ILE C  1 15  ? -25.287 -9.597  17.094  1.00 50.85  ? 15  ILE C N   1 
ATOM   5409  C  CA  . ILE C  1 15  ? -25.002 -10.873 17.746  1.00 47.71  ? 15  ILE C CA  1 
ATOM   5410  C  C   . ILE C  1 15  ? -25.582 -10.862 19.151  1.00 51.51  ? 15  ILE C C   1 
ATOM   5411  O  O   . ILE C  1 15  ? -26.071 -9.833  19.622  1.00 49.73  ? 15  ILE C O   1 
ATOM   5412  C  CB  . ILE C  1 15  ? -23.488 -11.159 17.863  1.00 45.29  ? 15  ILE C CB  1 
ATOM   5413  C  CG1 . ILE C  1 15  ? -22.805 -10.073 18.707  1.00 43.85  ? 15  ILE C CG1 1 
ATOM   5414  C  CG2 . ILE C  1 15  ? -22.850 -11.289 16.486  1.00 46.97  ? 15  ILE C CG2 1 
ATOM   5415  C  CD1 . ILE C  1 15  ? -21.345 -10.375 19.065  1.00 40.29  ? 15  ILE C CD1 1 
ATOM   5416  N  N   . GLU C  1 16  ? -25.535 -12.023 19.800  1.00 50.05  ? 16  GLU C N   1 
ATOM   5417  C  CA  . GLU C  1 16  ? -25.935 -12.174 21.191  1.00 57.49  ? 16  GLU C CA  1 
ATOM   5418  C  C   . GLU C  1 16  ? -24.696 -12.496 22.018  1.00 58.67  ? 16  GLU C C   1 
ATOM   5419  O  O   . GLU C  1 16  ? -23.886 -13.340 21.630  1.00 61.93  ? 16  GLU C O   1 
ATOM   5420  C  CB  . GLU C  1 16  ? -26.961 -13.298 21.341  1.00 66.92  ? 16  GLU C CB  1 
ATOM   5421  C  CG  . GLU C  1 16  ? -28.414 -12.853 21.291  1.00 76.52  ? 16  GLU C CG  1 
ATOM   5422  C  CD  . GLU C  1 16  ? -28.986 -12.539 22.667  1.00 83.94  ? 16  GLU C CD  1 
ATOM   5423  O  OE1 . GLU C  1 16  ? -30.080 -11.935 22.741  1.00 93.04  ? 16  GLU C OE1 1 
ATOM   5424  O  OE2 . GLU C  1 16  ? -28.346 -12.903 23.676  1.00 81.61  ? 16  GLU C OE2 1 
ATOM   5425  N  N   . LYS C  1 17  ? -24.545 -11.799 23.140  1.00 54.72  ? 17  LYS C N   1 
ATOM   5426  C  CA  . LYS C  1 17  ? -23.457 -12.034 24.086  1.00 49.25  ? 17  LYS C CA  1 
ATOM   5427  C  C   . LYS C  1 17  ? -24.057 -12.071 25.480  1.00 50.85  ? 17  LYS C C   1 
ATOM   5428  O  O   . LYS C  1 17  ? -25.164 -11.573 25.687  1.00 54.17  ? 17  LYS C O   1 
ATOM   5429  C  CB  . LYS C  1 17  ? -22.430 -10.905 24.024  1.00 52.33  ? 17  LYS C CB  1 
ATOM   5430  C  CG  . LYS C  1 17  ? -21.294 -11.120 23.050  1.00 54.38  ? 17  LYS C CG  1 
ATOM   5431  C  CD  . LYS C  1 17  ? -20.026 -10.568 23.649  1.00 53.12  ? 17  LYS C CD  1 
ATOM   5432  C  CE  . LYS C  1 17  ? -18.798 -11.001 22.874  1.00 58.66  ? 17  LYS C CE  1 
ATOM   5433  N  NZ  . LYS C  1 17  ? -18.955 -10.754 21.432  1.00 55.45  ? 17  LYS C NZ  1 
ATOM   5434  N  N   . GLU C  1 18  ? -23.342 -12.643 26.444  1.00 46.44  ? 18  GLU C N   1 
ATOM   5435  C  CA  . GLU C  1 18  ? -23.827 -12.596 27.817  1.00 51.90  ? 18  GLU C CA  1 
ATOM   5436  C  C   . GLU C  1 18  ? -23.593 -11.200 28.382  1.00 47.89  ? 18  GLU C C   1 
ATOM   5437  O  O   . GLU C  1 18  ? -22.596 -10.556 28.065  1.00 44.47  ? 18  GLU C O   1 
ATOM   5438  C  CB  . GLU C  1 18  ? -23.155 -13.662 28.696  1.00 60.26  ? 18  GLU C CB  1 
ATOM   5439  C  CG  . GLU C  1 18  ? -21.700 -13.379 29.044  1.00 70.06  ? 18  GLU C CG  1 
ATOM   5440  C  CD  . GLU C  1 18  ? -21.175 -14.280 30.160  1.00 78.57  ? 18  GLU C CD  1 
ATOM   5441  O  OE1 . GLU C  1 18  ? -21.804 -15.329 30.428  1.00 78.94  ? 18  GLU C OE1 1 
ATOM   5442  O  OE2 . GLU C  1 18  ? -20.135 -13.936 30.768  1.00 79.74  ? 18  GLU C OE2 1 
ATOM   5443  N  N   . LYS C  1 19  ? -24.524 -10.732 29.200  1.00 47.30  ? 19  LYS C N   1 
ATOM   5444  C  CA  . LYS C  1 19  ? -24.383 -9.436  29.844  1.00 50.57  ? 19  LYS C CA  1 
ATOM   5445  C  C   . LYS C  1 19  ? -23.145 -9.457  30.729  1.00 48.40  ? 19  LYS C C   1 
ATOM   5446  O  O   . LYS C  1 19  ? -22.976 -10.360 31.534  1.00 40.15  ? 19  LYS C O   1 
ATOM   5447  C  CB  . LYS C  1 19  ? -25.629 -9.127  30.675  1.00 55.10  ? 19  LYS C CB  1 
ATOM   5448  C  CG  . LYS C  1 19  ? -25.524 -7.895  31.565  1.00 56.65  ? 19  LYS C CG  1 
ATOM   5449  C  CD  . LYS C  1 19  ? -26.897 -7.548  32.141  1.00 58.36  ? 19  LYS C CD  1 
ATOM   5450  C  CE  . LYS C  1 19  ? -26.796 -6.546  33.272  1.00 60.40  ? 19  LYS C CE  1 
ATOM   5451  N  NZ  . LYS C  1 19  ? -28.127 -6.145  33.796  1.00 60.71  ? 19  LYS C NZ  1 
ATOM   5452  N  N   . PRO C  1 20  ? -22.268 -8.456  30.578  1.00 50.56  ? 20  PRO C N   1 
ATOM   5453  C  CA  . PRO C  1 20  ? -21.031 -8.402  31.360  1.00 45.43  ? 20  PRO C CA  1 
ATOM   5454  C  C   . PRO C  1 20  ? -21.289 -8.101  32.836  1.00 41.74  ? 20  PRO C C   1 
ATOM   5455  O  O   . PRO C  1 20  ? -22.280 -7.462  33.195  1.00 39.31  ? 20  PRO C O   1 
ATOM   5456  C  CB  . PRO C  1 20  ? -20.262 -7.237  30.728  1.00 49.82  ? 20  PRO C CB  1 
ATOM   5457  C  CG  . PRO C  1 20  ? -21.033 -6.841  29.506  1.00 51.93  ? 20  PRO C CG  1 
ATOM   5458  C  CD  . PRO C  1 20  ? -22.431 -7.272  29.728  1.00 49.28  ? 20  PRO C CD  1 
ATOM   5459  N  N   . ALA C  1 21  ? -20.383 -8.567  33.683  1.00 45.06  ? 21  ALA C N   1 
ATOM   5460  C  CA  . ALA C  1 21  ? -20.449 -8.310  35.116  1.00 46.84  ? 21  ALA C CA  1 
ATOM   5461  C  C   . ALA C  1 21  ? -19.210 -7.535  35.541  1.00 39.63  ? 21  ALA C C   1 
ATOM   5462  O  O   . ALA C  1 21  ? -18.138 -7.722  34.963  1.00 37.77  ? 21  ALA C O   1 
ATOM   5463  C  CB  . ALA C  1 21  ? -20.554 -9.634  35.895  1.00 38.88  ? 21  ALA C CB  1 
ATOM   5464  N  N   . PRO C  1 22  ? -19.349 -6.680  36.567  1.00 38.27  ? 22  PRO C N   1 
ATOM   5465  C  CA  . PRO C  1 22  ? -18.294 -5.757  37.013  1.00 37.16  ? 22  PRO C CA  1 
ATOM   5466  C  C   . PRO C  1 22  ? -17.357 -6.415  38.007  1.00 45.08  ? 22  PRO C C   1 
ATOM   5467  O  O   . PRO C  1 22  ? -17.807 -7.212  38.827  1.00 45.94  ? 22  PRO C O   1 
ATOM   5468  C  CB  . PRO C  1 22  ? -19.065 -4.674  37.768  1.00 36.54  ? 22  PRO C CB  1 
ATOM   5469  C  CG  . PRO C  1 22  ? -20.466 -5.280  38.055  1.00 40.94  ? 22  PRO C CG  1 
ATOM   5470  C  CD  . PRO C  1 22  ? -20.515 -6.661  37.465  1.00 34.40  ? 22  PRO C CD  1 
ATOM   5471  N  N   . GLY C  1 23  ? -16.078 -6.061  37.948  1.00 41.99  ? 23  GLY C N   1 
ATOM   5472  C  CA  . GLY C  1 23  ? -15.161 -6.371  39.023  1.00 36.81  ? 23  GLY C CA  1 
ATOM   5473  C  C   . GLY C  1 23  ? -15.404 -5.392  40.157  1.00 39.90  ? 23  GLY C C   1 
ATOM   5474  O  O   . GLY C  1 23  ? -16.294 -4.552  40.058  1.00 42.30  ? 23  GLY C O   1 
ATOM   5475  N  N   . PRO C  1 24  ? -14.628 -5.500  41.245  1.00 42.33  ? 24  PRO C N   1 
ATOM   5476  C  CA  . PRO C  1 24  ? -14.816 -4.640  42.422  1.00 44.63  ? 24  PRO C CA  1 
ATOM   5477  C  C   . PRO C  1 24  ? -14.668 -3.154  42.117  1.00 42.66  ? 24  PRO C C   1 
ATOM   5478  O  O   . PRO C  1 24  ? -15.262 -2.320  42.810  1.00 40.77  ? 24  PRO C O   1 
ATOM   5479  C  CB  . PRO C  1 24  ? -13.694 -5.089  43.373  1.00 41.26  ? 24  PRO C CB  1 
ATOM   5480  C  CG  . PRO C  1 24  ? -13.406 -6.498  42.977  1.00 43.77  ? 24  PRO C CG  1 
ATOM   5481  C  CD  . PRO C  1 24  ? -13.633 -6.563  41.484  1.00 42.37  ? 24  PRO C CD  1 
ATOM   5482  N  N   . PHE C  1 25  ? -13.875 -2.832  41.100  1.00 36.32  ? 25  PHE C N   1 
ATOM   5483  C  CA  . PHE C  1 25  ? -13.642 -1.443  40.727  1.00 36.37  ? 25  PHE C CA  1 
ATOM   5484  C  C   . PHE C  1 25  ? -14.383 -1.010  39.456  1.00 42.40  ? 25  PHE C C   1 
ATOM   5485  O  O   . PHE C  1 25  ? -14.175 0.106   38.962  1.00 43.63  ? 25  PHE C O   1 
ATOM   5486  C  CB  . PHE C  1 25  ? -12.139 -1.206  40.551  1.00 33.98  ? 25  PHE C CB  1 
ATOM   5487  C  CG  . PHE C  1 25  ? -11.349 -1.467  41.788  1.00 38.28  ? 25  PHE C CG  1 
ATOM   5488  C  CD1 . PHE C  1 25  ? -11.271 -0.512  42.787  1.00 38.75  ? 25  PHE C CD1 1 
ATOM   5489  C  CD2 . PHE C  1 25  ? -10.700 -2.682  41.970  1.00 40.57  ? 25  PHE C CD2 1 
ATOM   5490  C  CE1 . PHE C  1 25  ? -10.539 -0.766  43.946  1.00 44.28  ? 25  PHE C CE1 1 
ATOM   5491  C  CE2 . PHE C  1 25  ? -9.966  -2.940  43.127  1.00 36.80  ? 25  PHE C CE2 1 
ATOM   5492  C  CZ  . PHE C  1 25  ? -9.891  -1.985  44.111  1.00 39.80  ? 25  PHE C CZ  1 
ATOM   5493  N  N   . ASP C  1 26  ? -15.244 -1.874  38.926  1.00 35.51  ? 26  ASP C N   1 
ATOM   5494  C  CA  . ASP C  1 26  ? -15.834 -1.607  37.615  1.00 37.29  ? 26  ASP C CA  1 
ATOM   5495  C  C   . ASP C  1 26  ? -17.291 -1.177  37.654  1.00 43.03  ? 26  ASP C C   1 
ATOM   5496  O  O   . ASP C  1 26  ? -17.937 -1.224  38.701  1.00 40.18  ? 26  ASP C O   1 
ATOM   5497  C  CB  . ASP C  1 26  ? -15.691 -2.827  36.706  1.00 36.07  ? 26  ASP C CB  1 
ATOM   5498  C  CG  . ASP C  1 26  ? -14.284 -3.379  36.700  1.00 36.81  ? 26  ASP C CG  1 
ATOM   5499  O  OD1 . ASP C  1 26  ? -13.336 -2.573  36.840  1.00 33.85  ? 26  ASP C OD1 1 
ATOM   5500  O  OD2 . ASP C  1 26  ? -14.126 -4.614  36.562  1.00 44.73  ? 26  ASP C OD2 1 
ATOM   5501  N  N   . ALA C  1 27  ? -17.791 -0.749  36.494  1.00 40.28  ? 27  ALA C N   1 
ATOM   5502  C  CA  . ALA C  1 27  ? -19.187 -0.376  36.340  1.00 34.15  ? 27  ALA C CA  1 
ATOM   5503  C  C   . ALA C  1 27  ? -19.797 -1.040  35.116  1.00 34.17  ? 27  ALA C C   1 
ATOM   5504  O  O   . ALA C  1 27  ? -19.147 -1.194  34.080  1.00 33.59  ? 27  ALA C O   1 
ATOM   5505  C  CB  . ALA C  1 27  ? -19.339 1.161   36.244  1.00 31.19  ? 27  ALA C CB  1 
ATOM   5506  N  N   . ILE C  1 28  ? -21.055 -1.441  35.248  1.00 34.44  ? 28  ILE C N   1 
ATOM   5507  C  CA  . ILE C  1 28  ? -21.857 -1.816  34.098  1.00 29.27  ? 28  ILE C CA  1 
ATOM   5508  C  C   . ILE C  1 28  ? -22.745 -0.614  33.758  1.00 33.80  ? 28  ILE C C   1 
ATOM   5509  O  O   . ILE C  1 28  ? -23.386 -0.022  34.629  1.00 37.25  ? 28  ILE C O   1 
ATOM   5510  C  CB  . ILE C  1 28  ? -22.698 -3.092  34.365  1.00 32.43  ? 28  ILE C CB  1 
ATOM   5511  C  CG1 . ILE C  1 28  ? -21.801 -4.212  34.898  1.00 32.96  ? 28  ILE C CG1 1 
ATOM   5512  C  CG2 . ILE C  1 28  ? -23.379 -3.573  33.090  1.00 33.97  ? 28  ILE C CG2 1 
ATOM   5513  C  CD1 . ILE C  1 28  ? -20.736 -4.606  33.920  1.00 31.89  ? 28  ILE C CD1 1 
ATOM   5514  N  N   . VAL C  1 29  ? -22.750 -0.240  32.488  1.00 28.21  ? 29  VAL C N   1 
ATOM   5515  C  CA  . VAL C  1 29  ? -23.421 0.971   32.064  1.00 31.41  ? 29  VAL C CA  1 
ATOM   5516  C  C   . VAL C  1 29  ? -24.398 0.666   30.930  1.00 37.61  ? 29  VAL C C   1 
ATOM   5517  O  O   . VAL C  1 29  ? -24.165 -0.231  30.119  1.00 41.20  ? 29  VAL C O   1 
ATOM   5518  C  CB  . VAL C  1 29  ? -22.404 2.062   31.607  1.00 36.76  ? 29  VAL C CB  1 
ATOM   5519  C  CG1 . VAL C  1 29  ? -23.137 3.285   31.009  1.00 35.80  ? 29  VAL C CG1 1 
ATOM   5520  C  CG2 . VAL C  1 29  ? -21.476 2.466   32.767  1.00 32.51  ? 29  VAL C CG2 1 
ATOM   5521  N  N   . ARG C  1 30  ? -25.491 1.421   30.895  1.00 37.10  ? 30  ARG C N   1 
ATOM   5522  C  CA  . ARG C  1 30  ? -26.486 1.321   29.835  1.00 40.29  ? 30  ARG C CA  1 
ATOM   5523  C  C   . ARG C  1 30  ? -26.326 2.544   28.934  1.00 40.33  ? 30  ARG C C   1 
ATOM   5524  O  O   . ARG C  1 30  ? -26.397 3.673   29.409  1.00 40.86  ? 30  ARG C O   1 
ATOM   5525  C  CB  . ARG C  1 30  ? -27.884 1.328   30.463  1.00 48.26  ? 30  ARG C CB  1 
ATOM   5526  C  CG  . ARG C  1 30  ? -28.994 0.727   29.627  1.00 59.22  ? 30  ARG C CG  1 
ATOM   5527  C  CD  . ARG C  1 30  ? -30.359 0.960   30.284  1.00 69.47  ? 30  ARG C CD  1 
ATOM   5528  N  NE  . ARG C  1 30  ? -31.260 -0.181  30.107  1.00 80.22  ? 30  ARG C NE  1 
ATOM   5529  C  CZ  . ARG C  1 30  ? -31.691 -0.966  31.097  1.00 89.72  ? 30  ARG C CZ  1 
ATOM   5530  N  NH1 . ARG C  1 30  ? -31.316 -0.735  32.350  1.00 94.70  ? 30  ARG C NH1 1 
ATOM   5531  N  NH2 . ARG C  1 30  ? -32.505 -1.982  30.839  1.00 90.68  ? 30  ARG C NH2 1 
ATOM   5532  N  N   . PRO C  1 31  ? -26.120 2.333   27.630  1.00 39.65  ? 31  PRO C N   1 
ATOM   5533  C  CA  . PRO C  1 31  ? -25.953 3.509   26.764  1.00 38.03  ? 31  PRO C CA  1 
ATOM   5534  C  C   . PRO C  1 31  ? -27.269 4.273   26.602  1.00 42.48  ? 31  PRO C C   1 
ATOM   5535  O  O   . PRO C  1 31  ? -28.298 3.653   26.334  1.00 40.70  ? 31  PRO C O   1 
ATOM   5536  C  CB  . PRO C  1 31  ? -25.553 2.912   25.408  1.00 33.43  ? 31  PRO C CB  1 
ATOM   5537  C  CG  . PRO C  1 31  ? -25.933 1.446   25.465  1.00 37.55  ? 31  PRO C CG  1 
ATOM   5538  C  CD  . PRO C  1 31  ? -26.297 1.077   26.876  1.00 37.11  ? 31  PRO C CD  1 
ATOM   5539  N  N   . LEU C  1 32  ? -27.227 5.596   26.750  1.00 39.54  ? 32  LEU C N   1 
ATOM   5540  C  CA  . LEU C  1 32  ? -28.398 6.436   26.534  1.00 37.31  ? 32  LEU C CA  1 
ATOM   5541  C  C   . LEU C  1 32  ? -28.321 7.113   25.159  1.00 41.86  ? 32  LEU C C   1 
ATOM   5542  O  O   . LEU C  1 32  ? -29.350 7.373   24.514  1.00 37.53  ? 32  LEU C O   1 
ATOM   5543  C  CB  . LEU C  1 32  ? -28.515 7.490   27.641  1.00 31.41  ? 32  LEU C CB  1 
ATOM   5544  C  CG  . LEU C  1 32  ? -28.787 6.976   29.054  1.00 36.01  ? 32  LEU C CG  1 
ATOM   5545  C  CD1 . LEU C  1 32  ? -28.623 8.107   30.055  1.00 40.06  ? 32  LEU C CD1 1 
ATOM   5546  C  CD2 . LEU C  1 32  ? -30.175 6.365   29.167  1.00 35.00  ? 32  LEU C CD2 1 
ATOM   5547  N  N   . ALA C  1 33  ? -27.097 7.416   24.731  1.00 34.21  ? 33  ALA C N   1 
ATOM   5548  C  CA  . ALA C  1 33  ? -26.843 7.949   23.393  1.00 35.00  ? 33  ALA C CA  1 
ATOM   5549  C  C   . ALA C  1 33  ? -25.459 7.501   22.967  1.00 35.11  ? 33  ALA C C   1 
ATOM   5550  O  O   . ALA C  1 33  ? -24.547 7.463   23.785  1.00 35.78  ? 33  ALA C O   1 
ATOM   5551  C  CB  . ALA C  1 33  ? -26.927 9.487   23.379  1.00 33.45  ? 33  ALA C CB  1 
ATOM   5552  N  N   . VAL C  1 34  ? -25.304 7.153   21.694  1.00 36.29  ? 34  VAL C N   1 
ATOM   5553  C  CA  . VAL C  1 34  ? -24.018 6.690   21.193  1.00 33.94  ? 34  VAL C CA  1 
ATOM   5554  C  C   . VAL C  1 34  ? -23.789 7.251   19.804  1.00 34.30  ? 34  VAL C C   1 
ATOM   5555  O  O   . VAL C  1 34  ? -24.706 7.768   19.189  1.00 31.12  ? 34  VAL C O   1 
ATOM   5556  C  CB  . VAL C  1 34  ? -23.962 5.154   21.100  1.00 33.43  ? 34  VAL C CB  1 
ATOM   5557  C  CG1 . VAL C  1 34  ? -24.174 4.517   22.478  1.00 32.09  ? 34  VAL C CG1 1 
ATOM   5558  C  CG2 . VAL C  1 34  ? -24.984 4.660   20.090  1.00 25.65  ? 34  VAL C CG2 1 
ATOM   5559  N  N   . ALA C  1 35  ? -22.563 7.130   19.311  1.00 30.98  ? 35  ALA C N   1 
ATOM   5560  C  CA  . ALA C  1 35  ? -22.213 7.595   17.976  1.00 30.42  ? 35  ALA C CA  1 
ATOM   5561  C  C   . ALA C  1 35  ? -21.141 6.672   17.422  1.00 34.27  ? 35  ALA C C   1 
ATOM   5562  O  O   . ALA C  1 35  ? -20.365 6.095   18.190  1.00 33.50  ? 35  ALA C O   1 
ATOM   5563  C  CB  . ALA C  1 35  ? -21.697 9.023   18.031  1.00 29.64  ? 35  ALA C CB  1 
ATOM   5564  N  N   . PRO C  1 36  ? -21.085 6.537   16.089  1.00 37.28  ? 36  PRO C N   1 
ATOM   5565  C  CA  . PRO C  1 36  ? -20.112 5.698   15.385  1.00 32.93  ? 36  PRO C CA  1 
ATOM   5566  C  C   . PRO C  1 36  ? -18.917 6.531   14.972  1.00 33.84  ? 36  PRO C C   1 
ATOM   5567  O  O   . PRO C  1 36  ? -19.062 7.722   14.678  1.00 33.58  ? 36  PRO C O   1 
ATOM   5568  C  CB  . PRO C  1 36  ? -20.858 5.307   14.107  1.00 33.15  ? 36  PRO C CB  1 
ATOM   5569  C  CG  . PRO C  1 36  ? -22.057 6.275   14.012  1.00 33.33  ? 36  PRO C CG  1 
ATOM   5570  C  CD  . PRO C  1 36  ? -21.963 7.239   15.143  1.00 39.89  ? 36  PRO C CD  1 
ATOM   5571  N  N   . CYS C  1 37  ? -17.756 5.905   14.899  1.00 29.55  ? 37  CYS C N   1 
ATOM   5572  C  CA  . CYS C  1 37  ? -16.536 6.638   14.612  1.00 33.67  ? 37  CYS C CA  1 
ATOM   5573  C  C   . CYS C  1 37  ? -15.956 6.186   13.285  1.00 29.36  ? 37  CYS C C   1 
ATOM   5574  O  O   . CYS C  1 37  ? -16.090 5.038   12.916  1.00 31.00  ? 37  CYS C O   1 
ATOM   5575  C  CB  . CYS C  1 37  ? -15.500 6.439   15.740  1.00 28.05  ? 37  CYS C CB  1 
ATOM   5576  S  SG  . CYS C  1 37  ? -13.948 7.320   15.405  1.00 37.02  ? 37  CYS C SG  1 
ATOM   5577  N  N   . THR C  1 38  ? -15.315 7.089   12.554  1.00 35.52  ? 38  THR C N   1 
ATOM   5578  C  CA  . THR C  1 38  ? -14.610 6.672   11.345  1.00 32.63  ? 38  THR C CA  1 
ATOM   5579  C  C   . THR C  1 38  ? -13.566 5.569   11.648  1.00 37.53  ? 38  THR C C   1 
ATOM   5580  O  O   . THR C  1 38  ? -13.202 4.792   10.766  1.00 39.89  ? 38  THR C O   1 
ATOM   5581  C  CB  . THR C  1 38  ? -13.921 7.865   10.657  1.00 33.89  ? 38  THR C CB  1 
ATOM   5582  O  OG1 . THR C  1 38  ? -12.910 8.409   11.522  1.00 45.57  ? 38  THR C OG1 1 
ATOM   5583  C  CG2 . THR C  1 38  ? -14.938 8.963   10.336  1.00 33.59  ? 38  THR C CG2 1 
ATOM   5584  N  N   . SER C  1 39  ? -13.082 5.496   12.888  1.00 38.10  ? 39  SER C N   1 
ATOM   5585  C  CA  . SER C  1 39  ? -12.032 4.523   13.206  1.00 40.17  ? 39  SER C CA  1 
ATOM   5586  C  C   . SER C  1 39  ? -12.528 3.088   13.019  1.00 40.88  ? 39  SER C C   1 
ATOM   5587  O  O   . SER C  1 39  ? -11.796 2.228   12.536  1.00 34.19  ? 39  SER C O   1 
ATOM   5588  C  CB  . SER C  1 39  ? -11.484 4.727   14.622  1.00 40.16  ? 39  SER C CB  1 
ATOM   5589  O  OG  . SER C  1 39  ? -12.485 4.544   15.614  1.00 44.01  ? 39  SER C OG  1 
ATOM   5590  N  N   . ASP C  1 40  ? -13.781 2.845   13.395  1.00 38.34  ? 40  ASP C N   1 
ATOM   5591  C  CA  . ASP C  1 40  ? -14.368 1.514   13.292  1.00 43.57  ? 40  ASP C CA  1 
ATOM   5592  C  C   . ASP C  1 40  ? -14.522 1.072   11.835  1.00 44.21  ? 40  ASP C C   1 
ATOM   5593  O  O   . ASP C  1 40  ? -14.459 -0.117  11.544  1.00 44.90  ? 40  ASP C O   1 
ATOM   5594  C  CB  . ASP C  1 40  ? -15.715 1.435   14.030  1.00 36.52  ? 40  ASP C CB  1 
ATOM   5595  C  CG  . ASP C  1 40  ? -15.553 1.223   15.529  1.00 33.52  ? 40  ASP C CG  1 
ATOM   5596  O  OD1 . ASP C  1 40  ? -14.410 1.197   16.018  1.00 37.57  ? 40  ASP C OD1 1 
ATOM   5597  O  OD2 . ASP C  1 40  ? -16.574 1.094   16.227  1.00 34.91  ? 40  ASP C OD2 1 
ATOM   5598  N  N   . ILE C  1 41  ? -14.735 2.020   10.926  1.00 41.16  ? 41  ILE C N   1 
ATOM   5599  C  CA  . ILE C  1 41  ? -14.763 1.678   9.504   1.00 45.20  ? 41  ILE C CA  1 
ATOM   5600  C  C   . ILE C  1 41  ? -13.384 1.164   9.074   1.00 41.69  ? 41  ILE C C   1 
ATOM   5601  O  O   . ILE C  1 41  ? -13.267 0.137   8.403   1.00 41.22  ? 41  ILE C O   1 
ATOM   5602  C  CB  . ILE C  1 41  ? -15.181 2.865   8.604   1.00 44.81  ? 41  ILE C CB  1 
ATOM   5603  C  CG1 . ILE C  1 41  ? -16.568 3.393   8.997   1.00 38.44  ? 41  ILE C CG1 1 
ATOM   5604  C  CG2 . ILE C  1 41  ? -15.188 2.430   7.140   1.00 41.68  ? 41  ILE C CG2 1 
ATOM   5605  C  CD1 . ILE C  1 41  ? -17.648 2.302   9.044   1.00 29.86  ? 41  ILE C CD1 1 
ATOM   5606  N  N   . HIS C  1 42  ? -12.343 1.887   9.475   1.00 37.94  ? 42  HIS C N   1 
ATOM   5607  C  CA  . HIS C  1 42  ? -10.973 1.450   9.242   1.00 42.27  ? 42  HIS C CA  1 
ATOM   5608  C  C   . HIS C  1 42  ? -10.713 0.046   9.796   1.00 42.82  ? 42  HIS C C   1 
ATOM   5609  O  O   . HIS C  1 42  ? -10.191 -0.805  9.086   1.00 45.12  ? 42  HIS C O   1 
ATOM   5610  C  CB  . HIS C  1 42  ? -9.965  2.456   9.817   1.00 40.64  ? 42  HIS C CB  1 
ATOM   5611  C  CG  . HIS C  1 42  ? -9.978  3.782   9.116   1.00 49.00  ? 42  HIS C CG  1 
ATOM   5612  N  ND1 . HIS C  1 42  ? -9.673  4.967   9.751   1.00 50.59  ? 42  HIS C ND1 1 
ATOM   5613  C  CD2 . HIS C  1 42  ? -10.286 4.109   7.838   1.00 53.43  ? 42  HIS C CD2 1 
ATOM   5614  C  CE1 . HIS C  1 42  ? -9.775  5.966   8.891   1.00 51.02  ? 42  HIS C CE1 1 
ATOM   5615  N  NE2 . HIS C  1 42  ? -10.150 5.473   7.723   1.00 54.93  ? 42  HIS C NE2 1 
ATOM   5616  N  N   . THR C  1 43  ? -11.082 -0.206  11.050  1.00 43.91  ? 43  THR C N   1 
ATOM   5617  C  CA  . THR C  1 43  ? -10.772 -1.507  11.638  1.00 43.69  ? 43  THR C CA  1 
ATOM   5618  C  C   . THR C  1 43  ? -11.619 -2.629  11.035  1.00 47.16  ? 43  THR C C   1 
ATOM   5619  O  O   . THR C  1 43  ? -11.130 -3.734  10.855  1.00 51.90  ? 43  THR C O   1 
ATOM   5620  C  CB  . THR C  1 43  ? -10.836 -1.537  13.195  1.00 41.57  ? 43  THR C CB  1 
ATOM   5621  O  OG1 . THR C  1 43  ? -12.003 -2.229  13.632  1.00 56.46  ? 43  THR C OG1 1 
ATOM   5622  C  CG2 . THR C  1 43  ? -10.798 -0.166  13.793  1.00 40.46  ? 43  THR C CG2 1 
ATOM   5623  N  N   . VAL C  1 44  ? -12.882 -2.354  10.712  1.00 42.67  ? 44  VAL C N   1 
ATOM   5624  C  CA  . VAL C  1 44  ? -13.728 -3.384  10.113  1.00 43.75  ? 44  VAL C CA  1 
ATOM   5625  C  C   . VAL C  1 44  ? -13.423 -3.608  8.632   1.00 51.18  ? 44  VAL C C   1 
ATOM   5626  O  O   . VAL C  1 44  ? -13.236 -4.741  8.199   1.00 55.95  ? 44  VAL C O   1 
ATOM   5627  C  CB  . VAL C  1 44  ? -15.242 -3.077  10.236  1.00 41.79  ? 44  VAL C CB  1 
ATOM   5628  C  CG1 . VAL C  1 44  ? -16.050 -4.073  9.388   1.00 43.25  ? 44  VAL C CG1 1 
ATOM   5629  C  CG2 . VAL C  1 44  ? -15.695 -3.142  11.685  1.00 41.80  ? 44  VAL C CG2 1 
ATOM   5630  N  N   . PHE C  1 45  ? -13.381 -2.532  7.854   1.00 48.56  ? 45  PHE C N   1 
ATOM   5631  C  CA  . PHE C  1 45  ? -13.272 -2.673  6.405   1.00 45.24  ? 45  PHE C CA  1 
ATOM   5632  C  C   . PHE C  1 45  ? -11.860 -2.563  5.845   1.00 54.61  ? 45  PHE C C   1 
ATOM   5633  O  O   . PHE C  1 45  ? -11.623 -2.936  4.701   1.00 62.28  ? 45  PHE C O   1 
ATOM   5634  C  CB  . PHE C  1 45  ? -14.214 -1.700  5.696   1.00 38.31  ? 45  PHE C CB  1 
ATOM   5635  C  CG  . PHE C  1 45  ? -15.648 -1.931  6.028   1.00 42.82  ? 45  PHE C CG  1 
ATOM   5636  C  CD1 . PHE C  1 45  ? -16.373 -2.919  5.371   1.00 42.97  ? 45  PHE C CD1 1 
ATOM   5637  C  CD2 . PHE C  1 45  ? -16.274 -1.177  7.008   1.00 40.08  ? 45  PHE C CD2 1 
ATOM   5638  C  CE1 . PHE C  1 45  ? -17.699 -3.147  5.674   1.00 46.01  ? 45  PHE C CE1 1 
ATOM   5639  C  CE2 . PHE C  1 45  ? -17.600 -1.399  7.323   1.00 45.27  ? 45  PHE C CE2 1 
ATOM   5640  C  CZ  . PHE C  1 45  ? -18.316 -2.391  6.653   1.00 50.05  ? 45  PHE C CZ  1 
ATOM   5641  N  N   . GLU C  1 46  ? -10.921 -2.069  6.642   1.00 51.99  ? 46  GLU C N   1 
ATOM   5642  C  CA  . GLU C  1 46  ? -9.547  -1.981  6.172   1.00 50.38  ? 46  GLU C CA  1 
ATOM   5643  C  C   . GLU C  1 46  ? -8.593  -2.908  6.931   1.00 50.56  ? 46  GLU C C   1 
ATOM   5644  O  O   . GLU C  1 46  ? -7.437  -3.056  6.545   1.00 51.42  ? 46  GLU C O   1 
ATOM   5645  C  CB  . GLU C  1 46  ? -9.062  -0.527  6.186   1.00 51.46  ? 46  GLU C CB  1 
ATOM   5646  C  CG  . GLU C  1 46  ? -9.768  0.349   5.155   1.00 61.44  ? 46  GLU C CG  1 
ATOM   5647  C  CD  . GLU C  1 46  ? -9.527  1.837   5.372   1.00 69.45  ? 46  GLU C CD  1 
ATOM   5648  O  OE1 . GLU C  1 46  ? -8.383  2.220   5.690   1.00 70.92  ? 46  GLU C OE1 1 
ATOM   5649  O  OE2 . GLU C  1 46  ? -10.485 2.628   5.219   1.00 71.93  ? 46  GLU C OE2 1 
ATOM   5650  N  N   . GLY C  1 47  ? -9.090  -3.551  7.987   1.00 51.05  ? 47  GLY C N   1 
ATOM   5651  C  CA  . GLY C  1 47  ? -8.270  -4.414  8.824   1.00 48.29  ? 47  GLY C CA  1 
ATOM   5652  C  C   . GLY C  1 47  ? -7.133  -3.655  9.494   1.00 49.52  ? 47  GLY C C   1 
ATOM   5653  O  O   . GLY C  1 47  ? -6.071  -4.222  9.777   1.00 49.95  ? 47  GLY C O   1 
ATOM   5654  N  N   . ALA C  1 48  ? -7.373  -2.374  9.769   1.00 40.96  ? 48  ALA C N   1 
ATOM   5655  C  CA  . ALA C  1 48  ? -6.312  -1.431  10.118  1.00 48.98  ? 48  ALA C CA  1 
ATOM   5656  C  C   . ALA C  1 48  ? -5.522  -1.782  11.378  1.00 45.14  ? 48  ALA C C   1 
ATOM   5657  O  O   . ALA C  1 48  ? -4.386  -1.329  11.551  1.00 40.97  ? 48  ALA C O   1 
ATOM   5658  C  CB  . ALA C  1 48  ? -6.884  -0.019  10.232  1.00 54.03  ? 48  ALA C CB  1 
ATOM   5659  N  N   . ILE C  1 49  ? -6.134  -2.563  12.260  1.00 44.93  ? 49  ILE C N   1 
ATOM   5660  C  CA  . ILE C  1 49  ? -5.493  -2.953  13.510  1.00 51.12  ? 49  ILE C CA  1 
ATOM   5661  C  C   . ILE C  1 49  ? -5.701  -4.436  13.790  1.00 52.50  ? 49  ILE C C   1 
ATOM   5662  O  O   . ILE C  1 49  ? -5.843  -4.854  14.939  1.00 55.59  ? 49  ILE C O   1 
ATOM   5663  C  CB  . ILE C  1 49  ? -5.991  -2.120  14.716  1.00 52.09  ? 49  ILE C CB  1 
ATOM   5664  C  CG1 . ILE C  1 49  ? -7.513  -2.194  14.834  1.00 47.65  ? 49  ILE C CG1 1 
ATOM   5665  C  CG2 . ILE C  1 49  ? -5.513  -0.677  14.607  1.00 56.25  ? 49  ILE C CG2 1 
ATOM   5666  C  CD1 . ILE C  1 49  ? -8.059  -1.661  16.134  1.00 46.85  ? 49  ILE C CD1 1 
ATOM   5667  N  N   . GLY C  1 50  ? -5.721  -5.227  12.729  1.00 49.01  ? 50  GLY C N   1 
ATOM   5668  C  CA  . GLY C  1 50  ? -5.719  -6.668  12.877  1.00 44.86  ? 50  GLY C CA  1 
ATOM   5669  C  C   . GLY C  1 50  ? -7.102  -7.267  12.815  1.00 44.94  ? 50  GLY C C   1 
ATOM   5670  O  O   . GLY C  1 50  ? -8.102  -6.560  12.770  1.00 43.03  ? 50  GLY C O   1 
ATOM   5671  N  N   . GLU C  1 51  ? -7.157  -8.591  12.817  1.00 49.10  ? 51  GLU C N   1 
ATOM   5672  C  CA  . GLU C  1 51  ? -8.420  -9.296  12.718  1.00 50.04  ? 51  GLU C CA  1 
ATOM   5673  C  C   . GLU C  1 51  ? -9.150  -9.278  14.061  1.00 49.72  ? 51  GLU C C   1 
ATOM   5674  O  O   . GLU C  1 51  ? -8.537  -9.077  15.123  1.00 47.09  ? 51  GLU C O   1 
ATOM   5675  C  CB  . GLU C  1 51  ? -8.181  -10.736 12.241  1.00 58.42  ? 51  GLU C CB  1 
ATOM   5676  C  CG  . GLU C  1 51  ? -9.377  -11.660 12.374  1.00 66.34  ? 51  GLU C CG  1 
ATOM   5677  C  CD  . GLU C  1 51  ? -10.444 -11.414 11.325  1.00 77.40  ? 51  GLU C CD  1 
ATOM   5678  O  OE1 . GLU C  1 51  ? -10.720 -10.242 11.009  1.00 79.79  ? 51  GLU C OE1 1 
ATOM   5679  O  OE2 . GLU C  1 51  ? -11.019 -12.401 10.819  1.00 88.66  ? 51  GLU C OE2 1 
ATOM   5680  N  N   . ARG C  1 52  ? -10.463 -9.478  14.002  1.00 45.04  ? 52  ARG C N   1 
ATOM   5681  C  CA  . ARG C  1 52  ? -11.289 -9.555  15.195  1.00 42.65  ? 52  ARG C CA  1 
ATOM   5682  C  C   . ARG C  1 52  ? -12.436 -10.523 14.973  1.00 45.16  ? 52  ARG C C   1 
ATOM   5683  O  O   . ARG C  1 52  ? -12.835 -10.772 13.836  1.00 53.97  ? 52  ARG C O   1 
ATOM   5684  C  CB  . ARG C  1 52  ? -11.853 -8.183  15.539  1.00 38.63  ? 52  ARG C CB  1 
ATOM   5685  C  CG  . ARG C  1 52  ? -10.810 -7.155  15.877  1.00 38.71  ? 52  ARG C CG  1 
ATOM   5686  C  CD  . ARG C  1 52  ? -10.158 -7.476  17.203  1.00 38.63  ? 52  ARG C CD  1 
ATOM   5687  N  NE  . ARG C  1 52  ? -9.314  -6.374  17.645  1.00 43.27  ? 52  ARG C NE  1 
ATOM   5688  C  CZ  . ARG C  1 52  ? -8.113  -6.098  17.141  1.00 47.70  ? 52  ARG C CZ  1 
ATOM   5689  N  NH1 . ARG C  1 52  ? -7.606  -6.849  16.167  1.00 52.30  ? 52  ARG C NH1 1 
ATOM   5690  N  NH2 . ARG C  1 52  ? -7.424  -5.062  17.607  1.00 40.48  ? 52  ARG C NH2 1 
ATOM   5691  N  N   . HIS C  1 53  ? -12.976 -11.060 16.060  1.00 48.95  ? 53  HIS C N   1 
ATOM   5692  C  CA  . HIS C  1 53  ? -14.123 -11.952 15.960  1.00 59.99  ? 53  HIS C CA  1 
ATOM   5693  C  C   . HIS C  1 53  ? -15.204 -11.585 16.964  1.00 50.95  ? 53  HIS C C   1 
ATOM   5694  O  O   . HIS C  1 53  ? -14.964 -11.561 18.174  1.00 48.60  ? 53  HIS C O   1 
ATOM   5695  C  CB  . HIS C  1 53  ? -13.703 -13.418 16.126  1.00 72.85  ? 53  HIS C CB  1 
ATOM   5696  C  CG  . HIS C  1 53  ? -12.968 -13.969 14.943  1.00 86.66  ? 53  HIS C CG  1 
ATOM   5697  N  ND1 . HIS C  1 53  ? -13.574 -14.177 13.722  1.00 91.35  ? 53  HIS C ND1 1 
ATOM   5698  C  CD2 . HIS C  1 53  ? -11.676 -14.349 14.792  1.00 90.66  ? 53  HIS C CD2 1 
ATOM   5699  C  CE1 . HIS C  1 53  ? -12.688 -14.662 12.870  1.00 94.02  ? 53  HIS C CE1 1 
ATOM   5700  N  NE2 . HIS C  1 53  ? -11.529 -14.776 13.494  1.00 93.49  ? 53  HIS C NE2 1 
ATOM   5701  N  N   . ASN C  1 54  ? -16.390 -11.287 16.442  1.00 43.41  ? 54  ASN C N   1 
ATOM   5702  C  CA  . ASN C  1 54  ? -17.538 -10.940 17.271  1.00 42.92  ? 54  ASN C CA  1 
ATOM   5703  C  C   . ASN C  1 54  ? -17.226 -9.878  18.323  1.00 43.60  ? 54  ASN C C   1 
ATOM   5704  O  O   . ASN C  1 54  ? -17.632 -9.994  19.477  1.00 40.45  ? 54  ASN C O   1 
ATOM   5705  C  CB  . ASN C  1 54  ? -18.093 -12.196 17.936  1.00 48.20  ? 54  ASN C CB  1 
ATOM   5706  C  CG  . ASN C  1 54  ? -18.739 -13.143 16.934  1.00 51.12  ? 54  ASN C CG  1 
ATOM   5707  O  OD1 . ASN C  1 54  ? -19.322 -12.711 15.944  1.00 50.06  ? 54  ASN C OD1 1 
ATOM   5708  N  ND2 . ASN C  1 54  ? -18.634 -14.436 17.191  1.00 51.98  ? 54  ASN C ND2 1 
ATOM   5709  N  N   . MET C  1 55  ? -16.491 -8.847  17.930  1.00 38.01  ? 55  MET C N   1 
ATOM   5710  C  CA  . MET C  1 55  ? -16.207 -7.755  18.851  1.00 39.27  ? 55  MET C CA  1 
ATOM   5711  C  C   . MET C  1 55  ? -17.281 -6.672  18.712  1.00 40.98  ? 55  MET C C   1 
ATOM   5712  O  O   . MET C  1 55  ? -17.455 -6.088  17.636  1.00 38.41  ? 55  MET C O   1 
ATOM   5713  C  CB  . MET C  1 55  ? -14.831 -7.174  18.560  1.00 35.30  ? 55  MET C CB  1 
ATOM   5714  C  CG  . MET C  1 55  ? -14.374 -6.123  19.549  1.00 35.52  ? 55  MET C CG  1 
ATOM   5715  S  SD  . MET C  1 55  ? -12.960 -5.232  18.896  1.00 45.52  ? 55  MET C SD  1 
ATOM   5716  C  CE  . MET C  1 55  ? -13.648 -4.642  17.349  1.00 38.60  ? 55  MET C CE  1 
ATOM   5717  N  N   . ILE C  1 56  ? -18.027 -6.425  19.782  1.00 38.54  ? 56  ILE C N   1 
ATOM   5718  C  CA  . ILE C  1 56  ? -19.038 -5.376  19.723  1.00 43.83  ? 56  ILE C CA  1 
ATOM   5719  C  C   . ILE C  1 56  ? -18.392 -4.028  19.436  1.00 36.79  ? 56  ILE C C   1 
ATOM   5720  O  O   . ILE C  1 56  ? -17.367 -3.678  20.019  1.00 31.96  ? 56  ILE C O   1 
ATOM   5721  C  CB  . ILE C  1 56  ? -19.867 -5.285  21.004  1.00 44.07  ? 56  ILE C CB  1 
ATOM   5722  C  CG1 . ILE C  1 56  ? -20.793 -6.504  21.099  1.00 41.58  ? 56  ILE C CG1 1 
ATOM   5723  C  CG2 . ILE C  1 56  ? -20.668 -3.970  21.011  1.00 40.95  ? 56  ILE C CG2 1 
ATOM   5724  C  CD1 . ILE C  1 56  ? -21.479 -6.645  22.428  1.00 44.24  ? 56  ILE C CD1 1 
ATOM   5725  N  N   . LEU C  1 57  ? -18.984 -3.272  18.527  1.00 37.28  ? 57  LEU C N   1 
ATOM   5726  C  CA  . LEU C  1 57  ? -18.340 -2.051  18.063  1.00 40.82  ? 57  LEU C CA  1 
ATOM   5727  C  C   . LEU C  1 57  ? -18.665 -0.799  18.902  1.00 35.19  ? 57  LEU C C   1 
ATOM   5728  O  O   . LEU C  1 57  ? -19.415 -0.862  19.882  1.00 34.51  ? 57  LEU C O   1 
ATOM   5729  C  CB  . LEU C  1 57  ? -18.669 -1.834  16.591  1.00 41.61  ? 57  LEU C CB  1 
ATOM   5730  C  CG  . LEU C  1 57  ? -17.991 -2.862  15.692  1.00 40.47  ? 57  LEU C CG  1 
ATOM   5731  C  CD1 . LEU C  1 57  ? -18.743 -3.009  14.367  1.00 38.16  ? 57  LEU C CD1 1 
ATOM   5732  C  CD2 . LEU C  1 57  ? -16.557 -2.443  15.454  1.00 35.38  ? 57  LEU C CD2 1 
ATOM   5733  N  N   . GLY C  1 58  ? -18.078 0.328   18.513  1.00 31.26  ? 58  GLY C N   1 
ATOM   5734  C  CA  . GLY C  1 58  ? -18.436 1.622   19.076  1.00 34.62  ? 58  GLY C CA  1 
ATOM   5735  C  C   . GLY C  1 58  ? -17.719 1.973   20.364  1.00 36.51  ? 58  GLY C C   1 
ATOM   5736  O  O   . GLY C  1 58  ? -17.535 1.109   21.231  1.00 39.38  ? 58  GLY C O   1 
ATOM   5737  N  N   . HIS C  1 59  ? -17.314 3.238   20.495  1.00 34.44  ? 59  HIS C N   1 
ATOM   5738  C  CA  . HIS C  1 59  ? -16.631 3.701   21.707  1.00 30.98  ? 59  HIS C CA  1 
ATOM   5739  C  C   . HIS C  1 59  ? -16.986 5.136   22.114  1.00 37.16  ? 59  HIS C C   1 
ATOM   5740  O  O   . HIS C  1 59  ? -16.247 5.778   22.858  1.00 33.16  ? 59  HIS C O   1 
ATOM   5741  C  CB  . HIS C  1 59  ? -15.110 3.562   21.568  1.00 30.57  ? 59  HIS C CB  1 
ATOM   5742  C  CG  . HIS C  1 59  ? -14.576 4.066   20.265  1.00 35.31  ? 59  HIS C CG  1 
ATOM   5743  N  ND1 . HIS C  1 59  ? -14.228 3.228   19.228  1.00 39.62  ? 59  HIS C ND1 1 
ATOM   5744  C  CD2 . HIS C  1 59  ? -14.349 5.325   19.821  1.00 38.41  ? 59  HIS C CD2 1 
ATOM   5745  C  CE1 . HIS C  1 59  ? -13.788 3.946   18.210  1.00 33.56  ? 59  HIS C CE1 1 
ATOM   5746  N  NE2 . HIS C  1 59  ? -13.858 5.221   18.542  1.00 33.08  ? 59  HIS C NE2 1 
ATOM   5747  N  N   . GLU C  1 60  ? -18.119 5.633   21.638  1.00 36.70  ? 60  GLU C N   1 
ATOM   5748  C  CA  . GLU C  1 60  ? -18.600 6.958   22.028  1.00 35.83  ? 60  GLU C CA  1 
ATOM   5749  C  C   . GLU C  1 60  ? -19.999 6.831   22.611  1.00 37.44  ? 60  GLU C C   1 
ATOM   5750  O  O   . GLU C  1 60  ? -20.953 6.484   21.908  1.00 32.24  ? 60  GLU C O   1 
ATOM   5751  C  CB  . GLU C  1 60  ? -18.637 7.891   20.821  1.00 32.30  ? 60  GLU C CB  1 
ATOM   5752  C  CG  . GLU C  1 60  ? -17.269 8.187   20.217  1.00 28.21  ? 60  GLU C CG  1 
ATOM   5753  C  CD  . GLU C  1 60  ? -17.367 8.658   18.783  1.00 35.34  ? 60  GLU C CD  1 
ATOM   5754  O  OE1 . GLU C  1 60  ? -17.389 9.885   18.572  1.00 33.52  ? 60  GLU C OE1 1 
ATOM   5755  O  OE2 . GLU C  1 60  ? -17.458 7.800   17.871  1.00 41.92  ? 60  GLU C OE2 1 
ATOM   5756  N  N   . ALA C  1 61  ? -20.128 7.103   23.899  1.00 34.10  ? 61  ALA C N   1 
ATOM   5757  C  CA  . ALA C  1 61  ? -21.395 6.868   24.560  1.00 26.77  ? 61  ALA C CA  1 
ATOM   5758  C  C   . ALA C  1 61  ? -21.590 7.788   25.751  1.00 31.81  ? 61  ALA C C   1 
ATOM   5759  O  O   . ALA C  1 61  ? -20.636 8.129   26.453  1.00 32.20  ? 61  ALA C O   1 
ATOM   5760  C  CB  . ALA C  1 61  ? -21.470 5.409   25.027  1.00 23.97  ? 61  ALA C CB  1 
ATOM   5761  N  N   . VAL C  1 62  ? -22.840 8.173   25.967  1.00 32.71  ? 62  VAL C N   1 
ATOM   5762  C  CA  . VAL C  1 62  ? -23.284 8.712   27.241  1.00 34.26  ? 62  VAL C CA  1 
ATOM   5763  C  C   . VAL C  1 62  ? -24.220 7.656   27.809  1.00 41.29  ? 62  VAL C C   1 
ATOM   5764  O  O   . VAL C  1 62  ? -25.015 7.061   27.078  1.00 37.40  ? 62  VAL C O   1 
ATOM   5765  C  CB  . VAL C  1 62  ? -24.099 9.986   27.061  1.00 42.09  ? 62  VAL C CB  1 
ATOM   5766  C  CG1 . VAL C  1 62  ? -24.728 10.378  28.377  1.00 41.94  ? 62  VAL C CG1 1 
ATOM   5767  C  CG2 . VAL C  1 62  ? -23.229 11.108  26.508  1.00 42.95  ? 62  VAL C CG2 1 
ATOM   5768  N  N   . GLY C  1 63  ? -24.143 7.412   29.108  1.00 40.19  ? 63  GLY C N   1 
ATOM   5769  C  CA  . GLY C  1 63  ? -24.893 6.306   29.649  1.00 39.36  ? 63  GLY C CA  1 
ATOM   5770  C  C   . GLY C  1 63  ? -25.438 6.466   31.047  1.00 40.35  ? 63  GLY C C   1 
ATOM   5771  O  O   . GLY C  1 63  ? -25.244 7.491   31.718  1.00 35.87  ? 63  GLY C O   1 
ATOM   5772  N  N   . GLU C  1 64  ? -26.133 5.419   31.477  1.00 33.60  ? 64  GLU C N   1 
ATOM   5773  C  CA  . GLU C  1 64  ? -26.699 5.362   32.801  1.00 37.55  ? 64  GLU C CA  1 
ATOM   5774  C  C   . GLU C  1 64  ? -25.982 4.243   33.547  1.00 39.48  ? 64  GLU C C   1 
ATOM   5775  O  O   . GLU C  1 64  ? -25.902 3.106   33.064  1.00 45.10  ? 64  GLU C O   1 
ATOM   5776  C  CB  . GLU C  1 64  ? -28.193 5.072   32.712  1.00 37.55  ? 64  GLU C CB  1 
ATOM   5777  C  CG  . GLU C  1 64  ? -28.832 4.787   34.048  1.00 46.99  ? 64  GLU C CG  1 
ATOM   5778  C  CD  . GLU C  1 64  ? -30.254 4.267   33.917  1.00 58.74  ? 64  GLU C CD  1 
ATOM   5779  O  OE1 . GLU C  1 64  ? -31.039 4.469   34.866  1.00 64.06  ? 64  GLU C OE1 1 
ATOM   5780  O  OE2 . GLU C  1 64  ? -30.588 3.663   32.873  1.00 64.15  ? 64  GLU C OE2 1 
ATOM   5781  N  N   . VAL C  1 65  ? -25.428 4.565   34.707  1.00 41.04  ? 65  VAL C N   1 
ATOM   5782  C  CA  . VAL C  1 65  ? -24.775 3.541   35.507  1.00 38.63  ? 65  VAL C CA  1 
ATOM   5783  C  C   . VAL C  1 65  ? -25.835 2.544   35.964  1.00 37.63  ? 65  VAL C C   1 
ATOM   5784  O  O   . VAL C  1 65  ? -26.897 2.924   36.471  1.00 39.65  ? 65  VAL C O   1 
ATOM   5785  C  CB  . VAL C  1 65  ? -23.996 4.133   36.694  1.00 38.11  ? 65  VAL C CB  1 
ATOM   5786  C  CG1 . VAL C  1 65  ? -23.379 2.999   37.552  1.00 33.98  ? 65  VAL C CG1 1 
ATOM   5787  C  CG2 . VAL C  1 65  ? -22.906 5.069   36.172  1.00 35.37  ? 65  VAL C CG2 1 
ATOM   5788  N  N   . VAL C  1 66  ? -25.550 1.269   35.741  1.00 33.86  ? 66  VAL C N   1 
ATOM   5789  C  CA  . VAL C  1 66  ? -26.518 0.206   35.991  1.00 40.62  ? 66  VAL C CA  1 
ATOM   5790  C  C   . VAL C  1 66  ? -26.097 -0.677  37.168  1.00 47.38  ? 66  VAL C C   1 
ATOM   5791  O  O   . VAL C  1 66  ? -26.937 -1.208  37.901  1.00 45.41  ? 66  VAL C O   1 
ATOM   5792  C  CB  . VAL C  1 66  ? -26.731 -0.618  34.711  1.00 39.52  ? 66  VAL C CB  1 
ATOM   5793  C  CG1 . VAL C  1 66  ? -26.896 -2.061  35.023  1.00 41.80  ? 66  VAL C CG1 1 
ATOM   5794  C  CG2 . VAL C  1 66  ? -27.921 -0.065  33.931  1.00 48.30  ? 66  VAL C CG2 1 
ATOM   5795  N  N   . GLU C  1 67  ? -24.789 -0.839  37.342  1.00 45.11  ? 67  GLU C N   1 
ATOM   5796  C  CA  . GLU C  1 67  ? -24.275 -1.437  38.569  1.00 49.14  ? 67  GLU C CA  1 
ATOM   5797  C  C   . GLU C  1 67  ? -22.783 -1.180  38.772  1.00 43.07  ? 67  GLU C C   1 
ATOM   5798  O  O   . GLU C  1 67  ? -22.045 -0.900  37.824  1.00 41.04  ? 67  GLU C O   1 
ATOM   5799  C  CB  . GLU C  1 67  ? -24.611 -2.932  38.648  1.00 59.90  ? 67  GLU C CB  1 
ATOM   5800  C  CG  . GLU C  1 67  ? -23.671 -3.859  37.914  1.00 65.74  ? 67  GLU C CG  1 
ATOM   5801  C  CD  . GLU C  1 67  ? -24.261 -5.254  37.743  1.00 67.07  ? 67  GLU C CD  1 
ATOM   5802  O  OE1 . GLU C  1 67  ? -23.758 -6.202  38.393  1.00 55.88  ? 67  GLU C OE1 1 
ATOM   5803  O  OE2 . GLU C  1 67  ? -25.245 -5.387  36.971  1.00 71.48  ? 67  GLU C OE2 1 
ATOM   5804  N  N   . VAL C  1 68  ? -22.348 -1.261  40.020  1.00 40.45  ? 68  VAL C N   1 
ATOM   5805  C  CA  . VAL C  1 68  ? -20.958 -0.991  40.341  1.00 43.82  ? 68  VAL C CA  1 
ATOM   5806  C  C   . VAL C  1 68  ? -20.393 -2.056  41.273  1.00 49.83  ? 68  VAL C C   1 
ATOM   5807  O  O   . VAL C  1 68  ? -21.137 -2.723  41.993  1.00 49.59  ? 68  VAL C O   1 
ATOM   5808  C  CB  . VAL C  1 68  ? -20.800 0.413   40.955  1.00 44.94  ? 68  VAL C CB  1 
ATOM   5809  C  CG1 . VAL C  1 68  ? -21.279 1.460   39.953  1.00 42.40  ? 68  VAL C CG1 1 
ATOM   5810  C  CG2 . VAL C  1 68  ? -21.596 0.528   42.242  1.00 41.21  ? 68  VAL C CG2 1 
ATOM   5811  N  N   . GLY C  1 69  ? -19.076 -2.224  41.231  1.00 46.02  ? 69  GLY C N   1 
ATOM   5812  C  CA  . GLY C  1 69  ? -18.385 -3.130  42.127  1.00 42.62  ? 69  GLY C CA  1 
ATOM   5813  C  C   . GLY C  1 69  ? -18.357 -2.600  43.545  1.00 38.66  ? 69  GLY C C   1 
ATOM   5814  O  O   . GLY C  1 69  ? -18.712 -1.445  43.796  1.00 36.46  ? 69  GLY C O   1 
ATOM   5815  N  N   . SER C  1 70  ? -17.949 -3.452  44.478  1.00 41.01  ? 70  SER C N   1 
ATOM   5816  C  CA  . SER C  1 70  ? -17.957 -3.104  45.896  1.00 42.85  ? 70  SER C CA  1 
ATOM   5817  C  C   . SER C  1 70  ? -16.904 -2.052  46.253  1.00 43.41  ? 70  SER C C   1 
ATOM   5818  O  O   . SER C  1 70  ? -16.973 -1.429  47.315  1.00 46.12  ? 70  SER C O   1 
ATOM   5819  C  CB  . SER C  1 70  ? -17.783 -4.361  46.761  1.00 43.13  ? 70  SER C CB  1 
ATOM   5820  O  OG  . SER C  1 70  ? -16.626 -5.096  46.389  1.00 45.58  ? 70  SER C OG  1 
ATOM   5821  N  N   . GLU C  1 71  ? -15.938 -1.836  45.367  1.00 39.43  ? 71  GLU C N   1 
ATOM   5822  C  CA  . GLU C  1 71  ? -14.907 -0.837  45.638  1.00 40.28  ? 71  GLU C CA  1 
ATOM   5823  C  C   . GLU C  1 71  ? -15.161 0.508   44.958  1.00 46.46  ? 71  GLU C C   1 
ATOM   5824  O  O   . GLU C  1 71  ? -14.464 1.488   45.222  1.00 48.03  ? 71  GLU C O   1 
ATOM   5825  C  CB  . GLU C  1 71  ? -13.525 -1.372  45.265  1.00 40.94  ? 71  GLU C CB  1 
ATOM   5826  C  CG  . GLU C  1 71  ? -13.045 -2.498  46.179  1.00 47.57  ? 71  GLU C CG  1 
ATOM   5827  C  CD  . GLU C  1 71  ? -12.885 -2.041  47.616  1.00 54.76  ? 71  GLU C CD  1 
ATOM   5828  O  OE1 . GLU C  1 71  ? -12.057 -1.137  47.863  1.00 57.31  ? 71  GLU C OE1 1 
ATOM   5829  O  OE2 . GLU C  1 71  ? -13.591 -2.573  48.496  1.00 57.67  ? 71  GLU C OE2 1 
ATOM   5830  N  N   . VAL C  1 72  ? -16.156 0.564   44.083  1.00 46.22  ? 72  VAL C N   1 
ATOM   5831  C  CA  . VAL C  1 72  ? -16.479 1.822   43.413  1.00 36.92  ? 72  VAL C CA  1 
ATOM   5832  C  C   . VAL C  1 72  ? -17.047 2.819   44.420  1.00 40.01  ? 72  VAL C C   1 
ATOM   5833  O  O   . VAL C  1 72  ? -17.971 2.499   45.167  1.00 47.06  ? 72  VAL C O   1 
ATOM   5834  C  CB  . VAL C  1 72  ? -17.473 1.593   42.271  1.00 35.23  ? 72  VAL C CB  1 
ATOM   5835  C  CG1 . VAL C  1 72  ? -18.023 2.928   41.744  1.00 32.08  ? 72  VAL C CG1 1 
ATOM   5836  C  CG2 . VAL C  1 72  ? -16.807 0.792   41.152  1.00 36.70  ? 72  VAL C CG2 1 
ATOM   5837  N  N   . LYS C  1 73  ? -16.512 4.035   44.436  1.00 39.75  ? 73  LYS C N   1 
ATOM   5838  C  CA  . LYS C  1 73  ? -16.897 5.006   45.468  1.00 41.82  ? 73  LYS C CA  1 
ATOM   5839  C  C   . LYS C  1 73  ? -17.695 6.221   44.993  1.00 43.31  ? 73  LYS C C   1 
ATOM   5840  O  O   . LYS C  1 73  ? -18.459 6.793   45.774  1.00 43.87  ? 73  LYS C O   1 
ATOM   5841  C  CB  . LYS C  1 73  ? -15.662 5.479   46.243  1.00 48.77  ? 73  LYS C CB  1 
ATOM   5842  C  CG  . LYS C  1 73  ? -14.935 4.360   46.982  1.00 48.97  ? 73  LYS C CG  1 
ATOM   5843  C  CD  . LYS C  1 73  ? -15.931 3.493   47.755  1.00 61.12  ? 73  LYS C CD  1 
ATOM   5844  C  CE  . LYS C  1 73  ? -15.234 2.402   48.572  1.00 71.68  ? 73  LYS C CE  1 
ATOM   5845  N  NZ  . LYS C  1 73  ? -16.222 1.504   49.254  1.00 77.46  ? 73  LYS C NZ  1 
ATOM   5846  N  N   . ASP C  1 74  ? -17.526 6.609   43.728  1.00 34.57  ? 74  ASP C N   1 
ATOM   5847  C  CA  . ASP C  1 74  ? -18.028 7.902   43.249  1.00 41.29  ? 74  ASP C CA  1 
ATOM   5848  C  C   . ASP C  1 74  ? -19.196 7.775   42.286  1.00 45.58  ? 74  ASP C C   1 
ATOM   5849  O  O   . ASP C  1 74  ? -19.728 8.779   41.808  1.00 42.95  ? 74  ASP C O   1 
ATOM   5850  C  CB  . ASP C  1 74  ? -16.913 8.694   42.555  1.00 43.18  ? 74  ASP C CB  1 
ATOM   5851  C  CG  . ASP C  1 74  ? -15.903 9.261   43.530  1.00 47.77  ? 74  ASP C CG  1 
ATOM   5852  O  OD1 . ASP C  1 74  ? -16.238 9.383   44.728  1.00 54.75  ? 74  ASP C OD1 1 
ATOM   5853  O  OD2 . ASP C  1 74  ? -14.777 9.584   43.092  1.00 44.45  ? 74  ASP C OD2 1 
ATOM   5854  N  N   . PHE C  1 75  ? -19.583 6.541   41.982  1.00 41.92  ? 75  PHE C N   1 
ATOM   5855  C  CA  . PHE C  1 75  ? -20.669 6.321   41.058  1.00 40.10  ? 75  PHE C CA  1 
ATOM   5856  C  C   . PHE C  1 75  ? -21.638 5.265   41.590  1.00 49.74  ? 75  PHE C C   1 
ATOM   5857  O  O   . PHE C  1 75  ? -21.239 4.365   42.338  1.00 43.34  ? 75  PHE C O   1 
ATOM   5858  C  CB  . PHE C  1 75  ? -20.122 5.977   39.669  1.00 40.36  ? 75  PHE C CB  1 
ATOM   5859  C  CG  . PHE C  1 75  ? -19.322 7.092   39.050  1.00 40.90  ? 75  PHE C CG  1 
ATOM   5860  C  CD1 . PHE C  1 75  ? -19.945 8.073   38.284  1.00 37.04  ? 75  PHE C CD1 1 
ATOM   5861  C  CD2 . PHE C  1 75  ? -17.947 7.179   39.263  1.00 40.98  ? 75  PHE C CD2 1 
ATOM   5862  C  CE1 . PHE C  1 75  ? -19.211 9.113   37.728  1.00 36.19  ? 75  PHE C CE1 1 
ATOM   5863  C  CE2 . PHE C  1 75  ? -17.202 8.215   38.710  1.00 32.86  ? 75  PHE C CE2 1 
ATOM   5864  C  CZ  . PHE C  1 75  ? -17.838 9.183   37.941  1.00 35.66  ? 75  PHE C CZ  1 
ATOM   5865  N  N   . LYS C  1 76  ? -22.911 5.405   41.209  1.00 46.46  ? 76  LYS C N   1 
ATOM   5866  C  CA  . LYS C  1 76  ? -23.981 4.526   41.676  1.00 44.43  ? 76  LYS C CA  1 
ATOM   5867  C  C   . LYS C  1 76  ? -25.044 4.348   40.590  1.00 44.52  ? 76  LYS C C   1 
ATOM   5868  O  O   . LYS C  1 76  ? -25.177 5.197   39.701  1.00 47.68  ? 76  LYS C O   1 
ATOM   5869  C  CB  . LYS C  1 76  ? -24.621 5.098   42.946  1.00 46.90  ? 76  LYS C CB  1 
ATOM   5870  C  CG  . LYS C  1 76  ? -25.380 6.386   42.711  1.00 55.18  ? 76  LYS C CG  1 
ATOM   5871  C  CD  . LYS C  1 76  ? -26.132 6.840   43.951  1.00 60.83  ? 76  LYS C CD  1 
ATOM   5872  C  CE  . LYS C  1 76  ? -27.032 8.027   43.629  1.00 61.29  ? 76  LYS C CE  1 
ATOM   5873  N  NZ  . LYS C  1 76  ? -26.276 9.148   43.000  1.00 60.38  ? 76  LYS C NZ  1 
ATOM   5874  N  N   . PRO C  1 77  ? -25.799 3.236   40.652  1.00 44.22  ? 77  PRO C N   1 
ATOM   5875  C  CA  . PRO C  1 77  ? -26.862 2.965   39.677  1.00 42.80  ? 77  PRO C CA  1 
ATOM   5876  C  C   . PRO C  1 77  ? -27.772 4.169   39.528  1.00 43.35  ? 77  PRO C C   1 
ATOM   5877  O  O   . PRO C  1 77  ? -28.182 4.744   40.532  1.00 40.46  ? 77  PRO C O   1 
ATOM   5878  C  CB  . PRO C  1 77  ? -27.627 1.801   40.311  1.00 40.52  ? 77  PRO C CB  1 
ATOM   5879  C  CG  . PRO C  1 77  ? -26.575 1.068   41.086  1.00 44.88  ? 77  PRO C CG  1 
ATOM   5880  C  CD  . PRO C  1 77  ? -25.647 2.133   41.621  1.00 45.26  ? 77  PRO C CD  1 
ATOM   5881  N  N   . GLY C  1 78  ? -28.066 4.541   38.287  1.00 40.77  ? 78  GLY C N   1 
ATOM   5882  C  CA  . GLY C  1 78  ? -28.891 5.698   38.009  1.00 43.49  ? 78  GLY C CA  1 
ATOM   5883  C  C   . GLY C  1 78  ? -28.079 6.916   37.608  1.00 43.41  ? 78  GLY C C   1 
ATOM   5884  O  O   . GLY C  1 78  ? -28.599 7.817   36.952  1.00 43.68  ? 78  GLY C O   1 
ATOM   5885  N  N   . ASP C  1 79  ? -26.807 6.956   37.992  1.00 31.50  ? 79  ASP C N   1 
ATOM   5886  C  CA  . ASP C  1 79  ? -25.978 8.098   37.637  1.00 35.03  ? 79  ASP C CA  1 
ATOM   5887  C  C   . ASP C  1 79  ? -25.799 8.191   36.127  1.00 41.70  ? 79  ASP C C   1 
ATOM   5888  O  O   . ASP C  1 79  ? -25.436 7.211   35.478  1.00 43.52  ? 79  ASP C O   1 
ATOM   5889  C  CB  . ASP C  1 79  ? -24.614 8.042   38.334  1.00 35.55  ? 79  ASP C CB  1 
ATOM   5890  C  CG  . ASP C  1 79  ? -24.708 8.269   39.843  1.00 38.97  ? 79  ASP C CG  1 
ATOM   5891  O  OD1 . ASP C  1 79  ? -25.792 8.666   40.338  1.00 36.65  ? 79  ASP C OD1 1 
ATOM   5892  O  OD2 . ASP C  1 79  ? -23.686 8.052   40.532  1.00 41.22  ? 79  ASP C OD2 1 
ATOM   5893  N  N   . ARG C  1 80  ? -26.073 9.371   35.574  1.00 32.56  ? 80  ARG C N   1 
ATOM   5894  C  CA  . ARG C  1 80  ? -25.770 9.650   34.182  1.00 32.68  ? 80  ARG C CA  1 
ATOM   5895  C  C   . ARG C  1 80  ? -24.322 10.109  34.040  1.00 38.48  ? 80  ARG C C   1 
ATOM   5896  O  O   . ARG C  1 80  ? -23.872 11.033  34.728  1.00 39.38  ? 80  ARG C O   1 
ATOM   5897  C  CB  . ARG C  1 80  ? -26.713 10.719  33.623  1.00 39.31  ? 80  ARG C CB  1 
ATOM   5898  C  CG  . ARG C  1 80  ? -28.125 10.211  33.341  1.00 48.56  ? 80  ARG C CG  1 
ATOM   5899  C  CD  . ARG C  1 80  ? -28.952 11.234  32.560  1.00 52.73  ? 80  ARG C CD  1 
ATOM   5900  N  NE  . ARG C  1 80  ? -30.183 10.623  32.058  1.00 61.81  ? 80  ARG C NE  1 
ATOM   5901  C  CZ  . ARG C  1 80  ? -30.953 11.132  31.096  1.00 63.79  ? 80  ARG C CZ  1 
ATOM   5902  N  NH1 . ARG C  1 80  ? -30.636 12.281  30.510  1.00 58.71  ? 80  ARG C NH1 1 
ATOM   5903  N  NH2 . ARG C  1 80  ? -32.045 10.482  30.715  1.00 67.21  ? 80  ARG C NH2 1 
ATOM   5904  N  N   . VAL C  1 81  ? -23.602 9.464   33.131  1.00 33.72  ? 81  VAL C N   1 
ATOM   5905  C  CA  . VAL C  1 81  ? -22.178 9.694   32.982  1.00 32.54  ? 81  VAL C CA  1 
ATOM   5906  C  C   . VAL C  1 81  ? -21.743 9.817   31.531  1.00 38.86  ? 81  VAL C C   1 
ATOM   5907  O  O   . VAL C  1 81  ? -22.390 9.292   30.601  1.00 36.86  ? 81  VAL C O   1 
ATOM   5908  C  CB  . VAL C  1 81  ? -21.380 8.529   33.601  1.00 36.29  ? 81  VAL C CB  1 
ATOM   5909  C  CG1 . VAL C  1 81  ? -21.583 8.501   35.100  1.00 29.73  ? 81  VAL C CG1 1 
ATOM   5910  C  CG2 . VAL C  1 81  ? -21.819 7.218   32.973  1.00 34.38  ? 81  VAL C CG2 1 
ATOM   5911  N  N   . VAL C  1 82  ? -20.634 10.519  31.352  1.00 38.20  ? 82  VAL C N   1 
ATOM   5912  C  CA  . VAL C  1 82  ? -19.974 10.605  30.070  1.00 39.56  ? 82  VAL C CA  1 
ATOM   5913  C  C   . VAL C  1 82  ? -18.869 9.562   30.130  1.00 33.46  ? 82  VAL C C   1 
ATOM   5914  O  O   . VAL C  1 82  ? -18.114 9.526   31.081  1.00 32.50  ? 82  VAL C O   1 
ATOM   5915  C  CB  . VAL C  1 82  ? -19.373 12.011  29.849  1.00 36.73  ? 82  VAL C CB  1 
ATOM   5916  C  CG1 . VAL C  1 82  ? -18.535 12.052  28.582  1.00 28.17  ? 82  VAL C CG1 1 
ATOM   5917  C  CG2 . VAL C  1 82  ? -20.479 13.058  29.792  1.00 34.37  ? 82  VAL C CG2 1 
ATOM   5918  N  N   . VAL C  1 83  ? -18.798 8.707   29.117  1.00 37.05  ? 83  VAL C N   1 
ATOM   5919  C  CA  . VAL C  1 83  ? -17.809 7.648   29.074  1.00 32.86  ? 83  VAL C CA  1 
ATOM   5920  C  C   . VAL C  1 83  ? -16.721 7.976   28.050  1.00 36.34  ? 83  VAL C C   1 
ATOM   5921  O  O   . VAL C  1 83  ? -17.006 8.092   26.866  1.00 33.55  ? 83  VAL C O   1 
ATOM   5922  C  CB  . VAL C  1 83  ? -18.478 6.290   28.741  1.00 32.92  ? 83  VAL C CB  1 
ATOM   5923  C  CG1 . VAL C  1 83  ? -17.460 5.161   28.752  1.00 28.99  ? 83  VAL C CG1 1 
ATOM   5924  C  CG2 . VAL C  1 83  ? -19.602 6.007   29.736  1.00 30.22  ? 83  VAL C CG2 1 
ATOM   5925  N  N   . PRO C  1 84  ? -15.466 8.119   28.511  1.00 30.97  ? 84  PRO C N   1 
ATOM   5926  C  CA  . PRO C  1 84  ? -14.373 8.415   27.579  1.00 30.95  ? 84  PRO C CA  1 
ATOM   5927  C  C   . PRO C  1 84  ? -14.207 7.232   26.656  1.00 32.54  ? 84  PRO C C   1 
ATOM   5928  O  O   . PRO C  1 84  ? -14.396 6.102   27.089  1.00 31.85  ? 84  PRO C O   1 
ATOM   5929  C  CB  . PRO C  1 84  ? -13.120 8.491   28.471  1.00 28.62  ? 84  PRO C CB  1 
ATOM   5930  C  CG  . PRO C  1 84  ? -13.541 8.080   29.846  1.00 31.47  ? 84  PRO C CG  1 
ATOM   5931  C  CD  . PRO C  1 84  ? -14.994 7.680   29.832  1.00 28.73  ? 84  PRO C CD  1 
ATOM   5932  N  N   . ALA C  1 85  ? -13.855 7.486   25.407  1.00 32.12  ? 85  ALA C N   1 
ATOM   5933  C  CA  . ALA C  1 85  ? -13.498 6.415   24.493  1.00 29.53  ? 85  ALA C CA  1 
ATOM   5934  C  C   . ALA C  1 85  ? -12.259 5.691   25.015  1.00 34.15  ? 85  ALA C C   1 
ATOM   5935  O  O   . ALA C  1 85  ? -12.091 4.482   24.813  1.00 28.61  ? 85  ALA C O   1 
ATOM   5936  C  CB  . ALA C  1 85  ? -13.228 6.995   23.128  1.00 28.45  ? 85  ALA C CB  1 
ATOM   5937  N  N   . ILE C  1 86  ? -11.379 6.445   25.676  1.00 31.13  ? 86  ILE C N   1 
ATOM   5938  C  CA  . ILE C  1 86  ? -10.160 5.873   26.228  1.00 26.17  ? 86  ILE C CA  1 
ATOM   5939  C  C   . ILE C  1 86  ? -10.352 5.592   27.718  1.00 29.94  ? 86  ILE C C   1 
ATOM   5940  O  O   . ILE C  1 86  ? -10.601 6.511   28.502  1.00 29.69  ? 86  ILE C O   1 
ATOM   5941  C  CB  . ILE C  1 86  ? -8.933  6.776   25.929  1.00 33.70  ? 86  ILE C CB  1 
ATOM   5942  C  CG1 . ILE C  1 86  ? -8.323  6.407   24.576  1.00 32.53  ? 86  ILE C CG1 1 
ATOM   5943  C  CG2 . ILE C  1 86  ? -7.860  6.651   27.008  1.00 32.46  ? 86  ILE C CG2 1 
ATOM   5944  C  CD1 . ILE C  1 86  ? -9.324  6.166   23.489  1.00 32.70  ? 86  ILE C CD1 1 
ATOM   5945  N  N   . THR C  1 87  ? -10.268 4.313   28.098  1.00 30.26  ? 87  THR C N   1 
ATOM   5946  C  CA  . THR C  1 87  ? -10.464 3.912   29.490  1.00 32.33  ? 87  THR C CA  1 
ATOM   5947  C  C   . THR C  1 87  ? -9.298  3.042   29.964  1.00 38.31  ? 87  THR C C   1 
ATOM   5948  O  O   . THR C  1 87  ? -9.370  1.809   29.937  1.00 31.37  ? 87  THR C O   1 
ATOM   5949  C  CB  . THR C  1 87  ? -11.787 3.158   29.680  1.00 30.62  ? 87  THR C CB  1 
ATOM   5950  O  OG1 . THR C  1 87  ? -11.744 1.921   28.957  1.00 32.33  ? 87  THR C OG1 1 
ATOM   5951  C  CG2 . THR C  1 87  ? -12.967 4.025   29.183  1.00 24.10  ? 87  THR C CG2 1 
ATOM   5952  N  N   . PRO C  1 88  ? -8.214  3.697   30.396  1.00 36.65  ? 88  PRO C N   1 
ATOM   5953  C  CA  . PRO C  1 88  ? -6.950  3.035   30.723  1.00 35.35  ? 88  PRO C CA  1 
ATOM   5954  C  C   . PRO C  1 88  ? -7.025  2.193   32.000  1.00 34.75  ? 88  PRO C C   1 
ATOM   5955  O  O   . PRO C  1 88  ? -7.854  2.458   32.882  1.00 31.26  ? 88  PRO C O   1 
ATOM   5956  C  CB  . PRO C  1 88  ? -5.985  4.204   30.950  1.00 35.24  ? 88  PRO C CB  1 
ATOM   5957  C  CG  . PRO C  1 88  ? -6.699  5.436   30.538  1.00 36.44  ? 88  PRO C CG  1 
ATOM   5958  C  CD  . PRO C  1 88  ? -8.161  5.144   30.645  1.00 35.17  ? 88  PRO C CD  1 
ATOM   5959  N  N   . ASP C  1 89  ? -6.181  1.167   32.073  1.00 36.66  ? 89  ASP C N   1 
ATOM   5960  C  CA  . ASP C  1 89  ? -5.819  0.578   33.350  1.00 34.70  ? 89  ASP C CA  1 
ATOM   5961  C  C   . ASP C  1 89  ? -4.858  1.598   33.978  1.00 34.84  ? 89  ASP C C   1 
ATOM   5962  O  O   . ASP C  1 89  ? -3.840  1.958   33.382  1.00 30.99  ? 89  ASP C O   1 
ATOM   5963  C  CB  . ASP C  1 89  ? -5.159  -0.795  33.150  1.00 37.51  ? 89  ASP C CB  1 
ATOM   5964  C  CG  . ASP C  1 89  ? -6.118  -1.843  32.496  1.00 58.52  ? 89  ASP C CG  1 
ATOM   5965  O  OD1 . ASP C  1 89  ? -7.232  -2.091  33.027  1.00 48.81  ? 89  ASP C OD1 1 
ATOM   5966  O  OD2 . ASP C  1 89  ? -5.750  -2.436  31.451  1.00 53.86  ? 89  ASP C OD2 1 
ATOM   5967  N  N   . TRP C  1 90  ? -5.193  2.116   35.150  1.00 33.34  ? 90  TRP C N   1 
ATOM   5968  C  CA  . TRP C  1 90  ? -4.384  3.206   35.726  1.00 33.84  ? 90  TRP C CA  1 
ATOM   5969  C  C   . TRP C  1 90  ? -3.097  2.793   36.447  1.00 37.76  ? 90  TRP C C   1 
ATOM   5970  O  O   . TRP C  1 90  ? -2.172  3.589   36.583  1.00 40.89  ? 90  TRP C O   1 
ATOM   5971  C  CB  . TRP C  1 90  ? -5.240  4.104   36.611  1.00 27.13  ? 90  TRP C CB  1 
ATOM   5972  C  CG  . TRP C  1 90  ? -6.097  5.005   35.738  1.00 30.24  ? 90  TRP C CG  1 
ATOM   5973  C  CD1 . TRP C  1 90  ? -7.388  4.786   35.344  1.00 30.84  ? 90  TRP C CD1 1 
ATOM   5974  C  CD2 . TRP C  1 90  ? -5.691  6.226   35.122  1.00 31.90  ? 90  TRP C CD2 1 
ATOM   5975  N  NE1 . TRP C  1 90  ? -7.808  5.800   34.523  1.00 35.94  ? 90  TRP C NE1 1 
ATOM   5976  C  CE2 . TRP C  1 90  ? -6.784  6.699   34.371  1.00 38.62  ? 90  TRP C CE2 1 
ATOM   5977  C  CE3 . TRP C  1 90  ? -4.509  6.971   35.134  1.00 33.74  ? 90  TRP C CE3 1 
ATOM   5978  C  CZ2 . TRP C  1 90  ? -6.728  7.886   33.642  1.00 34.02  ? 90  TRP C CZ2 1 
ATOM   5979  C  CZ3 . TRP C  1 90  ? -4.456  8.148   34.412  1.00 34.86  ? 90  TRP C CZ3 1 
ATOM   5980  C  CH2 . TRP C  1 90  ? -5.556  8.593   33.672  1.00 32.99  ? 90  TRP C CH2 1 
ATOM   5981  N  N   . ARG C  1 91  ? -3.029  1.549   36.895  1.00 33.00  ? 91  ARG C N   1 
ATOM   5982  C  CA  . ARG C  1 91  ? -1.851  1.097   37.630  1.00 32.26  ? 91  ARG C CA  1 
ATOM   5983  C  C   . ARG C  1 91  ? -0.846  0.395   36.707  1.00 37.28  ? 91  ARG C C   1 
ATOM   5984  O  O   . ARG C  1 91  ? -0.681  -0.819  36.747  1.00 33.65  ? 91  ARG C O   1 
ATOM   5985  C  CB  . ARG C  1 91  ? -2.299  0.209   38.783  1.00 27.14  ? 91  ARG C CB  1 
ATOM   5986  C  CG  . ARG C  1 91  ? -3.220  0.948   39.753  1.00 36.62  ? 91  ARG C CG  1 
ATOM   5987  C  CD  . ARG C  1 91  ? -3.501  0.130   40.988  1.00 43.51  ? 91  ARG C CD  1 
ATOM   5988  N  NE  . ARG C  1 91  ? -3.728  -1.247  40.598  1.00 53.66  ? 91  ARG C NE  1 
ATOM   5989  C  CZ  . ARG C  1 91  ? -2.907  -2.246  40.877  1.00 47.71  ? 91  ARG C CZ  1 
ATOM   5990  N  NH1 . ARG C  1 91  ? -1.810  -2.033  41.583  1.00 41.30  ? 91  ARG C NH1 1 
ATOM   5991  N  NH2 . ARG C  1 91  ? -3.195  -3.461  40.453  1.00 54.60  ? 91  ARG C NH2 1 
ATOM   5992  N  N   . THR C  1 92  ? -0.194  1.169   35.846  1.00 38.43  ? 92  THR C N   1 
ATOM   5993  C  CA  . THR C  1 92  ? 0.796   0.607   34.928  1.00 35.44  ? 92  THR C CA  1 
ATOM   5994  C  C   . THR C  1 92  ? 1.991   1.525   34.815  1.00 37.87  ? 92  THR C C   1 
ATOM   5995  O  O   . THR C  1 92  ? 1.935   2.693   35.234  1.00 32.25  ? 92  THR C O   1 
ATOM   5996  C  CB  . THR C  1 92  ? 0.233   0.410   33.503  1.00 36.01  ? 92  THR C CB  1 
ATOM   5997  O  OG1 . THR C  1 92  ? -0.185  1.671   32.969  1.00 37.98  ? 92  THR C OG1 1 
ATOM   5998  C  CG2 . THR C  1 92  ? -0.942  -0.567  33.506  1.00 32.72  ? 92  THR C CG2 1 
ATOM   5999  N  N   . SER C  1 93  ? 3.063   0.995   34.234  1.00 38.88  ? 93  SER C N   1 
ATOM   6000  C  CA  . SER C  1 93  ? 4.285   1.754   33.996  1.00 37.21  ? 93  SER C CA  1 
ATOM   6001  C  C   . SER C  1 93  ? 4.041   2.926   33.060  1.00 34.69  ? 93  SER C C   1 
ATOM   6002  O  O   . SER C  1 93  ? 4.592   4.009   33.263  1.00 35.57  ? 93  SER C O   1 
ATOM   6003  C  CB  . SER C  1 93  ? 5.348   0.858   33.376  1.00 42.79  ? 93  SER C CB  1 
ATOM   6004  O  OG  . SER C  1 93  ? 4.874   0.314   32.152  1.00 52.19  ? 93  SER C OG  1 
ATOM   6005  N  N   . GLU C  1 94  ? 3.233   2.709   32.022  1.00 29.91  ? 94  GLU C N   1 
ATOM   6006  C  CA  . GLU C  1 94  ? 2.960   3.779   31.066  1.00 29.12  ? 94  GLU C CA  1 
ATOM   6007  C  C   . GLU C  1 94  ? 2.285   4.952   31.761  1.00 33.34  ? 94  GLU C C   1 
ATOM   6008  O  O   . GLU C  1 94  ? 2.569   6.113   31.448  1.00 34.29  ? 94  GLU C O   1 
ATOM   6009  C  CB  . GLU C  1 94  ? 2.136   3.293   29.875  1.00 32.65  ? 94  GLU C CB  1 
ATOM   6010  C  CG  . GLU C  1 94  ? 2.920   2.388   28.935  1.00 34.36  ? 94  GLU C CG  1 
ATOM   6011  C  CD  . GLU C  1 94  ? 2.884   0.929   29.366  1.00 40.37  ? 94  GLU C CD  1 
ATOM   6012  O  OE1 . GLU C  1 94  ? 2.137   0.593   30.317  1.00 35.85  ? 94  GLU C OE1 1 
ATOM   6013  O  OE2 . GLU C  1 94  ? 3.599   0.119   28.746  1.00 46.08  ? 94  GLU C OE2 1 
ATOM   6014  N  N   . VAL C  1 95  ? 1.399   4.661   32.711  1.00 32.93  ? 95  VAL C N   1 
ATOM   6015  C  CA  . VAL C  1 95  ? 0.818   5.750   33.504  1.00 33.12  ? 95  VAL C CA  1 
ATOM   6016  C  C   . VAL C  1 95  ? 1.896   6.512   34.285  1.00 37.95  ? 95  VAL C C   1 
ATOM   6017  O  O   . VAL C  1 95  ? 1.935   7.747   34.241  1.00 34.18  ? 95  VAL C O   1 
ATOM   6018  C  CB  . VAL C  1 95  ? -0.316  5.277   34.429  1.00 34.68  ? 95  VAL C CB  1 
ATOM   6019  C  CG1 . VAL C  1 95  ? -0.703  6.376   35.395  1.00 28.98  ? 95  VAL C CG1 1 
ATOM   6020  C  CG2 . VAL C  1 95  ? -1.519  4.881   33.599  1.00 34.60  ? 95  VAL C CG2 1 
ATOM   6021  N  N   . GLN C  1 96  ? 2.792   5.790   34.964  1.00 31.11  ? 96  GLN C N   1 
ATOM   6022  C  CA  . GLN C  1 96  ? 3.904   6.458   35.646  1.00 30.17  ? 96  GLN C CA  1 
ATOM   6023  C  C   . GLN C  1 96  ? 4.755   7.294   34.674  1.00 34.33  ? 96  GLN C C   1 
ATOM   6024  O  O   . GLN C  1 96  ? 5.319   8.315   35.073  1.00 33.19  ? 96  GLN C O   1 
ATOM   6025  C  CB  . GLN C  1 96  ? 4.771   5.460   36.462  1.00 28.83  ? 96  GLN C CB  1 
ATOM   6026  C  CG  . GLN C  1 96  ? 3.953   4.582   37.442  1.00 26.96  ? 96  GLN C CG  1 
ATOM   6027  C  CD  . GLN C  1 96  ? 4.801   3.924   38.543  1.00 32.96  ? 96  GLN C CD  1 
ATOM   6028  O  OE1 . GLN C  1 96  ? 5.955   4.262   38.748  1.00 38.01  ? 96  GLN C OE1 1 
ATOM   6029  N  NE2 . GLN C  1 96  ? 4.209   2.990   39.254  1.00 37.45  ? 96  GLN C NE2 1 
ATOM   6030  N  N   . ARG C  1 97  ? 4.838   6.862   33.411  1.00 33.00  ? 97  ARG C N   1 
ATOM   6031  C  CA  . ARG C  1 97  ? 5.590   7.573   32.364  1.00 32.23  ? 97  ARG C CA  1 
ATOM   6032  C  C   . ARG C  1 97  ? 4.848   8.784   31.787  1.00 33.19  ? 97  ARG C C   1 
ATOM   6033  O  O   . ARG C  1 97  ? 5.421   9.571   31.032  1.00 27.73  ? 97  ARG C O   1 
ATOM   6034  C  CB  . ARG C  1 97  ? 5.930   6.639   31.198  1.00 36.30  ? 97  ARG C CB  1 
ATOM   6035  C  CG  . ARG C  1 97  ? 7.065   5.674   31.469  1.00 36.67  ? 97  ARG C CG  1 
ATOM   6036  C  CD  . ARG C  1 97  ? 7.832   5.349   30.193  1.00 40.96  ? 97  ARG C CD  1 
ATOM   6037  N  NE  . ARG C  1 97  ? 7.037   4.548   29.271  1.00 54.69  ? 97  ARG C NE  1 
ATOM   6038  C  CZ  . ARG C  1 97  ? 6.650   4.942   28.059  1.00 48.19  ? 97  ARG C CZ  1 
ATOM   6039  N  NH1 . ARG C  1 97  ? 7.001   6.139   27.597  1.00 42.88  ? 97  ARG C NH1 1 
ATOM   6040  N  NH2 . ARG C  1 97  ? 5.924   4.120   27.303  1.00 41.41  ? 97  ARG C NH2 1 
ATOM   6041  N  N   . GLY C  1 98  ? 3.569   8.911   32.113  1.00 27.43  ? 98  GLY C N   1 
ATOM   6042  C  CA  . GLY C  1 98  ? 2.785   10.033  31.639  1.00 33.82  ? 98  GLY C CA  1 
ATOM   6043  C  C   . GLY C  1 98  ? 2.003   9.773   30.363  1.00 36.38  ? 98  GLY C C   1 
ATOM   6044  O  O   . GLY C  1 98  ? 1.619   10.705  29.674  1.00 40.45  ? 98  GLY C O   1 
ATOM   6045  N  N   . TYR C  1 99  ? 1.767   8.512   30.035  1.00 36.69  ? 99  TYR C N   1 
ATOM   6046  C  CA  . TYR C  1 99  ? 1.061   8.187   28.799  1.00 33.85  ? 99  TYR C CA  1 
ATOM   6047  C  C   . TYR C  1 99  ? -0.008  7.124   29.029  1.00 32.18  ? 99  TYR C C   1 
ATOM   6048  O  O   . TYR C  1 99  ? 0.141   5.972   28.616  1.00 33.44  ? 99  TYR C O   1 
ATOM   6049  C  CB  . TYR C  1 99  ? 2.056   7.763   27.708  1.00 32.62  ? 99  TYR C CB  1 
ATOM   6050  C  CG  . TYR C  1 99  ? 2.876   8.920   27.199  1.00 34.39  ? 99  TYR C CG  1 
ATOM   6051  C  CD1 . TYR C  1 99  ? 2.494   9.614   26.055  1.00 36.80  ? 99  TYR C CD1 1 
ATOM   6052  C  CD2 . TYR C  1 99  ? 4.012   9.351   27.884  1.00 35.72  ? 99  TYR C CD2 1 
ATOM   6053  C  CE1 . TYR C  1 99  ? 3.237   10.702  25.586  1.00 38.85  ? 99  TYR C CE1 1 
ATOM   6054  C  CE2 . TYR C  1 99  ? 4.768   10.445  27.427  1.00 37.89  ? 99  TYR C CE2 1 
ATOM   6055  C  CZ  . TYR C  1 99  ? 4.372   11.112  26.278  1.00 43.83  ? 99  TYR C CZ  1 
ATOM   6056  O  OH  . TYR C  1 99  ? 5.099   12.185  25.811  1.00 48.39  ? 99  TYR C OH  1 
ATOM   6057  N  N   . HIS C  1 100 ? -1.089  7.504   29.698  1.00 32.10  ? 100 HIS C N   1 
ATOM   6058  C  CA  . HIS C  1 100 ? -2.163  6.543   29.956  1.00 34.88  ? 100 HIS C CA  1 
ATOM   6059  C  C   . HIS C  1 100 ? -2.763  5.972   28.665  1.00 31.21  ? 100 HIS C C   1 
ATOM   6060  O  O   . HIS C  1 100 ? -3.251  4.845   28.665  1.00 34.18  ? 100 HIS C O   1 
ATOM   6061  C  CB  . HIS C  1 100 ? -3.251  7.142   30.847  1.00 36.92  ? 100 HIS C CB  1 
ATOM   6062  C  CG  . HIS C  1 100 ? -4.117  8.152   30.154  1.00 39.91  ? 100 HIS C CG  1 
ATOM   6063  N  ND1 . HIS C  1 100 ? -4.031  9.505   30.405  1.00 38.18  ? 100 HIS C ND1 1 
ATOM   6064  C  CD2 . HIS C  1 100 ? -5.093  8.002   29.227  1.00 33.27  ? 100 HIS C CD2 1 
ATOM   6065  C  CE1 . HIS C  1 100 ? -4.918  10.145  29.664  1.00 37.92  ? 100 HIS C CE1 1 
ATOM   6066  N  NE2 . HIS C  1 100 ? -5.574  9.256   28.939  1.00 37.57  ? 100 HIS C NE2 1 
ATOM   6067  N  N   . GLN C  1 101 ? -2.708  6.734   27.570  1.00 26.48  ? 101 GLN C N   1 
ATOM   6068  C  CA  . GLN C  1 101 ? -3.211  6.244   26.283  1.00 31.77  ? 101 GLN C CA  1 
ATOM   6069  C  C   . GLN C  1 101 ? -2.590  4.901   25.958  1.00 33.80  ? 101 GLN C C   1 
ATOM   6070  O  O   . GLN C  1 101 ? -3.159  4.104   25.193  1.00 37.09  ? 101 GLN C O   1 
ATOM   6071  C  CB  . GLN C  1 101 ? -2.917  7.220   25.123  1.00 26.64  ? 101 GLN C CB  1 
ATOM   6072  C  CG  . GLN C  1 101 ? -3.660  8.558   25.185  1.00 28.07  ? 101 GLN C CG  1 
ATOM   6073  C  CD  . GLN C  1 101 ? -2.852  9.639   25.915  1.00 38.00  ? 101 GLN C CD  1 
ATOM   6074  O  OE1 . GLN C  1 101 ? -2.107  9.355   26.863  1.00 33.83  ? 101 GLN C OE1 1 
ATOM   6075  N  NE2 . GLN C  1 101 ? -3.005  10.882  25.474  1.00 24.95  ? 101 GLN C NE2 1 
ATOM   6076  N  N   . HIS C  1 102 ? -1.417  4.646   26.529  1.00 34.58  ? 102 HIS C N   1 
ATOM   6077  C  CA  . HIS C  1 102 ? -0.650  3.465   26.145  1.00 34.45  ? 102 HIS C CA  1 
ATOM   6078  C  C   . HIS C  1 102 ? -0.427  2.496   27.305  1.00 32.37  ? 102 HIS C C   1 
ATOM   6079  O  O   . HIS C  1 102 ? 0.499   1.693   27.301  1.00 32.15  ? 102 HIS C O   1 
ATOM   6080  C  CB  . HIS C  1 102 ? 0.658   3.881   25.455  1.00 30.90  ? 102 HIS C CB  1 
ATOM   6081  C  CG  . HIS C  1 102 ? 0.439   4.822   24.305  1.00 33.05  ? 102 HIS C CG  1 
ATOM   6082  N  ND1 . HIS C  1 102 ? -0.232  4.449   23.153  1.00 28.13  ? 102 HIS C ND1 1 
ATOM   6083  C  CD2 . HIS C  1 102 ? 0.748   6.132   24.156  1.00 24.83  ? 102 HIS C CD2 1 
ATOM   6084  C  CE1 . HIS C  1 102 ? -0.304  5.487   22.337  1.00 32.80  ? 102 HIS C CE1 1 
ATOM   6085  N  NE2 . HIS C  1 102 ? 0.281   6.522   22.921  1.00 29.55  ? 102 HIS C NE2 1 
ATOM   6086  N  N   . SER C  1 103 ? -1.318  2.559   28.281  1.00 27.71  ? 103 SER C N   1 
ATOM   6087  C  CA  . SER C  1 103 ? -1.242  1.685   29.438  1.00 30.33  ? 103 SER C CA  1 
ATOM   6088  C  C   . SER C  1 103 ? -1.438  0.230   29.020  1.00 37.42  ? 103 SER C C   1 
ATOM   6089  O  O   . SER C  1 103 ? -2.516  -0.154  28.512  1.00 36.37  ? 103 SER C O   1 
ATOM   6090  C  CB  . SER C  1 103 ? -2.307  2.093   30.455  1.00 33.09  ? 103 SER C CB  1 
ATOM   6091  O  OG  . SER C  1 103 ? -2.322  1.196   31.545  1.00 42.34  ? 103 SER C OG  1 
ATOM   6092  N  N   . GLY C  1 104 ? -0.393  -0.575  29.212  1.00 33.63  ? 104 GLY C N   1 
ATOM   6093  C  CA  . GLY C  1 104 ? -0.444  -1.989  28.865  1.00 30.17  ? 104 GLY C CA  1 
ATOM   6094  C  C   . GLY C  1 104 ? 0.048   -2.263  27.459  1.00 33.65  ? 104 GLY C C   1 
ATOM   6095  O  O   . GLY C  1 104 ? -0.002  -3.391  26.999  1.00 40.12  ? 104 GLY C O   1 
ATOM   6096  N  N   . GLY C  1 105 ? 0.535   -1.232  26.773  1.00 37.69  ? 105 GLY C N   1 
ATOM   6097  C  CA  . GLY C  1 105 ? 0.998   -1.396  25.401  1.00 30.97  ? 105 GLY C CA  1 
ATOM   6098  C  C   . GLY C  1 105 ? 0.467   -0.314  24.476  1.00 36.08  ? 105 GLY C C   1 
ATOM   6099  O  O   . GLY C  1 105 ? -0.336  0.532   24.875  1.00 35.20  ? 105 GLY C O   1 
ATOM   6100  N  N   . MET C  1 106 ? 0.907   -0.347  23.225  1.00 33.04  ? 106 MET C N   1 
ATOM   6101  C  CA  . MET C  1 106 ? 0.559   0.701   22.288  1.00 35.87  ? 106 MET C CA  1 
ATOM   6102  C  C   . MET C  1 106 ? -0.956  0.756   21.992  1.00 30.60  ? 106 MET C C   1 
ATOM   6103  O  O   . MET C  1 106 ? -1.549  -0.211  21.540  1.00 34.74  ? 106 MET C O   1 
ATOM   6104  C  CB  . MET C  1 106 ? 1.375   0.549   21.002  1.00 30.49  ? 106 MET C CB  1 
ATOM   6105  C  CG  . MET C  1 106 ? 1.278   1.776   20.085  1.00 30.47  ? 106 MET C CG  1 
ATOM   6106  S  SD  . MET C  1 106 ? 2.388   1.685   18.669  1.00 41.10  ? 106 MET C SD  1 
ATOM   6107  C  CE  . MET C  1 106 ? 1.946   0.096   17.983  1.00 36.22  ? 106 MET C CE  1 
ATOM   6108  N  N   . LEU C  1 107 ? -1.561  1.899   22.274  1.00 27.32  ? 107 LEU C N   1 
ATOM   6109  C  CA  . LEU C  1 107 ? -2.978  2.156   21.986  1.00 32.86  ? 107 LEU C CA  1 
ATOM   6110  C  C   . LEU C  1 107 ? -3.884  1.427   22.957  1.00 31.96  ? 107 LEU C C   1 
ATOM   6111  O  O   . LEU C  1 107 ? -5.091  1.428   22.783  1.00 34.69  ? 107 LEU C O   1 
ATOM   6112  C  CB  . LEU C  1 107 ? -3.361  1.777   20.545  1.00 26.41  ? 107 LEU C CB  1 
ATOM   6113  C  CG  . LEU C  1 107 ? -2.504  2.297   19.378  1.00 36.87  ? 107 LEU C CG  1 
ATOM   6114  C  CD1 . LEU C  1 107 ? -3.184  2.011   18.072  1.00 36.38  ? 107 LEU C CD1 1 
ATOM   6115  C  CD2 . LEU C  1 107 ? -2.173  3.788   19.463  1.00 34.26  ? 107 LEU C CD2 1 
ATOM   6116  N  N   . ALA C  1 108 ? -3.307  0.814   23.985  1.00 27.42  ? 108 ALA C N   1 
ATOM   6117  C  CA  . ALA C  1 108 ? -4.071  -0.099  24.834  1.00 32.29  ? 108 ALA C CA  1 
ATOM   6118  C  C   . ALA C  1 108 ? -4.993  0.601   25.827  1.00 33.89  ? 108 ALA C C   1 
ATOM   6119  O  O   . ALA C  1 108 ? -5.814  -0.048  26.474  1.00 37.10  ? 108 ALA C O   1 
ATOM   6120  C  CB  . ALA C  1 108 ? -3.140  -1.103  25.560  1.00 33.21  ? 108 ALA C CB  1 
ATOM   6121  N  N   . GLY C  1 109 ? -4.850  1.916   25.969  1.00 34.19  ? 109 GLY C N   1 
ATOM   6122  C  CA  . GLY C  1 109 ? -5.782  2.675   26.778  1.00 30.14  ? 109 GLY C CA  1 
ATOM   6123  C  C   . GLY C  1 109 ? -7.112  2.803   26.046  1.00 29.48  ? 109 GLY C C   1 
ATOM   6124  O  O   . GLY C  1 109 ? -8.160  3.060   26.651  1.00 30.71  ? 109 GLY C O   1 
ATOM   6125  N  N   . TRP C  1 110 ? -7.055  2.634   24.731  1.00 31.42  ? 110 TRP C N   1 
ATOM   6126  C  CA  . TRP C  1 110 ? -8.263  2.542   23.904  1.00 34.59  ? 110 TRP C CA  1 
ATOM   6127  C  C   . TRP C  1 110 ? -8.718  1.092   23.875  1.00 34.19  ? 110 TRP C C   1 
ATOM   6128  O  O   . TRP C  1 110 ? -8.171  0.274   23.136  1.00 33.51  ? 110 TRP C O   1 
ATOM   6129  C  CB  . TRP C  1 110 ? -8.021  3.099   22.483  1.00 28.25  ? 110 TRP C CB  1 
ATOM   6130  C  CG  . TRP C  1 110 ? -9.064  2.727   21.448  1.00 38.91  ? 110 TRP C CG  1 
ATOM   6131  C  CD1 . TRP C  1 110 ? -10.398 2.505   21.659  1.00 42.49  ? 110 TRP C CD1 1 
ATOM   6132  C  CD2 . TRP C  1 110 ? -8.851  2.555   20.037  1.00 34.93  ? 110 TRP C CD2 1 
ATOM   6133  N  NE1 . TRP C  1 110 ? -11.020 2.186   20.472  1.00 41.12  ? 110 TRP C NE1 1 
ATOM   6134  C  CE2 . TRP C  1 110 ? -10.094 2.206   19.464  1.00 35.06  ? 110 TRP C CE2 1 
ATOM   6135  C  CE3 . TRP C  1 110 ? -7.727  2.641   19.209  1.00 33.33  ? 110 TRP C CE3 1 
ATOM   6136  C  CZ2 . TRP C  1 110 ? -10.246 1.951   18.103  1.00 27.50  ? 110 TRP C CZ2 1 
ATOM   6137  C  CZ3 . TRP C  1 110 ? -7.877  2.397   17.861  1.00 34.03  ? 110 TRP C CZ3 1 
ATOM   6138  C  CH2 . TRP C  1 110 ? -9.134  2.056   17.317  1.00 35.32  ? 110 TRP C CH2 1 
ATOM   6139  N  N   . LYS C  1 111 ? -9.717  0.790   24.701  1.00 34.03  ? 111 LYS C N   1 
ATOM   6140  C  CA  . LYS C  1 111 ? -10.231 -0.576  24.867  1.00 32.33  ? 111 LYS C CA  1 
ATOM   6141  C  C   . LYS C  1 111 ? -11.484 -0.851  24.007  1.00 34.10  ? 111 LYS C C   1 
ATOM   6142  O  O   . LYS C  1 111 ? -11.474 -1.739  23.150  1.00 30.52  ? 111 LYS C O   1 
ATOM   6143  C  CB  . LYS C  1 111 ? -10.509 -0.850  26.353  1.00 29.23  ? 111 LYS C CB  1 
ATOM   6144  C  CG  . LYS C  1 111 ? -9.238  -1.068  27.185  1.00 34.69  ? 111 LYS C CG  1 
ATOM   6145  C  CD  . LYS C  1 111 ? -9.521  -1.099  28.693  1.00 43.25  ? 111 LYS C CD  1 
ATOM   6146  C  CE  . LYS C  1 111 ? -8.234  -1.263  29.503  1.00 36.64  ? 111 LYS C CE  1 
ATOM   6147  N  NZ  . LYS C  1 111 ? -7.618  -2.604  29.255  1.00 37.98  ? 111 LYS C NZ  1 
ATOM   6148  N  N   . PHE C  1 112 ? -12.546 -0.078  24.229  1.00 33.41  ? 112 PHE C N   1 
ATOM   6149  C  CA  . PHE C  1 112 ? -13.777 -0.202  23.443  1.00 34.14  ? 112 PHE C CA  1 
ATOM   6150  C  C   . PHE C  1 112 ? -13.537 -0.261  21.933  1.00 35.79  ? 112 PHE C C   1 
ATOM   6151  O  O   . PHE C  1 112 ? -13.025 0.683   21.346  1.00 34.37  ? 112 PHE C O   1 
ATOM   6152  C  CB  . PHE C  1 112 ? -14.709 0.978   23.706  1.00 32.51  ? 112 PHE C CB  1 
ATOM   6153  C  CG  . PHE C  1 112 ? -15.294 1.017   25.091  1.00 34.78  ? 112 PHE C CG  1 
ATOM   6154  C  CD1 . PHE C  1 112 ? -15.789 -0.127  25.687  1.00 29.82  ? 112 PHE C CD1 1 
ATOM   6155  C  CD2 . PHE C  1 112 ? -15.397 2.226   25.774  1.00 30.67  ? 112 PHE C CD2 1 
ATOM   6156  C  CE1 . PHE C  1 112 ? -16.353 -0.080  26.946  1.00 25.37  ? 112 PHE C CE1 1 
ATOM   6157  C  CE2 . PHE C  1 112 ? -15.967 2.283   27.037  1.00 33.55  ? 112 PHE C CE2 1 
ATOM   6158  C  CZ  . PHE C  1 112 ? -16.447 1.133   27.625  1.00 29.09  ? 112 PHE C CZ  1 
ATOM   6159  N  N   . SER C  1 113 ? -13.965 -1.355  21.313  1.00 37.67  ? 113 SER C N   1 
ATOM   6160  C  CA  . SER C  1 113 ? -13.883 -1.546  19.859  1.00 34.08  ? 113 SER C CA  1 
ATOM   6161  C  C   . SER C  1 113 ? -12.445 -1.644  19.353  1.00 37.80  ? 113 SER C C   1 
ATOM   6162  O  O   . SER C  1 113 ? -12.183 -1.507  18.150  1.00 40.83  ? 113 SER C O   1 
ATOM   6163  C  CB  . SER C  1 113 ? -14.743 -0.528  19.071  1.00 31.05  ? 113 SER C CB  1 
ATOM   6164  O  OG  . SER C  1 113 ? -14.041 0.649   18.668  1.00 33.17  ? 113 SER C OG  1 
ATOM   6165  N  N   . ASN C  1 114 ? -11.530 -1.897  20.292  1.00 39.30  ? 114 ASN C N   1 
ATOM   6166  C  CA  . ASN C  1 114 ? -10.120 -2.209  20.009  1.00 36.02  ? 114 ASN C CA  1 
ATOM   6167  C  C   . ASN C  1 114 ? -9.779  -3.600  20.533  1.00 36.42  ? 114 ASN C C   1 
ATOM   6168  O  O   . ASN C  1 114 ? -9.634  -4.543  19.764  1.00 43.69  ? 114 ASN C O   1 
ATOM   6169  C  CB  . ASN C  1 114 ? -9.185  -1.171  20.640  1.00 38.00  ? 114 ASN C CB  1 
ATOM   6170  C  CG  . ASN C  1 114 ? -7.712  -1.455  20.350  1.00 42.95  ? 114 ASN C CG  1 
ATOM   6171  O  OD1 . ASN C  1 114 ? -7.390  -2.291  19.506  1.00 42.46  ? 114 ASN C OD1 1 
ATOM   6172  N  ND2 . ASN C  1 114 ? -6.811  -0.764  21.063  1.00 35.54  ? 114 ASN C ND2 1 
ATOM   6173  N  N   . VAL C  1 115 ? -9.691  -3.728  21.852  1.00 35.75  ? 115 VAL C N   1 
ATOM   6174  C  CA  . VAL C  1 115 ? -9.429  -5.016  22.499  1.00 34.37  ? 115 VAL C CA  1 
ATOM   6175  C  C   . VAL C  1 115 ? -10.515 -5.324  23.519  1.00 46.30  ? 115 VAL C C   1 
ATOM   6176  O  O   . VAL C  1 115 ? -10.326 -6.132  24.424  1.00 55.41  ? 115 VAL C O   1 
ATOM   6177  C  CB  . VAL C  1 115 ? -8.064  -5.019  23.232  1.00 33.38  ? 115 VAL C CB  1 
ATOM   6178  C  CG1 . VAL C  1 115 ? -6.925  -4.917  22.235  1.00 33.04  ? 115 VAL C CG1 1 
ATOM   6179  C  CG2 . VAL C  1 115 ? -7.996  -3.859  24.225  1.00 35.25  ? 115 VAL C CG2 1 
ATOM   6180  N  N   . LYS C  1 116 ? -11.660 -4.676  23.374  1.00 44.70  ? 116 LYS C N   1 
ATOM   6181  C  CA  . LYS C  1 116 ? -12.756 -4.897  24.296  1.00 37.59  ? 116 LYS C CA  1 
ATOM   6182  C  C   . LYS C  1 116 ? -14.084 -4.661  23.571  1.00 33.89  ? 116 LYS C C   1 
ATOM   6183  O  O   . LYS C  1 116 ? -14.160 -3.830  22.661  1.00 35.16  ? 116 LYS C O   1 
ATOM   6184  C  CB  . LYS C  1 116 ? -12.604 -3.948  25.488  1.00 38.06  ? 116 LYS C CB  1 
ATOM   6185  C  CG  . LYS C  1 116 ? -13.603 -4.147  26.622  1.00 37.38  ? 116 LYS C CG  1 
ATOM   6186  C  CD  . LYS C  1 116 ? -13.467 -3.024  27.642  1.00 31.20  ? 116 LYS C CD  1 
ATOM   6187  C  CE  . LYS C  1 116 ? -14.332 -3.265  28.869  1.00 32.94  ? 116 LYS C CE  1 
ATOM   6188  N  NZ  . LYS C  1 116 ? -13.961 -2.352  29.998  1.00 28.81  ? 116 LYS C NZ  1 
ATOM   6189  N  N   . ASP C  1 117 ? -15.115 -5.404  23.971  1.00 35.21  ? 117 ASP C N   1 
ATOM   6190  C  CA  . ASP C  1 117 ? -16.460 -5.195  23.462  1.00 36.26  ? 117 ASP C CA  1 
ATOM   6191  C  C   . ASP C  1 117 ? -16.868 -3.739  23.658  1.00 39.69  ? 117 ASP C C   1 
ATOM   6192  O  O   . ASP C  1 117 ? -16.758 -3.192  24.763  1.00 34.43  ? 117 ASP C O   1 
ATOM   6193  C  CB  . ASP C  1 117 ? -17.452 -6.130  24.152  1.00 38.05  ? 117 ASP C CB  1 
ATOM   6194  C  CG  . ASP C  1 117 ? -17.482 -7.518  23.524  1.00 41.61  ? 117 ASP C CG  1 
ATOM   6195  O  OD1 . ASP C  1 117 ? -17.131 -7.650  22.332  1.00 40.65  ? 117 ASP C OD1 1 
ATOM   6196  O  OD2 . ASP C  1 117 ? -17.864 -8.479  24.225  1.00 39.49  ? 117 ASP C OD2 1 
ATOM   6197  N  N   . GLY C  1 118 ? -17.334 -3.121  22.575  1.00 36.48  ? 118 GLY C N   1 
ATOM   6198  C  CA  . GLY C  1 118 ? -17.662 -1.708  22.569  1.00 32.68  ? 118 GLY C CA  1 
ATOM   6199  C  C   . GLY C  1 118 ? -19.014 -1.336  23.156  1.00 36.04  ? 118 GLY C C   1 
ATOM   6200  O  O   . GLY C  1 118 ? -19.674 -2.138  23.815  1.00 37.04  ? 118 GLY C O   1 
ATOM   6201  N  N   . VAL C  1 119 ? -19.438 -0.103  22.887  1.00 32.80  ? 119 VAL C N   1 
ATOM   6202  C  CA  . VAL C  1 119 ? -20.612 0.454   23.525  1.00 31.53  ? 119 VAL C CA  1 
ATOM   6203  C  C   . VAL C  1 119 ? -21.919 0.180   22.756  1.00 35.48  ? 119 VAL C C   1 
ATOM   6204  O  O   . VAL C  1 119 ? -22.998 0.482   23.263  1.00 35.00  ? 119 VAL C O   1 
ATOM   6205  C  CB  . VAL C  1 119 ? -20.443 1.973   23.777  1.00 34.41  ? 119 VAL C CB  1 
ATOM   6206  C  CG1 . VAL C  1 119 ? -19.196 2.233   24.622  1.00 38.64  ? 119 VAL C CG1 1 
ATOM   6207  C  CG2 . VAL C  1 119 ? -20.370 2.729   22.461  1.00 33.13  ? 119 VAL C CG2 1 
ATOM   6208  N  N   . PHE C  1 120 ? -21.828 -0.399  21.556  1.00 35.10  ? 120 PHE C N   1 
ATOM   6209  C  CA  . PHE C  1 120 ? -23.032 -0.740  20.778  1.00 31.83  ? 120 PHE C CA  1 
ATOM   6210  C  C   . PHE C  1 120 ? -23.695 -2.036  21.249  1.00 38.21  ? 120 PHE C C   1 
ATOM   6211  O  O   . PHE C  1 120 ? -23.929 -2.943  20.447  1.00 37.25  ? 120 PHE C O   1 
ATOM   6212  C  CB  . PHE C  1 120 ? -22.697 -0.906  19.297  1.00 24.94  ? 120 PHE C CB  1 
ATOM   6213  C  CG  . PHE C  1 120 ? -22.271 0.356   18.624  1.00 30.21  ? 120 PHE C CG  1 
ATOM   6214  C  CD1 . PHE C  1 120 ? -22.569 1.587   19.178  1.00 26.31  ? 120 PHE C CD1 1 
ATOM   6215  C  CD2 . PHE C  1 120 ? -21.591 0.311   17.420  1.00 27.10  ? 120 PHE C CD2 1 
ATOM   6216  C  CE1 . PHE C  1 120 ? -22.176 2.749   18.545  1.00 33.05  ? 120 PHE C CE1 1 
ATOM   6217  C  CE2 . PHE C  1 120 ? -21.194 1.464   16.787  1.00 23.70  ? 120 PHE C CE2 1 
ATOM   6218  C  CZ  . PHE C  1 120 ? -21.488 2.684   17.344  1.00 30.86  ? 120 PHE C CZ  1 
ATOM   6219  N  N   . GLY C  1 121 ? -23.994 -2.120  22.540  1.00 35.02  ? 121 GLY C N   1 
ATOM   6220  C  CA  . GLY C  1 121 ? -24.725 -3.245  23.098  1.00 35.88  ? 121 GLY C CA  1 
ATOM   6221  C  C   . GLY C  1 121 ? -25.666 -2.745  24.177  1.00 37.16  ? 121 GLY C C   1 
ATOM   6222  O  O   . GLY C  1 121 ? -25.547 -1.614  24.632  1.00 37.85  ? 121 GLY C O   1 
ATOM   6223  N  N   . GLU C  1 122 ? -26.587 -3.586  24.615  1.00 33.99  ? 122 GLU C N   1 
ATOM   6224  C  CA  . GLU C  1 122 ? -27.582 -3.147  25.583  1.00 41.76  ? 122 GLU C CA  1 
ATOM   6225  C  C   . GLU C  1 122 ? -26.939 -2.733  26.890  1.00 40.62  ? 122 GLU C C   1 
ATOM   6226  O  O   . GLU C  1 122 ? -27.464 -1.889  27.601  1.00 36.45  ? 122 GLU C O   1 
ATOM   6227  C  CB  . GLU C  1 122 ? -28.609 -4.241  25.832  1.00 42.77  ? 122 GLU C CB  1 
ATOM   6228  C  CG  . GLU C  1 122 ? -29.257 -4.777  24.559  1.00 47.25  ? 122 GLU C CG  1 
ATOM   6229  C  CD  . GLU C  1 122 ? -30.255 -5.871  24.864  1.00 50.55  ? 122 GLU C CD  1 
ATOM   6230  O  OE1 . GLU C  1 122 ? -30.110 -6.978  24.304  1.00 51.84  ? 122 GLU C OE1 1 
ATOM   6231  O  OE2 . GLU C  1 122 ? -31.164 -5.628  25.687  1.00 49.44  ? 122 GLU C OE2 1 
ATOM   6232  N  N   . PHE C  1 123 ? -25.804 -3.344  27.208  1.00 43.14  ? 123 PHE C N   1 
ATOM   6233  C  CA  . PHE C  1 123 ? -24.986 -2.907  28.337  1.00 41.33  ? 123 PHE C CA  1 
ATOM   6234  C  C   . PHE C  1 123 ? -23.540 -2.934  27.893  1.00 43.29  ? 123 PHE C C   1 
ATOM   6235  O  O   . PHE C  1 123 ? -23.195 -3.601  26.916  1.00 40.37  ? 123 PHE C O   1 
ATOM   6236  C  CB  . PHE C  1 123 ? -25.177 -3.826  29.551  1.00 44.65  ? 123 PHE C CB  1 
ATOM   6237  C  CG  . PHE C  1 123 ? -26.593 -3.873  30.051  1.00 46.38  ? 123 PHE C CG  1 
ATOM   6238  C  CD1 . PHE C  1 123 ? -27.075 -2.888  30.900  1.00 47.13  ? 123 PHE C CD1 1 
ATOM   6239  C  CD2 . PHE C  1 123 ? -27.453 -4.884  29.648  1.00 44.09  ? 123 PHE C CD2 1 
ATOM   6240  C  CE1 . PHE C  1 123 ? -28.387 -2.915  31.353  1.00 44.92  ? 123 PHE C CE1 1 
ATOM   6241  C  CE2 . PHE C  1 123 ? -28.770 -4.914  30.093  1.00 40.63  ? 123 PHE C CE2 1 
ATOM   6242  C  CZ  . PHE C  1 123 ? -29.236 -3.928  30.946  1.00 40.66  ? 123 PHE C CZ  1 
ATOM   6243  N  N   . PHE C  1 124 ? -22.696 -2.179  28.582  1.00 38.41  ? 124 PHE C N   1 
ATOM   6244  C  CA  . PHE C  1 124 ? -21.272 -2.360  28.408  1.00 37.92  ? 124 PHE C CA  1 
ATOM   6245  C  C   . PHE C  1 124 ? -20.561 -2.209  29.741  1.00 38.36  ? 124 PHE C C   1 
ATOM   6246  O  O   . PHE C  1 124 ? -21.134 -1.765  30.748  1.00 35.40  ? 124 PHE C O   1 
ATOM   6247  C  CB  . PHE C  1 124 ? -20.682 -1.445  27.315  1.00 34.98  ? 124 PHE C CB  1 
ATOM   6248  C  CG  . PHE C  1 124 ? -20.886 0.028   27.564  1.00 38.99  ? 124 PHE C CG  1 
ATOM   6249  C  CD1 . PHE C  1 124 ? -19.937 0.767   28.264  1.00 31.50  ? 124 PHE C CD1 1 
ATOM   6250  C  CD2 . PHE C  1 124 ? -22.016 0.680   27.082  1.00 36.59  ? 124 PHE C CD2 1 
ATOM   6251  C  CE1 . PHE C  1 124 ? -20.120 2.116   28.491  1.00 29.82  ? 124 PHE C CE1 1 
ATOM   6252  C  CE2 . PHE C  1 124 ? -22.205 2.035   27.310  1.00 29.73  ? 124 PHE C CE2 1 
ATOM   6253  C  CZ  . PHE C  1 124 ? -21.255 2.751   28.012  1.00 34.41  ? 124 PHE C CZ  1 
ATOM   6254  N  N   . HIS C  1 125 ? -19.298 -2.594  29.732  1.00 36.26  ? 125 HIS C N   1 
ATOM   6255  C  CA  . HIS C  1 125 ? -18.510 -2.667  30.938  1.00 34.77  ? 125 HIS C CA  1 
ATOM   6256  C  C   . HIS C  1 125 ? -17.477 -1.538  30.936  1.00 31.54  ? 125 HIS C C   1 
ATOM   6257  O  O   . HIS C  1 125 ? -16.805 -1.309  29.931  1.00 36.70  ? 125 HIS C O   1 
ATOM   6258  C  CB  . HIS C  1 125 ? -17.844 -4.039  30.956  1.00 32.24  ? 125 HIS C CB  1 
ATOM   6259  C  CG  . HIS C  1 125 ? -16.827 -4.217  32.038  1.00 39.02  ? 125 HIS C CG  1 
ATOM   6260  N  ND1 . HIS C  1 125 ? -15.626 -3.541  32.045  1.00 39.23  ? 125 HIS C ND1 1 
ATOM   6261  C  CD2 . HIS C  1 125 ? -16.812 -5.028  33.124  1.00 39.35  ? 125 HIS C CD2 1 
ATOM   6262  C  CE1 . HIS C  1 125 ? -14.918 -3.920  33.097  1.00 44.64  ? 125 HIS C CE1 1 
ATOM   6263  N  NE2 . HIS C  1 125 ? -15.615 -4.819  33.769  1.00 41.07  ? 125 HIS C NE2 1 
ATOM   6264  N  N   . VAL C  1 126 ? -17.361 -0.817  32.047  1.00 34.29  ? 126 VAL C N   1 
ATOM   6265  C  CA  . VAL C  1 126 ? -16.286 0.177   32.189  1.00 28.82  ? 126 VAL C CA  1 
ATOM   6266  C  C   . VAL C  1 126 ? -15.313 -0.238  33.298  1.00 32.08  ? 126 VAL C C   1 
ATOM   6267  O  O   . VAL C  1 126 ? -15.717 -0.433  34.446  1.00 34.56  ? 126 VAL C O   1 
ATOM   6268  C  CB  . VAL C  1 126 ? -16.829 1.600   32.484  1.00 29.67  ? 126 VAL C CB  1 
ATOM   6269  C  CG1 . VAL C  1 126 ? -15.673 2.606   32.604  1.00 30.06  ? 126 VAL C CG1 1 
ATOM   6270  C  CG2 . VAL C  1 126 ? -17.816 2.047   31.405  1.00 26.45  ? 126 VAL C CG2 1 
ATOM   6271  N  N   . ASN C  1 127 ? -14.035 -0.380  32.954  1.00 30.82  ? 127 ASN C N   1 
ATOM   6272  C  CA  . ASN C  1 127 ? -13.021 -0.713  33.949  1.00 37.80  ? 127 ASN C CA  1 
ATOM   6273  C  C   . ASN C  1 127 ? -12.652 0.522   34.776  1.00 38.91  ? 127 ASN C C   1 
ATOM   6274  O  O   . ASN C  1 127 ? -12.509 1.626   34.236  1.00 39.62  ? 127 ASN C O   1 
ATOM   6275  C  CB  . ASN C  1 127 ? -11.776 -1.322  33.292  1.00 35.57  ? 127 ASN C CB  1 
ATOM   6276  C  CG  . ASN C  1 127 ? -11.179 -0.416  32.218  1.00 37.11  ? 127 ASN C CG  1 
ATOM   6277  O  OD1 . ASN C  1 127 ? -11.821 -0.135  31.211  1.00 32.18  ? 127 ASN C OD1 1 
ATOM   6278  N  ND2 . ASN C  1 127 ? -9.946  0.038   32.432  1.00 35.03  ? 127 ASN C ND2 1 
ATOM   6279  N  N   . ASP C  1 128 ? -12.530 0.331   36.085  1.00 32.88  ? 128 ASP C N   1 
ATOM   6280  C  CA  . ASP C  1 128 ? -12.151 1.407   37.008  1.00 34.91  ? 128 ASP C CA  1 
ATOM   6281  C  C   . ASP C  1 128 ? -13.071 2.629   36.882  1.00 36.19  ? 128 ASP C C   1 
ATOM   6282  O  O   . ASP C  1 128 ? -12.659 3.691   36.399  1.00 38.10  ? 128 ASP C O   1 
ATOM   6283  C  CB  . ASP C  1 128 ? -10.680 1.810   36.809  1.00 34.65  ? 128 ASP C CB  1 
ATOM   6284  C  CG  . ASP C  1 128 ? -10.088 2.478   38.039  1.00 38.64  ? 128 ASP C CG  1 
ATOM   6285  O  OD1 . ASP C  1 128 ? -10.864 3.051   38.826  1.00 37.55  ? 128 ASP C OD1 1 
ATOM   6286  O  OD2 . ASP C  1 128 ? -8.853  2.422   38.228  1.00 38.33  ? 128 ASP C OD2 1 
ATOM   6287  N  N   . ALA C  1 129 ? -14.307 2.464   37.347  1.00 30.61  ? 129 ALA C N   1 
ATOM   6288  C  CA  . ALA C  1 129 ? -15.335 3.499   37.276  1.00 33.07  ? 129 ALA C CA  1 
ATOM   6289  C  C   . ALA C  1 129 ? -14.867 4.836   37.818  1.00 40.42  ? 129 ALA C C   1 
ATOM   6290  O  O   . ALA C  1 129 ? -15.020 5.874   37.159  1.00 38.87  ? 129 ALA C O   1 
ATOM   6291  C  CB  . ALA C  1 129 ? -16.608 3.047   38.022  1.00 35.53  ? 129 ALA C CB  1 
ATOM   6292  N  N   . ASP C  1 130 ? -14.300 4.799   39.023  1.00 39.96  ? 130 ASP C N   1 
ATOM   6293  C  CA  . ASP C  1 130 ? -13.929 6.007   39.742  1.00 39.98  ? 130 ASP C CA  1 
ATOM   6294  C  C   . ASP C  1 130 ? -12.842 6.814   39.035  1.00 34.27  ? 130 ASP C C   1 
ATOM   6295  O  O   . ASP C  1 130 ? -12.767 8.026   39.211  1.00 31.29  ? 130 ASP C O   1 
ATOM   6296  C  CB  . ASP C  1 130 ? -13.485 5.656   41.169  1.00 39.76  ? 130 ASP C CB  1 
ATOM   6297  C  CG  . ASP C  1 130 ? -14.658 5.443   42.105  1.00 45.77  ? 130 ASP C CG  1 
ATOM   6298  O  OD1 . ASP C  1 130 ? -15.811 5.683   41.686  1.00 45.40  ? 130 ASP C OD1 1 
ATOM   6299  O  OD2 . ASP C  1 130 ? -14.426 5.047   43.264  1.00 50.32  ? 130 ASP C OD2 1 
ATOM   6300  N  N   . MET C  1 131 ? -11.991 6.141   38.262  1.00 30.44  ? 131 MET C N   1 
ATOM   6301  C  CA  . MET C  1 131 ? -10.946 6.832   37.509  1.00 27.20  ? 131 MET C CA  1 
ATOM   6302  C  C   . MET C  1 131 ? -11.358 7.133   36.059  1.00 36.71  ? 131 MET C C   1 
ATOM   6303  O  O   . MET C  1 131 ? -10.758 7.991   35.410  1.00 32.52  ? 131 MET C O   1 
ATOM   6304  C  CB  . MET C  1 131 ? -9.662  6.009   37.485  1.00 27.26  ? 131 MET C CB  1 
ATOM   6305  C  CG  . MET C  1 131 ? -8.976  5.848   38.848  1.00 31.57  ? 131 MET C CG  1 
ATOM   6306  S  SD  . MET C  1 131 ? -8.179  7.361   39.447  1.00 34.30  ? 131 MET C SD  1 
ATOM   6307  C  CE  . MET C  1 131 ? -6.755  7.438   38.367  1.00 32.73  ? 131 MET C CE  1 
ATOM   6308  N  N   . ASN C  1 132 ? -12.366 6.420   35.548  1.00 29.85  ? 132 ASN C N   1 
ATOM   6309  C  CA  . ASN C  1 132 ? -12.661 6.471   34.122  1.00 37.03  ? 132 ASN C CA  1 
ATOM   6310  C  C   . ASN C  1 132 ? -14.030 7.047   33.725  1.00 39.49  ? 132 ASN C C   1 
ATOM   6311  O  O   . ASN C  1 132 ? -14.274 7.245   32.552  1.00 41.90  ? 132 ASN C O   1 
ATOM   6312  C  CB  . ASN C  1 132 ? -12.464 5.089   33.474  1.00 33.24  ? 132 ASN C CB  1 
ATOM   6313  C  CG  . ASN C  1 132 ? -10.999 4.769   33.190  1.00 33.83  ? 132 ASN C CG  1 
ATOM   6314  O  OD1 . ASN C  1 132 ? -10.210 5.640   32.816  1.00 31.24  ? 132 ASN C OD1 1 
ATOM   6315  N  ND2 . ASN C  1 132 ? -10.636 3.504   33.349  1.00 27.72  ? 132 ASN C ND2 1 
ATOM   6316  N  N   . LEU C  1 133 ? -14.913 7.308   34.686  1.00 35.88  ? 133 LEU C N   1 
ATOM   6317  C  CA  . LEU C  1 133 ? -16.201 7.951   34.389  1.00 36.64  ? 133 LEU C CA  1 
ATOM   6318  C  C   . LEU C  1 133 ? -16.261 9.404   34.895  1.00 38.94  ? 133 LEU C C   1 
ATOM   6319  O  O   . LEU C  1 133 ? -15.593 9.759   35.867  1.00 35.94  ? 133 LEU C O   1 
ATOM   6320  C  CB  . LEU C  1 133 ? -17.357 7.175   35.017  1.00 32.14  ? 133 LEU C CB  1 
ATOM   6321  C  CG  . LEU C  1 133 ? -17.647 5.743   34.549  1.00 35.46  ? 133 LEU C CG  1 
ATOM   6322  C  CD1 . LEU C  1 133 ? -18.578 5.062   35.538  1.00 32.75  ? 133 LEU C CD1 1 
ATOM   6323  C  CD2 . LEU C  1 133 ? -18.251 5.728   33.141  1.00 25.50  ? 133 LEU C CD2 1 
ATOM   6324  N  N   . ALA C  1 134 ? -17.087 10.218  34.238  1.00 30.76  ? 134 ALA C N   1 
ATOM   6325  C  CA  . ALA C  1 134 ? -17.392 11.568  34.676  1.00 30.24  ? 134 ALA C CA  1 
ATOM   6326  C  C   . ALA C  1 134 ? -18.906 11.767  34.709  1.00 36.18  ? 134 ALA C C   1 
ATOM   6327  O  O   . ALA C  1 134 ? -19.633 11.292  33.829  1.00 41.34  ? 134 ALA C O   1 
ATOM   6328  C  CB  . ALA C  1 134 ? -16.760 12.572  33.731  1.00 31.21  ? 134 ALA C CB  1 
ATOM   6329  N  N   . HIS C  1 135 ? -19.382 12.479  35.717  1.00 27.20  ? 135 HIS C N   1 
ATOM   6330  C  CA  . HIS C  1 135 ? -20.798 12.767  35.838  1.00 36.69  ? 135 HIS C CA  1 
ATOM   6331  C  C   . HIS C  1 135 ? -21.245 13.738  34.755  1.00 41.00  ? 135 HIS C C   1 
ATOM   6332  O  O   . HIS C  1 135 ? -20.535 14.694  34.433  1.00 37.17  ? 135 HIS C O   1 
ATOM   6333  C  CB  . HIS C  1 135 ? -21.105 13.366  37.213  1.00 39.10  ? 135 HIS C CB  1 
ATOM   6334  C  CG  . HIS C  1 135 ? -21.002 12.380  38.330  1.00 43.19  ? 135 HIS C CG  1 
ATOM   6335  N  ND1 . HIS C  1 135 ? -21.932 11.381  38.524  1.00 47.56  ? 135 HIS C ND1 1 
ATOM   6336  C  CD2 . HIS C  1 135 ? -20.074 12.229  39.303  1.00 43.28  ? 135 HIS C CD2 1 
ATOM   6337  C  CE1 . HIS C  1 135 ? -21.580 10.658  39.573  1.00 51.29  ? 135 HIS C CE1 1 
ATOM   6338  N  NE2 . HIS C  1 135 ? -20.456 11.152  40.063  1.00 44.87  ? 135 HIS C NE2 1 
ATOM   6339  N  N   . LEU C  1 136 ? -22.428 13.501  34.201  1.00 38.91  ? 136 LEU C N   1 
ATOM   6340  C  CA  . LEU C  1 136 ? -22.958 14.394  33.177  1.00 36.66  ? 136 LEU C CA  1 
ATOM   6341  C  C   . LEU C  1 136 ? -23.814 15.477  33.824  1.00 37.57  ? 136 LEU C C   1 
ATOM   6342  O  O   . LEU C  1 136 ? -24.791 15.168  34.507  1.00 43.59  ? 136 LEU C O   1 
ATOM   6343  C  CB  . LEU C  1 136 ? -23.783 13.600  32.160  1.00 41.54  ? 136 LEU C CB  1 
ATOM   6344  C  CG  . LEU C  1 136 ? -24.522 14.447  31.115  1.00 41.20  ? 136 LEU C CG  1 
ATOM   6345  C  CD1 . LEU C  1 136 ? -23.515 15.163  30.236  1.00 41.31  ? 136 LEU C CD1 1 
ATOM   6346  C  CD2 . LEU C  1 136 ? -25.452 13.581  30.283  1.00 45.29  ? 136 LEU C CD2 1 
ATOM   6347  N  N   . PRO C  1 137 ? -23.441 16.753  33.635  1.00 40.83  ? 137 PRO C N   1 
ATOM   6348  C  CA  . PRO C  1 137 ? -24.278 17.841  34.155  1.00 44.98  ? 137 PRO C CA  1 
ATOM   6349  C  C   . PRO C  1 137 ? -25.582 17.893  33.380  1.00 46.97  ? 137 PRO C C   1 
ATOM   6350  O  O   . PRO C  1 137 ? -25.557 17.789  32.154  1.00 37.75  ? 137 PRO C O   1 
ATOM   6351  C  CB  . PRO C  1 137 ? -23.456 19.097  33.864  1.00 45.47  ? 137 PRO C CB  1 
ATOM   6352  C  CG  . PRO C  1 137 ? -22.061 18.604  33.658  1.00 48.93  ? 137 PRO C CG  1 
ATOM   6353  C  CD  . PRO C  1 137 ? -22.196 17.253  33.037  1.00 43.28  ? 137 PRO C CD  1 
ATOM   6354  N  N   . LYS C  1 138 ? -26.698 18.059  34.079  1.00 48.23  ? 138 LYS C N   1 
ATOM   6355  C  CA  . LYS C  1 138 ? -28.006 18.010  33.435  1.00 51.01  ? 138 LYS C CA  1 
ATOM   6356  C  C   . LYS C  1 138 ? -28.160 19.098  32.376  1.00 50.72  ? 138 LYS C C   1 
ATOM   6357  O  O   . LYS C  1 138 ? -29.039 19.012  31.516  1.00 42.50  ? 138 LYS C O   1 
ATOM   6358  C  CB  . LYS C  1 138 ? -29.114 18.144  34.477  1.00 52.62  ? 138 LYS C CB  1 
ATOM   6359  C  CG  . LYS C  1 138 ? -29.049 19.449  35.247  1.00 64.76  ? 138 LYS C CG  1 
ATOM   6360  C  CD  . LYS C  1 138 ? -30.183 19.574  36.247  1.00 72.55  ? 138 LYS C CD  1 
ATOM   6361  C  CE  . LYS C  1 138 ? -29.960 20.756  37.175  1.00 77.35  ? 138 LYS C CE  1 
ATOM   6362  N  NZ  . LYS C  1 138 ? -30.933 20.757  38.297  1.00 81.83  ? 138 LYS C NZ  1 
ATOM   6363  N  N   . GLU C  1 139 ? -27.309 20.120  32.438  1.00 47.12  ? 139 GLU C N   1 
ATOM   6364  C  CA  . GLU C  1 139 ? -27.417 21.249  31.509  1.00 47.01  ? 139 GLU C CA  1 
ATOM   6365  C  C   . GLU C  1 139 ? -26.854 20.941  30.117  1.00 45.81  ? 139 GLU C C   1 
ATOM   6366  O  O   . GLU C  1 139 ? -27.041 21.715  29.186  1.00 45.27  ? 139 GLU C O   1 
ATOM   6367  C  CB  . GLU C  1 139 ? -26.746 22.502  32.085  1.00 50.54  ? 139 GLU C CB  1 
ATOM   6368  C  CG  . GLU C  1 139 ? -27.396 23.057  33.354  1.00 51.83  ? 139 GLU C CG  1 
ATOM   6369  C  CD  . GLU C  1 139 ? -27.003 22.297  34.613  1.00 54.33  ? 139 GLU C CD  1 
ATOM   6370  O  OE1 . GLU C  1 139 ? -26.024 21.524  34.569  1.00 50.96  ? 139 GLU C OE1 1 
ATOM   6371  O  OE2 . GLU C  1 139 ? -27.672 22.475  35.653  1.00 59.56  ? 139 GLU C OE2 1 
ATOM   6372  N  N   . ILE C  1 140 ? -26.173 19.808  29.973  1.00 38.88  ? 140 ILE C N   1 
ATOM   6373  C  CA  . ILE C  1 140 ? -25.582 19.432  28.692  1.00 39.94  ? 140 ILE C CA  1 
ATOM   6374  C  C   . ILE C  1 140 ? -26.423 18.386  27.952  1.00 42.10  ? 140 ILE C C   1 
ATOM   6375  O  O   . ILE C  1 140 ? -26.599 17.269  28.436  1.00 45.40  ? 140 ILE C O   1 
ATOM   6376  C  CB  . ILE C  1 140 ? -24.162 18.880  28.887  1.00 39.19  ? 140 ILE C CB  1 
ATOM   6377  C  CG1 . ILE C  1 140 ? -23.277 19.920  29.570  1.00 46.70  ? 140 ILE C CG1 1 
ATOM   6378  C  CG2 . ILE C  1 140 ? -23.558 18.486  27.554  1.00 37.20  ? 140 ILE C CG2 1 
ATOM   6379  C  CD1 . ILE C  1 140 ? -21.920 19.355  29.986  1.00 42.01  ? 140 ILE C CD1 1 
ATOM   6380  N  N   . PRO C  1 141 ? -26.939 18.741  26.765  1.00 45.32  ? 141 PRO C N   1 
ATOM   6381  C  CA  . PRO C  1 141 ? -27.811 17.815  26.035  1.00 40.00  ? 141 PRO C CA  1 
ATOM   6382  C  C   . PRO C  1 141 ? -27.052 16.564  25.652  1.00 39.60  ? 141 PRO C C   1 
ATOM   6383  O  O   . PRO C  1 141 ? -25.833 16.630  25.441  1.00 37.63  ? 141 PRO C O   1 
ATOM   6384  C  CB  . PRO C  1 141 ? -28.172 18.595  24.767  1.00 40.66  ? 141 PRO C CB  1 
ATOM   6385  C  CG  . PRO C  1 141 ? -27.915 20.019  25.101  1.00 43.55  ? 141 PRO C CG  1 
ATOM   6386  C  CD  . PRO C  1 141 ? -26.726 19.989  26.019  1.00 44.73  ? 141 PRO C CD  1 
ATOM   6387  N  N   . LEU C  1 142 ? -27.764 15.447  25.555  1.00 36.02  ? 142 LEU C N   1 
ATOM   6388  C  CA  . LEU C  1 142 ? -27.141 14.176  25.221  1.00 43.43  ? 142 LEU C CA  1 
ATOM   6389  C  C   . LEU C  1 142 ? -26.339 14.280  23.940  1.00 42.18  ? 142 LEU C C   1 
ATOM   6390  O  O   . LEU C  1 142 ? -25.217 13.771  23.870  1.00 38.27  ? 142 LEU C O   1 
ATOM   6391  C  CB  . LEU C  1 142 ? -28.188 13.066  25.076  1.00 42.20  ? 142 LEU C CB  1 
ATOM   6392  C  CG  . LEU C  1 142 ? -28.859 12.564  26.354  1.00 39.71  ? 142 LEU C CG  1 
ATOM   6393  C  CD1 . LEU C  1 142 ? -29.918 11.511  26.033  1.00 41.84  ? 142 LEU C CD1 1 
ATOM   6394  C  CD2 . LEU C  1 142 ? -27.835 12.012  27.327  1.00 32.10  ? 142 LEU C CD2 1 
ATOM   6395  N  N   . GLU C  1 143 ? -26.918 14.938  22.935  1.00 37.90  ? 143 GLU C N   1 
ATOM   6396  C  CA  . GLU C  1 143 ? -26.329 14.965  21.600  1.00 37.38  ? 143 GLU C CA  1 
ATOM   6397  C  C   . GLU C  1 143 ? -24.959 15.598  21.666  1.00 38.19  ? 143 GLU C C   1 
ATOM   6398  O  O   . GLU C  1 143 ? -24.010 15.139  21.029  1.00 38.08  ? 143 GLU C O   1 
ATOM   6399  C  CB  . GLU C  1 143 ? -27.200 15.770  20.621  1.00 41.44  ? 143 GLU C CB  1 
ATOM   6400  C  CG  . GLU C  1 143 ? -28.489 15.073  20.158  1.00 42.19  ? 143 GLU C CG  1 
ATOM   6401  C  CD  . GLU C  1 143 ? -29.653 15.359  21.075  1.00 47.29  ? 143 GLU C CD  1 
ATOM   6402  O  OE1 . GLU C  1 143 ? -29.431 15.949  22.147  1.00 49.53  ? 143 GLU C OE1 1 
ATOM   6403  O  OE2 . GLU C  1 143 ? -30.794 14.999  20.735  1.00 55.40  ? 143 GLU C OE2 1 
ATOM   6404  N  N   . ALA C  1 144 ? -24.878 16.677  22.432  1.00 37.61  ? 144 ALA C N   1 
ATOM   6405  C  CA  . ALA C  1 144 ? -23.633 17.394  22.599  1.00 42.22  ? 144 ALA C CA  1 
ATOM   6406  C  C   . ALA C  1 144 ? -22.697 16.578  23.483  1.00 35.98  ? 144 ALA C C   1 
ATOM   6407  O  O   . ALA C  1 144 ? -21.511 16.466  23.202  1.00 28.44  ? 144 ALA C O   1 
ATOM   6408  C  CB  . ALA C  1 144 ? -23.890 18.771  23.202  1.00 41.80  ? 144 ALA C CB  1 
ATOM   6409  N  N   . ALA C  1 145 ? -23.232 15.999  24.548  1.00 37.02  ? 145 ALA C N   1 
ATOM   6410  C  CA  . ALA C  1 145 ? -22.392 15.264  25.486  1.00 30.28  ? 145 ALA C CA  1 
ATOM   6411  C  C   . ALA C  1 145 ? -21.627 14.169  24.759  1.00 34.58  ? 145 ALA C C   1 
ATOM   6412  O  O   . ALA C  1 145 ? -20.436 13.984  24.987  1.00 43.42  ? 145 ALA C O   1 
ATOM   6413  C  CB  . ALA C  1 145 ? -23.227 14.682  26.598  1.00 26.07  ? 145 ALA C CB  1 
ATOM   6414  N  N   . VAL C  1 146 ? -22.301 13.473  23.850  1.00 32.58  ? 146 VAL C N   1 
ATOM   6415  C  CA  . VAL C  1 146 ? -21.701 12.322  23.177  1.00 27.85  ? 146 VAL C CA  1 
ATOM   6416  C  C   . VAL C  1 146 ? -20.554 12.712  22.230  1.00 30.26  ? 146 VAL C C   1 
ATOM   6417  O  O   . VAL C  1 146 ? -19.818 11.857  21.737  1.00 32.05  ? 146 VAL C O   1 
ATOM   6418  C  CB  . VAL C  1 146 ? -22.785 11.449  22.460  1.00 32.32  ? 146 VAL C CB  1 
ATOM   6419  C  CG1 . VAL C  1 146 ? -23.008 11.930  21.073  1.00 33.31  ? 146 VAL C CG1 1 
ATOM   6420  C  CG2 . VAL C  1 146 ? -22.368 9.965   22.443  1.00 29.44  ? 146 VAL C CG2 1 
ATOM   6421  N  N   . MET C  1 147 ? -20.393 14.009  21.986  1.00 28.12  ? 147 MET C N   1 
ATOM   6422  C  CA  . MET C  1 147 ? -19.269 14.498  21.192  1.00 29.98  ? 147 MET C CA  1 
ATOM   6423  C  C   . MET C  1 147 ? -17.975 14.650  22.029  1.00 33.35  ? 147 MET C C   1 
ATOM   6424  O  O   . MET C  1 147 ? -16.888 14.835  21.490  1.00 32.04  ? 147 MET C O   1 
ATOM   6425  C  CB  . MET C  1 147 ? -19.627 15.826  20.524  1.00 31.07  ? 147 MET C CB  1 
ATOM   6426  C  CG  . MET C  1 147 ? -20.732 15.730  19.455  1.00 28.08  ? 147 MET C CG  1 
ATOM   6427  S  SD  . MET C  1 147 ? -20.242 14.696  18.072  1.00 34.33  ? 147 MET C SD  1 
ATOM   6428  C  CE  . MET C  1 147 ? -21.013 13.131  18.502  1.00 29.32  ? 147 MET C CE  1 
ATOM   6429  N  N   . ILE C  1 148 ? -18.106 14.553  23.343  1.00 30.79  ? 148 ILE C N   1 
ATOM   6430  C  CA  . ILE C  1 148 ? -16.979 14.743  24.248  1.00 30.43  ? 148 ILE C CA  1 
ATOM   6431  C  C   . ILE C  1 148 ? -16.007 13.540  24.362  1.00 33.72  ? 148 ILE C C   1 
ATOM   6432  O  O   . ILE C  1 148 ? -14.792 13.736  24.440  1.00 35.27  ? 148 ILE C O   1 
ATOM   6433  C  CB  . ILE C  1 148 ? -17.475 15.125  25.661  1.00 26.30  ? 148 ILE C CB  1 
ATOM   6434  C  CG1 . ILE C  1 148 ? -18.208 16.453  25.616  1.00 25.62  ? 148 ILE C CG1 1 
ATOM   6435  C  CG2 . ILE C  1 148 ? -16.307 15.161  26.653  1.00 28.00  ? 148 ILE C CG2 1 
ATOM   6436  C  CD1 . ILE C  1 148 ? -19.056 16.694  26.839  1.00 31.05  ? 148 ILE C CD1 1 
ATOM   6437  N  N   . PRO C  1 149 ? -16.529 12.299  24.376  1.00 32.91  ? 149 PRO C N   1 
ATOM   6438  C  CA  . PRO C  1 149 ? -15.647 11.151  24.652  1.00 33.71  ? 149 PRO C CA  1 
ATOM   6439  C  C   . PRO C  1 149 ? -14.571 10.909  23.606  1.00 30.30  ? 149 PRO C C   1 
ATOM   6440  O  O   . PRO C  1 149 ? -13.622 10.209  23.902  1.00 27.59  ? 149 PRO C O   1 
ATOM   6441  C  CB  . PRO C  1 149 ? -16.607 9.954   24.634  1.00 29.22  ? 149 PRO C CB  1 
ATOM   6442  C  CG  . PRO C  1 149 ? -17.951 10.515  24.835  1.00 26.48  ? 149 PRO C CG  1 
ATOM   6443  C  CD  . PRO C  1 149 ? -17.925 11.869  24.190  1.00 33.37  ? 149 PRO C CD  1 
ATOM   6444  N  N   . ASP C  1 150 ? -14.730 11.441  22.401  1.00 30.20  ? 150 ASP C N   1 
ATOM   6445  C  CA  . ASP C  1 150 ? -13.825 11.092  21.310  1.00 24.92  ? 150 ASP C CA  1 
ATOM   6446  C  C   . ASP C  1 150 ? -13.541 12.323  20.457  1.00 28.44  ? 150 ASP C C   1 
ATOM   6447  O  O   . ASP C  1 150 ? -12.410 12.791  20.383  1.00 33.89  ? 150 ASP C O   1 
ATOM   6448  C  CB  . ASP C  1 150 ? -14.453 9.975   20.466  1.00 31.13  ? 150 ASP C CB  1 
ATOM   6449  C  CG  . ASP C  1 150 ? -13.476 9.326   19.470  1.00 33.90  ? 150 ASP C CG  1 
ATOM   6450  O  OD1 . ASP C  1 150 ? -12.439 9.923   19.093  1.00 28.97  ? 150 ASP C OD1 1 
ATOM   6451  O  OD2 . ASP C  1 150 ? -13.792 8.203   19.025  1.00 30.67  ? 150 ASP C OD2 1 
ATOM   6452  N  N   . MET C  1 151 ? -14.580 12.864  19.834  1.00 27.00  ? 151 MET C N   1 
ATOM   6453  C  CA  . MET C  1 151 ? -14.398 13.964  18.896  1.00 28.24  ? 151 MET C CA  1 
ATOM   6454  C  C   . MET C  1 151 ? -13.706 15.168  19.537  1.00 31.53  ? 151 MET C C   1 
ATOM   6455  O  O   . MET C  1 151 ? -12.792 15.742  18.960  1.00 33.01  ? 151 MET C O   1 
ATOM   6456  C  CB  . MET C  1 151 ? -15.740 14.399  18.296  1.00 32.53  ? 151 MET C CB  1 
ATOM   6457  C  CG  . MET C  1 151 ? -16.483 13.300  17.529  1.00 31.97  ? 151 MET C CG  1 
ATOM   6458  S  SD  . MET C  1 151 ? -15.529 12.652  16.146  1.00 36.01  ? 151 MET C SD  1 
ATOM   6459  C  CE  . MET C  1 151 ? -14.690 11.224  16.877  1.00 37.77  ? 151 MET C CE  1 
ATOM   6460  N  N   . MET C  1 152 ? -14.154 15.565  20.721  1.00 29.49  ? 152 MET C N   1 
ATOM   6461  C  CA  . MET C  1 152 ? -13.588 16.747  21.348  1.00 32.38  ? 152 MET C CA  1 
ATOM   6462  C  C   . MET C  1 152 ? -12.197 16.458  21.929  1.00 34.17  ? 152 MET C C   1 
ATOM   6463  O  O   . MET C  1 152 ? -11.272 17.252  21.765  1.00 30.60  ? 152 MET C O   1 
ATOM   6464  C  CB  . MET C  1 152 ? -14.516 17.298  22.426  1.00 34.72  ? 152 MET C CB  1 
ATOM   6465  C  CG  . MET C  1 152 ? -14.099 18.656  22.935  1.00 34.81  ? 152 MET C CG  1 
ATOM   6466  S  SD  . MET C  1 152 ? -15.228 19.279  24.177  1.00 41.11  ? 152 MET C SD  1 
ATOM   6467  C  CE  . MET C  1 152 ? -16.763 19.167  23.288  1.00 39.13  ? 152 MET C CE  1 
ATOM   6468  N  N   . THR C  1 153 ? -12.042 15.311  22.586  1.00 33.65  ? 153 THR C N   1 
ATOM   6469  C  CA  . THR C  1 153 ? -10.761 15.005  23.178  1.00 28.29  ? 153 THR C CA  1 
ATOM   6470  C  C   . THR C  1 153 ? -9.702  14.804  22.096  1.00 27.20  ? 153 THR C C   1 
ATOM   6471  O  O   . THR C  1 153 ? -8.593  15.270  22.257  1.00 26.56  ? 153 THR C O   1 
ATOM   6472  C  CB  . THR C  1 153 ? -10.796 13.813  24.150  1.00 32.98  ? 153 THR C CB  1 
ATOM   6473  O  OG1 . THR C  1 153 ? -9.467  13.582  24.638  1.00 32.31  ? 153 THR C OG1 1 
ATOM   6474  C  CG2 . THR C  1 153 ? -11.358 12.534  23.476  1.00 27.66  ? 153 THR C CG2 1 
ATOM   6475  N  N   . THR C  1 154 ? -10.060 14.147  20.991  1.00 22.12  ? 154 THR C N   1 
ATOM   6476  C  CA  . THR C  1 154 ? -9.129  13.971  19.866  1.00 27.39  ? 154 THR C CA  1 
ATOM   6477  C  C   . THR C  1 154 ? -8.735  15.275  19.162  1.00 32.59  ? 154 THR C C   1 
ATOM   6478  O  O   . THR C  1 154 ? -7.550  15.553  18.955  1.00 32.92  ? 154 THR C O   1 
ATOM   6479  C  CB  . THR C  1 154 ? -9.690  12.998  18.813  1.00 29.64  ? 154 THR C CB  1 
ATOM   6480  O  OG1 . THR C  1 154 ? -10.025 11.763  19.450  1.00 31.39  ? 154 THR C OG1 1 
ATOM   6481  C  CG2 . THR C  1 154 ? -8.653  12.730  17.710  1.00 27.15  ? 154 THR C CG2 1 
ATOM   6482  N  N   . GLY C  1 155 ? -9.734  16.065  18.775  1.00 34.88  ? 155 GLY C N   1 
ATOM   6483  C  CA  . GLY C  1 155 ? -9.482  17.331  18.115  1.00 27.24  ? 155 GLY C CA  1 
ATOM   6484  C  C   . GLY C  1 155 ? -8.656  18.275  18.987  1.00 30.89  ? 155 GLY C C   1 
ATOM   6485  O  O   . GLY C  1 155 ? -7.678  18.864  18.528  1.00 25.76  ? 155 GLY C O   1 
ATOM   6486  N  N   . PHE C  1 156 ? -9.041  18.418  20.250  1.00 35.06  ? 156 PHE C N   1 
ATOM   6487  C  CA  . PHE C  1 156 ? -8.312  19.278  21.182  1.00 29.99  ? 156 PHE C CA  1 
ATOM   6488  C  C   . PHE C  1 156 ? -6.881  18.778  21.431  1.00 33.41  ? 156 PHE C C   1 
ATOM   6489  O  O   . PHE C  1 156 ? -5.972  19.563  21.649  1.00 33.71  ? 156 PHE C O   1 
ATOM   6490  C  CB  . PHE C  1 156 ? -9.088  19.413  22.500  1.00 30.15  ? 156 PHE C CB  1 
ATOM   6491  C  CG  . PHE C  1 156 ? -10.286 20.338  22.415  1.00 34.29  ? 156 PHE C CG  1 
ATOM   6492  C  CD1 . PHE C  1 156 ? -10.791 20.739  21.184  1.00 32.82  ? 156 PHE C CD1 1 
ATOM   6493  C  CD2 . PHE C  1 156 ? -10.917 20.782  23.563  1.00 36.82  ? 156 PHE C CD2 1 
ATOM   6494  C  CE1 . PHE C  1 156 ? -11.889 21.580  21.105  1.00 34.76  ? 156 PHE C CE1 1 
ATOM   6495  C  CE2 . PHE C  1 156 ? -12.020 21.629  23.486  1.00 40.71  ? 156 PHE C CE2 1 
ATOM   6496  C  CZ  . PHE C  1 156 ? -12.504 22.020  22.254  1.00 33.38  ? 156 PHE C CZ  1 
ATOM   6497  N  N   . HIS C  1 157 ? -6.679  17.467  21.391  1.00 33.92  ? 157 HIS C N   1 
ATOM   6498  C  CA  . HIS C  1 157 ? -5.338  16.922  21.558  1.00 31.20  ? 157 HIS C CA  1 
ATOM   6499  C  C   . HIS C  1 157 ? -4.451  17.303  20.382  1.00 24.26  ? 157 HIS C C   1 
ATOM   6500  O  O   . HIS C  1 157 ? -3.272  17.567  20.552  1.00 34.73  ? 157 HIS C O   1 
ATOM   6501  C  CB  . HIS C  1 157 ? -5.386  15.403  21.731  1.00 34.64  ? 157 HIS C CB  1 
ATOM   6502  C  CG  . HIS C  1 157 ? -4.131  14.821  22.311  1.00 36.25  ? 157 HIS C CG  1 
ATOM   6503  N  ND1 . HIS C  1 157 ? -3.577  15.274  23.492  1.00 27.15  ? 157 HIS C ND1 1 
ATOM   6504  C  CD2 . HIS C  1 157 ? -3.336  13.810  21.885  1.00 34.94  ? 157 HIS C CD2 1 
ATOM   6505  C  CE1 . HIS C  1 157 ? -2.499  14.557  23.772  1.00 29.61  ? 157 HIS C CE1 1 
ATOM   6506  N  NE2 . HIS C  1 157 ? -2.327  13.667  22.810  1.00 35.74  ? 157 HIS C NE2 1 
ATOM   6507  N  N   . GLY C  1 158 ? -5.027  17.336  19.184  1.00 28.02  ? 158 GLY C N   1 
ATOM   6508  C  CA  . GLY C  1 158 ? -4.313  17.857  18.031  1.00 29.75  ? 158 GLY C CA  1 
ATOM   6509  C  C   . GLY C  1 158 ? -3.773  19.261  18.293  1.00 27.66  ? 158 GLY C C   1 
ATOM   6510  O  O   . GLY C  1 158 ? -2.645  19.588  17.923  1.00 28.03  ? 158 GLY C O   1 
ATOM   6511  N  N   . ALA C  1 159 ? -4.582  20.091  18.942  1.00 26.96  ? 159 ALA C N   1 
ATOM   6512  C  CA  . ALA C  1 159 ? -4.204  21.479  19.233  1.00 25.27  ? 159 ALA C CA  1 
ATOM   6513  C  C   . ALA C  1 159 ? -3.215  21.554  20.393  1.00 27.68  ? 159 ALA C C   1 
ATOM   6514  O  O   . ALA C  1 159 ? -2.347  22.415  20.404  1.00 31.13  ? 159 ALA C O   1 
ATOM   6515  C  CB  . ALA C  1 159 ? -5.453  22.325  19.532  1.00 23.18  ? 159 ALA C CB  1 
ATOM   6516  N  N   . GLU C  1 160 ? -3.352  20.637  21.357  1.00 25.00  ? 160 GLU C N   1 
ATOM   6517  C  CA  . GLU C  1 160 ? -2.409  20.517  22.481  1.00 28.93  ? 160 GLU C CA  1 
ATOM   6518  C  C   . GLU C  1 160 ? -1.019  20.081  22.039  1.00 34.35  ? 160 GLU C C   1 
ATOM   6519  O  O   . GLU C  1 160 ? -0.009  20.694  22.422  1.00 29.39  ? 160 GLU C O   1 
ATOM   6520  C  CB  . GLU C  1 160 ? -2.929  19.527  23.531  1.00 23.85  ? 160 GLU C CB  1 
ATOM   6521  C  CG  . GLU C  1 160 ? -4.094  20.066  24.344  1.00 34.93  ? 160 GLU C CG  1 
ATOM   6522  C  CD  . GLU C  1 160 ? -4.845  18.961  25.062  1.00 35.48  ? 160 GLU C CD  1 
ATOM   6523  O  OE1 . GLU C  1 160 ? -4.933  17.838  24.510  1.00 29.24  ? 160 GLU C OE1 1 
ATOM   6524  O  OE2 . GLU C  1 160 ? -5.342  19.215  26.176  1.00 29.65  ? 160 GLU C OE2 1 
ATOM   6525  N  N   . LEU C  1 161 ? -0.973  19.003  21.258  1.00 32.15  ? 161 LEU C N   1 
ATOM   6526  C  CA  . LEU C  1 161 ? 0.281   18.498  20.718  1.00 32.03  ? 161 LEU C CA  1 
ATOM   6527  C  C   . LEU C  1 161 ? 0.964   19.557  19.868  1.00 28.98  ? 161 LEU C C   1 
ATOM   6528  O  O   . LEU C  1 161 ? 2.191   19.635  19.829  1.00 28.77  ? 161 LEU C O   1 
ATOM   6529  C  CB  . LEU C  1 161 ? 0.038   17.245  19.873  1.00 29.60  ? 161 LEU C CB  1 
ATOM   6530  C  CG  . LEU C  1 161 ? -0.387  15.987  20.640  1.00 38.11  ? 161 LEU C CG  1 
ATOM   6531  C  CD1 . LEU C  1 161 ? -0.511  14.814  19.695  1.00 35.48  ? 161 LEU C CD1 1 
ATOM   6532  C  CD2 . LEU C  1 161 ? 0.600   15.667  21.764  1.00 34.96  ? 161 LEU C CD2 1 
ATOM   6533  N  N   . ALA C  1 162 ? 0.161   20.358  19.170  1.00 22.35  ? 162 ALA C N   1 
ATOM   6534  C  CA  . ALA C  1 162 ? 0.697   21.417  18.318  1.00 26.30  ? 162 ALA C CA  1 
ATOM   6535  C  C   . ALA C  1 162 ? 1.480   22.501  19.081  1.00 28.45  ? 162 ALA C C   1 
ATOM   6536  O  O   . ALA C  1 162 ? 2.232   23.254  18.472  1.00 31.61  ? 162 ALA C O   1 
ATOM   6537  C  CB  . ALA C  1 162 ? -0.413  22.054  17.499  1.00 30.59  ? 162 ALA C CB  1 
ATOM   6538  N  N   . ASP C  1 163 ? 1.294   22.595  20.395  1.00 27.32  ? 163 ASP C N   1 
ATOM   6539  C  CA  . ASP C  1 163 ? 2.035   23.588  21.181  1.00 29.32  ? 163 ASP C CA  1 
ATOM   6540  C  C   . ASP C  1 163 ? 1.923   24.962  20.497  1.00 33.33  ? 163 ASP C C   1 
ATOM   6541  O  O   . ASP C  1 163 ? 2.919   25.575  20.099  1.00 24.43  ? 163 ASP C O   1 
ATOM   6542  C  CB  . ASP C  1 163 ? 3.494   23.161  21.276  1.00 30.64  ? 163 ASP C CB  1 
ATOM   6543  C  CG  . ASP C  1 163 ? 4.228   23.820  22.426  1.00 41.71  ? 163 ASP C CG  1 
ATOM   6544  O  OD1 . ASP C  1 163 ? 3.589   24.508  23.257  1.00 45.87  ? 163 ASP C OD1 1 
ATOM   6545  O  OD2 . ASP C  1 163 ? 5.458   23.638  22.496  1.00 42.80  ? 163 ASP C OD2 1 
ATOM   6546  N  N   . ILE C  1 164 ? 0.687   25.420  20.348  1.00 28.54  ? 164 ILE C N   1 
ATOM   6547  C  CA  . ILE C  1 164 ? 0.381   26.655  19.639  1.00 25.85  ? 164 ILE C CA  1 
ATOM   6548  C  C   . ILE C  1 164 ? 0.772   27.905  20.426  1.00 29.10  ? 164 ILE C C   1 
ATOM   6549  O  O   . ILE C  1 164 ? 0.481   28.006  21.624  1.00 34.84  ? 164 ILE C O   1 
ATOM   6550  C  CB  . ILE C  1 164 ? -1.119  26.687  19.317  1.00 25.22  ? 164 ILE C CB  1 
ATOM   6551  C  CG1 . ILE C  1 164 ? -1.436  25.594  18.292  1.00 23.77  ? 164 ILE C CG1 1 
ATOM   6552  C  CG2 . ILE C  1 164 ? -1.546  28.075  18.824  1.00 29.48  ? 164 ILE C CG2 1 
ATOM   6553  C  CD1 . ILE C  1 164 ? -2.868  25.163  18.305  1.00 28.52  ? 164 ILE C CD1 1 
ATOM   6554  N  N   . GLU C  1 165 ? 1.444   28.834  19.745  1.00 23.24  ? 165 GLU C N   1 
ATOM   6555  C  CA  . GLU C  1 165 ? 1.824   30.148  20.290  1.00 26.65  ? 165 GLU C CA  1 
ATOM   6556  C  C   . GLU C  1 165 ? 0.686   31.125  20.039  1.00 27.89  ? 165 GLU C C   1 
ATOM   6557  O  O   . GLU C  1 165 ? 0.031   31.050  19.003  1.00 35.01  ? 165 GLU C O   1 
ATOM   6558  C  CB  . GLU C  1 165 ? 3.070   30.705  19.576  1.00 32.36  ? 165 GLU C CB  1 
ATOM   6559  C  CG  . GLU C  1 165 ? 4.377   29.881  19.723  1.00 36.80  ? 165 GLU C CG  1 
ATOM   6560  C  CD  . GLU C  1 165 ? 5.319   30.054  18.520  1.00 46.53  ? 165 GLU C CD  1 
ATOM   6561  O  OE1 . GLU C  1 165 ? 6.346   30.753  18.646  1.00 48.23  ? 165 GLU C OE1 1 
ATOM   6562  O  OE2 . GLU C  1 165 ? 5.026   29.502  17.433  1.00 53.23  ? 165 GLU C OE2 1 
ATOM   6563  N  N   . MET C  1 166 ? 0.454   32.053  20.966  1.00 29.87  ? 166 MET C N   1 
ATOM   6564  C  CA  . MET C  1 166 ? -0.660  32.985  20.828  1.00 31.26  ? 166 MET C CA  1 
ATOM   6565  C  C   . MET C  1 166 ? -0.477  33.823  19.575  1.00 26.97  ? 166 MET C C   1 
ATOM   6566  O  O   . MET C  1 166 ? 0.597   34.388  19.351  1.00 28.76  ? 166 MET C O   1 
ATOM   6567  C  CB  . MET C  1 166 ? -0.787  33.883  22.065  1.00 37.03  ? 166 MET C CB  1 
ATOM   6568  C  CG  . MET C  1 166 ? -0.914  33.098  23.333  1.00 35.31  ? 166 MET C CG  1 
ATOM   6569  S  SD  . MET C  1 166 ? -1.786  33.907  24.671  1.00 44.24  ? 166 MET C SD  1 
ATOM   6570  C  CE  . MET C  1 166 ? -3.437  33.922  23.982  1.00 36.78  ? 166 MET C CE  1 
ATOM   6571  N  N   . GLY C  1 167 ? -1.516  33.877  18.750  1.00 30.84  ? 167 GLY C N   1 
ATOM   6572  C  CA  . GLY C  1 167 ? -1.501  34.715  17.559  1.00 29.73  ? 167 GLY C CA  1 
ATOM   6573  C  C   . GLY C  1 167 ? -0.858  34.038  16.361  1.00 32.12  ? 167 GLY C C   1 
ATOM   6574  O  O   . GLY C  1 167 ? -0.848  34.592  15.268  1.00 32.84  ? 167 GLY C O   1 
ATOM   6575  N  N   . SER C  1 168 ? -0.323  32.836  16.552  1.00 29.24  ? 168 SER C N   1 
ATOM   6576  C  CA  . SER C  1 168 ? 0.331   32.139  15.437  1.00 36.40  ? 168 SER C CA  1 
ATOM   6577  C  C   . SER C  1 168 ? -0.653  31.522  14.419  1.00 34.00  ? 168 SER C C   1 
ATOM   6578  O  O   . SER C  1 168 ? -1.846  31.363  14.702  1.00 36.32  ? 168 SER C O   1 
ATOM   6579  C  CB  . SER C  1 168 ? 1.346   31.099  15.940  1.00 28.52  ? 168 SER C CB  1 
ATOM   6580  O  OG  . SER C  1 168 ? 0.709   29.923  16.421  1.00 30.52  ? 168 SER C OG  1 
ATOM   6581  N  N   . SER C  1 169 ? -0.147  31.210  13.225  1.00 25.07  ? 169 SER C N   1 
ATOM   6582  C  CA  . SER C  1 169 ? -0.996  30.683  12.157  1.00 33.83  ? 169 SER C CA  1 
ATOM   6583  C  C   . SER C  1 169 ? -1.043  29.151  12.170  1.00 35.74  ? 169 SER C C   1 
ATOM   6584  O  O   . SER C  1 169 ? -0.030  28.486  12.390  1.00 31.36  ? 169 SER C O   1 
ATOM   6585  C  CB  . SER C  1 169 ? -0.490  31.148  10.796  1.00 35.15  ? 169 SER C CB  1 
ATOM   6586  O  OG  . SER C  1 169 ? 0.855   30.748  10.607  1.00 35.06  ? 169 SER C OG  1 
ATOM   6587  N  N   . VAL C  1 170 ? -2.226  28.603  11.927  1.00 36.13  ? 170 VAL C N   1 
ATOM   6588  C  CA  . VAL C  1 170 ? -2.422  27.160  11.967  1.00 32.62  ? 170 VAL C CA  1 
ATOM   6589  C  C   . VAL C  1 170 ? -3.200  26.671  10.752  1.00 31.40  ? 170 VAL C C   1 
ATOM   6590  O  O   . VAL C  1 170 ? -4.203  27.262  10.364  1.00 30.08  ? 170 VAL C O   1 
ATOM   6591  C  CB  . VAL C  1 170 ? -3.162  26.743  13.254  1.00 31.39  ? 170 VAL C CB  1 
ATOM   6592  C  CG1 . VAL C  1 170 ? -3.381  25.238  13.288  1.00 31.51  ? 170 VAL C CG1 1 
ATOM   6593  C  CG2 . VAL C  1 170 ? -2.379  27.219  14.490  1.00 28.97  ? 170 VAL C CG2 1 
ATOM   6594  N  N   . VAL C  1 171 ? -2.715  25.595  10.147  1.00 30.06  ? 171 VAL C N   1 
ATOM   6595  C  CA  . VAL C  1 171 ? -3.469  24.904  9.120   1.00 30.59  ? 171 VAL C CA  1 
ATOM   6596  C  C   . VAL C  1 171 ? -4.030  23.595  9.661   1.00 33.76  ? 171 VAL C C   1 
ATOM   6597  O  O   . VAL C  1 171 ? -3.304  22.797  10.260  1.00 32.06  ? 171 VAL C O   1 
ATOM   6598  C  CB  . VAL C  1 171 ? -2.619  24.652  7.860   1.00 31.53  ? 171 VAL C CB  1 
ATOM   6599  C  CG1 . VAL C  1 171 ? -3.294  23.631  6.969   1.00 28.21  ? 171 VAL C CG1 1 
ATOM   6600  C  CG2 . VAL C  1 171 ? -2.388  25.978  7.094   1.00 26.84  ? 171 VAL C CG2 1 
ATOM   6601  N  N   . VAL C  1 172 ? -5.333  23.394  9.472   1.00 30.86  ? 172 VAL C N   1 
ATOM   6602  C  CA  . VAL C  1 172 ? -5.967  22.143  9.840   1.00 30.55  ? 172 VAL C CA  1 
ATOM   6603  C  C   . VAL C  1 172 ? -6.391  21.412  8.595   1.00 35.28  ? 172 VAL C C   1 
ATOM   6604  O  O   . VAL C  1 172 ? -7.283  21.866  7.847   1.00 31.07  ? 172 VAL C O   1 
ATOM   6605  C  CB  . VAL C  1 172 ? -7.204  22.327  10.710  1.00 31.09  ? 172 VAL C CB  1 
ATOM   6606  C  CG1 . VAL C  1 172 ? -7.778  20.947  11.059  1.00 26.14  ? 172 VAL C CG1 1 
ATOM   6607  C  CG2 . VAL C  1 172 ? -6.859  23.088  11.968  1.00 24.82  ? 172 VAL C CG2 1 
ATOM   6608  N  N   . ILE C  1 173 ? -5.750  20.277  8.362   1.00 31.29  ? 173 ILE C N   1 
ATOM   6609  C  CA  . ILE C  1 173 ? -6.000  19.548  7.138   1.00 31.96  ? 173 ILE C CA  1 
ATOM   6610  C  C   . ILE C  1 173 ? -7.057  18.493  7.383   1.00 33.89  ? 173 ILE C C   1 
ATOM   6611  O  O   . ILE C  1 173 ? -6.803  17.515  8.092   1.00 30.89  ? 173 ILE C O   1 
ATOM   6612  C  CB  . ILE C  1 173 ? -4.741  18.872  6.603   1.00 35.34  ? 173 ILE C CB  1 
ATOM   6613  C  CG1 . ILE C  1 173 ? -3.624  19.887  6.400   1.00 28.54  ? 173 ILE C CG1 1 
ATOM   6614  C  CG2 . ILE C  1 173 ? -5.044  18.124  5.286   1.00 34.35  ? 173 ILE C CG2 1 
ATOM   6615  C  CD1 . ILE C  1 173 ? -2.340  19.236  5.858   1.00 29.88  ? 173 ILE C CD1 1 
ATOM   6616  N  N   . GLY C  1 174 ? -8.233  18.689  6.781   1.00 31.29  ? 174 GLY C N   1 
ATOM   6617  C  CA  . GLY C  1 174 ? -9.358  17.786  6.972   1.00 26.81  ? 174 GLY C CA  1 
ATOM   6618  C  C   . GLY C  1 174 ? -10.334 18.392  7.954   1.00 33.86  ? 174 GLY C C   1 
ATOM   6619  O  O   . GLY C  1 174 ? -9.966  18.707  9.095   1.00 34.22  ? 174 GLY C O   1 
ATOM   6620  N  N   . ILE C  1 175 ? -11.576 18.590  7.514   1.00 33.98  ? 175 ILE C N   1 
ATOM   6621  C  CA  . ILE C  1 175 ? -12.551 19.282  8.352   1.00 38.65  ? 175 ILE C CA  1 
ATOM   6622  C  C   . ILE C  1 175 ? -13.810 18.449  8.639   1.00 40.93  ? 175 ILE C C   1 
ATOM   6623  O  O   . ILE C  1 175 ? -14.924 18.975  8.684   1.00 32.83  ? 175 ILE C O   1 
ATOM   6624  C  CB  . ILE C  1 175 ? -12.888 20.673  7.796   1.00 38.52  ? 175 ILE C CB  1 
ATOM   6625  C  CG1 . ILE C  1 175 ? -13.400 20.554  6.362   1.00 43.06  ? 175 ILE C CG1 1 
ATOM   6626  C  CG2 . ILE C  1 175 ? -11.644 21.583  7.860   1.00 31.17  ? 175 ILE C CG2 1 
ATOM   6627  C  CD1 . ILE C  1 175 ? -13.896 21.876  5.779   1.00 49.21  ? 175 ILE C CD1 1 
ATOM   6628  N  N   . GLY C  1 176 ? -13.603 17.144  8.836   1.00 42.31  ? 176 GLY C N   1 
ATOM   6629  C  CA  . GLY C  1 176 ? -14.609 16.262  9.402   1.00 33.80  ? 176 GLY C CA  1 
ATOM   6630  C  C   . GLY C  1 176 ? -14.693 16.548  10.892  1.00 34.72  ? 176 GLY C C   1 
ATOM   6631  O  O   . GLY C  1 176 ? -14.074 17.491  11.369  1.00 36.64  ? 176 GLY C O   1 
ATOM   6632  N  N   . ALA C  1 177 ? -15.441 15.736  11.631  1.00 33.76  ? 177 ALA C N   1 
ATOM   6633  C  CA  . ALA C  1 177 ? -15.650 15.980  13.052  1.00 32.62  ? 177 ALA C CA  1 
ATOM   6634  C  C   . ALA C  1 177 ? -14.346 16.282  13.844  1.00 31.60  ? 177 ALA C C   1 
ATOM   6635  O  O   . ALA C  1 177 ? -14.275 17.267  14.579  1.00 30.71  ? 177 ALA C O   1 
ATOM   6636  C  CB  . ALA C  1 177 ? -16.407 14.812  13.682  1.00 31.30  ? 177 ALA C CB  1 
ATOM   6637  N  N   . VAL C  1 178 ? -13.328 15.442  13.700  1.00 30.79  ? 178 VAL C N   1 
ATOM   6638  C  CA  . VAL C  1 178 ? -12.093 15.647  14.455  1.00 32.90  ? 178 VAL C CA  1 
ATOM   6639  C  C   . VAL C  1 178 ? -11.426 16.970  14.058  1.00 31.47  ? 178 VAL C C   1 
ATOM   6640  O  O   . VAL C  1 178 ? -10.988 17.729  14.920  1.00 30.83  ? 178 VAL C O   1 
ATOM   6641  C  CB  . VAL C  1 178 ? -11.099 14.473  14.288  1.00 31.48  ? 178 VAL C CB  1 
ATOM   6642  C  CG1 . VAL C  1 178 ? -9.802  14.796  15.015  1.00 30.62  ? 178 VAL C CG1 1 
ATOM   6643  C  CG2 . VAL C  1 178 ? -11.699 13.190  14.839  1.00 29.90  ? 178 VAL C CG2 1 
ATOM   6644  N  N   . GLY C  1 179 ? -11.371 17.242  12.753  1.00 31.55  ? 179 GLY C N   1 
ATOM   6645  C  CA  . GLY C  1 179 ? -10.765 18.457  12.231  1.00 28.93  ? 179 GLY C CA  1 
ATOM   6646  C  C   . GLY C  1 179 ? -11.449 19.725  12.696  1.00 32.72  ? 179 GLY C C   1 
ATOM   6647  O  O   . GLY C  1 179 ? -10.810 20.749  12.964  1.00 31.41  ? 179 GLY C O   1 
ATOM   6648  N  N   . LEU C  1 180 ? -12.769 19.659  12.791  1.00 37.22  ? 180 LEU C N   1 
ATOM   6649  C  CA  . LEU C  1 180 ? -13.544 20.796  13.260  1.00 38.42  ? 180 LEU C CA  1 
ATOM   6650  C  C   . LEU C  1 180 ? -13.246 21.054  14.730  1.00 29.89  ? 180 LEU C C   1 
ATOM   6651  O  O   . LEU C  1 180 ? -13.183 22.194  15.177  1.00 32.77  ? 180 LEU C O   1 
ATOM   6652  C  CB  . LEU C  1 180 ? -15.037 20.541  13.050  1.00 28.15  ? 180 LEU C CB  1 
ATOM   6653  C  CG  . LEU C  1 180 ? -15.441 20.484  11.585  1.00 32.67  ? 180 LEU C CG  1 
ATOM   6654  C  CD1 . LEU C  1 180 ? -16.840 19.927  11.476  1.00 33.34  ? 180 LEU C CD1 1 
ATOM   6655  C  CD2 . LEU C  1 180 ? -15.357 21.890  10.937  1.00 27.89  ? 180 LEU C CD2 1 
ATOM   6656  N  N   . MET C  1 181 ? -13.052 19.990  15.484  1.00 29.57  ? 181 MET C N   1 
ATOM   6657  C  CA  . MET C  1 181 ? -12.692 20.171  16.882  1.00 33.05  ? 181 MET C CA  1 
ATOM   6658  C  C   . MET C  1 181 ? -11.207 20.568  17.002  1.00 33.95  ? 181 MET C C   1 
ATOM   6659  O  O   . MET C  1 181 ? -10.790 21.187  17.987  1.00 31.14  ? 181 MET C O   1 
ATOM   6660  C  CB  . MET C  1 181 ? -13.018 18.904  17.673  1.00 32.03  ? 181 MET C CB  1 
ATOM   6661  C  CG  . MET C  1 181 ? -14.511 18.724  17.962  1.00 25.19  ? 181 MET C CG  1 
ATOM   6662  S  SD  . MET C  1 181 ? -15.178 19.981  19.080  1.00 33.98  ? 181 MET C SD  1 
ATOM   6663  C  CE  . MET C  1 181 ? -15.877 21.125  17.881  1.00 36.82  ? 181 MET C CE  1 
ATOM   6664  N  N   . GLY C  1 182 ? -10.413 20.197  16.000  1.00 31.53  ? 182 GLY C N   1 
ATOM   6665  C  CA  . GLY C  1 182 ? -9.046  20.670  15.910  1.00 31.09  ? 182 GLY C CA  1 
ATOM   6666  C  C   . GLY C  1 182 ? -9.017  22.189  15.734  1.00 34.92  ? 182 GLY C C   1 
ATOM   6667  O  O   . GLY C  1 182 ? -8.279  22.886  16.441  1.00 36.01  ? 182 GLY C O   1 
ATOM   6668  N  N   . ILE C  1 183 ? -9.820  22.700  14.792  1.00 29.92  ? 183 ILE C N   1 
ATOM   6669  C  CA  . ILE C  1 183 ? -9.959  24.146  14.584  1.00 27.25  ? 183 ILE C CA  1 
ATOM   6670  C  C   . ILE C  1 183 ? -10.417 24.837  15.860  1.00 30.46  ? 183 ILE C C   1 
ATOM   6671  O  O   . ILE C  1 183 ? -9.853  25.851  16.274  1.00 28.14  ? 183 ILE C O   1 
ATOM   6672  C  CB  . ILE C  1 183 ? -10.997 24.461  13.493  1.00 29.89  ? 183 ILE C CB  1 
ATOM   6673  C  CG1 . ILE C  1 183 ? -10.429 24.168  12.111  1.00 27.85  ? 183 ILE C CG1 1 
ATOM   6674  C  CG2 . ILE C  1 183 ? -11.415 25.934  13.561  1.00 31.90  ? 183 ILE C CG2 1 
ATOM   6675  C  CD1 . ILE C  1 183 ? -11.509 24.088  11.053  1.00 27.97  ? 183 ILE C CD1 1 
ATOM   6676  N  N   . ALA C  1 184 ? -11.451 24.282  16.484  1.00 32.99  ? 184 ALA C N   1 
ATOM   6677  C  CA  . ALA C  1 184 ? -11.956 24.823  17.740  1.00 32.02  ? 184 ALA C CA  1 
ATOM   6678  C  C   . ALA C  1 184 ? -10.863 24.799  18.835  1.00 33.56  ? 184 ALA C C   1 
ATOM   6679  O  O   . ALA C  1 184 ? -10.642 25.787  19.534  1.00 28.86  ? 184 ALA C O   1 
ATOM   6680  C  CB  . ALA C  1 184 ? -13.190 24.042  18.177  1.00 24.70  ? 184 ALA C CB  1 
ATOM   6681  N  N   . GLY C  1 185 ? -10.183 23.668  18.987  1.00 28.46  ? 185 GLY C N   1 
ATOM   6682  C  CA  . GLY C  1 185 ? -9.091  23.588  19.946  1.00 25.31  ? 185 GLY C CA  1 
ATOM   6683  C  C   . GLY C  1 185 ? -7.983  24.586  19.636  1.00 31.82  ? 185 GLY C C   1 
ATOM   6684  O  O   . GLY C  1 185 ? -7.432  25.227  20.536  1.00 29.51  ? 185 GLY C O   1 
ATOM   6685  N  N   . ALA C  1 186 ? -7.640  24.710  18.358  1.00 30.20  ? 186 ALA C N   1 
ATOM   6686  C  CA  . ALA C  1 186 ? -6.618  25.671  17.948  1.00 28.33  ? 186 ALA C CA  1 
ATOM   6687  C  C   . ALA C  1 186 ? -7.026  27.074  18.381  1.00 35.36  ? 186 ALA C C   1 
ATOM   6688  O  O   . ALA C  1 186 ? -6.207  27.874  18.826  1.00 34.34  ? 186 ALA C O   1 
ATOM   6689  C  CB  . ALA C  1 186 ? -6.425  25.629  16.442  1.00 22.55  ? 186 ALA C CB  1 
ATOM   6690  N  N   . LYS C  1 187 ? -8.310  27.369  18.237  1.00 34.94  ? 187 LYS C N   1 
ATOM   6691  C  CA  . LYS C  1 187 ? -8.815  28.684  18.579  1.00 39.09  ? 187 LYS C CA  1 
ATOM   6692  C  C   . LYS C  1 187 ? -8.733  28.868  20.088  1.00 35.57  ? 187 LYS C C   1 
ATOM   6693  O  O   . LYS C  1 187 ? -8.388  29.951  20.584  1.00 34.43  ? 187 LYS C O   1 
ATOM   6694  C  CB  . LYS C  1 187 ? -10.249 28.856  18.054  1.00 41.35  ? 187 LYS C CB  1 
ATOM   6695  C  CG  . LYS C  1 187 ? -11.100 29.859  18.801  1.00 48.22  ? 187 LYS C CG  1 
ATOM   6696  C  CD  . LYS C  1 187 ? -10.672 31.266  18.558  1.00 60.71  ? 187 LYS C CD  1 
ATOM   6697  C  CE  . LYS C  1 187 ? -11.762 32.229  19.025  1.00 74.28  ? 187 LYS C CE  1 
ATOM   6698  N  NZ  . LYS C  1 187 ? -13.036 32.026  18.259  1.00 77.14  ? 187 LYS C NZ  1 
ATOM   6699  N  N   . LEU C  1 188 ? -9.054  27.805  20.812  1.00 32.07  ? 188 LEU C N   1 
ATOM   6700  C  CA  . LEU C  1 188 ? -8.991  27.838  22.260  1.00 38.45  ? 188 LEU C CA  1 
ATOM   6701  C  C   . LEU C  1 188 ? -7.547  27.779  22.792  1.00 42.55  ? 188 LEU C C   1 
ATOM   6702  O  O   . LEU C  1 188 ? -7.339  27.817  24.002  1.00 45.32  ? 188 LEU C O   1 
ATOM   6703  C  CB  . LEU C  1 188 ? -9.826  26.704  22.860  1.00 39.37  ? 188 LEU C CB  1 
ATOM   6704  C  CG  . LEU C  1 188 ? -11.338 26.830  22.666  1.00 41.09  ? 188 LEU C CG  1 
ATOM   6705  C  CD1 . LEU C  1 188 ? -12.056 25.656  23.302  1.00 44.25  ? 188 LEU C CD1 1 
ATOM   6706  C  CD2 . LEU C  1 188 ? -11.840 28.153  23.235  1.00 33.35  ? 188 LEU C CD2 1 
ATOM   6707  N  N   . ARG C  1 189 ? -6.560  27.671  21.906  1.00 34.23  ? 189 ARG C N   1 
ATOM   6708  C  CA  . ARG C  1 189 ? -5.162  27.756  22.350  1.00 36.12  ? 189 ARG C CA  1 
ATOM   6709  C  C   . ARG C  1 189 ? -4.570  29.100  21.940  1.00 35.99  ? 189 ARG C C   1 
ATOM   6710  O  O   . ARG C  1 189 ? -3.397  29.397  22.213  1.00 29.06  ? 189 ARG C O   1 
ATOM   6711  C  CB  . ARG C  1 189 ? -4.321  26.585  21.836  1.00 28.73  ? 189 ARG C CB  1 
ATOM   6712  C  CG  . ARG C  1 189 ? -4.723  25.231  22.421  1.00 28.50  ? 189 ARG C CG  1 
ATOM   6713  C  CD  . ARG C  1 189 ? -4.630  25.227  23.946  1.00 30.85  ? 189 ARG C CD  1 
ATOM   6714  N  NE  . ARG C  1 189 ? -3.247  25.070  24.378  1.00 31.24  ? 189 ARG C NE  1 
ATOM   6715  C  CZ  . ARG C  1 189 ? -2.822  25.145  25.637  1.00 41.79  ? 189 ARG C CZ  1 
ATOM   6716  N  NH1 . ARG C  1 189 ? -3.669  25.397  26.628  1.00 41.10  ? 189 ARG C NH1 1 
ATOM   6717  N  NH2 . ARG C  1 189 ? -1.534  24.965  25.905  1.00 43.71  ? 189 ARG C NH2 1 
ATOM   6718  N  N   . GLY C  1 190 ? -5.406  29.910  21.290  1.00 30.03  ? 190 GLY C N   1 
ATOM   6719  C  CA  . GLY C  1 190 ? -5.080  31.294  20.997  1.00 27.71  ? 190 GLY C CA  1 
ATOM   6720  C  C   . GLY C  1 190 ? -4.460  31.541  19.638  1.00 31.41  ? 190 GLY C C   1 
ATOM   6721  O  O   . GLY C  1 190 ? -3.741  32.524  19.456  1.00 32.92  ? 190 GLY C O   1 
ATOM   6722  N  N   . ALA C  1 191 ? -4.726  30.656  18.678  1.00 25.89  ? 191 ALA C N   1 
ATOM   6723  C  CA  . ALA C  1 191 ? -4.234  30.864  17.319  1.00 27.69  ? 191 ALA C CA  1 
ATOM   6724  C  C   . ALA C  1 191 ? -4.791  32.152  16.676  1.00 32.19  ? 191 ALA C C   1 
ATOM   6725  O  O   . ALA C  1 191 ? -5.918  32.580  16.972  1.00 23.80  ? 191 ALA C O   1 
ATOM   6726  C  CB  . ALA C  1 191 ? -4.565  29.675  16.459  1.00 29.14  ? 191 ALA C CB  1 
ATOM   6727  N  N   . GLY C  1 192 ? -4.007  32.758  15.782  1.00 32.92  ? 192 GLY C N   1 
ATOM   6728  C  CA  . GLY C  1 192 ? -4.502  33.887  15.000  1.00 30.31  ? 192 GLY C CA  1 
ATOM   6729  C  C   . GLY C  1 192 ? -5.288  33.386  13.797  1.00 36.68  ? 192 GLY C C   1 
ATOM   6730  O  O   . GLY C  1 192 ? -6.469  33.033  13.899  1.00 34.54  ? 192 GLY C O   1 
ATOM   6731  N  N   . ARG C  1 193 ? -4.613  33.328  12.657  1.00 30.82  ? 193 ARG C N   1 
ATOM   6732  C  CA  . ARG C  1 193 ? -5.193  32.801  11.454  1.00 34.56  ? 193 ARG C CA  1 
ATOM   6733  C  C   . ARG C  1 193 ? -5.369  31.286  11.579  1.00 34.09  ? 193 ARG C C   1 
ATOM   6734  O  O   . ARG C  1 193 ? -4.453  30.580  12.013  1.00 27.80  ? 193 ARG C O   1 
ATOM   6735  C  CB  . ARG C  1 193 ? -4.289  33.146  10.258  1.00 45.20  ? 193 ARG C CB  1 
ATOM   6736  C  CG  . ARG C  1 193 ? -5.019  33.223  8.923   1.00 39.31  ? 193 ARG C CG  1 
ATOM   6737  C  CD  . ARG C  1 193 ? -4.086  33.498  7.743   1.00 36.78  ? 193 ARG C CD  1 
ATOM   6738  N  NE  . ARG C  1 193 ? -4.867  33.702  6.520   1.00 41.63  ? 193 ARG C NE  1 
ATOM   6739  C  CZ  . ARG C  1 193 ? -4.434  34.322  5.426   1.00 42.77  ? 193 ARG C CZ  1 
ATOM   6740  N  NH1 . ARG C  1 193 ? -3.206  34.825  5.377   1.00 43.31  ? 193 ARG C NH1 1 
ATOM   6741  N  NH2 . ARG C  1 193 ? -5.244  34.466  4.386   1.00 40.43  ? 193 ARG C NH2 1 
ATOM   6742  N  N   . ILE C  1 194 ? -6.554  30.792  11.204  1.00 26.09  ? 194 ILE C N   1 
ATOM   6743  C  CA  . ILE C  1 194 ? -6.792  29.358  11.100  1.00 29.14  ? 194 ILE C CA  1 
ATOM   6744  C  C   . ILE C  1 194 ? -7.320  28.970  9.715   1.00 33.46  ? 194 ILE C C   1 
ATOM   6745  O  O   . ILE C  1 194 ? -8.422  29.361  9.322   1.00 28.08  ? 194 ILE C O   1 
ATOM   6746  C  CB  . ILE C  1 194 ? -7.744  28.851  12.192  1.00 33.38  ? 194 ILE C CB  1 
ATOM   6747  C  CG1 . ILE C  1 194 ? -7.170  29.164  13.583  1.00 30.72  ? 194 ILE C CG1 1 
ATOM   6748  C  CG2 . ILE C  1 194 ? -7.993  27.345  12.017  1.00 23.38  ? 194 ILE C CG2 1 
ATOM   6749  C  CD1 . ILE C  1 194 ? -8.147  28.895  14.720  1.00 27.25  ? 194 ILE C CD1 1 
ATOM   6750  N  N   . ILE C  1 195 ? -6.497  28.239  8.974   1.00 30.34  ? 195 ILE C N   1 
ATOM   6751  C  CA  . ILE C  1 195 ? -6.831  27.845  7.626   1.00 33.91  ? 195 ILE C CA  1 
ATOM   6752  C  C   . ILE C  1 195 ? -7.334  26.405  7.653   1.00 35.85  ? 195 ILE C C   1 
ATOM   6753  O  O   . ILE C  1 195 ? -6.603  25.486  8.048   1.00 35.10  ? 195 ILE C O   1 
ATOM   6754  C  CB  . ILE C  1 195 ? -5.612  27.948  6.696   1.00 36.51  ? 195 ILE C CB  1 
ATOM   6755  C  CG1 . ILE C  1 195 ? -5.002  29.349  6.779   1.00 35.67  ? 195 ILE C CG1 1 
ATOM   6756  C  CG2 . ILE C  1 195 ? -6.003  27.587  5.241   1.00 31.62  ? 195 ILE C CG2 1 
ATOM   6757  C  CD1 . ILE C  1 195 ? -3.605  29.465  6.156   1.00 34.33  ? 195 ILE C CD1 1 
ATOM   6758  N  N   . GLY C  1 196 ? -8.597  26.219  7.281   1.00 31.09  ? 196 GLY C N   1 
ATOM   6759  C  CA  . GLY C  1 196 ? -9.172  24.882  7.216   1.00 29.15  ? 196 GLY C CA  1 
ATOM   6760  C  C   . GLY C  1 196 ? -9.076  24.370  5.798   1.00 29.83  ? 196 GLY C C   1 
ATOM   6761  O  O   . GLY C  1 196 ? -9.216  25.137  4.854   1.00 32.39  ? 196 GLY C O   1 
ATOM   6762  N  N   . VAL C  1 197 ? -8.823  23.077  5.638   1.00 36.92  ? 197 VAL C N   1 
ATOM   6763  C  CA  . VAL C  1 197 ? -8.754  22.482  4.310   1.00 33.33  ? 197 VAL C CA  1 
ATOM   6764  C  C   . VAL C  1 197 ? -9.836  21.417  4.167   1.00 37.03  ? 197 VAL C C   1 
ATOM   6765  O  O   . VAL C  1 197 ? -9.861  20.443  4.934   1.00 35.44  ? 197 VAL C O   1 
ATOM   6766  C  CB  . VAL C  1 197 ? -7.380  21.837  4.055   1.00 32.81  ? 197 VAL C CB  1 
ATOM   6767  C  CG1 . VAL C  1 197 ? -7.337  21.205  2.667   1.00 28.69  ? 197 VAL C CG1 1 
ATOM   6768  C  CG2 . VAL C  1 197 ? -6.258  22.857  4.237   1.00 28.98  ? 197 VAL C CG2 1 
ATOM   6769  N  N   . GLY C  1 198 ? -10.734 21.618  3.197   1.00 32.39  ? 198 GLY C N   1 
ATOM   6770  C  CA  . GLY C  1 198 ? -11.845 20.713  2.933   1.00 33.63  ? 198 GLY C CA  1 
ATOM   6771  C  C   . GLY C  1 198 ? -12.870 21.399  2.037   1.00 43.46  ? 198 GLY C C   1 
ATOM   6772  O  O   . GLY C  1 198 ? -12.702 22.568  1.700   1.00 45.92  ? 198 GLY C O   1 
ATOM   6773  N  N   . SER C  1 199 ? -13.943 20.704  1.667   1.00 44.98  ? 199 SER C N   1 
ATOM   6774  C  CA  . SER C  1 199 ? -14.869 21.247  0.660   1.00 37.72  ? 199 SER C CA  1 
ATOM   6775  C  C   . SER C  1 199 ? -16.353 20.913  0.855   1.00 41.59  ? 199 SER C C   1 
ATOM   6776  O  O   . SER C  1 199 ? -17.214 21.620  0.335   1.00 48.27  ? 199 SER C O   1 
ATOM   6777  C  CB  . SER C  1 199 ? -14.435 20.820  -0.745  1.00 29.64  ? 199 SER C CB  1 
ATOM   6778  O  OG  . SER C  1 199 ? -14.427 19.411  -0.857  1.00 40.43  ? 199 SER C OG  1 
ATOM   6779  N  N   . ARG C  1 200 ? -16.663 19.832  1.565   1.00 47.04  ? 200 ARG C N   1 
ATOM   6780  C  CA  . ARG C  1 200 ? -18.062 19.530  1.862   1.00 43.88  ? 200 ARG C CA  1 
ATOM   6781  C  C   . ARG C  1 200 ? -18.711 20.741  2.519   1.00 44.95  ? 200 ARG C C   1 
ATOM   6782  O  O   . ARG C  1 200 ? -18.290 21.174  3.593   1.00 40.45  ? 200 ARG C O   1 
ATOM   6783  C  CB  . ARG C  1 200 ? -18.192 18.318  2.770   1.00 35.87  ? 200 ARG C CB  1 
ATOM   6784  C  CG  . ARG C  1 200 ? -17.918 16.995  2.093   1.00 47.60  ? 200 ARG C CG  1 
ATOM   6785  C  CD  . ARG C  1 200 ? -17.845 15.904  3.144   1.00 66.46  ? 200 ARG C CD  1 
ATOM   6786  N  NE  . ARG C  1 200 ? -18.395 14.646  2.664   1.00 75.54  ? 200 ARG C NE  1 
ATOM   6787  C  CZ  . ARG C  1 200 ? -18.742 13.643  3.459   1.00 83.47  ? 200 ARG C CZ  1 
ATOM   6788  N  NH1 . ARG C  1 200 ? -18.597 13.761  4.771   1.00 88.14  ? 200 ARG C NH1 1 
ATOM   6789  N  NH2 . ARG C  1 200 ? -19.236 12.527  2.943   1.00 84.46  ? 200 ARG C NH2 1 
ATOM   6790  N  N   . PRO C  1 201 ? -19.737 21.297  1.861   1.00 45.16  ? 201 PRO C N   1 
ATOM   6791  C  CA  . PRO C  1 201 ? -20.343 22.563  2.283   1.00 48.54  ? 201 PRO C CA  1 
ATOM   6792  C  C   . PRO C  1 201 ? -20.749 22.567  3.756   1.00 44.72  ? 201 PRO C C   1 
ATOM   6793  O  O   . PRO C  1 201 ? -20.621 23.603  4.417   1.00 43.70  ? 201 PRO C O   1 
ATOM   6794  C  CB  . PRO C  1 201 ? -21.571 22.695  1.361   1.00 41.98  ? 201 PRO C CB  1 
ATOM   6795  C  CG  . PRO C  1 201 ? -21.186 21.929  0.119   1.00 35.79  ? 201 PRO C CG  1 
ATOM   6796  C  CD  . PRO C  1 201 ? -20.344 20.772  0.620   1.00 45.32  ? 201 PRO C CD  1 
ATOM   6797  N  N   . ILE C  1 202 ? -21.235 21.444  4.271   1.00 41.60  ? 202 ILE C N   1 
ATOM   6798  C  CA  . ILE C  1 202 ? -21.645 21.444  5.663   1.00 46.61  ? 202 ILE C CA  1 
ATOM   6799  C  C   . ILE C  1 202 ? -20.423 21.474  6.591   1.00 40.84  ? 202 ILE C C   1 
ATOM   6800  O  O   . ILE C  1 202 ? -20.477 22.032  7.682   1.00 37.69  ? 202 ILE C O   1 
ATOM   6801  C  CB  . ILE C  1 202 ? -22.576 20.283  6.003   1.00 47.98  ? 202 ILE C CB  1 
ATOM   6802  C  CG1 . ILE C  1 202 ? -23.304 20.584  7.316   1.00 53.73  ? 202 ILE C CG1 1 
ATOM   6803  C  CG2 . ILE C  1 202 ? -21.799 18.962  6.058   1.00 46.85  ? 202 ILE C CG2 1 
ATOM   6804  C  CD1 . ILE C  1 202 ? -24.449 19.647  7.612   1.00 60.24  ? 202 ILE C CD1 1 
ATOM   6805  N  N   . CYS C  1 203 ? -19.318 20.888  6.146   1.00 33.89  ? 203 CYS C N   1 
ATOM   6806  C  CA  . CYS C  1 203 ? -18.077 20.954  6.916   1.00 41.57  ? 203 CYS C CA  1 
ATOM   6807  C  C   . CYS C  1 203 ? -17.479 22.362  6.852   1.00 39.72  ? 203 CYS C C   1 
ATOM   6808  O  O   . CYS C  1 203 ? -16.968 22.878  7.847   1.00 36.18  ? 203 CYS C O   1 
ATOM   6809  C  CB  . CYS C  1 203 ? -17.074 19.913  6.418   1.00 41.31  ? 203 CYS C CB  1 
ATOM   6810  S  SG  . CYS C  1 203 ? -17.637 18.177  6.626   1.00 43.85  ? 203 CYS C SG  1 
ATOM   6811  N  N   . VAL C  1 204 ? -17.566 22.982  5.677   1.00 36.70  ? 204 VAL C N   1 
ATOM   6812  C  CA  . VAL C  1 204 ? -17.049 24.333  5.476   1.00 38.09  ? 204 VAL C CA  1 
ATOM   6813  C  C   . VAL C  1 204 ? -17.751 25.325  6.423   1.00 39.39  ? 204 VAL C C   1 
ATOM   6814  O  O   . VAL C  1 204 ? -17.094 26.120  7.108   1.00 40.85  ? 204 VAL C O   1 
ATOM   6815  C  CB  . VAL C  1 204 ? -17.138 24.735  3.979   1.00 37.37  ? 204 VAL C CB  1 
ATOM   6816  C  CG1 . VAL C  1 204 ? -17.019 26.238  3.783   1.00 30.42  ? 204 VAL C CG1 1 
ATOM   6817  C  CG2 . VAL C  1 204 ? -16.058 23.990  3.184   1.00 32.07  ? 204 VAL C CG2 1 
ATOM   6818  N  N   . GLU C  1 205 ? -19.079 25.249  6.488   1.00 32.93  ? 205 GLU C N   1 
ATOM   6819  C  CA  . GLU C  1 205 ? -19.850 26.095  7.391   1.00 36.95  ? 205 GLU C CA  1 
ATOM   6820  C  C   . GLU C  1 205 ? -19.512 25.801  8.850   1.00 29.22  ? 205 GLU C C   1 
ATOM   6821  O  O   . GLU C  1 205 ? -19.320 26.706  9.648   1.00 30.78  ? 205 GLU C O   1 
ATOM   6822  C  CB  . GLU C  1 205 ? -21.343 25.905  7.151   1.00 40.65  ? 205 GLU C CB  1 
ATOM   6823  C  CG  . GLU C  1 205 ? -21.794 26.490  5.833   1.00 58.00  ? 205 GLU C CG  1 
ATOM   6824  C  CD  . GLU C  1 205 ? -21.483 27.977  5.728   1.00 62.76  ? 205 GLU C CD  1 
ATOM   6825  O  OE1 . GLU C  1 205 ? -20.736 28.364  4.801   1.00 62.10  ? 205 GLU C OE1 1 
ATOM   6826  O  OE2 . GLU C  1 205 ? -21.972 28.751  6.584   1.00 64.02  ? 205 GLU C OE2 1 
ATOM   6827  N  N   . ALA C  1 206 ? -19.479 24.530  9.205   1.00 27.27  ? 206 ALA C N   1 
ATOM   6828  C  CA  . ALA C  1 206 ? -19.041 24.151  10.542  1.00 31.63  ? 206 ALA C CA  1 
ATOM   6829  C  C   . ALA C  1 206 ? -17.647 24.742  10.843  1.00 35.07  ? 206 ALA C C   1 
ATOM   6830  O  O   . ALA C  1 206 ? -17.414 25.294  11.921  1.00 33.89  ? 206 ALA C O   1 
ATOM   6831  C  CB  . ALA C  1 206 ? -19.046 22.629  10.686  1.00 29.76  ? 206 ALA C CB  1 
ATOM   6832  N  N   . ALA C  1 207 ? -16.748 24.666  9.865   1.00 31.29  ? 207 ALA C N   1 
ATOM   6833  C  CA  . ALA C  1 207 ? -15.380 25.145  10.045  1.00 36.66  ? 207 ALA C CA  1 
ATOM   6834  C  C   . ALA C  1 207 ? -15.332 26.626  10.367  1.00 38.53  ? 207 ALA C C   1 
ATOM   6835  O  O   . ALA C  1 207 ? -14.594 27.050  11.262  1.00 34.82  ? 207 ALA C O   1 
ATOM   6836  C  CB  . ALA C  1 207 ? -14.525 24.831  8.818   1.00 30.48  ? 207 ALA C CB  1 
ATOM   6837  N  N   . LYS C  1 208 ? -16.117 27.415  9.642   1.00 38.24  ? 208 LYS C N   1 
ATOM   6838  C  CA  . LYS C  1 208 ? -16.155 28.845  9.888   1.00 37.89  ? 208 LYS C CA  1 
ATOM   6839  C  C   . LYS C  1 208 ? -16.729 29.069  11.276  1.00 40.66  ? 208 LYS C C   1 
ATOM   6840  O  O   . LYS C  1 208 ? -16.223 29.884  12.056  1.00 36.63  ? 208 LYS C O   1 
ATOM   6841  C  CB  . LYS C  1 208 ? -17.022 29.560  8.847   1.00 43.17  ? 208 LYS C CB  1 
ATOM   6842  C  CG  . LYS C  1 208 ? -16.485 29.534  7.412   1.00 43.79  ? 208 LYS C CG  1 
ATOM   6843  C  CD  . LYS C  1 208 ? -17.556 30.054  6.451   1.00 53.43  ? 208 LYS C CD  1 
ATOM   6844  C  CE  . LYS C  1 208 ? -17.126 29.958  4.996   1.00 57.57  ? 208 LYS C CE  1 
ATOM   6845  N  NZ  . LYS C  1 208 ? -18.321 30.007  4.095   1.00 60.92  ? 208 LYS C NZ  1 
ATOM   6846  N  N   . PHE C  1 209 ? -17.789 28.335  11.595  1.00 33.53  ? 209 PHE C N   1 
ATOM   6847  C  CA  . PHE C  1 209 ? -18.381 28.481  12.913  1.00 38.07  ? 209 PHE C CA  1 
ATOM   6848  C  C   . PHE C  1 209 ? -17.359 28.246  14.044  1.00 35.74  ? 209 PHE C C   1 
ATOM   6849  O  O   . PHE C  1 209 ? -17.388 28.943  15.056  1.00 39.44  ? 209 PHE C O   1 
ATOM   6850  C  CB  . PHE C  1 209 ? -19.571 27.551  13.084  1.00 33.94  ? 209 PHE C CB  1 
ATOM   6851  C  CG  . PHE C  1 209 ? -20.177 27.600  14.452  1.00 36.10  ? 209 PHE C CG  1 
ATOM   6852  C  CD1 . PHE C  1 209 ? -21.096 28.596  14.781  1.00 34.88  ? 209 PHE C CD1 1 
ATOM   6853  C  CD2 . PHE C  1 209 ? -19.838 26.645  15.411  1.00 35.48  ? 209 PHE C CD2 1 
ATOM   6854  C  CE1 . PHE C  1 209 ? -21.668 28.650  16.046  1.00 38.05  ? 209 PHE C CE1 1 
ATOM   6855  C  CE2 . PHE C  1 209 ? -20.393 26.688  16.688  1.00 34.75  ? 209 PHE C CE2 1 
ATOM   6856  C  CZ  . PHE C  1 209 ? -21.315 27.691  17.008  1.00 39.26  ? 209 PHE C CZ  1 
ATOM   6857  N  N   . TYR C  1 210 ? -16.465 27.272  13.877  1.00 33.11  ? 210 TYR C N   1 
ATOM   6858  C  CA  . TYR C  1 210 ? -15.532 26.918  14.956  1.00 34.65  ? 210 TYR C CA  1 
ATOM   6859  C  C   . TYR C  1 210 ? -14.274 27.796  14.986  1.00 37.80  ? 210 TYR C C   1 
ATOM   6860  O  O   . TYR C  1 210 ? -13.469 27.698  15.918  1.00 37.35  ? 210 TYR C O   1 
ATOM   6861  C  CB  . TYR C  1 210 ? -15.171 25.415  14.951  1.00 33.56  ? 210 TYR C CB  1 
ATOM   6862  C  CG  . TYR C  1 210 ? -16.295 24.556  15.485  1.00 38.90  ? 210 TYR C CG  1 
ATOM   6863  C  CD1 . TYR C  1 210 ? -16.775 24.730  16.789  1.00 31.47  ? 210 TYR C CD1 1 
ATOM   6864  C  CD2 . TYR C  1 210 ? -16.896 23.580  14.681  1.00 37.29  ? 210 TYR C CD2 1 
ATOM   6865  C  CE1 . TYR C  1 210 ? -17.815 23.960  17.276  1.00 29.81  ? 210 TYR C CE1 1 
ATOM   6866  C  CE2 . TYR C  1 210 ? -17.940 22.803  15.154  1.00 31.77  ? 210 TYR C CE2 1 
ATOM   6867  C  CZ  . TYR C  1 210 ? -18.405 22.994  16.445  1.00 35.02  ? 210 TYR C CZ  1 
ATOM   6868  O  OH  . TYR C  1 210 ? -19.449 22.206  16.902  1.00 30.39  ? 210 TYR C OH  1 
ATOM   6869  N  N   . GLY C  1 211 ? -14.107 28.644  13.970  1.00 32.49  ? 211 GLY C N   1 
ATOM   6870  C  CA  . GLY C  1 211 ? -13.042 29.628  13.988  1.00 35.99  ? 211 GLY C CA  1 
ATOM   6871  C  C   . GLY C  1 211 ? -12.121 29.732  12.786  1.00 38.91  ? 211 GLY C C   1 
ATOM   6872  O  O   . GLY C  1 211 ? -11.180 30.532  12.806  1.00 35.55  ? 211 GLY C O   1 
ATOM   6873  N  N   . ALA C  1 212 ? -12.352 28.944  11.740  1.00 30.44  ? 212 ALA C N   1 
ATOM   6874  C  CA  . ALA C  1 212 ? -11.498 29.080  10.562  1.00 29.83  ? 212 ALA C CA  1 
ATOM   6875  C  C   . ALA C  1 212 ? -11.674 30.464  9.927   1.00 37.94  ? 212 ALA C C   1 
ATOM   6876  O  O   . ALA C  1 212 ? -12.795 30.917  9.702   1.00 35.17  ? 212 ALA C O   1 
ATOM   6877  C  CB  . ALA C  1 212 ? -11.782 27.996  9.555   1.00 26.55  ? 212 ALA C CB  1 
ATOM   6878  N  N   . THR C  1 213 ? -10.560 31.128  9.636   1.00 38.93  ? 213 THR C N   1 
ATOM   6879  C  CA  . THR C  1 213 ? -10.595 32.428  8.966   1.00 33.99  ? 213 THR C CA  1 
ATOM   6880  C  C   . THR C  1 213 ? -10.455 32.265  7.462   1.00 30.68  ? 213 THR C C   1 
ATOM   6881  O  O   . THR C  1 213 ? -10.685 33.198  6.701   1.00 34.32  ? 213 THR C O   1 
ATOM   6882  C  CB  . THR C  1 213 ? -9.431  33.335  9.450   1.00 35.30  ? 213 THR C CB  1 
ATOM   6883  O  OG1 . THR C  1 213 ? -8.183  32.673  9.200   1.00 34.76  ? 213 THR C OG1 1 
ATOM   6884  C  CG2 . THR C  1 213 ? -9.555  33.599  10.935  1.00 33.07  ? 213 THR C CG2 1 
ATOM   6885  N  N   . ASP C  1 214 ? -10.036 31.084  7.036   1.00 31.97  ? 214 ASP C N   1 
ATOM   6886  C  CA  . ASP C  1 214 ? -9.834  30.806  5.620   1.00 34.13  ? 214 ASP C CA  1 
ATOM   6887  C  C   . ASP C  1 214 ? -10.174 29.343  5.379   1.00 39.31  ? 214 ASP C C   1 
ATOM   6888  O  O   . ASP C  1 214 ? -9.932  28.492  6.243   1.00 37.58  ? 214 ASP C O   1 
ATOM   6889  C  CB  . ASP C  1 214 ? -8.371  31.020  5.217   1.00 36.49  ? 214 ASP C CB  1 
ATOM   6890  C  CG  . ASP C  1 214 ? -7.870  32.433  5.506   1.00 46.29  ? 214 ASP C CG  1 
ATOM   6891  O  OD1 . ASP C  1 214 ? -7.617  32.769  6.688   1.00 46.87  ? 214 ASP C OD1 1 
ATOM   6892  O  OD2 . ASP C  1 214 ? -7.704  33.197  4.534   1.00 45.67  ? 214 ASP C OD2 1 
ATOM   6893  N  N   . ILE C  1 215 ? -10.713 29.061  4.199   1.00 34.07  ? 215 ILE C N   1 
ATOM   6894  C  CA  . ILE C  1 215 ? -10.987 27.701  3.767   1.00 37.16  ? 215 ILE C CA  1 
ATOM   6895  C  C   . ILE C  1 215 ? -10.338 27.472  2.404   1.00 39.30  ? 215 ILE C C   1 
ATOM   6896  O  O   . ILE C  1 215 ? -10.557 28.241  1.466   1.00 41.28  ? 215 ILE C O   1 
ATOM   6897  C  CB  . ILE C  1 215 ? -12.497 27.464  3.623   1.00 39.29  ? 215 ILE C CB  1 
ATOM   6898  C  CG1 . ILE C  1 215 ? -13.220 27.761  4.940   1.00 34.78  ? 215 ILE C CG1 1 
ATOM   6899  C  CG2 . ILE C  1 215 ? -12.770 26.037  3.138   1.00 38.68  ? 215 ILE C CG2 1 
ATOM   6900  C  CD1 . ILE C  1 215 ? -12.939 26.748  6.018   1.00 32.48  ? 215 ILE C CD1 1 
ATOM   6901  N  N   . LEU C  1 216 ? -9.542  26.418  2.292   1.00 36.60  ? 216 LEU C N   1 
ATOM   6902  C  CA  . LEU C  1 216 ? -8.929  26.070  1.020   1.00 34.61  ? 216 LEU C CA  1 
ATOM   6903  C  C   . LEU C  1 216 ? -9.535  24.793  0.478   1.00 41.38  ? 216 LEU C C   1 
ATOM   6904  O  O   . LEU C  1 216 ? -9.717  23.827  1.216   1.00 42.03  ? 216 LEU C O   1 
ATOM   6905  C  CB  . LEU C  1 216 ? -7.427  25.908  1.172   1.00 30.57  ? 216 LEU C CB  1 
ATOM   6906  C  CG  . LEU C  1 216 ? -6.707  27.156  1.670   1.00 36.23  ? 216 LEU C CG  1 
ATOM   6907  C  CD1 . LEU C  1 216 ? -5.212  26.916  1.649   1.00 36.36  ? 216 LEU C CD1 1 
ATOM   6908  C  CD2 . LEU C  1 216 ? -7.068  28.342  0.799   1.00 40.49  ? 216 LEU C CD2 1 
ATOM   6909  N  N   . ASN C  1 217 ? -9.876  24.816  -0.807  1.00 53.24  ? 217 ASN C N   1 
ATOM   6910  C  CA  . ASN C  1 217 ? -10.431 23.663  -1.518  1.00 57.93  ? 217 ASN C CA  1 
ATOM   6911  C  C   . ASN C  1 217 ? -9.367  23.088  -2.429  1.00 49.52  ? 217 ASN C C   1 
ATOM   6912  O  O   . ASN C  1 217 ? -8.554  23.828  -2.972  1.00 43.56  ? 217 ASN C O   1 
ATOM   6913  C  CB  . ASN C  1 217 ? -11.629 24.070  -2.395  1.00 56.23  ? 217 ASN C CB  1 
ATOM   6914  C  CG  . ASN C  1 217 ? -12.877 24.379  -1.591  1.00 61.24  ? 217 ASN C CG  1 
ATOM   6915  O  OD1 . ASN C  1 217 ? -13.887 24.824  -2.140  1.00 74.71  ? 217 ASN C OD1 1 
ATOM   6916  N  ND2 . ASN C  1 217 ? -12.819 24.150  -0.291  1.00 53.81  ? 217 ASN C ND2 1 
ATOM   6917  N  N   . TYR C  1 218 ? -9.376  21.777  -2.621  1.00 60.90  ? 218 TYR C N   1 
ATOM   6918  C  CA  . TYR C  1 218 ? -8.411  21.183  -3.526  1.00 72.68  ? 218 TYR C CA  1 
ATOM   6919  C  C   . TYR C  1 218 ? -8.994  21.260  -4.912  1.00 77.79  ? 218 TYR C C   1 
ATOM   6920  O  O   . TYR C  1 218 ? -9.552  20.291  -5.423  1.00 83.51  ? 218 TYR C O   1 
ATOM   6921  C  CB  . TYR C  1 218 ? -8.073  19.736  -3.150  1.00 80.39  ? 218 TYR C CB  1 
ATOM   6922  C  CG  . TYR C  1 218 ? -6.598  19.435  -3.295  1.00 87.35  ? 218 TYR C CG  1 
ATOM   6923  C  CD1 . TYR C  1 218 ? -5.886  18.822  -2.270  1.00 89.93  ? 218 TYR C CD1 1 
ATOM   6924  C  CD2 . TYR C  1 218 ? -5.908  19.801  -4.444  1.00 90.79  ? 218 TYR C CD2 1 
ATOM   6925  C  CE1 . TYR C  1 218 ? -4.534  18.565  -2.396  1.00 92.08  ? 218 TYR C CE1 1 
ATOM   6926  C  CE2 . TYR C  1 218 ? -4.560  19.548  -4.580  1.00 92.26  ? 218 TYR C CE2 1 
ATOM   6927  C  CZ  . TYR C  1 218 ? -3.876  18.932  -3.554  1.00 95.80  ? 218 TYR C CZ  1 
ATOM   6928  O  OH  . TYR C  1 218 ? -2.527  18.682  -3.692  1.00 99.50  ? 218 TYR C OH  1 
ATOM   6929  N  N   . LYS C  1 219 ? -8.901  22.442  -5.500  1.00 75.02  ? 219 LYS C N   1 
ATOM   6930  C  CA  . LYS C  1 219 ? -9.340  22.640  -6.860  1.00 82.22  ? 219 LYS C CA  1 
ATOM   6931  C  C   . LYS C  1 219 ? -8.755  23.957  -7.318  1.00 92.33  ? 219 LYS C C   1 
ATOM   6932  O  O   . LYS C  1 219 ? -8.399  24.118  -8.486  1.00 97.68  ? 219 LYS C O   1 
ATOM   6933  C  CB  . LYS C  1 219 ? -10.864 22.670  -6.937  1.00 88.97  ? 219 LYS C CB  1 
ATOM   6934  C  CG  . LYS C  1 219 ? -11.462 24.060  -6.852  1.00 93.11  ? 219 LYS C CG  1 
ATOM   6935  C  CD  . LYS C  1 219 ? -12.971 24.008  -6.989  1.00 96.77  ? 219 LYS C CD  1 
ATOM   6936  C  CE  . LYS C  1 219 ? -13.637 23.796  -5.644  1.00 96.74  ? 219 LYS C CE  1 
ATOM   6937  N  NZ  . LYS C  1 219 ? -13.535 25.023  -4.810  1.00 95.32  ? 219 LYS C NZ  1 
ATOM   6938  N  N   . ASN C  1 220 ? -8.648  24.898  -6.382  1.00 86.86  ? 220 ASN C N   1 
ATOM   6939  C  CA  . ASN C  1 220 ? -7.950  26.139  -6.647  1.00 70.06  ? 220 ASN C CA  1 
ATOM   6940  C  C   . ASN C  1 220 ? -6.469  25.839  -6.706  1.00 57.21  ? 220 ASN C C   1 
ATOM   6941  O  O   . ASN C  1 220 ? -5.648  26.719  -6.499  1.00 49.83  ? 220 ASN C O   1 
ATOM   6942  C  CB  . ASN C  1 220 ? -8.216  27.170  -5.556  1.00 76.02  ? 220 ASN C CB  1 
ATOM   6943  C  CG  . ASN C  1 220 ? -7.908  28.584  -6.007  1.00 88.16  ? 220 ASN C CG  1 
ATOM   6944  O  OD1 . ASN C  1 220 ? -7.953  28.887  -7.199  1.00 93.70  ? 220 ASN C OD1 1 
ATOM   6945  N  ND2 . ASN C  1 220 ? -7.593  29.460  -5.056  1.00 92.10  ? 220 ASN C ND2 1 
ATOM   6946  N  N   . GLY C  1 221 ? -6.133  24.579  -6.963  1.00 54.29  ? 221 GLY C N   1 
ATOM   6947  C  CA  . GLY C  1 221 ? -4.748  24.178  -7.099  1.00 51.10  ? 221 GLY C CA  1 
ATOM   6948  C  C   . GLY C  1 221 ? -4.206  23.486  -5.868  1.00 44.09  ? 221 GLY C C   1 
ATOM   6949  O  O   . GLY C  1 221 ? -4.922  23.289  -4.893  1.00 46.38  ? 221 GLY C O   1 
ATOM   6950  N  N   . HIS C  1 222 ? -2.937  23.103  -5.923  1.00 43.91  ? 222 HIS C N   1 
ATOM   6951  C  CA  . HIS C  1 222 ? -2.293  22.412  -4.814  1.00 50.26  ? 222 HIS C CA  1 
ATOM   6952  C  C   . HIS C  1 222 ? -2.401  23.176  -3.497  1.00 51.82  ? 222 HIS C C   1 
ATOM   6953  O  O   . HIS C  1 222 ? -2.168  24.382  -3.444  1.00 48.38  ? 222 HIS C O   1 
ATOM   6954  C  CB  . HIS C  1 222 ? -0.828  22.163  -5.142  1.00 59.94  ? 222 HIS C CB  1 
ATOM   6955  C  CG  . HIS C  1 222 ? -0.625  21.313  -6.353  1.00 76.68  ? 222 HIS C CG  1 
ATOM   6956  N  ND1 . HIS C  1 222 ? -0.601  19.936  -6.298  1.00 81.44  ? 222 HIS C ND1 1 
ATOM   6957  C  CD2 . HIS C  1 222 ? -0.450  21.643  -7.656  1.00 82.16  ? 222 HIS C CD2 1 
ATOM   6958  C  CE1 . HIS C  1 222 ? -0.408  19.455  -7.514  1.00 84.79  ? 222 HIS C CE1 1 
ATOM   6959  N  NE2 . HIS C  1 222 ? -0.314  20.469  -8.355  1.00 83.72  ? 222 HIS C NE2 1 
ATOM   6960  N  N   . ILE C  1 223 ? -2.748  22.457  -2.436  1.00 53.63  ? 223 ILE C N   1 
ATOM   6961  C  CA  . ILE C  1 223 ? -2.892  23.056  -1.116  1.00 51.47  ? 223 ILE C CA  1 
ATOM   6962  C  C   . ILE C  1 223 ? -1.648  23.812  -0.676  1.00 39.29  ? 223 ILE C C   1 
ATOM   6963  O  O   . ILE C  1 223 ? -1.746  24.903  -0.118  1.00 42.18  ? 223 ILE C O   1 
ATOM   6964  C  CB  . ILE C  1 223 ? -3.216  21.998  -0.061  1.00 57.85  ? 223 ILE C CB  1 
ATOM   6965  C  CG1 . ILE C  1 223 ? -4.546  21.344  -0.388  1.00 70.44  ? 223 ILE C CG1 1 
ATOM   6966  C  CG2 . ILE C  1 223 ? -3.303  22.626  1.316   1.00 56.54  ? 223 ILE C CG2 1 
ATOM   6967  C  CD1 . ILE C  1 223 ? -4.944  20.328  0.629   1.00 81.98  ? 223 ILE C CD1 1 
ATOM   6968  N  N   . VAL C  1 224 ? -0.480  23.229  -0.926  1.00 38.74  ? 224 VAL C N   1 
ATOM   6969  C  CA  . VAL C  1 224 ? 0.771   23.837  -0.507  1.00 37.68  ? 224 VAL C CA  1 
ATOM   6970  C  C   . VAL C  1 224 ? 0.932   25.186  -1.197  1.00 40.78  ? 224 VAL C C   1 
ATOM   6971  O  O   . VAL C  1 224 ? 1.244   26.184  -0.554  1.00 42.85  ? 224 VAL C O   1 
ATOM   6972  C  CB  . VAL C  1 224 ? 1.980   22.935  -0.808  1.00 38.98  ? 224 VAL C CB  1 
ATOM   6973  C  CG1 . VAL C  1 224 ? 3.259   23.610  -0.361  1.00 33.42  ? 224 VAL C CG1 1 
ATOM   6974  C  CG2 . VAL C  1 224 ? 1.822   21.588  -0.111  1.00 41.13  ? 224 VAL C CG2 1 
ATOM   6975  N  N   . ASP C  1 225 ? 0.679   25.214  -2.500  1.00 38.29  ? 225 ASP C N   1 
ATOM   6976  C  CA  . ASP C  1 225 ? 0.737   26.453  -3.285  1.00 38.75  ? 225 ASP C CA  1 
ATOM   6977  C  C   . ASP C  1 225 ? -0.232  27.509  -2.761  1.00 37.71  ? 225 ASP C C   1 
ATOM   6978  O  O   . ASP C  1 225 ? 0.125   28.682  -2.610  1.00 34.23  ? 225 ASP C O   1 
ATOM   6979  C  CB  . ASP C  1 225 ? 0.439   26.152  -4.747  1.00 42.50  ? 225 ASP C CB  1 
ATOM   6980  C  CG  . ASP C  1 225 ? 1.484   25.259  -5.375  1.00 43.88  ? 225 ASP C CG  1 
ATOM   6981  O  OD1 . ASP C  1 225 ? 2.588   25.171  -4.818  1.00 55.32  ? 225 ASP C OD1 1 
ATOM   6982  O  OD2 . ASP C  1 225 ? 1.209   24.645  -6.424  1.00 56.99  ? 225 ASP C OD2 1 
ATOM   6983  N  N   . GLN C  1 226 ? -1.452  27.081  -2.455  1.00 31.39  ? 226 GLN C N   1 
ATOM   6984  C  CA  . GLN C  1 226 ? -2.447  27.988  -1.891  1.00 31.82  ? 226 GLN C CA  1 
ATOM   6985  C  C   . GLN C  1 226 ? -1.994  28.561  -0.539  1.00 40.37  ? 226 GLN C C   1 
ATOM   6986  O  O   . GLN C  1 226 ? -2.150  29.759  -0.271  1.00 33.24  ? 226 GLN C O   1 
ATOM   6987  C  CB  . GLN C  1 226 ? -3.771  27.255  -1.730  1.00 34.77  ? 226 GLN C CB  1 
ATOM   6988  C  CG  . GLN C  1 226 ? -4.310  26.723  -3.050  1.00 38.49  ? 226 GLN C CG  1 
ATOM   6989  C  CD  . GLN C  1 226 ? -5.788  26.467  -2.993  1.00 41.63  ? 226 GLN C CD  1 
ATOM   6990  O  OE1 . GLN C  1 226 ? -6.572  27.370  -2.691  1.00 44.60  ? 226 GLN C OE1 1 
ATOM   6991  N  NE2 . GLN C  1 226 ? -6.185  25.227  -3.265  1.00 38.11  ? 226 GLN C NE2 1 
ATOM   6992  N  N   . VAL C  1 227 ? -1.434  27.706  0.317   1.00 35.55  ? 227 VAL C N   1 
ATOM   6993  C  CA  . VAL C  1 227 ? -0.978  28.182  1.614   1.00 31.48  ? 227 VAL C CA  1 
ATOM   6994  C  C   . VAL C  1 227 ? 0.180   29.170  1.445   1.00 36.49  ? 227 VAL C C   1 
ATOM   6995  O  O   . VAL C  1 227 ? 0.225   30.218  2.095   1.00 43.65  ? 227 VAL C O   1 
ATOM   6996  C  CB  . VAL C  1 227 ? -0.556  27.027  2.527   1.00 33.08  ? 227 VAL C CB  1 
ATOM   6997  C  CG1 . VAL C  1 227 ? 0.188   27.578  3.738   1.00 34.98  ? 227 VAL C CG1 1 
ATOM   6998  C  CG2 . VAL C  1 227 ? -1.787  26.203  2.937   1.00 28.67  ? 227 VAL C CG2 1 
ATOM   6999  N  N   . MET C  1 228 ? 1.118   28.835  0.569   1.00 32.60  ? 228 MET C N   1 
ATOM   7000  C  CA  . MET C  1 228 ? 2.200   29.747  0.253   1.00 32.59  ? 228 MET C CA  1 
ATOM   7001  C  C   . MET C  1 228 ? 1.666   31.085  -0.280  1.00 48.15  ? 228 MET C C   1 
ATOM   7002  O  O   . MET C  1 228 ? 2.147   32.154  0.109   1.00 46.16  ? 228 MET C O   1 
ATOM   7003  C  CB  . MET C  1 228 ? 3.157   29.087  -0.731  1.00 31.81  ? 228 MET C CB  1 
ATOM   7004  C  CG  . MET C  1 228 ? 3.899   27.896  -0.097  1.00 33.11  ? 228 MET C CG  1 
ATOM   7005  S  SD  . MET C  1 228 ? 4.660   28.363  1.482   1.00 49.77  ? 228 MET C SD  1 
ATOM   7006  C  CE  . MET C  1 228 ? 5.037   26.753  2.155   1.00 62.02  ? 228 MET C CE  1 
ATOM   7007  N  N   . LYS C  1 229 ? 0.649   31.025  -1.136  1.00 45.03  ? 229 LYS C N   1 
ATOM   7008  C  CA  . LYS C  1 229 ? 0.035   32.241  -1.652  1.00 53.98  ? 229 LYS C CA  1 
ATOM   7009  C  C   . LYS C  1 229 ? -0.594  33.089  -0.549  1.00 51.00  ? 229 LYS C C   1 
ATOM   7010  O  O   . LYS C  1 229 ? -0.445  34.311  -0.541  1.00 48.67  ? 229 LYS C O   1 
ATOM   7011  C  CB  . LYS C  1 229 ? -1.005  31.926  -2.736  1.00 61.00  ? 229 LYS C CB  1 
ATOM   7012  C  CG  . LYS C  1 229 ? -0.452  31.988  -4.148  1.00 71.89  ? 229 LYS C CG  1 
ATOM   7013  C  CD  . LYS C  1 229 ? -1.573  32.086  -5.171  1.00 83.07  ? 229 LYS C CD  1 
ATOM   7014  C  CE  . LYS C  1 229 ? -1.068  32.626  -6.507  1.00 89.96  ? 229 LYS C CE  1 
ATOM   7015  N  NZ  . LYS C  1 229 ? -2.182  32.936  -7.452  1.00 91.44  ? 229 LYS C NZ  1 
ATOM   7016  N  N   . LEU C  1 230 ? -1.302  32.452  0.377   1.00 47.96  ? 230 LEU C N   1 
ATOM   7017  C  CA  . LEU C  1 230 ? -1.944  33.201  1.455   1.00 45.29  ? 230 LEU C CA  1 
ATOM   7018  C  C   . LEU C  1 230 ? -0.908  33.776  2.414   1.00 42.82  ? 230 LEU C C   1 
ATOM   7019  O  O   . LEU C  1 230 ? -1.176  34.765  3.093   1.00 46.52  ? 230 LEU C O   1 
ATOM   7020  C  CB  . LEU C  1 230 ? -2.933  32.333  2.240   1.00 43.67  ? 230 LEU C CB  1 
ATOM   7021  C  CG  . LEU C  1 230 ? -4.173  31.779  1.538   1.00 49.49  ? 230 LEU C CG  1 
ATOM   7022  C  CD1 . LEU C  1 230 ? -5.009  30.946  2.510   1.00 40.50  ? 230 LEU C CD1 1 
ATOM   7023  C  CD2 . LEU C  1 230 ? -5.017  32.909  0.919   1.00 50.52  ? 230 LEU C CD2 1 
ATOM   7024  N  N   . THR C  1 231 ? 0.262   33.148  2.483   1.00 44.08  ? 231 THR C N   1 
ATOM   7025  C  CA  . THR C  1 231 ? 1.268   33.533  3.470   1.00 39.75  ? 231 THR C CA  1 
ATOM   7026  C  C   . THR C  1 231 ? 2.480   34.191  2.826   1.00 46.29  ? 231 THR C C   1 
ATOM   7027  O  O   . THR C  1 231 ? 3.539   34.293  3.450   1.00 47.52  ? 231 THR C O   1 
ATOM   7028  C  CB  . THR C  1 231 ? 1.765   32.321  4.295   1.00 34.33  ? 231 THR C CB  1 
ATOM   7029  O  OG1 . THR C  1 231 ? 2.434   31.387  3.440   1.00 34.18  ? 231 THR C OG1 1 
ATOM   7030  C  CG2 . THR C  1 231 ? 0.616   31.635  5.008   1.00 33.38  ? 231 THR C CG2 1 
ATOM   7031  N  N   . ASN C  1 232 ? 2.330   34.621  1.576   1.00 47.15  ? 232 ASN C N   1 
ATOM   7032  C  CA  . ASN C  1 232 ? 3.425   35.259  0.866   1.00 55.56  ? 232 ASN C CA  1 
ATOM   7033  C  C   . ASN C  1 232 ? 4.716   34.463  0.912   1.00 47.85  ? 232 ASN C C   1 
ATOM   7034  O  O   . ASN C  1 232 ? 5.789   35.041  1.052   1.00 49.23  ? 232 ASN C O   1 
ATOM   7035  C  CB  . ASN C  1 232 ? 3.703   36.640  1.461   1.00 70.29  ? 232 ASN C CB  1 
ATOM   7036  C  CG  . ASN C  1 232 ? 3.060   37.752  0.678   1.00 79.69  ? 232 ASN C CG  1 
ATOM   7037  O  OD1 . ASN C  1 232 ? 3.699   38.763  0.391   1.00 87.13  ? 232 ASN C OD1 1 
ATOM   7038  N  ND2 . ASN C  1 232 ? 1.791   37.576  0.317   1.00 82.23  ? 232 ASN C ND2 1 
ATOM   7039  N  N   . GLY C  1 233 ? 4.617   33.146  0.821   1.00 49.30  ? 233 GLY C N   1 
ATOM   7040  C  CA  . GLY C  1 233 ? 5.799   32.302  0.786   1.00 49.13  ? 233 GLY C CA  1 
ATOM   7041  C  C   . GLY C  1 233 ? 6.399   31.970  2.143   1.00 43.13  ? 233 GLY C C   1 
ATOM   7042  O  O   . GLY C  1 233 ? 7.369   31.227  2.222   1.00 47.77  ? 233 GLY C O   1 
ATOM   7043  N  N   . LYS C  1 234 ? 5.819   32.502  3.212   1.00 43.61  ? 234 LYS C N   1 
ATOM   7044  C  CA  . LYS C  1 234 ? 6.384   32.330  4.551   1.00 50.10  ? 234 LYS C CA  1 
ATOM   7045  C  C   . LYS C  1 234 ? 5.922   31.060  5.267   1.00 46.86  ? 234 LYS C C   1 
ATOM   7046  O  O   . LYS C  1 234 ? 6.545   30.632  6.236   1.00 48.92  ? 234 LYS C O   1 
ATOM   7047  C  CB  . LYS C  1 234 ? 6.086   33.559  5.418   1.00 56.63  ? 234 LYS C CB  1 
ATOM   7048  C  CG  . LYS C  1 234 ? 6.669   34.841  4.870   1.00 62.12  ? 234 LYS C CG  1 
ATOM   7049  C  CD  . LYS C  1 234 ? 6.006   36.059  5.494   1.00 74.27  ? 234 LYS C CD  1 
ATOM   7050  C  CE  . LYS C  1 234 ? 6.470   37.348  4.815   1.00 80.46  ? 234 LYS C CE  1 
ATOM   7051  N  NZ  . LYS C  1 234 ? 5.834   38.562  5.399   1.00 83.63  ? 234 LYS C NZ  1 
ATOM   7052  N  N   . GLY C  1 235 ? 4.827   30.470  4.803   1.00 40.60  ? 235 GLY C N   1 
ATOM   7053  C  CA  . GLY C  1 235 ? 4.310   29.264  5.419   1.00 36.16  ? 235 GLY C CA  1 
ATOM   7054  C  C   . GLY C  1 235 ? 3.599   29.534  6.731   1.00 30.69  ? 235 GLY C C   1 
ATOM   7055  O  O   . GLY C  1 235 ? 3.392   30.682  7.099   1.00 32.63  ? 235 GLY C O   1 
ATOM   7056  N  N   . VAL C  1 236 ? 3.231   28.468  7.442   1.00 29.16  ? 236 VAL C N   1 
ATOM   7057  C  CA  . VAL C  1 236 ? 2.456   28.600  8.672   1.00 25.84  ? 236 VAL C CA  1 
ATOM   7058  C  C   . VAL C  1 236 ? 3.216   28.035  9.884   1.00 29.21  ? 236 VAL C C   1 
ATOM   7059  O  O   . VAL C  1 236 ? 4.115   27.218  9.725   1.00 27.99  ? 236 VAL C O   1 
ATOM   7060  C  CB  . VAL C  1 236 ? 1.068   27.920  8.523   1.00 32.58  ? 236 VAL C CB  1 
ATOM   7061  C  CG1 . VAL C  1 236 ? 0.173   28.722  7.547   1.00 29.03  ? 236 VAL C CG1 1 
ATOM   7062  C  CG2 . VAL C  1 236 ? 1.217   26.485  8.039   1.00 29.26  ? 236 VAL C CG2 1 
ATOM   7063  N  N   . ASP C  1 237 ? 2.842   28.459  11.089  1.00 30.95  ? 237 ASP C N   1 
ATOM   7064  C  CA  . ASP C  1 237 ? 3.522   28.003  12.314  1.00 30.82  ? 237 ASP C CA  1 
ATOM   7065  C  C   . ASP C  1 237 ? 3.241   26.544  12.708  1.00 34.69  ? 237 ASP C C   1 
ATOM   7066  O  O   . ASP C  1 237 ? 4.126   25.851  13.242  1.00 33.06  ? 237 ASP C O   1 
ATOM   7067  C  CB  . ASP C  1 237 ? 3.144   28.910  13.476  1.00 22.27  ? 237 ASP C CB  1 
ATOM   7068  C  CG  . ASP C  1 237 ? 3.497   30.350  13.213  1.00 31.43  ? 237 ASP C CG  1 
ATOM   7069  O  OD1 . ASP C  1 237 ? 4.702   30.643  13.055  1.00 31.70  ? 237 ASP C OD1 1 
ATOM   7070  O  OD2 . ASP C  1 237 ? 2.565   31.178  13.128  1.00 36.19  ? 237 ASP C OD2 1 
ATOM   7071  N  N   . ARG C  1 238 ? 2.007   26.096  12.460  1.00 30.70  ? 238 ARG C N   1 
ATOM   7072  C  CA  . ARG C  1 238 ? 1.541   24.787  12.893  1.00 25.88  ? 238 ARG C CA  1 
ATOM   7073  C  C   . ARG C  1 238 ? 0.604   24.169  11.875  1.00 32.95  ? 238 ARG C C   1 
ATOM   7074  O  O   . ARG C  1 238 ? -0.204  24.867  11.235  1.00 23.11  ? 238 ARG C O   1 
ATOM   7075  C  CB  . ARG C  1 238 ? 0.763   24.932  14.200  1.00 30.38  ? 238 ARG C CB  1 
ATOM   7076  C  CG  . ARG C  1 238 ? 1.537   25.606  15.333  1.00 21.50  ? 238 ARG C CG  1 
ATOM   7077  C  CD  . ARG C  1 238 ? 2.707   24.719  15.743  1.00 18.48  ? 238 ARG C CD  1 
ATOM   7078  N  NE  . ARG C  1 238 ? 3.311   25.154  16.991  1.00 24.06  ? 238 ARG C NE  1 
ATOM   7079  C  CZ  . ARG C  1 238 ? 4.360   25.963  17.084  1.00 33.89  ? 238 ARG C CZ  1 
ATOM   7080  N  NH1 . ARG C  1 238 ? 4.918   26.459  15.983  1.00 29.63  ? 238 ARG C NH1 1 
ATOM   7081  N  NH2 . ARG C  1 238 ? 4.852   26.270  18.283  1.00 27.39  ? 238 ARG C NH2 1 
ATOM   7082  N  N   . VAL C  1 239 ? 0.693   22.852  11.756  1.00 29.59  ? 239 VAL C N   1 
ATOM   7083  C  CA  . VAL C  1 239 ? -0.224  22.075  10.940  1.00 28.71  ? 239 VAL C CA  1 
ATOM   7084  C  C   . VAL C  1 239 ? -0.793  20.917  11.761  1.00 30.94  ? 239 VAL C C   1 
ATOM   7085  O  O   . VAL C  1 239 ? -0.050  20.158  12.401  1.00 28.12  ? 239 VAL C O   1 
ATOM   7086  C  CB  . VAL C  1 239 ? 0.460   21.469  9.716   1.00 30.38  ? 239 VAL C CB  1 
ATOM   7087  C  CG1 . VAL C  1 239 ? -0.576  20.710  8.868   1.00 33.19  ? 239 VAL C CG1 1 
ATOM   7088  C  CG2 . VAL C  1 239 ? 1.183   22.556  8.903   1.00 24.88  ? 239 VAL C CG2 1 
ATOM   7089  N  N   . ILE C  1 240 ? -2.113  20.813  11.757  1.00 29.50  ? 240 ILE C N   1 
ATOM   7090  C  CA  . ILE C  1 240 ? -2.805  19.722  12.404  1.00 26.59  ? 240 ILE C CA  1 
ATOM   7091  C  C   . ILE C  1 240 ? -3.351  18.822  11.305  1.00 33.12  ? 240 ILE C C   1 
ATOM   7092  O  O   . ILE C  1 240 ? -4.110  19.265  10.433  1.00 34.03  ? 240 ILE C O   1 
ATOM   7093  C  CB  . ILE C  1 240 ? -3.931  20.239  13.294  1.00 27.43  ? 240 ILE C CB  1 
ATOM   7094  C  CG1 . ILE C  1 240 ? -3.364  21.186  14.361  1.00 30.13  ? 240 ILE C CG1 1 
ATOM   7095  C  CG2 . ILE C  1 240 ? -4.677  19.081  13.941  1.00 27.06  ? 240 ILE C CG2 1 
ATOM   7096  C  CD1 . ILE C  1 240 ? -4.413  21.701  15.343  1.00 30.85  ? 240 ILE C CD1 1 
ATOM   7097  N  N   . MET C  1 241 ? -2.925  17.569  11.322  1.00 33.98  ? 241 MET C N   1 
ATOM   7098  C  CA  . MET C  1 241 ? -3.360  16.602  10.331  1.00 35.32  ? 241 MET C CA  1 
ATOM   7099  C  C   . MET C  1 241 ? -4.557  15.836  10.866  1.00 39.55  ? 241 MET C C   1 
ATOM   7100  O  O   . MET C  1 241 ? -4.414  14.972  11.741  1.00 38.65  ? 241 MET C O   1 
ATOM   7101  C  CB  . MET C  1 241 ? -2.229  15.643  9.989   1.00 31.63  ? 241 MET C CB  1 
ATOM   7102  C  CG  . MET C  1 241 ? -1.096  16.286  9.220   1.00 33.66  ? 241 MET C CG  1 
ATOM   7103  S  SD  . MET C  1 241 ? 0.310   15.165  9.203   1.00 35.26  ? 241 MET C SD  1 
ATOM   7104  C  CE  . MET C  1 241 ? -0.536  13.683  8.641   1.00 40.95  ? 241 MET C CE  1 
ATOM   7105  N  N   . ALA C  1 242 ? -5.738  16.143  10.332  1.00 30.62  ? 242 ALA C N   1 
ATOM   7106  C  CA  . ALA C  1 242 ? -6.971  15.625  10.914  1.00 35.67  ? 242 ALA C CA  1 
ATOM   7107  C  C   . ALA C  1 242 ? -7.712  14.646  10.000  1.00 44.66  ? 242 ALA C C   1 
ATOM   7108  O  O   . ALA C  1 242 ? -8.685  14.024  10.411  1.00 51.04  ? 242 ALA C O   1 
ATOM   7109  C  CB  . ALA C  1 242 ? -7.889  16.776  11.307  1.00 33.98  ? 242 ALA C CB  1 
ATOM   7110  N  N   . GLY C  1 243 ? -7.257  14.522  8.761   1.00 40.56  ? 243 GLY C N   1 
ATOM   7111  C  CA  . GLY C  1 243 ? -7.956  13.707  7.788   1.00 37.82  ? 243 GLY C CA  1 
ATOM   7112  C  C   . GLY C  1 243 ? -7.186  13.640  6.488   1.00 45.77  ? 243 GLY C C   1 
ATOM   7113  O  O   . GLY C  1 243 ? -6.141  14.283  6.339   1.00 45.39  ? 243 GLY C O   1 
ATOM   7114  N  N   . GLY C  1 244 ? -7.699  12.853  5.548   1.00 45.26  ? 244 GLY C N   1 
ATOM   7115  C  CA  . GLY C  1 244 ? -7.020  12.641  4.283   1.00 52.13  ? 244 GLY C CA  1 
ATOM   7116  C  C   . GLY C  1 244 ? -6.121  11.418  4.312   1.00 54.78  ? 244 GLY C C   1 
ATOM   7117  O  O   . GLY C  1 244 ? -6.178  10.595  5.233   1.00 54.81  ? 244 GLY C O   1 
ATOM   7118  N  N   . GLY C  1 245 ? -5.283  11.298  3.290   1.00 60.78  ? 245 GLY C N   1 
ATOM   7119  C  CA  . GLY C  1 245 ? -4.340  10.202  3.208   1.00 61.97  ? 245 GLY C CA  1 
ATOM   7120  C  C   . GLY C  1 245 ? -3.034  10.553  3.893   1.00 68.47  ? 245 GLY C C   1 
ATOM   7121  O  O   . GLY C  1 245 ? -2.935  11.551  4.615   1.00 64.49  ? 245 GLY C O   1 
ATOM   7122  N  N   . SER C  1 246 ? -2.023  9.728   3.661   1.00 73.05  ? 246 SER C N   1 
ATOM   7123  C  CA  . SER C  1 246 ? -0.749  9.902   4.332   1.00 74.25  ? 246 SER C CA  1 
ATOM   7124  C  C   . SER C  1 246 ? 0.162   10.837  3.545   1.00 67.06  ? 246 SER C C   1 
ATOM   7125  O  O   . SER C  1 246 ? 1.256   11.169  4.009   1.00 60.91  ? 246 SER C O   1 
ATOM   7126  C  CB  . SER C  1 246 ? -0.076  8.543   4.595   1.00 79.39  ? 246 SER C CB  1 
ATOM   7127  O  OG  . SER C  1 246 ? -0.000  7.751   3.420   1.00 83.06  ? 246 SER C OG  1 
ATOM   7128  N  N   . GLU C  1 247 ? -0.295  11.256  2.360   1.00 58.21  ? 247 GLU C N   1 
ATOM   7129  C  CA  . GLU C  1 247 ? 0.412   12.272  1.568   1.00 49.27  ? 247 GLU C CA  1 
ATOM   7130  C  C   . GLU C  1 247 ? 0.194   13.653  2.195   1.00 42.11  ? 247 GLU C C   1 
ATOM   7131  O  O   . GLU C  1 247 ? 0.847   14.637  1.856   1.00 41.81  ? 247 GLU C O   1 
ATOM   7132  C  CB  . GLU C  1 247 ? -0.070  12.259  0.120   1.00 51.18  ? 247 GLU C CB  1 
ATOM   7133  C  CG  . GLU C  1 247 ? -1.491  12.783  -0.061  1.00 55.62  ? 247 GLU C CG  1 
ATOM   7134  C  CD  . GLU C  1 247 ? -2.560  11.806  0.430   1.00 67.02  ? 247 GLU C CD  1 
ATOM   7135  O  OE1 . GLU C  1 247 ? -2.276  10.587  0.539   1.00 70.21  ? 247 GLU C OE1 1 
ATOM   7136  O  OE2 . GLU C  1 247 ? -3.693  12.267  0.699   1.00 67.14  ? 247 GLU C OE2 1 
ATOM   7137  N  N   . THR C  1 248 ? -0.756  13.707  3.111   1.00 32.05  ? 248 THR C N   1 
ATOM   7138  C  CA  . THR C  1 248 ? -0.973  14.871  3.929   1.00 34.57  ? 248 THR C CA  1 
ATOM   7139  C  C   . THR C  1 248 ? 0.281   15.217  4.746   1.00 35.67  ? 248 THR C C   1 
ATOM   7140  O  O   . THR C  1 248 ? 0.589   16.393  4.940   1.00 31.42  ? 248 THR C O   1 
ATOM   7141  C  CB  . THR C  1 248 ? -2.186  14.639  4.843   1.00 48.08  ? 248 THR C CB  1 
ATOM   7142  O  OG1 . THR C  1 248 ? -3.390  14.691  4.049   1.00 56.71  ? 248 THR C OG1 1 
ATOM   7143  C  CG2 . THR C  1 248 ? -2.253  15.693  5.916   1.00 53.51  ? 248 THR C CG2 1 
ATOM   7144  N  N   . LEU C  1 249 ? 1.012   14.206  5.215   1.00 29.56  ? 249 LEU C N   1 
ATOM   7145  C  CA  . LEU C  1 249 ? 2.247   14.479  5.939   1.00 35.56  ? 249 LEU C CA  1 
ATOM   7146  C  C   . LEU C  1 249 ? 3.195   15.321  5.079   1.00 35.90  ? 249 LEU C C   1 
ATOM   7147  O  O   . LEU C  1 249 ? 3.691   16.364  5.514   1.00 32.42  ? 249 LEU C O   1 
ATOM   7148  C  CB  . LEU C  1 249 ? 2.932   13.194  6.408   1.00 30.93  ? 249 LEU C CB  1 
ATOM   7149  C  CG  . LEU C  1 249 ? 4.257   13.380  7.169   1.00 33.90  ? 249 LEU C CG  1 
ATOM   7150  C  CD1 . LEU C  1 249 ? 4.087   14.307  8.355   1.00 29.92  ? 249 LEU C CD1 1 
ATOM   7151  C  CD2 . LEU C  1 249 ? 4.770   12.032  7.637   1.00 27.32  ? 249 LEU C CD2 1 
ATOM   7152  N  N   . SER C  1 250 ? 3.426   14.892  3.848   1.00 33.17  ? 250 SER C N   1 
ATOM   7153  C  CA  . SER C  1 250 ? 4.274   15.675  2.964   1.00 39.56  ? 250 SER C CA  1 
ATOM   7154  C  C   . SER C  1 250 ? 3.758   17.116  2.812   1.00 34.69  ? 250 SER C C   1 
ATOM   7155  O  O   . SER C  1 250 ? 4.521   18.071  2.871   1.00 37.65  ? 250 SER C O   1 
ATOM   7156  C  CB  . SER C  1 250 ? 4.403   15.013  1.599   1.00 37.78  ? 250 SER C CB  1 
ATOM   7157  O  OG  . SER C  1 250 ? 5.294   15.767  0.805   1.00 44.80  ? 250 SER C OG  1 
ATOM   7158  N  N   . GLN C  1 251 ? 2.459   17.269  2.640   1.00 30.36  ? 251 GLN C N   1 
ATOM   7159  C  CA  . GLN C  1 251 ? 1.886   18.601  2.490   1.00 30.86  ? 251 GLN C CA  1 
ATOM   7160  C  C   . GLN C  1 251 ? 2.165   19.415  3.750   1.00 38.11  ? 251 GLN C C   1 
ATOM   7161  O  O   . GLN C  1 251 ? 2.492   20.602  3.686   1.00 34.47  ? 251 GLN C O   1 
ATOM   7162  C  CB  . GLN C  1 251 ? 0.378   18.507  2.246   1.00 31.16  ? 251 GLN C CB  1 
ATOM   7163  C  CG  . GLN C  1 251 ? 0.010   17.655  1.028   1.00 43.76  ? 251 GLN C CG  1 
ATOM   7164  C  CD  . GLN C  1 251 ? -1.501  17.399  0.884   1.00 53.45  ? 251 GLN C CD  1 
ATOM   7165  O  OE1 . GLN C  1 251 ? -2.287  17.613  1.815   1.00 50.69  ? 251 GLN C OE1 1 
ATOM   7166  N  NE2 . GLN C  1 251 ? -1.900  16.915  -0.288  1.00 56.14  ? 251 GLN C NE2 1 
ATOM   7167  N  N   . ALA C  1 252 ? 2.037   18.762  4.899   1.00 35.37  ? 252 ALA C N   1 
ATOM   7168  C  CA  . ALA C  1 252 ? 2.244   19.446  6.162   1.00 33.99  ? 252 ALA C CA  1 
ATOM   7169  C  C   . ALA C  1 252 ? 3.698   19.893  6.274   1.00 31.03  ? 252 ALA C C   1 
ATOM   7170  O  O   . ALA C  1 252 ? 3.966   21.030  6.632   1.00 33.46  ? 252 ALA C O   1 
ATOM   7171  C  CB  . ALA C  1 252 ? 1.828   18.559  7.335   1.00 26.74  ? 252 ALA C CB  1 
ATOM   7172  N  N   . VAL C  1 253 ? 4.633   19.012  5.935   1.00 31.80  ? 253 VAL C N   1 
ATOM   7173  C  CA  . VAL C  1 253 ? 6.043   19.376  5.993   1.00 35.28  ? 253 VAL C CA  1 
ATOM   7174  C  C   . VAL C  1 253 ? 6.341   20.543  5.061   1.00 40.15  ? 253 VAL C C   1 
ATOM   7175  O  O   . VAL C  1 253 ? 7.143   21.429  5.381   1.00 41.60  ? 253 VAL C O   1 
ATOM   7176  C  CB  . VAL C  1 253 ? 6.965   18.183  5.657   1.00 30.13  ? 253 VAL C CB  1 
ATOM   7177  C  CG1 . VAL C  1 253 ? 8.414   18.650  5.443   1.00 30.56  ? 253 VAL C CG1 1 
ATOM   7178  C  CG2 . VAL C  1 253 ? 6.883   17.117  6.750   1.00 28.69  ? 253 VAL C CG2 1 
ATOM   7179  N  N   . LYS C  1 254 ? 5.695   20.551  3.905   1.00 35.81  ? 254 LYS C N   1 
ATOM   7180  C  CA  . LYS C  1 254 ? 5.973   21.585  2.906   1.00 38.53  ? 254 LYS C CA  1 
ATOM   7181  C  C   . LYS C  1 254 ? 5.362   22.927  3.281   1.00 40.30  ? 254 LYS C C   1 
ATOM   7182  O  O   . LYS C  1 254 ? 5.868   23.966  2.899   1.00 46.79  ? 254 LYS C O   1 
ATOM   7183  C  CB  . LYS C  1 254 ? 5.499   21.143  1.525   1.00 39.87  ? 254 LYS C CB  1 
ATOM   7184  C  CG  . LYS C  1 254 ? 6.394   20.090  0.878   1.00 37.42  ? 254 LYS C CG  1 
ATOM   7185  C  CD  . LYS C  1 254 ? 5.744   19.515  -0.379  1.00 40.29  ? 254 LYS C CD  1 
ATOM   7186  C  CE  . LYS C  1 254 ? 6.602   18.412  -0.990  1.00 45.80  ? 254 LYS C CE  1 
ATOM   7187  N  NZ  . LYS C  1 254 ? 5.876   17.680  -2.064  1.00 55.69  ? 254 LYS C NZ  1 
ATOM   7188  N  N   . MET C  1 255 ? 4.293   22.888  4.065   1.00 40.24  ? 255 MET C N   1 
ATOM   7189  C  CA  . MET C  1 255 ? 3.575   24.089  4.477   1.00 38.78  ? 255 MET C CA  1 
ATOM   7190  C  C   . MET C  1 255 ? 4.151   24.775  5.727   1.00 28.81  ? 255 MET C C   1 
ATOM   7191  O  O   . MET C  1 255 ? 4.075   26.002  5.839   1.00 27.75  ? 255 MET C O   1 
ATOM   7192  C  CB  . MET C  1 255 ? 2.092   23.754  4.710   1.00 43.57  ? 255 MET C CB  1 
ATOM   7193  C  CG  . MET C  1 255 ? 1.313   23.438  3.441   1.00 58.76  ? 255 MET C CG  1 
ATOM   7194  S  SD  . MET C  1 255 ? -0.268  22.660  3.835   1.00 61.30  ? 255 MET C SD  1 
ATOM   7195  C  CE  . MET C  1 255 ? -0.437  23.384  5.445   1.00 16.03  ? 255 MET C CE  1 
ATOM   7196  N  N   . VAL C  1 256 ? 4.694   24.000  6.675   1.00 27.39  ? 256 VAL C N   1 
ATOM   7197  C  CA  . VAL C  1 256 ? 5.141   24.595  7.925   1.00 28.97  ? 256 VAL C CA  1 
ATOM   7198  C  C   . VAL C  1 256 ? 6.467   25.285  7.792   1.00 30.11  ? 256 VAL C C   1 
ATOM   7199  O  O   . VAL C  1 256 ? 7.330   24.869  7.027   1.00 31.26  ? 256 VAL C O   1 
ATOM   7200  C  CB  . VAL C  1 256 ? 5.374   23.608  9.100   1.00 33.45  ? 256 VAL C CB  1 
ATOM   7201  C  CG1 . VAL C  1 256 ? 4.163   23.486  9.999   1.00 41.84  ? 256 VAL C CG1 1 
ATOM   7202  C  CG2 . VAL C  1 256 ? 5.964   22.304  8.636   1.00 32.84  ? 256 VAL C CG2 1 
ATOM   7203  N  N   . LYS C  1 257 ? 6.624   26.310  8.616   1.00 25.92  ? 257 LYS C N   1 
ATOM   7204  C  CA  . LYS C  1 257 ? 7.891   26.996  8.803   1.00 25.21  ? 257 LYS C CA  1 
ATOM   7205  C  C   . LYS C  1 257 ? 8.947   26.075  9.423   1.00 30.40  ? 257 LYS C C   1 
ATOM   7206  O  O   . LYS C  1 257 ? 8.622   25.192  10.225  1.00 30.98  ? 257 LYS C O   1 
ATOM   7207  C  CB  . LYS C  1 257 ? 7.676   28.184  9.740   1.00 30.18  ? 257 LYS C CB  1 
ATOM   7208  C  CG  . LYS C  1 257 ? 6.825   29.318  9.153   1.00 32.23  ? 257 LYS C CG  1 
ATOM   7209  C  CD  . LYS C  1 257 ? 6.471   30.349  10.224  1.00 29.48  ? 257 LYS C CD  1 
ATOM   7210  C  CE  . LYS C  1 257 ? 5.488   31.403  9.683   1.00 35.34  ? 257 LYS C CE  1 
ATOM   7211  N  NZ  . LYS C  1 257 ? 5.271   32.503  10.697  1.00 42.83  ? 257 LYS C NZ  1 
ATOM   7212  N  N   . PRO C  1 258 ? 10.219  26.281  9.054   1.00 32.93  ? 258 PRO C N   1 
ATOM   7213  C  CA  . PRO C  1 258 ? 11.293  25.675  9.858   1.00 31.79  ? 258 PRO C CA  1 
ATOM   7214  C  C   . PRO C  1 258 ? 11.074  26.020  11.337  1.00 28.66  ? 258 PRO C C   1 
ATOM   7215  O  O   . PRO C  1 258 ? 10.793  27.169  11.657  1.00 33.88  ? 258 PRO C O   1 
ATOM   7216  C  CB  . PRO C  1 258 ? 12.563  26.373  9.352   1.00 29.45  ? 258 PRO C CB  1 
ATOM   7217  C  CG  . PRO C  1 258 ? 12.205  26.903  7.957   1.00 29.50  ? 258 PRO C CG  1 
ATOM   7218  C  CD  . PRO C  1 258 ? 10.721  27.200  8.008   1.00 30.40  ? 258 PRO C CD  1 
ATOM   7219  N  N   . GLY C  1 259 ? 11.184  25.040  12.223  1.00 28.16  ? 259 GLY C N   1 
ATOM   7220  C  CA  . GLY C  1 259 ? 10.963  25.284  13.630  1.00 24.76  ? 259 GLY C CA  1 
ATOM   7221  C  C   . GLY C  1 259 ? 9.513   25.129  14.034  1.00 29.92  ? 259 GLY C C   1 
ATOM   7222  O  O   . GLY C  1 259 ? 9.184   25.220  15.211  1.00 34.01  ? 259 GLY C O   1 
ATOM   7223  N  N   . GLY C  1 260 ? 8.639   24.892  13.062  1.00 31.03  ? 260 GLY C N   1 
ATOM   7224  C  CA  . GLY C  1 260 ? 7.241   24.650  13.361  1.00 26.54  ? 260 GLY C CA  1 
ATOM   7225  C  C   . GLY C  1 260 ? 6.933   23.250  13.878  1.00 28.46  ? 260 GLY C C   1 
ATOM   7226  O  O   . GLY C  1 260 ? 7.825   22.416  14.043  1.00 32.04  ? 260 GLY C O   1 
ATOM   7227  N  N   . ILE C  1 261 ? 5.653   22.993  14.139  1.00 25.24  ? 261 ILE C N   1 
ATOM   7228  C  CA  . ILE C  1 261 ? 5.209   21.690  14.625  1.00 30.52  ? 261 ILE C CA  1 
ATOM   7229  C  C   . ILE C  1 261 ? 4.038   21.155  13.783  1.00 30.70  ? 261 ILE C C   1 
ATOM   7230  O  O   . ILE C  1 261 ? 3.124   21.900  13.426  1.00 31.68  ? 261 ILE C O   1 
ATOM   7231  C  CB  . ILE C  1 261 ? 4.763   21.760  16.087  1.00 29.21  ? 261 ILE C CB  1 
ATOM   7232  C  CG1 . ILE C  1 261 ? 5.893   22.319  16.959  1.00 34.82  ? 261 ILE C CG1 1 
ATOM   7233  C  CG2 . ILE C  1 261 ? 4.302   20.365  16.579  1.00 23.79  ? 261 ILE C CG2 1 
ATOM   7234  C  CD1 . ILE C  1 261 ? 5.574   22.337  18.464  1.00 34.89  ? 261 ILE C CD1 1 
ATOM   7235  N  N   . ILE C  1 262 ? 4.102   19.871  13.455  1.00 26.95  ? 262 ILE C N   1 
ATOM   7236  C  CA  . ILE C  1 262 ? 3.048   19.154  12.740  1.00 23.02  ? 262 ILE C CA  1 
ATOM   7237  C  C   . ILE C  1 262 ? 2.416   18.170  13.716  1.00 32.19  ? 262 ILE C C   1 
ATOM   7238  O  O   . ILE C  1 262 ? 3.110   17.292  14.269  1.00 28.47  ? 262 ILE C O   1 
ATOM   7239  C  CB  . ILE C  1 262 ? 3.624   18.361  11.550  1.00 30.61  ? 262 ILE C CB  1 
ATOM   7240  C  CG1 . ILE C  1 262 ? 4.189   19.315  10.501  1.00 35.03  ? 262 ILE C CG1 1 
ATOM   7241  C  CG2 . ILE C  1 262 ? 2.541   17.430  10.915  1.00 31.17  ? 262 ILE C CG2 1 
ATOM   7242  C  CD1 . ILE C  1 262 ? 5.056   18.655  9.467   1.00 30.78  ? 262 ILE C CD1 1 
ATOM   7243  N  N   . SER C  1 263 ? 1.112   18.332  13.943  1.00 25.57  ? 263 SER C N   1 
ATOM   7244  C  CA  . SER C  1 263 ? 0.387   17.514  14.897  1.00 29.57  ? 263 SER C CA  1 
ATOM   7245  C  C   . SER C  1 263 ? -0.613  16.568  14.198  1.00 32.10  ? 263 SER C C   1 
ATOM   7246  O  O   . SER C  1 263 ? -1.629  17.010  13.662  1.00 26.03  ? 263 SER C O   1 
ATOM   7247  C  CB  . SER C  1 263 ? -0.355  18.424  15.868  1.00 41.41  ? 263 SER C CB  1 
ATOM   7248  O  OG  . SER C  1 263 ? -1.089  17.675  16.816  1.00 40.93  ? 263 SER C OG  1 
ATOM   7249  N  N   . ASN C  1 264 ? -0.329  15.270  14.217  1.00 32.94  ? 264 ASN C N   1 
ATOM   7250  C  CA  . ASN C  1 264 ? -1.236  14.291  13.612  1.00 31.67  ? 264 ASN C CA  1 
ATOM   7251  C  C   . ASN C  1 264 ? -2.193  13.678  14.617  1.00 32.41  ? 264 ASN C C   1 
ATOM   7252  O  O   . ASN C  1 264 ? -1.769  13.072  15.594  1.00 33.19  ? 264 ASN C O   1 
ATOM   7253  C  CB  . ASN C  1 264 ? -0.465  13.163  12.948  1.00 28.55  ? 264 ASN C CB  1 
ATOM   7254  C  CG  . ASN C  1 264 ? -1.389  12.033  12.470  1.00 41.44  ? 264 ASN C CG  1 
ATOM   7255  O  OD1 . ASN C  1 264 ? -1.944  12.079  11.371  1.00 32.70  ? 264 ASN C OD1 1 
ATOM   7256  N  ND2 . ASN C  1 264 ? -1.574  11.036  13.315  1.00 40.69  ? 264 ASN C ND2 1 
ATOM   7257  N  N   . ILE C  1 265 ? -3.487  13.843  14.382  1.00 31.16  ? 265 ILE C N   1 
ATOM   7258  C  CA  . ILE C  1 265 ? -4.480  13.123  15.162  1.00 31.88  ? 265 ILE C CA  1 
ATOM   7259  C  C   . ILE C  1 265 ? -5.244  12.171  14.257  1.00 38.95  ? 265 ILE C C   1 
ATOM   7260  O  O   . ILE C  1 265 ? -6.135  11.457  14.705  1.00 34.52  ? 265 ILE C O   1 
ATOM   7261  C  CB  . ILE C  1 265 ? -5.463  14.062  15.867  1.00 33.29  ? 265 ILE C CB  1 
ATOM   7262  C  CG1 . ILE C  1 265 ? -6.036  15.088  14.874  1.00 30.46  ? 265 ILE C CG1 1 
ATOM   7263  C  CG2 . ILE C  1 265 ? -4.793  14.724  17.066  1.00 32.86  ? 265 ILE C CG2 1 
ATOM   7264  C  CD1 . ILE C  1 265 ? -6.785  16.184  15.543  1.00 31.85  ? 265 ILE C CD1 1 
ATOM   7265  N  N   . ASN C  1 266 ? -4.859  12.162  12.984  1.00 38.39  ? 266 ASN C N   1 
ATOM   7266  C  CA  . ASN C  1 266 ? -5.415  11.253  11.994  1.00 32.16  ? 266 ASN C CA  1 
ATOM   7267  C  C   . ASN C  1 266 ? -5.100  9.767   12.247  1.00 45.35  ? 266 ASN C C   1 
ATOM   7268  O  O   . ASN C  1 266 ? -3.929  9.359   12.328  1.00 43.77  ? 266 ASN C O   1 
ATOM   7269  C  CB  . ASN C  1 266 ? -4.884  11.617  10.613  1.00 30.07  ? 266 ASN C CB  1 
ATOM   7270  C  CG  . ASN C  1 266 ? -5.787  11.133  9.513   1.00 44.24  ? 266 ASN C CG  1 
ATOM   7271  O  OD1 . ASN C  1 266 ? -6.954  10.834  9.756   1.00 39.73  ? 266 ASN C OD1 1 
ATOM   7272  N  ND2 . ASN C  1 266 ? -5.262  11.055  8.296   1.00 57.70  ? 266 ASN C ND2 1 
ATOM   7273  N  N   . TYR C  1 267 ? -6.153  8.964   12.365  1.00 50.11  ? 267 TYR C N   1 
ATOM   7274  C  CA  . TYR C  1 267 ? -6.030  7.507   12.367  1.00 50.55  ? 267 TYR C CA  1 
ATOM   7275  C  C   . TYR C  1 267 ? -5.799  7.035   10.938  1.00 45.73  ? 267 TYR C C   1 
ATOM   7276  O  O   . TYR C  1 267 ? -6.733  6.910   10.158  1.00 38.86  ? 267 TYR C O   1 
ATOM   7277  C  CB  . TYR C  1 267 ? -7.297  6.876   12.942  1.00 53.95  ? 267 TYR C CB  1 
ATOM   7278  C  CG  . TYR C  1 267 ? -7.344  5.356   12.957  1.00 66.80  ? 267 TYR C CG  1 
ATOM   7279  C  CD1 . TYR C  1 267 ? -6.187  4.582   12.823  1.00 65.64  ? 267 TYR C CD1 1 
ATOM   7280  C  CD2 . TYR C  1 267 ? -8.554  4.697   13.141  1.00 71.27  ? 267 TYR C CD2 1 
ATOM   7281  C  CE1 . TYR C  1 267 ? -6.246  3.191   12.852  1.00 63.03  ? 267 TYR C CE1 1 
ATOM   7282  C  CE2 . TYR C  1 267 ? -8.624  3.321   13.175  1.00 73.02  ? 267 TYR C CE2 1 
ATOM   7283  C  CZ  . TYR C  1 267 ? -7.474  2.569   13.032  1.00 69.51  ? 267 TYR C CZ  1 
ATOM   7284  O  OH  . TYR C  1 267 ? -7.584  1.196   13.068  1.00 67.48  ? 267 TYR C OH  1 
ATOM   7285  N  N   . HIS C  1 268 ? -4.540  6.819   10.588  1.00 48.11  ? 268 HIS C N   1 
ATOM   7286  C  CA  . HIS C  1 268 ? -4.206  6.262   9.291   1.00 48.60  ? 268 HIS C CA  1 
ATOM   7287  C  C   . HIS C  1 268 ? -4.540  4.776   9.343   1.00 48.86  ? 268 HIS C C   1 
ATOM   7288  O  O   . HIS C  1 268 ? -4.161  4.082   10.290  1.00 30.93  ? 268 HIS C O   1 
ATOM   7289  C  CB  . HIS C  1 268 ? -2.726  6.507   9.003   1.00 48.76  ? 268 HIS C CB  1 
ATOM   7290  C  CG  . HIS C  1 268 ? -2.363  7.957   8.994   1.00 52.91  ? 268 HIS C CG  1 
ATOM   7291  N  ND1 . HIS C  1 268 ? -2.036  8.636   7.841   1.00 56.00  ? 268 HIS C ND1 1 
ATOM   7292  C  CD2 . HIS C  1 268 ? -2.327  8.873   9.993   1.00 54.03  ? 268 HIS C CD2 1 
ATOM   7293  C  CE1 . HIS C  1 268 ? -1.790  9.902   8.132   1.00 57.76  ? 268 HIS C CE1 1 
ATOM   7294  N  NE2 . HIS C  1 268 ? -1.963  10.073  9.431   1.00 52.91  ? 268 HIS C NE2 1 
ATOM   7295  N  N   . GLY C  1 269 ? -5.282  4.302   8.346   1.00 56.84  ? 269 GLY C N   1 
ATOM   7296  C  CA  . GLY C  1 269 ? -5.783  2.938   8.355   1.00 57.02  ? 269 GLY C CA  1 
ATOM   7297  C  C   . GLY C  1 269 ? -5.165  2.006   7.330   1.00 58.58  ? 269 GLY C C   1 
ATOM   7298  O  O   . GLY C  1 269 ? -5.398  0.797   7.380   1.00 64.38  ? 269 GLY C O   1 
ATOM   7299  N  N   . SER C  1 270 ? -4.378  2.549   6.402   1.00 53.38  ? 270 SER C N   1 
ATOM   7300  C  CA  . SER C  1 270 ? -3.776  1.729   5.346   1.00 57.10  ? 270 SER C CA  1 
ATOM   7301  C  C   . SER C  1 270 ? -2.472  2.315   4.805   1.00 51.00  ? 270 SER C C   1 
ATOM   7302  O  O   . SER C  1 270 ? -2.164  3.480   5.054   1.00 47.63  ? 270 SER C O   1 
ATOM   7303  C  CB  . SER C  1 270 ? -4.770  1.543   4.196   1.00 63.10  ? 270 SER C CB  1 
ATOM   7304  O  OG  . SER C  1 270 ? -5.088  2.789   3.602   1.00 64.24  ? 270 SER C OG  1 
ATOM   7305  N  N   . GLY C  1 271 ? -1.730  1.506   4.043   1.00 50.89  ? 271 GLY C N   1 
ATOM   7306  C  CA  . GLY C  1 271 ? -0.404  1.867   3.549   1.00 52.22  ? 271 GLY C CA  1 
ATOM   7307  C  C   . GLY C  1 271 ? 0.686   1.333   4.481   1.00 51.14  ? 271 GLY C C   1 
ATOM   7308  O  O   . GLY C  1 271 ? 0.471   1.243   5.690   1.00 46.73  ? 271 GLY C O   1 
ATOM   7309  N  N   . ASP C  1 272 ? 1.846   0.966   3.938   1.00 43.24  ? 272 ASP C N   1 
ATOM   7310  C  CA  . ASP C  1 272 ? 2.942   0.470   4.777   1.00 37.79  ? 272 ASP C CA  1 
ATOM   7311  C  C   . ASP C  1 272 ? 3.644   1.600   5.552   1.00 40.60  ? 272 ASP C C   1 
ATOM   7312  O  O   . ASP C  1 272 ? 4.066   1.418   6.697   1.00 41.58  ? 272 ASP C O   1 
ATOM   7313  C  CB  . ASP C  1 272 ? 3.963   -0.324  3.949   1.00 39.16  ? 272 ASP C CB  1 
ATOM   7314  C  CG  . ASP C  1 272 ? 3.603   -1.820  3.835   1.00 59.85  ? 272 ASP C CG  1 
ATOM   7315  O  OD1 . ASP C  1 272 ? 2.617   -2.256  4.478   1.00 66.19  ? 272 ASP C OD1 1 
ATOM   7316  O  OD2 . ASP C  1 272 ? 4.309   -2.562  3.110   1.00 54.98  ? 272 ASP C OD2 1 
ATOM   7317  N  N   . ALA C  1 273 ? 3.748   2.768   4.933   1.00 44.60  ? 273 ALA C N   1 
ATOM   7318  C  CA  . ALA C  1 273 ? 4.520   3.862   5.508   1.00 47.45  ? 273 ALA C CA  1 
ATOM   7319  C  C   . ALA C  1 273 ? 3.890   5.234   5.277   1.00 49.43  ? 273 ALA C C   1 
ATOM   7320  O  O   . ALA C  1 273 ? 3.068   5.405   4.373   1.00 50.16  ? 273 ALA C O   1 
ATOM   7321  C  CB  . ALA C  1 273 ? 5.916   3.835   4.945   1.00 41.65  ? 273 ALA C CB  1 
ATOM   7322  N  N   . LEU C  1 274 ? 4.267   6.205   6.109   1.00 45.32  ? 274 LEU C N   1 
ATOM   7323  C  CA  . LEU C  1 274 ? 3.994   7.614   5.824   1.00 41.96  ? 274 LEU C CA  1 
ATOM   7324  C  C   . LEU C  1 274 ? 5.288   8.240   5.320   1.00 38.33  ? 274 LEU C C   1 
ATOM   7325  O  O   . LEU C  1 274 ? 6.360   7.928   5.829   1.00 37.54  ? 274 LEU C O   1 
ATOM   7326  C  CB  . LEU C  1 274 ? 3.509   8.360   7.070   1.00 41.98  ? 274 LEU C CB  1 
ATOM   7327  C  CG  . LEU C  1 274 ? 2.149   7.997   7.665   1.00 44.55  ? 274 LEU C CG  1 
ATOM   7328  C  CD1 . LEU C  1 274 ? 2.216   6.663   8.344   1.00 42.65  ? 274 LEU C CD1 1 
ATOM   7329  C  CD2 . LEU C  1 274 ? 1.700   9.070   8.645   1.00 49.18  ? 274 LEU C CD2 1 
ATOM   7330  N  N   . LEU C  1 275 ? 5.202   9.119   4.329   1.00 32.28  ? 275 LEU C N   1 
ATOM   7331  C  CA  . LEU C  1 275 ? 6.415   9.681   3.731   1.00 36.38  ? 275 LEU C CA  1 
ATOM   7332  C  C   . LEU C  1 275 ? 6.741   11.121  4.151   1.00 37.63  ? 275 LEU C C   1 
ATOM   7333  O  O   . LEU C  1 275 ? 5.883   12.006  4.137   1.00 35.34  ? 275 LEU C O   1 
ATOM   7334  C  CB  . LEU C  1 275 ? 6.346   9.602   2.205   1.00 44.83  ? 275 LEU C CB  1 
ATOM   7335  C  CG  . LEU C  1 275 ? 5.882   8.282   1.588   1.00 52.18  ? 275 LEU C CG  1 
ATOM   7336  C  CD1 . LEU C  1 275 ? 5.899   8.377   0.063   1.00 55.85  ? 275 LEU C CD1 1 
ATOM   7337  C  CD2 . LEU C  1 275 ? 6.742   7.128   2.064   1.00 52.12  ? 275 LEU C CD2 1 
ATOM   7338  N  N   . ILE C  1 276 ? 8.000   11.339  4.513   1.00 41.29  ? 276 ILE C N   1 
ATOM   7339  C  CA  . ILE C  1 276 ? 8.519   12.670  4.806   1.00 40.25  ? 276 ILE C CA  1 
ATOM   7340  C  C   . ILE C  1 276 ? 9.380   13.109  3.627   1.00 42.84  ? 276 ILE C C   1 
ATOM   7341  O  O   . ILE C  1 276 ? 10.342  12.423  3.285   1.00 44.25  ? 276 ILE C O   1 
ATOM   7342  C  CB  . ILE C  1 276 ? 9.400   12.671  6.082   1.00 35.92  ? 276 ILE C CB  1 
ATOM   7343  C  CG1 . ILE C  1 276 ? 8.629   12.128  7.294   1.00 34.69  ? 276 ILE C CG1 1 
ATOM   7344  C  CG2 . ILE C  1 276 ? 9.964   14.073  6.370   1.00 36.21  ? 276 ILE C CG2 1 
ATOM   7345  C  CD1 . ILE C  1 276 ? 9.531   11.903  8.537   1.00 30.57  ? 276 ILE C CD1 1 
ATOM   7346  N  N   . PRO C  1 277 ? 9.040   14.255  3.006   1.00 35.12  ? 277 PRO C N   1 
ATOM   7347  C  CA  . PRO C  1 277 ? 9.841   14.788  1.899   1.00 36.86  ? 277 PRO C CA  1 
ATOM   7348  C  C   . PRO C  1 277 ? 11.211  15.196  2.404   1.00 40.36  ? 277 PRO C C   1 
ATOM   7349  O  O   . PRO C  1 277 ? 11.293  16.078  3.262   1.00 40.95  ? 277 PRO C O   1 
ATOM   7350  C  CB  . PRO C  1 277 ? 9.085   16.052  1.472   1.00 33.90  ? 277 PRO C CB  1 
ATOM   7351  C  CG  . PRO C  1 277 ? 7.876   16.142  2.348   1.00 38.86  ? 277 PRO C CG  1 
ATOM   7352  C  CD  . PRO C  1 277 ? 8.025   15.207  3.480   1.00 33.23  ? 277 PRO C CD  1 
ATOM   7353  N  N   . ARG C  1 278 ? 12.265  14.586  1.873   1.00 42.40  ? 278 ARG C N   1 
ATOM   7354  C  CA  . ARG C  1 278 ? 13.621  14.846  2.352   1.00 42.14  ? 278 ARG C CA  1 
ATOM   7355  C  C   . ARG C  1 278 ? 13.970  16.329  2.348   1.00 46.37  ? 278 ARG C C   1 
ATOM   7356  O  O   . ARG C  1 278 ? 14.300  16.917  3.385   1.00 50.38  ? 278 ARG C O   1 
ATOM   7357  C  CB  . ARG C  1 278 ? 14.647  14.100  1.499   1.00 39.84  ? 278 ARG C CB  1 
ATOM   7358  C  CG  . ARG C  1 278 ? 16.082  14.256  2.003   1.00 36.96  ? 278 ARG C CG  1 
ATOM   7359  C  CD  . ARG C  1 278 ? 17.067  13.370  1.219   1.00 42.40  ? 278 ARG C CD  1 
ATOM   7360  N  NE  . ARG C  1 278 ? 17.281  13.843  -0.151  1.00 41.01  ? 278 ARG C NE  1 
ATOM   7361  C  CZ  . ARG C  1 278 ? 18.127  14.814  -0.491  1.00 50.14  ? 278 ARG C CZ  1 
ATOM   7362  N  NH1 . ARG C  1 278 ? 18.846  15.433  0.440   1.00 50.56  ? 278 ARG C NH1 1 
ATOM   7363  N  NH2 . ARG C  1 278 ? 18.248  15.177  -1.765  1.00 53.45  ? 278 ARG C NH2 1 
ATOM   7364  N  N   . VAL C  1 279 ? 13.900  16.918  1.162   1.00 40.96  ? 279 VAL C N   1 
ATOM   7365  C  CA  . VAL C  1 279 ? 14.366  18.273  0.937   1.00 38.26  ? 279 VAL C CA  1 
ATOM   7366  C  C   . VAL C  1 279 ? 13.663  19.302  1.819   1.00 38.93  ? 279 VAL C C   1 
ATOM   7367  O  O   . VAL C  1 279 ? 14.316  20.142  2.447   1.00 40.79  ? 279 VAL C O   1 
ATOM   7368  C  CB  . VAL C  1 279 ? 14.236  18.637  -0.556  1.00 43.25  ? 279 VAL C CB  1 
ATOM   7369  C  CG1 . VAL C  1 279 ? 14.501  20.143  -0.791  1.00 38.15  ? 279 VAL C CG1 1 
ATOM   7370  C  CG2 . VAL C  1 279 ? 15.192  17.760  -1.371  1.00 40.92  ? 279 VAL C CG2 1 
ATOM   7371  N  N   . GLU C  1 280 ? 12.338  19.233  1.873   1.00 34.48  ? 280 GLU C N   1 
ATOM   7372  C  CA  . GLU C  1 280 ? 11.569  20.218  2.619   1.00 39.08  ? 280 GLU C CA  1 
ATOM   7373  C  C   . GLU C  1 280 ? 11.595  19.968  4.121   1.00 38.26  ? 280 GLU C C   1 
ATOM   7374  O  O   . GLU C  1 280 ? 11.185  20.828  4.914   1.00 38.50  ? 280 GLU C O   1 
ATOM   7375  C  CB  . GLU C  1 280 ? 10.138  20.283  2.105   1.00 41.99  ? 280 GLU C CB  1 
ATOM   7376  C  CG  . GLU C  1 280 ? 10.032  20.802  0.682   1.00 47.09  ? 280 GLU C CG  1 
ATOM   7377  C  CD  . GLU C  1 280 ? 10.283  19.730  -0.373  1.00 49.70  ? 280 GLU C CD  1 
ATOM   7378  O  OE1 . GLU C  1 280 ? 10.471  18.545  -0.023  1.00 46.99  ? 280 GLU C OE1 1 
ATOM   7379  O  OE2 . GLU C  1 280 ? 10.291  20.086  -1.565  1.00 52.93  ? 280 GLU C OE2 1 
ATOM   7380  N  N   . TRP C  1 281 ? 12.074  18.789  4.503   1.00 35.73  ? 281 TRP C N   1 
ATOM   7381  C  CA  . TRP C  1 281 ? 12.344  18.495  5.901   1.00 31.62  ? 281 TRP C CA  1 
ATOM   7382  C  C   . TRP C  1 281 ? 13.787  18.901  6.235   1.00 31.84  ? 281 TRP C C   1 
ATOM   7383  O  O   . TRP C  1 281 ? 14.346  18.483  7.248   1.00 32.83  ? 281 TRP C O   1 
ATOM   7384  C  CB  . TRP C  1 281 ? 12.109  17.013  6.195   1.00 31.36  ? 281 TRP C CB  1 
ATOM   7385  C  CG  . TRP C  1 281 ? 11.765  16.744  7.638   1.00 27.61  ? 281 TRP C CG  1 
ATOM   7386  C  CD1 . TRP C  1 281 ? 10.810  17.372  8.378   1.00 31.10  ? 281 TRP C CD1 1 
ATOM   7387  C  CD2 . TRP C  1 281 ? 12.355  15.764  8.496   1.00 28.10  ? 281 TRP C CD2 1 
ATOM   7388  N  NE1 . TRP C  1 281 ? 10.780  16.863  9.651   1.00 30.16  ? 281 TRP C NE1 1 
ATOM   7389  C  CE2 . TRP C  1 281 ? 11.718  15.870  9.749   1.00 33.15  ? 281 TRP C CE2 1 
ATOM   7390  C  CE3 . TRP C  1 281 ? 13.365  14.817  8.332   1.00 27.38  ? 281 TRP C CE3 1 
ATOM   7391  C  CZ2 . TRP C  1 281 ? 12.070  15.068  10.839  1.00 35.33  ? 281 TRP C CZ2 1 
ATOM   7392  C  CZ3 . TRP C  1 281 ? 13.711  14.021  9.410   1.00 31.86  ? 281 TRP C CZ3 1 
ATOM   7393  C  CH2 . TRP C  1 281 ? 13.062  14.148  10.645  1.00 29.91  ? 281 TRP C CH2 1 
ATOM   7394  N  N   . GLY C  1 282 ? 14.380  19.724  5.373   1.00 37.79  ? 282 GLY C N   1 
ATOM   7395  C  CA  . GLY C  1 282 ? 15.732  20.207  5.593   1.00 39.16  ? 282 GLY C CA  1 
ATOM   7396  C  C   . GLY C  1 282 ? 16.714  19.056  5.729   1.00 38.46  ? 282 GLY C C   1 
ATOM   7397  O  O   . GLY C  1 282 ? 17.675  19.127  6.505   1.00 38.06  ? 282 GLY C O   1 
ATOM   7398  N  N   . CYS C  1 283 ? 16.476  17.989  4.972   1.00 38.69  ? 283 CYS C N   1 
ATOM   7399  C  CA  . CYS C  1 283 ? 17.344  16.814  5.035   1.00 42.78  ? 283 CYS C CA  1 
ATOM   7400  C  C   . CYS C  1 283 ? 17.441  16.292  6.466   1.00 34.92  ? 283 CYS C C   1 
ATOM   7401  O  O   . CYS C  1 283 ? 18.398  15.624  6.814   1.00 34.00  ? 283 CYS C O   1 
ATOM   7402  C  CB  . CYS C  1 283 ? 18.751  17.131  4.498   1.00 47.85  ? 283 CYS C CB  1 
ATOM   7403  S  SG  . CYS C  1 283 ? 18.820  17.649  2.746   1.00 56.06  ? 283 CYS C SG  1 
ATOM   7404  N  N   . GLY C  1 284 ? 16.446  16.613  7.288   1.00 34.69  ? 284 GLY C N   1 
ATOM   7405  C  CA  . GLY C  1 284 ? 16.381  16.137  8.660   1.00 31.32  ? 284 GLY C CA  1 
ATOM   7406  C  C   . GLY C  1 284 ? 16.794  17.191  9.677   1.00 35.80  ? 284 GLY C C   1 
ATOM   7407  O  O   . GLY C  1 284 ? 16.895  16.892  10.864  1.00 32.65  ? 284 GLY C O   1 
ATOM   7408  N  N   . MET C  1 285 ? 17.001  18.425  9.215   1.00 25.69  ? 285 MET C N   1 
ATOM   7409  C  CA  . MET C  1 285 ? 17.591  19.473  10.043  1.00 29.76  ? 285 MET C CA  1 
ATOM   7410  C  C   . MET C  1 285 ? 16.761  20.756  10.132  1.00 31.21  ? 285 MET C C   1 
ATOM   7411  O  O   . MET C  1 285 ? 17.224  21.748  10.677  1.00 28.12  ? 285 MET C O   1 
ATOM   7412  C  CB  . MET C  1 285 ? 19.005  19.796  9.546   1.00 23.69  ? 285 MET C CB  1 
ATOM   7413  C  CG  . MET C  1 285 ? 20.014  18.639  9.783   1.00 29.94  ? 285 MET C CG  1 
ATOM   7414  S  SD  . MET C  1 285 ? 21.625  18.951  9.011   1.00 39.75  ? 285 MET C SD  1 
ATOM   7415  C  CE  . MET C  1 285 ? 21.101  19.396  7.354   1.00 42.70  ? 285 MET C CE  1 
ATOM   7416  N  N   . ALA C  1 286 ? 15.531  20.717  9.622   1.00 27.24  ? 286 ALA C N   1 
ATOM   7417  C  CA  . ALA C  1 286 ? 14.670  21.894  9.569   1.00 31.61  ? 286 ALA C CA  1 
ATOM   7418  C  C   . ALA C  1 286 ? 13.919  22.191  10.865  1.00 31.55  ? 286 ALA C C   1 
ATOM   7419  O  O   . ALA C  1 286 ? 13.121  23.130  10.931  1.00 30.82  ? 286 ALA C O   1 
ATOM   7420  C  CB  . ALA C  1 286 ? 13.675  21.747  8.415   1.00 40.56  ? 286 ALA C CB  1 
ATOM   7421  N  N   . HIS C  1 287 ? 14.152  21.391  11.894  1.00 25.52  ? 287 HIS C N   1 
ATOM   7422  C  CA  . HIS C  1 287 ? 13.379  21.528  13.125  1.00 26.18  ? 287 HIS C CA  1 
ATOM   7423  C  C   . HIS C  1 287 ? 11.860  21.491  12.886  1.00 26.89  ? 287 HIS C C   1 
ATOM   7424  O  O   . HIS C  1 287 ? 11.086  22.195  13.543  1.00 29.70  ? 287 HIS C O   1 
ATOM   7425  C  CB  . HIS C  1 287 ? 13.762  22.813  13.869  1.00 26.37  ? 287 HIS C CB  1 
ATOM   7426  C  CG  . HIS C  1 287 ? 15.124  22.773  14.489  1.00 31.02  ? 287 HIS C CG  1 
ATOM   7427  N  ND1 . HIS C  1 287 ? 16.237  23.304  13.870  1.00 30.43  ? 287 HIS C ND1 1 
ATOM   7428  C  CD2 . HIS C  1 287 ? 15.551  22.281  15.681  1.00 24.45  ? 287 HIS C CD2 1 
ATOM   7429  C  CE1 . HIS C  1 287 ? 17.291  23.141  14.654  1.00 29.08  ? 287 HIS C CE1 1 
ATOM   7430  N  NE2 . HIS C  1 287 ? 16.902  22.527  15.758  1.00 26.11  ? 287 HIS C NE2 1 
ATOM   7431  N  N   . LYS C  1 288 ? 11.424  20.674  11.946  1.00 25.35  ? 288 LYS C N   1 
ATOM   7432  C  CA  . LYS C  1 288 ? 9.991   20.464  11.790  1.00 28.45  ? 288 LYS C CA  1 
ATOM   7433  C  C   . LYS C  1 288 ? 9.567   19.223  12.569  1.00 29.78  ? 288 LYS C C   1 
ATOM   7434  O  O   . LYS C  1 288 ? 9.711   18.089  12.102  1.00 27.79  ? 288 LYS C O   1 
ATOM   7435  C  CB  . LYS C  1 288 ? 9.593   20.396  10.306  1.00 23.48  ? 288 LYS C CB  1 
ATOM   7436  C  CG  . LYS C  1 288 ? 9.870   21.722  9.585   1.00 26.50  ? 288 LYS C CG  1 
ATOM   7437  C  CD  . LYS C  1 288 ? 9.693   21.606  8.081   1.00 28.83  ? 288 LYS C CD  1 
ATOM   7438  C  CE  . LYS C  1 288 ? 9.927   22.966  7.432   1.00 27.24  ? 288 LYS C CE  1 
ATOM   7439  N  NZ  . LYS C  1 288 ? 9.582   22.992  6.010   1.00 26.27  ? 288 LYS C NZ  1 
ATOM   7440  N  N   . THR C  1 289 ? 9.042   19.457  13.764  1.00 24.88  ? 289 THR C N   1 
ATOM   7441  C  CA  . THR C  1 289 ? 8.693   18.376  14.663  1.00 29.28  ? 289 THR C CA  1 
ATOM   7442  C  C   . THR C  1 289 ? 7.398   17.701  14.222  1.00 29.98  ? 289 THR C C   1 
ATOM   7443  O  O   . THR C  1 289 ? 6.448   18.357  13.840  1.00 29.02  ? 289 THR C O   1 
ATOM   7444  C  CB  . THR C  1 289 ? 8.569   18.881  16.104  1.00 26.60  ? 289 THR C CB  1 
ATOM   7445  O  OG1 . THR C  1 289 ? 9.860   19.304  16.557  1.00 35.61  ? 289 THR C OG1 1 
ATOM   7446  C  CG2 . THR C  1 289 ? 8.089   17.778  17.017  1.00 25.74  ? 289 THR C CG2 1 
ATOM   7447  N  N   . ILE C  1 290 ? 7.382   16.379  14.274  1.00 29.62  ? 290 ILE C N   1 
ATOM   7448  C  CA  . ILE C  1 290 ? 6.201   15.623  13.917  1.00 31.31  ? 290 ILE C CA  1 
ATOM   7449  C  C   . ILE C  1 290 ? 5.700   14.853  15.132  1.00 29.28  ? 290 ILE C C   1 
ATOM   7450  O  O   . ILE C  1 290 ? 6.425   14.040  15.702  1.00 28.89  ? 290 ILE C O   1 
ATOM   7451  C  CB  . ILE C  1 290 ? 6.503   14.660  12.768  1.00 31.51  ? 290 ILE C CB  1 
ATOM   7452  C  CG1 . ILE C  1 290 ? 6.931   15.450  11.528  1.00 32.30  ? 290 ILE C CG1 1 
ATOM   7453  C  CG2 . ILE C  1 290 ? 5.296   13.781  12.468  1.00 30.93  ? 290 ILE C CG2 1 
ATOM   7454  C  CD1 . ILE C  1 290 ? 7.654   14.587  10.500  1.00 33.11  ? 290 ILE C CD1 1 
ATOM   7455  N  N   . LYS C  1 291 ? 4.471   15.147  15.540  1.00 27.66  ? 291 LYS C N   1 
ATOM   7456  C  CA  . LYS C  1 291 ? 3.813   14.431  16.622  1.00 29.79  ? 291 LYS C CA  1 
ATOM   7457  C  C   . LYS C  1 291 ? 2.561   13.722  16.096  1.00 34.43  ? 291 LYS C C   1 
ATOM   7458  O  O   . LYS C  1 291 ? 2.001   14.092  15.066  1.00 34.46  ? 291 LYS C O   1 
ATOM   7459  C  CB  . LYS C  1 291 ? 3.418   15.390  17.749  1.00 33.15  ? 291 LYS C CB  1 
ATOM   7460  C  CG  . LYS C  1 291 ? 4.532   16.315  18.252  1.00 33.79  ? 291 LYS C CG  1 
ATOM   7461  C  CD  . LYS C  1 291 ? 4.146   16.875  19.615  1.00 34.95  ? 291 LYS C CD  1 
ATOM   7462  C  CE  . LYS C  1 291 ? 5.040   18.029  20.062  1.00 34.87  ? 291 LYS C CE  1 
ATOM   7463  N  NZ  . LYS C  1 291 ? 4.448   18.708  21.260  1.00 31.66  ? 291 LYS C NZ  1 
ATOM   7464  N  N   . GLY C  1 292 ? 2.115   12.707  16.814  1.00 35.41  ? 292 GLY C N   1 
ATOM   7465  C  CA  . GLY C  1 292 ? 0.870   12.033  16.476  1.00 39.90  ? 292 GLY C CA  1 
ATOM   7466  C  C   . GLY C  1 292 ? 0.439   11.242  17.685  1.00 37.79  ? 292 GLY C C   1 
ATOM   7467  O  O   . GLY C  1 292 ? 1.204   10.400  18.156  1.00 33.10  ? 292 GLY C O   1 
ATOM   7468  N  N   . GLY C  1 293 ? -0.744  11.529  18.219  1.00 26.65  ? 293 GLY C N   1 
ATOM   7469  C  CA  . GLY C  1 293 ? -1.152  10.916  19.472  1.00 30.60  ? 293 GLY C CA  1 
ATOM   7470  C  C   . GLY C  1 293 ? -2.624  10.519  19.621  1.00 33.99  ? 293 GLY C C   1 
ATOM   7471  O  O   . GLY C  1 293 ? -3.535  11.231  19.189  1.00 27.72  ? 293 GLY C O   1 
ATOM   7472  N  N   . LEU C  1 294 ? -2.848  9.374   20.255  1.00 29.86  ? 294 LEU C N   1 
ATOM   7473  C  CA  . LEU C  1 294 ? -4.185  8.914   20.584  1.00 25.90  ? 294 LEU C CA  1 
ATOM   7474  C  C   . LEU C  1 294 ? -4.779  9.881   21.597  1.00 29.58  ? 294 LEU C C   1 
ATOM   7475  O  O   . LEU C  1 294 ? -4.091  10.362  22.478  1.00 29.37  ? 294 LEU C O   1 
ATOM   7476  C  CB  . LEU C  1 294 ? -4.119  7.499   21.168  1.00 20.18  ? 294 LEU C CB  1 
ATOM   7477  C  CG  . LEU C  1 294 ? -5.382  6.773   21.609  1.00 30.64  ? 294 LEU C CG  1 
ATOM   7478  C  CD1 . LEU C  1 294 ? -6.374  6.683   20.455  1.00 19.50  ? 294 LEU C CD1 1 
ATOM   7479  C  CD2 . LEU C  1 294 ? -5.041  5.374   22.126  1.00 32.05  ? 294 LEU C CD2 1 
ATOM   7480  N  N   . CYS C  1 295 ? -6.060  10.187  21.464  1.00 28.99  ? 295 CYS C N   1 
ATOM   7481  C  CA  . CYS C  1 295 ? -6.670  11.127  22.383  1.00 29.12  ? 295 CYS C CA  1 
ATOM   7482  C  C   . CYS C  1 295 ? -6.564  10.650  23.821  1.00 28.57  ? 295 CYS C C   1 
ATOM   7483  O  O   . CYS C  1 295 ? -6.630  9.457   24.092  1.00 31.26  ? 295 CYS C O   1 
ATOM   7484  C  CB  . CYS C  1 295 ? -8.147  11.345  22.031  1.00 33.75  ? 295 CYS C CB  1 
ATOM   7485  S  SG  . CYS C  1 295 ? -9.137  9.843   22.179  1.00 31.72  ? 295 CYS C SG  1 
ATOM   7486  N  N   . PRO C  1 296 ? -6.406  11.599  24.754  1.00 31.91  ? 296 PRO C N   1 
ATOM   7487  C  CA  . PRO C  1 296 ? -6.499  11.322  26.187  1.00 35.94  ? 296 PRO C CA  1 
ATOM   7488  C  C   . PRO C  1 296 ? -7.887  10.826  26.541  1.00 34.01  ? 296 PRO C C   1 
ATOM   7489  O  O   . PRO C  1 296 ? -8.851  11.139  25.822  1.00 30.49  ? 296 PRO C O   1 
ATOM   7490  C  CB  . PRO C  1 296 ? -6.298  12.704  26.826  1.00 29.17  ? 296 PRO C CB  1 
ATOM   7491  C  CG  . PRO C  1 296 ? -5.553  13.484  25.822  1.00 34.89  ? 296 PRO C CG  1 
ATOM   7492  C  CD  . PRO C  1 296 ? -6.034  12.999  24.487  1.00 29.41  ? 296 PRO C CD  1 
ATOM   7493  N  N   . GLY C  1 297 ? -7.978  10.105  27.658  1.00 26.21  ? 297 GLY C N   1 
ATOM   7494  C  CA  . GLY C  1 297 ? -9.233  9.602   28.179  1.00 36.07  ? 297 GLY C CA  1 
ATOM   7495  C  C   . GLY C  1 297 ? -9.255  9.710   29.684  1.00 35.23  ? 297 GLY C C   1 
ATOM   7496  O  O   . GLY C  1 297 ? -8.539  10.534  30.254  1.00 38.01  ? 297 GLY C O   1 
ATOM   7497  N  N   . GLY C  1 298 ? -10.069 8.884   30.335  1.00 29.42  ? 298 GLY C N   1 
ATOM   7498  C  CA  . GLY C  1 298 ? -10.162 8.922   31.782  1.00 25.29  ? 298 GLY C CA  1 
ATOM   7499  C  C   . GLY C  1 298 ? -11.037 10.057  32.303  1.00 32.78  ? 298 GLY C C   1 
ATOM   7500  O  O   . GLY C  1 298 ? -11.407 10.966  31.552  1.00 34.79  ? 298 GLY C O   1 
ATOM   7501  N  N   . ARG C  1 299 ? -11.350 10.005  33.599  1.00 31.10  ? 299 ARG C N   1 
ATOM   7502  C  CA  . ARG C  1 299 ? -12.272 10.941  34.238  1.00 36.04  ? 299 ARG C CA  1 
ATOM   7503  C  C   . ARG C  1 299 ? -11.833 12.414  34.175  1.00 37.27  ? 299 ARG C C   1 
ATOM   7504  O  O   . ARG C  1 299 ? -12.634 13.295  33.852  1.00 33.72  ? 299 ARG C O   1 
ATOM   7505  C  CB  . ARG C  1 299 ? -12.518 10.513  35.690  1.00 29.36  ? 299 ARG C CB  1 
ATOM   7506  C  CG  . ARG C  1 299 ? -13.212 11.564  36.574  1.00 32.48  ? 299 ARG C CG  1 
ATOM   7507  C  CD  . ARG C  1 299 ? -13.482 10.951  37.928  1.00 31.44  ? 299 ARG C CD  1 
ATOM   7508  N  NE  . ARG C  1 299 ? -14.317 11.752  38.816  1.00 30.44  ? 299 ARG C NE  1 
ATOM   7509  C  CZ  . ARG C  1 299 ? -14.685 11.329  40.028  1.00 35.52  ? 299 ARG C CZ  1 
ATOM   7510  N  NH1 . ARG C  1 299 ? -14.280 10.140  40.470  1.00 31.72  ? 299 ARG C NH1 1 
ATOM   7511  N  NH2 . ARG C  1 299 ? -15.452 12.078  40.801  1.00 37.30  ? 299 ARG C NH2 1 
ATOM   7512  N  N   . LEU C  1 300 ? -10.568 12.687  34.474  1.00 33.38  ? 300 LEU C N   1 
ATOM   7513  C  CA  . LEU C  1 300 ? -10.104 14.075  34.460  1.00 33.10  ? 300 LEU C CA  1 
ATOM   7514  C  C   . LEU C  1 300 ? -10.275 14.701  33.074  1.00 29.46  ? 300 LEU C C   1 
ATOM   7515  O  O   . LEU C  1 300 ? -10.661 15.851  32.949  1.00 33.85  ? 300 LEU C O   1 
ATOM   7516  C  CB  . LEU C  1 300 ? -8.643  14.194  34.904  1.00 34.03  ? 300 LEU C CB  1 
ATOM   7517  C  CG  . LEU C  1 300 ? -8.105  15.631  34.876  1.00 37.80  ? 300 LEU C CG  1 
ATOM   7518  C  CD1 . LEU C  1 300 ? -8.855  16.506  35.858  1.00 36.82  ? 300 LEU C CD1 1 
ATOM   7519  C  CD2 . LEU C  1 300 ? -6.625  15.682  35.170  1.00 31.23  ? 300 LEU C CD2 1 
ATOM   7520  N  N   . ARG C  1 301 ? -9.953  13.946  32.038  1.00 29.42  ? 301 ARG C N   1 
ATOM   7521  C  CA  . ARG C  1 301 ? -10.042 14.466  30.692  1.00 29.36  ? 301 ARG C CA  1 
ATOM   7522  C  C   . ARG C  1 301 ? -11.482 14.874  30.401  1.00 36.49  ? 301 ARG C C   1 
ATOM   7523  O  O   . ARG C  1 301 ? -11.734 15.929  29.812  1.00 39.96  ? 301 ARG C O   1 
ATOM   7524  C  CB  . ARG C  1 301 ? -9.593  13.418  29.676  1.00 29.71  ? 301 ARG C CB  1 
ATOM   7525  C  CG  . ARG C  1 301 ? -9.690  13.907  28.224  1.00 29.64  ? 301 ARG C CG  1 
ATOM   7526  C  CD  . ARG C  1 301 ? -8.903  15.226  28.030  1.00 32.34  ? 301 ARG C CD  1 
ATOM   7527  N  NE  . ARG C  1 301 ? -8.600  15.462  26.617  1.00 34.01  ? 301 ARG C NE  1 
ATOM   7528  C  CZ  . ARG C  1 301 ? -7.793  16.419  26.162  1.00 34.33  ? 301 ARG C CZ  1 
ATOM   7529  N  NH1 . ARG C  1 301 ? -7.207  17.266  27.010  1.00 29.71  ? 301 ARG C NH1 1 
ATOM   7530  N  NH2 . ARG C  1 301 ? -7.576  16.530  24.853  1.00 24.94  ? 301 ARG C NH2 1 
ATOM   7531  N  N   . MET C  1 302 ? -12.429 14.037  30.823  1.00 34.10  ? 302 MET C N   1 
ATOM   7532  C  CA  . MET C  1 302 ? -13.837 14.310  30.557  1.00 35.55  ? 302 MET C CA  1 
ATOM   7533  C  C   . MET C  1 302 ? -14.314 15.534  31.347  1.00 33.67  ? 302 MET C C   1 
ATOM   7534  O  O   . MET C  1 302 ? -15.044 16.382  30.829  1.00 34.46  ? 302 MET C O   1 
ATOM   7535  C  CB  . MET C  1 302 ? -14.716 13.083  30.881  1.00 34.78  ? 302 MET C CB  1 
ATOM   7536  C  CG  . MET C  1 302 ? -14.488 11.815  30.016  1.00 27.40  ? 302 MET C CG  1 
ATOM   7537  S  SD  . MET C  1 302 ? -14.878 11.991  28.238  1.00 33.50  ? 302 MET C SD  1 
ATOM   7538  C  CE  . MET C  1 302 ? -13.269 12.501  27.589  1.00 25.19  ? 302 MET C CE  1 
ATOM   7539  N  N   . GLU C  1 303 ? -13.911 15.625  32.608  1.00 32.07  ? 303 GLU C N   1 
ATOM   7540  C  CA  . GLU C  1 303 ? -14.381 16.714  33.440  1.00 34.30  ? 303 GLU C CA  1 
ATOM   7541  C  C   . GLU C  1 303 ? -13.852 18.044  32.913  1.00 36.86  ? 303 GLU C C   1 
ATOM   7542  O  O   . GLU C  1 303 ? -14.541 19.060  32.987  1.00 39.13  ? 303 GLU C O   1 
ATOM   7543  C  CB  . GLU C  1 303 ? -13.994 16.508  34.904  1.00 36.20  ? 303 GLU C CB  1 
ATOM   7544  C  CG  . GLU C  1 303 ? -14.592 15.268  35.542  1.00 42.65  ? 303 GLU C CG  1 
ATOM   7545  C  CD  . GLU C  1 303 ? -14.086 15.039  36.959  1.00 45.16  ? 303 GLU C CD  1 
ATOM   7546  O  OE1 . GLU C  1 303 ? -12.948 15.459  37.263  1.00 38.68  ? 303 GLU C OE1 1 
ATOM   7547  O  OE2 . GLU C  1 303 ? -14.828 14.444  37.772  1.00 50.10  ? 303 GLU C OE2 1 
ATOM   7548  N  N   . ARG C  1 304 ? -12.644 18.029  32.354  1.00 33.95  ? 304 ARG C N   1 
ATOM   7549  C  CA  . ARG C  1 304 ? -12.071 19.250  31.789  1.00 29.59  ? 304 ARG C CA  1 
ATOM   7550  C  C   . ARG C  1 304 ? -12.896 19.720  30.590  1.00 36.31  ? 304 ARG C C   1 
ATOM   7551  O  O   . ARG C  1 304 ? -13.249 20.902  30.500  1.00 35.38  ? 304 ARG C O   1 
ATOM   7552  C  CB  . ARG C  1 304 ? -10.605 19.038  31.392  1.00 31.02  ? 304 ARG C CB  1 
ATOM   7553  C  CG  . ARG C  1 304 ? -9.664  18.772  32.572  1.00 33.49  ? 304 ARG C CG  1 
ATOM   7554  C  CD  . ARG C  1 304 ? -9.065  20.067  33.056  1.00 41.39  ? 304 ARG C CD  1 
ATOM   7555  N  NE  . ARG C  1 304 ? -8.428  19.983  34.369  1.00 40.45  ? 304 ARG C NE  1 
ATOM   7556  C  CZ  . ARG C  1 304 ? -7.129  19.783  34.573  1.00 40.31  ? 304 ARG C CZ  1 
ATOM   7557  N  NH1 . ARG C  1 304 ? -6.304  19.598  33.547  1.00 33.75  ? 304 ARG C NH1 1 
ATOM   7558  N  NH2 . ARG C  1 304 ? -6.656  19.761  35.815  1.00 36.51  ? 304 ARG C NH2 1 
ATOM   7559  N  N   . LEU C  1 305 ? -13.215 18.785  29.690  1.00 31.02  ? 305 LEU C N   1 
ATOM   7560  C  CA  . LEU C  1 305 ? -13.999 19.094  28.502  1.00 35.14  ? 305 LEU C CA  1 
ATOM   7561  C  C   . LEU C  1 305 ? -15.440 19.411  28.863  1.00 39.60  ? 305 LEU C C   1 
ATOM   7562  O  O   . LEU C  1 305 ? -16.063 20.295  28.266  1.00 36.24  ? 305 LEU C O   1 
ATOM   7563  C  CB  . LEU C  1 305 ? -13.936 17.958  27.479  1.00 32.72  ? 305 LEU C CB  1 
ATOM   7564  C  CG  . LEU C  1 305 ? -12.516 17.596  27.027  1.00 36.26  ? 305 LEU C CG  1 
ATOM   7565  C  CD1 . LEU C  1 305 ? -12.499 16.607  25.871  1.00 36.97  ? 305 LEU C CD1 1 
ATOM   7566  C  CD2 . LEU C  1 305 ? -11.716 18.831  26.675  1.00 36.63  ? 305 LEU C CD2 1 
ATOM   7567  N  N   . ILE C  1 306 ? -15.968 18.704  29.849  1.00 37.54  ? 306 ILE C N   1 
ATOM   7568  C  CA  . ILE C  1 306 ? -17.289 19.044  30.343  1.00 35.67  ? 306 ILE C CA  1 
ATOM   7569  C  C   . ILE C  1 306 ? -17.309 20.509  30.778  1.00 38.37  ? 306 ILE C C   1 
ATOM   7570  O  O   . ILE C  1 306 ? -18.216 21.251  30.418  1.00 37.85  ? 306 ILE C O   1 
ATOM   7571  C  CB  . ILE C  1 306 ? -17.723 18.139  31.508  1.00 35.78  ? 306 ILE C CB  1 
ATOM   7572  C  CG1 . ILE C  1 306 ? -18.158 16.771  30.972  1.00 39.97  ? 306 ILE C CG1 1 
ATOM   7573  C  CG2 . ILE C  1 306 ? -18.866 18.785  32.270  1.00 38.12  ? 306 ILE C CG2 1 
ATOM   7574  C  CD1 . ILE C  1 306 ? -18.194 15.666  32.021  1.00 40.73  ? 306 ILE C CD1 1 
ATOM   7575  N  N   . ASP C  1 307 ? -16.301 20.931  31.537  1.00 32.93  ? 307 ASP C N   1 
ATOM   7576  C  CA  . ASP C  1 307 ? -16.230 22.331  31.951  1.00 35.34  ? 307 ASP C CA  1 
ATOM   7577  C  C   . ASP C  1 307 ? -16.181 23.274  30.743  1.00 35.20  ? 307 ASP C C   1 
ATOM   7578  O  O   . ASP C  1 307 ? -16.804 24.335  30.755  1.00 34.38  ? 307 ASP C O   1 
ATOM   7579  C  CB  . ASP C  1 307 ? -15.042 22.584  32.898  1.00 42.19  ? 307 ASP C CB  1 
ATOM   7580  C  CG  . ASP C  1 307 ? -15.447 22.581  34.380  1.00 42.14  ? 307 ASP C CG  1 
ATOM   7581  O  OD1 . ASP C  1 307 ? -16.521 22.052  34.738  1.00 40.17  ? 307 ASP C OD1 1 
ATOM   7582  O  OD2 . ASP C  1 307 ? -14.683 23.115  35.204  1.00 49.08  ? 307 ASP C OD2 1 
ATOM   7583  N  N   . LEU C  1 308 ? -15.444 22.887  29.704  1.00 33.74  ? 308 LEU C N   1 
ATOM   7584  C  CA  . LEU C  1 308 ? -15.358 23.702  28.496  1.00 33.65  ? 308 LEU C CA  1 
ATOM   7585  C  C   . LEU C  1 308 ? -16.728 23.859  27.837  1.00 34.77  ? 308 LEU C C   1 
ATOM   7586  O  O   . LEU C  1 308 ? -17.038 24.917  27.293  1.00 33.96  ? 308 LEU C O   1 
ATOM   7587  C  CB  . LEU C  1 308 ? -14.357 23.118  27.497  1.00 31.82  ? 308 LEU C CB  1 
ATOM   7588  C  CG  . LEU C  1 308 ? -12.898 23.253  27.939  1.00 34.47  ? 308 LEU C CG  1 
ATOM   7589  C  CD1 . LEU C  1 308 ? -11.973 22.623  26.915  1.00 38.66  ? 308 LEU C CD1 1 
ATOM   7590  C  CD2 . LEU C  1 308 ? -12.582 24.708  28.096  1.00 33.12  ? 308 LEU C CD2 1 
ATOM   7591  N  N   . VAL C  1 309 ? -17.540 22.805  27.881  1.00 33.04  ? 309 VAL C N   1 
ATOM   7592  C  CA  . VAL C  1 309 ? -18.882 22.863  27.310  1.00 31.47  ? 309 VAL C CA  1 
ATOM   7593  C  C   . VAL C  1 309 ? -19.798 23.624  28.258  1.00 35.83  ? 309 VAL C C   1 
ATOM   7594  O  O   . VAL C  1 309 ? -20.503 24.545  27.856  1.00 34.89  ? 309 VAL C O   1 
ATOM   7595  C  CB  . VAL C  1 309 ? -19.441 21.448  27.050  1.00 34.57  ? 309 VAL C CB  1 
ATOM   7596  C  CG1 . VAL C  1 309 ? -20.923 21.504  26.636  1.00 34.53  ? 309 VAL C CG1 1 
ATOM   7597  C  CG2 . VAL C  1 309 ? -18.603 20.735  25.978  1.00 24.77  ? 309 VAL C CG2 1 
ATOM   7598  N  N   . PHE C  1 310 ? -19.754 23.254  29.533  1.00 33.21  ? 310 PHE C N   1 
ATOM   7599  C  CA  . PHE C  1 310 ? -20.622 23.872  30.517  1.00 37.35  ? 310 PHE C CA  1 
ATOM   7600  C  C   . PHE C  1 310 ? -20.488 25.391  30.538  1.00 41.56  ? 310 PHE C C   1 
ATOM   7601  O  O   . PHE C  1 310 ? -21.485 26.101  30.615  1.00 42.77  ? 310 PHE C O   1 
ATOM   7602  C  CB  . PHE C  1 310 ? -20.332 23.310  31.905  1.00 42.60  ? 310 PHE C CB  1 
ATOM   7603  C  CG  . PHE C  1 310 ? -21.244 23.842  32.965  1.00 43.85  ? 310 PHE C CG  1 
ATOM   7604  C  CD1 . PHE C  1 310 ? -22.545 23.378  33.072  1.00 46.09  ? 310 PHE C CD1 1 
ATOM   7605  C  CD2 . PHE C  1 310 ? -20.806 24.810  33.851  1.00 39.49  ? 310 PHE C CD2 1 
ATOM   7606  C  CE1 . PHE C  1 310 ? -23.400 23.872  34.049  1.00 48.14  ? 310 PHE C CE1 1 
ATOM   7607  C  CE2 . PHE C  1 310 ? -21.650 25.305  34.830  1.00 41.46  ? 310 PHE C CE2 1 
ATOM   7608  C  CZ  . PHE C  1 310 ? -22.950 24.835  34.930  1.00 40.80  ? 310 PHE C CZ  1 
ATOM   7609  N  N   . TYR C  1 311 ? -19.249 25.878  30.495  1.00 40.74  ? 311 TYR C N   1 
ATOM   7610  C  CA  . TYR C  1 311 ? -18.977 27.309  30.505  1.00 41.34  ? 311 TYR C CA  1 
ATOM   7611  C  C   . TYR C  1 311 ? -18.955 27.891  29.092  1.00 40.33  ? 311 TYR C C   1 
ATOM   7612  O  O   . TYR C  1 311 ? -18.484 29.003  28.879  1.00 40.68  ? 311 TYR C O   1 
ATOM   7613  C  CB  . TYR C  1 311 ? -17.667 27.605  31.237  1.00 40.50  ? 311 TYR C CB  1 
ATOM   7614  C  CG  . TYR C  1 311 ? -17.763 27.351  32.720  1.00 45.41  ? 311 TYR C CG  1 
ATOM   7615  C  CD1 . TYR C  1 311 ? -18.683 28.046  33.502  1.00 44.61  ? 311 TYR C CD1 1 
ATOM   7616  C  CD2 . TYR C  1 311 ? -16.951 26.414  33.340  1.00 39.74  ? 311 TYR C CD2 1 
ATOM   7617  C  CE1 . TYR C  1 311 ? -18.790 27.812  34.859  1.00 48.29  ? 311 TYR C CE1 1 
ATOM   7618  C  CE2 . TYR C  1 311 ? -17.041 26.175  34.706  1.00 43.46  ? 311 TYR C CE2 1 
ATOM   7619  C  CZ  . TYR C  1 311 ? -17.960 26.880  35.459  1.00 53.21  ? 311 TYR C CZ  1 
ATOM   7620  O  OH  . TYR C  1 311 ? -18.063 26.654  36.813  1.00 58.70  ? 311 TYR C OH  1 
ATOM   7621  N  N   . LYS C  1 312 ? -19.453 27.121  28.131  1.00 37.32  ? 312 LYS C N   1 
ATOM   7622  C  CA  . LYS C  1 312 ? -19.681 27.618  26.771  1.00 42.41  ? 312 LYS C CA  1 
ATOM   7623  C  C   . LYS C  1 312 ? -18.429 28.185  26.099  1.00 44.74  ? 312 LYS C C   1 
ATOM   7624  O  O   . LYS C  1 312 ? -18.488 29.215  25.409  1.00 38.95  ? 312 LYS C O   1 
ATOM   7625  C  CB  . LYS C  1 312 ? -20.829 28.643  26.759  1.00 43.86  ? 312 LYS C CB  1 
ATOM   7626  C  CG  . LYS C  1 312 ? -22.015 28.186  27.615  1.00 50.30  ? 312 LYS C CG  1 
ATOM   7627  C  CD  . LYS C  1 312 ? -23.256 29.048  27.478  1.00 53.76  ? 312 LYS C CD  1 
ATOM   7628  C  CE  . LYS C  1 312 ? -24.279 28.645  28.537  1.00 58.79  ? 312 LYS C CE  1 
ATOM   7629  N  NZ  . LYS C  1 312 ? -25.680 28.983  28.165  1.00 64.61  ? 312 LYS C NZ  1 
ATOM   7630  N  N   . ARG C  1 313 ? -17.301 27.511  26.305  1.00 39.53  ? 313 ARG C N   1 
ATOM   7631  C  CA  . ARG C  1 313 ? -16.092 27.813  25.544  1.00 40.59  ? 313 ARG C CA  1 
ATOM   7632  C  C   . ARG C  1 313 ? -16.180 27.190  24.148  1.00 34.51  ? 313 ARG C C   1 
ATOM   7633  O  O   . ARG C  1 313 ? -15.560 27.672  23.202  1.00 37.92  ? 313 ARG C O   1 
ATOM   7634  C  CB  . ARG C  1 313 ? -14.843 27.290  26.266  1.00 35.08  ? 313 ARG C CB  1 
ATOM   7635  C  CG  . ARG C  1 313 ? -14.723 27.734  27.720  1.00 34.94  ? 313 ARG C CG  1 
ATOM   7636  C  CD  . ARG C  1 313 ? -14.811 29.238  27.857  1.00 39.84  ? 313 ARG C CD  1 
ATOM   7637  N  NE  . ARG C  1 313 ? -14.470 29.692  29.208  1.00 38.85  ? 313 ARG C NE  1 
ATOM   7638  C  CZ  . ARG C  1 313 ? -14.763 30.904  29.683  1.00 42.32  ? 313 ARG C CZ  1 
ATOM   7639  N  NH1 . ARG C  1 313 ? -15.399 31.798  28.914  1.00 36.93  ? 313 ARG C NH1 1 
ATOM   7640  N  NH2 . ARG C  1 313 ? -14.422 31.229  30.925  1.00 36.43  ? 313 ARG C NH2 1 
ATOM   7641  N  N   . VAL C  1 314 ? -16.929 26.093  24.042  1.00 40.14  ? 314 VAL C N   1 
ATOM   7642  C  CA  . VAL C  1 314 ? -17.150 25.389  22.773  1.00 42.11  ? 314 VAL C CA  1 
ATOM   7643  C  C   . VAL C  1 314 ? -18.557 24.796  22.760  1.00 43.38  ? 314 VAL C C   1 
ATOM   7644  O  O   . VAL C  1 314 ? -19.078 24.427  23.805  1.00 40.35  ? 314 VAL C O   1 
ATOM   7645  C  CB  . VAL C  1 314 ? -16.139 24.237  22.561  1.00 45.21  ? 314 VAL C CB  1 
ATOM   7646  C  CG1 . VAL C  1 314 ? -16.177 23.268  23.731  1.00 41.29  ? 314 VAL C CG1 1 
ATOM   7647  C  CG2 . VAL C  1 314 ? -16.424 23.484  21.235  1.00 34.43  ? 314 VAL C CG2 1 
ATOM   7648  N  N   . ASP C  1 315 ? -19.165 24.713  21.576  1.00 49.32  ? 315 ASP C N   1 
ATOM   7649  C  CA  . ASP C  1 315 ? -20.481 24.087  21.388  1.00 37.82  ? 315 ASP C CA  1 
ATOM   7650  C  C   . ASP C  1 315 ? -20.377 22.972  20.349  1.00 34.86  ? 315 ASP C C   1 
ATOM   7651  O  O   . ASP C  1 315 ? -20.423 23.228  19.144  1.00 34.93  ? 315 ASP C O   1 
ATOM   7652  C  CB  . ASP C  1 315 ? -21.506 25.139  20.928  1.00 37.70  ? 315 ASP C CB  1 
ATOM   7653  C  CG  . ASP C  1 315 ? -22.872 24.534  20.592  1.00 44.37  ? 315 ASP C CG  1 
ATOM   7654  O  OD1 . ASP C  1 315 ? -23.127 23.360  20.942  1.00 47.12  ? 315 ASP C OD1 1 
ATOM   7655  O  OD2 . ASP C  1 315 ? -23.696 25.248  19.983  1.00 45.22  ? 315 ASP C OD2 1 
ATOM   7656  N  N   . PRO C  1 316 ? -20.246 21.721  20.807  1.00 37.28  ? 316 PRO C N   1 
ATOM   7657  C  CA  . PRO C  1 316 ? -20.028 20.604  19.875  1.00 33.99  ? 316 PRO C CA  1 
ATOM   7658  C  C   . PRO C  1 316 ? -21.307 20.087  19.188  1.00 38.17  ? 316 PRO C C   1 
ATOM   7659  O  O   . PRO C  1 316 ? -21.232 19.105  18.446  1.00 42.06  ? 316 PRO C O   1 
ATOM   7660  C  CB  . PRO C  1 316 ? -19.466 19.499  20.773  1.00 29.36  ? 316 PRO C CB  1 
ATOM   7661  C  CG  . PRO C  1 316 ? -19.799 19.908  22.199  1.00 35.97  ? 316 PRO C CG  1 
ATOM   7662  C  CD  . PRO C  1 316 ? -20.425 21.272  22.197  1.00 34.18  ? 316 PRO C CD  1 
ATOM   7663  N  N   . SER C  1 317 ? -22.456 20.708  19.438  1.00 39.07  ? 317 SER C N   1 
ATOM   7664  C  CA  . SER C  1 317 ? -23.710 20.234  18.837  1.00 30.70  ? 317 SER C CA  1 
ATOM   7665  C  C   . SER C  1 317 ? -23.724 20.421  17.331  1.00 36.52  ? 317 SER C C   1 
ATOM   7666  O  O   . SER C  1 317 ? -24.389 19.663  16.628  1.00 41.26  ? 317 SER C O   1 
ATOM   7667  C  CB  . SER C  1 317 ? -24.921 20.913  19.458  1.00 32.40  ? 317 SER C CB  1 
ATOM   7668  O  OG  . SER C  1 317 ? -24.940 22.292  19.137  1.00 36.59  ? 317 SER C OG  1 
ATOM   7669  N  N   . LYS C  1 318 ? -22.972 21.400  16.827  1.00 37.68  ? 318 LYS C N   1 
ATOM   7670  C  CA  . LYS C  1 318 ? -22.923 21.644  15.383  1.00 38.26  ? 318 LYS C CA  1 
ATOM   7671  C  C   . LYS C  1 318 ? -22.302 20.469  14.636  1.00 33.72  ? 318 LYS C C   1 
ATOM   7672  O  O   . LYS C  1 318 ? -22.532 20.311  13.443  1.00 33.59  ? 318 LYS C O   1 
ATOM   7673  C  CB  . LYS C  1 318 ? -22.181 22.948  15.022  1.00 39.61  ? 318 LYS C CB  1 
ATOM   7674  C  CG  . LYS C  1 318 ? -22.604 24.202  15.803  1.00 39.63  ? 318 LYS C CG  1 
ATOM   7675  C  CD  . LYS C  1 318 ? -24.130 24.407  15.871  1.00 37.44  ? 318 LYS C CD  1 
ATOM   7676  C  CE  . LYS C  1 318 ? -24.446 25.694  16.636  1.00 40.77  ? 318 LYS C CE  1 
ATOM   7677  N  NZ  . LYS C  1 318 ? -25.894 25.924  16.911  1.00 44.59  ? 318 LYS C NZ  1 
ATOM   7678  N  N   . LEU C  1 319 ? -21.517 19.644  15.330  1.00 36.49  ? 319 LEU C N   1 
ATOM   7679  C  CA  . LEU C  1 319 ? -20.969 18.420  14.727  1.00 30.23  ? 319 LEU C CA  1 
ATOM   7680  C  C   . LEU C  1 319 ? -22.067 17.427  14.357  1.00 34.81  ? 319 LEU C C   1 
ATOM   7681  O  O   . LEU C  1 319 ? -21.880 16.553  13.499  1.00 34.44  ? 319 LEU C O   1 
ATOM   7682  C  CB  . LEU C  1 319 ? -19.991 17.728  15.693  1.00 33.13  ? 319 LEU C CB  1 
ATOM   7683  C  CG  . LEU C  1 319 ? -18.799 18.587  16.147  1.00 31.67  ? 319 LEU C CG  1 
ATOM   7684  C  CD1 . LEU C  1 319 ? -17.965 17.885  17.216  1.00 29.83  ? 319 LEU C CD1 1 
ATOM   7685  C  CD2 . LEU C  1 319 ? -17.944 18.932  14.952  1.00 28.06  ? 319 LEU C CD2 1 
ATOM   7686  N  N   . VAL C  1 320 ? -23.209 17.538  15.024  1.00 34.53  ? 320 VAL C N   1 
ATOM   7687  C  CA  . VAL C  1 320 ? -24.202 16.474  14.924  1.00 33.59  ? 320 VAL C CA  1 
ATOM   7688  C  C   . VAL C  1 320 ? -25.203 16.772  13.816  1.00 33.64  ? 320 VAL C C   1 
ATOM   7689  O  O   . VAL C  1 320 ? -26.107 17.577  13.993  1.00 30.65  ? 320 VAL C O   1 
ATOM   7690  C  CB  . VAL C  1 320 ? -24.904 16.218  16.272  1.00 34.83  ? 320 VAL C CB  1 
ATOM   7691  C  CG1 . VAL C  1 320 ? -25.931 15.085  16.141  1.00 33.38  ? 320 VAL C CG1 1 
ATOM   7692  C  CG2 . VAL C  1 320 ? -23.849 15.847  17.335  1.00 31.92  ? 320 VAL C CG2 1 
ATOM   7693  N  N   . THR C  1 321 ? -25.018 16.126  12.671  1.00 31.29  ? 321 THR C N   1 
ATOM   7694  C  CA  . THR C  1 321 ? -25.839 16.413  11.510  1.00 40.56  ? 321 THR C CA  1 
ATOM   7695  C  C   . THR C  1 321 ? -27.017 15.458  11.373  1.00 42.64  ? 321 THR C C   1 
ATOM   7696  O  O   . THR C  1 321 ? -28.021 15.809  10.761  1.00 42.12  ? 321 THR C O   1 
ATOM   7697  C  CB  . THR C  1 321 ? -25.012 16.361  10.237  1.00 41.70  ? 321 THR C CB  1 
ATOM   7698  O  OG1 . THR C  1 321 ? -24.364 15.091  10.153  1.00 38.70  ? 321 THR C OG1 1 
ATOM   7699  C  CG2 . THR C  1 321 ? -23.959 17.477  10.266  1.00 38.41  ? 321 THR C CG2 1 
ATOM   7700  N  N   . HIS C  1 322 ? -26.885 14.260  11.941  1.00 32.21  ? 322 HIS C N   1 
ATOM   7701  C  CA  . HIS C  1 322 ? -27.942 13.260  11.900  1.00 31.27  ? 322 HIS C CA  1 
ATOM   7702  C  C   . HIS C  1 322 ? -28.246 12.752  13.294  1.00 33.98  ? 322 HIS C C   1 
ATOM   7703  O  O   . HIS C  1 322 ? -27.334 12.324  14.015  1.00 42.22  ? 322 HIS C O   1 
ATOM   7704  C  CB  . HIS C  1 322 ? -27.510 12.064  11.051  1.00 36.18  ? 322 HIS C CB  1 
ATOM   7705  C  CG  . HIS C  1 322 ? -27.252 12.394  9.614   1.00 39.00  ? 322 HIS C CG  1 
ATOM   7706  N  ND1 . HIS C  1 322 ? -26.315 13.327  9.220   1.00 35.09  ? 322 HIS C ND1 1 
ATOM   7707  C  CD2 . HIS C  1 322 ? -27.799 11.900  8.475   1.00 33.53  ? 322 HIS C CD2 1 
ATOM   7708  C  CE1 . HIS C  1 322 ? -26.304 13.401  7.900   1.00 42.28  ? 322 HIS C CE1 1 
ATOM   7709  N  NE2 . HIS C  1 322 ? -27.190 12.539  7.424   1.00 42.30  ? 322 HIS C NE2 1 
ATOM   7710  N  N   . VAL C  1 323 ? -29.519 12.768  13.675  1.00 35.74  ? 323 VAL C N   1 
ATOM   7711  C  CA  . VAL C  1 323 ? -29.929 12.129  14.927  1.00 38.81  ? 323 VAL C CA  1 
ATOM   7712  C  C   . VAL C  1 323 ? -31.061 11.111  14.705  1.00 43.26  ? 323 VAL C C   1 
ATOM   7713  O  O   . VAL C  1 323 ? -32.100 11.448  14.118  1.00 35.27  ? 323 VAL C O   1 
ATOM   7714  C  CB  . VAL C  1 323 ? -30.351 13.168  16.007  1.00 35.78  ? 323 VAL C CB  1 
ATOM   7715  C  CG1 . VAL C  1 323 ? -30.545 12.474  17.346  1.00 29.07  ? 323 VAL C CG1 1 
ATOM   7716  C  CG2 . VAL C  1 323 ? -29.300 14.304  16.136  1.00 24.90  ? 323 VAL C CG2 1 
ATOM   7717  N  N   . PHE C  1 324 ? -30.860 9.880   15.188  1.00 37.06  ? 324 PHE C N   1 
ATOM   7718  C  CA  . PHE C  1 324 ? -31.863 8.823   15.065  1.00 40.48  ? 324 PHE C CA  1 
ATOM   7719  C  C   . PHE C  1 324 ? -32.326 8.290   16.428  1.00 40.56  ? 324 PHE C C   1 
ATOM   7720  O  O   . PHE C  1 324 ? -31.582 8.320   17.400  1.00 38.44  ? 324 PHE C O   1 
ATOM   7721  C  CB  . PHE C  1 324 ? -31.323 7.665   14.220  1.00 36.38  ? 324 PHE C CB  1 
ATOM   7722  C  CG  . PHE C  1 324 ? -30.813 8.086   12.881  1.00 37.84  ? 324 PHE C CG  1 
ATOM   7723  C  CD1 . PHE C  1 324 ? -31.644 8.742   11.988  1.00 36.78  ? 324 PHE C CD1 1 
ATOM   7724  C  CD2 . PHE C  1 324 ? -29.508 7.820   12.502  1.00 38.50  ? 324 PHE C CD2 1 
ATOM   7725  C  CE1 . PHE C  1 324 ? -31.185 9.133   10.739  1.00 31.36  ? 324 PHE C CE1 1 
ATOM   7726  C  CE2 . PHE C  1 324 ? -29.045 8.198   11.254  1.00 35.91  ? 324 PHE C CE2 1 
ATOM   7727  C  CZ  . PHE C  1 324 ? -29.902 8.854   10.363  1.00 31.31  ? 324 PHE C CZ  1 
ATOM   7728  N  N   . ARG C  1 325 ? -33.572 7.828   16.503  1.00 43.44  ? 325 ARG C N   1 
ATOM   7729  C  CA  . ARG C  1 325 ? -34.051 7.181   17.723  1.00 43.69  ? 325 ARG C CA  1 
ATOM   7730  C  C   . ARG C  1 325 ? -34.080 5.673   17.501  1.00 41.64  ? 325 ARG C C   1 
ATOM   7731  O  O   . ARG C  1 325 ? -34.494 5.201   16.439  1.00 40.16  ? 325 ARG C O   1 
ATOM   7732  C  CB  . ARG C  1 325 ? -35.438 7.706   18.138  1.00 39.87  ? 325 ARG C CB  1 
ATOM   7733  C  CG  . ARG C  1 325 ? -35.474 9.220   18.413  1.00 45.63  ? 325 ARG C CG  1 
ATOM   7734  C  CD  . ARG C  1 325 ? -36.727 9.692   19.177  1.00 39.49  ? 325 ARG C CD  1 
ATOM   7735  N  NE  . ARG C  1 325 ? -36.620 9.411   20.600  1.00 52.96  ? 325 ARG C NE  1 
ATOM   7736  C  CZ  . ARG C  1 325 ? -36.340 10.306  21.542  1.00 52.82  ? 325 ARG C CZ  1 
ATOM   7737  N  NH1 . ARG C  1 325 ? -36.142 11.582  21.247  1.00 47.76  ? 325 ARG C NH1 1 
ATOM   7738  N  NH2 . ARG C  1 325 ? -36.264 9.909   22.798  1.00 60.70  ? 325 ARG C NH2 1 
ATOM   7739  N  N   . GLY C  1 326 ? -33.607 4.917   18.484  1.00 40.19  ? 326 GLY C N   1 
ATOM   7740  C  CA  . GLY C  1 326 ? -33.804 3.480   18.464  1.00 36.99  ? 326 GLY C CA  1 
ATOM   7741  C  C   . GLY C  1 326 ? -32.560 2.623   18.367  1.00 38.86  ? 326 GLY C C   1 
ATOM   7742  O  O   . GLY C  1 326 ? -31.721 2.787   17.480  1.00 38.99  ? 326 GLY C O   1 
ATOM   7743  N  N   . PHE C  1 327 ? -32.478 1.666   19.281  1.00 33.47  ? 327 PHE C N   1 
ATOM   7744  C  CA  . PHE C  1 327 ? -31.345 0.765   19.374  1.00 38.62  ? 327 PHE C CA  1 
ATOM   7745  C  C   . PHE C  1 327 ? -30.925 0.207   18.017  1.00 40.44  ? 327 PHE C C   1 
ATOM   7746  O  O   . PHE C  1 327 ? -29.747 0.219   17.677  1.00 41.22  ? 327 PHE C O   1 
ATOM   7747  C  CB  . PHE C  1 327 ? -31.704 -0.371  20.326  1.00 39.65  ? 327 PHE C CB  1 
ATOM   7748  C  CG  . PHE C  1 327 ? -30.551 -1.236  20.701  1.00 38.47  ? 327 PHE C CG  1 
ATOM   7749  C  CD1 . PHE C  1 327 ? -29.448 -0.703  21.346  1.00 34.53  ? 327 PHE C CD1 1 
ATOM   7750  C  CD2 . PHE C  1 327 ? -30.589 -2.599  20.449  1.00 41.50  ? 327 PHE C CD2 1 
ATOM   7751  C  CE1 . PHE C  1 327 ? -28.400 -1.510  21.712  1.00 35.75  ? 327 PHE C CE1 1 
ATOM   7752  C  CE2 . PHE C  1 327 ? -29.540 -3.412  20.808  1.00 42.76  ? 327 PHE C CE2 1 
ATOM   7753  C  CZ  . PHE C  1 327 ? -28.443 -2.869  21.444  1.00 36.02  ? 327 PHE C CZ  1 
ATOM   7754  N  N   . ASP C  1 328 ? -31.892 -0.270  17.240  1.00 39.93  ? 328 ASP C N   1 
ATOM   7755  C  CA  . ASP C  1 328 ? -31.587 -0.898  15.954  1.00 42.09  ? 328 ASP C CA  1 
ATOM   7756  C  C   . ASP C  1 328 ? -30.968 0.085   14.975  1.00 39.60  ? 328 ASP C C   1 
ATOM   7757  O  O   . ASP C  1 328 ? -30.259 -0.326  14.061  1.00 36.66  ? 328 ASP C O   1 
ATOM   7758  C  CB  . ASP C  1 328 ? -32.829 -1.562  15.323  1.00 40.88  ? 328 ASP C CB  1 
ATOM   7759  C  CG  . ASP C  1 328 ? -33.370 -2.725  16.155  1.00 50.98  ? 328 ASP C CG  1 
ATOM   7760  O  OD1 . ASP C  1 328 ? -32.631 -3.274  17.000  1.00 58.95  ? 328 ASP C OD1 1 
ATOM   7761  O  OD2 . ASP C  1 328 ? -34.547 -3.091  15.964  1.00 61.41  ? 328 ASP C OD2 1 
ATOM   7762  N  N   . ASN C  1 329 ? -31.229 1.379   15.158  1.00 39.35  ? 329 ASN C N   1 
ATOM   7763  C  CA  . ASN C  1 329 ? -30.643 2.376   14.262  1.00 37.77  ? 329 ASN C CA  1 
ATOM   7764  C  C   . ASN C  1 329 ? -29.146 2.638   14.472  1.00 40.46  ? 329 ASN C C   1 
ATOM   7765  O  O   . ASN C  1 329 ? -28.516 3.369   13.707  1.00 33.81  ? 329 ASN C O   1 
ATOM   7766  C  CB  . ASN C  1 329 ? -31.460 3.655   14.255  1.00 35.52  ? 329 ASN C CB  1 
ATOM   7767  C  CG  . ASN C  1 329 ? -32.623 3.568   13.282  1.00 39.82  ? 329 ASN C CG  1 
ATOM   7768  O  OD1 . ASN C  1 329 ? -32.521 2.888   12.273  1.00 38.08  ? 329 ASN C OD1 1 
ATOM   7769  N  ND2 . ASN C  1 329 ? -33.723 4.239   13.583  1.00 40.06  ? 329 ASN C ND2 1 
ATOM   7770  N  N   . ILE C  1 330 ? -28.572 1.995   15.484  1.00 38.52  ? 330 ILE C N   1 
ATOM   7771  C  CA  . ILE C  1 330 ? -27.125 1.944   15.598  1.00 36.81  ? 330 ILE C CA  1 
ATOM   7772  C  C   . ILE C  1 330 ? -26.530 1.480   14.268  1.00 36.19  ? 330 ILE C C   1 
ATOM   7773  O  O   . ILE C  1 330 ? -25.602 2.091   13.747  1.00 36.17  ? 330 ILE C O   1 
ATOM   7774  C  CB  . ILE C  1 330 ? -26.705 0.998   16.724  1.00 37.30  ? 330 ILE C CB  1 
ATOM   7775  C  CG1 . ILE C  1 330 ? -26.980 1.655   18.071  1.00 36.09  ? 330 ILE C CG1 1 
ATOM   7776  C  CG2 . ILE C  1 330 ? -25.234 0.621   16.598  1.00 35.16  ? 330 ILE C CG2 1 
ATOM   7777  C  CD1 . ILE C  1 330 ? -26.825 0.724   19.243  1.00 35.17  ? 330 ILE C CD1 1 
ATOM   7778  N  N   . GLU C  1 331 ? -27.087 0.405   13.715  1.00 33.13  ? 331 GLU C N   1 
ATOM   7779  C  CA  . GLU C  1 331 ? -26.656 -0.118  12.423  1.00 34.38  ? 331 GLU C CA  1 
ATOM   7780  C  C   . GLU C  1 331 ? -26.762 0.930   11.318  1.00 38.12  ? 331 GLU C C   1 
ATOM   7781  O  O   . GLU C  1 331 ? -25.821 1.119   10.546  1.00 39.69  ? 331 GLU C O   1 
ATOM   7782  C  CB  . GLU C  1 331 ? -27.497 -1.346  12.037  1.00 33.63  ? 331 GLU C CB  1 
ATOM   7783  C  CG  . GLU C  1 331 ? -27.299 -1.788  10.590  1.00 32.85  ? 331 GLU C CG  1 
ATOM   7784  C  CD  . GLU C  1 331 ? -27.989 -3.127  10.270  1.00 47.25  ? 331 GLU C CD  1 
ATOM   7785  O  OE1 . GLU C  1 331 ? -28.850 -3.576  11.055  1.00 41.59  ? 331 GLU C OE1 1 
ATOM   7786  O  OE2 . GLU C  1 331 ? -27.672 -3.732  9.225   1.00 52.31  ? 331 GLU C OE2 1 
ATOM   7787  N  N   . LYS C  1 332 ? -27.917 1.591   11.228  1.00 36.20  ? 332 LYS C N   1 
ATOM   7788  C  CA  . LYS C  1 332 ? -28.104 2.654   10.232  1.00 41.27  ? 332 LYS C CA  1 
ATOM   7789  C  C   . LYS C  1 332 ? -27.031 3.729   10.370  1.00 41.24  ? 332 LYS C C   1 
ATOM   7790  O  O   . LYS C  1 332 ? -26.426 4.170   9.388   1.00 40.47  ? 332 LYS C O   1 
ATOM   7791  C  CB  . LYS C  1 332 ? -29.499 3.299   10.353  1.00 38.95  ? 332 LYS C CB  1 
ATOM   7792  C  CG  . LYS C  1 332 ? -29.843 4.248   9.219   1.00 43.98  ? 332 LYS C CG  1 
ATOM   7793  C  CD  . LYS C  1 332 ? -31.347 4.554   9.168   1.00 46.80  ? 332 LYS C CD  1 
ATOM   7794  C  CE  . LYS C  1 332 ? -31.748 5.551   10.248  1.00 45.87  ? 332 LYS C CE  1 
ATOM   7795  N  NZ  . LYS C  1 332 ? -33.228 5.821   10.216  1.00 51.35  ? 332 LYS C NZ  1 
ATOM   7796  N  N   . ALA C  1 333 ? -26.811 4.172   11.596  1.00 34.38  ? 333 ALA C N   1 
ATOM   7797  C  CA  . ALA C  1 333 ? -25.844 5.230   11.806  1.00 40.53  ? 333 ALA C CA  1 
ATOM   7798  C  C   . ALA C  1 333 ? -24.461 4.713   11.409  1.00 43.40  ? 333 ALA C C   1 
ATOM   7799  O  O   . ALA C  1 333 ? -23.652 5.453   10.836  1.00 35.40  ? 333 ALA C O   1 
ATOM   7800  C  CB  . ALA C  1 333 ? -25.872 5.706   13.258  1.00 31.86  ? 333 ALA C CB  1 
ATOM   7801  N  N   . PHE C  1 334 ? -24.209 3.431   11.681  1.00 38.12  ? 334 PHE C N   1 
ATOM   7802  C  CA  . PHE C  1 334 ? -22.915 2.835   11.351  1.00 37.91  ? 334 PHE C CA  1 
ATOM   7803  C  C   . PHE C  1 334 ? -22.664 2.819   9.845   1.00 40.12  ? 334 PHE C C   1 
ATOM   7804  O  O   . PHE C  1 334 ? -21.576 3.171   9.395   1.00 43.53  ? 334 PHE C O   1 
ATOM   7805  C  CB  . PHE C  1 334 ? -22.781 1.412   11.913  1.00 41.18  ? 334 PHE C CB  1 
ATOM   7806  C  CG  . PHE C  1 334 ? -21.423 0.774   11.632  1.00 43.63  ? 334 PHE C CG  1 
ATOM   7807  C  CD1 . PHE C  1 334 ? -20.352 0.969   12.498  1.00 45.13  ? 334 PHE C CD1 1 
ATOM   7808  C  CD2 . PHE C  1 334 ? -21.218 0.007   10.490  1.00 35.13  ? 334 PHE C CD2 1 
ATOM   7809  C  CE1 . PHE C  1 334 ? -19.096 0.397   12.235  1.00 46.60  ? 334 PHE C CE1 1 
ATOM   7810  C  CE2 . PHE C  1 334 ? -19.976 -0.567  10.222  1.00 46.20  ? 334 PHE C CE2 1 
ATOM   7811  C  CZ  . PHE C  1 334 ? -18.909 -0.371  11.099  1.00 47.03  ? 334 PHE C CZ  1 
ATOM   7812  N  N   . MET C  1 335 ? -23.667 2.402   9.074   1.00 45.11  ? 335 MET C N   1 
ATOM   7813  C  CA  . MET C  1 335 ? -23.562 2.365   7.610   1.00 45.13  ? 335 MET C CA  1 
ATOM   7814  C  C   . MET C  1 335 ? -23.421 3.766   7.020   1.00 47.82  ? 335 MET C C   1 
ATOM   7815  O  O   . MET C  1 335 ? -22.869 3.956   5.935   1.00 42.33  ? 335 MET C O   1 
ATOM   7816  C  CB  . MET C  1 335 ? -24.773 1.651   6.999   1.00 41.62  ? 335 MET C CB  1 
ATOM   7817  C  CG  . MET C  1 335 ? -24.882 0.185   7.385   1.00 37.43  ? 335 MET C CG  1 
ATOM   7818  S  SD  . MET C  1 335 ? -23.277 -0.672  7.418   1.00 63.96  ? 335 MET C SD  1 
ATOM   7819  C  CE  . MET C  1 335 ? -22.786 -0.603  5.699   1.00 62.85  ? 335 MET C CE  1 
ATOM   7820  N  N   . LEU C  1 336 ? -23.917 4.750   7.757   1.00 55.34  ? 336 LEU C N   1 
ATOM   7821  C  CA  . LEU C  1 336 ? -23.816 6.149   7.366   1.00 49.18  ? 336 LEU C CA  1 
ATOM   7822  C  C   . LEU C  1 336 ? -22.355 6.587   7.284   1.00 45.69  ? 336 LEU C C   1 
ATOM   7823  O  O   . LEU C  1 336 ? -21.962 7.280   6.348   1.00 46.04  ? 336 LEU C O   1 
ATOM   7824  C  CB  . LEU C  1 336 ? -24.573 6.997   8.385   1.00 57.85  ? 336 LEU C CB  1 
ATOM   7825  C  CG  . LEU C  1 336 ? -25.207 8.332   8.004   1.00 60.96  ? 336 LEU C CG  1 
ATOM   7826  C  CD1 . LEU C  1 336 ? -25.912 8.253   6.654   1.00 58.67  ? 336 LEU C CD1 1 
ATOM   7827  C  CD2 . LEU C  1 336 ? -26.166 8.762   9.114   1.00 51.75  ? 336 LEU C CD2 1 
ATOM   7828  N  N   . MET C  1 337 ? -21.547 6.179   8.261   1.00 43.82  ? 337 MET C N   1 
ATOM   7829  C  CA  . MET C  1 337 ? -20.116 6.499   8.239   1.00 44.46  ? 337 MET C CA  1 
ATOM   7830  C  C   . MET C  1 337 ? -19.373 5.758   7.132   1.00 46.85  ? 337 MET C C   1 
ATOM   7831  O  O   . MET C  1 337 ? -18.333 6.214   6.675   1.00 48.39  ? 337 MET C O   1 
ATOM   7832  C  CB  . MET C  1 337 ? -19.438 6.181   9.576   1.00 44.34  ? 337 MET C CB  1 
ATOM   7833  C  CG  . MET C  1 337 ? -20.114 6.776   10.793  1.00 50.40  ? 337 MET C CG  1 
ATOM   7834  S  SD  . MET C  1 337 ? -19.958 8.566   10.910  1.00 41.35  ? 337 MET C SD  1 
ATOM   7835  C  CE  . MET C  1 337 ? -18.203 8.763   11.271  1.00 44.62  ? 337 MET C CE  1 
ATOM   7836  N  N   . LYS C  1 338 ? -19.889 4.607   6.712   1.00 48.17  ? 338 LYS C N   1 
ATOM   7837  C  CA  . LYS C  1 338 ? -19.242 3.881   5.624   1.00 49.91  ? 338 LYS C CA  1 
ATOM   7838  C  C   . LYS C  1 338 ? -19.378 4.619   4.292   1.00 48.21  ? 338 LYS C C   1 
ATOM   7839  O  O   . LYS C  1 338 ? -18.385 4.972   3.668   1.00 49.12  ? 338 LYS C O   1 
ATOM   7840  C  CB  . LYS C  1 338 ? -19.774 2.451   5.497   1.00 44.68  ? 338 LYS C CB  1 
ATOM   7841  C  CG  . LYS C  1 338 ? -18.919 1.588   4.578   1.00 47.85  ? 338 LYS C CG  1 
ATOM   7842  C  CD  . LYS C  1 338 ? -19.448 0.160   4.451   1.00 48.27  ? 338 LYS C CD  1 
ATOM   7843  C  CE  . LYS C  1 338 ? -18.764 -0.568  3.294   1.00 53.24  ? 338 LYS C CE  1 
ATOM   7844  N  NZ  . LYS C  1 338 ? -19.453 -1.849  2.928   1.00 62.40  ? 338 LYS C NZ  1 
ATOM   7845  N  N   . ASP C  1 339 ? -20.608 4.859   3.860   1.00 54.00  ? 339 ASP C N   1 
ATOM   7846  C  CA  . ASP C  1 339 ? -20.821 5.506   2.565   1.00 60.04  ? 339 ASP C CA  1 
ATOM   7847  C  C   . ASP C  1 339 ? -20.676 7.023   2.637   1.00 52.56  ? 339 ASP C C   1 
ATOM   7848  O  O   . ASP C  1 339 ? -20.506 7.687   1.622   1.00 53.85  ? 339 ASP C O   1 
ATOM   7849  C  CB  . ASP C  1 339 ? -22.157 5.090   1.933   1.00 68.80  ? 339 ASP C CB  1 
ATOM   7850  C  CG  . ASP C  1 339 ? -23.187 4.656   2.958   1.00 69.18  ? 339 ASP C CG  1 
ATOM   7851  O  OD1 . ASP C  1 339 ? -23.383 5.400   3.943   1.00 80.05  ? 339 ASP C OD1 1 
ATOM   7852  O  OD2 . ASP C  1 339 ? -23.806 3.581   2.768   1.00 51.92  ? 339 ASP C OD2 1 
ATOM   7853  N  N   . LYS C  1 340 ? -20.723 7.551   3.851   1.00 50.08  ? 340 LYS C N   1 
ATOM   7854  C  CA  . LYS C  1 340 ? -20.467 8.961   4.103   1.00 53.46  ? 340 LYS C CA  1 
ATOM   7855  C  C   . LYS C  1 340 ? -21.084 9.906   3.058   1.00 54.21  ? 340 LYS C C   1 
ATOM   7856  O  O   . LYS C  1 340 ? -20.410 10.356  2.126   1.00 54.82  ? 340 LYS C O   1 
ATOM   7857  C  CB  . LYS C  1 340 ? -18.966 9.200   4.258   1.00 61.72  ? 340 LYS C CB  1 
ATOM   7858  C  CG  . LYS C  1 340 ? -18.636 10.165  5.393   1.00 79.17  ? 340 LYS C CG  1 
ATOM   7859  C  CD  . LYS C  1 340 ? -17.300 9.833   6.057   1.00 87.14  ? 340 LYS C CD  1 
ATOM   7860  C  CE  . LYS C  1 340 ? -17.222 10.406  7.471   1.00 83.97  ? 340 LYS C CE  1 
ATOM   7861  N  NZ  . LYS C  1 340 ? -17.685 11.821  7.528   1.00 81.50  ? 340 LYS C NZ  1 
ATOM   7862  N  N   . PRO C  1 341 ? -22.380 10.206  3.213   1.00 44.49  ? 341 PRO C N   1 
ATOM   7863  C  CA  . PRO C  1 341 ? -23.059 11.185  2.352   1.00 39.00  ? 341 PRO C CA  1 
ATOM   7864  C  C   . PRO C  1 341 ? -22.476 12.583  2.536   1.00 44.51  ? 341 PRO C C   1 
ATOM   7865  O  O   . PRO C  1 341 ? -21.832 12.847  3.556   1.00 37.27  ? 341 PRO C O   1 
ATOM   7866  C  CB  . PRO C  1 341 ? -24.516 11.137  2.843   1.00 33.75  ? 341 PRO C CB  1 
ATOM   7867  C  CG  . PRO C  1 341 ? -24.432 10.577  4.224   1.00 39.42  ? 341 PRO C CG  1 
ATOM   7868  C  CD  . PRO C  1 341 ? -23.321 9.558   4.141   1.00 44.20  ? 341 PRO C CD  1 
ATOM   7869  N  N   . LYS C  1 342 ? -22.723 13.470  1.571   1.00 48.19  ? 342 LYS C N   1 
ATOM   7870  C  CA  . LYS C  1 342 ? -22.072 14.774  1.536   1.00 50.06  ? 342 LYS C CA  1 
ATOM   7871  C  C   . LYS C  1 342 ? -22.540 15.766  2.607   1.00 45.25  ? 342 LYS C C   1 
ATOM   7872  O  O   . LYS C  1 342 ? -21.858 16.750  2.866   1.00 43.67  ? 342 LYS C O   1 
ATOM   7873  C  CB  . LYS C  1 342 ? -22.202 15.386  0.144   1.00 67.65  ? 342 LYS C CB  1 
ATOM   7874  C  CG  . LYS C  1 342 ? -21.564 14.540  -0.956  1.00 82.54  ? 342 LYS C CG  1 
ATOM   7875  C  CD  . LYS C  1 342 ? -20.053 14.754  -1.046  1.00 87.54  ? 342 LYS C CD  1 
ATOM   7876  C  CE  . LYS C  1 342 ? -19.467 14.043  -2.263  1.00 91.41  ? 342 LYS C CE  1 
ATOM   7877  N  NZ  . LYS C  1 342 ? -18.245 14.722  -2.784  1.00 93.29  ? 342 LYS C NZ  1 
ATOM   7878  N  N   . ASP C  1 343 ? -23.693 15.517  3.223   1.00 41.51  ? 343 ASP C N   1 
ATOM   7879  C  CA  . ASP C  1 343 ? -24.171 16.368  4.318   1.00 39.68  ? 343 ASP C CA  1 
ATOM   7880  C  C   . ASP C  1 343 ? -23.837 15.791  5.707   1.00 37.41  ? 343 ASP C C   1 
ATOM   7881  O  O   . ASP C  1 343 ? -24.376 16.225  6.724   1.00 43.69  ? 343 ASP C O   1 
ATOM   7882  C  CB  . ASP C  1 343 ? -25.678 16.622  4.198   1.00 39.41  ? 343 ASP C CB  1 
ATOM   7883  C  CG  . ASP C  1 343 ? -26.498 15.330  4.195   1.00 43.03  ? 343 ASP C CG  1 
ATOM   7884  O  OD1 . ASP C  1 343 ? -25.917 14.243  3.974   1.00 39.73  ? 343 ASP C OD1 1 
ATOM   7885  O  OD2 . ASP C  1 343 ? -27.728 15.401  4.418   1.00 50.24  ? 343 ASP C OD2 1 
ATOM   7886  N  N   . LEU C  1 344 ? -22.945 14.816  5.760   1.00 31.23  ? 344 LEU C N   1 
ATOM   7887  C  CA  . LEU C  1 344 ? -22.667 14.178  7.039   1.00 36.09  ? 344 LEU C CA  1 
ATOM   7888  C  C   . LEU C  1 344 ? -21.422 14.737  7.733   1.00 42.17  ? 344 LEU C C   1 
ATOM   7889  O  O   . LEU C  1 344 ? -20.379 14.944  7.115   1.00 42.74  ? 344 LEU C O   1 
ATOM   7890  C  CB  . LEU C  1 344 ? -22.524 12.659  6.887   1.00 40.91  ? 344 LEU C CB  1 
ATOM   7891  C  CG  . LEU C  1 344 ? -21.961 11.962  8.139   1.00 38.72  ? 344 LEU C CG  1 
ATOM   7892  C  CD1 . LEU C  1 344 ? -23.064 11.721  9.157   1.00 31.08  ? 344 LEU C CD1 1 
ATOM   7893  C  CD2 . LEU C  1 344 ? -21.273 10.662  7.784   1.00 39.83  ? 344 LEU C CD2 1 
ATOM   7894  N  N   . ILE C  1 345 ? -21.558 14.997  9.026   1.00 37.52  ? 345 ILE C N   1 
ATOM   7895  C  CA  . ILE C  1 345 ? -20.410 15.186  9.888   1.00 38.15  ? 345 ILE C CA  1 
ATOM   7896  C  C   . ILE C  1 345 ? -20.419 14.067  10.914  1.00 31.06  ? 345 ILE C C   1 
ATOM   7897  O  O   . ILE C  1 345 ? -19.582 13.182  10.868  1.00 35.93  ? 345 ILE C O   1 
ATOM   7898  C  CB  . ILE C  1 345 ? -20.441 16.539  10.609  1.00 37.50  ? 345 ILE C CB  1 
ATOM   7899  C  CG1 . ILE C  1 345 ? -20.418 17.679  9.596   1.00 33.49  ? 345 ILE C CG1 1 
ATOM   7900  C  CG2 . ILE C  1 345 ? -19.248 16.656  11.564  1.00 34.89  ? 345 ILE C CG2 1 
ATOM   7901  C  CD1 . ILE C  1 345 ? -20.540 19.029  10.235  1.00 30.85  ? 345 ILE C CD1 1 
ATOM   7902  N  N   . LYS C  1 346 ? -21.391 14.105  11.821  1.00 28.99  ? 346 LYS C N   1 
ATOM   7903  C  CA  . LYS C  1 346 ? -21.525 13.081  12.847  1.00 31.16  ? 346 LYS C CA  1 
ATOM   7904  C  C   . LYS C  1 346 ? -22.998 12.703  13.096  1.00 38.66  ? 346 LYS C C   1 
ATOM   7905  O  O   . LYS C  1 346 ? -23.861 13.572  13.211  1.00 34.34  ? 346 LYS C O   1 
ATOM   7906  C  CB  . LYS C  1 346 ? -20.866 13.584  14.134  1.00 37.65  ? 346 LYS C CB  1 
ATOM   7907  C  CG  . LYS C  1 346 ? -20.468 12.525  15.105  1.00 50.85  ? 346 LYS C CG  1 
ATOM   7908  C  CD  . LYS C  1 346 ? -19.122 11.873  14.787  1.00 43.10  ? 346 LYS C CD  1 
ATOM   7909  C  CE  . LYS C  1 346 ? -18.711 11.011  15.979  1.00 31.59  ? 346 LYS C CE  1 
ATOM   7910  N  NZ  . LYS C  1 346 ? -17.694 9.966   15.657  1.00 34.24  ? 346 LYS C NZ  1 
ATOM   7911  N  N   . PRO C  1 347 ? -23.289 11.394  13.163  1.00 37.41  ? 347 PRO C N   1 
ATOM   7912  C  CA  . PRO C  1 347 ? -24.605 10.889  13.549  1.00 39.24  ? 347 PRO C CA  1 
ATOM   7913  C  C   . PRO C  1 347 ? -24.618 10.516  15.020  1.00 38.99  ? 347 PRO C C   1 
ATOM   7914  O  O   . PRO C  1 347 ? -23.602 10.074  15.549  1.00 46.74  ? 347 PRO C O   1 
ATOM   7915  C  CB  . PRO C  1 347 ? -24.739 9.595   12.728  1.00 43.77  ? 347 PRO C CB  1 
ATOM   7916  C  CG  . PRO C  1 347 ? -23.401 9.403   12.026  1.00 42.01  ? 347 PRO C CG  1 
ATOM   7917  C  CD  . PRO C  1 347 ? -22.425 10.307  12.695  1.00 34.07  ? 347 PRO C CD  1 
ATOM   7918  N  N   . VAL C  1 348 ? -25.759 10.698  15.667  1.00 37.76  ? 348 VAL C N   1 
ATOM   7919  C  CA  . VAL C  1 348 ? -25.959 10.277  17.044  1.00 32.49  ? 348 VAL C CA  1 
ATOM   7920  C  C   . VAL C  1 348 ? -27.229 9.422   17.105  1.00 38.53  ? 348 VAL C C   1 
ATOM   7921  O  O   . VAL C  1 348 ? -28.247 9.727   16.459  1.00 36.30  ? 348 VAL C O   1 
ATOM   7922  C  CB  . VAL C  1 348 ? -26.073 11.496  17.986  1.00 34.85  ? 348 VAL C CB  1 
ATOM   7923  C  CG1 . VAL C  1 348 ? -26.679 11.107  19.336  1.00 29.91  ? 348 VAL C CG1 1 
ATOM   7924  C  CG2 . VAL C  1 348 ? -24.684 12.184  18.176  1.00 32.86  ? 348 VAL C CG2 1 
ATOM   7925  N  N   . VAL C  1 349 ? -27.173 8.330   17.850  1.00 34.08  ? 349 VAL C N   1 
ATOM   7926  C  CA  . VAL C  1 349 ? -28.373 7.538   18.040  1.00 36.83  ? 349 VAL C CA  1 
ATOM   7927  C  C   . VAL C  1 349 ? -28.850 7.724   19.468  1.00 38.01  ? 349 VAL C C   1 
ATOM   7928  O  O   . VAL C  1 349 ? -28.085 7.573   20.417  1.00 42.18  ? 349 VAL C O   1 
ATOM   7929  C  CB  . VAL C  1 349 ? -28.139 6.052   17.724  1.00 35.14  ? 349 VAL C CB  1 
ATOM   7930  C  CG1 . VAL C  1 349 ? -29.448 5.257   17.856  1.00 32.37  ? 349 VAL C CG1 1 
ATOM   7931  C  CG2 . VAL C  1 349 ? -27.574 5.903   16.331  1.00 33.64  ? 349 VAL C CG2 1 
ATOM   7932  N  N   . ILE C  1 350 ? -30.114 8.083   19.613  1.00 34.82  ? 350 ILE C N   1 
ATOM   7933  C  CA  . ILE C  1 350 ? -30.702 8.274   20.927  1.00 39.88  ? 350 ILE C CA  1 
ATOM   7934  C  C   . ILE C  1 350 ? -31.435 7.009   21.319  1.00 43.59  ? 350 ILE C C   1 
ATOM   7935  O  O   . ILE C  1 350 ? -32.210 6.456   20.535  1.00 42.93  ? 350 ILE C O   1 
ATOM   7936  C  CB  . ILE C  1 350 ? -31.659 9.473   20.940  1.00 41.40  ? 350 ILE C CB  1 
ATOM   7937  C  CG1 . ILE C  1 350 ? -30.858 10.766  20.791  1.00 50.40  ? 350 ILE C CG1 1 
ATOM   7938  C  CG2 . ILE C  1 350 ? -32.435 9.511   22.233  1.00 37.23  ? 350 ILE C CG2 1 
ATOM   7939  C  CD1 . ILE C  1 350 ? -31.727 11.982  20.624  1.00 66.09  ? 350 ILE C CD1 1 
ATOM   7940  N  N   . LEU C  1 351 ? -31.165 6.538   22.529  1.00 45.80  ? 351 LEU C N   1 
ATOM   7941  C  CA  . LEU C  1 351 ? -31.685 5.256   22.967  1.00 49.46  ? 351 LEU C CA  1 
ATOM   7942  C  C   . LEU C  1 351 ? -32.672 5.419   24.120  1.00 55.82  ? 351 LEU C C   1 
ATOM   7943  O  O   . LEU C  1 351 ? -33.224 4.434   24.612  1.00 57.51  ? 351 LEU C O   1 
ATOM   7944  C  CB  . LEU C  1 351 ? -30.534 4.329   23.358  1.00 43.60  ? 351 LEU C CB  1 
ATOM   7945  C  CG  . LEU C  1 351 ? -29.343 4.276   22.392  1.00 44.11  ? 351 LEU C CG  1 
ATOM   7946  C  CD1 . LEU C  1 351 ? -28.229 3.405   22.969  1.00 42.25  ? 351 LEU C CD1 1 
ATOM   7947  C  CD2 . LEU C  1 351 ? -29.772 3.738   21.040  1.00 49.19  ? 351 LEU C CD2 1 
ATOM   7948  N  N   . ALA C  1 352 ? -32.897 6.663   24.540  1.00 59.28  ? 352 ALA C N   1 
ATOM   7949  C  CA  . ALA C  1 352 ? -33.903 6.952   25.564  1.00 66.14  ? 352 ALA C CA  1 
ATOM   7950  C  C   . ALA C  1 352 ? -34.783 8.159   25.209  1.00 71.69  ? 352 ALA C C   1 
ATOM   7951  O  O   . ALA C  1 352 ? -35.917 8.280   25.670  1.00 72.04  ? 352 ALA C O   1 
ATOM   7952  C  CB  . ALA C  1 352 ? -33.245 7.155   26.909  1.00 66.87  ? 352 ALA C CB  1 
ATOM   7953  O  OXT . ALA C  1 352 ? -34.394 9.050   24.457  1.00 72.75  ? 352 ALA C OXT 1 
ATOM   7954  N  N   . MET D  1 1   ? 11.609  70.161  19.711  1.00 51.24  ? 1   MET D N   1 
ATOM   7955  C  CA  . MET D  1 1   ? 10.246  69.671  19.865  1.00 54.91  ? 1   MET D CA  1 
ATOM   7956  C  C   . MET D  1 1   ? 9.762   69.655  21.317  1.00 50.42  ? 1   MET D C   1 
ATOM   7957  O  O   . MET D  1 1   ? 10.554  69.686  22.253  1.00 54.81  ? 1   MET D O   1 
ATOM   7958  C  CB  . MET D  1 1   ? 10.154  68.244  19.322  1.00 62.21  ? 1   MET D CB  1 
ATOM   7959  C  CG  . MET D  1 1   ? 10.833  67.207  20.205  1.00 59.16  ? 1   MET D CG  1 
ATOM   7960  S  SD  . MET D  1 1   ? 10.430  65.510  19.713  1.00 50.68  ? 1   MET D SD  1 
ATOM   7961  C  CE  . MET D  1 1   ? 11.189  64.576  21.057  1.00 42.09  ? 1   MET D CE  1 
ATOM   7962  N  N   . LYS D  1 2   ? 8.448   69.549  21.479  1.00 46.71  ? 2   LYS D N   1 
ATOM   7963  C  CA  . LYS D  1 2   ? 7.800   69.409  22.777  1.00 52.73  ? 2   LYS D CA  1 
ATOM   7964  C  C   . LYS D  1 2   ? 7.593   67.958  23.223  1.00 58.40  ? 2   LYS D C   1 
ATOM   7965  O  O   . LYS D  1 2   ? 7.462   67.042  22.405  1.00 60.15  ? 2   LYS D O   1 
ATOM   7966  C  CB  . LYS D  1 2   ? 6.442   70.119  22.751  1.00 61.58  ? 2   LYS D CB  1 
ATOM   7967  C  CG  . LYS D  1 2   ? 6.535   71.570  22.327  1.00 61.76  ? 2   LYS D CG  1 
ATOM   7968  C  CD  . LYS D  1 2   ? 5.857   72.465  23.337  1.00 71.22  ? 2   LYS D CD  1 
ATOM   7969  C  CE  . LYS D  1 2   ? 6.461   73.867  23.316  1.00 72.39  ? 2   LYS D CE  1 
ATOM   7970  N  NZ  . LYS D  1 2   ? 6.449   74.469  24.683  1.00 74.07  ? 2   LYS D NZ  1 
ATOM   7971  N  N   . GLY D  1 3   ? 7.540   67.765  24.535  1.00 57.18  ? 3   GLY D N   1 
ATOM   7972  C  CA  . GLY D  1 3   ? 7.339   66.450  25.114  1.00 56.72  ? 3   GLY D CA  1 
ATOM   7973  C  C   . GLY D  1 3   ? 6.883   66.548  26.557  1.00 57.87  ? 3   GLY D C   1 
ATOM   7974  O  O   . GLY D  1 3   ? 7.296   67.452  27.292  1.00 53.65  ? 3   GLY D O   1 
ATOM   7975  N  N   . PHE D  1 4   ? 6.026   65.620  26.966  1.00 51.38  ? 4   PHE D N   1 
ATOM   7976  C  CA  . PHE D  1 4   ? 5.510   65.626  28.324  1.00 49.50  ? 4   PHE D CA  1 
ATOM   7977  C  C   . PHE D  1 4   ? 6.374   64.739  29.198  1.00 55.75  ? 4   PHE D C   1 
ATOM   7978  O  O   . PHE D  1 4   ? 6.413   63.524  29.013  1.00 65.32  ? 4   PHE D O   1 
ATOM   7979  C  CB  . PHE D  1 4   ? 4.052   65.168  28.354  1.00 49.08  ? 4   PHE D CB  1 
ATOM   7980  C  CG  . PHE D  1 4   ? 3.406   65.338  29.690  1.00 51.68  ? 4   PHE D CG  1 
ATOM   7981  C  CD1 . PHE D  1 4   ? 3.046   66.600  30.141  1.00 53.70  ? 4   PHE D CD1 1 
ATOM   7982  C  CD2 . PHE D  1 4   ? 3.173   64.245  30.506  1.00 48.64  ? 4   PHE D CD2 1 
ATOM   7983  C  CE1 . PHE D  1 4   ? 2.460   66.767  31.381  1.00 53.43  ? 4   PHE D CE1 1 
ATOM   7984  C  CE2 . PHE D  1 4   ? 2.583   64.408  31.749  1.00 51.24  ? 4   PHE D CE2 1 
ATOM   7985  C  CZ  . PHE D  1 4   ? 2.232   65.674  32.189  1.00 49.84  ? 4   PHE D CZ  1 
ATOM   7986  N  N   . ALA D  1 5   ? 7.062   65.344  30.160  1.00 52.95  ? 5   ALA D N   1 
ATOM   7987  C  CA  . ALA D  1 5   ? 8.158   64.661  30.829  1.00 49.97  ? 5   ALA D CA  1 
ATOM   7988  C  C   . ALA D  1 5   ? 8.020   64.545  32.334  1.00 55.36  ? 5   ALA D C   1 
ATOM   7989  O  O   . ALA D  1 5   ? 7.218   65.229  32.959  1.00 61.00  ? 5   ALA D O   1 
ATOM   7990  C  CB  . ALA D  1 5   ? 9.491   65.341  30.483  1.00 52.85  ? 5   ALA D CB  1 
ATOM   7991  N  N   . MET D  1 6   ? 8.823   63.656  32.903  1.00 52.39  ? 6   MET D N   1 
ATOM   7992  C  CA  . MET D  1 6   ? 9.066   63.646  34.333  1.00 50.77  ? 6   MET D CA  1 
ATOM   7993  C  C   . MET D  1 6   ? 10.275  64.541  34.591  1.00 59.10  ? 6   MET D C   1 
ATOM   7994  O  O   . MET D  1 6   ? 11.398  64.206  34.217  1.00 59.49  ? 6   MET D O   1 
ATOM   7995  C  CB  . MET D  1 6   ? 9.331   62.216  34.803  1.00 40.80  ? 6   MET D CB  1 
ATOM   7996  C  CG  . MET D  1 6   ? 10.179  62.081  36.077  1.00 44.03  ? 6   MET D CG  1 
ATOM   7997  S  SD  . MET D  1 6   ? 10.431  60.320  36.520  1.00 60.09  ? 6   MET D SD  1 
ATOM   7998  C  CE  . MET D  1 6   ? 10.689  59.589  34.906  1.00 168.15 ? 6   MET D CE  1 
ATOM   7999  N  N   . LEU D  1 7   ? 10.037  65.693  35.208  1.00 66.91  ? 7   LEU D N   1 
ATOM   8000  C  CA  . LEU D  1 7   ? 11.100  66.657  35.474  1.00 67.51  ? 7   LEU D CA  1 
ATOM   8001  C  C   . LEU D  1 7   ? 11.996  66.149  36.590  1.00 74.37  ? 7   LEU D C   1 
ATOM   8002  O  O   . LEU D  1 7   ? 13.209  66.364  36.578  1.00 81.94  ? 7   LEU D O   1 
ATOM   8003  C  CB  . LEU D  1 7   ? 10.493  68.007  35.841  1.00 60.75  ? 7   LEU D CB  1 
ATOM   8004  C  CG  . LEU D  1 7   ? 9.339   68.376  34.907  1.00 61.39  ? 7   LEU D CG  1 
ATOM   8005  C  CD1 . LEU D  1 7   ? 8.578   69.607  35.392  1.00 61.36  ? 7   LEU D CD1 1 
ATOM   8006  C  CD2 . LEU D  1 7   ? 9.855   68.574  33.487  1.00 57.79  ? 7   LEU D CD2 1 
ATOM   8007  N  N   . SER D  1 8   ? 11.378  65.461  37.545  1.00 72.24  ? 8   SER D N   1 
ATOM   8008  C  CA  . SER D  1 8   ? 12.075  64.801  38.641  1.00 67.85  ? 8   SER D CA  1 
ATOM   8009  C  C   . SER D  1 8   ? 11.018  64.087  39.466  1.00 66.02  ? 8   SER D C   1 
ATOM   8010  O  O   . SER D  1 8   ? 9.824   64.316  39.276  1.00 68.42  ? 8   SER D O   1 
ATOM   8011  C  CB  . SER D  1 8   ? 12.813  65.818  39.510  1.00 69.94  ? 8   SER D CB  1 
ATOM   8012  O  OG  . SER D  1 8   ? 11.905  66.759  40.058  1.00 72.43  ? 8   SER D OG  1 
ATOM   8013  N  N   . ILE D  1 9   ? 11.448  63.232  40.385  1.00 67.11  ? 9   ILE D N   1 
ATOM   8014  C  CA  . ILE D  1 9   ? 10.507  62.447  41.176  1.00 71.12  ? 9   ILE D CA  1 
ATOM   8015  C  C   . ILE D  1 9   ? 9.484   63.327  41.876  1.00 68.46  ? 9   ILE D C   1 
ATOM   8016  O  O   . ILE D  1 9   ? 9.830   64.122  42.746  1.00 69.51  ? 9   ILE D O   1 
ATOM   8017  C  CB  . ILE D  1 9   ? 11.220  61.600  42.231  1.00 77.62  ? 9   ILE D CB  1 
ATOM   8018  C  CG1 . ILE D  1 9   ? 12.118  60.565  41.550  1.00 81.00  ? 9   ILE D CG1 1 
ATOM   8019  C  CG2 . ILE D  1 9   ? 10.191  60.934  43.134  1.00 79.81  ? 9   ILE D CG2 1 
ATOM   8020  C  CD1 . ILE D  1 9   ? 12.849  59.654  42.508  1.00 81.26  ? 9   ILE D CD1 1 
ATOM   8021  N  N   . GLY D  1 10  ? 8.222   63.173  41.489  1.00 60.98  ? 10  GLY D N   1 
ATOM   8022  C  CA  . GLY D  1 10  ? 7.139   63.955  42.051  1.00 59.50  ? 10  GLY D CA  1 
ATOM   8023  C  C   . GLY D  1 10  ? 6.754   65.113  41.152  1.00 63.88  ? 10  GLY D C   1 
ATOM   8024  O  O   . GLY D  1 10  ? 5.775   65.816  41.417  1.00 66.32  ? 10  GLY D O   1 
ATOM   8025  N  N   . LYS D  1 11  ? 7.517   65.310  40.079  1.00 64.97  ? 11  LYS D N   1 
ATOM   8026  C  CA  . LYS D  1 11  ? 7.263   66.423  39.164  1.00 67.73  ? 11  LYS D CA  1 
ATOM   8027  C  C   . LYS D  1 11  ? 7.163   66.043  37.686  1.00 58.77  ? 11  LYS D C   1 
ATOM   8028  O  O   . LYS D  1 11  ? 8.043   65.384  37.135  1.00 50.93  ? 11  LYS D O   1 
ATOM   8029  C  CB  . LYS D  1 11  ? 8.316   67.521  39.336  1.00 71.72  ? 11  LYS D CB  1 
ATOM   8030  C  CG  . LYS D  1 11  ? 8.003   68.500  40.443  1.00 75.35  ? 11  LYS D CG  1 
ATOM   8031  C  CD  . LYS D  1 11  ? 8.753   69.810  40.255  1.00 72.33  ? 11  LYS D CD  1 
ATOM   8032  C  CE  . LYS D  1 11  ? 8.430   70.775  41.380  1.00 66.91  ? 11  LYS D CE  1 
ATOM   8033  N  NZ  . LYS D  1 11  ? 9.556   71.702  41.616  1.00 56.96  ? 11  LYS D NZ  1 
ATOM   8034  N  N   . VAL D  1 12  ? 6.093   66.497  37.048  1.00 61.32  ? 12  VAL D N   1 
ATOM   8035  C  CA  . VAL D  1 12  ? 5.926   66.315  35.618  1.00 62.36  ? 12  VAL D CA  1 
ATOM   8036  C  C   . VAL D  1 12  ? 5.597   67.648  34.972  1.00 69.00  ? 12  VAL D C   1 
ATOM   8037  O  O   . VAL D  1 12  ? 5.140   68.572  35.642  1.00 74.46  ? 12  VAL D O   1 
ATOM   8038  C  CB  . VAL D  1 12  ? 4.797   65.323  35.300  1.00 59.79  ? 12  VAL D CB  1 
ATOM   8039  C  CG1 . VAL D  1 12  ? 5.236   63.896  35.597  1.00 54.36  ? 12  VAL D CG1 1 
ATOM   8040  C  CG2 . VAL D  1 12  ? 3.537   65.688  36.075  1.00 60.61  ? 12  VAL D CG2 1 
ATOM   8041  N  N   . GLY D  1 13  ? 5.830   67.740  33.668  1.00 68.40  ? 13  GLY D N   1 
ATOM   8042  C  CA  . GLY D  1 13  ? 5.492   68.930  32.916  1.00 70.01  ? 13  GLY D CA  1 
ATOM   8043  C  C   . GLY D  1 13  ? 6.019   68.878  31.497  1.00 68.31  ? 13  GLY D C   1 
ATOM   8044  O  O   . GLY D  1 13  ? 6.914   68.089  31.180  1.00 66.92  ? 13  GLY D O   1 
ATOM   8045  N  N   . TRP D  1 14  ? 5.451   69.722  30.643  1.00 65.89  ? 14  TRP D N   1 
ATOM   8046  C  CA  . TRP D  1 14  ? 5.890   69.853  29.260  1.00 64.90  ? 14  TRP D CA  1 
ATOM   8047  C  C   . TRP D  1 14  ? 7.293   70.440  29.199  1.00 66.66  ? 14  TRP D C   1 
ATOM   8048  O  O   . TRP D  1 14  ? 7.616   71.374  29.932  1.00 72.21  ? 14  TRP D O   1 
ATOM   8049  C  CB  . TRP D  1 14  ? 4.911   70.741  28.477  1.00 60.01  ? 14  TRP D CB  1 
ATOM   8050  C  CG  . TRP D  1 14  ? 3.555   70.109  28.303  1.00 62.24  ? 14  TRP D CG  1 
ATOM   8051  C  CD1 . TRP D  1 14  ? 2.420   70.380  29.017  1.00 62.85  ? 14  TRP D CD1 1 
ATOM   8052  C  CD2 . TRP D  1 14  ? 3.203   69.080  27.365  1.00 54.64  ? 14  TRP D CD2 1 
ATOM   8053  N  NE1 . TRP D  1 14  ? 1.380   69.591  28.569  1.00 65.06  ? 14  TRP D NE1 1 
ATOM   8054  C  CE2 . TRP D  1 14  ? 1.838   68.782  27.562  1.00 55.42  ? 14  TRP D CE2 1 
ATOM   8055  C  CE3 . TRP D  1 14  ? 3.905   68.398  26.368  1.00 50.55  ? 14  TRP D CE3 1 
ATOM   8056  C  CZ2 . TRP D  1 14  ? 1.165   67.829  26.800  1.00 54.93  ? 14  TRP D CZ2 1 
ATOM   8057  C  CZ3 . TRP D  1 14  ? 3.239   67.440  25.621  1.00 55.92  ? 14  TRP D CZ3 1 
ATOM   8058  C  CH2 . TRP D  1 14  ? 1.882   67.168  25.837  1.00 55.85  ? 14  TRP D CH2 1 
ATOM   8059  N  N   . ILE D  1 15  ? 8.129   69.889  28.331  1.00 55.89  ? 15  ILE D N   1 
ATOM   8060  C  CA  . ILE D  1 15  ? 9.467   70.422  28.144  1.00 56.92  ? 15  ILE D CA  1 
ATOM   8061  C  C   . ILE D  1 15  ? 9.805   70.494  26.673  1.00 59.90  ? 15  ILE D C   1 
ATOM   8062  O  O   . ILE D  1 15  ? 9.146   69.865  25.842  1.00 59.51  ? 15  ILE D O   1 
ATOM   8063  C  CB  . ILE D  1 15  ? 10.547  69.570  28.844  1.00 62.78  ? 15  ILE D CB  1 
ATOM   8064  C  CG1 . ILE D  1 15  ? 10.626  68.176  28.220  1.00 58.49  ? 15  ILE D CG1 1 
ATOM   8065  C  CG2 . ILE D  1 15  ? 10.272  69.473  30.330  1.00 71.81  ? 15  ILE D CG2 1 
ATOM   8066  C  CD1 . ILE D  1 15  ? 11.808  67.367  28.685  1.00 55.65  ? 15  ILE D CD1 1 
ATOM   8067  N  N   . GLU D  1 16  ? 10.836  71.273  26.359  1.00 61.46  ? 16  GLU D N   1 
ATOM   8068  C  CA  . GLU D  1 16  ? 11.372  71.335  25.011  1.00 60.09  ? 16  GLU D CA  1 
ATOM   8069  C  C   . GLU D  1 16  ? 12.600  70.443  24.915  1.00 60.49  ? 16  GLU D C   1 
ATOM   8070  O  O   . GLU D  1 16  ? 13.589  70.658  25.606  1.00 62.55  ? 16  GLU D O   1 
ATOM   8071  C  CB  . GLU D  1 16  ? 11.748  72.766  24.637  1.00 63.73  ? 16  GLU D CB  1 
ATOM   8072  C  CG  . GLU D  1 16  ? 12.293  72.909  23.224  1.00 63.27  ? 16  GLU D CG  1 
ATOM   8073  C  CD  . GLU D  1 16  ? 11.198  72.935  22.176  1.00 61.38  ? 16  GLU D CD  1 
ATOM   8074  O  OE1 . GLU D  1 16  ? 10.013  73.018  22.559  1.00 67.05  ? 16  GLU D OE1 1 
ATOM   8075  O  OE2 . GLU D  1 16  ? 11.523  72.892  20.970  1.00 55.73  ? 16  GLU D OE2 1 
ATOM   8076  N  N   . LYS D  1 17  ? 12.526  69.425  24.070  1.00 59.40  ? 17  LYS D N   1 
ATOM   8077  C  CA  . LYS D  1 17  ? 13.691  68.604  23.796  1.00 62.12  ? 17  LYS D CA  1 
ATOM   8078  C  C   . LYS D  1 17  ? 14.066  68.703  22.326  1.00 57.25  ? 17  LYS D C   1 
ATOM   8079  O  O   . LYS D  1 17  ? 13.240  69.056  21.478  1.00 52.98  ? 17  LYS D O   1 
ATOM   8080  C  CB  . LYS D  1 17  ? 13.435  67.144  24.168  1.00 62.87  ? 17  LYS D CB  1 
ATOM   8081  C  CG  . LYS D  1 17  ? 13.958  66.743  25.535  1.00 66.64  ? 17  LYS D CG  1 
ATOM   8082  C  CD  . LYS D  1 17  ? 14.521  65.341  25.460  1.00 67.67  ? 17  LYS D CD  1 
ATOM   8083  C  CE  . LYS D  1 17  ? 15.593  65.096  26.510  1.00 72.50  ? 17  LYS D CE  1 
ATOM   8084  N  NZ  . LYS D  1 17  ? 15.023  64.603  27.784  1.00 75.50  ? 17  LYS D NZ  1 
ATOM   8085  N  N   . GLU D  1 18  ? 15.322  68.397  22.035  1.00 51.79  ? 18  GLU D N   1 
ATOM   8086  C  CA  . GLU D  1 18  ? 15.775  68.299  20.667  1.00 52.44  ? 18  GLU D CA  1 
ATOM   8087  C  C   . GLU D  1 18  ? 15.099  67.086  20.002  1.00 56.83  ? 18  GLU D C   1 
ATOM   8088  O  O   . GLU D  1 18  ? 14.983  66.020  20.609  1.00 54.52  ? 18  GLU D O   1 
ATOM   8089  C  CB  . GLU D  1 18  ? 17.288  68.138  20.656  1.00 61.17  ? 18  GLU D CB  1 
ATOM   8090  C  CG  . GLU D  1 18  ? 17.868  67.893  19.293  1.00 73.49  ? 18  GLU D CG  1 
ATOM   8091  C  CD  . GLU D  1 18  ? 19.377  67.861  19.310  1.00 84.16  ? 18  GLU D CD  1 
ATOM   8092  O  OE1 . GLU D  1 18  ? 19.968  68.114  20.384  1.00 86.53  ? 18  GLU D OE1 1 
ATOM   8093  O  OE2 . GLU D  1 18  ? 19.969  67.583  18.247  1.00 88.18  ? 18  GLU D OE2 1 
ATOM   8094  N  N   . LYS D  1 19  ? 14.642  67.254  18.767  1.00 52.68  ? 19  LYS D N   1 
ATOM   8095  C  CA  . LYS D  1 19  ? 14.043  66.151  18.021  1.00 53.95  ? 19  LYS D CA  1 
ATOM   8096  C  C   . LYS D  1 19  ? 15.088  65.067  17.757  1.00 51.48  ? 19  LYS D C   1 
ATOM   8097  O  O   . LYS D  1 19  ? 16.145  65.334  17.196  1.00 56.46  ? 19  LYS D O   1 
ATOM   8098  C  CB  . LYS D  1 19  ? 13.445  66.664  16.711  1.00 57.87  ? 19  LYS D CB  1 
ATOM   8099  C  CG  . LYS D  1 19  ? 12.678  65.628  15.881  1.00 57.89  ? 19  LYS D CG  1 
ATOM   8100  C  CD  . LYS D  1 19  ? 11.917  66.328  14.776  1.00 57.41  ? 19  LYS D CD  1 
ATOM   8101  C  CE  . LYS D  1 19  ? 11.409  65.373  13.723  1.00 66.82  ? 19  LYS D CE  1 
ATOM   8102  N  NZ  . LYS D  1 19  ? 10.581  66.112  12.733  1.00 63.52  ? 19  LYS D NZ  1 
ATOM   8103  N  N   . PRO D  1 20  ? 14.802  63.833  18.184  1.00 51.66  ? 20  PRO D N   1 
ATOM   8104  C  CA  . PRO D  1 20  ? 15.778  62.751  18.011  1.00 49.23  ? 20  PRO D CA  1 
ATOM   8105  C  C   . PRO D  1 20  ? 16.008  62.419  16.536  1.00 43.38  ? 20  PRO D C   1 
ATOM   8106  O  O   . PRO D  1 20  ? 15.078  62.495  15.739  1.00 47.36  ? 20  PRO D O   1 
ATOM   8107  C  CB  . PRO D  1 20  ? 15.117  61.574  18.736  1.00 53.19  ? 20  PRO D CB  1 
ATOM   8108  C  CG  . PRO D  1 20  ? 13.639  61.897  18.663  1.00 53.14  ? 20  PRO D CG  1 
ATOM   8109  C  CD  . PRO D  1 20  ? 13.614  63.380  18.921  1.00 52.27  ? 20  PRO D CD  1 
ATOM   8110  N  N   . ALA D  1 21  ? 17.248  62.083  16.193  1.00 47.94  ? 21  ALA D N   1 
ATOM   8111  C  CA  . ALA D  1 21  ? 17.607  61.615  14.861  1.00 48.12  ? 21  ALA D CA  1 
ATOM   8112  C  C   . ALA D  1 21  ? 17.913  60.118  14.946  1.00 53.06  ? 21  ALA D C   1 
ATOM   8113  O  O   . ALA D  1 21  ? 18.298  59.618  16.002  1.00 49.96  ? 21  ALA D O   1 
ATOM   8114  C  CB  . ALA D  1 21  ? 18.820  62.360  14.353  1.00 44.06  ? 21  ALA D CB  1 
ATOM   8115  N  N   . PRO D  1 22  ? 17.757  59.402  13.828  1.00 52.13  ? 22  PRO D N   1 
ATOM   8116  C  CA  . PRO D  1 22  ? 17.940  57.953  13.829  1.00 46.34  ? 22  PRO D CA  1 
ATOM   8117  C  C   . PRO D  1 22  ? 19.349  57.517  13.426  1.00 50.23  ? 22  PRO D C   1 
ATOM   8118  O  O   . PRO D  1 22  ? 19.944  58.098  12.521  1.00 45.42  ? 22  PRO D O   1 
ATOM   8119  C  CB  . PRO D  1 22  ? 16.945  57.482  12.758  1.00 44.90  ? 22  PRO D CB  1 
ATOM   8120  C  CG  . PRO D  1 22  ? 16.399  58.769  12.082  1.00 51.90  ? 22  PRO D CG  1 
ATOM   8121  C  CD  . PRO D  1 22  ? 17.254  59.889  12.531  1.00 51.38  ? 22  PRO D CD  1 
ATOM   8122  N  N   . GLY D  1 23  ? 19.872  56.489  14.087  1.00 44.67  ? 23  GLY D N   1 
ATOM   8123  C  CA  . GLY D  1 23  ? 21.034  55.787  13.571  1.00 41.85  ? 23  GLY D CA  1 
ATOM   8124  C  C   . GLY D  1 23  ? 20.569  54.989  12.367  1.00 44.48  ? 23  GLY D C   1 
ATOM   8125  O  O   . GLY D  1 23  ? 19.376  54.941  12.090  1.00 43.52  ? 23  GLY D O   1 
ATOM   8126  N  N   . PRO D  1 24  ? 21.503  54.349  11.653  1.00 49.67  ? 24  PRO D N   1 
ATOM   8127  C  CA  . PRO D  1 24  ? 21.187  53.652  10.397  1.00 48.52  ? 24  PRO D CA  1 
ATOM   8128  C  C   . PRO D  1 24  ? 20.076  52.592  10.522  1.00 46.21  ? 24  PRO D C   1 
ATOM   8129  O  O   . PRO D  1 24  ? 19.468  52.240  9.510   1.00 40.24  ? 24  PRO D O   1 
ATOM   8130  C  CB  . PRO D  1 24  ? 22.519  52.979  10.021  1.00 50.36  ? 24  PRO D CB  1 
ATOM   8131  C  CG  . PRO D  1 24  ? 23.570  53.730  10.775  1.00 52.40  ? 24  PRO D CG  1 
ATOM   8132  C  CD  . PRO D  1 24  ? 22.913  54.180  12.049  1.00 50.87  ? 24  PRO D CD  1 
ATOM   8133  N  N   . PHE D  1 25  ? 19.821  52.102  11.734  1.00 43.49  ? 25  PHE D N   1 
ATOM   8134  C  CA  . PHE D  1 25  ? 18.896  50.986  11.944  1.00 38.47  ? 25  PHE D CA  1 
ATOM   8135  C  C   . PHE D  1 25  ? 17.609  51.453  12.609  1.00 42.68  ? 25  PHE D C   1 
ATOM   8136  O  O   . PHE D  1 25  ? 16.670  50.675  12.778  1.00 48.70  ? 25  PHE D O   1 
ATOM   8137  C  CB  . PHE D  1 25  ? 19.546  49.880  12.792  1.00 36.50  ? 25  PHE D CB  1 
ATOM   8138  C  CG  . PHE D  1 25  ? 20.693  49.180  12.105  1.00 36.37  ? 25  PHE D CG  1 
ATOM   8139  C  CD1 . PHE D  1 25  ? 20.459  48.140  11.221  1.00 33.35  ? 25  PHE D CD1 1 
ATOM   8140  C  CD2 . PHE D  1 25  ? 22.010  49.560  12.359  1.00 41.71  ? 25  PHE D CD2 1 
ATOM   8141  C  CE1 . PHE D  1 25  ? 21.509  47.514  10.578  1.00 38.79  ? 25  PHE D CE1 1 
ATOM   8142  C  CE2 . PHE D  1 25  ? 23.066  48.933  11.728  1.00 39.33  ? 25  PHE D CE2 1 
ATOM   8143  C  CZ  . PHE D  1 25  ? 22.816  47.905  10.836  1.00 41.90  ? 25  PHE D CZ  1 
ATOM   8144  N  N   . ASP D  1 26  ? 17.550  52.733  12.954  1.00 41.42  ? 26  ASP D N   1 
ATOM   8145  C  CA  . ASP D  1 26  ? 16.409  53.251  13.708  1.00 43.90  ? 26  ASP D CA  1 
ATOM   8146  C  C   . ASP D  1 26  ? 15.358  53.952  12.841  1.00 41.99  ? 26  ASP D C   1 
ATOM   8147  O  O   . ASP D  1 26  ? 15.606  54.261  11.670  1.00 42.39  ? 26  ASP D O   1 
ATOM   8148  C  CB  . ASP D  1 26  ? 16.899  54.215  14.791  1.00 47.76  ? 26  ASP D CB  1 
ATOM   8149  C  CG  . ASP D  1 26  ? 17.990  53.616  15.652  1.00 49.72  ? 26  ASP D CG  1 
ATOM   8150  O  OD1 . ASP D  1 26  ? 17.929  52.397  15.947  1.00 43.79  ? 26  ASP D OD1 1 
ATOM   8151  O  OD2 . ASP D  1 26  ? 18.901  54.380  16.037  1.00 55.32  ? 26  ASP D OD2 1 
ATOM   8152  N  N   . ALA D  1 27  ? 14.189  54.201  13.436  1.00 36.04  ? 27  ALA D N   1 
ATOM   8153  C  CA  . ALA D  1 27  ? 13.164  55.064  12.829  1.00 37.20  ? 27  ALA D CA  1 
ATOM   8154  C  C   . ALA D  1 27  ? 12.732  56.155  13.806  1.00 43.01  ? 27  ALA D C   1 
ATOM   8155  O  O   . ALA D  1 27  ? 12.761  55.962  15.024  1.00 45.16  ? 27  ALA D O   1 
ATOM   8156  C  CB  . ALA D  1 27  ? 11.947  54.243  12.384  1.00 37.76  ? 27  ALA D CB  1 
ATOM   8157  N  N   . ILE D  1 28  ? 12.361  57.311  13.268  1.00 42.82  ? 28  ILE D N   1 
ATOM   8158  C  CA  . ILE D  1 28  ? 11.717  58.349  14.049  1.00 40.24  ? 28  ILE D CA  1 
ATOM   8159  C  C   . ILE D  1 28  ? 10.228  58.260  13.756  1.00 45.53  ? 28  ILE D C   1 
ATOM   8160  O  O   . ILE D  1 28  ? 9.812   58.182  12.598  1.00 42.86  ? 28  ILE D O   1 
ATOM   8161  C  CB  . ILE D  1 28  ? 12.213  59.751  13.659  1.00 44.83  ? 28  ILE D CB  1 
ATOM   8162  C  CG1 . ILE D  1 28  ? 13.714  59.873  13.907  1.00 49.56  ? 28  ILE D CG1 1 
ATOM   8163  C  CG2 . ILE D  1 28  ? 11.481  60.795  14.450  1.00 36.33  ? 28  ILE D CG2 1 
ATOM   8164  C  CD1 . ILE D  1 28  ? 14.115  59.440  15.275  1.00 47.88  ? 28  ILE D CD1 1 
ATOM   8165  N  N   . VAL D  1 29  ? 9.425   58.282  14.811  1.00 49.72  ? 29  VAL D N   1 
ATOM   8166  C  CA  . VAL D  1 29  ? 8.004   58.038  14.691  1.00 43.84  ? 29  VAL D CA  1 
ATOM   8167  C  C   . VAL D  1 29  ? 7.197   59.147  15.341  1.00 50.36  ? 29  VAL D C   1 
ATOM   8168  O  O   . VAL D  1 29  ? 7.538   59.612  16.425  1.00 52.79  ? 29  VAL D O   1 
ATOM   8169  C  CB  . VAL D  1 29  ? 7.634   56.697  15.365  1.00 47.42  ? 29  VAL D CB  1 
ATOM   8170  C  CG1 . VAL D  1 29  ? 6.163   56.354  15.123  1.00 49.27  ? 29  VAL D CG1 1 
ATOM   8171  C  CG2 . VAL D  1 29  ? 8.537   55.584  14.851  1.00 40.67  ? 29  VAL D CG2 1 
ATOM   8172  N  N   . ARG D  1 30  ? 6.124   59.574  14.685  1.00 46.92  ? 30  ARG D N   1 
ATOM   8173  C  CA  . ARG D  1 30  ? 5.208   60.514  15.318  1.00 48.52  ? 30  ARG D CA  1 
ATOM   8174  C  C   . ARG D  1 30  ? 3.952   59.771  15.752  1.00 44.62  ? 30  ARG D C   1 
ATOM   8175  O  O   . ARG D  1 30  ? 3.392   58.997  14.985  1.00 50.00  ? 30  ARG D O   1 
ATOM   8176  C  CB  . ARG D  1 30  ? 4.876   61.702  14.399  1.00 52.87  ? 30  ARG D CB  1 
ATOM   8177  C  CG  . ARG D  1 30  ? 3.543   61.637  13.683  1.00 56.73  ? 30  ARG D CG  1 
ATOM   8178  C  CD  . ARG D  1 30  ? 3.110   63.011  13.088  1.00 60.05  ? 30  ARG D CD  1 
ATOM   8179  N  NE  . ARG D  1 30  ? 3.969   63.468  11.988  1.00 63.60  ? 30  ARG D NE  1 
ATOM   8180  C  CZ  . ARG D  1 30  ? 4.579   64.657  11.941  1.00 70.48  ? 30  ARG D CZ  1 
ATOM   8181  N  NH1 . ARG D  1 30  ? 4.413   65.540  12.922  1.00 71.40  ? 30  ARG D NH1 1 
ATOM   8182  N  NH2 . ARG D  1 30  ? 5.348   64.975  10.902  1.00 66.84  ? 30  ARG D NH2 1 
ATOM   8183  N  N   . PRO D  1 31  ? 3.508   60.002  16.995  1.00 46.17  ? 31  PRO D N   1 
ATOM   8184  C  CA  . PRO D  1 31  ? 2.373   59.241  17.527  1.00 41.43  ? 31  PRO D CA  1 
ATOM   8185  C  C   . PRO D  1 31  ? 1.045   59.699  16.941  1.00 47.48  ? 31  PRO D C   1 
ATOM   8186  O  O   . PRO D  1 31  ? 0.862   60.893  16.737  1.00 45.16  ? 31  PRO D O   1 
ATOM   8187  C  CB  . PRO D  1 31  ? 2.400   59.544  19.029  1.00 41.97  ? 31  PRO D CB  1 
ATOM   8188  C  CG  . PRO D  1 31  ? 3.433   60.642  19.224  1.00 47.35  ? 31  PRO D CG  1 
ATOM   8189  C  CD  . PRO D  1 31  ? 3.952   61.078  17.904  1.00 41.88  ? 31  PRO D CD  1 
ATOM   8190  N  N   . LEU D  1 32  ? 0.139   58.759  16.683  1.00 43.39  ? 32  LEU D N   1 
ATOM   8191  C  CA  . LEU D  1 32  ? -1.216  59.087  16.256  1.00 44.34  ? 32  LEU D CA  1 
ATOM   8192  C  C   . LEU D  1 32  ? -2.196  58.834  17.386  1.00 50.34  ? 32  LEU D C   1 
ATOM   8193  O  O   . LEU D  1 32  ? -3.254  59.464  17.457  1.00 55.36  ? 32  LEU D O   1 
ATOM   8194  C  CB  . LEU D  1 32  ? -1.615  58.256  15.051  1.00 41.78  ? 32  LEU D CB  1 
ATOM   8195  C  CG  . LEU D  1 32  ? -0.723  58.456  13.833  1.00 49.58  ? 32  LEU D CG  1 
ATOM   8196  C  CD1 . LEU D  1 32  ? -1.168  57.505  12.741  1.00 47.30  ? 32  LEU D CD1 1 
ATOM   8197  C  CD2 . LEU D  1 32  ? -0.775  59.922  13.358  1.00 50.17  ? 32  LEU D CD2 1 
ATOM   8198  N  N   . ALA D  1 33  ? -1.841  57.897  18.259  1.00 48.21  ? 33  ALA D N   1 
ATOM   8199  C  CA  . ALA D  1 33  ? -2.594  57.657  19.482  1.00 46.15  ? 33  ALA D CA  1 
ATOM   8200  C  C   . ALA D  1 33  ? -1.678  57.124  20.596  1.00 44.49  ? 33  ALA D C   1 
ATOM   8201  O  O   . ALA D  1 33  ? -0.734  56.379  20.337  1.00 39.69  ? 33  ALA D O   1 
ATOM   8202  C  CB  . ALA D  1 33  ? -3.771  56.704  19.216  1.00 36.47  ? 33  ALA D CB  1 
ATOM   8203  N  N   . VAL D  1 34  ? -1.957  57.537  21.829  1.00 41.63  ? 34  VAL D N   1 
ATOM   8204  C  CA  . VAL D  1 34  ? -1.172  57.130  22.976  1.00 36.72  ? 34  VAL D CA  1 
ATOM   8205  C  C   . VAL D  1 34  ? -2.089  56.875  24.158  1.00 43.36  ? 34  VAL D C   1 
ATOM   8206  O  O   . VAL D  1 34  ? -3.253  57.266  24.146  1.00 38.15  ? 34  VAL D O   1 
ATOM   8207  C  CB  . VAL D  1 34  ? -0.101  58.186  23.363  1.00 34.94  ? 34  VAL D CB  1 
ATOM   8208  C  CG1 . VAL D  1 34  ? 0.804   58.485  22.181  1.00 38.55  ? 34  VAL D CG1 1 
ATOM   8209  C  CG2 . VAL D  1 34  ? -0.749  59.494  23.879  1.00 33.93  ? 34  VAL D CG2 1 
ATOM   8210  N  N   . ALA D  1 35  ? -1.555  56.185  25.159  1.00 46.83  ? 35  ALA D N   1 
ATOM   8211  C  CA  . ALA D  1 35  ? -2.247  55.946  26.419  1.00 48.52  ? 35  ALA D CA  1 
ATOM   8212  C  C   . ALA D  1 35  ? -1.225  55.978  27.548  1.00 47.08  ? 35  ALA D C   1 
ATOM   8213  O  O   . ALA D  1 35  ? -0.058  55.664  27.328  1.00 45.73  ? 35  ALA D O   1 
ATOM   8214  C  CB  . ALA D  1 35  ? -2.945  54.607  26.395  1.00 40.18  ? 35  ALA D CB  1 
ATOM   8215  N  N   . PRO D  1 36  ? -1.658  56.361  28.759  1.00 47.46  ? 36  PRO D N   1 
ATOM   8216  C  CA  . PRO D  1 36  ? -0.768  56.376  29.923  1.00 49.04  ? 36  PRO D CA  1 
ATOM   8217  C  C   . PRO D  1 36  ? -0.821  55.027  30.628  1.00 47.39  ? 36  PRO D C   1 
ATOM   8218  O  O   . PRO D  1 36  ? -1.853  54.354  30.552  1.00 42.23  ? 36  PRO D O   1 
ATOM   8219  C  CB  . PRO D  1 36  ? -1.404  57.429  30.828  1.00 42.00  ? 36  PRO D CB  1 
ATOM   8220  C  CG  . PRO D  1 36  ? -2.829  57.635  30.282  1.00 45.75  ? 36  PRO D CG  1 
ATOM   8221  C  CD  . PRO D  1 36  ? -3.033  56.718  29.132  1.00 41.42  ? 36  PRO D CD  1 
ATOM   8222  N  N   . CYS D  1 37  ? 0.260   54.636  31.297  1.00 50.53  ? 37  CYS D N   1 
ATOM   8223  C  CA  . CYS D  1 37  ? 0.292   53.372  32.037  1.00 45.39  ? 37  CYS D CA  1 
ATOM   8224  C  C   . CYS D  1 37  ? 0.517   53.597  33.539  1.00 45.20  ? 37  CYS D C   1 
ATOM   8225  O  O   . CYS D  1 37  ? 1.218   54.519  33.950  1.00 37.49  ? 37  CYS D O   1 
ATOM   8226  C  CB  . CYS D  1 37  ? 1.346   52.418  31.465  1.00 47.04  ? 37  CYS D CB  1 
ATOM   8227  S  SG  . CYS D  1 37  ? 1.562   50.838  32.411  1.00 46.85  ? 37  CYS D SG  1 
ATOM   8228  N  N   . THR D  1 38  ? -0.108  52.755  34.351  1.00 54.79  ? 38  THR D N   1 
ATOM   8229  C  CA  . THR D  1 38  ? -0.017  52.871  35.803  1.00 57.67  ? 38  THR D CA  1 
ATOM   8230  C  C   . THR D  1 38  ? 1.435   52.882  36.276  1.00 57.60  ? 38  THR D C   1 
ATOM   8231  O  O   . THR D  1 38  ? 1.761   53.503  37.282  1.00 64.64  ? 38  THR D O   1 
ATOM   8232  C  CB  . THR D  1 38  ? -0.765  51.716  36.483  1.00 57.68  ? 38  THR D CB  1 
ATOM   8233  O  OG1 . THR D  1 38  ? -0.357  50.476  35.890  1.00 67.23  ? 38  THR D OG1 1 
ATOM   8234  C  CG2 . THR D  1 38  ? -2.260  51.864  36.290  1.00 53.40  ? 38  THR D CG2 1 
ATOM   8235  N  N   . SER D  1 39  ? 2.303   52.205  35.530  1.00 50.69  ? 39  SER D N   1 
ATOM   8236  C  CA  . SER D  1 39  ? 3.711   52.088  35.888  1.00 49.19  ? 39  SER D CA  1 
ATOM   8237  C  C   . SER D  1 39  ? 4.424   53.428  35.841  1.00 52.12  ? 39  SER D C   1 
ATOM   8238  O  O   . SER D  1 39  ? 5.415   53.625  36.526  1.00 47.08  ? 39  SER D O   1 
ATOM   8239  C  CB  . SER D  1 39  ? 4.419   51.110  34.948  1.00 49.49  ? 39  SER D CB  1 
ATOM   8240  O  OG  . SER D  1 39  ? 4.453   51.613  33.621  1.00 46.15  ? 39  SER D OG  1 
ATOM   8241  N  N   . ASP D  1 40  ? 3.934   54.352  35.022  1.00 53.22  ? 40  ASP D N   1 
ATOM   8242  C  CA  . ASP D  1 40  ? 4.554   55.668  34.977  1.00 54.28  ? 40  ASP D CA  1 
ATOM   8243  C  C   . ASP D  1 40  ? 4.152   56.475  36.198  1.00 59.08  ? 40  ASP D C   1 
ATOM   8244  O  O   . ASP D  1 40  ? 4.864   57.393  36.613  1.00 63.77  ? 40  ASP D O   1 
ATOM   8245  C  CB  . ASP D  1 40  ? 4.204   56.410  33.689  1.00 49.63  ? 40  ASP D CB  1 
ATOM   8246  C  CG  . ASP D  1 40  ? 5.191   56.131  32.572  1.00 49.49  ? 40  ASP D CG  1 
ATOM   8247  O  OD1 . ASP D  1 40  ? 6.159   55.369  32.801  1.00 49.04  ? 40  ASP D OD1 1 
ATOM   8248  O  OD2 . ASP D  1 40  ? 4.998   56.673  31.461  1.00 47.32  ? 40  ASP D OD2 1 
ATOM   8249  N  N   . ILE D  1 41  ? 3.004   56.136  36.773  1.00 57.75  ? 41  ILE D N   1 
ATOM   8250  C  CA  . ILE D  1 41  ? 2.605   56.751  38.028  1.00 61.47  ? 41  ILE D CA  1 
ATOM   8251  C  C   . ILE D  1 41  ? 3.580   56.307  39.123  1.00 65.33  ? 41  ILE D C   1 
ATOM   8252  O  O   . ILE D  1 41  ? 4.054   57.118  39.925  1.00 62.51  ? 41  ILE D O   1 
ATOM   8253  C  CB  . ILE D  1 41  ? 1.161   56.396  38.395  1.00 56.17  ? 41  ILE D CB  1 
ATOM   8254  C  CG1 . ILE D  1 41  ? 0.199   57.062  37.412  1.00 54.45  ? 41  ILE D CG1 1 
ATOM   8255  C  CG2 . ILE D  1 41  ? 0.843   56.829  39.814  1.00 52.89  ? 41  ILE D CG2 1 
ATOM   8256  C  CD1 . ILE D  1 41  ? 0.480   58.524  37.183  1.00 55.74  ? 41  ILE D CD1 1 
ATOM   8257  N  N   . HIS D  1 42  ? 3.905   55.020  39.132  1.00 67.48  ? 42  HIS D N   1 
ATOM   8258  C  CA  . HIS D  1 42  ? 4.891   54.522  40.074  1.00 72.96  ? 42  HIS D CA  1 
ATOM   8259  C  C   . HIS D  1 42  ? 6.183   55.328  40.002  1.00 71.28  ? 42  HIS D C   1 
ATOM   8260  O  O   . HIS D  1 42  ? 6.606   55.917  40.995  1.00 72.67  ? 42  HIS D O   1 
ATOM   8261  C  CB  . HIS D  1 42  ? 5.187   53.043  39.838  1.00 78.06  ? 42  HIS D CB  1 
ATOM   8262  C  CG  . HIS D  1 42  ? 4.031   52.142  40.138  1.00 86.51  ? 42  HIS D CG  1 
ATOM   8263  N  ND1 . HIS D  1 42  ? 3.159   52.374  41.179  1.00 87.52  ? 42  HIS D ND1 1 
ATOM   8264  C  CD2 . HIS D  1 42  ? 3.615   50.997  39.545  1.00 87.99  ? 42  HIS D CD2 1 
ATOM   8265  C  CE1 . HIS D  1 42  ? 2.247   51.419  41.206  1.00 89.07  ? 42  HIS D CE1 1 
ATOM   8266  N  NE2 . HIS D  1 42  ? 2.502   50.571  40.226  1.00 88.95  ? 42  HIS D NE2 1 
ATOM   8267  N  N   . THR D  1 43  ? 6.809   55.363  38.831  1.00 61.93  ? 43  THR D N   1 
ATOM   8268  C  CA  . THR D  1 43  ? 8.132   55.963  38.748  1.00 60.28  ? 43  THR D CA  1 
ATOM   8269  C  C   . THR D  1 43  ? 8.100   57.456  39.065  1.00 61.51  ? 43  THR D C   1 
ATOM   8270  O  O   . THR D  1 43  ? 8.955   57.968  39.786  1.00 64.74  ? 43  THR D O   1 
ATOM   8271  C  CB  . THR D  1 43  ? 8.791   55.750  37.379  1.00 51.97  ? 43  THR D CB  1 
ATOM   8272  O  OG1 . THR D  1 43  ? 8.548   56.895  36.551  1.00 65.03  ? 43  THR D OG1 1 
ATOM   8273  C  CG2 . THR D  1 43  ? 8.259   54.512  36.725  1.00 43.04  ? 43  THR D CG2 1 
ATOM   8274  N  N   . VAL D  1 44  ? 7.116   58.160  38.534  1.00 58.49  ? 44  VAL D N   1 
ATOM   8275  C  CA  . VAL D  1 44  ? 7.091   59.599  38.724  1.00 63.58  ? 44  VAL D CA  1 
ATOM   8276  C  C   . VAL D  1 44  ? 6.880   59.958  40.184  1.00 69.65  ? 44  VAL D C   1 
ATOM   8277  O  O   . VAL D  1 44  ? 7.467   60.912  40.673  1.00 73.02  ? 44  VAL D O   1 
ATOM   8278  C  CB  . VAL D  1 44  ? 6.023   60.296  37.853  1.00 62.16  ? 44  VAL D CB  1 
ATOM   8279  C  CG1 . VAL D  1 44  ? 5.815   61.743  38.311  1.00 57.90  ? 44  VAL D CG1 1 
ATOM   8280  C  CG2 . VAL D  1 44  ? 6.427   60.258  36.396  1.00 63.17  ? 44  VAL D CG2 1 
ATOM   8281  N  N   . PHE D  1 45  ? 6.059   59.187  40.889  1.00 70.81  ? 45  PHE D N   1 
ATOM   8282  C  CA  . PHE D  1 45  ? 5.632   59.613  42.217  1.00 67.11  ? 45  PHE D CA  1 
ATOM   8283  C  C   . PHE D  1 45  ? 6.151   58.761  43.368  1.00 69.64  ? 45  PHE D C   1 
ATOM   8284  O  O   . PHE D  1 45  ? 6.233   59.237  44.497  1.00 73.71  ? 45  PHE D O   1 
ATOM   8285  C  CB  . PHE D  1 45  ? 4.112   59.736  42.277  1.00 58.83  ? 45  PHE D CB  1 
ATOM   8286  C  CG  . PHE D  1 45  ? 3.552   60.749  41.316  1.00 65.21  ? 45  PHE D CG  1 
ATOM   8287  C  CD1 . PHE D  1 45  ? 3.576   62.102  41.622  1.00 69.20  ? 45  PHE D CD1 1 
ATOM   8288  C  CD2 . PHE D  1 45  ? 3.005   60.350  40.107  1.00 64.14  ? 45  PHE D CD2 1 
ATOM   8289  C  CE1 . PHE D  1 45  ? 3.058   63.036  40.736  1.00 71.36  ? 45  PHE D CE1 1 
ATOM   8290  C  CE2 . PHE D  1 45  ? 2.489   61.276  39.220  1.00 66.41  ? 45  PHE D CE2 1 
ATOM   8291  C  CZ  . PHE D  1 45  ? 2.512   62.620  39.533  1.00 70.31  ? 45  PHE D CZ  1 
ATOM   8292  N  N   . GLU D  1 46  ? 6.496   57.511  43.085  1.00 69.35  ? 46  GLU D N   1 
ATOM   8293  C  CA  . GLU D  1 46  ? 7.071   56.629  44.099  1.00 68.57  ? 46  GLU D CA  1 
ATOM   8294  C  C   . GLU D  1 46  ? 8.528   56.328  43.795  1.00 71.11  ? 46  GLU D C   1 
ATOM   8295  O  O   . GLU D  1 46  ? 9.090   55.373  44.333  1.00 76.11  ? 46  GLU D O   1 
ATOM   8296  C  CB  . GLU D  1 46  ? 6.311   55.306  44.165  1.00 73.80  ? 46  GLU D CB  1 
ATOM   8297  C  CG  . GLU D  1 46  ? 4.953   55.380  44.822  1.00 83.31  ? 46  GLU D CG  1 
ATOM   8298  C  CD  . GLU D  1 46  ? 4.324   54.007  44.990  1.00 91.52  ? 46  GLU D CD  1 
ATOM   8299  O  OE1 . GLU D  1 46  ? 4.814   53.039  44.360  1.00 89.71  ? 46  GLU D OE1 1 
ATOM   8300  O  OE2 . GLU D  1 46  ? 3.342   53.899  45.754  1.00 96.93  ? 46  GLU D OE2 1 
ATOM   8301  N  N   . GLY D  1 47  ? 9.130   57.131  42.923  1.00 70.69  ? 47  GLY D N   1 
ATOM   8302  C  CA  . GLY D  1 47  ? 10.495  56.903  42.477  1.00 70.56  ? 47  GLY D CA  1 
ATOM   8303  C  C   . GLY D  1 47  ? 10.806  55.436  42.255  1.00 68.43  ? 47  GLY D C   1 
ATOM   8304  O  O   . GLY D  1 47  ? 11.901  54.974  42.566  1.00 71.07  ? 47  GLY D O   1 
ATOM   8305  N  N   . ALA D  1 48  ? 9.842   54.708  41.701  1.00 65.11  ? 48  ALA D N   1 
ATOM   8306  C  CA  . ALA D  1 48  ? 9.904   53.254  41.642  1.00 63.66  ? 48  ALA D CA  1 
ATOM   8307  C  C   . ALA D  1 48  ? 11.104  52.712  40.872  1.00 62.45  ? 48  ALA D C   1 
ATOM   8308  O  O   . ALA D  1 48  ? 11.416  51.524  40.957  1.00 59.09  ? 48  ALA D O   1 
ATOM   8309  C  CB  . ALA D  1 48  ? 8.608   52.695  41.066  1.00 66.54  ? 48  ALA D CB  1 
ATOM   8310  N  N   . ILE D  1 49  ? 11.769  53.577  40.112  1.00 64.66  ? 49  ILE D N   1 
ATOM   8311  C  CA  . ILE D  1 49  ? 12.897  53.145  39.289  1.00 67.02  ? 49  ILE D CA  1 
ATOM   8312  C  C   . ILE D  1 49  ? 14.090  54.069  39.474  1.00 64.10  ? 49  ILE D C   1 
ATOM   8313  O  O   . ILE D  1 49  ? 15.048  54.023  38.698  1.00 62.53  ? 49  ILE D O   1 
ATOM   8314  C  CB  . ILE D  1 49  ? 12.536  53.123  37.785  1.00 65.85  ? 49  ILE D CB  1 
ATOM   8315  C  CG1 . ILE D  1 49  ? 12.229  54.546  37.295  1.00 63.92  ? 49  ILE D CG1 1 
ATOM   8316  C  CG2 . ILE D  1 49  ? 11.371  52.183  37.526  1.00 57.14  ? 49  ILE D CG2 1 
ATOM   8317  C  CD1 . ILE D  1 49  ? 11.811  54.629  35.834  1.00 67.58  ? 49  ILE D CD1 1 
ATOM   8318  N  N   . GLY D  1 50  ? 14.018  54.911  40.500  1.00 66.25  ? 50  GLY D N   1 
ATOM   8319  C  CA  . GLY D  1 50  ? 15.072  55.861  40.788  1.00 65.37  ? 50  GLY D CA  1 
ATOM   8320  C  C   . GLY D  1 50  ? 14.797  57.222  40.188  1.00 71.08  ? 50  GLY D C   1 
ATOM   8321  O  O   . GLY D  1 50  ? 13.802  57.424  39.489  1.00 75.89  ? 50  GLY D O   1 
ATOM   8322  N  N   . GLU D  1 51  ? 15.691  58.163  40.459  1.00 71.07  ? 51  GLU D N   1 
ATOM   8323  C  CA  . GLU D  1 51  ? 15.531  59.528  39.979  1.00 75.08  ? 51  GLU D CA  1 
ATOM   8324  C  C   . GLU D  1 51  ? 15.642  59.602  38.457  1.00 71.27  ? 51  GLU D C   1 
ATOM   8325  O  O   . GLU D  1 51  ? 16.273  58.761  37.825  1.00 70.02  ? 51  GLU D O   1 
ATOM   8326  C  CB  . GLU D  1 51  ? 16.569  60.447  40.635  1.00 75.93  ? 51  GLU D CB  1 
ATOM   8327  C  CG  . GLU D  1 51  ? 16.511  61.894  40.172  1.00 83.84  ? 51  GLU D CG  1 
ATOM   8328  C  CD  . GLU D  1 51  ? 15.315  62.644  40.729  1.00 88.21  ? 51  GLU D CD  1 
ATOM   8329  O  OE1 . GLU D  1 51  ? 15.004  62.476  41.927  1.00 92.31  ? 51  GLU D OE1 1 
ATOM   8330  O  OE2 . GLU D  1 51  ? 14.691  63.411  39.971  1.00 88.47  ? 51  GLU D OE2 1 
ATOM   8331  N  N   . ARG D  1 52  ? 15.014  60.614  37.876  1.00 69.63  ? 52  ARG D N   1 
ATOM   8332  C  CA  . ARG D  1 52  ? 15.122  60.871  36.452  1.00 69.43  ? 52  ARG D CA  1 
ATOM   8333  C  C   . ARG D  1 52  ? 15.047  62.372  36.282  1.00 71.69  ? 52  ARG D C   1 
ATOM   8334  O  O   . ARG D  1 52  ? 14.414  63.058  37.079  1.00 76.58  ? 52  ARG D O   1 
ATOM   8335  C  CB  . ARG D  1 52  ? 13.968  60.210  35.687  1.00 66.80  ? 52  ARG D CB  1 
ATOM   8336  C  CG  . ARG D  1 52  ? 13.996  58.679  35.641  1.00 54.38  ? 52  ARG D CG  1 
ATOM   8337  C  CD  . ARG D  1 52  ? 15.195  58.191  34.859  1.00 52.69  ? 52  ARG D CD  1 
ATOM   8338  N  NE  . ARG D  1 52  ? 15.186  56.749  34.601  1.00 55.63  ? 52  ARG D NE  1 
ATOM   8339  C  CZ  . ARG D  1 52  ? 15.579  55.816  35.469  1.00 55.24  ? 52  ARG D CZ  1 
ATOM   8340  N  NH1 . ARG D  1 52  ? 15.990  56.162  36.683  1.00 67.31  ? 52  ARG D NH1 1 
ATOM   8341  N  NH2 . ARG D  1 52  ? 15.557  54.532  35.128  1.00 44.72  ? 52  ARG D NH2 1 
ATOM   8342  N  N   . HIS D  1 53  ? 15.693  62.896  35.251  1.00 70.99  ? 53  HIS D N   1 
ATOM   8343  C  CA  . HIS D  1 53  ? 15.568  64.311  34.969  1.00 75.21  ? 53  HIS D CA  1 
ATOM   8344  C  C   . HIS D  1 53  ? 15.143  64.516  33.528  1.00 67.29  ? 53  HIS D C   1 
ATOM   8345  O  O   . HIS D  1 53  ? 15.814  64.054  32.603  1.00 64.08  ? 53  HIS D O   1 
ATOM   8346  C  CB  . HIS D  1 53  ? 16.872  65.053  35.270  1.00 89.98  ? 53  HIS D CB  1 
ATOM   8347  C  CG  . HIS D  1 53  ? 17.281  64.988  36.708  1.00 103.20 ? 53  HIS D CG  1 
ATOM   8348  N  ND1 . HIS D  1 53  ? 16.676  65.745  37.688  1.00 109.31 ? 53  HIS D ND1 1 
ATOM   8349  C  CD2 . HIS D  1 53  ? 18.231  64.253  37.335  1.00 108.09 ? 53  HIS D CD2 1 
ATOM   8350  C  CE1 . HIS D  1 53  ? 17.236  65.481  38.855  1.00 111.63 ? 53  HIS D CE1 1 
ATOM   8351  N  NE2 . HIS D  1 53  ? 18.183  64.579  38.668  1.00 110.28 ? 53  HIS D NE2 1 
ATOM   8352  N  N   . ASN D  1 54  ? 14.013  65.195  33.357  1.00 60.64  ? 54  ASN D N   1 
ATOM   8353  C  CA  . ASN D  1 54  ? 13.497  65.536  32.041  1.00 61.85  ? 54  ASN D CA  1 
ATOM   8354  C  C   . ASN D  1 54  ? 13.353  64.338  31.098  1.00 56.19  ? 54  ASN D C   1 
ATOM   8355  O  O   . ASN D  1 54  ? 13.691  64.426  29.921  1.00 56.52  ? 54  ASN D O   1 
ATOM   8356  C  CB  . ASN D  1 54  ? 14.371  66.615  31.413  1.00 64.05  ? 54  ASN D CB  1 
ATOM   8357  C  CG  . ASN D  1 54  ? 14.530  67.818  32.314  1.00 67.88  ? 54  ASN D CG  1 
ATOM   8358  O  OD1 . ASN D  1 54  ? 13.543  68.401  32.763  1.00 67.51  ? 54  ASN D OD1 1 
ATOM   8359  N  ND2 . ASN D  1 54  ? 15.773  68.192  32.591  1.00 67.51  ? 54  ASN D ND2 1 
ATOM   8360  N  N   . MET D  1 55  ? 12.849  63.225  31.623  1.00 48.56  ? 55  MET D N   1 
ATOM   8361  C  CA  . MET D  1 55  ? 12.554  62.052  30.801  1.00 49.86  ? 55  MET D CA  1 
ATOM   8362  C  C   . MET D  1 55  ? 11.113  62.072  30.281  1.00 50.38  ? 55  MET D C   1 
ATOM   8363  O  O   . MET D  1 55  ? 10.150  62.036  31.056  1.00 51.41  ? 55  MET D O   1 
ATOM   8364  C  CB  . MET D  1 55  ? 12.800  60.767  31.588  1.00 51.50  ? 55  MET D CB  1 
ATOM   8365  C  CG  . MET D  1 55  ? 11.984  59.578  31.098  1.00 51.85  ? 55  MET D CG  1 
ATOM   8366  S  SD  . MET D  1 55  ? 12.195  58.138  32.145  1.00 48.97  ? 55  MET D SD  1 
ATOM   8367  C  CE  . MET D  1 55  ? 13.735  57.519  31.492  1.00 60.20  ? 55  MET D CE  1 
ATOM   8368  N  N   . ILE D  1 56  ? 10.970  62.145  28.964  1.00 47.53  ? 56  ILE D N   1 
ATOM   8369  C  CA  . ILE D  1 56  ? 9.657   62.056  28.345  1.00 46.40  ? 56  ILE D CA  1 
ATOM   8370  C  C   . ILE D  1 56  ? 8.970   60.727  28.713  1.00 48.07  ? 56  ILE D C   1 
ATOM   8371  O  O   . ILE D  1 56  ? 9.558   59.652  28.587  1.00 45.12  ? 56  ILE D O   1 
ATOM   8372  C  CB  . ILE D  1 56  ? 9.769   62.211  26.827  1.00 44.77  ? 56  ILE D CB  1 
ATOM   8373  C  CG1 . ILE D  1 56  ? 10.492  63.530  26.505  1.00 46.04  ? 56  ILE D CG1 1 
ATOM   8374  C  CG2 . ILE D  1 56  ? 8.383   62.157  26.173  1.00 38.86  ? 56  ILE D CG2 1 
ATOM   8375  C  CD1 . ILE D  1 56  ? 10.397  63.980  25.034  1.00 39.95  ? 56  ILE D CD1 1 
ATOM   8376  N  N   . LEU D  1 57  ? 7.732   60.821  29.188  1.00 50.69  ? 57  LEU D N   1 
ATOM   8377  C  CA  . LEU D  1 57  ? 6.978   59.673  29.682  1.00 50.16  ? 57  LEU D CA  1 
ATOM   8378  C  C   . LEU D  1 57  ? 6.219   58.937  28.578  1.00 51.69  ? 57  LEU D C   1 
ATOM   8379  O  O   . LEU D  1 57  ? 6.269   59.321  27.405  1.00 54.06  ? 57  LEU D O   1 
ATOM   8380  C  CB  . LEU D  1 57  ? 5.982   60.133  30.748  1.00 46.95  ? 57  LEU D CB  1 
ATOM   8381  C  CG  . LEU D  1 57  ? 6.647   60.600  32.036  1.00 47.85  ? 57  LEU D CG  1 
ATOM   8382  C  CD1 . LEU D  1 57  ? 5.682   61.362  32.943  1.00 41.31  ? 57  LEU D CD1 1 
ATOM   8383  C  CD2 . LEU D  1 57  ? 7.237   59.396  32.748  1.00 46.86  ? 57  LEU D CD2 1 
ATOM   8384  N  N   . GLY D  1 58  ? 5.511   57.882  28.971  1.00 44.25  ? 58  GLY D N   1 
ATOM   8385  C  CA  . GLY D  1 58  ? 4.670   57.121  28.057  1.00 47.61  ? 58  GLY D CA  1 
ATOM   8386  C  C   . GLY D  1 58  ? 5.388   56.075  27.217  1.00 46.08  ? 58  GLY D C   1 
ATOM   8387  O  O   . GLY D  1 58  ? 6.475   56.320  26.694  1.00 44.33  ? 58  GLY D O   1 
ATOM   8388  N  N   . HIS D  1 59  ? 4.784   54.895  27.084  1.00 40.89  ? 59  HIS D N   1 
ATOM   8389  C  CA  . HIS D  1 59  ? 5.365   53.864  26.231  1.00 37.32  ? 59  HIS D CA  1 
ATOM   8390  C  C   . HIS D  1 59  ? 4.285   53.033  25.563  1.00 39.63  ? 59  HIS D C   1 
ATOM   8391  O  O   . HIS D  1 59  ? 4.465   51.838  25.322  1.00 44.91  ? 59  HIS D O   1 
ATOM   8392  C  CB  . HIS D  1 59  ? 6.297   52.955  27.035  1.00 39.37  ? 59  HIS D CB  1 
ATOM   8393  C  CG  . HIS D  1 59  ? 5.691   52.455  28.305  1.00 41.87  ? 59  HIS D CG  1 
ATOM   8394  N  ND1 . HIS D  1 59  ? 6.006   52.988  29.537  1.00 42.03  ? 59  HIS D ND1 1 
ATOM   8395  C  CD2 . HIS D  1 59  ? 4.784   51.477  28.536  1.00 37.77  ? 59  HIS D CD2 1 
ATOM   8396  C  CE1 . HIS D  1 59  ? 5.314   52.364  30.473  1.00 38.48  ? 59  HIS D CE1 1 
ATOM   8397  N  NE2 . HIS D  1 59  ? 4.562   51.445  29.891  1.00 45.10  ? 59  HIS D NE2 1 
ATOM   8398  N  N   . GLU D  1 60  ? 3.150   53.654  25.281  1.00 41.12  ? 60  GLU D N   1 
ATOM   8399  C  CA  . GLU D  1 60  ? 2.086   52.968  24.565  1.00 38.73  ? 60  GLU D CA  1 
ATOM   8400  C  C   . GLU D  1 60  ? 1.655   53.854  23.406  1.00 43.55  ? 60  GLU D C   1 
ATOM   8401  O  O   . GLU D  1 60  ? 0.959   54.858  23.600  1.00 42.22  ? 60  GLU D O   1 
ATOM   8402  C  CB  . GLU D  1 60  ? 0.908   52.675  25.500  1.00 45.26  ? 60  GLU D CB  1 
ATOM   8403  C  CG  . GLU D  1 60  ? 1.239   51.757  26.692  1.00 43.21  ? 60  GLU D CG  1 
ATOM   8404  C  CD  . GLU D  1 60  ? 0.154   51.795  27.775  1.00 49.98  ? 60  GLU D CD  1 
ATOM   8405  O  OE1 . GLU D  1 60  ? -0.798  50.981  27.716  1.00 40.39  ? 60  GLU D OE1 1 
ATOM   8406  O  OE2 . GLU D  1 60  ? 0.245   52.661  28.674  1.00 53.53  ? 60  GLU D OE2 1 
ATOM   8407  N  N   . ALA D  1 61  ? 2.094   53.501  22.203  1.00 36.70  ? 61  ALA D N   1 
ATOM   8408  C  CA  . ALA D  1 61  ? 1.783   54.316  21.047  1.00 41.01  ? 61  ALA D CA  1 
ATOM   8409  C  C   . ALA D  1 61  ? 1.512   53.504  19.796  1.00 40.75  ? 61  ALA D C   1 
ATOM   8410  O  O   . ALA D  1 61  ? 2.145   52.477  19.557  1.00 40.06  ? 61  ALA D O   1 
ATOM   8411  C  CB  . ALA D  1 61  ? 2.899   55.316  20.780  1.00 36.25  ? 61  ALA D CB  1 
ATOM   8412  N  N   . VAL D  1 62  ? 0.541   53.979  19.024  1.00 43.51  ? 62  VAL D N   1 
ATOM   8413  C  CA  . VAL D  1 62  ? 0.473   53.709  17.597  1.00 45.76  ? 62  VAL D CA  1 
ATOM   8414  C  C   . VAL D  1 62  ? 0.927   55.020  16.976  1.00 42.98  ? 62  VAL D C   1 
ATOM   8415  O  O   . VAL D  1 62  ? 0.616   56.091  17.494  1.00 47.88  ? 62  VAL D O   1 
ATOM   8416  C  CB  . VAL D  1 62  ? -0.958  53.321  17.130  1.00 45.41  ? 62  VAL D CB  1 
ATOM   8417  C  CG1 . VAL D  1 62  ? -1.287  51.921  17.576  1.00 45.23  ? 62  VAL D CG1 1 
ATOM   8418  C  CG2 . VAL D  1 62  ? -1.974  54.272  17.700  1.00 51.98  ? 62  VAL D CG2 1 
ATOM   8419  N  N   . GLY D  1 63  ? 1.694   54.942  15.896  1.00 39.06  ? 63  GLY D N   1 
ATOM   8420  C  CA  . GLY D  1 63  ? 2.283   56.125  15.309  1.00 36.76  ? 63  GLY D CA  1 
ATOM   8421  C  C   . GLY D  1 63  ? 2.433   56.004  13.808  1.00 41.30  ? 63  GLY D C   1 
ATOM   8422  O  O   . GLY D  1 63  ? 1.950   55.052  13.213  1.00 45.36  ? 63  GLY D O   1 
ATOM   8423  N  N   . GLU D  1 64  ? 3.090   56.982  13.193  1.00 41.51  ? 64  GLU D N   1 
ATOM   8424  C  CA  . GLU D  1 64  ? 3.415   56.911  11.776  1.00 45.47  ? 64  GLU D CA  1 
ATOM   8425  C  C   . GLU D  1 64  ? 4.895   57.201  11.577  1.00 44.20  ? 64  GLU D C   1 
ATOM   8426  O  O   . GLU D  1 64  ? 5.425   58.185  12.102  1.00 39.08  ? 64  GLU D O   1 
ATOM   8427  C  CB  . GLU D  1 64  ? 2.551   57.885  10.950  1.00 46.21  ? 64  GLU D CB  1 
ATOM   8428  C  CG  . GLU D  1 64  ? 2.776   59.343  11.289  1.00 61.14  ? 64  GLU D CG  1 
ATOM   8429  C  CD  . GLU D  1 64  ? 1.914   60.294  10.464  1.00 71.06  ? 64  GLU D CD  1 
ATOM   8430  O  OE1 . GLU D  1 64  ? 0.912   59.829  9.870   1.00 66.39  ? 64  GLU D OE1 1 
ATOM   8431  O  OE2 . GLU D  1 64  ? 2.243   61.505  10.423  1.00 73.70  ? 64  GLU D OE2 1 
ATOM   8432  N  N   . VAL D  1 65  ? 5.561   56.336  10.821  1.00 46.28  ? 65  VAL D N   1 
ATOM   8433  C  CA  . VAL D  1 65  ? 6.989   56.482  10.592  1.00 45.93  ? 65  VAL D CA  1 
ATOM   8434  C  C   . VAL D  1 65  ? 7.308   57.789  9.899   1.00 49.59  ? 65  VAL D C   1 
ATOM   8435  O  O   . VAL D  1 65  ? 6.743   58.102  8.853   1.00 43.73  ? 65  VAL D O   1 
ATOM   8436  C  CB  . VAL D  1 65  ? 7.538   55.363  9.721   1.00 41.72  ? 65  VAL D CB  1 
ATOM   8437  C  CG1 . VAL D  1 65  ? 9.005   55.610  9.446   1.00 42.02  ? 65  VAL D CG1 1 
ATOM   8438  C  CG2 . VAL D  1 65  ? 7.316   54.014  10.386  1.00 34.69  ? 65  VAL D CG2 1 
ATOM   8439  N  N   . VAL D  1 66  ? 8.246   58.537  10.468  1.00 47.28  ? 66  VAL D N   1 
ATOM   8440  C  CA  . VAL D  1 66  ? 8.611   59.817  9.890   1.00 49.83  ? 66  VAL D CA  1 
ATOM   8441  C  C   . VAL D  1 66  ? 9.953   59.779  9.151   1.00 47.01  ? 66  VAL D C   1 
ATOM   8442  O  O   . VAL D  1 66  ? 10.114  60.409  8.117   1.00 50.64  ? 66  VAL D O   1 
ATOM   8443  C  CB  . VAL D  1 66  ? 8.572   60.930  10.951  1.00 51.39  ? 66  VAL D CB  1 
ATOM   8444  C  CG1 . VAL D  1 66  ? 9.683   61.914  10.714  1.00 55.38  ? 66  VAL D CG1 1 
ATOM   8445  C  CG2 . VAL D  1 66  ? 7.198   61.606  10.927  1.00 43.86  ? 66  VAL D CG2 1 
ATOM   8446  N  N   . GLU D  1 67  ? 10.919  59.045  9.682   1.00 51.91  ? 67  GLU D N   1 
ATOM   8447  C  CA  . GLU D  1 67  ? 12.158  58.825  8.947   1.00 49.70  ? 67  GLU D CA  1 
ATOM   8448  C  C   . GLU D  1 67  ? 12.806  57.575  9.477   1.00 44.22  ? 67  GLU D C   1 
ATOM   8449  O  O   . GLU D  1 67  ? 12.491  57.146  10.577  1.00 46.30  ? 67  GLU D O   1 
ATOM   8450  C  CB  . GLU D  1 67  ? 13.112  60.023  9.034   1.00 53.75  ? 67  GLU D CB  1 
ATOM   8451  C  CG  . GLU D  1 67  ? 13.513  60.431  10.426  1.00 59.67  ? 67  GLU D CG  1 
ATOM   8452  C  CD  . GLU D  1 67  ? 14.412  61.681  10.454  1.00 64.19  ? 67  GLU D CD  1 
ATOM   8453  O  OE1 . GLU D  1 67  ? 15.556  61.640  9.933   1.00 57.45  ? 67  GLU D OE1 1 
ATOM   8454  O  OE2 . GLU D  1 67  ? 13.975  62.700  11.025  1.00 63.32  ? 67  GLU D OE2 1 
ATOM   8455  N  N   . VAL D  1 68  ? 13.688  56.987  8.674   1.00 44.19  ? 68  VAL D N   1 
ATOM   8456  C  CA  . VAL D  1 68  ? 14.329  55.719  8.989   1.00 50.12  ? 68  VAL D CA  1 
ATOM   8457  C  C   . VAL D  1 68  ? 15.777  55.838  8.546   1.00 54.26  ? 68  VAL D C   1 
ATOM   8458  O  O   . VAL D  1 68  ? 16.098  56.647  7.656   1.00 47.46  ? 68  VAL D O   1 
ATOM   8459  C  CB  . VAL D  1 68  ? 13.669  54.533  8.243   1.00 48.38  ? 68  VAL D CB  1 
ATOM   8460  C  CG1 . VAL D  1 68  ? 12.178  54.479  8.538   1.00 47.23  ? 68  VAL D CG1 1 
ATOM   8461  C  CG2 . VAL D  1 68  ? 13.909  54.645  6.742   1.00 43.79  ? 68  VAL D CG2 1 
ATOM   8462  N  N   . GLY D  1 69  ? 16.647  55.053  9.176   1.00 46.62  ? 69  GLY D N   1 
ATOM   8463  C  CA  . GLY D  1 69  ? 18.054  55.054  8.828   1.00 43.84  ? 69  GLY D CA  1 
ATOM   8464  C  C   . GLY D  1 69  ? 18.303  54.377  7.492   1.00 42.35  ? 69  GLY D C   1 
ATOM   8465  O  O   . GLY D  1 69  ? 17.401  53.787  6.909   1.00 44.71  ? 69  GLY D O   1 
ATOM   8466  N  N   . SER D  1 70  ? 19.541  54.461  7.024   1.00 47.81  ? 70  SER D N   1 
ATOM   8467  C  CA  . SER D  1 70  ? 19.935  53.954  5.718   1.00 45.54  ? 70  SER D CA  1 
ATOM   8468  C  C   . SER D  1 70  ? 19.942  52.434  5.656   1.00 46.83  ? 70  SER D C   1 
ATOM   8469  O  O   . SER D  1 70  ? 20.109  51.854  4.588   1.00 48.28  ? 70  SER D O   1 
ATOM   8470  C  CB  . SER D  1 70  ? 21.326  54.483  5.364   1.00 46.67  ? 70  SER D CB  1 
ATOM   8471  O  OG  . SER D  1 70  ? 22.284  54.031  6.308   1.00 58.97  ? 70  SER D OG  1 
ATOM   8472  N  N   . GLU D  1 71  ? 19.761  51.787  6.799   1.00 52.67  ? 71  GLU D N   1 
ATOM   8473  C  CA  . GLU D  1 71  ? 19.775  50.328  6.847   1.00 56.28  ? 71  GLU D CA  1 
ATOM   8474  C  C   . GLU D  1 71  ? 18.383  49.749  7.080   1.00 53.53  ? 71  GLU D C   1 
ATOM   8475  O  O   . GLU D  1 71  ? 18.209  48.531  7.120   1.00 54.87  ? 71  GLU D O   1 
ATOM   8476  C  CB  . GLU D  1 71  ? 20.748  49.830  7.925   1.00 57.08  ? 71  GLU D CB  1 
ATOM   8477  C  CG  . GLU D  1 71  ? 22.209  49.925  7.525   1.00 56.50  ? 71  GLU D CG  1 
ATOM   8478  C  CD  . GLU D  1 71  ? 22.503  49.175  6.238   1.00 67.30  ? 71  GLU D CD  1 
ATOM   8479  O  OE1 . GLU D  1 71  ? 21.929  48.081  6.032   1.00 74.58  ? 71  GLU D OE1 1 
ATOM   8480  O  OE2 . GLU D  1 71  ? 23.309  49.675  5.429   1.00 71.64  ? 71  GLU D OE2 1 
ATOM   8481  N  N   . VAL D  1 72  ? 17.396  50.622  7.237   1.00 44.96  ? 72  VAL D N   1 
ATOM   8482  C  CA  . VAL D  1 72  ? 16.029  50.172  7.469   1.00 46.47  ? 72  VAL D CA  1 
ATOM   8483  C  C   . VAL D  1 72  ? 15.372  49.679  6.184   1.00 54.69  ? 72  VAL D C   1 
ATOM   8484  O  O   . VAL D  1 72  ? 15.358  50.384  5.177   1.00 54.22  ? 72  VAL D O   1 
ATOM   8485  C  CB  . VAL D  1 72  ? 15.183  51.279  8.089   1.00 39.83  ? 72  VAL D CB  1 
ATOM   8486  C  CG1 . VAL D  1 72  ? 13.752  50.830  8.228   1.00 34.23  ? 72  VAL D CG1 1 
ATOM   8487  C  CG2 . VAL D  1 72  ? 15.778  51.663  9.451   1.00 46.75  ? 72  VAL D CG2 1 
ATOM   8488  N  N   . LYS D  1 73  ? 14.820  48.467  6.230   1.00 47.06  ? 73  LYS D N   1 
ATOM   8489  C  CA  . LYS D  1 73  ? 14.368  47.799  5.020   1.00 47.57  ? 73  LYS D CA  1 
ATOM   8490  C  C   . LYS D  1 73  ? 12.858  47.646  4.915   1.00 43.17  ? 73  LYS D C   1 
ATOM   8491  O  O   . LYS D  1 73  ? 12.318  47.661  3.823   1.00 47.58  ? 73  LYS D O   1 
ATOM   8492  C  CB  . LYS D  1 73  ? 15.010  46.410  4.907   1.00 49.88  ? 73  LYS D CB  1 
ATOM   8493  C  CG  . LYS D  1 73  ? 16.529  46.404  4.994   1.00 57.65  ? 73  LYS D CG  1 
ATOM   8494  C  CD  . LYS D  1 73  ? 17.164  47.013  3.755   1.00 65.26  ? 73  LYS D CD  1 
ATOM   8495  C  CE  . LYS D  1 73  ? 18.682  46.916  3.817   1.00 69.21  ? 73  LYS D CE  1 
ATOM   8496  N  NZ  . LYS D  1 73  ? 19.318  47.308  2.528   1.00 71.95  ? 73  LYS D NZ  1 
ATOM   8497  N  N   . ASP D  1 74  ? 12.175  47.477  6.040   1.00 41.21  ? 74  ASP D N   1 
ATOM   8498  C  CA  . ASP D  1 74  ? 10.774  47.064  5.993   1.00 39.72  ? 74  ASP D CA  1 
ATOM   8499  C  C   . ASP D  1 74  ? 9.808   48.186  6.359   1.00 42.75  ? 74  ASP D C   1 
ATOM   8500  O  O   . ASP D  1 74  ? 8.593   48.013  6.276   1.00 47.98  ? 74  ASP D O   1 
ATOM   8501  C  CB  . ASP D  1 74  ? 10.524  45.888  6.933   1.00 38.59  ? 74  ASP D CB  1 
ATOM   8502  C  CG  . ASP D  1 74  ? 11.340  44.646  6.576   1.00 47.39  ? 74  ASP D CG  1 
ATOM   8503  O  OD1 . ASP D  1 74  ? 11.734  44.464  5.401   1.00 48.89  ? 74  ASP D OD1 1 
ATOM   8504  O  OD2 . ASP D  1 74  ? 11.573  43.839  7.499   1.00 43.25  ? 74  ASP D OD2 1 
ATOM   8505  N  N   . PHE D  1 75  ? 10.341  49.321  6.790   1.00 38.91  ? 75  PHE D N   1 
ATOM   8506  C  CA  . PHE D  1 75  ? 9.498   50.464  7.134   1.00 42.87  ? 75  PHE D CA  1 
ATOM   8507  C  C   . PHE D  1 75  ? 10.019  51.722  6.469   1.00 44.85  ? 75  PHE D C   1 
ATOM   8508  O  O   . PHE D  1 75  ? 11.225  51.902  6.336   1.00 46.47  ? 75  PHE D O   1 
ATOM   8509  C  CB  . PHE D  1 75  ? 9.402   50.644  8.651   1.00 33.51  ? 75  PHE D CB  1 
ATOM   8510  C  CG  . PHE D  1 75  ? 8.848   49.444  9.352   1.00 36.20  ? 75  PHE D CG  1 
ATOM   8511  C  CD1 . PHE D  1 75  ? 7.480   49.296  9.519   1.00 42.58  ? 75  PHE D CD1 1 
ATOM   8512  C  CD2 . PHE D  1 75  ? 9.696   48.442  9.818   1.00 33.03  ? 75  PHE D CD2 1 
ATOM   8513  C  CE1 . PHE D  1 75  ? 6.953   48.170  10.142  1.00 34.04  ? 75  PHE D CE1 1 
ATOM   8514  C  CE2 . PHE D  1 75  ? 9.186   47.308  10.451  1.00 32.42  ? 75  PHE D CE2 1 
ATOM   8515  C  CZ  . PHE D  1 75  ? 7.812   47.170  10.615  1.00 35.81  ? 75  PHE D CZ  1 
ATOM   8516  N  N   . LYS D  1 76  ? 9.097   52.577  6.036   1.00 52.93  ? 76  LYS D N   1 
ATOM   8517  C  CA  . LYS D  1 76  ? 9.451   53.848  5.408   1.00 52.21  ? 76  LYS D CA  1 
ATOM   8518  C  C   . LYS D  1 76  ? 8.524   54.960  5.892   1.00 46.70  ? 76  LYS D C   1 
ATOM   8519  O  O   . LYS D  1 76  ? 7.484   54.684  6.497   1.00 46.26  ? 76  LYS D O   1 
ATOM   8520  C  CB  . LYS D  1 76  ? 9.411   53.730  3.881   1.00 49.98  ? 76  LYS D CB  1 
ATOM   8521  C  CG  . LYS D  1 76  ? 8.026   53.539  3.289   1.00 56.22  ? 76  LYS D CG  1 
ATOM   8522  C  CD  . LYS D  1 76  ? 7.383   52.246  3.757   1.00 66.86  ? 76  LYS D CD  1 
ATOM   8523  C  CE  . LYS D  1 76  ? 8.185   50.987  3.401   1.00 68.32  ? 76  LYS D CE  1 
ATOM   8524  N  NZ  . LYS D  1 76  ? 7.437   49.718  3.716   1.00 54.74  ? 76  LYS D NZ  1 
ATOM   8525  N  N   . PRO D  1 77  ? 8.901   56.223  5.626   1.00 46.60  ? 77  PRO D N   1 
ATOM   8526  C  CA  . PRO D  1 77  ? 8.082   57.382  5.997   1.00 48.37  ? 77  PRO D CA  1 
ATOM   8527  C  C   . PRO D  1 77  ? 6.644   57.208  5.526   1.00 49.58  ? 77  PRO D C   1 
ATOM   8528  O  O   . PRO D  1 77  ? 6.423   56.874  4.365   1.00 55.49  ? 77  PRO D O   1 
ATOM   8529  C  CB  . PRO D  1 77  ? 8.735   58.533  5.228   1.00 52.85  ? 77  PRO D CB  1 
ATOM   8530  C  CG  . PRO D  1 77  ? 10.135  58.103  5.006   1.00 54.76  ? 77  PRO D CG  1 
ATOM   8531  C  CD  . PRO D  1 77  ? 10.081  56.612  4.835   1.00 46.38  ? 77  PRO D CD  1 
ATOM   8532  N  N   . GLY D  1 78  ? 5.687   57.428  6.424   1.00 47.72  ? 78  GLY D N   1 
ATOM   8533  C  CA  . GLY D  1 78  ? 4.283   57.258  6.113   1.00 43.65  ? 78  GLY D CA  1 
ATOM   8534  C  C   . GLY D  1 78  ? 3.619   56.032  6.721   1.00 49.12  ? 78  GLY D C   1 
ATOM   8535  O  O   . GLY D  1 78  ? 2.419   56.050  6.979   1.00 49.73  ? 78  GLY D O   1 
ATOM   8536  N  N   . ASP D  1 79  ? 4.371   54.957  6.956   1.00 48.17  ? 79  ASP D N   1 
ATOM   8537  C  CA  . ASP D  1 79  ? 3.731   53.721  7.400   1.00 42.80  ? 79  ASP D CA  1 
ATOM   8538  C  C   . ASP D  1 79  ? 3.104   53.908  8.772   1.00 42.93  ? 79  ASP D C   1 
ATOM   8539  O  O   . ASP D  1 79  ? 3.691   54.556  9.646   1.00 42.30  ? 79  ASP D O   1 
ATOM   8540  C  CB  . ASP D  1 79  ? 4.738   52.575  7.453   1.00 50.23  ? 79  ASP D CB  1 
ATOM   8541  C  CG  . ASP D  1 79  ? 5.284   52.221  6.091   1.00 51.74  ? 79  ASP D CG  1 
ATOM   8542  O  OD1 . ASP D  1 79  ? 4.712   52.684  5.076   1.00 50.71  ? 79  ASP D OD1 1 
ATOM   8543  O  OD2 . ASP D  1 79  ? 6.290   51.484  6.043   1.00 45.56  ? 79  ASP D OD2 1 
ATOM   8544  N  N   . ARG D  1 80  ? 1.910   53.352  8.958   1.00 37.51  ? 80  ARG D N   1 
ATOM   8545  C  CA  . ARG D  1 80  ? 1.283   53.344  10.274  1.00 42.81  ? 80  ARG D CA  1 
ATOM   8546  C  C   . ARG D  1 80  ? 1.765   52.121  11.049  1.00 42.88  ? 80  ARG D C   1 
ATOM   8547  O  O   . ARG D  1 80  ? 1.749   51.009  10.534  1.00 39.45  ? 80  ARG D O   1 
ATOM   8548  C  CB  . ARG D  1 80  ? -0.234  53.344  10.162  1.00 43.67  ? 80  ARG D CB  1 
ATOM   8549  C  CG  . ARG D  1 80  ? -0.791  54.698  9.725   1.00 59.29  ? 80  ARG D CG  1 
ATOM   8550  C  CD  . ARG D  1 80  ? -2.299  54.743  9.856   1.00 65.07  ? 80  ARG D CD  1 
ATOM   8551  N  NE  . ARG D  1 80  ? -2.802  56.114  9.900   1.00 75.84  ? 80  ARG D NE  1 
ATOM   8552  C  CZ  . ARG D  1 80  ? -3.973  56.459  10.427  1.00 82.03  ? 80  ARG D CZ  1 
ATOM   8553  N  NH1 . ARG D  1 80  ? -4.756  55.534  10.967  1.00 88.88  ? 80  ARG D NH1 1 
ATOM   8554  N  NH2 . ARG D  1 80  ? -4.357  57.729  10.429  1.00 80.00  ? 80  ARG D NH2 1 
ATOM   8555  N  N   . VAL D  1 81  ? 2.210   52.324  12.282  1.00 45.91  ? 81  VAL D N   1 
ATOM   8556  C  CA  . VAL D  1 81  ? 2.809   51.221  13.023  1.00 43.26  ? 81  VAL D CA  1 
ATOM   8557  C  C   . VAL D  1 81  ? 2.276   51.073  14.445  1.00 43.72  ? 81  VAL D C   1 
ATOM   8558  O  O   . VAL D  1 81  ? 1.842   52.045  15.077  1.00 43.51  ? 81  VAL D O   1 
ATOM   8559  C  CB  . VAL D  1 81  ? 4.353   51.344  13.058  1.00 37.53  ? 81  VAL D CB  1 
ATOM   8560  C  CG1 . VAL D  1 81  ? 4.936   51.222  11.647  1.00 29.25  ? 81  VAL D CG1 1 
ATOM   8561  C  CG2 . VAL D  1 81  ? 4.779   52.676  13.710  1.00 38.39  ? 81  VAL D CG2 1 
ATOM   8562  N  N   . VAL D  1 82  ? 2.298   49.837  14.934  1.00 42.79  ? 82  VAL D N   1 
ATOM   8563  C  CA  . VAL D  1 82  ? 2.131   49.587  16.352  1.00 41.35  ? 82  VAL D CA  1 
ATOM   8564  C  C   . VAL D  1 82  ? 3.541   49.511  16.952  1.00 40.04  ? 82  VAL D C   1 
ATOM   8565  O  O   . VAL D  1 82  ? 4.413   48.847  16.404  1.00 37.44  ? 82  VAL D O   1 
ATOM   8566  C  CB  . VAL D  1 82  ? 1.348   48.292  16.613  1.00 47.74  ? 82  VAL D CB  1 
ATOM   8567  C  CG1 . VAL D  1 82  ? 1.112   48.108  18.107  1.00 50.39  ? 82  VAL D CG1 1 
ATOM   8568  C  CG2 . VAL D  1 82  ? 0.020   48.324  15.870  1.00 42.37  ? 82  VAL D CG2 1 
ATOM   8569  N  N   . VAL D  1 83  ? 3.763   50.235  18.048  1.00 38.25  ? 83  VAL D N   1 
ATOM   8570  C  CA  . VAL D  1 83  ? 5.059   50.284  18.712  1.00 35.31  ? 83  VAL D CA  1 
ATOM   8571  C  C   . VAL D  1 83  ? 4.955   49.514  20.018  1.00 37.29  ? 83  VAL D C   1 
ATOM   8572  O  O   . VAL D  1 83  ? 4.167   49.870  20.891  1.00 41.07  ? 83  VAL D O   1 
ATOM   8573  C  CB  . VAL D  1 83  ? 5.465   51.740  19.029  1.00 39.94  ? 83  VAL D CB  1 
ATOM   8574  C  CG1 . VAL D  1 83  ? 6.846   51.790  19.707  1.00 35.46  ? 83  VAL D CG1 1 
ATOM   8575  C  CG2 . VAL D  1 83  ? 5.445   52.580  17.766  1.00 38.08  ? 83  VAL D CG2 1 
ATOM   8576  N  N   . PRO D  1 84  ? 5.740   48.442  20.158  1.00 39.14  ? 84  PRO D N   1 
ATOM   8577  C  CA  . PRO D  1 84  ? 5.698   47.707  21.427  1.00 31.76  ? 84  PRO D CA  1 
ATOM   8578  C  C   . PRO D  1 84  ? 6.273   48.588  22.534  1.00 31.36  ? 84  PRO D C   1 
ATOM   8579  O  O   . PRO D  1 84  ? 7.197   49.360  22.267  1.00 35.31  ? 84  PRO D O   1 
ATOM   8580  C  CB  . PRO D  1 84  ? 6.639   46.510  21.195  1.00 30.23  ? 84  PRO D CB  1 
ATOM   8581  C  CG  . PRO D  1 84  ? 7.293   46.703  19.885  1.00 33.55  ? 84  PRO D CG  1 
ATOM   8582  C  CD  . PRO D  1 84  ? 6.859   48.035  19.296  1.00 39.72  ? 84  PRO D CD  1 
ATOM   8583  N  N   . ALA D  1 85  ? 5.741   48.493  23.748  1.00 31.78  ? 85  ALA D N   1 
ATOM   8584  C  CA  . ALA D  1 85  ? 6.359   49.179  24.890  1.00 36.78  ? 85  ALA D CA  1 
ATOM   8585  C  C   . ALA D  1 85  ? 7.789   48.682  25.141  1.00 42.08  ? 85  ALA D C   1 
ATOM   8586  O  O   . ALA D  1 85  ? 8.625   49.411  25.687  1.00 35.89  ? 85  ALA D O   1 
ATOM   8587  C  CB  . ALA D  1 85  ? 5.529   48.976  26.141  1.00 32.74  ? 85  ALA D CB  1 
ATOM   8588  N  N   . ILE D  1 86  ? 8.045   47.428  24.762  1.00 33.21  ? 86  ILE D N   1 
ATOM   8589  C  CA  . ILE D  1 86  ? 9.360   46.814  24.908  1.00 33.80  ? 86  ILE D CA  1 
ATOM   8590  C  C   . ILE D  1 86  ? 10.082  46.759  23.558  1.00 31.97  ? 86  ILE D C   1 
ATOM   8591  O  O   . ILE D  1 86  ? 9.622   46.089  22.633  1.00 28.85  ? 86  ILE D O   1 
ATOM   8592  C  CB  . ILE D  1 86  ? 9.229   45.393  25.503  1.00 35.10  ? 86  ILE D CB  1 
ATOM   8593  C  CG1 . ILE D  1 86  ? 9.153   45.473  27.025  1.00 36.80  ? 86  ILE D CG1 1 
ATOM   8594  C  CG2 . ILE D  1 86  ? 10.379  44.497  25.058  1.00 33.94  ? 86  ILE D CG2 1 
ATOM   8595  C  CD1 . ILE D  1 86  ? 8.158   46.496  27.550  1.00 36.23  ? 86  ILE D CD1 1 
ATOM   8596  N  N   . THR D  1 87  ? 11.202  47.472  23.459  1.00 34.50  ? 87  THR D N   1 
ATOM   8597  C  CA  . THR D  1 87  ? 11.944  47.603  22.207  1.00 34.40  ? 87  THR D CA  1 
ATOM   8598  C  C   . THR D  1 87  ? 13.424  47.288  22.422  1.00 40.64  ? 87  THR D C   1 
ATOM   8599  O  O   . THR D  1 87  ? 14.259  48.200  22.495  1.00 38.66  ? 87  THR D O   1 
ATOM   8600  C  CB  . THR D  1 87  ? 11.823  49.037  21.620  1.00 36.10  ? 87  THR D CB  1 
ATOM   8601  O  OG1 . THR D  1 87  ? 12.150  50.017  22.625  1.00 31.55  ? 87  THR D OG1 1 
ATOM   8602  C  CG2 . THR D  1 87  ? 10.411  49.290  21.102  1.00 26.99  ? 87  THR D CG2 1 
ATOM   8603  N  N   . PRO D  1 88  ? 13.761  45.993  22.488  1.00 38.29  ? 88  PRO D N   1 
ATOM   8604  C  CA  . PRO D  1 88  ? 15.108  45.580  22.913  1.00 44.03  ? 88  PRO D CA  1 
ATOM   8605  C  C   . PRO D  1 88  ? 16.191  45.836  21.878  1.00 37.86  ? 88  PRO D C   1 
ATOM   8606  O  O   . PRO D  1 88  ? 15.915  45.981  20.676  1.00 34.18  ? 88  PRO D O   1 
ATOM   8607  C  CB  . PRO D  1 88  ? 14.982  44.060  23.106  1.00 42.43  ? 88  PRO D CB  1 
ATOM   8608  C  CG  . PRO D  1 88  ? 13.546  43.721  22.860  1.00 37.97  ? 88  PRO D CG  1 
ATOM   8609  C  CD  . PRO D  1 88  ? 12.920  44.846  22.114  1.00 33.42  ? 88  PRO D CD  1 
ATOM   8610  N  N   . ASP D  1 89  ? 17.421  45.892  22.375  1.00 33.41  ? 89  ASP D N   1 
ATOM   8611  C  CA  . ASP D  1 89  ? 18.610  45.751  21.563  1.00 35.21  ? 89  ASP D CA  1 
ATOM   8612  C  C   . ASP D  1 89  ? 18.703  44.260  21.248  1.00 42.70  ? 89  ASP D C   1 
ATOM   8613  O  O   . ASP D  1 89  ? 18.713  43.415  22.151  1.00 33.21  ? 89  ASP D O   1 
ATOM   8614  C  CB  . ASP D  1 89  ? 19.834  46.238  22.354  1.00 40.36  ? 89  ASP D CB  1 
ATOM   8615  C  CG  . ASP D  1 89  ? 19.812  47.769  22.594  1.00 55.70  ? 89  ASP D CG  1 
ATOM   8616  O  OD1 . ASP D  1 89  ? 19.457  48.521  21.654  1.00 53.50  ? 89  ASP D OD1 1 
ATOM   8617  O  OD2 . ASP D  1 89  ? 20.151  48.224  23.716  1.00 55.42  ? 89  ASP D OD2 1 
ATOM   8618  N  N   . TRP D  1 90  ? 18.735  43.920  19.968  1.00 46.26  ? 90  TRP D N   1 
ATOM   8619  C  CA  . TRP D  1 90  ? 18.590  42.527  19.599  1.00 41.21  ? 90  TRP D CA  1 
ATOM   8620  C  C   . TRP D  1 90  ? 19.902  41.738  19.533  1.00 43.47  ? 90  TRP D C   1 
ATOM   8621  O  O   . TRP D  1 90  ? 19.878  40.514  19.520  1.00 39.99  ? 90  TRP D O   1 
ATOM   8622  C  CB  . TRP D  1 90  ? 17.753  42.381  18.328  1.00 36.49  ? 90  TRP D CB  1 
ATOM   8623  C  CG  . TRP D  1 90  ? 16.289  42.540  18.621  1.00 35.35  ? 90  TRP D CG  1 
ATOM   8624  C  CD1 . TRP D  1 90  ? 15.555  43.700  18.571  1.00 32.37  ? 90  TRP D CD1 1 
ATOM   8625  C  CD2 . TRP D  1 90  ? 15.389  41.512  19.062  1.00 30.73  ? 90  TRP D CD2 1 
ATOM   8626  N  NE1 . TRP D  1 90  ? 14.251  43.446  18.930  1.00 39.44  ? 90  TRP D NE1 1 
ATOM   8627  C  CE2 . TRP D  1 90  ? 14.122  42.113  19.236  1.00 37.70  ? 90  TRP D CE2 1 
ATOM   8628  C  CE3 . TRP D  1 90  ? 15.529  40.140  19.306  1.00 30.50  ? 90  TRP D CE3 1 
ATOM   8629  C  CZ2 . TRP D  1 90  ? 13.002  41.390  19.651  1.00 41.18  ? 90  TRP D CZ2 1 
ATOM   8630  C  CZ3 . TRP D  1 90  ? 14.419  39.420  19.727  1.00 37.44  ? 90  TRP D CZ3 1 
ATOM   8631  C  CH2 . TRP D  1 90  ? 13.166  40.047  19.892  1.00 39.02  ? 90  TRP D CH2 1 
ATOM   8632  N  N   . ARG D  1 91  ? 21.035  42.430  19.503  1.00 36.43  ? 91  ARG D N   1 
ATOM   8633  C  CA  . ARG D  1 91  ? 22.326  41.743  19.497  1.00 30.68  ? 91  ARG D CA  1 
ATOM   8634  C  C   . ARG D  1 91  ? 22.929  41.692  20.894  1.00 38.97  ? 91  ARG D C   1 
ATOM   8635  O  O   . ARG D  1 91  ? 23.880  42.408  21.202  1.00 38.84  ? 91  ARG D O   1 
ATOM   8636  C  CB  . ARG D  1 91  ? 23.304  42.398  18.520  1.00 31.95  ? 91  ARG D CB  1 
ATOM   8637  C  CG  . ARG D  1 91  ? 22.823  42.456  17.053  1.00 42.04  ? 91  ARG D CG  1 
ATOM   8638  C  CD  . ARG D  1 91  ? 23.955  42.900  16.111  1.00 41.50  ? 91  ARG D CD  1 
ATOM   8639  N  NE  . ARG D  1 91  ? 24.847  43.864  16.762  1.00 51.32  ? 91  ARG D NE  1 
ATOM   8640  C  CZ  . ARG D  1 91  ? 26.162  43.731  16.851  1.00 60.08  ? 91  ARG D CZ  1 
ATOM   8641  N  NH1 . ARG D  1 91  ? 26.759  42.686  16.314  1.00 59.14  ? 91  ARG D NH1 1 
ATOM   8642  N  NH2 . ARG D  1 91  ? 26.886  44.656  17.465  1.00 79.88  ? 91  ARG D NH2 1 
ATOM   8643  N  N   . THR D  1 92  ? 22.352  40.863  21.754  1.00 34.60  ? 92  THR D N   1 
ATOM   8644  C  CA  . THR D  1 92  ? 22.874  40.695  23.105  1.00 31.20  ? 92  THR D CA  1 
ATOM   8645  C  C   . THR D  1 92  ? 22.849  39.224  23.478  1.00 36.34  ? 92  THR D C   1 
ATOM   8646  O  O   . THR D  1 92  ? 22.259  38.393  22.765  1.00 36.90  ? 92  THR D O   1 
ATOM   8647  C  CB  . THR D  1 92  ? 22.041  41.463  24.137  1.00 42.13  ? 92  THR D CB  1 
ATOM   8648  O  OG1 . THR D  1 92  ? 20.692  40.978  24.111  1.00 41.79  ? 92  THR D OG1 1 
ATOM   8649  C  CG2 . THR D  1 92  ? 22.051  42.986  23.840  1.00 38.97  ? 92  THR D CG2 1 
ATOM   8650  N  N   . SER D  1 93  ? 23.478  38.903  24.601  1.00 34.93  ? 93  SER D N   1 
ATOM   8651  C  CA  . SER D  1 93  ? 23.561  37.521  25.049  1.00 39.81  ? 93  SER D CA  1 
ATOM   8652  C  C   . SER D  1 93  ? 22.235  37.086  25.644  1.00 39.44  ? 93  SER D C   1 
ATOM   8653  O  O   . SER D  1 93  ? 21.860  35.919  25.533  1.00 40.60  ? 93  SER D O   1 
ATOM   8654  C  CB  . SER D  1 93  ? 24.692  37.334  26.062  1.00 40.40  ? 93  SER D CB  1 
ATOM   8655  O  OG  . SER D  1 93  ? 24.376  37.970  27.286  1.00 49.97  ? 93  SER D OG  1 
ATOM   8656  N  N   . GLU D  1 94  ? 21.517  38.012  26.277  1.00 35.19  ? 94  GLU D N   1 
ATOM   8657  C  CA  . GLU D  1 94  ? 20.179  37.661  26.761  1.00 38.27  ? 94  GLU D CA  1 
ATOM   8658  C  C   . GLU D  1 94  ? 19.250  37.232  25.604  1.00 37.34  ? 94  GLU D C   1 
ATOM   8659  O  O   . GLU D  1 94  ? 18.354  36.388  25.755  1.00 36.05  ? 94  GLU D O   1 
ATOM   8660  C  CB  . GLU D  1 94  ? 19.572  38.802  27.575  1.00 36.74  ? 94  GLU D CB  1 
ATOM   8661  C  CG  . GLU D  1 94  ? 20.242  39.000  28.904  1.00 37.38  ? 94  GLU D CG  1 
ATOM   8662  C  CD  . GLU D  1 94  ? 21.437  39.954  28.857  1.00 46.84  ? 94  GLU D CD  1 
ATOM   8663  O  OE1 . GLU D  1 94  ? 21.712  40.570  27.803  1.00 46.56  ? 94  GLU D OE1 1 
ATOM   8664  O  OE2 . GLU D  1 94  ? 22.110  40.091  29.898  1.00 53.77  ? 94  GLU D OE2 1 
ATOM   8665  N  N   . VAL D  1 95  ? 19.478  37.804  24.432  1.00 41.27  ? 95  VAL D N   1 
ATOM   8666  C  CA  . VAL D  1 95  ? 18.691  37.411  23.276  1.00 37.08  ? 95  VAL D CA  1 
ATOM   8667  C  C   . VAL D  1 95  ? 19.099  36.010  22.795  1.00 33.72  ? 95  VAL D C   1 
ATOM   8668  O  O   . VAL D  1 95  ? 18.252  35.191  22.426  1.00 37.87  ? 95  VAL D O   1 
ATOM   8669  C  CB  . VAL D  1 95  ? 18.743  38.491  22.162  1.00 37.32  ? 95  VAL D CB  1 
ATOM   8670  C  CG1 . VAL D  1 95  ? 18.112  37.977  20.877  1.00 35.01  ? 95  VAL D CG1 1 
ATOM   8671  C  CG2 . VAL D  1 95  ? 18.012  39.747  22.635  1.00 41.56  ? 95  VAL D CG2 1 
ATOM   8672  N  N   . GLN D  1 96  ? 20.391  35.709  22.825  1.00 37.80  ? 96  GLN D N   1 
ATOM   8673  C  CA  . GLN D  1 96  ? 20.808  34.344  22.519  1.00 37.91  ? 96  GLN D CA  1 
ATOM   8674  C  C   . GLN D  1 96  ? 20.253  33.351  23.555  1.00 36.88  ? 96  GLN D C   1 
ATOM   8675  O  O   . GLN D  1 96  ? 19.931  32.210  23.208  1.00 33.66  ? 96  GLN D O   1 
ATOM   8676  C  CB  . GLN D  1 96  ? 22.323  34.251  22.379  1.00 38.90  ? 96  GLN D CB  1 
ATOM   8677  C  CG  . GLN D  1 96  ? 22.876  35.148  21.265  1.00 42.31  ? 96  GLN D CG  1 
ATOM   8678  C  CD  . GLN D  1 96  ? 24.266  34.730  20.800  1.00 39.75  ? 96  GLN D CD  1 
ATOM   8679  O  OE1 . GLN D  1 96  ? 24.695  33.604  21.030  1.00 47.22  ? 96  GLN D OE1 1 
ATOM   8680  N  NE2 . GLN D  1 96  ? 24.969  35.633  20.141  1.00 39.22  ? 96  GLN D NE2 1 
ATOM   8681  N  N   . ARG D  1 97  ? 20.093  33.800  24.802  1.00 33.75  ? 97  ARG D N   1 
ATOM   8682  C  CA  . ARG D  1 97  ? 19.459  32.987  25.855  1.00 39.28  ? 97  ARG D CA  1 
ATOM   8683  C  C   . ARG D  1 97  ? 17.918  32.906  25.747  1.00 40.14  ? 97  ARG D C   1 
ATOM   8684  O  O   . ARG D  1 97  ? 17.292  32.102  26.426  1.00 34.52  ? 97  ARG D O   1 
ATOM   8685  C  CB  . ARG D  1 97  ? 19.828  33.508  27.256  1.00 37.77  ? 97  ARG D CB  1 
ATOM   8686  C  CG  . ARG D  1 97  ? 21.290  33.353  27.649  1.00 33.83  ? 97  ARG D CG  1 
ATOM   8687  C  CD  . ARG D  1 97  ? 21.494  33.486  29.155  1.00 36.78  ? 97  ARG D CD  1 
ATOM   8688  N  NE  . ARG D  1 97  ? 21.084  34.780  29.677  1.00 43.86  ? 97  ARG D NE  1 
ATOM   8689  C  CZ  . ARG D  1 97  ? 20.142  34.949  30.601  1.00 45.32  ? 97  ARG D CZ  1 
ATOM   8690  N  NH1 . ARG D  1 97  ? 19.519  33.899  31.121  1.00 39.36  ? 97  ARG D NH1 1 
ATOM   8691  N  NH2 . ARG D  1 97  ? 19.838  36.173  31.020  1.00 42.49  ? 97  ARG D NH2 1 
ATOM   8692  N  N   . GLY D  1 98  ? 17.311  33.753  24.922  1.00 37.02  ? 98  GLY D N   1 
ATOM   8693  C  CA  . GLY D  1 98  ? 15.865  33.732  24.729  1.00 33.87  ? 98  GLY D CA  1 
ATOM   8694  C  C   . GLY D  1 98  ? 15.074  34.662  25.641  1.00 34.33  ? 98  GLY D C   1 
ATOM   8695  O  O   . GLY D  1 98  ? 13.885  34.449  25.877  1.00 34.23  ? 98  GLY D O   1 
ATOM   8696  N  N   . TYR D  1 99  ? 15.723  35.696  26.168  1.00 30.43  ? 99  TYR D N   1 
ATOM   8697  C  CA  . TYR D  1 99  ? 15.019  36.621  27.049  1.00 35.58  ? 99  TYR D CA  1 
ATOM   8698  C  C   . TYR D  1 99  ? 15.229  38.078  26.644  1.00 36.70  ? 99  TYR D C   1 
ATOM   8699  O  O   . TYR D  1 99  ? 15.898  38.841  27.333  1.00 31.74  ? 99  TYR D O   1 
ATOM   8700  C  CB  . TYR D  1 99  ? 15.358  36.372  28.524  1.00 36.36  ? 99  TYR D CB  1 
ATOM   8701  C  CG  . TYR D  1 99  ? 14.696  35.112  29.063  1.00 40.99  ? 99  TYR D CG  1 
ATOM   8702  C  CD1 . TYR D  1 99  ? 13.413  35.160  29.585  1.00 36.83  ? 99  TYR D CD1 1 
ATOM   8703  C  CD2 . TYR D  1 99  ? 15.355  33.872  29.033  1.00 39.72  ? 99  TYR D CD2 1 
ATOM   8704  C  CE1 . TYR D  1 99  ? 12.802  34.034  30.064  1.00 43.97  ? 99  TYR D CE1 1 
ATOM   8705  C  CE2 . TYR D  1 99  ? 14.738  32.713  29.513  1.00 33.94  ? 99  TYR D CE2 1 
ATOM   8706  C  CZ  . TYR D  1 99  ? 13.461  32.813  30.026  1.00 42.38  ? 99  TYR D CZ  1 
ATOM   8707  O  OH  . TYR D  1 99  ? 12.806  31.713  30.502  1.00 40.92  ? 99  TYR D OH  1 
ATOM   8708  N  N   . HIS D  1 100 ? 14.628  38.450  25.520  1.00 35.42  ? 100 HIS D N   1 
ATOM   8709  C  CA  . HIS D  1 100 ? 14.793  39.791  24.981  1.00 35.49  ? 100 HIS D CA  1 
ATOM   8710  C  C   . HIS D  1 100 ? 14.370  40.871  25.980  1.00 33.20  ? 100 HIS D C   1 
ATOM   8711  O  O   . HIS D  1 100 ? 14.870  41.980  25.946  1.00 38.80  ? 100 HIS D O   1 
ATOM   8712  C  CB  . HIS D  1 100 ? 14.056  39.931  23.636  1.00 30.96  ? 100 HIS D CB  1 
ATOM   8713  C  CG  . HIS D  1 100 ? 12.567  40.057  23.757  1.00 33.76  ? 100 HIS D CG  1 
ATOM   8714  N  ND1 . HIS D  1 100 ? 11.699  39.068  23.341  1.00 32.22  ? 100 HIS D ND1 1 
ATOM   8715  C  CD2 . HIS D  1 100 ? 11.791  41.075  24.206  1.00 31.15  ? 100 HIS D CD2 1 
ATOM   8716  C  CE1 . HIS D  1 100 ? 10.455  39.461  23.552  1.00 36.60  ? 100 HIS D CE1 1 
ATOM   8717  N  NE2 . HIS D  1 100 ? 10.484  40.674  24.078  1.00 40.89  ? 100 HIS D NE2 1 
ATOM   8718  N  N   . GLN D  1 101 ? 13.468  40.538  26.891  1.00 36.25  ? 101 GLN D N   1 
ATOM   8719  C  CA  . GLN D  1 101 ? 12.964  41.537  27.821  1.00 36.20  ? 101 GLN D CA  1 
ATOM   8720  C  C   . GLN D  1 101 ? 14.094  42.091  28.693  1.00 45.11  ? 101 GLN D C   1 
ATOM   8721  O  O   . GLN D  1 101 ? 13.991  43.191  29.240  1.00 46.95  ? 101 GLN D O   1 
ATOM   8722  C  CB  . GLN D  1 101 ? 11.836  40.960  28.693  1.00 36.95  ? 101 GLN D CB  1 
ATOM   8723  C  CG  . GLN D  1 101 ? 10.506  40.657  27.938  1.00 31.90  ? 101 GLN D CG  1 
ATOM   8724  C  CD  . GLN D  1 101 ? 10.317  39.171  27.650  1.00 34.68  ? 101 GLN D CD  1 
ATOM   8725  O  OE1 . GLN D  1 101 ? 11.260  38.484  27.259  1.00 30.47  ? 101 GLN D OE1 1 
ATOM   8726  N  NE2 . GLN D  1 101 ? 9.094   38.673  27.843  1.00 32.32  ? 101 GLN D NE2 1 
ATOM   8727  N  N   . HIS D  1 102 ? 15.176  41.327  28.806  1.00 42.82  ? 102 HIS D N   1 
ATOM   8728  C  CA  . HIS D  1 102 ? 16.274  41.671  29.697  1.00 38.05  ? 102 HIS D CA  1 
ATOM   8729  C  C   . HIS D  1 102 ? 17.581  41.811  28.930  1.00 35.35  ? 102 HIS D C   1 
ATOM   8730  O  O   . HIS D  1 102 ? 18.659  41.509  29.434  1.00 39.04  ? 102 HIS D O   1 
ATOM   8731  C  CB  . HIS D  1 102 ? 16.375  40.619  30.803  1.00 35.00  ? 102 HIS D CB  1 
ATOM   8732  C  CG  . HIS D  1 102 ? 15.045  40.256  31.392  1.00 32.61  ? 102 HIS D CG  1 
ATOM   8733  N  ND1 . HIS D  1 102 ? 14.340  41.109  32.218  1.00 36.97  ? 102 HIS D ND1 1 
ATOM   8734  C  CD2 . HIS D  1 102 ? 14.273  39.154  31.245  1.00 30.55  ? 102 HIS D CD2 1 
ATOM   8735  C  CE1 . HIS D  1 102 ? 13.198  40.540  32.567  1.00 37.23  ? 102 HIS D CE1 1 
ATOM   8736  N  NE2 . HIS D  1 102 ? 13.136  39.349  31.995  1.00 35.35  ? 102 HIS D NE2 1 
ATOM   8737  N  N   . SER D  1 103 ? 17.467  42.286  27.701  1.00 41.10  ? 103 SER D N   1 
ATOM   8738  C  CA  . SER D  1 103 ? 18.615  42.505  26.840  1.00 42.13  ? 103 SER D CA  1 
ATOM   8739  C  C   . SER D  1 103 ? 19.436  43.677  27.356  1.00 42.10  ? 103 SER D C   1 
ATOM   8740  O  O   . SER D  1 103 ? 18.961  44.811  27.394  1.00 39.78  ? 103 SER D O   1 
ATOM   8741  C  CB  . SER D  1 103 ? 18.142  42.771  25.413  1.00 38.13  ? 103 SER D CB  1 
ATOM   8742  O  OG  . SER D  1 103 ? 19.243  42.919  24.542  1.00 45.90  ? 103 SER D OG  1 
ATOM   8743  N  N   . GLY D  1 104 ? 20.662  43.398  27.782  1.00 41.37  ? 104 GLY D N   1 
ATOM   8744  C  CA  . GLY D  1 104 ? 21.517  44.435  28.333  1.00 43.12  ? 104 GLY D CA  1 
ATOM   8745  C  C   . GLY D  1 104 ? 21.342  44.656  29.829  1.00 46.47  ? 104 GLY D C   1 
ATOM   8746  O  O   . GLY D  1 104 ? 22.053  45.458  30.427  1.00 43.63  ? 104 GLY D O   1 
ATOM   8747  N  N   . GLY D  1 105 ? 20.401  43.944  30.440  1.00 47.05  ? 105 GLY D N   1 
ATOM   8748  C  CA  . GLY D  1 105 ? 20.183  44.058  31.873  1.00 49.30  ? 105 GLY D CA  1 
ATOM   8749  C  C   . GLY D  1 105 ? 18.738  43.813  32.268  1.00 46.73  ? 105 GLY D C   1 
ATOM   8750  O  O   . GLY D  1 105 ? 17.852  43.811  31.415  1.00 43.29  ? 105 GLY D O   1 
ATOM   8751  N  N   . MET D  1 106 ? 18.502  43.619  33.562  1.00 45.40  ? 106 MET D N   1 
ATOM   8752  C  CA  . MET D  1 106 ? 17.162  43.360  34.070  1.00 41.94  ? 106 MET D CA  1 
ATOM   8753  C  C   . MET D  1 106 ? 16.177  44.451  33.635  1.00 37.24  ? 106 MET D C   1 
ATOM   8754  O  O   . MET D  1 106 ? 16.330  45.615  33.997  1.00 39.81  ? 106 MET D O   1 
ATOM   8755  C  CB  . MET D  1 106 ? 17.165  43.231  35.597  1.00 35.69  ? 106 MET D CB  1 
ATOM   8756  C  CG  . MET D  1 106 ? 15.955  42.450  36.137  1.00 36.74  ? 106 MET D CG  1 
ATOM   8757  S  SD  . MET D  1 106 ? 16.060  42.170  37.919  1.00 54.50  ? 106 MET D SD  1 
ATOM   8758  C  CE  . MET D  1 106 ? 16.266  43.842  38.519  1.00 123.51 ? 106 MET D CE  1 
ATOM   8759  N  N   . LEU D  1 107 ? 15.172  44.051  32.857  1.00 39.27  ? 107 LEU D N   1 
ATOM   8760  C  CA  . LEU D  1 107 ? 14.121  44.956  32.361  1.00 43.48  ? 107 LEU D CA  1 
ATOM   8761  C  C   . LEU D  1 107 ? 14.603  45.932  31.288  1.00 39.35  ? 107 LEU D C   1 
ATOM   8762  O  O   . LEU D  1 107 ? 13.848  46.801  30.842  1.00 36.15  ? 107 LEU D O   1 
ATOM   8763  C  CB  . LEU D  1 107 ? 13.452  45.725  33.503  1.00 48.80  ? 107 LEU D CB  1 
ATOM   8764  C  CG  . LEU D  1 107 ? 13.097  44.915  34.750  1.00 55.02  ? 107 LEU D CG  1 
ATOM   8765  C  CD1 . LEU D  1 107 ? 12.047  45.641  35.564  1.00 60.81  ? 107 LEU D CD1 1 
ATOM   8766  C  CD2 . LEU D  1 107 ? 12.609  43.525  34.378  1.00 46.27  ? 107 LEU D CD2 1 
ATOM   8767  N  N   . ALA D  1 108 ? 15.850  45.774  30.856  1.00 39.82  ? 108 ALA D N   1 
ATOM   8768  C  CA  . ALA D  1 108 ? 16.461  46.748  29.958  1.00 42.25  ? 108 ALA D CA  1 
ATOM   8769  C  C   . ALA D  1 108 ? 15.775  46.784  28.602  1.00 37.56  ? 108 ALA D C   1 
ATOM   8770  O  O   . ALA D  1 108 ? 15.927  47.742  27.852  1.00 38.68  ? 108 ALA D O   1 
ATOM   8771  C  CB  . ALA D  1 108 ? 17.958  46.476  29.804  1.00 41.84  ? 108 ALA D CB  1 
ATOM   8772  N  N   . GLY D  1 109 ? 15.025  45.728  28.292  1.00 38.12  ? 109 GLY D N   1 
ATOM   8773  C  CA  . GLY D  1 109 ? 14.267  45.665  27.057  1.00 32.97  ? 109 GLY D CA  1 
ATOM   8774  C  C   . GLY D  1 109 ? 13.204  46.739  27.033  1.00 35.29  ? 109 GLY D C   1 
ATOM   8775  O  O   . GLY D  1 109 ? 12.779  47.190  25.970  1.00 30.70  ? 109 GLY D O   1 
ATOM   8776  N  N   . TRP D  1 110 ? 12.780  47.150  28.221  1.00 39.00  ? 110 TRP D N   1 
ATOM   8777  C  CA  . TRP D  1 110 ? 11.826  48.236  28.365  1.00 36.54  ? 110 TRP D CA  1 
ATOM   8778  C  C   . TRP D  1 110 ? 12.576  49.563  28.456  1.00 43.29  ? 110 TRP D C   1 
ATOM   8779  O  O   . TRP D  1 110 ? 13.131  49.902  29.511  1.00 45.97  ? 110 TRP D O   1 
ATOM   8780  C  CB  . TRP D  1 110 ? 10.961  48.007  29.604  1.00 38.02  ? 110 TRP D CB  1 
ATOM   8781  C  CG  . TRP D  1 110 ? 10.246  49.221  30.091  1.00 45.74  ? 110 TRP D CG  1 
ATOM   8782  C  CD1 . TRP D  1 110 ? 9.780   50.257  29.333  1.00 45.58  ? 110 TRP D CD1 1 
ATOM   8783  C  CD2 . TRP D  1 110 ? 9.884   49.522  31.448  1.00 46.54  ? 110 TRP D CD2 1 
ATOM   8784  N  NE1 . TRP D  1 110 ? 9.175   51.194  30.136  1.00 48.59  ? 110 TRP D NE1 1 
ATOM   8785  C  CE2 . TRP D  1 110 ? 9.220   50.768  31.435  1.00 47.51  ? 110 TRP D CE2 1 
ATOM   8786  C  CE3 . TRP D  1 110 ? 10.063  48.866  32.668  1.00 44.92  ? 110 TRP D CE3 1 
ATOM   8787  C  CZ2 . TRP D  1 110 ? 8.729   51.367  32.592  1.00 44.35  ? 110 TRP D CZ2 1 
ATOM   8788  C  CZ3 . TRP D  1 110 ? 9.572   49.462  33.817  1.00 49.93  ? 110 TRP D CZ3 1 
ATOM   8789  C  CH2 . TRP D  1 110 ? 8.917   50.706  33.771  1.00 42.17  ? 110 TRP D CH2 1 
ATOM   8790  N  N   . LYS D  1 111 ? 12.599  50.310  27.351  1.00 35.09  ? 111 LYS D N   1 
ATOM   8791  C  CA  . LYS D  1 111 ? 13.368  51.555  27.287  1.00 37.11  ? 111 LYS D CA  1 
ATOM   8792  C  C   . LYS D  1 111 ? 12.502  52.812  27.499  1.00 43.69  ? 111 LYS D C   1 
ATOM   8793  O  O   . LYS D  1 111 ? 12.836  53.685  28.324  1.00 38.78  ? 111 LYS D O   1 
ATOM   8794  C  CB  . LYS D  1 111 ? 14.139  51.653  25.956  1.00 38.48  ? 111 LYS D CB  1 
ATOM   8795  C  CG  . LYS D  1 111 ? 15.044  50.462  25.624  1.00 40.27  ? 111 LYS D CG  1 
ATOM   8796  C  CD  . LYS D  1 111 ? 15.744  50.669  24.277  1.00 35.33  ? 111 LYS D CD  1 
ATOM   8797  C  CE  . LYS D  1 111 ? 16.830  49.650  24.002  1.00 41.21  ? 111 LYS D CE  1 
ATOM   8798  N  NZ  . LYS D  1 111 ? 18.094  49.914  24.796  1.00 46.55  ? 111 LYS D NZ  1 
ATOM   8799  N  N   . PHE D  1 112 ? 11.400  52.896  26.745  1.00 36.46  ? 112 PHE D N   1 
ATOM   8800  C  CA  . PHE D  1 112 ? 10.504  54.053  26.766  1.00 33.94  ? 112 PHE D CA  1 
ATOM   8801  C  C   . PHE D  1 112 ? 10.038  54.371  28.172  1.00 41.79  ? 112 PHE D C   1 
ATOM   8802  O  O   . PHE D  1 112 ? 9.381   53.546  28.809  1.00 45.67  ? 112 PHE D O   1 
ATOM   8803  C  CB  . PHE D  1 112 ? 9.260   53.784  25.922  1.00 35.32  ? 112 PHE D CB  1 
ATOM   8804  C  CG  . PHE D  1 112 ? 9.494   53.817  24.447  1.00 33.23  ? 112 PHE D CG  1 
ATOM   8805  C  CD1 . PHE D  1 112 ? 10.281  54.802  23.870  1.00 39.23  ? 112 PHE D CD1 1 
ATOM   8806  C  CD2 . PHE D  1 112 ? 8.873   52.890  23.627  1.00 35.29  ? 112 PHE D CD2 1 
ATOM   8807  C  CE1 . PHE D  1 112 ? 10.469  54.851  22.487  1.00 43.52  ? 112 PHE D CE1 1 
ATOM   8808  C  CE2 . PHE D  1 112 ? 9.051   52.924  22.249  1.00 42.13  ? 112 PHE D CE2 1 
ATOM   8809  C  CZ  . PHE D  1 112 ? 9.855   53.912  21.679  1.00 49.40  ? 112 PHE D CZ  1 
ATOM   8810  N  N   . SER D  1 113 ? 10.354  55.584  28.627  1.00 42.58  ? 113 SER D N   1 
ATOM   8811  C  CA  . SER D  1 113 ? 10.072  56.050  29.993  1.00 47.58  ? 113 SER D CA  1 
ATOM   8812  C  C   . SER D  1 113 ? 10.675  55.155  31.090  1.00 46.91  ? 113 SER D C   1 
ATOM   8813  O  O   . SER D  1 113 ? 10.245  55.207  32.247  1.00 47.10  ? 113 SER D O   1 
ATOM   8814  C  CB  . SER D  1 113 ? 8.569   56.277  30.227  1.00 46.94  ? 113 SER D CB  1 
ATOM   8815  O  OG  . SER D  1 113 ? 7.882   55.064  30.513  1.00 42.86  ? 113 SER D OG  1 
ATOM   8816  N  N   . ASN D  1 114 ? 11.651  54.331  30.713  1.00 42.53  ? 114 ASN D N   1 
ATOM   8817  C  CA  . ASN D  1 114 ? 12.509  53.666  31.695  1.00 43.96  ? 114 ASN D CA  1 
ATOM   8818  C  C   . ASN D  1 114 ? 13.938  54.206  31.610  1.00 45.53  ? 114 ASN D C   1 
ATOM   8819  O  O   . ASN D  1 114 ? 14.394  54.870  32.524  1.00 44.26  ? 114 ASN D O   1 
ATOM   8820  C  CB  . ASN D  1 114 ? 12.502  52.148  31.522  1.00 46.28  ? 114 ASN D CB  1 
ATOM   8821  C  CG  . ASN D  1 114 ? 13.378  51.439  32.557  1.00 54.09  ? 114 ASN D CG  1 
ATOM   8822  O  OD1 . ASN D  1 114 ? 13.645  51.978  33.634  1.00 54.45  ? 114 ASN D OD1 1 
ATOM   8823  N  ND2 . ASN D  1 114 ? 13.830  50.229  32.229  1.00 52.46  ? 114 ASN D ND2 1 
ATOM   8824  N  N   . VAL D  1 115 ? 14.631  53.928  30.504  1.00 49.78  ? 115 VAL D N   1 
ATOM   8825  C  CA  . VAL D  1 115 ? 15.968  54.477  30.255  1.00 48.63  ? 115 VAL D CA  1 
ATOM   8826  C  C   . VAL D  1 115 ? 16.021  55.262  28.947  1.00 49.28  ? 115 VAL D C   1 
ATOM   8827  O  O   . VAL D  1 115 ? 17.079  55.430  28.345  1.00 52.52  ? 115 VAL D O   1 
ATOM   8828  C  CB  . VAL D  1 115 ? 17.050  53.379  30.202  1.00 42.53  ? 115 VAL D CB  1 
ATOM   8829  C  CG1 . VAL D  1 115 ? 17.157  52.678  31.545  1.00 42.08  ? 115 VAL D CG1 1 
ATOM   8830  C  CG2 . VAL D  1 115 ? 16.736  52.373  29.088  1.00 42.23  ? 115 VAL D CG2 1 
ATOM   8831  N  N   . LYS D  1 116 ? 14.879  55.765  28.515  1.00 45.35  ? 116 LYS D N   1 
ATOM   8832  C  CA  . LYS D  1 116 ? 14.814  56.418  27.220  1.00 40.18  ? 116 LYS D CA  1 
ATOM   8833  C  C   . LYS D  1 116 ? 13.629  57.351  27.200  1.00 45.05  ? 116 LYS D C   1 
ATOM   8834  O  O   . LYS D  1 116 ? 12.595  57.074  27.806  1.00 43.81  ? 116 LYS D O   1 
ATOM   8835  C  CB  . LYS D  1 116 ? 14.663  55.359  26.117  1.00 43.20  ? 116 LYS D CB  1 
ATOM   8836  C  CG  . LYS D  1 116 ? 14.936  55.837  24.696  1.00 38.57  ? 116 LYS D CG  1 
ATOM   8837  C  CD  . LYS D  1 116 ? 14.619  54.728  23.691  1.00 36.63  ? 116 LYS D CD  1 
ATOM   8838  C  CE  . LYS D  1 116 ? 14.665  55.213  22.240  1.00 32.40  ? 116 LYS D CE  1 
ATOM   8839  N  NZ  . LYS D  1 116 ? 14.814  54.051  21.307  1.00 35.74  ? 116 LYS D NZ  1 
ATOM   8840  N  N   . ASP D  1 117 ? 13.780  58.474  26.515  1.00 44.10  ? 117 ASP D N   1 
ATOM   8841  C  CA  . ASP D  1 117 ? 12.631  59.313  26.258  1.00 39.61  ? 117 ASP D CA  1 
ATOM   8842  C  C   . ASP D  1 117 ? 11.485  58.483  25.681  1.00 41.43  ? 117 ASP D C   1 
ATOM   8843  O  O   . ASP D  1 117 ? 11.651  57.765  24.686  1.00 39.55  ? 117 ASP D O   1 
ATOM   8844  C  CB  . ASP D  1 117 ? 13.021  60.481  25.355  1.00 38.42  ? 117 ASP D CB  1 
ATOM   8845  C  CG  . ASP D  1 117 ? 13.674  61.617  26.137  1.00 48.12  ? 117 ASP D CG  1 
ATOM   8846  O  OD1 . ASP D  1 117 ? 13.411  61.733  27.358  1.00 47.09  ? 117 ASP D OD1 1 
ATOM   8847  O  OD2 . ASP D  1 117 ? 14.448  62.389  25.536  1.00 48.72  ? 117 ASP D OD2 1 
ATOM   8848  N  N   . GLY D  1 118 ? 10.327  58.575  26.335  1.00 41.41  ? 118 GLY D N   1 
ATOM   8849  C  CA  . GLY D  1 118 ? 9.129   57.864  25.926  1.00 30.17  ? 118 GLY D CA  1 
ATOM   8850  C  C   . GLY D  1 118 ? 8.356   58.478  24.749  1.00 40.83  ? 118 GLY D C   1 
ATOM   8851  O  O   . GLY D  1 118 ? 8.902   59.264  23.971  1.00 45.18  ? 118 GLY D O   1 
ATOM   8852  N  N   . VAL D  1 119 ? 7.078   58.116  24.618  1.00 43.45  ? 119 VAL D N   1 
ATOM   8853  C  CA  . VAL D  1 119 ? 6.308   58.420  23.407  1.00 47.43  ? 119 VAL D CA  1 
ATOM   8854  C  C   . VAL D  1 119 ? 5.411   59.666  23.508  1.00 49.59  ? 119 VAL D C   1 
ATOM   8855  O  O   . VAL D  1 119 ? 4.737   60.031  22.538  1.00 42.54  ? 119 VAL D O   1 
ATOM   8856  C  CB  . VAL D  1 119 ? 5.459   57.192  22.932  1.00 46.50  ? 119 VAL D CB  1 
ATOM   8857  C  CG1 . VAL D  1 119 ? 6.361   55.976  22.634  1.00 45.39  ? 119 VAL D CG1 1 
ATOM   8858  C  CG2 . VAL D  1 119 ? 4.399   56.821  23.960  1.00 41.74  ? 119 VAL D CG2 1 
ATOM   8859  N  N   . PHE D  1 120 ? 5.406   60.321  24.669  1.00 56.29  ? 120 PHE D N   1 
ATOM   8860  C  CA  . PHE D  1 120 ? 4.621   61.552  24.835  1.00 51.47  ? 120 PHE D CA  1 
ATOM   8861  C  C   . PHE D  1 120 ? 5.373   62.771  24.334  1.00 49.61  ? 120 PHE D C   1 
ATOM   8862  O  O   . PHE D  1 120 ? 5.461   63.781  25.033  1.00 51.26  ? 120 PHE D O   1 
ATOM   8863  C  CB  . PHE D  1 120 ? 4.215   61.779  26.298  1.00 48.88  ? 120 PHE D CB  1 
ATOM   8864  C  CG  . PHE D  1 120 ? 3.287   60.727  26.845  1.00 51.96  ? 120 PHE D CG  1 
ATOM   8865  C  CD1 . PHE D  1 120 ? 2.555   59.905  25.989  1.00 46.09  ? 120 PHE D CD1 1 
ATOM   8866  C  CD2 . PHE D  1 120 ? 3.127   60.575  28.215  1.00 48.38  ? 120 PHE D CD2 1 
ATOM   8867  C  CE1 . PHE D  1 120 ? 1.697   58.943  26.500  1.00 43.34  ? 120 PHE D CE1 1 
ATOM   8868  C  CE2 . PHE D  1 120 ? 2.268   59.613  28.735  1.00 45.91  ? 120 PHE D CE2 1 
ATOM   8869  C  CZ  . PHE D  1 120 ? 1.547   58.797  27.875  1.00 40.50  ? 120 PHE D CZ  1 
ATOM   8870  N  N   . GLY D  1 121 ? 5.937   62.674  23.135  1.00 45.97  ? 121 GLY D N   1 
ATOM   8871  C  CA  . GLY D  1 121 ? 6.518   63.841  22.482  1.00 47.43  ? 121 GLY D CA  1 
ATOM   8872  C  C   . GLY D  1 121 ? 5.997   63.943  21.062  1.00 49.53  ? 121 GLY D C   1 
ATOM   8873  O  O   . GLY D  1 121 ? 5.317   63.030  20.582  1.00 48.17  ? 121 GLY D O   1 
ATOM   8874  N  N   . GLU D  1 122 ? 6.302   65.041  20.381  1.00 54.34  ? 122 GLU D N   1 
ATOM   8875  C  CA  . GLU D  1 122 ? 5.810   65.229  19.017  1.00 53.35  ? 122 GLU D CA  1 
ATOM   8876  C  C   . GLU D  1 122 ? 6.399   64.122  18.182  1.00 43.34  ? 122 GLU D C   1 
ATOM   8877  O  O   . GLU D  1 122 ? 5.843   63.732  17.159  1.00 43.41  ? 122 GLU D O   1 
ATOM   8878  C  CB  . GLU D  1 122 ? 6.237   66.583  18.427  1.00 50.64  ? 122 GLU D CB  1 
ATOM   8879  C  CG  . GLU D  1 122 ? 5.834   67.798  19.231  1.00 57.65  ? 122 GLU D CG  1 
ATOM   8880  C  CD  . GLU D  1 122 ? 6.281   69.097  18.569  1.00 56.19  ? 122 GLU D CD  1 
ATOM   8881  O  OE1 . GLU D  1 122 ? 7.169   69.771  19.121  1.00 53.53  ? 122 GLU D OE1 1 
ATOM   8882  O  OE2 . GLU D  1 122 ? 5.759   69.430  17.486  1.00 55.61  ? 122 GLU D OE2 1 
ATOM   8883  N  N   . PHE D  1 123 ? 7.552   63.638  18.626  1.00 44.33  ? 123 PHE D N   1 
ATOM   8884  C  CA  . PHE D  1 123 ? 8.220   62.532  17.971  1.00 44.97  ? 123 PHE D CA  1 
ATOM   8885  C  C   . PHE D  1 123 ? 8.918   61.686  19.018  1.00 45.41  ? 123 PHE D C   1 
ATOM   8886  O  O   . PHE D  1 123 ? 9.188   62.156  20.125  1.00 39.05  ? 123 PHE D O   1 
ATOM   8887  C  CB  . PHE D  1 123 ? 9.248   63.048  16.960  1.00 45.91  ? 123 PHE D CB  1 
ATOM   8888  C  CG  . PHE D  1 123 ? 8.679   64.018  15.954  1.00 55.56  ? 123 PHE D CG  1 
ATOM   8889  C  CD1 . PHE D  1 123 ? 7.911   63.566  14.892  1.00 53.46  ? 123 PHE D CD1 1 
ATOM   8890  C  CD2 . PHE D  1 123 ? 8.913   65.382  16.075  1.00 57.50  ? 123 PHE D CD2 1 
ATOM   8891  C  CE1 . PHE D  1 123 ? 7.380   64.456  13.960  1.00 60.14  ? 123 PHE D CE1 1 
ATOM   8892  C  CE2 . PHE D  1 123 ? 8.386   66.283  15.150  1.00 60.24  ? 123 PHE D CE2 1 
ATOM   8893  C  CZ  . PHE D  1 123 ? 7.618   65.822  14.091  1.00 58.06  ? 123 PHE D CZ  1 
ATOM   8894  N  N   . PHE D  1 124 ? 9.209   60.437  18.663  1.00 39.58  ? 124 PHE D N   1 
ATOM   8895  C  CA  . PHE D  1 124 ? 10.072  59.602  19.491  1.00 46.28  ? 124 PHE D CA  1 
ATOM   8896  C  C   . PHE D  1 124 ? 10.936  58.698  18.619  1.00 49.56  ? 124 PHE D C   1 
ATOM   8897  O  O   . PHE D  1 124 ? 10.722  58.582  17.395  1.00 44.42  ? 124 PHE D O   1 
ATOM   8898  C  CB  . PHE D  1 124 ? 9.273   58.787  20.524  1.00 44.97  ? 124 PHE D CB  1 
ATOM   8899  C  CG  . PHE D  1 124 ? 8.199   57.919  19.919  1.00 51.35  ? 124 PHE D CG  1 
ATOM   8900  C  CD1 . PHE D  1 124 ? 8.462   56.595  19.574  1.00 50.48  ? 124 PHE D CD1 1 
ATOM   8901  C  CD2 . PHE D  1 124 ? 6.926   58.426  19.691  1.00 47.75  ? 124 PHE D CD2 1 
ATOM   8902  C  CE1 . PHE D  1 124 ? 7.479   55.796  19.010  1.00 48.76  ? 124 PHE D CE1 1 
ATOM   8903  C  CE2 . PHE D  1 124 ? 5.930   57.633  19.131  1.00 44.31  ? 124 PHE D CE2 1 
ATOM   8904  C  CZ  . PHE D  1 124 ? 6.205   56.316  18.785  1.00 42.11  ? 124 PHE D CZ  1 
ATOM   8905  N  N   . HIS D  1 125 ? 11.902  58.056  19.271  1.00 45.97  ? 125 HIS D N   1 
ATOM   8906  C  CA  . HIS D  1 125 ? 12.952  57.297  18.611  1.00 46.56  ? 125 HIS D CA  1 
ATOM   8907  C  C   . HIS D  1 125 ? 12.745  55.793  18.828  1.00 43.31  ? 125 HIS D C   1 
ATOM   8908  O  O   . HIS D  1 125 ? 12.529  55.338  19.952  1.00 46.92  ? 125 HIS D O   1 
ATOM   8909  C  CB  . HIS D  1 125 ? 14.312  57.741  19.166  1.00 44.13  ? 125 HIS D CB  1 
ATOM   8910  C  CG  . HIS D  1 125 ? 15.471  56.947  18.651  1.00 47.05  ? 125 HIS D CG  1 
ATOM   8911  N  ND1 . HIS D  1 125 ? 15.727  55.656  19.056  1.00 50.50  ? 125 HIS D ND1 1 
ATOM   8912  C  CD2 . HIS D  1 125 ? 16.449  57.264  17.771  1.00 47.02  ? 125 HIS D CD2 1 
ATOM   8913  C  CE1 . HIS D  1 125 ? 16.813  55.211  18.449  1.00 46.94  ? 125 HIS D CE1 1 
ATOM   8914  N  NE2 . HIS D  1 125 ? 17.268  56.165  17.659  1.00 44.56  ? 125 HIS D NE2 1 
ATOM   8915  N  N   . VAL D  1 126 ? 12.781  55.021  17.750  1.00 43.59  ? 126 VAL D N   1 
ATOM   8916  C  CA  . VAL D  1 126 ? 12.680  53.561  17.870  1.00 36.77  ? 126 VAL D CA  1 
ATOM   8917  C  C   . VAL D  1 126 ? 13.978  52.919  17.419  1.00 41.04  ? 126 VAL D C   1 
ATOM   8918  O  O   . VAL D  1 126 ? 14.394  53.084  16.265  1.00 35.94  ? 126 VAL D O   1 
ATOM   8919  C  CB  . VAL D  1 126 ? 11.501  52.974  17.074  1.00 35.99  ? 126 VAL D CB  1 
ATOM   8920  C  CG1 . VAL D  1 126 ? 11.440  51.434  17.254  1.00 31.95  ? 126 VAL D CG1 1 
ATOM   8921  C  CG2 . VAL D  1 126 ? 10.199  53.598  17.526  1.00 34.20  ? 126 VAL D CG2 1 
ATOM   8922  N  N   . ASN D  1 127 ? 14.639  52.232  18.348  1.00 35.89  ? 127 ASN D N   1 
ATOM   8923  C  CA  . ASN D  1 127 ? 15.853  51.497  18.018  1.00 37.96  ? 127 ASN D CA  1 
ATOM   8924  C  C   . ASN D  1 127 ? 15.505  50.255  17.209  1.00 36.22  ? 127 ASN D C   1 
ATOM   8925  O  O   . ASN D  1 127 ? 14.611  49.504  17.579  1.00 35.65  ? 127 ASN D O   1 
ATOM   8926  C  CB  . ASN D  1 127 ? 16.636  51.100  19.284  1.00 33.39  ? 127 ASN D CB  1 
ATOM   8927  C  CG  . ASN D  1 127 ? 15.775  50.375  20.299  1.00 39.20  ? 127 ASN D CG  1 
ATOM   8928  O  OD1 . ASN D  1 127 ? 14.822  50.946  20.828  1.00 36.79  ? 127 ASN D OD1 1 
ATOM   8929  N  ND2 . ASN D  1 127 ? 16.105  49.104  20.580  1.00 39.77  ? 127 ASN D ND2 1 
ATOM   8930  N  N   . ASP D  1 128 ? 16.228  50.045  16.114  1.00 36.29  ? 128 ASP D N   1 
ATOM   8931  C  CA  . ASP D  1 128 ? 16.067  48.860  15.270  1.00 36.95  ? 128 ASP D CA  1 
ATOM   8932  C  C   . ASP D  1 128 ? 14.632  48.685  14.760  1.00 42.08  ? 128 ASP D C   1 
ATOM   8933  O  O   . ASP D  1 128 ? 13.874  47.832  15.231  1.00 40.22  ? 128 ASP D O   1 
ATOM   8934  C  CB  . ASP D  1 128 ? 16.565  47.592  15.974  1.00 37.20  ? 128 ASP D CB  1 
ATOM   8935  C  CG  . ASP D  1 128 ? 16.914  46.484  14.985  1.00 41.99  ? 128 ASP D CG  1 
ATOM   8936  O  OD1 . ASP D  1 128 ? 16.401  46.554  13.833  1.00 38.61  ? 128 ASP D OD1 1 
ATOM   8937  O  OD2 . ASP D  1 128 ? 17.698  45.561  15.348  1.00 36.57  ? 128 ASP D OD2 1 
ATOM   8938  N  N   . ALA D  1 129 ? 14.266  49.512  13.790  1.00 34.22  ? 129 ALA D N   1 
ATOM   8939  C  CA  . ALA D  1 129 ? 12.906  49.527  13.310  1.00 36.25  ? 129 ALA D CA  1 
ATOM   8940  C  C   . ALA D  1 129 ? 12.476  48.164  12.770  1.00 37.32  ? 129 ALA D C   1 
ATOM   8941  O  O   . ALA D  1 129 ? 11.394  47.664  13.097  1.00 41.24  ? 129 ALA D O   1 
ATOM   8942  C  CB  . ALA D  1 129 ? 12.736  50.622  12.240  1.00 34.34  ? 129 ALA D CB  1 
ATOM   8943  N  N   . ASP D  1 130 ? 13.329  47.561  11.952  1.00 30.59  ? 130 ASP D N   1 
ATOM   8944  C  CA  . ASP D  1 130 ? 12.971  46.314  11.317  1.00 37.63  ? 130 ASP D CA  1 
ATOM   8945  C  C   . ASP D  1 130 ? 12.651  45.228  12.338  1.00 43.15  ? 130 ASP D C   1 
ATOM   8946  O  O   . ASP D  1 130 ? 11.839  44.339  12.051  1.00 40.44  ? 130 ASP D O   1 
ATOM   8947  C  CB  . ASP D  1 130 ? 14.065  45.875  10.341  1.00 39.38  ? 130 ASP D CB  1 
ATOM   8948  C  CG  . ASP D  1 130 ? 14.045  46.684  9.051   1.00 43.24  ? 130 ASP D CG  1 
ATOM   8949  O  OD1 . ASP D  1 130 ? 13.004  47.307  8.754   1.00 42.94  ? 130 ASP D OD1 1 
ATOM   8950  O  OD2 . ASP D  1 130 ? 15.059  46.693  8.329   1.00 44.51  ? 130 ASP D OD2 1 
ATOM   8951  N  N   . MET D  1 131 ? 13.263  45.303  13.526  1.00 32.61  ? 131 MET D N   1 
ATOM   8952  C  CA  . MET D  1 131 ? 13.051  44.265  14.549  1.00 33.72  ? 131 MET D CA  1 
ATOM   8953  C  C   . MET D  1 131 ? 11.991  44.667  15.580  1.00 37.43  ? 131 MET D C   1 
ATOM   8954  O  O   . MET D  1 131 ? 11.462  43.822  16.304  1.00 33.00  ? 131 MET D O   1 
ATOM   8955  C  CB  . MET D  1 131 ? 14.359  43.923  15.271  1.00 30.81  ? 131 MET D CB  1 
ATOM   8956  C  CG  . MET D  1 131 ? 15.402  43.206  14.396  1.00 38.06  ? 131 MET D CG  1 
ATOM   8957  S  SD  . MET D  1 131 ? 15.032  41.446  14.076  1.00 37.79  ? 131 MET D SD  1 
ATOM   8958  C  CE  . MET D  1 131 ? 13.742  41.563  12.845  1.00 137.16 ? 131 MET D CE  1 
ATOM   8959  N  N   . ASN D  1 132 ? 11.668  45.957  15.627  1.00 33.44  ? 132 ASN D N   1 
ATOM   8960  C  CA  . ASN D  1 132 ? 10.873  46.483  16.740  1.00 43.21  ? 132 ASN D CA  1 
ATOM   8961  C  C   . ASN D  1 132 ? 9.525   47.097  16.387  1.00 44.05  ? 132 ASN D C   1 
ATOM   8962  O  O   . ASN D  1 132 ? 8.745   47.420  17.277  1.00 51.02  ? 132 ASN D O   1 
ATOM   8963  C  CB  . ASN D  1 132 ? 11.710  47.448  17.611  1.00 31.83  ? 132 ASN D CB  1 
ATOM   8964  C  CG  . ASN D  1 132 ? 12.665  46.695  18.530  1.00 35.16  ? 132 ASN D CG  1 
ATOM   8965  O  OD1 . ASN D  1 132 ? 12.381  45.552  18.913  1.00 37.53  ? 132 ASN D OD1 1 
ATOM   8966  N  ND2 . ASN D  1 132 ? 13.802  47.311  18.871  1.00 33.13  ? 132 ASN D ND2 1 
ATOM   8967  N  N   . LEU D  1 133 ? 9.245   47.254  15.101  1.00 38.32  ? 133 LEU D N   1 
ATOM   8968  C  CA  . LEU D  1 133 ? 7.971   47.838  14.685  1.00 37.19  ? 133 LEU D CA  1 
ATOM   8969  C  C   . LEU D  1 133 ? 7.096   46.821  13.942  1.00 39.29  ? 133 LEU D C   1 
ATOM   8970  O  O   . LEU D  1 133 ? 7.607   45.850  13.387  1.00 41.91  ? 133 LEU D O   1 
ATOM   8971  C  CB  . LEU D  1 133 ? 8.215   49.051  13.792  1.00 28.43  ? 133 LEU D CB  1 
ATOM   8972  C  CG  . LEU D  1 133 ? 8.890   50.295  14.370  1.00 36.15  ? 133 LEU D CG  1 
ATOM   8973  C  CD1 . LEU D  1 133 ? 9.187   51.283  13.254  1.00 32.26  ? 133 LEU D CD1 1 
ATOM   8974  C  CD2 . LEU D  1 133 ? 8.022   50.955  15.429  1.00 39.53  ? 133 LEU D CD2 1 
ATOM   8975  N  N   . ALA D  1 134 ? 5.781   47.051  13.930  1.00 40.54  ? 134 ALA D N   1 
ATOM   8976  C  CA  . ALA D  1 134 ? 4.874   46.252  13.090  1.00 45.07  ? 134 ALA D CA  1 
ATOM   8977  C  C   . ALA D  1 134 ? 3.768   47.087  12.437  1.00 39.03  ? 134 ALA D C   1 
ATOM   8978  O  O   . ALA D  1 134 ? 3.139   47.931  13.076  1.00 31.56  ? 134 ALA D O   1 
ATOM   8979  C  CB  . ALA D  1 134 ? 4.271   45.084  13.875  1.00 36.24  ? 134 ALA D CB  1 
ATOM   8980  N  N   . HIS D  1 135 ? 3.541   46.824  11.157  1.00 41.85  ? 135 HIS D N   1 
ATOM   8981  C  CA  . HIS D  1 135 ? 2.534   47.535  10.386  1.00 46.13  ? 135 HIS D CA  1 
ATOM   8982  C  C   . HIS D  1 135 ? 1.157   47.342  11.002  1.00 46.44  ? 135 HIS D C   1 
ATOM   8983  O  O   . HIS D  1 135 ? 0.816   46.255  11.484  1.00 44.04  ? 135 HIS D O   1 
ATOM   8984  C  CB  . HIS D  1 135 ? 2.543   47.059  8.931   1.00 46.74  ? 135 HIS D CB  1 
ATOM   8985  C  CG  . HIS D  1 135 ? 3.846   47.286  8.227   1.00 44.03  ? 135 HIS D CG  1 
ATOM   8986  N  ND1 . HIS D  1 135 ? 4.255   48.531  7.798   1.00 45.13  ? 135 HIS D ND1 1 
ATOM   8987  C  CD2 . HIS D  1 135 ? 4.829   46.425  7.873   1.00 40.55  ? 135 HIS D CD2 1 
ATOM   8988  C  CE1 . HIS D  1 135 ? 5.435   48.429  7.212   1.00 41.32  ? 135 HIS D CE1 1 
ATOM   8989  N  NE2 . HIS D  1 135 ? 5.804   47.161  7.242   1.00 46.79  ? 135 HIS D NE2 1 
ATOM   8990  N  N   . LEU D  1 136 ? 0.373   48.410  10.997  1.00 41.53  ? 136 LEU D N   1 
ATOM   8991  C  CA  . LEU D  1 136 ? -0.959  48.370  11.578  1.00 43.02  ? 136 LEU D CA  1 
ATOM   8992  C  C   . LEU D  1 136 ? -2.002  48.297  10.480  1.00 43.92  ? 136 LEU D C   1 
ATOM   8993  O  O   . LEU D  1 136 ? -2.112  49.213  9.673   1.00 37.44  ? 136 LEU D O   1 
ATOM   8994  C  CB  . LEU D  1 136 ? -1.201  49.626  12.416  1.00 41.75  ? 136 LEU D CB  1 
ATOM   8995  C  CG  . LEU D  1 136 ? -2.600  49.756  13.025  1.00 46.95  ? 136 LEU D CG  1 
ATOM   8996  C  CD1 . LEU D  1 136 ? -2.870  48.603  14.000  1.00 47.69  ? 136 LEU D CD1 1 
ATOM   8997  C  CD2 . LEU D  1 136 ? -2.747  51.089  13.727  1.00 47.32  ? 136 LEU D CD2 1 
ATOM   8998  N  N   . PRO D  1 137 ? -2.775  47.205  10.444  1.00 44.70  ? 137 PRO D N   1 
ATOM   8999  C  CA  . PRO D  1 137 ? -3.817  47.093  9.421   1.00 39.70  ? 137 PRO D CA  1 
ATOM   9000  C  C   . PRO D  1 137 ? -4.790  48.247  9.603   1.00 45.77  ? 137 PRO D C   1 
ATOM   9001  O  O   . PRO D  1 137 ? -5.072  48.626  10.736  1.00 44.88  ? 137 PRO D O   1 
ATOM   9002  C  CB  . PRO D  1 137 ? -4.500  45.766  9.755   1.00 38.20  ? 137 PRO D CB  1 
ATOM   9003  C  CG  . PRO D  1 137 ? -3.482  45.015  10.639  1.00 35.88  ? 137 PRO D CG  1 
ATOM   9004  C  CD  . PRO D  1 137 ? -2.814  46.095  11.410  1.00 36.43  ? 137 PRO D CD  1 
ATOM   9005  N  N   . LYS D  1 138 ? -5.285  48.804  8.504   1.00 45.71  ? 138 LYS D N   1 
ATOM   9006  C  CA  . LYS D  1 138 ? -6.196  49.941  8.582   1.00 49.77  ? 138 LYS D CA  1 
ATOM   9007  C  C   . LYS D  1 138 ? -7.523  49.518  9.198   1.00 45.93  ? 138 LYS D C   1 
ATOM   9008  O  O   . LYS D  1 138 ? -8.261  50.339  9.733   1.00 44.94  ? 138 LYS D O   1 
ATOM   9009  C  CB  . LYS D  1 138 ? -6.420  50.528  7.193   1.00 51.63  ? 138 LYS D CB  1 
ATOM   9010  C  CG  . LYS D  1 138 ? -6.870  49.487  6.172   1.00 63.53  ? 138 LYS D CG  1 
ATOM   9011  C  CD  . LYS D  1 138 ? -7.030  50.109  4.791   1.00 75.18  ? 138 LYS D CD  1 
ATOM   9012  C  CE  . LYS D  1 138 ? -8.105  49.400  3.973   1.00 79.97  ? 138 LYS D CE  1 
ATOM   9013  N  NZ  . LYS D  1 138 ? -8.582  50.234  2.826   1.00 80.74  ? 138 LYS D NZ  1 
ATOM   9014  N  N   . GLU D  1 139 ? -7.817  48.227  9.126   1.00 45.30  ? 139 GLU D N   1 
ATOM   9015  C  CA  . GLU D  1 139 ? -9.062  47.693  9.665   1.00 48.82  ? 139 GLU D CA  1 
ATOM   9016  C  C   . GLU D  1 139 ? -9.180  47.868  11.185  1.00 49.18  ? 139 GLU D C   1 
ATOM   9017  O  O   . GLU D  1 139 ? -10.279 47.857  11.736  1.00 49.66  ? 139 GLU D O   1 
ATOM   9018  C  CB  . GLU D  1 139 ? -9.216  46.207  9.294   1.00 43.03  ? 139 GLU D CB  1 
ATOM   9019  C  CG  . GLU D  1 139 ? -9.442  45.942  7.808   1.00 45.48  ? 139 GLU D CG  1 
ATOM   9020  C  CD  . GLU D  1 139 ? -8.166  46.026  6.984   1.00 51.18  ? 139 GLU D CD  1 
ATOM   9021  O  OE1 . GLU D  1 139 ? -7.067  46.063  7.566   1.00 49.62  ? 139 GLU D OE1 1 
ATOM   9022  O  OE2 . GLU D  1 139 ? -8.255  46.040  5.743   1.00 57.77  ? 139 GLU D OE2 1 
ATOM   9023  N  N   . ILE D  1 140 ? -8.051  48.025  11.865  1.00 43.32  ? 140 ILE D N   1 
ATOM   9024  C  CA  . ILE D  1 140 ? -8.065  48.121  13.318  1.00 44.00  ? 140 ILE D CA  1 
ATOM   9025  C  C   . ILE D  1 140 ? -8.064  49.575  13.780  1.00 46.41  ? 140 ILE D C   1 
ATOM   9026  O  O   . ILE D  1 140 ? -7.159  50.331  13.441  1.00 51.47  ? 140 ILE D O   1 
ATOM   9027  C  CB  . ILE D  1 140 ? -6.858  47.389  13.933  1.00 36.97  ? 140 ILE D CB  1 
ATOM   9028  C  CG1 . ILE D  1 140 ? -6.948  45.894  13.636  1.00 39.00  ? 140 ILE D CG1 1 
ATOM   9029  C  CG2 . ILE D  1 140 ? -6.764  47.669  15.433  1.00 29.49  ? 140 ILE D CG2 1 
ATOM   9030  C  CD1 . ILE D  1 140 ? -5.714  45.137  14.047  1.00 46.13  ? 140 ILE D CD1 1 
ATOM   9031  N  N   . PRO D  1 141 ? -9.079  49.962  14.570  1.00 46.28  ? 141 PRO D N   1 
ATOM   9032  C  CA  . PRO D  1 141 ? -9.223  51.334  15.078  1.00 47.34  ? 141 PRO D CA  1 
ATOM   9033  C  C   . PRO D  1 141 ? -8.101  51.682  16.054  1.00 47.65  ? 141 PRO D C   1 
ATOM   9034  O  O   . PRO D  1 141 ? -7.671  50.812  16.828  1.00 48.88  ? 141 PRO D O   1 
ATOM   9035  C  CB  . PRO D  1 141 ? -10.558 51.300  15.833  1.00 49.53  ? 141 PRO D CB  1 
ATOM   9036  C  CG  . PRO D  1 141 ? -11.214 50.017  15.455  1.00 49.69  ? 141 PRO D CG  1 
ATOM   9037  C  CD  . PRO D  1 141 ? -10.139 49.068  15.066  1.00 41.19  ? 141 PRO D CD  1 
ATOM   9038  N  N   . LEU D  1 142 ? -7.658  52.940  16.032  1.00 40.40  ? 142 LEU D N   1 
ATOM   9039  C  CA  . LEU D  1 142 ? -6.531  53.380  16.843  1.00 38.04  ? 142 LEU D CA  1 
ATOM   9040  C  C   . LEU D  1 142 ? -6.700  53.044  18.322  1.00 44.46  ? 142 LEU D C   1 
ATOM   9041  O  O   . LEU D  1 142 ? -5.745  52.641  18.968  1.00 43.78  ? 142 LEU D O   1 
ATOM   9042  C  CB  . LEU D  1 142 ? -6.297  54.886  16.690  1.00 32.46  ? 142 LEU D CB  1 
ATOM   9043  C  CG  . LEU D  1 142 ? -6.016  55.428  15.288  1.00 42.01  ? 142 LEU D CG  1 
ATOM   9044  C  CD1 . LEU D  1 142 ? -5.736  56.939  15.353  1.00 45.21  ? 142 LEU D CD1 1 
ATOM   9045  C  CD2 . LEU D  1 142 ? -4.866  54.704  14.645  1.00 51.17  ? 142 LEU D CD2 1 
ATOM   9046  N  N   . GLU D  1 143 ? -7.902  53.238  18.859  1.00 46.41  ? 143 GLU D N   1 
ATOM   9047  C  CA  . GLU D  1 143 ? -8.117  53.086  20.295  1.00 50.97  ? 143 GLU D CA  1 
ATOM   9048  C  C   . GLU D  1 143 ? -7.987  51.637  20.723  1.00 53.33  ? 143 GLU D C   1 
ATOM   9049  O  O   . GLU D  1 143 ? -7.693  51.352  21.885  1.00 51.75  ? 143 GLU D O   1 
ATOM   9050  C  CB  . GLU D  1 143 ? -9.479  53.639  20.723  1.00 61.13  ? 143 GLU D CB  1 
ATOM   9051  C  CG  . GLU D  1 143 ? -10.654 53.115  19.919  1.00 72.24  ? 143 GLU D CG  1 
ATOM   9052  C  CD  . GLU D  1 143 ? -10.962 53.985  18.711  1.00 75.57  ? 143 GLU D CD  1 
ATOM   9053  O  OE1 . GLU D  1 143 ? -10.108 54.819  18.341  1.00 70.27  ? 143 GLU D OE1 1 
ATOM   9054  O  OE2 . GLU D  1 143 ? -12.064 53.839  18.137  1.00 79.43  ? 143 GLU D OE2 1 
ATOM   9055  N  N   . ALA D  1 144 ? -8.229  50.730  19.781  1.00 45.32  ? 144 ALA D N   1 
ATOM   9056  C  CA  . ALA D  1 144 ? -8.047  49.318  20.019  1.00 41.34  ? 144 ALA D CA  1 
ATOM   9057  C  C   . ALA D  1 144 ? -6.575  48.994  19.833  1.00 40.49  ? 144 ALA D C   1 
ATOM   9058  O  O   . ALA D  1 144 ? -5.958  48.317  20.654  1.00 40.50  ? 144 ALA D O   1 
ATOM   9059  C  CB  . ALA D  1 144 ? -8.894  48.511  19.048  1.00 40.41  ? 144 ALA D CB  1 
ATOM   9060  N  N   . ALA D  1 145 ? -6.011  49.502  18.745  1.00 43.63  ? 145 ALA D N   1 
ATOM   9061  C  CA  . ALA D  1 145 ? -4.617  49.248  18.430  1.00 37.60  ? 145 ALA D CA  1 
ATOM   9062  C  C   . ALA D  1 145 ? -3.693  49.677  19.562  1.00 39.33  ? 145 ALA D C   1 
ATOM   9063  O  O   . ALA D  1 145 ? -2.744  48.972  19.891  1.00 42.56  ? 145 ALA D O   1 
ATOM   9064  C  CB  . ALA D  1 145 ? -4.231  49.937  17.120  1.00 35.03  ? 145 ALA D CB  1 
ATOM   9065  N  N   . VAL D  1 146 ? -3.952  50.833  20.169  1.00 37.57  ? 146 VAL D N   1 
ATOM   9066  C  CA  . VAL D  1 146 ? -3.023  51.316  21.188  1.00 36.36  ? 146 VAL D CA  1 
ATOM   9067  C  C   . VAL D  1 146 ? -3.058  50.442  22.456  1.00 34.69  ? 146 VAL D C   1 
ATOM   9068  O  O   . VAL D  1 146 ? -2.226  50.584  23.339  1.00 37.66  ? 146 VAL D O   1 
ATOM   9069  C  CB  . VAL D  1 146 ? -3.213  52.835  21.505  1.00 39.37  ? 146 VAL D CB  1 
ATOM   9070  C  CG1 . VAL D  1 146 ? -4.434  53.062  22.360  1.00 40.46  ? 146 VAL D CG1 1 
ATOM   9071  C  CG2 . VAL D  1 146 ? -1.979  53.394  22.185  1.00 37.44  ? 146 VAL D CG2 1 
ATOM   9072  N  N   . MET D  1 147 ? -4.017  49.524  22.535  1.00 41.07  ? 147 MET D N   1 
ATOM   9073  C  CA  . MET D  1 147 ? -4.091  48.606  23.667  1.00 38.82  ? 147 MET D CA  1 
ATOM   9074  C  C   . MET D  1 147 ? -3.120  47.430  23.503  1.00 40.07  ? 147 MET D C   1 
ATOM   9075  O  O   . MET D  1 147 ? -2.971  46.604  24.394  1.00 33.51  ? 147 MET D O   1 
ATOM   9076  C  CB  . MET D  1 147 ? -5.519  48.073  23.835  1.00 39.86  ? 147 MET D CB  1 
ATOM   9077  C  CG  . MET D  1 147 ? -6.545  49.107  24.339  1.00 37.01  ? 147 MET D CG  1 
ATOM   9078  S  SD  . MET D  1 147 ? -6.111  49.792  25.959  1.00 47.97  ? 147 MET D SD  1 
ATOM   9079  C  CE  . MET D  1 147 ? -5.348  51.332  25.436  1.00 37.81  ? 147 MET D CE  1 
ATOM   9080  N  N   . ILE D  1 148 ? -2.473  47.354  22.350  1.00 41.18  ? 148 ILE D N   1 
ATOM   9081  C  CA  . ILE D  1 148 ? -1.647  46.203  22.013  1.00 39.10  ? 148 ILE D CA  1 
ATOM   9082  C  C   . ILE D  1 148 ? -0.224  46.291  22.596  1.00 42.73  ? 148 ILE D C   1 
ATOM   9083  O  O   . ILE D  1 148 ? 0.287   45.320  23.162  1.00 41.90  ? 148 ILE D O   1 
ATOM   9084  C  CB  . ILE D  1 148 ? -1.584  46.012  20.479  1.00 40.77  ? 148 ILE D CB  1 
ATOM   9085  C  CG1 . ILE D  1 148 ? -2.983  45.740  19.914  1.00 44.90  ? 148 ILE D CG1 1 
ATOM   9086  C  CG2 . ILE D  1 148 ? -0.636  44.882  20.114  1.00 40.69  ? 148 ILE D CG2 1 
ATOM   9087  C  CD1 . ILE D  1 148 ? -3.011  45.643  18.421  1.00 44.30  ? 148 ILE D CD1 1 
ATOM   9088  N  N   . PRO D  1 149 ? 0.422   47.460  22.456  1.00 37.58  ? 149 PRO D N   1 
ATOM   9089  C  CA  . PRO D  1 149 ? 1.812   47.614  22.901  1.00 35.32  ? 149 PRO D CA  1 
ATOM   9090  C  C   . PRO D  1 149 ? 2.113   47.149  24.326  1.00 38.64  ? 149 PRO D C   1 
ATOM   9091  O  O   . PRO D  1 149 ? 3.268   46.842  24.597  1.00 38.75  ? 149 PRO D O   1 
ATOM   9092  C  CB  . PRO D  1 149 ? 2.038   49.119  22.796  1.00 34.93  ? 149 PRO D CB  1 
ATOM   9093  C  CG  . PRO D  1 149 ? 1.164   49.529  21.635  1.00 44.31  ? 149 PRO D CG  1 
ATOM   9094  C  CD  . PRO D  1 149 ? -0.037  48.616  21.663  1.00 37.46  ? 149 PRO D CD  1 
ATOM   9095  N  N   . ASP D  1 150 ? 1.117   47.088  25.205  1.00 35.66  ? 150 ASP D N   1 
ATOM   9096  C  CA  . ASP D  1 150 ? 1.397   46.968  26.637  1.00 35.63  ? 150 ASP D CA  1 
ATOM   9097  C  C   . ASP D  1 150 ? 0.318   46.159  27.340  1.00 34.58  ? 150 ASP D C   1 
ATOM   9098  O  O   . ASP D  1 150 ? 0.601   45.099  27.903  1.00 33.62  ? 150 ASP D O   1 
ATOM   9099  C  CB  . ASP D  1 150 ? 1.508   48.381  27.260  1.00 34.08  ? 150 ASP D CB  1 
ATOM   9100  C  CG  . ASP D  1 150 ? 2.093   48.377  28.661  1.00 42.19  ? 150 ASP D CG  1 
ATOM   9101  O  OD1 . ASP D  1 150 ? 2.041   47.341  29.361  1.00 37.31  ? 150 ASP D OD1 1 
ATOM   9102  O  OD2 . ASP D  1 150 ? 2.612   49.441  29.066  1.00 43.86  ? 150 ASP D OD2 1 
ATOM   9103  N  N   . MET D  1 151 ? -0.922  46.647  27.297  1.00 33.52  ? 151 MET D N   1 
ATOM   9104  C  CA  . MET D  1 151 ? -2.004  45.991  28.023  1.00 38.39  ? 151 MET D CA  1 
ATOM   9105  C  C   . MET D  1 151 ? -2.170  44.563  27.531  1.00 41.13  ? 151 MET D C   1 
ATOM   9106  O  O   . MET D  1 151 ? -2.172  43.618  28.319  1.00 40.19  ? 151 MET D O   1 
ATOM   9107  C  CB  . MET D  1 151 ? -3.325  46.760  27.894  1.00 33.70  ? 151 MET D CB  1 
ATOM   9108  C  CG  . MET D  1 151 ? -3.303  48.177  28.463  1.00 36.55  ? 151 MET D CG  1 
ATOM   9109  S  SD  . MET D  1 151 ? -2.846  48.291  30.203  1.00 47.56  ? 151 MET D SD  1 
ATOM   9110  C  CE  . MET D  1 151 ? -1.058  48.489  30.081  1.00 38.44  ? 151 MET D CE  1 
ATOM   9111  N  N   . MET D  1 152 ? -2.274  44.398  26.219  1.00 37.37  ? 152 MET D N   1 
ATOM   9112  C  CA  . MET D  1 152 ? -2.474  43.067  25.667  1.00 34.97  ? 152 MET D CA  1 
ATOM   9113  C  C   . MET D  1 152 ? -1.261  42.155  25.834  1.00 32.63  ? 152 MET D C   1 
ATOM   9114  O  O   . MET D  1 152 ? -1.383  41.023  26.307  1.00 35.61  ? 152 MET D O   1 
ATOM   9115  C  CB  . MET D  1 152 ? -2.890  43.138  24.199  1.00 38.90  ? 152 MET D CB  1 
ATOM   9116  C  CG  . MET D  1 152 ? -3.399  41.818  23.693  1.00 37.48  ? 152 MET D CG  1 
ATOM   9117  S  SD  . MET D  1 152 ? -4.079  41.946  22.036  1.00 43.28  ? 152 MET D SD  1 
ATOM   9118  C  CE  . MET D  1 152 ? -5.338  43.183  22.306  1.00 28.12  ? 152 MET D CE  1 
ATOM   9119  N  N   . THR D  1 153 ? -0.090  42.624  25.433  1.00 31.03  ? 153 THR D N   1 
ATOM   9120  C  CA  . THR D  1 153 ? 1.089   41.780  25.566  1.00 33.11  ? 153 THR D CA  1 
ATOM   9121  C  C   . THR D  1 153 ? 1.318   41.395  27.043  1.00 37.15  ? 153 THR D C   1 
ATOM   9122  O  O   . THR D  1 153 ? 1.687   40.270  27.338  1.00 38.28  ? 153 THR D O   1 
ATOM   9123  C  CB  . THR D  1 153 ? 2.345   42.423  24.956  1.00 33.26  ? 153 THR D CB  1 
ATOM   9124  O  OG1 . THR D  1 153 ? 3.456   41.536  25.122  1.00 35.35  ? 153 THR D OG1 1 
ATOM   9125  C  CG2 . THR D  1 153 ? 2.646   43.778  25.617  1.00 31.80  ? 153 THR D CG2 1 
ATOM   9126  N  N   . THR D  1 154 ? 1.053   42.319  27.966  1.00 35.64  ? 154 THR D N   1 
ATOM   9127  C  CA  . THR D  1 154 ? 1.178   42.024  29.387  1.00 35.29  ? 154 THR D CA  1 
ATOM   9128  C  C   . THR D  1 154 ? 0.135   41.037  29.924  1.00 36.16  ? 154 THR D C   1 
ATOM   9129  O  O   . THR D  1 154 ? 0.478   40.045  30.567  1.00 29.83  ? 154 THR D O   1 
ATOM   9130  C  CB  . THR D  1 154 ? 1.153   43.301  30.249  1.00 41.02  ? 154 THR D CB  1 
ATOM   9131  O  OG1 . THR D  1 154 ? 2.346   44.064  30.011  1.00 38.57  ? 154 THR D OG1 1 
ATOM   9132  C  CG2 . THR D  1 154 ? 1.091   42.932  31.723  1.00 46.68  ? 154 THR D CG2 1 
ATOM   9133  N  N   . GLY D  1 155 ? -1.140  41.317  29.702  1.00 30.06  ? 155 GLY D N   1 
ATOM   9134  C  CA  . GLY D  1 155 ? -2.166  40.405  30.173  1.00 29.10  ? 155 GLY D CA  1 
ATOM   9135  C  C   . GLY D  1 155 ? -1.977  39.012  29.585  1.00 36.08  ? 155 GLY D C   1 
ATOM   9136  O  O   . GLY D  1 155 ? -2.097  37.988  30.279  1.00 30.87  ? 155 GLY D O   1 
ATOM   9137  N  N   . PHE D  1 156 ? -1.670  38.961  28.296  1.00 33.60  ? 156 PHE D N   1 
ATOM   9138  C  CA  . PHE D  1 156 ? -1.548  37.672  27.624  1.00 34.97  ? 156 PHE D CA  1 
ATOM   9139  C  C   . PHE D  1 156 ? -0.330  36.891  28.130  1.00 36.61  ? 156 PHE D C   1 
ATOM   9140  O  O   . PHE D  1 156 ? -0.352  35.659  28.225  1.00 31.50  ? 156 PHE D O   1 
ATOM   9141  C  CB  . PHE D  1 156 ? -1.550  37.862  26.103  1.00 36.46  ? 156 PHE D CB  1 
ATOM   9142  C  CG  . PHE D  1 156 ? -2.933  38.136  25.526  1.00 38.95  ? 156 PHE D CG  1 
ATOM   9143  C  CD1 . PHE D  1 156 ? -3.971  38.561  26.344  1.00 38.27  ? 156 PHE D CD1 1 
ATOM   9144  C  CD2 . PHE D  1 156 ? -3.189  37.969  24.167  1.00 43.74  ? 156 PHE D CD2 1 
ATOM   9145  C  CE1 . PHE D  1 156 ? -5.241  38.796  25.817  1.00 40.45  ? 156 PHE D CE1 1 
ATOM   9146  C  CE2 . PHE D  1 156 ? -4.462  38.209  23.629  1.00 43.50  ? 156 PHE D CE2 1 
ATOM   9147  C  CZ  . PHE D  1 156 ? -5.485  38.613  24.450  1.00 34.83  ? 156 PHE D CZ  1 
ATOM   9148  N  N   . HIS D  1 157 ? 0.724   37.616  28.484  1.00 34.83  ? 157 HIS D N   1 
ATOM   9149  C  CA  . HIS D  1 157 ? 1.924   36.977  28.983  1.00 34.71  ? 157 HIS D CA  1 
ATOM   9150  C  C   . HIS D  1 157 ? 1.649   36.312  30.325  1.00 35.35  ? 157 HIS D C   1 
ATOM   9151  O  O   . HIS D  1 157 ? 2.221   35.276  30.622  1.00 38.19  ? 157 HIS D O   1 
ATOM   9152  C  CB  . HIS D  1 157 ? 3.067   37.981  29.085  1.00 35.29  ? 157 HIS D CB  1 
ATOM   9153  C  CG  . HIS D  1 157 ? 4.419   37.353  29.247  1.00 32.74  ? 157 HIS D CG  1 
ATOM   9154  N  ND1 . HIS D  1 157 ? 4.871   36.335  28.434  1.00 36.66  ? 157 HIS D ND1 1 
ATOM   9155  C  CD2 . HIS D  1 157 ? 5.437   37.637  30.097  1.00 30.94  ? 157 HIS D CD2 1 
ATOM   9156  C  CE1 . HIS D  1 157 ? 6.102   36.006  28.789  1.00 35.11  ? 157 HIS D CE1 1 
ATOM   9157  N  NE2 . HIS D  1 157 ? 6.469   36.782  29.794  1.00 32.46  ? 157 HIS D NE2 1 
ATOM   9158  N  N   . GLY D  1 158 ? 0.772   36.911  31.128  1.00 29.11  ? 158 GLY D N   1 
ATOM   9159  C  CA  . GLY D  1 158 ? 0.276   36.268  32.339  1.00 29.63  ? 158 GLY D CA  1 
ATOM   9160  C  C   . GLY D  1 158 ? -0.328  34.890  32.058  1.00 31.76  ? 158 GLY D C   1 
ATOM   9161  O  O   . GLY D  1 158 ? -0.046  33.889  32.753  1.00 29.04  ? 158 GLY D O   1 
ATOM   9162  N  N   . ALA D  1 159 ? -1.162  34.832  31.032  1.00 30.14  ? 159 ALA D N   1 
ATOM   9163  C  CA  . ALA D  1 159 ? -1.776  33.561  30.623  1.00 30.65  ? 159 ALA D CA  1 
ATOM   9164  C  C   . ALA D  1 159 ? -0.764  32.559  30.023  1.00 34.68  ? 159 ALA D C   1 
ATOM   9165  O  O   . ALA D  1 159 ? -0.884  31.358  30.228  1.00 33.16  ? 159 ALA D O   1 
ATOM   9166  C  CB  . ALA D  1 159 ? -2.945  33.810  29.659  1.00 28.48  ? 159 ALA D CB  1 
ATOM   9167  N  N   . GLU D  1 160 ? 0.238   33.050  29.298  1.00 38.13  ? 160 GLU D N   1 
ATOM   9168  C  CA  . GLU D  1 160 ? 1.267   32.172  28.732  1.00 32.81  ? 160 GLU D CA  1 
ATOM   9169  C  C   . GLU D  1 160 ? 2.119   31.539  29.818  1.00 31.46  ? 160 GLU D C   1 
ATOM   9170  O  O   . GLU D  1 160 ? 2.276   30.314  29.858  1.00 22.68  ? 160 GLU D O   1 
ATOM   9171  C  CB  . GLU D  1 160 ? 2.163   32.936  27.748  1.00 33.13  ? 160 GLU D CB  1 
ATOM   9172  C  CG  . GLU D  1 160 ? 1.404   33.448  26.511  1.00 39.18  ? 160 GLU D CG  1 
ATOM   9173  C  CD  . GLU D  1 160 ? 2.184   34.487  25.726  1.00 42.03  ? 160 GLU D CD  1 
ATOM   9174  O  OE1 . GLU D  1 160 ? 2.717   35.436  26.349  1.00 37.44  ? 160 GLU D OE1 1 
ATOM   9175  O  OE2 . GLU D  1 160 ? 2.259   34.354  24.487  1.00 42.01  ? 160 GLU D OE2 1 
ATOM   9176  N  N   . LEU D  1 161 ? 2.666   32.392  30.685  1.00 30.72  ? 161 LEU D N   1 
ATOM   9177  C  CA  . LEU D  1 161 ? 3.494   31.964  31.801  1.00 34.75  ? 161 LEU D CA  1 
ATOM   9178  C  C   . LEU D  1 161 ? 2.734   30.969  32.657  1.00 32.06  ? 161 LEU D C   1 
ATOM   9179  O  O   . LEU D  1 161 ? 3.322   30.085  33.270  1.00 34.41  ? 161 LEU D O   1 
ATOM   9180  C  CB  . LEU D  1 161 ? 3.885   33.168  32.676  1.00 32.47  ? 161 LEU D CB  1 
ATOM   9181  C  CG  . LEU D  1 161 ? 4.897   34.172  32.114  1.00 38.44  ? 161 LEU D CG  1 
ATOM   9182  C  CD1 . LEU D  1 161 ? 5.119   35.335  33.094  1.00 31.18  ? 161 LEU D CD1 1 
ATOM   9183  C  CD2 . LEU D  1 161 ? 6.207   33.485  31.762  1.00 39.31  ? 161 LEU D CD2 1 
ATOM   9184  N  N   . ALA D  1 162 ? 1.417   31.136  32.706  1.00 32.68  ? 162 ALA D N   1 
ATOM   9185  C  CA  . ALA D  1 162 ? 0.580   30.298  33.552  1.00 28.55  ? 162 ALA D CA  1 
ATOM   9186  C  C   . ALA D  1 162 ? 0.497   28.848  33.042  1.00 28.04  ? 162 ALA D C   1 
ATOM   9187  O  O   . ALA D  1 162 ? 0.070   27.956  33.775  1.00 27.81  ? 162 ALA D O   1 
ATOM   9188  C  CB  . ALA D  1 162 ? -0.805  30.907  33.678  1.00 31.43  ? 162 ALA D CB  1 
ATOM   9189  N  N   . ASP D  1 163 ? 0.908   28.630  31.793  1.00 24.60  ? 163 ASP D N   1 
ATOM   9190  C  CA  . ASP D  1 163 ? 0.924   27.287  31.198  1.00 35.08  ? 163 ASP D CA  1 
ATOM   9191  C  C   . ASP D  1 163 ? -0.400  26.566  31.439  1.00 34.78  ? 163 ASP D C   1 
ATOM   9192  O  O   . ASP D  1 163 ? -0.451  25.492  32.057  1.00 36.85  ? 163 ASP D O   1 
ATOM   9193  C  CB  . ASP D  1 163 ? 2.082   26.477  31.781  1.00 42.55  ? 163 ASP D CB  1 
ATOM   9194  C  CG  . ASP D  1 163 ? 2.446   25.269  30.930  1.00 47.14  ? 163 ASP D CG  1 
ATOM   9195  O  OD1 . ASP D  1 163 ? 1.869   25.093  29.829  1.00 41.33  ? 163 ASP D OD1 1 
ATOM   9196  O  OD2 . ASP D  1 163 ? 3.316   24.487  31.379  1.00 48.50  ? 163 ASP D OD2 1 
ATOM   9197  N  N   . ILE D  1 164 ? -1.472  27.177  30.956  1.00 25.83  ? 164 ILE D N   1 
ATOM   9198  C  CA  . ILE D  1 164 ? -2.828  26.699  31.214  1.00 29.38  ? 164 ILE D CA  1 
ATOM   9199  C  C   . ILE D  1 164 ? -3.171  25.352  30.524  1.00 35.18  ? 164 ILE D C   1 
ATOM   9200  O  O   . ILE D  1 164 ? -2.871  25.149  29.347  1.00 32.32  ? 164 ILE D O   1 
ATOM   9201  C  CB  . ILE D  1 164 ? -3.851  27.802  30.820  1.00 34.21  ? 164 ILE D CB  1 
ATOM   9202  C  CG1 . ILE D  1 164 ? -3.643  29.037  31.720  1.00 37.35  ? 164 ILE D CG1 1 
ATOM   9203  C  CG2 . ILE D  1 164 ? -5.282  27.269  30.887  1.00 27.33  ? 164 ILE D CG2 1 
ATOM   9204  C  CD1 . ILE D  1 164 ? -4.210  30.361  31.173  1.00 32.33  ? 164 ILE D CD1 1 
ATOM   9205  N  N   . GLU D  1 165 ? -3.776  24.434  31.281  1.00 28.64  ? 165 GLU D N   1 
ATOM   9206  C  CA  . GLU D  1 165 ? -4.341  23.202  30.719  1.00 36.03  ? 165 GLU D CA  1 
ATOM   9207  C  C   . GLU D  1 165 ? -5.765  23.461  30.218  1.00 37.17  ? 165 GLU D C   1 
ATOM   9208  O  O   . GLU D  1 165 ? -6.544  24.186  30.847  1.00 33.36  ? 165 GLU D O   1 
ATOM   9209  C  CB  . GLU D  1 165 ? -4.404  22.100  31.781  1.00 36.29  ? 165 GLU D CB  1 
ATOM   9210  C  CG  . GLU D  1 165 ? -3.060  21.694  32.386  1.00 41.36  ? 165 GLU D CG  1 
ATOM   9211  C  CD  . GLU D  1 165 ? -3.210  21.198  33.819  1.00 48.30  ? 165 GLU D CD  1 
ATOM   9212  O  OE1 . GLU D  1 165 ? -3.285  22.045  34.748  1.00 42.31  ? 165 GLU D OE1 1 
ATOM   9213  O  OE2 . GLU D  1 165 ? -3.255  19.961  34.013  1.00 48.15  ? 165 GLU D OE2 1 
ATOM   9214  N  N   . MET D  1 166 ? -6.116  22.856  29.097  1.00 34.41  ? 166 MET D N   1 
ATOM   9215  C  CA  . MET D  1 166 ? -7.441  23.060  28.538  1.00 33.18  ? 166 MET D CA  1 
ATOM   9216  C  C   . MET D  1 166 ? -8.498  22.619  29.535  1.00 31.90  ? 166 MET D C   1 
ATOM   9217  O  O   . MET D  1 166 ? -8.469  21.499  29.997  1.00 32.26  ? 166 MET D O   1 
ATOM   9218  C  CB  . MET D  1 166 ? -7.571  22.281  27.239  1.00 35.33  ? 166 MET D CB  1 
ATOM   9219  C  CG  . MET D  1 166 ? -6.607  22.767  26.179  1.00 33.78  ? 166 MET D CG  1 
ATOM   9220  S  SD  . MET D  1 166 ? -7.173  22.341  24.537  1.00 41.08  ? 166 MET D SD  1 
ATOM   9221  C  CE  . MET D  1 166 ? -8.425  23.598  24.265  1.00 32.79  ? 166 MET D CE  1 
ATOM   9222  N  N   . GLY D  1 167 ? -9.431  23.505  29.874  1.00 33.83  ? 167 GLY D N   1 
ATOM   9223  C  CA  . GLY D  1 167 ? -10.522 23.148  30.769  1.00 31.34  ? 167 GLY D CA  1 
ATOM   9224  C  C   . GLY D  1 167 ? -10.282 23.430  32.244  1.00 34.77  ? 167 GLY D C   1 
ATOM   9225  O  O   . GLY D  1 167 ? -11.202 23.339  33.061  1.00 30.73  ? 167 GLY D O   1 
ATOM   9226  N  N   . SER D  1 168 ? -9.046  23.774  32.593  1.00 31.81  ? 168 SER D N   1 
ATOM   9227  C  CA  . SER D  1 168 ? -8.698  24.028  33.988  1.00 37.39  ? 168 SER D CA  1 
ATOM   9228  C  C   . SER D  1 168 ? -9.226  25.366  34.504  1.00 39.78  ? 168 SER D C   1 
ATOM   9229  O  O   . SER D  1 168 ? -9.606  26.251  33.718  1.00 34.53  ? 168 SER D O   1 
ATOM   9230  C  CB  . SER D  1 168 ? -7.185  23.975  34.186  1.00 38.36  ? 168 SER D CB  1 
ATOM   9231  O  OG  . SER D  1 168 ? -6.548  25.032  33.499  1.00 36.04  ? 168 SER D OG  1 
ATOM   9232  N  N   . SER D  1 169 ? -9.246  25.492  35.832  1.00 28.63  ? 169 SER D N   1 
ATOM   9233  C  CA  . SER D  1 169 ? -9.750  26.684  36.507  1.00 31.80  ? 169 SER D CA  1 
ATOM   9234  C  C   . SER D  1 169 ? -8.653  27.715  36.722  1.00 34.68  ? 169 SER D C   1 
ATOM   9235  O  O   . SER D  1 169 ? -7.527  27.359  37.103  1.00 32.56  ? 169 SER D O   1 
ATOM   9236  C  CB  . SER D  1 169 ? -10.351 26.314  37.867  1.00 27.27  ? 169 SER D CB  1 
ATOM   9237  O  OG  . SER D  1 169 ? -9.373  25.768  38.740  1.00 33.55  ? 169 SER D OG  1 
ATOM   9238  N  N   . VAL D  1 170 ? -8.996  28.990  36.513  1.00 38.93  ? 170 VAL D N   1 
ATOM   9239  C  CA  . VAL D  1 170 ? -8.048  30.092  36.678  1.00 36.69  ? 170 VAL D CA  1 
ATOM   9240  C  C   . VAL D  1 170 ? -8.614  31.248  37.514  1.00 42.49  ? 170 VAL D C   1 
ATOM   9241  O  O   . VAL D  1 170 ? -9.711  31.746  37.234  1.00 41.51  ? 170 VAL D O   1 
ATOM   9242  C  CB  . VAL D  1 170 ? -7.651  30.675  35.315  1.00 34.81  ? 170 VAL D CB  1 
ATOM   9243  C  CG1 . VAL D  1 170 ? -6.557  31.731  35.489  1.00 32.85  ? 170 VAL D CG1 1 
ATOM   9244  C  CG2 . VAL D  1 170 ? -7.222  29.568  34.359  1.00 31.04  ? 170 VAL D CG2 1 
ATOM   9245  N  N   . VAL D  1 171 ? -7.868  31.680  38.528  1.00 36.78  ? 171 VAL D N   1 
ATOM   9246  C  CA  . VAL D  1 171 ? -8.198  32.919  39.226  1.00 37.29  ? 171 VAL D CA  1 
ATOM   9247  C  C   . VAL D  1 171 ? -7.307  34.023  38.672  1.00 41.19  ? 171 VAL D C   1 
ATOM   9248  O  O   . VAL D  1 171 ? -6.101  33.818  38.485  1.00 39.64  ? 171 VAL D O   1 
ATOM   9249  C  CB  . VAL D  1 171 ? -8.006  32.828  40.763  1.00 37.48  ? 171 VAL D CB  1 
ATOM   9250  C  CG1 . VAL D  1 171 ? -8.099  34.236  41.407  1.00 35.96  ? 171 VAL D CG1 1 
ATOM   9251  C  CG2 . VAL D  1 171 ? -9.030  31.907  41.376  1.00 40.03  ? 171 VAL D CG2 1 
ATOM   9252  N  N   . VAL D  1 172 ? -7.907  35.172  38.367  1.00 36.85  ? 172 VAL D N   1 
ATOM   9253  C  CA  . VAL D  1 172 ? -7.144  36.373  38.016  1.00 42.78  ? 172 VAL D CA  1 
ATOM   9254  C  C   . VAL D  1 172 ? -7.393  37.429  39.085  1.00 45.92  ? 172 VAL D C   1 
ATOM   9255  O  O   . VAL D  1 172 ? -8.516  37.919  39.240  1.00 47.84  ? 172 VAL D O   1 
ATOM   9256  C  CB  . VAL D  1 172 ? -7.554  36.963  36.647  1.00 38.02  ? 172 VAL D CB  1 
ATOM   9257  C  CG1 . VAL D  1 172 ? -6.707  38.200  36.326  1.00 32.44  ? 172 VAL D CG1 1 
ATOM   9258  C  CG2 . VAL D  1 172 ? -7.432  35.912  35.544  1.00 34.05  ? 172 VAL D CG2 1 
ATOM   9259  N  N   . ILE D  1 173 ? -6.353  37.761  39.835  1.00 41.19  ? 173 ILE D N   1 
ATOM   9260  C  CA  . ILE D  1 173 ? -6.480  38.720  40.917  1.00 37.04  ? 173 ILE D CA  1 
ATOM   9261  C  C   . ILE D  1 173 ? -6.133  40.080  40.373  1.00 36.82  ? 173 ILE D C   1 
ATOM   9262  O  O   . ILE D  1 173 ? -5.000  40.318  39.973  1.00 35.91  ? 173 ILE D O   1 
ATOM   9263  C  CB  . ILE D  1 173 ? -5.519  38.422  42.075  1.00 35.67  ? 173 ILE D CB  1 
ATOM   9264  C  CG1 . ILE D  1 173 ? -5.714  36.997  42.589  1.00 35.30  ? 173 ILE D CG1 1 
ATOM   9265  C  CG2 . ILE D  1 173 ? -5.706  39.457  43.202  1.00 40.17  ? 173 ILE D CG2 1 
ATOM   9266  C  CD1 . ILE D  1 173 ? -4.714  36.576  43.669  1.00 36.14  ? 173 ILE D CD1 1 
ATOM   9267  N  N   . GLY D  1 174 ? -7.115  40.968  40.349  1.00 38.00  ? 174 GLY D N   1 
ATOM   9268  C  CA  . GLY D  1 174 ? -6.909  42.292  39.795  1.00 47.37  ? 174 GLY D CA  1 
ATOM   9269  C  C   . GLY D  1 174 ? -7.542  42.392  38.423  1.00 49.89  ? 174 GLY D C   1 
ATOM   9270  O  O   . GLY D  1 174 ? -7.099  41.726  37.476  1.00 48.23  ? 174 GLY D O   1 
ATOM   9271  N  N   . ILE D  1 175 ? -8.581  43.216  38.307  1.00 43.23  ? 175 ILE D N   1 
ATOM   9272  C  CA  . ILE D  1 175 ? -9.251  43.374  37.021  1.00 48.48  ? 175 ILE D CA  1 
ATOM   9273  C  C   . ILE D  1 175 ? -9.212  44.791  36.448  1.00 50.99  ? 175 ILE D C   1 
ATOM   9274  O  O   . ILE D  1 175 ? -10.203 45.281  35.903  1.00 43.40  ? 175 ILE D O   1 
ATOM   9275  C  CB  . ILE D  1 175 ? -10.687 42.857  37.054  1.00 52.37  ? 175 ILE D CB  1 
ATOM   9276  C  CG1 . ILE D  1 175 ? -11.475 43.520  38.182  1.00 47.77  ? 175 ILE D CG1 1 
ATOM   9277  C  CG2 . ILE D  1 175 ? -10.683 41.337  37.205  1.00 58.80  ? 175 ILE D CG2 1 
ATOM   9278  C  CD1 . ILE D  1 175 ? -12.958 43.195  38.135  1.00 49.13  ? 175 ILE D CD1 1 
ATOM   9279  N  N   . GLY D  1 176 ? -8.053  45.431  36.571  1.00 45.06  ? 176 GLY D N   1 
ATOM   9280  C  CA  . GLY D  1 176 ? -7.731  46.588  35.757  1.00 39.89  ? 176 GLY D CA  1 
ATOM   9281  C  C   . GLY D  1 176 ? -7.451  46.115  34.341  1.00 45.65  ? 176 GLY D C   1 
ATOM   9282  O  O   . GLY D  1 176 ? -7.641  44.923  34.037  1.00 41.67  ? 176 GLY D O   1 
ATOM   9283  N  N   . ALA D  1 177 ? -6.993  47.025  33.479  1.00 44.30  ? 177 ALA D N   1 
ATOM   9284  C  CA  . ALA D  1 177 ? -6.780  46.704  32.060  1.00 39.46  ? 177 ALA D CA  1 
ATOM   9285  C  C   . ALA D  1 177 ? -5.951  45.424  31.860  1.00 41.37  ? 177 ALA D C   1 
ATOM   9286  O  O   . ALA D  1 177 ? -6.389  44.493  31.189  1.00 39.73  ? 177 ALA D O   1 
ATOM   9287  C  CB  . ALA D  1 177 ? -6.140  47.875  31.338  1.00 36.55  ? 177 ALA D CB  1 
ATOM   9288  N  N   . VAL D  1 178 ? -4.761  45.383  32.454  1.00 43.36  ? 178 VAL D N   1 
ATOM   9289  C  CA  . VAL D  1 178 ? -3.884  44.207  32.376  1.00 39.38  ? 178 VAL D CA  1 
ATOM   9290  C  C   . VAL D  1 178 ? -4.587  42.944  32.856  1.00 34.60  ? 178 VAL D C   1 
ATOM   9291  O  O   . VAL D  1 178 ? -4.554  41.908  32.200  1.00 38.91  ? 178 VAL D O   1 
ATOM   9292  C  CB  . VAL D  1 178 ? -2.616  44.425  33.217  1.00 43.33  ? 178 VAL D CB  1 
ATOM   9293  C  CG1 . VAL D  1 178 ? -1.961  43.097  33.569  1.00 49.38  ? 178 VAL D CG1 1 
ATOM   9294  C  CG2 . VAL D  1 178 ? -1.653  45.333  32.472  1.00 44.19  ? 178 VAL D CG2 1 
ATOM   9295  N  N   . GLY D  1 179 ? -5.227  43.044  34.013  1.00 37.67  ? 179 GLY D N   1 
ATOM   9296  C  CA  . GLY D  1 179 ? -5.955  41.933  34.582  1.00 35.76  ? 179 GLY D CA  1 
ATOM   9297  C  C   . GLY D  1 179 ? -7.046  41.469  33.635  1.00 40.20  ? 179 GLY D C   1 
ATOM   9298  O  O   . GLY D  1 179 ? -7.365  40.285  33.582  1.00 39.03  ? 179 GLY D O   1 
ATOM   9299  N  N   . LEU D  1 180 ? -7.620  42.406  32.883  1.00 38.05  ? 180 LEU D N   1 
ATOM   9300  C  CA  . LEU D  1 180 ? -8.715  42.080  31.981  1.00 39.12  ? 180 LEU D CA  1 
ATOM   9301  C  C   . LEU D  1 180 ? -8.198  41.343  30.754  1.00 38.98  ? 180 LEU D C   1 
ATOM   9302  O  O   . LEU D  1 180 ? -8.868  40.450  30.235  1.00 36.65  ? 180 LEU D O   1 
ATOM   9303  C  CB  . LEU D  1 180 ? -9.481  43.333  31.566  1.00 43.84  ? 180 LEU D CB  1 
ATOM   9304  C  CG  . LEU D  1 180 ? -10.328 43.962  32.670  1.00 47.34  ? 180 LEU D CG  1 
ATOM   9305  C  CD1 . LEU D  1 180 ? -10.791 45.351  32.249  1.00 40.27  ? 180 LEU D CD1 1 
ATOM   9306  C  CD2 . LEU D  1 180 ? -11.511 43.063  33.016  1.00 42.33  ? 180 LEU D CD2 1 
ATOM   9307  N  N   . MET D  1 181 ? -7.008  41.712  30.291  1.00 36.92  ? 181 MET D N   1 
ATOM   9308  C  CA  . MET D  1 181 ? -6.372  40.971  29.203  1.00 36.57  ? 181 MET D CA  1 
ATOM   9309  C  C   . MET D  1 181 ? -5.854  39.609  29.690  1.00 31.58  ? 181 MET D C   1 
ATOM   9310  O  O   . MET D  1 181 ? -5.642  38.695  28.894  1.00 31.64  ? 181 MET D O   1 
ATOM   9311  C  CB  . MET D  1 181 ? -5.249  41.796  28.582  1.00 37.34  ? 181 MET D CB  1 
ATOM   9312  C  CG  . MET D  1 181 ? -5.780  43.003  27.788  1.00 43.20  ? 181 MET D CG  1 
ATOM   9313  S  SD  . MET D  1 181 ? -6.631  42.499  26.276  1.00 41.55  ? 181 MET D SD  1 
ATOM   9314  C  CE  . MET D  1 181 ? -8.343  42.499  26.803  1.00 38.18  ? 181 MET D CE  1 
ATOM   9315  N  N   . GLY D  1 182 ? -5.645  39.493  30.999  1.00 33.32  ? 182 GLY D N   1 
ATOM   9316  C  CA  . GLY D  1 182 ? -5.232  38.232  31.595  1.00 35.22  ? 182 GLY D CA  1 
ATOM   9317  C  C   . GLY D  1 182 ? -6.387  37.257  31.518  1.00 38.41  ? 182 GLY D C   1 
ATOM   9318  O  O   . GLY D  1 182 ? -6.215  36.066  31.190  1.00 38.37  ? 182 GLY D O   1 
ATOM   9319  N  N   . ILE D  1 183 ? -7.577  37.774  31.814  1.00 37.71  ? 183 ILE D N   1 
ATOM   9320  C  CA  . ILE D  1 183 ? -8.804  36.991  31.689  1.00 40.86  ? 183 ILE D CA  1 
ATOM   9321  C  C   . ILE D  1 183 ? -9.051  36.550  30.241  1.00 39.17  ? 183 ILE D C   1 
ATOM   9322  O  O   . ILE D  1 183 ? -9.376  35.389  29.987  1.00 34.34  ? 183 ILE D O   1 
ATOM   9323  C  CB  . ILE D  1 183 ? -10.027 37.761  32.214  1.00 39.22  ? 183 ILE D CB  1 
ATOM   9324  C  CG1 . ILE D  1 183 ? -9.952  37.929  33.733  1.00 38.15  ? 183 ILE D CG1 1 
ATOM   9325  C  CG2 . ILE D  1 183 ? -11.313 37.035  31.852  1.00 42.10  ? 183 ILE D CG2 1 
ATOM   9326  C  CD1 . ILE D  1 183 ? -11.112 38.769  34.308  1.00 33.74  ? 183 ILE D CD1 1 
ATOM   9327  N  N   . ALA D  1 184 ? -8.892  37.474  29.298  1.00 42.33  ? 184 ALA D N   1 
ATOM   9328  C  CA  . ALA D  1 184 ? -9.009  37.150  27.868  1.00 42.17  ? 184 ALA D CA  1 
ATOM   9329  C  C   . ALA D  1 184 ? -7.970  36.107  27.414  1.00 36.50  ? 184 ALA D C   1 
ATOM   9330  O  O   . ALA D  1 184 ? -8.300  35.140  26.719  1.00 37.61  ? 184 ALA D O   1 
ATOM   9331  C  CB  . ALA D  1 184 ? -8.872  38.408  27.042  1.00 35.54  ? 184 ALA D CB  1 
ATOM   9332  N  N   . GLY D  1 185 ? -6.712  36.327  27.790  1.00 39.10  ? 185 GLY D N   1 
ATOM   9333  C  CA  . GLY D  1 185 ? -5.648  35.376  27.503  1.00 32.60  ? 185 GLY D CA  1 
ATOM   9334  C  C   . GLY D  1 185 ? -5.923  33.977  28.056  1.00 28.62  ? 185 GLY D C   1 
ATOM   9335  O  O   . GLY D  1 185 ? -5.672  32.969  27.391  1.00 30.50  ? 185 GLY D O   1 
ATOM   9336  N  N   . ALA D  1 186 ? -6.441  33.906  29.274  1.00 36.18  ? 186 ALA D N   1 
ATOM   9337  C  CA  . ALA D  1 186 ? -6.725  32.608  29.878  1.00 37.54  ? 186 ALA D CA  1 
ATOM   9338  C  C   . ALA D  1 186 ? -7.758  31.908  29.028  1.00 36.20  ? 186 ALA D C   1 
ATOM   9339  O  O   . ALA D  1 186 ? -7.604  30.735  28.705  1.00 33.77  ? 186 ALA D O   1 
ATOM   9340  C  CB  . ALA D  1 186 ? -7.231  32.766  31.305  1.00 35.33  ? 186 ALA D CB  1 
ATOM   9341  N  N   . LYS D  1 187 ? -8.809  32.644  28.661  1.00 37.61  ? 187 LYS D N   1 
ATOM   9342  C  CA  . LYS D  1 187 ? -9.861  32.087  27.828  1.00 36.75  ? 187 LYS D CA  1 
ATOM   9343  C  C   . LYS D  1 187 ? -9.263  31.613  26.526  1.00 35.95  ? 187 LYS D C   1 
ATOM   9344  O  O   . LYS D  1 187 ? -9.587  30.522  26.046  1.00 35.68  ? 187 LYS D O   1 
ATOM   9345  C  CB  . LYS D  1 187 ? -10.957 33.119  27.533  1.00 43.57  ? 187 LYS D CB  1 
ATOM   9346  C  CG  . LYS D  1 187 ? -12.081 32.589  26.629  1.00 45.57  ? 187 LYS D CG  1 
ATOM   9347  C  CD  . LYS D  1 187 ? -13.209 33.599  26.526  1.00 62.35  ? 187 LYS D CD  1 
ATOM   9348  C  CE  . LYS D  1 187 ? -14.376 33.078  25.681  1.00 69.67  ? 187 LYS D CE  1 
ATOM   9349  N  NZ  . LYS D  1 187 ? -15.511 34.060  25.638  1.00 67.87  ? 187 LYS D NZ  1 
ATOM   9350  N  N   . LEU D  1 188 ? -8.402  32.451  25.955  1.00 29.13  ? 188 LEU D N   1 
ATOM   9351  C  CA  . LEU D  1 188 ? -7.726  32.115  24.709  1.00 35.65  ? 188 LEU D CA  1 
ATOM   9352  C  C   . LEU D  1 188 ? -6.697  30.981  24.874  1.00 42.01  ? 188 LEU D C   1 
ATOM   9353  O  O   . LEU D  1 188 ? -6.182  30.457  23.887  1.00 53.31  ? 188 LEU D O   1 
ATOM   9354  C  CB  . LEU D  1 188 ? -7.046  33.347  24.113  1.00 36.56  ? 188 LEU D CB  1 
ATOM   9355  C  CG  . LEU D  1 188 ? -7.934  34.470  23.571  1.00 43.80  ? 188 LEU D CG  1 
ATOM   9356  C  CD1 . LEU D  1 188 ? -7.085  35.491  22.837  1.00 49.70  ? 188 LEU D CD1 1 
ATOM   9357  C  CD2 . LEU D  1 188 ? -8.999  33.926  22.651  1.00 40.66  ? 188 LEU D CD2 1 
ATOM   9358  N  N   . ARG D  1 189 ? -6.389  30.604  26.108  1.00 31.51  ? 189 ARG D N   1 
ATOM   9359  C  CA  . ARG D  1 189 ? -5.520  29.443  26.303  1.00 35.35  ? 189 ARG D CA  1 
ATOM   9360  C  C   . ARG D  1 189 ? -6.347  28.208  26.616  1.00 32.09  ? 189 ARG D C   1 
ATOM   9361  O  O   . ARG D  1 189 ? -5.809  27.124  26.801  1.00 33.79  ? 189 ARG D O   1 
ATOM   9362  C  CB  . ARG D  1 189 ? -4.457  29.709  27.378  1.00 31.03  ? 189 ARG D CB  1 
ATOM   9363  C  CG  . ARG D  1 189 ? -3.422  30.728  26.925  1.00 33.87  ? 189 ARG D CG  1 
ATOM   9364  C  CD  . ARG D  1 189 ? -2.713  30.254  25.665  1.00 32.16  ? 189 ARG D CD  1 
ATOM   9365  N  NE  . ARG D  1 189 ? -1.716  29.239  25.981  1.00 34.81  ? 189 ARG D NE  1 
ATOM   9366  C  CZ  . ARG D  1 189 ? -0.965  28.613  25.082  1.00 38.66  ? 189 ARG D CZ  1 
ATOM   9367  N  NH1 . ARG D  1 189 ? -1.119  28.871  23.791  1.00 35.57  ? 189 ARG D NH1 1 
ATOM   9368  N  NH2 . ARG D  1 189 ? -0.075  27.700  25.476  1.00 40.15  ? 189 ARG D NH2 1 
ATOM   9369  N  N   . GLY D  1 190 ? -7.666  28.381  26.662  1.00 33.11  ? 190 GLY D N   1 
ATOM   9370  C  CA  . GLY D  1 190 ? -8.575  27.261  26.808  1.00 27.83  ? 190 GLY D CA  1 
ATOM   9371  C  C   . GLY D  1 190 ? -9.042  27.024  28.226  1.00 35.51  ? 190 GLY D C   1 
ATOM   9372  O  O   . GLY D  1 190 ? -9.392  25.903  28.596  1.00 31.88  ? 190 GLY D O   1 
ATOM   9373  N  N   . ALA D  1 191 ? -9.041  28.074  29.039  1.00 33.57  ? 191 ALA D N   1 
ATOM   9374  C  CA  . ALA D  1 191 ? -9.484  27.917  30.416  1.00 30.56  ? 191 ALA D CA  1 
ATOM   9375  C  C   . ALA D  1 191 ? -10.985 27.657  30.485  1.00 32.50  ? 191 ALA D C   1 
ATOM   9376  O  O   . ALA D  1 191 ? -11.759 28.185  29.681  1.00 31.48  ? 191 ALA D O   1 
ATOM   9377  C  CB  . ALA D  1 191 ? -9.123  29.130  31.239  1.00 32.62  ? 191 ALA D CB  1 
ATOM   9378  N  N   . GLY D  1 192 ? -11.384 26.837  31.450  1.00 32.37  ? 192 GLY D N   1 
ATOM   9379  C  CA  . GLY D  1 192 ? -12.784 26.603  31.722  1.00 33.34  ? 192 GLY D CA  1 
ATOM   9380  C  C   . GLY D  1 192 ? -13.293 27.691  32.643  1.00 34.57  ? 192 GLY D C   1 
ATOM   9381  O  O   . GLY D  1 192 ? -13.642 28.788  32.203  1.00 35.66  ? 192 GLY D O   1 
ATOM   9382  N  N   . ARG D  1 193 ? -13.339 27.387  33.931  1.00 33.04  ? 193 ARG D N   1 
ATOM   9383  C  CA  . ARG D  1 193 ? -13.806 28.358  34.897  1.00 35.48  ? 193 ARG D CA  1 
ATOM   9384  C  C   . ARG D  1 193 ? -12.749 29.440  35.068  1.00 40.84  ? 193 ARG D C   1 
ATOM   9385  O  O   . ARG D  1 193 ? -11.556 29.146  35.269  1.00 36.17  ? 193 ARG D O   1 
ATOM   9386  C  CB  . ARG D  1 193 ? -14.103 27.688  36.236  1.00 41.38  ? 193 ARG D CB  1 
ATOM   9387  C  CG  . ARG D  1 193 ? -14.805 28.600  37.229  1.00 43.57  ? 193 ARG D CG  1 
ATOM   9388  C  CD  . ARG D  1 193 ? -15.293 27.815  38.435  1.00 47.18  ? 193 ARG D CD  1 
ATOM   9389  N  NE  . ARG D  1 193 ? -16.347 28.532  39.146  1.00 51.14  ? 193 ARG D NE  1 
ATOM   9390  C  CZ  . ARG D  1 193 ? -17.044 28.037  40.165  1.00 54.44  ? 193 ARG D CZ  1 
ATOM   9391  N  NH1 . ARG D  1 193 ? -16.804 26.805  40.611  1.00 54.87  ? 193 ARG D NH1 1 
ATOM   9392  N  NH2 . ARG D  1 193 ? -17.988 28.779  40.739  1.00 52.30  ? 193 ARG D NH2 1 
ATOM   9393  N  N   . ILE D  1 194 ? -13.186 30.692  34.966  1.00 35.91  ? 194 ILE D N   1 
ATOM   9394  C  CA  . ILE D  1 194 ? -12.296 31.819  35.172  1.00 40.69  ? 194 ILE D CA  1 
ATOM   9395  C  C   . ILE D  1 194 ? -12.891 32.749  36.212  1.00 45.26  ? 194 ILE D C   1 
ATOM   9396  O  O   . ILE D  1 194 ? -13.924 33.388  35.980  1.00 41.83  ? 194 ILE D O   1 
ATOM   9397  C  CB  . ILE D  1 194 ? -12.073 32.612  33.883  1.00 37.71  ? 194 ILE D CB  1 
ATOM   9398  C  CG1 . ILE D  1 194 ? -11.394 31.746  32.827  1.00 36.02  ? 194 ILE D CG1 1 
ATOM   9399  C  CG2 . ILE D  1 194 ? -11.215 33.836  34.159  1.00 36.54  ? 194 ILE D CG2 1 
ATOM   9400  C  CD1 . ILE D  1 194 ? -11.259 32.463  31.491  1.00 37.72  ? 194 ILE D CD1 1 
ATOM   9401  N  N   . ILE D  1 195 ? -12.221 32.826  37.354  1.00 41.92  ? 195 ILE D N   1 
ATOM   9402  C  CA  . ILE D  1 195 ? -12.683 33.629  38.473  1.00 42.91  ? 195 ILE D CA  1 
ATOM   9403  C  C   . ILE D  1 195 ? -11.896 34.942  38.590  1.00 45.40  ? 195 ILE D C   1 
ATOM   9404  O  O   . ILE D  1 195 ? -10.720 34.929  38.959  1.00 38.93  ? 195 ILE D O   1 
ATOM   9405  C  CB  . ILE D  1 195 ? -12.538 32.839  39.787  1.00 40.27  ? 195 ILE D CB  1 
ATOM   9406  C  CG1 . ILE D  1 195 ? -13.292 31.512  39.696  1.00 39.00  ? 195 ILE D CG1 1 
ATOM   9407  C  CG2 . ILE D  1 195 ? -13.035 33.653  40.971  1.00 35.84  ? 195 ILE D CG2 1 
ATOM   9408  C  CD1 . ILE D  1 195 ? -12.880 30.517  40.785  1.00 35.52  ? 195 ILE D CD1 1 
ATOM   9409  N  N   . GLY D  1 196 ? -12.550 36.066  38.285  1.00 40.93  ? 196 GLY D N   1 
ATOM   9410  C  CA  . GLY D  1 196 ? -11.929 37.380  38.386  1.00 39.63  ? 196 GLY D CA  1 
ATOM   9411  C  C   . GLY D  1 196 ? -12.120 38.043  39.743  1.00 46.72  ? 196 GLY D C   1 
ATOM   9412  O  O   . GLY D  1 196 ? -13.189 37.936  40.340  1.00 49.92  ? 196 GLY D O   1 
ATOM   9413  N  N   . VAL D  1 197 ? -11.083 38.730  40.222  1.00 48.34  ? 197 VAL D N   1 
ATOM   9414  C  CA  . VAL D  1 197 ? -11.098 39.356  41.546  1.00 51.51  ? 197 VAL D CA  1 
ATOM   9415  C  C   . VAL D  1 197 ? -10.972 40.875  41.466  1.00 48.45  ? 197 VAL D C   1 
ATOM   9416  O  O   . VAL D  1 197 ? -9.985  41.392  40.941  1.00 48.98  ? 197 VAL D O   1 
ATOM   9417  C  CB  . VAL D  1 197 ? -9.933  38.848  42.418  1.00 49.95  ? 197 VAL D CB  1 
ATOM   9418  C  CG1 . VAL D  1 197 ? -9.917  39.583  43.752  1.00 51.23  ? 197 VAL D CG1 1 
ATOM   9419  C  CG2 . VAL D  1 197 ? -10.011 37.328  42.614  1.00 43.99  ? 197 VAL D CG2 1 
ATOM   9420  N  N   . GLY D  1 198 ? -11.961 41.583  42.006  1.00 51.52  ? 198 GLY D N   1 
ATOM   9421  C  CA  . GLY D  1 198 ? -12.004 43.037  41.935  1.00 55.11  ? 198 GLY D CA  1 
ATOM   9422  C  C   . GLY D  1 198 ? -13.412 43.583  42.151  1.00 69.89  ? 198 GLY D C   1 
ATOM   9423  O  O   . GLY D  1 198 ? -14.382 42.825  42.182  1.00 72.17  ? 198 GLY D O   1 
ATOM   9424  N  N   . SER D  1 199 ? -13.538 44.902  42.275  1.00 78.27  ? 199 SER D N   1 
ATOM   9425  C  CA  . SER D  1 199 ? -14.813 45.499  42.679  1.00 83.02  ? 199 SER D CA  1 
ATOM   9426  C  C   . SER D  1 199 ? -15.416 46.528  41.711  1.00 87.86  ? 199 SER D C   1 
ATOM   9427  O  O   . SER D  1 199 ? -16.627 46.520  41.477  1.00 89.10  ? 199 SER D O   1 
ATOM   9428  C  CB  . SER D  1 199 ? -14.687 46.107  44.079  1.00 80.88  ? 199 SER D CB  1 
ATOM   9429  O  OG  . SER D  1 199 ? -13.498 46.870  44.194  1.00 83.73  ? 199 SER D OG  1 
ATOM   9430  N  N   . ARG D  1 200 ? -14.585 47.415  41.166  1.00 85.62  ? 200 ARG D N   1 
ATOM   9431  C  CA  . ARG D  1 200 ? -15.074 48.473  40.281  1.00 79.55  ? 200 ARG D CA  1 
ATOM   9432  C  C   . ARG D  1 200 ? -16.066 47.928  39.266  1.00 78.45  ? 200 ARG D C   1 
ATOM   9433  O  O   . ARG D  1 200 ? -15.710 47.120  38.410  1.00 80.66  ? 200 ARG D O   1 
ATOM   9434  C  CB  . ARG D  1 200 ? -13.923 49.157  39.548  1.00 80.81  ? 200 ARG D CB  1 
ATOM   9435  C  CG  . ARG D  1 200 ? -12.682 49.346  40.385  1.00 89.54  ? 200 ARG D CG  1 
ATOM   9436  C  CD  . ARG D  1 200 ? -11.610 50.091  39.612  1.00 93.63  ? 200 ARG D CD  1 
ATOM   9437  N  NE  . ARG D  1 200 ? -11.546 51.494  40.001  1.00 95.14  ? 200 ARG D NE  1 
ATOM   9438  C  CZ  . ARG D  1 200 ? -10.892 52.427  39.321  1.00 95.24  ? 200 ARG D CZ  1 
ATOM   9439  N  NH1 . ARG D  1 200 ? -10.255 52.110  38.200  1.00 95.60  ? 200 ARG D NH1 1 
ATOM   9440  N  NH2 . ARG D  1 200 ? -10.882 53.678  39.762  1.00 93.82  ? 200 ARG D NH2 1 
ATOM   9441  N  N   . PRO D  1 201 ? -17.321 48.380  39.360  1.00 77.50  ? 201 PRO D N   1 
ATOM   9442  C  CA  . PRO D  1 201 ? -18.415 47.925  38.499  1.00 71.32  ? 201 PRO D CA  1 
ATOM   9443  C  C   . PRO D  1 201 ? -18.022 47.875  37.032  1.00 65.90  ? 201 PRO D C   1 
ATOM   9444  O  O   . PRO D  1 201 ? -18.317 46.888  36.358  1.00 70.85  ? 201 PRO D O   1 
ATOM   9445  C  CB  . PRO D  1 201 ? -19.487 48.997  38.708  1.00 72.04  ? 201 PRO D CB  1 
ATOM   9446  C  CG  . PRO D  1 201 ? -19.245 49.494  40.094  1.00 75.72  ? 201 PRO D CG  1 
ATOM   9447  C  CD  . PRO D  1 201 ? -17.756 49.416  40.314  1.00 78.10  ? 201 PRO D CD  1 
ATOM   9448  N  N   . ILE D  1 202 ? -17.371 48.921  36.538  1.00 55.53  ? 202 ILE D N   1 
ATOM   9449  C  CA  . ILE D  1 202 ? -17.048 48.967  35.118  1.00 54.08  ? 202 ILE D CA  1 
ATOM   9450  C  C   . ILE D  1 202 ? -16.011 47.917  34.749  1.00 55.30  ? 202 ILE D C   1 
ATOM   9451  O  O   . ILE D  1 202 ? -16.054 47.347  33.662  1.00 59.87  ? 202 ILE D O   1 
ATOM   9452  C  CB  . ILE D  1 202 ? -16.604 50.364  34.644  1.00 57.33  ? 202 ILE D CB  1 
ATOM   9453  C  CG1 . ILE D  1 202 ? -16.417 50.363  33.125  1.00 61.32  ? 202 ILE D CG1 1 
ATOM   9454  C  CG2 . ILE D  1 202 ? -15.338 50.804  35.350  1.00 57.97  ? 202 ILE D CG2 1 
ATOM   9455  C  CD1 . ILE D  1 202 ? -16.779 51.676  32.458  1.00 66.37  ? 202 ILE D CD1 1 
ATOM   9456  N  N   . CYS D  1 203 ? -15.080 47.661  35.659  1.00 51.55  ? 203 CYS D N   1 
ATOM   9457  C  CA  . CYS D  1 203 ? -14.127 46.583  35.450  1.00 57.83  ? 203 CYS D CA  1 
ATOM   9458  C  C   . CYS D  1 203 ? -14.854 45.254  35.502  1.00 57.12  ? 203 CYS D C   1 
ATOM   9459  O  O   . CYS D  1 203 ? -14.590 44.362  34.704  1.00 59.58  ? 203 CYS D O   1 
ATOM   9460  C  CB  . CYS D  1 203 ? -13.018 46.633  36.496  1.00 56.01  ? 203 CYS D CB  1 
ATOM   9461  S  SG  . CYS D  1 203 ? -12.014 48.128  36.351  1.00 57.45  ? 203 CYS D SG  1 
ATOM   9462  N  N   . VAL D  1 204 ? -15.786 45.140  36.439  1.00 56.82  ? 204 VAL D N   1 
ATOM   9463  C  CA  . VAL D  1 204 ? -16.555 43.918  36.610  1.00 57.17  ? 204 VAL D CA  1 
ATOM   9464  C  C   . VAL D  1 204 ? -17.267 43.530  35.321  1.00 52.71  ? 204 VAL D C   1 
ATOM   9465  O  O   . VAL D  1 204 ? -17.261 42.366  34.913  1.00 53.65  ? 204 VAL D O   1 
ATOM   9466  C  CB  . VAL D  1 204 ? -17.581 44.074  37.742  1.00 61.78  ? 204 VAL D CB  1 
ATOM   9467  C  CG1 . VAL D  1 204 ? -18.649 42.982  37.662  1.00 63.69  ? 204 VAL D CG1 1 
ATOM   9468  C  CG2 . VAL D  1 204 ? -16.874 44.068  39.094  1.00 50.36  ? 204 VAL D CG2 1 
ATOM   9469  N  N   . GLU D  1 205 ? -17.870 44.515  34.673  1.00 44.40  ? 205 GLU D N   1 
ATOM   9470  C  CA  . GLU D  1 205 ? -18.595 44.262  33.442  1.00 50.78  ? 205 GLU D CA  1 
ATOM   9471  C  C   . GLU D  1 205 ? -17.654 43.906  32.280  1.00 46.54  ? 205 GLU D C   1 
ATOM   9472  O  O   . GLU D  1 205 ? -17.996 43.104  31.412  1.00 44.91  ? 205 GLU D O   1 
ATOM   9473  C  CB  . GLU D  1 205 ? -19.483 45.462  33.093  1.00 57.64  ? 205 GLU D CB  1 
ATOM   9474  C  CG  . GLU D  1 205 ? -20.746 45.086  32.337  1.00 68.69  ? 205 GLU D CG  1 
ATOM   9475  C  CD  . GLU D  1 205 ? -21.645 44.142  33.123  1.00 80.40  ? 205 GLU D CD  1 
ATOM   9476  O  OE1 . GLU D  1 205 ? -21.563 44.138  34.375  1.00 82.94  ? 205 GLU D OE1 1 
ATOM   9477  O  OE2 . GLU D  1 205 ? -22.435 43.407  32.486  1.00 83.49  ? 205 GLU D OE2 1 
ATOM   9478  N  N   . ALA D  1 206 ? -16.466 44.500  32.265  1.00 42.58  ? 206 ALA D N   1 
ATOM   9479  C  CA  . ALA D  1 206 ? -15.487 44.160  31.240  1.00 43.94  ? 206 ALA D CA  1 
ATOM   9480  C  C   . ALA D  1 206 ? -14.940 42.750  31.502  1.00 41.29  ? 206 ALA D C   1 
ATOM   9481  O  O   . ALA D  1 206 ? -14.639 42.002  30.571  1.00 41.32  ? 206 ALA D O   1 
ATOM   9482  C  CB  . ALA D  1 206 ? -14.358 45.175  31.220  1.00 45.61  ? 206 ALA D CB  1 
ATOM   9483  N  N   . ALA D  1 207 ? -14.832 42.392  32.776  1.00 34.21  ? 207 ALA D N   1 
ATOM   9484  C  CA  . ALA D  1 207 ? -14.314 41.079  33.151  1.00 37.73  ? 207 ALA D CA  1 
ATOM   9485  C  C   . ALA D  1 207 ? -15.251 39.997  32.624  1.00 42.61  ? 207 ALA D C   1 
ATOM   9486  O  O   . ALA D  1 207 ? -14.807 39.027  32.012  1.00 43.91  ? 207 ALA D O   1 
ATOM   9487  C  CB  . ALA D  1 207 ? -14.161 40.970  34.657  1.00 35.98  ? 207 ALA D CB  1 
ATOM   9488  N  N   . LYS D  1 208 ? -16.550 40.179  32.851  1.00 46.04  ? 208 LYS D N   1 
ATOM   9489  C  CA  . LYS D  1 208 ? -17.553 39.276  32.286  1.00 47.39  ? 208 LYS D CA  1 
ATOM   9490  C  C   . LYS D  1 208 ? -17.466 39.245  30.759  1.00 46.72  ? 208 LYS D C   1 
ATOM   9491  O  O   . LYS D  1 208 ? -17.566 38.191  30.144  1.00 50.97  ? 208 LYS D O   1 
ATOM   9492  C  CB  . LYS D  1 208 ? -18.965 39.690  32.710  1.00 51.05  ? 208 LYS D CB  1 
ATOM   9493  C  CG  . LYS D  1 208 ? -19.234 39.677  34.212  1.00 54.28  ? 208 LYS D CG  1 
ATOM   9494  C  CD  . LYS D  1 208 ? -20.631 40.250  34.510  1.00 60.82  ? 208 LYS D CD  1 
ATOM   9495  C  CE  . LYS D  1 208 ? -20.829 40.592  35.990  1.00 66.56  ? 208 LYS D CE  1 
ATOM   9496  N  NZ  . LYS D  1 208 ? -22.028 41.472  36.232  1.00 70.94  ? 208 LYS D NZ  1 
ATOM   9497  N  N   . PHE D  1 209 ? -17.286 40.406  30.144  1.00 47.36  ? 209 PHE D N   1 
ATOM   9498  C  CA  . PHE D  1 209 ? -17.209 40.484  28.686  1.00 39.33  ? 209 PHE D CA  1 
ATOM   9499  C  C   . PHE D  1 209 ? -16.039 39.668  28.151  1.00 43.44  ? 209 PHE D C   1 
ATOM   9500  O  O   . PHE D  1 209 ? -16.114 39.080  27.080  1.00 41.24  ? 209 PHE D O   1 
ATOM   9501  C  CB  . PHE D  1 209 ? -17.099 41.955  28.231  1.00 43.49  ? 209 PHE D CB  1 
ATOM   9502  C  CG  . PHE D  1 209 ? -16.851 42.121  26.754  1.00 45.22  ? 209 PHE D CG  1 
ATOM   9503  C  CD1 . PHE D  1 209 ? -17.911 42.135  25.854  1.00 49.91  ? 209 PHE D CD1 1 
ATOM   9504  C  CD2 . PHE D  1 209 ? -15.559 42.266  26.261  1.00 45.84  ? 209 PHE D CD2 1 
ATOM   9505  C  CE1 . PHE D  1 209 ? -17.689 42.275  24.487  1.00 44.69  ? 209 PHE D CE1 1 
ATOM   9506  C  CE2 . PHE D  1 209 ? -15.323 42.411  24.897  1.00 48.03  ? 209 PHE D CE2 1 
ATOM   9507  C  CZ  . PHE D  1 209 ? -16.396 42.413  24.002  1.00 44.85  ? 209 PHE D CZ  1 
ATOM   9508  N  N   . TYR D  1 210 ? -14.947 39.631  28.902  1.00 42.03  ? 210 TYR D N   1 
ATOM   9509  C  CA  . TYR D  1 210 ? -13.753 38.977  28.406  1.00 42.46  ? 210 TYR D CA  1 
ATOM   9510  C  C   . TYR D  1 210 ? -13.669 37.492  28.755  1.00 43.40  ? 210 TYR D C   1 
ATOM   9511  O  O   . TYR D  1 210 ? -12.759 36.808  28.311  1.00 42.40  ? 210 TYR D O   1 
ATOM   9512  C  CB  . TYR D  1 210 ? -12.494 39.730  28.857  1.00 43.23  ? 210 TYR D CB  1 
ATOM   9513  C  CG  . TYR D  1 210 ? -12.266 40.996  28.071  1.00 39.06  ? 210 TYR D CG  1 
ATOM   9514  C  CD1 . TYR D  1 210 ? -12.043 40.949  26.698  1.00 34.04  ? 210 TYR D CD1 1 
ATOM   9515  C  CD2 . TYR D  1 210 ? -12.287 42.237  28.691  1.00 41.80  ? 210 TYR D CD2 1 
ATOM   9516  C  CE1 . TYR D  1 210 ? -11.836 42.100  25.969  1.00 32.57  ? 210 TYR D CE1 1 
ATOM   9517  C  CE2 . TYR D  1 210 ? -12.081 43.405  27.967  1.00 39.24  ? 210 TYR D CE2 1 
ATOM   9518  C  CZ  . TYR D  1 210 ? -11.857 43.332  26.609  1.00 39.93  ? 210 TYR D CZ  1 
ATOM   9519  O  OH  . TYR D  1 210 ? -11.657 44.493  25.888  1.00 41.62  ? 210 TYR D OH  1 
ATOM   9520  N  N   . GLY D  1 211 ? -14.608 36.994  29.553  1.00 43.74  ? 211 GLY D N   1 
ATOM   9521  C  CA  . GLY D  1 211 ? -14.668 35.569  29.808  1.00 39.59  ? 211 GLY D CA  1 
ATOM   9522  C  C   . GLY D  1 211 ? -14.890 35.123  31.236  1.00 42.63  ? 211 GLY D C   1 
ATOM   9523  O  O   . GLY D  1 211 ? -15.072 33.929  31.487  1.00 43.90  ? 211 GLY D O   1 
ATOM   9524  N  N   . ALA D  1 212 ? -14.879 36.052  32.184  1.00 38.59  ? 212 ALA D N   1 
ATOM   9525  C  CA  . ALA D  1 212 ? -15.021 35.647  33.579  1.00 39.98  ? 212 ALA D CA  1 
ATOM   9526  C  C   . ALA D  1 212 ? -16.381 35.000  33.820  1.00 41.50  ? 212 ALA D C   1 
ATOM   9527  O  O   . ALA D  1 212 ? -17.417 35.528  33.407  1.00 47.06  ? 212 ALA D O   1 
ATOM   9528  C  CB  . ALA D  1 212 ? -14.795 36.821  34.526  1.00 48.25  ? 212 ALA D CB  1 
ATOM   9529  N  N   . THR D  1 213 ? -16.363 33.847  34.479  1.00 36.42  ? 213 THR D N   1 
ATOM   9530  C  CA  . THR D  1 213 ? -17.572 33.110  34.808  1.00 41.67  ? 213 THR D CA  1 
ATOM   9531  C  C   . THR D  1 213 ? -17.955 33.360  36.265  1.00 44.83  ? 213 THR D C   1 
ATOM   9532  O  O   . THR D  1 213 ? -19.021 32.954  36.732  1.00 42.22  ? 213 THR D O   1 
ATOM   9533  C  CB  . THR D  1 213 ? -17.356 31.608  34.593  1.00 44.08  ? 213 THR D CB  1 
ATOM   9534  O  OG1 . THR D  1 213 ? -16.353 31.140  35.502  1.00 45.84  ? 213 THR D OG1 1 
ATOM   9535  C  CG2 . THR D  1 213 ? -16.899 31.343  33.162  1.00 44.15  ? 213 THR D CG2 1 
ATOM   9536  N  N   . ASP D  1 214 ? -17.054 34.016  36.983  1.00 45.45  ? 214 ASP D N   1 
ATOM   9537  C  CA  . ASP D  1 214 ? -17.272 34.368  38.373  1.00 44.11  ? 214 ASP D CA  1 
ATOM   9538  C  C   . ASP D  1 214 ? -16.527 35.664  38.656  1.00 48.12  ? 214 ASP D C   1 
ATOM   9539  O  O   . ASP D  1 214 ? -15.469 35.926  38.073  1.00 47.00  ? 214 ASP D O   1 
ATOM   9540  C  CB  . ASP D  1 214 ? -16.755 33.265  39.304  1.00 48.07  ? 214 ASP D CB  1 
ATOM   9541  C  CG  . ASP D  1 214 ? -17.448 31.934  39.078  1.00 50.78  ? 214 ASP D CG  1 
ATOM   9542  O  OD1 . ASP D  1 214 ? -17.076 31.218  38.127  1.00 45.67  ? 214 ASP D OD1 1 
ATOM   9543  O  OD2 . ASP D  1 214 ? -18.363 31.602  39.859  1.00 56.16  ? 214 ASP D OD2 1 
ATOM   9544  N  N   . ILE D  1 215 ? -17.089 36.476  39.541  1.00 48.87  ? 215 ILE D N   1 
ATOM   9545  C  CA  . ILE D  1 215 ? -16.428 37.687  39.990  1.00 46.53  ? 215 ILE D CA  1 
ATOM   9546  C  C   . ILE D  1 215 ? -16.437 37.724  41.503  1.00 53.23  ? 215 ILE D C   1 
ATOM   9547  O  O   . ILE D  1 215 ? -17.499 37.726  42.130  1.00 60.14  ? 215 ILE D O   1 
ATOM   9548  C  CB  . ILE D  1 215 ? -17.134 38.946  39.480  1.00 50.44  ? 215 ILE D CB  1 
ATOM   9549  C  CG1 . ILE D  1 215 ? -17.195 38.948  37.949  1.00 49.02  ? 215 ILE D CG1 1 
ATOM   9550  C  CG2 . ILE D  1 215 ? -16.444 40.202  40.046  1.00 45.74  ? 215 ILE D CG2 1 
ATOM   9551  C  CD1 . ILE D  1 215 ? -15.841 39.027  37.299  1.00 48.45  ? 215 ILE D CD1 1 
ATOM   9552  N  N   . LEU D  1 216 ? -15.250 37.757  42.092  1.00 52.23  ? 216 LEU D N   1 
ATOM   9553  C  CA  . LEU D  1 216 ? -15.131 37.797  43.537  1.00 57.57  ? 216 LEU D CA  1 
ATOM   9554  C  C   . LEU D  1 216 ? -14.802 39.192  44.018  1.00 57.31  ? 216 LEU D C   1 
ATOM   9555  O  O   . LEU D  1 216 ? -13.908 39.851  43.489  1.00 53.79  ? 216 LEU D O   1 
ATOM   9556  C  CB  . LEU D  1 216 ? -14.062 36.823  44.012  1.00 57.85  ? 216 LEU D CB  1 
ATOM   9557  C  CG  . LEU D  1 216 ? -14.399 35.382  43.658  1.00 54.17  ? 216 LEU D CG  1 
ATOM   9558  C  CD1 . LEU D  1 216 ? -13.421 34.445  44.336  1.00 54.60  ? 216 LEU D CD1 1 
ATOM   9559  C  CD2 . LEU D  1 216 ? -15.815 35.091  44.088  1.00 50.47  ? 216 LEU D CD2 1 
ATOM   9560  N  N   . ASN D  1 217 ? -15.538 39.626  45.030  1.00 61.36  ? 217 ASN D N   1 
ATOM   9561  C  CA  . ASN D  1 217 ? -15.330 40.918  45.652  1.00 66.09  ? 217 ASN D CA  1 
ATOM   9562  C  C   . ASN D  1 217 ? -14.681 40.765  47.022  1.00 70.48  ? 217 ASN D C   1 
ATOM   9563  O  O   . ASN D  1 217 ? -15.215 40.078  47.893  1.00 63.05  ? 217 ASN D O   1 
ATOM   9564  C  CB  . ASN D  1 217 ? -16.678 41.606  45.810  1.00 75.02  ? 217 ASN D CB  1 
ATOM   9565  C  CG  . ASN D  1 217 ? -16.573 42.929  46.509  1.00 87.79  ? 217 ASN D CG  1 
ATOM   9566  O  OD1 . ASN D  1 217 ? -15.599 43.662  46.337  1.00 94.16  ? 217 ASN D OD1 1 
ATOM   9567  N  ND2 . ASN D  1 217 ? -17.586 43.257  47.302  1.00 94.43  ? 217 ASN D ND2 1 
ATOM   9568  N  N   . TYR D  1 218 ? -13.530 41.395  47.225  1.00 79.30  ? 218 TYR D N   1 
ATOM   9569  C  CA  . TYR D  1 218 ? -12.994 41.474  48.575  1.00 93.43  ? 218 TYR D CA  1 
ATOM   9570  C  C   . TYR D  1 218 ? -13.979 42.245  49.441  1.00 96.40  ? 218 TYR D C   1 
ATOM   9571  O  O   . TYR D  1 218 ? -14.371 43.362  49.098  1.00 95.11  ? 218 TYR D O   1 
ATOM   9572  C  CB  . TYR D  1 218 ? -11.636 42.166  48.611  1.00 106.70 ? 218 TYR D CB  1 
ATOM   9573  C  CG  . TYR D  1 218 ? -11.245 42.594  50.009  1.00 122.26 ? 218 TYR D CG  1 
ATOM   9574  C  CD1 . TYR D  1 218 ? -10.615 41.709  50.877  1.00 129.20 ? 218 TYR D CD1 1 
ATOM   9575  C  CD2 . TYR D  1 218 ? -11.523 43.877  50.468  1.00 129.63 ? 218 TYR D CD2 1 
ATOM   9576  C  CE1 . TYR D  1 218 ? -10.261 42.094  52.162  1.00 133.96 ? 218 TYR D CE1 1 
ATOM   9577  C  CE2 . TYR D  1 218 ? -11.174 44.272  51.751  1.00 134.68 ? 218 TYR D CE2 1 
ATOM   9578  C  CZ  . TYR D  1 218 ? -10.543 43.376  52.593  1.00 136.41 ? 218 TYR D CZ  1 
ATOM   9579  O  OH  . TYR D  1 218 ? -10.194 43.764  53.869  1.00 137.69 ? 218 TYR D OH  1 
ATOM   9580  N  N   . LYS D  1 219 ? -14.363 41.632  50.556  1.00 98.19  ? 219 LYS D N   1 
ATOM   9581  C  CA  . LYS D  1 219 ? -15.318 42.182  51.521  1.00 101.46 ? 219 LYS D CA  1 
ATOM   9582  C  C   . LYS D  1 219 ? -16.545 41.283  51.606  1.00 98.51  ? 219 LYS D C   1 
ATOM   9583  O  O   . LYS D  1 219 ? -17.473 41.543  52.367  1.00 102.05 ? 219 LYS D O   1 
ATOM   9584  C  CB  . LYS D  1 219 ? -15.700 43.639  51.230  1.00 107.09 ? 219 LYS D CB  1 
ATOM   9585  C  CG  . LYS D  1 219 ? -16.998 43.835  50.472  1.00 112.73 ? 219 LYS D CG  1 
ATOM   9586  C  CD  . LYS D  1 219 ? -17.433 45.295  50.527  1.00 118.88 ? 219 LYS D CD  1 
ATOM   9587  C  CE  . LYS D  1 219 ? -18.879 45.470  50.084  1.00 122.62 ? 219 LYS D CE  1 
ATOM   9588  N  NZ  . LYS D  1 219 ? -19.344 46.876  50.242  1.00 125.58 ? 219 LYS D NZ  1 
ATOM   9589  N  N   . ASN D  1 220 ? -16.540 40.222  50.810  1.00 92.68  ? 220 ASN D N   1 
ATOM   9590  C  CA  . ASN D  1 220 ? -17.438 39.099  51.036  1.00 90.97  ? 220 ASN D CA  1 
ATOM   9591  C  C   . ASN D  1 220 ? -16.708 38.039  51.849  1.00 88.49  ? 220 ASN D C   1 
ATOM   9592  O  O   . ASN D  1 220 ? -17.062 36.860  51.822  1.00 89.38  ? 220 ASN D O   1 
ATOM   9593  C  CB  . ASN D  1 220 ? -17.918 38.505  49.713  1.00 89.40  ? 220 ASN D CB  1 
ATOM   9594  C  CG  . ASN D  1 220 ? -19.262 39.043  49.296  1.00 90.97  ? 220 ASN D CG  1 
ATOM   9595  O  OD1 . ASN D  1 220 ? -19.908 39.772  50.050  1.00 92.83  ? 220 ASN D OD1 1 
ATOM   9596  N  ND2 . ASN D  1 220 ? -19.701 38.680  48.096  1.00 89.96  ? 220 ASN D ND2 1 
ATOM   9597  N  N   . GLY D  1 221 ? -15.682 38.477  52.571  1.00 85.05  ? 221 GLY D N   1 
ATOM   9598  C  CA  . GLY D  1 221 ? -14.777 37.574  53.257  1.00 81.77  ? 221 GLY D CA  1 
ATOM   9599  C  C   . GLY D  1 221 ? -13.433 37.569  52.554  1.00 75.68  ? 221 GLY D C   1 
ATOM   9600  O  O   . GLY D  1 221 ? -13.316 38.050  51.427  1.00 79.08  ? 221 GLY D O   1 
ATOM   9601  N  N   . HIS D  1 222 ? -12.411 37.040  53.213  1.00 67.04  ? 222 HIS D N   1 
ATOM   9602  C  CA  . HIS D  1 222 ? -11.103 36.967  52.585  1.00 70.38  ? 222 HIS D CA  1 
ATOM   9603  C  C   . HIS D  1 222 ? -11.175 36.159  51.299  1.00 61.06  ? 222 HIS D C   1 
ATOM   9604  O  O   . HIS D  1 222 ? -11.898 35.165  51.217  1.00 63.70  ? 222 HIS D O   1 
ATOM   9605  C  CB  . HIS D  1 222 ? -10.063 36.388  53.542  1.00 82.95  ? 222 HIS D CB  1 
ATOM   9606  C  CG  . HIS D  1 222 ? -9.514  37.397  54.500  1.00 96.41  ? 222 HIS D CG  1 
ATOM   9607  N  ND1 . HIS D  1 222 ? -9.880  37.442  55.828  1.00 100.68 ? 222 HIS D ND1 1 
ATOM   9608  C  CD2 . HIS D  1 222 ? -8.644  38.419  54.314  1.00 100.97 ? 222 HIS D CD2 1 
ATOM   9609  C  CE1 . HIS D  1 222 ? -9.246  38.437  56.423  1.00 103.10 ? 222 HIS D CE1 1 
ATOM   9610  N  NE2 . HIS D  1 222 ? -8.491  39.046  55.527  1.00 103.87 ? 222 HIS D NE2 1 
ATOM   9611  N  N   . ILE D  1 223 ? -10.419 36.589  50.297  1.00 51.77  ? 223 ILE D N   1 
ATOM   9612  C  CA  . ILE D  1 223 ? -10.547 36.012  48.964  1.00 54.29  ? 223 ILE D CA  1 
ATOM   9613  C  C   . ILE D  1 223 ? -10.291 34.502  48.921  1.00 53.88  ? 223 ILE D C   1 
ATOM   9614  O  O   . ILE D  1 223 ? -10.992 33.761  48.223  1.00 48.23  ? 223 ILE D O   1 
ATOM   9615  C  CB  . ILE D  1 223 ? -9.672  36.754  47.938  1.00 58.37  ? 223 ILE D CB  1 
ATOM   9616  C  CG1 . ILE D  1 223 ? -10.216 36.512  46.537  1.00 59.17  ? 223 ILE D CG1 1 
ATOM   9617  C  CG2 . ILE D  1 223 ? -8.232  36.325  48.041  1.00 63.13  ? 223 ILE D CG2 1 
ATOM   9618  C  CD1 . ILE D  1 223 ? -11.725 36.650  46.465  1.00 60.39  ? 223 ILE D CD1 1 
ATOM   9619  N  N   . VAL D  1 224 ? -9.305  34.046  49.687  1.00 53.54  ? 224 VAL D N   1 
ATOM   9620  C  CA  . VAL D  1 224 ? -8.961  32.626  49.721  1.00 47.80  ? 224 VAL D CA  1 
ATOM   9621  C  C   . VAL D  1 224 ? -10.138 31.783  50.201  1.00 49.03  ? 224 VAL D C   1 
ATOM   9622  O  O   . VAL D  1 224 ? -10.419 30.721  49.640  1.00 49.78  ? 224 VAL D O   1 
ATOM   9623  C  CB  . VAL D  1 224 ? -7.731  32.366  50.614  1.00 44.70  ? 224 VAL D CB  1 
ATOM   9624  C  CG1 . VAL D  1 224 ? -7.441  30.861  50.723  1.00 38.35  ? 224 VAL D CG1 1 
ATOM   9625  C  CG2 . VAL D  1 224 ? -6.531  33.119  50.068  1.00 43.21  ? 224 VAL D CG2 1 
ATOM   9626  N  N   . ASP D  1 225 ? -10.825 32.261  51.237  1.00 49.73  ? 225 ASP D N   1 
ATOM   9627  C  CA  . ASP D  1 225 ? -12.016 31.578  51.731  1.00 56.56  ? 225 ASP D CA  1 
ATOM   9628  C  C   . ASP D  1 225 ? -13.141 31.568  50.695  1.00 51.41  ? 225 ASP D C   1 
ATOM   9629  O  O   . ASP D  1 225 ? -13.874 30.585  50.564  1.00 48.37  ? 225 ASP D O   1 
ATOM   9630  C  CB  . ASP D  1 225 ? -12.482 32.210  53.036  1.00 64.67  ? 225 ASP D CB  1 
ATOM   9631  C  CG  . ASP D  1 225 ? -11.471 32.038  54.145  1.00 69.63  ? 225 ASP D CG  1 
ATOM   9632  O  OD1 . ASP D  1 225 ? -10.624 31.126  54.028  1.00 65.25  ? 225 ASP D OD1 1 
ATOM   9633  O  OD2 . ASP D  1 225 ? -11.515 32.809  55.125  1.00 74.55  ? 225 ASP D OD2 1 
ATOM   9634  N  N   . GLN D  1 226 ? -13.269 32.662  49.954  1.00 48.71  ? 226 GLN D N   1 
ATOM   9635  C  CA  . GLN D  1 226 ? -14.253 32.731  48.880  1.00 43.47  ? 226 GLN D CA  1 
ATOM   9636  C  C   . GLN D  1 226 ? -13.908 31.731  47.776  1.00 55.02  ? 226 GLN D C   1 
ATOM   9637  O  O   . GLN D  1 226 ? -14.773 30.995  47.294  1.00 59.43  ? 226 GLN D O   1 
ATOM   9638  C  CB  . GLN D  1 226 ? -14.303 34.135  48.301  1.00 42.76  ? 226 GLN D CB  1 
ATOM   9639  C  CG  . GLN D  1 226 ? -14.860 35.171  49.265  1.00 48.17  ? 226 GLN D CG  1 
ATOM   9640  C  CD  . GLN D  1 226 ? -15.312 36.429  48.558  1.00 52.75  ? 226 GLN D CD  1 
ATOM   9641  O  OE1 . GLN D  1 226 ? -16.075 36.377  47.588  1.00 59.41  ? 226 GLN D OE1 1 
ATOM   9642  N  NE2 . GLN D  1 226 ? -14.847 37.572  49.041  1.00 48.37  ? 226 GLN D NE2 1 
ATOM   9643  N  N   . VAL D  1 227 ? -12.642 31.703  47.373  1.00 52.00  ? 227 VAL D N   1 
ATOM   9644  C  CA  . VAL D  1 227 ? -12.220 30.782  46.325  1.00 51.99  ? 227 VAL D CA  1 
ATOM   9645  C  C   . VAL D  1 227 ? -12.416 29.325  46.747  1.00 50.87  ? 227 VAL D C   1 
ATOM   9646  O  O   . VAL D  1 227 ? -12.880 28.500  45.948  1.00 47.56  ? 227 VAL D O   1 
ATOM   9647  C  CB  . VAL D  1 227 ? -10.765 31.029  45.878  1.00 49.54  ? 227 VAL D CB  1 
ATOM   9648  C  CG1 . VAL D  1 227 ? -10.257 29.862  45.055  1.00 47.45  ? 227 VAL D CG1 1 
ATOM   9649  C  CG2 . VAL D  1 227 ? -10.672 32.327  45.083  1.00 46.70  ? 227 VAL D CG2 1 
ATOM   9650  N  N   . MET D  1 228 ? -12.079 29.016  48.002  1.00 48.19  ? 228 MET D N   1 
ATOM   9651  C  CA  . MET D  1 228 ? -12.275 27.665  48.530  1.00 47.58  ? 228 MET D CA  1 
ATOM   9652  C  C   . MET D  1 228 ? -13.746 27.241  48.493  1.00 54.10  ? 228 MET D C   1 
ATOM   9653  O  O   . MET D  1 228 ? -14.067 26.137  48.052  1.00 53.85  ? 228 MET D O   1 
ATOM   9654  C  CB  . MET D  1 228 ? -11.699 27.528  49.947  1.00 45.57  ? 228 MET D CB  1 
ATOM   9655  C  CG  . MET D  1 228 ? -10.182 27.677  50.004  1.00 42.41  ? 228 MET D CG  1 
ATOM   9656  S  SD  . MET D  1 228 ? -9.328  26.563  48.856  1.00 62.10  ? 228 MET D SD  1 
ATOM   9657  C  CE  . MET D  1 228 ? -9.212  25.084  49.859  1.00 161.82 ? 228 MET D CE  1 
ATOM   9658  N  N   . LYS D  1 229 ? -14.640 28.117  48.946  1.00 54.26  ? 229 LYS D N   1 
ATOM   9659  C  CA  . LYS D  1 229 ? -16.063 27.799  48.943  1.00 60.15  ? 229 LYS D CA  1 
ATOM   9660  C  C   . LYS D  1 229 ? -16.614 27.648  47.521  1.00 62.45  ? 229 LYS D C   1 
ATOM   9661  O  O   . LYS D  1 229 ? -17.506 26.835  47.284  1.00 69.54  ? 229 LYS D O   1 
ATOM   9662  C  CB  . LYS D  1 229 ? -16.867 28.836  49.724  1.00 67.31  ? 229 LYS D CB  1 
ATOM   9663  C  CG  . LYS D  1 229 ? -18.316 28.446  49.905  1.00 77.11  ? 229 LYS D CG  1 
ATOM   9664  C  CD  . LYS D  1 229 ? -19.074 29.467  50.727  1.00 86.31  ? 229 LYS D CD  1 
ATOM   9665  C  CE  . LYS D  1 229 ? -20.548 29.106  50.798  1.00 93.04  ? 229 LYS D CE  1 
ATOM   9666  N  NZ  . LYS D  1 229 ? -21.325 30.103  51.577  1.00 98.28  ? 229 LYS D NZ  1 
ATOM   9667  N  N   . LEU D  1 230 ? -16.081 28.421  46.578  1.00 55.67  ? 230 LEU D N   1 
ATOM   9668  C  CA  . LEU D  1 230 ? -16.455 28.261  45.173  1.00 53.39  ? 230 LEU D CA  1 
ATOM   9669  C  C   . LEU D  1 230 ? -16.024 26.902  44.622  1.00 51.50  ? 230 LEU D C   1 
ATOM   9670  O  O   . LEU D  1 230 ? -16.713 26.304  43.794  1.00 50.86  ? 230 LEU D O   1 
ATOM   9671  C  CB  . LEU D  1 230 ? -15.854 29.377  44.306  1.00 52.85  ? 230 LEU D CB  1 
ATOM   9672  C  CG  . LEU D  1 230 ? -16.508 30.763  44.371  1.00 57.65  ? 230 LEU D CG  1 
ATOM   9673  C  CD1 . LEU D  1 230 ? -15.941 31.705  43.305  1.00 53.50  ? 230 LEU D CD1 1 
ATOM   9674  C  CD2 . LEU D  1 230 ? -18.024 30.648  44.232  1.00 57.85  ? 230 LEU D CD2 1 
ATOM   9675  N  N   . THR D  1 231 ? -14.879 26.418  45.084  1.00 45.32  ? 231 THR D N   1 
ATOM   9676  C  CA  . THR D  1 231 ? -14.263 25.242  44.487  1.00 46.64  ? 231 THR D CA  1 
ATOM   9677  C  C   . THR D  1 231 ? -14.319 24.072  45.449  1.00 53.70  ? 231 THR D C   1 
ATOM   9678  O  O   . THR D  1 231 ? -13.581 23.090  45.298  1.00 53.27  ? 231 THR D O   1 
ATOM   9679  C  CB  . THR D  1 231 ? -12.791 25.514  44.146  1.00 43.48  ? 231 THR D CB  1 
ATOM   9680  O  OG1 . THR D  1 231 ? -12.066 25.713  45.363  1.00 45.29  ? 231 THR D OG1 1 
ATOM   9681  C  CG2 . THR D  1 231 ? -12.668 26.769  43.290  1.00 39.94  ? 231 THR D CG2 1 
ATOM   9682  N  N   . ASN D  1 232 ? -15.180 24.195  46.455  1.00 54.61  ? 232 ASN D N   1 
ATOM   9683  C  CA  . ASN D  1 232 ? -15.393 23.124  47.417  1.00 55.04  ? 232 ASN D CA  1 
ATOM   9684  C  C   . ASN D  1 232 ? -14.101 22.619  48.053  1.00 55.36  ? 232 ASN D C   1 
ATOM   9685  O  O   . ASN D  1 232 ? -13.884 21.411  48.169  1.00 51.35  ? 232 ASN D O   1 
ATOM   9686  C  CB  . ASN D  1 232 ? -16.119 21.959  46.752  1.00 61.85  ? 232 ASN D CB  1 
ATOM   9687  C  CG  . ASN D  1 232 ? -16.856 21.100  47.751  1.00 73.79  ? 232 ASN D CG  1 
ATOM   9688  O  OD1 . ASN D  1 232 ? -17.307 21.591  48.789  1.00 79.62  ? 232 ASN D OD1 1 
ATOM   9689  N  ND2 . ASN D  1 232 ? -16.988 19.811  47.448  1.00 72.68  ? 232 ASN D ND2 1 
ATOM   9690  N  N   . GLY D  1 233 ? -13.242 23.549  48.455  1.00 54.12  ? 233 GLY D N   1 
ATOM   9691  C  CA  . GLY D  1 233 ? -11.989 23.212  49.107  1.00 49.93  ? 233 GLY D CA  1 
ATOM   9692  C  C   . GLY D  1 233 ? -10.941 22.670  48.156  1.00 50.16  ? 233 GLY D C   1 
ATOM   9693  O  O   . GLY D  1 233 ? -9.819  22.402  48.565  1.00 47.58  ? 233 GLY D O   1 
ATOM   9694  N  N   . LYS D  1 234 ? -11.304 22.509  46.887  1.00 52.47  ? 234 LYS D N   1 
ATOM   9695  C  CA  . LYS D  1 234 ? -10.403 21.910  45.904  1.00 51.46  ? 234 LYS D CA  1 
ATOM   9696  C  C   . LYS D  1 234 ? -9.285  22.841  45.479  1.00 45.36  ? 234 LYS D C   1 
ATOM   9697  O  O   . LYS D  1 234 ? -8.190  22.391  45.135  1.00 40.63  ? 234 LYS D O   1 
ATOM   9698  C  CB  . LYS D  1 234 ? -11.172 21.510  44.651  1.00 54.05  ? 234 LYS D CB  1 
ATOM   9699  C  CG  . LYS D  1 234 ? -11.739 20.119  44.666  1.00 67.32  ? 234 LYS D CG  1 
ATOM   9700  C  CD  . LYS D  1 234 ? -12.793 19.977  43.562  1.00 74.67  ? 234 LYS D CD  1 
ATOM   9701  C  CE  . LYS D  1 234 ? -12.466 20.842  42.335  1.00 76.10  ? 234 LYS D CE  1 
ATOM   9702  N  NZ  . LYS D  1 234 ? -11.211 20.455  41.619  1.00 72.06  ? 234 LYS D NZ  1 
ATOM   9703  N  N   . GLY D  1 235 ? -9.583  24.136  45.471  1.00 44.94  ? 235 GLY D N   1 
ATOM   9704  C  CA  . GLY D  1 235 ? -8.666  25.129  44.954  1.00 42.16  ? 235 GLY D CA  1 
ATOM   9705  C  C   . GLY D  1 235 ? -8.749  25.267  43.446  1.00 39.14  ? 235 GLY D C   1 
ATOM   9706  O  O   . GLY D  1 235 ? -9.617  24.682  42.801  1.00 42.70  ? 235 GLY D O   1 
ATOM   9707  N  N   . VAL D  1 236 ? -7.838  26.051  42.882  1.00 33.66  ? 236 VAL D N   1 
ATOM   9708  C  CA  . VAL D  1 236 ? -7.815  26.303  41.452  1.00 31.17  ? 236 VAL D CA  1 
ATOM   9709  C  C   . VAL D  1 236 ? -6.483  25.843  40.876  1.00 34.90  ? 236 VAL D C   1 
ATOM   9710  O  O   . VAL D  1 236 ? -5.495  25.733  41.591  1.00 31.92  ? 236 VAL D O   1 
ATOM   9711  C  CB  . VAL D  1 236 ? -8.036  27.798  41.137  1.00 34.46  ? 236 VAL D CB  1 
ATOM   9712  C  CG1 . VAL D  1 236 ? -9.439  28.238  41.572  1.00 34.63  ? 236 VAL D CG1 1 
ATOM   9713  C  CG2 . VAL D  1 236 ? -6.960  28.672  41.812  1.00 29.78  ? 236 VAL D CG2 1 
ATOM   9714  N  N   . ASP D  1 237 ? -6.462  25.571  39.581  1.00 35.59  ? 237 ASP D N   1 
ATOM   9715  C  CA  . ASP D  1 237 ? -5.256  25.094  38.937  1.00 36.05  ? 237 ASP D CA  1 
ATOM   9716  C  C   . ASP D  1 237 ? -4.230  26.198  38.709  1.00 38.11  ? 237 ASP D C   1 
ATOM   9717  O  O   . ASP D  1 237 ? -3.022  25.958  38.779  1.00 39.51  ? 237 ASP D O   1 
ATOM   9718  C  CB  . ASP D  1 237 ? -5.612  24.433  37.612  1.00 28.09  ? 237 ASP D CB  1 
ATOM   9719  C  CG  . ASP D  1 237 ? -6.575  23.278  37.788  1.00 34.00  ? 237 ASP D CG  1 
ATOM   9720  O  OD1 . ASP D  1 237 ? -6.192  22.266  38.423  1.00 38.60  ? 237 ASP D OD1 1 
ATOM   9721  O  OD2 . ASP D  1 237 ? -7.713  23.387  37.286  1.00 40.61  ? 237 ASP D OD2 1 
ATOM   9722  N  N   . ARG D  1 238 ? -4.704  27.403  38.418  1.00 37.28  ? 238 ARG D N   1 
ATOM   9723  C  CA  . ARG D  1 238 ? -3.794  28.486  38.090  1.00 34.04  ? 238 ARG D CA  1 
ATOM   9724  C  C   . ARG D  1 238 ? -4.217  29.813  38.705  1.00 35.20  ? 238 ARG D C   1 
ATOM   9725  O  O   . ARG D  1 238 ? -5.404  30.104  38.846  1.00 33.52  ? 238 ARG D O   1 
ATOM   9726  C  CB  . ARG D  1 238 ? -3.663  28.625  36.573  1.00 36.77  ? 238 ARG D CB  1 
ATOM   9727  C  CG  . ARG D  1 238 ? -3.228  27.344  35.846  1.00 35.10  ? 238 ARG D CG  1 
ATOM   9728  C  CD  . ARG D  1 238 ? -1.769  27.034  36.130  1.00 32.94  ? 238 ARG D CD  1 
ATOM   9729  N  NE  . ARG D  1 238 ? -1.238  26.021  35.221  1.00 29.19  ? 238 ARG D NE  1 
ATOM   9730  C  CZ  . ARG D  1 238 ? -1.249  24.713  35.471  1.00 31.15  ? 238 ARG D CZ  1 
ATOM   9731  N  NH1 . ARG D  1 238 ? -1.780  24.252  36.598  1.00 31.41  ? 238 ARG D NH1 1 
ATOM   9732  N  NH2 . ARG D  1 238 ? -0.727  23.864  34.600  1.00 25.81  ? 238 ARG D NH2 1 
ATOM   9733  N  N   . VAL D  1 239 ? -3.231  30.619  39.077  1.00 37.24  ? 239 VAL D N   1 
ATOM   9734  C  CA  . VAL D  1 239 ? -3.505  31.978  39.501  1.00 37.59  ? 239 VAL D CA  1 
ATOM   9735  C  C   . VAL D  1 239 ? -2.678  32.972  38.702  1.00 37.14  ? 239 VAL D C   1 
ATOM   9736  O  O   . VAL D  1 239 ? -1.476  32.797  38.549  1.00 41.97  ? 239 VAL D O   1 
ATOM   9737  C  CB  . VAL D  1 239 ? -3.239  32.181  40.991  1.00 36.15  ? 239 VAL D CB  1 
ATOM   9738  C  CG1 . VAL D  1 239 ? -3.653  33.609  41.400  1.00 27.24  ? 239 VAL D CG1 1 
ATOM   9739  C  CG2 . VAL D  1 239 ? -4.006  31.146  41.803  1.00 33.85  ? 239 VAL D CG2 1 
ATOM   9740  N  N   . ILE D  1 240 ? -3.323  34.012  38.176  1.00 33.86  ? 240 ILE D N   1 
ATOM   9741  C  CA  . ILE D  1 240 ? -2.577  35.095  37.550  1.00 28.47  ? 240 ILE D CA  1 
ATOM   9742  C  C   . ILE D  1 240 ? -2.658  36.315  38.468  1.00 41.27  ? 240 ILE D C   1 
ATOM   9743  O  O   . ILE D  1 240 ? -3.755  36.770  38.812  1.00 41.53  ? 240 ILE D O   1 
ATOM   9744  C  CB  . ILE D  1 240 ? -3.123  35.451  36.150  1.00 36.42  ? 240 ILE D CB  1 
ATOM   9745  C  CG1 . ILE D  1 240 ? -3.098  34.231  35.205  1.00 33.38  ? 240 ILE D CG1 1 
ATOM   9746  C  CG2 . ILE D  1 240 ? -2.349  36.629  35.546  1.00 32.63  ? 240 ILE D CG2 1 
ATOM   9747  C  CD1 . ILE D  1 240 ? -3.770  34.510  33.826  1.00 33.41  ? 240 ILE D CD1 1 
ATOM   9748  N  N   . MET D  1 241 ? -1.499  36.829  38.880  1.00 39.57  ? 241 MET D N   1 
ATOM   9749  C  CA  . MET D  1 241 ? -1.435  38.038  39.696  1.00 35.97  ? 241 MET D CA  1 
ATOM   9750  C  C   . MET D  1 241 ? -1.313  39.289  38.828  1.00 38.57  ? 241 MET D C   1 
ATOM   9751  O  O   . MET D  1 241 ? -0.268  39.543  38.221  1.00 38.42  ? 241 MET D O   1 
ATOM   9752  C  CB  . MET D  1 241 ? -0.273  37.955  40.675  1.00 39.11  ? 241 MET D CB  1 
ATOM   9753  C  CG  . MET D  1 241 ? -0.452  36.892  41.739  1.00 36.27  ? 241 MET D CG  1 
ATOM   9754  S  SD  . MET D  1 241 ? 1.092   36.576  42.610  1.00 43.68  ? 241 MET D SD  1 
ATOM   9755  C  CE  . MET D  1 241 ? 1.500   38.201  43.242  1.00 47.72  ? 241 MET D CE  1 
ATOM   9756  N  N   . ALA D  1 242 ? -2.391  40.065  38.758  1.00 35.40  ? 242 ALA D N   1 
ATOM   9757  C  CA  . ALA D  1 242 ? -2.424  41.208  37.860  1.00 41.37  ? 242 ALA D CA  1 
ATOM   9758  C  C   . ALA D  1 242 ? -2.619  42.544  38.582  1.00 46.16  ? 242 ALA D C   1 
ATOM   9759  O  O   . ALA D  1 242 ? -2.433  43.602  37.988  1.00 55.12  ? 242 ALA D O   1 
ATOM   9760  C  CB  . ALA D  1 242 ? -3.494  41.007  36.801  1.00 34.11  ? 242 ALA D CB  1 
ATOM   9761  N  N   . GLY D  1 243 ? -2.988  42.497  39.858  1.00 47.42  ? 243 GLY D N   1 
ATOM   9762  C  CA  . GLY D  1 243 ? -3.192  43.716  40.632  1.00 52.02  ? 243 GLY D CA  1 
ATOM   9763  C  C   . GLY D  1 243 ? -3.190  43.485  42.134  1.00 58.43  ? 243 GLY D C   1 
ATOM   9764  O  O   . GLY D  1 243 ? -3.220  42.337  42.592  1.00 57.28  ? 243 GLY D O   1 
ATOM   9765  N  N   . GLY D  1 244 ? -3.147  44.573  42.902  1.00 57.75  ? 244 GLY D N   1 
ATOM   9766  C  CA  . GLY D  1 244 ? -3.179  44.491  44.354  1.00 59.99  ? 244 GLY D CA  1 
ATOM   9767  C  C   . GLY D  1 244 ? -1.814  44.654  45.000  1.00 66.00  ? 244 GLY D C   1 
ATOM   9768  O  O   . GLY D  1 244 ? -0.837  44.992  44.333  1.00 67.67  ? 244 GLY D O   1 
ATOM   9769  N  N   . GLY D  1 245 ? -1.748  44.424  46.307  1.00 71.11  ? 245 GLY D N   1 
ATOM   9770  C  CA  . GLY D  1 245 ? -0.497  44.525  47.037  1.00 75.23  ? 245 GLY D CA  1 
ATOM   9771  C  C   . GLY D  1 245 ? 0.305   43.239  46.963  1.00 78.02  ? 245 GLY D C   1 
ATOM   9772  O  O   . GLY D  1 245 ? -0.106  42.289  46.304  1.00 75.45  ? 245 GLY D O   1 
ATOM   9773  N  N   . SER D  1 246 ? 1.449   43.204  47.641  1.00 80.08  ? 246 SER D N   1 
ATOM   9774  C  CA  . SER D  1 246 ? 2.303   42.021  47.625  1.00 81.74  ? 246 SER D CA  1 
ATOM   9775  C  C   . SER D  1 246 ? 1.696   40.874  48.436  1.00 76.74  ? 246 SER D C   1 
ATOM   9776  O  O   . SER D  1 246 ? 2.123   39.722  48.302  1.00 75.06  ? 246 SER D O   1 
ATOM   9777  C  CB  . SER D  1 246 ? 3.725   42.348  48.108  1.00 85.62  ? 246 SER D CB  1 
ATOM   9778  O  OG  . SER D  1 246 ? 3.737   42.821  49.445  1.00 91.03  ? 246 SER D OG  1 
ATOM   9779  N  N   . GLU D  1 247 ? 0.699   41.189  49.265  1.00 64.15  ? 247 GLU D N   1 
ATOM   9780  C  CA  . GLU D  1 247 ? -0.011  40.160  50.021  1.00 58.94  ? 247 GLU D CA  1 
ATOM   9781  C  C   . GLU D  1 247 ? -0.785  39.261  49.063  1.00 55.09  ? 247 GLU D C   1 
ATOM   9782  O  O   . GLU D  1 247 ? -1.304  38.210  49.442  1.00 53.03  ? 247 GLU D O   1 
ATOM   9783  C  CB  . GLU D  1 247 ? -0.975  40.783  51.020  1.00 56.87  ? 247 GLU D CB  1 
ATOM   9784  C  CG  . GLU D  1 247 ? -2.233  41.350  50.385  1.00 64.21  ? 247 GLU D CG  1 
ATOM   9785  C  CD  . GLU D  1 247 ? -2.036  42.754  49.832  1.00 73.40  ? 247 GLU D CD  1 
ATOM   9786  O  OE1 . GLU D  1 247 ? -0.945  43.335  50.030  1.00 75.61  ? 247 GLU D OE1 1 
ATOM   9787  O  OE2 . GLU D  1 247 ? -2.978  43.280  49.202  1.00 75.02  ? 247 GLU D OE2 1 
ATOM   9788  N  N   . THR D  1 248 ? -0.862  39.705  47.817  1.00 47.77  ? 248 THR D N   1 
ATOM   9789  C  CA  . THR D  1 248 ? -1.531  38.969  46.759  1.00 44.45  ? 248 THR D CA  1 
ATOM   9790  C  C   . THR D  1 248 ? -0.860  37.623  46.490  1.00 39.21  ? 248 THR D C   1 
ATOM   9791  O  O   . THR D  1 248 ? -1.531  36.645  46.156  1.00 47.27  ? 248 THR D O   1 
ATOM   9792  C  CB  . THR D  1 248 ? -1.603  39.829  45.479  1.00 45.10  ? 248 THR D CB  1 
ATOM   9793  O  OG1 . THR D  1 248 ? -2.609  40.836  45.659  1.00 53.63  ? 248 THR D OG1 1 
ATOM   9794  C  CG2 . THR D  1 248 ? -1.977  38.997  44.285  1.00 57.01  ? 248 THR D CG2 1 
ATOM   9795  N  N   . LEU D  1 249 ? 0.459   37.571  46.657  1.00 42.15  ? 249 LEU D N   1 
ATOM   9796  C  CA  . LEU D  1 249 ? 1.210   36.333  46.454  1.00 38.61  ? 249 LEU D CA  1 
ATOM   9797  C  C   . LEU D  1 249 ? 0.785   35.241  47.428  1.00 38.73  ? 249 LEU D C   1 
ATOM   9798  O  O   . LEU D  1 249 ? 0.557   34.103  47.035  1.00 43.37  ? 249 LEU D O   1 
ATOM   9799  C  CB  . LEU D  1 249 ? 2.710   36.579  46.590  1.00 36.07  ? 249 LEU D CB  1 
ATOM   9800  C  CG  . LEU D  1 249 ? 3.568   35.313  46.463  1.00 37.53  ? 249 LEU D CG  1 
ATOM   9801  C  CD1 . LEU D  1 249 ? 3.254   34.580  45.147  1.00 40.99  ? 249 LEU D CD1 1 
ATOM   9802  C  CD2 . LEU D  1 249 ? 5.055   35.646  46.562  1.00 40.07  ? 249 LEU D CD2 1 
ATOM   9803  N  N   . SER D  1 250 ? 0.680   35.595  48.699  1.00 42.62  ? 250 SER D N   1 
ATOM   9804  C  CA  . SER D  1 250 ? 0.258   34.648  49.721  1.00 45.02  ? 250 SER D CA  1 
ATOM   9805  C  C   . SER D  1 250 ? -1.132  34.094  49.393  1.00 45.47  ? 250 SER D C   1 
ATOM   9806  O  O   . SER D  1 250 ? -1.360  32.883  49.438  1.00 45.43  ? 250 SER D O   1 
ATOM   9807  C  CB  . SER D  1 250 ? 0.261   35.321  51.092  1.00 39.59  ? 250 SER D CB  1 
ATOM   9808  O  OG  . SER D  1 250 ? -0.048  34.395  52.113  1.00 39.40  ? 250 SER D OG  1 
ATOM   9809  N  N   . GLN D  1 251 ? -2.052  34.990  49.049  1.00 37.85  ? 251 GLN D N   1 
ATOM   9810  C  CA  . GLN D  1 251 ? -3.395  34.593  48.635  1.00 39.58  ? 251 GLN D CA  1 
ATOM   9811  C  C   . GLN D  1 251 ? -3.333  33.596  47.485  1.00 42.40  ? 251 GLN D C   1 
ATOM   9812  O  O   . GLN D  1 251 ? -3.992  32.555  47.509  1.00 48.51  ? 251 GLN D O   1 
ATOM   9813  C  CB  . GLN D  1 251 ? -4.216  35.829  48.230  1.00 39.08  ? 251 GLN D CB  1 
ATOM   9814  C  CG  . GLN D  1 251 ? -4.249  36.910  49.321  1.00 48.31  ? 251 GLN D CG  1 
ATOM   9815  C  CD  . GLN D  1 251 ? -4.849  38.244  48.850  1.00 59.99  ? 251 GLN D CD  1 
ATOM   9816  O  OE1 . GLN D  1 251 ? -5.046  38.473  47.654  1.00 59.04  ? 251 GLN D OE1 1 
ATOM   9817  N  NE2 . GLN D  1 251 ? -5.124  39.131  49.798  1.00 59.09  ? 251 GLN D NE2 1 
ATOM   9818  N  N   . ALA D  1 252 ? -2.531  33.923  46.478  1.00 46.85  ? 252 ALA D N   1 
ATOM   9819  C  CA  . ALA D  1 252 ? -2.307  33.028  45.348  1.00 41.19  ? 252 ALA D CA  1 
ATOM   9820  C  C   . ALA D  1 252 ? -1.809  31.660  45.813  1.00 39.83  ? 252 ALA D C   1 
ATOM   9821  O  O   . ALA D  1 252 ? -2.334  30.620  45.413  1.00 34.47  ? 252 ALA D O   1 
ATOM   9822  C  CB  . ALA D  1 252 ? -1.307  33.654  44.367  1.00 28.60  ? 252 ALA D CB  1 
ATOM   9823  N  N   . VAL D  1 253 ? -0.782  31.656  46.652  1.00 41.00  ? 253 VAL D N   1 
ATOM   9824  C  CA  . VAL D  1 253 ? -0.202  30.390  47.074  1.00 43.20  ? 253 VAL D CA  1 
ATOM   9825  C  C   . VAL D  1 253 ? -1.249  29.557  47.791  1.00 44.87  ? 253 VAL D C   1 
ATOM   9826  O  O   . VAL D  1 253 ? -1.322  28.345  47.607  1.00 46.52  ? 253 VAL D O   1 
ATOM   9827  C  CB  . VAL D  1 253 ? 1.037   30.588  47.966  1.00 47.25  ? 253 VAL D CB  1 
ATOM   9828  C  CG1 . VAL D  1 253 ? 1.435   29.262  48.666  1.00 34.03  ? 253 VAL D CG1 1 
ATOM   9829  C  CG2 . VAL D  1 253 ? 2.188   31.141  47.139  1.00 40.01  ? 253 VAL D CG2 1 
ATOM   9830  N  N   . LYS D  1 254 ? -2.084  30.214  48.586  1.00 48.90  ? 254 LYS D N   1 
ATOM   9831  C  CA  . LYS D  1 254 ? -3.047  29.485  49.398  1.00 45.65  ? 254 LYS D CA  1 
ATOM   9832  C  C   . LYS D  1 254 ? -4.195  28.913  48.573  1.00 43.05  ? 254 LYS D C   1 
ATOM   9833  O  O   . LYS D  1 254 ? -4.736  27.857  48.891  1.00 50.11  ? 254 LYS D O   1 
ATOM   9834  C  CB  . LYS D  1 254 ? -3.565  30.362  50.541  1.00 41.99  ? 254 LYS D CB  1 
ATOM   9835  C  CG  . LYS D  1 254 ? -2.493  30.669  51.601  1.00 40.68  ? 254 LYS D CG  1 
ATOM   9836  C  CD  . LYS D  1 254 ? -3.047  31.536  52.733  1.00 44.66  ? 254 LYS D CD  1 
ATOM   9837  C  CE  . LYS D  1 254 ? -1.926  32.173  53.556  1.00 51.38  ? 254 LYS D CE  1 
ATOM   9838  N  NZ  . LYS D  1 254 ? -2.459  33.125  54.567  1.00 56.68  ? 254 LYS D NZ  1 
ATOM   9839  N  N   . MET D  1 255 ? -4.552  29.588  47.494  1.00 37.03  ? 255 MET D N   1 
ATOM   9840  C  CA  . MET D  1 255 ? -5.722  29.163  46.743  1.00 41.22  ? 255 MET D CA  1 
ATOM   9841  C  C   . MET D  1 255 ? -5.383  28.190  45.617  1.00 39.62  ? 255 MET D C   1 
ATOM   9842  O  O   . MET D  1 255 ? -6.250  27.455  45.149  1.00 40.01  ? 255 MET D O   1 
ATOM   9843  C  CB  . MET D  1 255 ? -6.493  30.374  46.209  1.00 43.96  ? 255 MET D CB  1 
ATOM   9844  C  CG  . MET D  1 255 ? -5.834  31.049  45.030  1.00 49.18  ? 255 MET D CG  1 
ATOM   9845  S  SD  . MET D  1 255 ? -6.724  32.527  44.478  1.00 48.93  ? 255 MET D SD  1 
ATOM   9846  C  CE  . MET D  1 255 ? -6.854  33.453  46.002  1.00 39.16  ? 255 MET D CE  1 
ATOM   9847  N  N   . VAL D  1 256 ? -4.124  28.163  45.192  1.00 37.30  ? 256 VAL D N   1 
ATOM   9848  C  CA  . VAL D  1 256 ? -3.749  27.295  44.081  1.00 36.86  ? 256 VAL D CA  1 
ATOM   9849  C  C   . VAL D  1 256 ? -3.461  25.870  44.557  1.00 42.08  ? 256 VAL D C   1 
ATOM   9850  O  O   . VAL D  1 256 ? -2.959  25.663  45.659  1.00 40.91  ? 256 VAL D O   1 
ATOM   9851  C  CB  . VAL D  1 256 ? -2.527  27.825  43.303  1.00 33.63  ? 256 VAL D CB  1 
ATOM   9852  C  CG1 . VAL D  1 256 ? -1.225  27.309  43.939  1.00 29.15  ? 256 VAL D CG1 1 
ATOM   9853  C  CG2 . VAL D  1 256 ? -2.593  27.385  41.840  1.00 35.75  ? 256 VAL D CG2 1 
ATOM   9854  N  N   . LYS D  1 257 ? -3.789  24.896  43.714  1.00 38.17  ? 257 LYS D N   1 
ATOM   9855  C  CA  . LYS D  1 257 ? -3.517  23.495  44.000  1.00 30.78  ? 257 LYS D CA  1 
ATOM   9856  C  C   . LYS D  1 257 ? -2.028  23.200  43.994  1.00 32.60  ? 257 LYS D C   1 
ATOM   9857  O  O   . LYS D  1 257 ? -1.258  23.879  43.313  1.00 30.78  ? 257 LYS D O   1 
ATOM   9858  C  CB  . LYS D  1 257 ? -4.164  22.600  42.941  1.00 27.53  ? 257 LYS D CB  1 
ATOM   9859  C  CG  . LYS D  1 257 ? -5.683  22.511  42.994  1.00 33.00  ? 257 LYS D CG  1 
ATOM   9860  C  CD  . LYS D  1 257 ? -6.187  21.849  41.715  1.00 43.71  ? 257 LYS D CD  1 
ATOM   9861  C  CE  . LYS D  1 257 ? -7.678  22.041  41.520  1.00 40.88  ? 257 LYS D CE  1 
ATOM   9862  N  NZ  . LYS D  1 257 ? -8.125  21.458  40.229  1.00 41.67  ? 257 LYS D NZ  1 
ATOM   9863  N  N   . PRO D  1 258 ? -1.622  22.156  44.733  1.00 31.27  ? 258 PRO D N   1 
ATOM   9864  C  CA  . PRO D  1 258 ? -0.258  21.638  44.605  1.00 32.19  ? 258 PRO D CA  1 
ATOM   9865  C  C   . PRO D  1 258 ? -0.036  21.170  43.176  1.00 31.34  ? 258 PRO D C   1 
ATOM   9866  O  O   . PRO D  1 258 ? -0.907  20.513  42.611  1.00 37.98  ? 258 PRO D O   1 
ATOM   9867  C  CB  . PRO D  1 258 ? -0.249  20.428  45.551  1.00 36.84  ? 258 PRO D CB  1 
ATOM   9868  C  CG  . PRO D  1 258 ? -1.371  20.665  46.499  1.00 37.93  ? 258 PRO D CG  1 
ATOM   9869  C  CD  . PRO D  1 258 ? -2.411  21.425  45.743  1.00 28.59  ? 258 PRO D CD  1 
ATOM   9870  N  N   . GLY D  1 259 ? 1.123   21.484  42.610  1.00 32.52  ? 259 GLY D N   1 
ATOM   9871  C  CA  . GLY D  1 259 ? 1.397   21.222  41.210  1.00 30.06  ? 259 GLY D CA  1 
ATOM   9872  C  C   . GLY D  1 259 ? 0.940   22.386  40.344  1.00 36.85  ? 259 GLY D C   1 
ATOM   9873  O  O   . GLY D  1 259 ? 1.193   22.415  39.141  1.00 33.21  ? 259 GLY D O   1 
ATOM   9874  N  N   . GLY D  1 260 ? 0.270   23.359  40.959  1.00 34.75  ? 260 GLY D N   1 
ATOM   9875  C  CA  . GLY D  1 260 ? -0.272  24.481  40.215  1.00 33.60  ? 260 GLY D CA  1 
ATOM   9876  C  C   . GLY D  1 260 ? 0.790   25.501  39.855  1.00 37.08  ? 260 GLY D C   1 
ATOM   9877  O  O   . GLY D  1 260 ? 1.959   25.378  40.242  1.00 37.93  ? 260 GLY D O   1 
ATOM   9878  N  N   . ILE D  1 261 ? 0.384   26.518  39.104  1.00 34.81  ? 261 ILE D N   1 
ATOM   9879  C  CA  . ILE D  1 261 ? 1.286   27.594  38.738  1.00 34.82  ? 261 ILE D CA  1 
ATOM   9880  C  C   . ILE D  1 261 ? 0.715   28.972  39.102  1.00 37.41  ? 261 ILE D C   1 
ATOM   9881  O  O   . ILE D  1 261 ? -0.470  29.262  38.881  1.00 33.30  ? 261 ILE D O   1 
ATOM   9882  C  CB  . ILE D  1 261 ? 1.632   27.566  37.238  1.00 38.41  ? 261 ILE D CB  1 
ATOM   9883  C  CG1 . ILE D  1 261 ? 2.266   26.227  36.852  1.00 36.50  ? 261 ILE D CG1 1 
ATOM   9884  C  CG2 . ILE D  1 261 ? 2.564   28.717  36.894  1.00 34.67  ? 261 ILE D CG2 1 
ATOM   9885  C  CD1 . ILE D  1 261 ? 2.591   26.101  35.377  1.00 31.16  ? 261 ILE D CD1 1 
ATOM   9886  N  N   . ILE D  1 262 ? 1.562   29.812  39.683  1.00 38.20  ? 262 ILE D N   1 
ATOM   9887  C  CA  . ILE D  1 262 ? 1.188   31.194  39.960  1.00 36.73  ? 262 ILE D CA  1 
ATOM   9888  C  C   . ILE D  1 262 ? 1.961   32.079  39.010  1.00 35.33  ? 262 ILE D C   1 
ATOM   9889  O  O   . ILE D  1 262 ? 3.191   32.034  38.967  1.00 38.34  ? 262 ILE D O   1 
ATOM   9890  C  CB  . ILE D  1 262 ? 1.531   31.608  41.395  1.00 36.18  ? 262 ILE D CB  1 
ATOM   9891  C  CG1 . ILE D  1 262 ? 0.636   30.866  42.381  1.00 39.83  ? 262 ILE D CG1 1 
ATOM   9892  C  CG2 . ILE D  1 262 ? 1.414   33.146  41.564  1.00 23.36  ? 262 ILE D CG2 1 
ATOM   9893  C  CD1 . ILE D  1 262 ? 1.295   30.620  43.721  1.00 41.68  ? 262 ILE D CD1 1 
ATOM   9894  N  N   . SER D  1 263 ? 1.230   32.887  38.256  1.00 30.62  ? 263 SER D N   1 
ATOM   9895  C  CA  . SER D  1 263 ? 1.816   33.736  37.229  1.00 34.64  ? 263 SER D CA  1 
ATOM   9896  C  C   . SER D  1 263 ? 1.634   35.209  37.573  1.00 38.03  ? 263 SER D C   1 
ATOM   9897  O  O   . SER D  1 263 ? 0.515   35.726  37.535  1.00 38.65  ? 263 SER D O   1 
ATOM   9898  C  CB  . SER D  1 263 ? 1.138   33.445  35.887  1.00 35.54  ? 263 SER D CB  1 
ATOM   9899  O  OG  . SER D  1 263 ? 1.611   34.323  34.887  1.00 42.56  ? 263 SER D OG  1 
ATOM   9900  N  N   . ASN D  1 264 ? 2.727   35.890  37.898  1.00 37.14  ? 264 ASN D N   1 
ATOM   9901  C  CA  . ASN D  1 264 ? 2.660   37.312  38.202  1.00 34.10  ? 264 ASN D CA  1 
ATOM   9902  C  C   . ASN D  1 264 ? 3.036   38.217  37.035  1.00 34.21  ? 264 ASN D C   1 
ATOM   9903  O  O   . ASN D  1 264 ? 4.060   38.036  36.384  1.00 37.04  ? 264 ASN D O   1 
ATOM   9904  C  CB  . ASN D  1 264 ? 3.561   37.681  39.384  1.00 37.73  ? 264 ASN D CB  1 
ATOM   9905  C  CG  . ASN D  1 264 ? 3.549   39.174  39.655  1.00 43.50  ? 264 ASN D CG  1 
ATOM   9906  O  OD1 . ASN D  1 264 ? 2.588   39.694  40.227  1.00 40.28  ? 264 ASN D OD1 1 
ATOM   9907  N  ND2 . ASN D  1 264 ? 4.592   39.880  39.202  1.00 42.66  ? 264 ASN D ND2 1 
ATOM   9908  N  N   . ILE D  1 265 ? 2.221   39.225  36.794  1.00 31.82  ? 265 ILE D N   1 
ATOM   9909  C  CA  . ILE D  1 265 ? 2.574   40.223  35.804  1.00 39.57  ? 265 ILE D CA  1 
ATOM   9910  C  C   . ILE D  1 265 ? 2.402   41.598  36.425  1.00 43.53  ? 265 ILE D C   1 
ATOM   9911  O  O   . ILE D  1 265 ? 2.552   42.611  35.752  1.00 41.66  ? 265 ILE D O   1 
ATOM   9912  C  CB  . ILE D  1 265 ? 1.692   40.110  34.561  1.00 35.41  ? 265 ILE D CB  1 
ATOM   9913  C  CG1 . ILE D  1 265 ? 0.230   40.068  34.974  1.00 41.12  ? 265 ILE D CG1 1 
ATOM   9914  C  CG2 . ILE D  1 265 ? 2.015   38.851  33.778  1.00 36.16  ? 265 ILE D CG2 1 
ATOM   9915  C  CD1 . ILE D  1 265 ? -0.686  39.757  33.836  1.00 34.12  ? 265 ILE D CD1 1 
ATOM   9916  N  N   . ASN D  1 266 ? 2.077   41.620  37.713  1.00 42.30  ? 266 ASN D N   1 
ATOM   9917  C  CA  . ASN D  1 266 ? 1.881   42.878  38.432  1.00 47.76  ? 266 ASN D CA  1 
ATOM   9918  C  C   . ASN D  1 266 ? 3.213   43.570  38.722  1.00 47.33  ? 266 ASN D C   1 
ATOM   9919  O  O   . ASN D  1 266 ? 4.219   42.912  39.006  1.00 36.38  ? 266 ASN D O   1 
ATOM   9920  C  CB  . ASN D  1 266 ? 1.131   42.626  39.745  1.00 44.60  ? 266 ASN D CB  1 
ATOM   9921  C  CG  . ASN D  1 266 ? 0.633   43.910  40.391  1.00 49.30  ? 266 ASN D CG  1 
ATOM   9922  O  OD1 . ASN D  1 266 ? 0.564   44.956  39.749  1.00 53.21  ? 266 ASN D OD1 1 
ATOM   9923  N  ND2 . ASN D  1 266 ? 0.278   43.831  41.666  1.00 49.91  ? 266 ASN D ND2 1 
ATOM   9924  N  N   . TYR D  1 267 ? 3.229   44.893  38.624  1.00 57.72  ? 267 TYR D N   1 
ATOM   9925  C  CA  . TYR D  1 267 ? 4.380   45.654  39.096  1.00 63.82  ? 267 TYR D CA  1 
ATOM   9926  C  C   . TYR D  1 267 ? 4.245   45.875  40.588  1.00 68.11  ? 267 TYR D C   1 
ATOM   9927  O  O   . TYR D  1 267 ? 3.385   46.628  41.031  1.00 73.75  ? 267 TYR D O   1 
ATOM   9928  C  CB  . TYR D  1 267 ? 4.481   47.009  38.410  1.00 66.57  ? 267 TYR D CB  1 
ATOM   9929  C  CG  . TYR D  1 267 ? 5.814   47.692  38.636  1.00 79.54  ? 267 TYR D CG  1 
ATOM   9930  C  CD1 . TYR D  1 267 ? 6.581   47.422  39.768  1.00 77.51  ? 267 TYR D CD1 1 
ATOM   9931  C  CD2 . TYR D  1 267 ? 6.300   48.622  37.723  1.00 87.39  ? 267 TYR D CD2 1 
ATOM   9932  C  CE1 . TYR D  1 267 ? 7.791   48.044  39.969  1.00 79.41  ? 267 TYR D CE1 1 
ATOM   9933  C  CE2 . TYR D  1 267 ? 7.512   49.252  37.919  1.00 86.15  ? 267 TYR D CE2 1 
ATOM   9934  C  CZ  . TYR D  1 267 ? 8.253   48.960  39.040  1.00 86.56  ? 267 TYR D CZ  1 
ATOM   9935  O  OH  . TYR D  1 267 ? 9.460   49.594  39.227  1.00 95.12  ? 267 TYR D OH  1 
ATOM   9936  N  N   . HIS D  1 268 ? 5.089   45.205  41.360  1.00 67.79  ? 268 HIS D N   1 
ATOM   9937  C  CA  . HIS D  1 268 ? 5.146   45.437  42.791  1.00 74.78  ? 268 HIS D CA  1 
ATOM   9938  C  C   . HIS D  1 268 ? 6.183   46.529  43.032  1.00 86.27  ? 268 HIS D C   1 
ATOM   9939  O  O   . HIS D  1 268 ? 7.386   46.285  42.931  1.00 85.94  ? 268 HIS D O   1 
ATOM   9940  C  CB  . HIS D  1 268 ? 5.521   44.148  43.534  1.00 69.02  ? 268 HIS D CB  1 
ATOM   9941  C  CG  . HIS D  1 268 ? 4.669   42.969  43.171  1.00 65.89  ? 268 HIS D CG  1 
ATOM   9942  N  ND1 . HIS D  1 268 ? 3.524   42.634  43.864  1.00 67.15  ? 268 HIS D ND1 1 
ATOM   9943  C  CD2 . HIS D  1 268 ? 4.791   42.051  42.183  1.00 56.81  ? 268 HIS D CD2 1 
ATOM   9944  C  CE1 . HIS D  1 268 ? 2.979   41.562  43.318  1.00 61.79  ? 268 HIS D CE1 1 
ATOM   9945  N  NE2 . HIS D  1 268 ? 3.728   41.189  42.296  1.00 59.21  ? 268 HIS D NE2 1 
ATOM   9946  N  N   . GLY D  1 269 ? 5.710   47.736  43.333  1.00 96.60  ? 269 GLY D N   1 
ATOM   9947  C  CA  . GLY D  1 269 ? 6.582   48.891  43.463  1.00 100.49 ? 269 GLY D CA  1 
ATOM   9948  C  C   . GLY D  1 269 ? 6.804   49.396  44.878  1.00 106.44 ? 269 GLY D C   1 
ATOM   9949  O  O   . GLY D  1 269 ? 7.300   50.506  45.063  1.00 113.38 ? 269 GLY D O   1 
ATOM   9950  N  N   . SER D  1 270 ? 6.449   48.594  45.880  1.00 104.43 ? 270 SER D N   1 
ATOM   9951  C  CA  . SER D  1 270 ? 6.633   49.006  47.271  1.00 103.04 ? 270 SER D CA  1 
ATOM   9952  C  C   . SER D  1 270 ? 6.823   47.828  48.223  1.00 95.85  ? 270 SER D C   1 
ATOM   9953  O  O   . SER D  1 270 ? 6.196   46.780  48.071  1.00 96.26  ? 270 SER D O   1 
ATOM   9954  C  CB  . SER D  1 270 ? 5.458   49.864  47.742  1.00 106.48 ? 270 SER D CB  1 
ATOM   9955  O  OG  . SER D  1 270 ? 4.328   49.059  48.031  1.00 108.20 ? 270 SER D OG  1 
ATOM   9956  N  N   . GLY D  1 271 ? 7.681   48.026  49.218  1.00 88.99  ? 271 GLY D N   1 
ATOM   9957  C  CA  . GLY D  1 271 ? 7.999   46.991  50.183  1.00 81.28  ? 271 GLY D CA  1 
ATOM   9958  C  C   . GLY D  1 271 ? 9.359   46.385  49.893  1.00 77.55  ? 271 GLY D C   1 
ATOM   9959  O  O   . GLY D  1 271 ? 9.815   46.382  48.751  1.00 78.12  ? 271 GLY D O   1 
ATOM   9960  N  N   . ASP D  1 272 ? 10.020  45.871  50.921  1.00 72.63  ? 272 ASP D N   1 
ATOM   9961  C  CA  . ASP D  1 272 ? 11.331  45.272  50.715  1.00 70.75  ? 272 ASP D CA  1 
ATOM   9962  C  C   . ASP D  1 272 ? 11.222  43.894  50.062  1.00 67.49  ? 272 ASP D C   1 
ATOM   9963  O  O   . ASP D  1 272 ? 12.115  43.479  49.320  1.00 59.46  ? 272 ASP D O   1 
ATOM   9964  C  CB  . ASP D  1 272 ? 12.106  45.188  52.033  1.00 77.15  ? 272 ASP D CB  1 
ATOM   9965  C  CG  . ASP D  1 272 ? 12.665  46.534  52.470  1.00 89.23  ? 272 ASP D CG  1 
ATOM   9966  O  OD1 . ASP D  1 272 ? 12.401  47.547  51.785  1.00 92.37  ? 272 ASP D OD1 1 
ATOM   9967  O  OD2 . ASP D  1 272 ? 13.371  46.576  53.499  1.00 92.58  ? 272 ASP D OD2 1 
ATOM   9968  N  N   . ALA D  1 273 ? 10.118  43.195  50.317  1.00 68.70  ? 273 ALA D N   1 
ATOM   9969  C  CA  . ALA D  1 273 ? 10.015  41.801  49.900  1.00 67.34  ? 273 ALA D CA  1 
ATOM   9970  C  C   . ALA D  1 273 ? 8.587   41.278  49.740  1.00 65.94  ? 273 ALA D C   1 
ATOM   9971  O  O   . ALA D  1 273 ? 7.662   41.750  50.403  1.00 66.05  ? 273 ALA D O   1 
ATOM   9972  C  CB  . ALA D  1 273 ? 10.779  40.925  50.878  1.00 67.73  ? 273 ALA D CB  1 
ATOM   9973  N  N   . LEU D  1 274 ? 8.422   40.295  48.853  1.00 60.33  ? 274 LEU D N   1 
ATOM   9974  C  CA  . LEU D  1 274 ? 7.172   39.553  48.759  1.00 49.97  ? 274 LEU D CA  1 
ATOM   9975  C  C   . LEU D  1 274 ? 7.262   38.297  49.623  1.00 49.06  ? 274 LEU D C   1 
ATOM   9976  O  O   . LEU D  1 274 ? 8.327   37.664  49.716  1.00 48.75  ? 274 LEU D O   1 
ATOM   9977  C  CB  . LEU D  1 274 ? 6.867   39.170  47.315  1.00 46.93  ? 274 LEU D CB  1 
ATOM   9978  C  CG  . LEU D  1 274 ? 6.793   40.292  46.288  1.00 50.92  ? 274 LEU D CG  1 
ATOM   9979  C  CD1 . LEU D  1 274 ? 8.154   40.549  45.695  1.00 45.87  ? 274 LEU D CD1 1 
ATOM   9980  C  CD2 . LEU D  1 274 ? 5.812   39.918  45.190  1.00 59.78  ? 274 LEU D CD2 1 
ATOM   9981  N  N   . LEU D  1 275 ? 6.150   37.932  50.258  1.00 47.80  ? 275 LEU D N   1 
ATOM   9982  C  CA  . LEU D  1 275 ? 6.134   36.780  51.160  1.00 55.89  ? 275 LEU D CA  1 
ATOM   9983  C  C   . LEU D  1 275 ? 5.419   35.555  50.594  1.00 53.95  ? 275 LEU D C   1 
ATOM   9984  O  O   . LEU D  1 275 ? 4.306   35.652  50.072  1.00 49.67  ? 275 LEU D O   1 
ATOM   9985  C  CB  . LEU D  1 275 ? 5.505   37.150  52.500  1.00 63.79  ? 275 LEU D CB  1 
ATOM   9986  C  CG  . LEU D  1 275 ? 6.391   37.923  53.469  1.00 71.50  ? 275 LEU D CG  1 
ATOM   9987  C  CD1 . LEU D  1 275 ? 6.833   39.240  52.856  1.00 70.90  ? 275 LEU D CD1 1 
ATOM   9988  C  CD2 . LEU D  1 275 ? 5.632   38.151  54.759  1.00 77.98  ? 275 LEU D CD2 1 
ATOM   9989  N  N   . ILE D  1 276 ? 6.078   34.407  50.711  1.00 51.22  ? 276 ILE D N   1 
ATOM   9990  C  CA  . ILE D  1 276 ? 5.464   33.122  50.421  1.00 49.89  ? 276 ILE D CA  1 
ATOM   9991  C  C   . ILE D  1 276 ? 5.079   32.523  51.770  1.00 51.27  ? 276 ILE D C   1 
ATOM   9992  O  O   . ILE D  1 276 ? 5.907   32.467  52.681  1.00 50.30  ? 276 ILE D O   1 
ATOM   9993  C  CB  . ILE D  1 276 ? 6.460   32.185  49.710  1.00 45.54  ? 276 ILE D CB  1 
ATOM   9994  C  CG1 . ILE D  1 276 ? 6.948   32.802  48.396  1.00 41.18  ? 276 ILE D CG1 1 
ATOM   9995  C  CG2 . ILE D  1 276 ? 5.852   30.816  49.469  1.00 47.71  ? 276 ILE D CG2 1 
ATOM   9996  C  CD1 . ILE D  1 276 ? 8.273   32.214  47.894  1.00 31.82  ? 276 ILE D CD1 1 
ATOM   9997  N  N   . PRO D  1 277 ? 3.816   32.094  51.914  1.00 50.33  ? 277 PRO D N   1 
ATOM   9998  C  CA  . PRO D  1 277 ? 3.373   31.432  53.145  1.00 49.15  ? 277 PRO D CA  1 
ATOM   9999  C  C   . PRO D  1 277 ? 4.046   30.074  53.216  1.00 48.46  ? 277 PRO D C   1 
ATOM   10000 O  O   . PRO D  1 277 ? 3.759   29.243  52.361  1.00 50.06  ? 277 PRO D O   1 
ATOM   10001 C  CB  . PRO D  1 277 ? 1.868   31.229  52.924  1.00 50.95  ? 277 PRO D CB  1 
ATOM   10002 C  CG  . PRO D  1 277 ? 1.533   31.919  51.631  1.00 49.49  ? 277 PRO D CG  1 
ATOM   10003 C  CD  . PRO D  1 277 ? 2.794   32.047  50.859  1.00 50.55  ? 277 PRO D CD  1 
ATOM   10004 N  N   . ARG D  1 278 ? 4.920   29.848  54.196  1.00 44.02  ? 278 ARG D N   1 
ATOM   10005 C  CA  . ARG D  1 278 ? 5.707   28.614  54.232  1.00 43.35  ? 278 ARG D CA  1 
ATOM   10006 C  C   . ARG D  1 278 ? 4.871   27.336  54.214  1.00 36.46  ? 278 ARG D C   1 
ATOM   10007 O  O   . ARG D  1 278 ? 5.094   26.435  53.396  1.00 43.22  ? 278 ARG D O   1 
ATOM   10008 C  CB  . ARG D  1 278 ? 6.659   28.600  55.435  1.00 47.77  ? 278 ARG D CB  1 
ATOM   10009 C  CG  . ARG D  1 278 ? 7.555   27.367  55.494  1.00 46.15  ? 278 ARG D CG  1 
ATOM   10010 C  CD  . ARG D  1 278 ? 8.399   27.365  56.776  1.00 50.68  ? 278 ARG D CD  1 
ATOM   10011 N  NE  . ARG D  1 278 ? 7.545   27.421  57.958  1.00 54.17  ? 278 ARG D NE  1 
ATOM   10012 C  CZ  . ARG D  1 278 ? 7.114   26.358  58.631  1.00 47.86  ? 278 ARG D CZ  1 
ATOM   10013 N  NH1 . ARG D  1 278 ? 7.471   25.136  58.253  1.00 42.67  ? 278 ARG D NH1 1 
ATOM   10014 N  NH2 . ARG D  1 278 ? 6.320   26.519  59.684  1.00 46.77  ? 278 ARG D NH2 1 
ATOM   10015 N  N   . VAL D  1 279 ? 3.909   27.253  55.120  1.00 35.58  ? 279 VAL D N   1 
ATOM   10016 C  CA  . VAL D  1 279 ? 3.102   26.044  55.255  1.00 39.07  ? 279 VAL D CA  1 
ATOM   10017 C  C   . VAL D  1 279 ? 2.276   25.745  53.995  1.00 43.42  ? 279 VAL D C   1 
ATOM   10018 O  O   . VAL D  1 279 ? 2.183   24.601  53.542  1.00 45.14  ? 279 VAL D O   1 
ATOM   10019 C  CB  . VAL D  1 279 ? 2.163   26.152  56.471  1.00 45.68  ? 279 VAL D CB  1 
ATOM   10020 C  CG1 . VAL D  1 279 ? 1.066   25.094  56.407  1.00 52.49  ? 279 VAL D CG1 1 
ATOM   10021 C  CG2 . VAL D  1 279 ? 2.954   26.031  57.763  1.00 44.72  ? 279 VAL D CG2 1 
ATOM   10022 N  N   . GLU D  1 280 ? 1.669   26.771  53.420  1.00 39.16  ? 280 GLU D N   1 
ATOM   10023 C  CA  . GLU D  1 280 ? 0.805   26.524  52.274  1.00 46.82  ? 280 GLU D CA  1 
ATOM   10024 C  C   . GLU D  1 280 ? 1.602   26.328  50.991  1.00 41.83  ? 280 GLU D C   1 
ATOM   10025 O  O   . GLU D  1 280 ? 1.068   25.859  49.994  1.00 45.17  ? 280 GLU D O   1 
ATOM   10026 C  CB  . GLU D  1 280 ? -0.262  27.607  52.141  1.00 42.98  ? 280 GLU D CB  1 
ATOM   10027 C  CG  . GLU D  1 280 ? -1.370  27.456  53.168  1.00 44.19  ? 280 GLU D CG  1 
ATOM   10028 C  CD  . GLU D  1 280 ? -1.077  28.149  54.500  1.00 50.89  ? 280 GLU D CD  1 
ATOM   10029 O  OE1 . GLU D  1 280 ? 0.061   28.627  54.720  1.00 43.61  ? 280 GLU D OE1 1 
ATOM   10030 O  OE2 . GLU D  1 280 ? -2.004  28.214  55.336  1.00 58.92  ? 280 GLU D OE2 1 
ATOM   10031 N  N   . TRP D  1 281 ? 2.884   26.672  51.035  1.00 37.58  ? 281 TRP D N   1 
ATOM   10032 C  CA  . TRP D  1 281 ? 3.804   26.341  49.948  1.00 39.49  ? 281 TRP D CA  1 
ATOM   10033 C  C   . TRP D  1 281 ? 4.462   24.969  50.206  1.00 41.92  ? 281 TRP D C   1 
ATOM   10034 O  O   . TRP D  1 281 ? 5.533   24.648  49.669  1.00 39.11  ? 281 TRP D O   1 
ATOM   10035 C  CB  . TRP D  1 281 ? 4.856   27.452  49.802  1.00 34.84  ? 281 TRP D CB  1 
ATOM   10036 C  CG  . TRP D  1 281 ? 5.478   27.558  48.440  1.00 36.75  ? 281 TRP D CG  1 
ATOM   10037 C  CD1 . TRP D  1 281 ? 4.823   27.673  47.238  1.00 41.38  ? 281 TRP D CD1 1 
ATOM   10038 C  CD2 . TRP D  1 281 ? 6.877   27.593  48.137  1.00 35.91  ? 281 TRP D CD2 1 
ATOM   10039 N  NE1 . TRP D  1 281 ? 5.732   27.763  46.210  1.00 37.82  ? 281 TRP D NE1 1 
ATOM   10040 C  CE2 . TRP D  1 281 ? 6.998   27.718  46.735  1.00 34.75  ? 281 TRP D CE2 1 
ATOM   10041 C  CE3 . TRP D  1 281 ? 8.042   27.526  48.915  1.00 37.33  ? 281 TRP D CE3 1 
ATOM   10042 C  CZ2 . TRP D  1 281 ? 8.233   27.778  46.096  1.00 33.80  ? 281 TRP D CZ2 1 
ATOM   10043 C  CZ3 . TRP D  1 281 ? 9.271   27.583  48.278  1.00 35.11  ? 281 TRP D CZ3 1 
ATOM   10044 C  CH2 . TRP D  1 281 ? 9.358   27.705  46.879  1.00 37.68  ? 281 TRP D CH2 1 
ATOM   10045 N  N   . GLY D  1 282 ? 3.813   24.155  51.034  1.00 40.95  ? 282 GLY D N   1 
ATOM   10046 C  CA  . GLY D  1 282 ? 4.334   22.840  51.363  1.00 38.25  ? 282 GLY D CA  1 
ATOM   10047 C  C   . GLY D  1 282 ? 5.765   22.861  51.877  1.00 37.03  ? 282 GLY D C   1 
ATOM   10048 O  O   . GLY D  1 282 ? 6.542   21.937  51.622  1.00 35.46  ? 282 GLY D O   1 
ATOM   10049 N  N   . CYS D  1 283 ? 6.114   23.926  52.593  1.00 36.36  ? 283 CYS D N   1 
ATOM   10050 C  CA  . CYS D  1 283 ? 7.455   24.082  53.142  1.00 46.57  ? 283 CYS D CA  1 
ATOM   10051 C  C   . CYS D  1 283 ? 8.533   23.999  52.052  1.00 49.27  ? 283 CYS D C   1 
ATOM   10052 O  O   . CYS D  1 283 ? 9.680   23.647  52.329  1.00 45.88  ? 283 CYS D O   1 
ATOM   10053 C  CB  . CYS D  1 283 ? 7.705   23.038  54.238  1.00 48.02  ? 283 CYS D CB  1 
ATOM   10054 S  SG  . CYS D  1 283 ? 6.420   22.982  55.547  1.00 63.58  ? 283 CYS D SG  1 
ATOM   10055 N  N   . GLY D  1 284 ? 8.159   24.327  50.817  1.00 45.24  ? 284 GLY D N   1 
ATOM   10056 C  CA  . GLY D  1 284 ? 9.089   24.314  49.699  1.00 38.60  ? 284 GLY D CA  1 
ATOM   10057 C  C   . GLY D  1 284 ? 8.908   23.144  48.738  1.00 36.00  ? 284 GLY D C   1 
ATOM   10058 O  O   . GLY D  1 284 ? 9.602   23.048  47.722  1.00 40.35  ? 284 GLY D O   1 
ATOM   10059 N  N   . MET D  1 285 ? 7.963   22.260  49.041  1.00 33.25  ? 285 MET D N   1 
ATOM   10060 C  CA  . MET D  1 285 ? 7.855   20.998  48.310  1.00 39.13  ? 285 MET D CA  1 
ATOM   10061 C  C   . MET D  1 285 ? 6.486   20.760  47.684  1.00 42.12  ? 285 MET D C   1 
ATOM   10062 O  O   . MET D  1 285 ? 6.116   19.610  47.384  1.00 33.71  ? 285 MET D O   1 
ATOM   10063 C  CB  . MET D  1 285 ? 8.209   19.827  49.241  1.00 33.30  ? 285 MET D CB  1 
ATOM   10064 C  CG  . MET D  1 285 ? 9.599   19.927  49.826  1.00 35.21  ? 285 MET D CG  1 
ATOM   10065 S  SD  . MET D  1 285 ? 9.884   18.666  51.078  1.00 41.85  ? 285 MET D SD  1 
ATOM   10066 C  CE  . MET D  1 285 ? 8.716   19.185  52.330  1.00 39.15  ? 285 MET D CE  1 
ATOM   10067 N  N   . ALA D  1 286 ? 5.740   21.841  47.476  1.00 34.72  ? 286 ALA D N   1 
ATOM   10068 C  CA  . ALA D  1 286 ? 4.357   21.721  47.041  1.00 29.96  ? 286 ALA D CA  1 
ATOM   10069 C  C   . ALA D  1 286 ? 4.178   21.774  45.523  1.00 32.87  ? 286 ALA D C   1 
ATOM   10070 O  O   . ALA D  1 286 ? 3.056   21.745  45.031  1.00 42.66  ? 286 ALA D O   1 
ATOM   10071 C  CB  . ALA D  1 286 ? 3.490   22.783  47.729  1.00 29.63  ? 286 ALA D CB  1 
ATOM   10072 N  N   . HIS D  1 287 ? 5.278   21.825  44.782  1.00 32.23  ? 287 HIS D N   1 
ATOM   10073 C  CA  . HIS D  1 287 ? 5.210   22.049  43.338  1.00 33.01  ? 287 HIS D CA  1 
ATOM   10074 C  C   . HIS D  1 287 ? 4.261   23.205  42.949  1.00 33.11  ? 287 HIS D C   1 
ATOM   10075 O  O   . HIS D  1 287 ? 3.552   23.115  41.937  1.00 29.12  ? 287 HIS D O   1 
ATOM   10076 C  CB  . HIS D  1 287 ? 4.816   20.763  42.587  1.00 30.58  ? 287 HIS D CB  1 
ATOM   10077 C  CG  . HIS D  1 287 ? 5.828   19.658  42.691  1.00 26.84  ? 287 HIS D CG  1 
ATOM   10078 N  ND1 . HIS D  1 287 ? 5.738   18.656  43.635  1.00 25.75  ? 287 HIS D ND1 1 
ATOM   10079 C  CD2 . HIS D  1 287 ? 6.941   19.390  41.963  1.00 24.21  ? 287 HIS D CD2 1 
ATOM   10080 C  CE1 . HIS D  1 287 ? 6.757   17.822  43.489  1.00 26.23  ? 287 HIS D CE1 1 
ATOM   10081 N  NE2 . HIS D  1 287 ? 7.504   18.245  42.485  1.00 26.62  ? 287 HIS D NE2 1 
ATOM   10082 N  N   . LYS D  1 288 ? 4.239   24.274  43.749  1.00 29.89  ? 288 LYS D N   1 
ATOM   10083 C  CA  . LYS D  1 288 ? 3.509   25.491  43.372  1.00 36.80  ? 288 LYS D CA  1 
ATOM   10084 C  C   . LYS D  1 288 ? 4.484   26.491  42.770  1.00 34.18  ? 288 LYS D C   1 
ATOM   10085 O  O   . LYS D  1 288 ? 5.063   27.315  43.467  1.00 34.35  ? 288 LYS D O   1 
ATOM   10086 C  CB  . LYS D  1 288 ? 2.750   26.105  44.557  1.00 36.21  ? 288 LYS D CB  1 
ATOM   10087 C  CG  . LYS D  1 288 ? 1.560   25.277  45.029  1.00 33.75  ? 288 LYS D CG  1 
ATOM   10088 C  CD  . LYS D  1 288 ? 1.052   25.734  46.383  1.00 32.87  ? 288 LYS D CD  1 
ATOM   10089 C  CE  . LYS D  1 288 ? -0.085  24.834  46.868  1.00 38.07  ? 288 LYS D CE  1 
ATOM   10090 N  NZ  . LYS D  1 288 ? -0.874  25.483  47.947  1.00 36.16  ? 288 LYS D NZ  1 
ATOM   10091 N  N   . THR D  1 289 ? 4.665   26.390  41.461  1.00 33.40  ? 289 THR D N   1 
ATOM   10092 C  CA  . THR D  1 289 ? 5.659   27.175  40.753  1.00 31.01  ? 289 THR D CA  1 
ATOM   10093 C  C   . THR D  1 289 ? 5.261   28.639  40.716  1.00 37.26  ? 289 THR D C   1 
ATOM   10094 O  O   . THR D  1 289 ? 4.093   28.961  40.459  1.00 31.93  ? 289 THR D O   1 
ATOM   10095 C  CB  . THR D  1 289 ? 5.807   26.665  39.312  1.00 31.38  ? 289 THR D CB  1 
ATOM   10096 O  OG1 . THR D  1 289 ? 6.397   25.357  39.333  1.00 28.08  ? 289 THR D OG1 1 
ATOM   10097 C  CG2 . THR D  1 289 ? 6.673   27.628  38.477  1.00 24.71  ? 289 THR D CG2 1 
ATOM   10098 N  N   . ILE D  1 290 ? 6.231   29.516  40.976  1.00 32.40  ? 290 ILE D N   1 
ATOM   10099 C  CA  . ILE D  1 290 ? 5.993   30.959  40.940  1.00 31.40  ? 290 ILE D CA  1 
ATOM   10100 C  C   . ILE D  1 290 ? 6.782   31.631  39.818  1.00 32.17  ? 290 ILE D C   1 
ATOM   10101 O  O   . ILE D  1 290 ? 7.995   31.508  39.735  1.00 32.58  ? 290 ILE D O   1 
ATOM   10102 C  CB  . ILE D  1 290 ? 6.324   31.617  42.278  1.00 32.87  ? 290 ILE D CB  1 
ATOM   10103 C  CG1 . ILE D  1 290 ? 5.519   30.950  43.394  1.00 34.54  ? 290 ILE D CG1 1 
ATOM   10104 C  CG2 . ILE D  1 290 ? 6.026   33.101  42.227  1.00 34.91  ? 290 ILE D CG2 1 
ATOM   10105 C  CD1 . ILE D  1 290 ? 5.988   31.305  44.787  1.00 29.01  ? 290 ILE D CD1 1 
ATOM   10106 N  N   . LYS D  1 291 ? 6.067   32.302  38.925  1.00 30.15  ? 291 LYS D N   1 
ATOM   10107 C  CA  . LYS D  1 291 ? 6.677   32.950  37.774  1.00 33.75  ? 291 LYS D CA  1 
ATOM   10108 C  C   . LYS D  1 291 ? 6.297   34.421  37.773  1.00 32.63  ? 291 LYS D C   1 
ATOM   10109 O  O   . LYS D  1 291 ? 5.273   34.793  38.345  1.00 32.67  ? 291 LYS D O   1 
ATOM   10110 C  CB  . LYS D  1 291 ? 6.194   32.305  36.476  1.00 34.89  ? 291 LYS D CB  1 
ATOM   10111 C  CG  . LYS D  1 291 ? 6.701   30.899  36.249  1.00 38.04  ? 291 LYS D CG  1 
ATOM   10112 C  CD  . LYS D  1 291 ? 6.446   30.508  34.802  1.00 44.21  ? 291 LYS D CD  1 
ATOM   10113 C  CE  . LYS D  1 291 ? 6.125   29.043  34.660  1.00 36.98  ? 291 LYS D CE  1 
ATOM   10114 N  NZ  . LYS D  1 291 ? 5.843   28.717  33.242  1.00 31.41  ? 291 LYS D NZ  1 
ATOM   10115 N  N   . GLY D  1 292 ? 7.125   35.246  37.137  1.00 38.33  ? 292 GLY D N   1 
ATOM   10116 C  CA  . GLY D  1 292 ? 6.891   36.688  37.062  1.00 35.36  ? 292 GLY D CA  1 
ATOM   10117 C  C   . GLY D  1 292 ? 7.725   37.297  35.952  1.00 40.56  ? 292 GLY D C   1 
ATOM   10118 O  O   . GLY D  1 292 ? 8.960   37.269  36.015  1.00 39.33  ? 292 GLY D O   1 
ATOM   10119 N  N   . GLY D  1 293 ? 7.068   37.851  34.930  1.00 37.94  ? 293 GLY D N   1 
ATOM   10120 C  CA  . GLY D  1 293 ? 7.795   38.345  33.770  1.00 34.71  ? 293 GLY D CA  1 
ATOM   10121 C  C   . GLY D  1 293 ? 7.329   39.647  33.126  1.00 44.27  ? 293 GLY D C   1 
ATOM   10122 O  O   . GLY D  1 293 ? 6.129   39.933  33.072  1.00 43.52  ? 293 GLY D O   1 
ATOM   10123 N  N   . LEU D  1 294 ? 8.292   40.432  32.638  1.00 42.83  ? 294 LEU D N   1 
ATOM   10124 C  CA  . LEU D  1 294 ? 8.018   41.615  31.819  1.00 36.53  ? 294 LEU D CA  1 
ATOM   10125 C  C   . LEU D  1 294 ? 7.439   41.183  30.477  1.00 40.26  ? 294 LEU D C   1 
ATOM   10126 O  O   . LEU D  1 294 ? 7.847   40.165  29.908  1.00 34.30  ? 294 LEU D O   1 
ATOM   10127 C  CB  . LEU D  1 294 ? 9.305   42.399  31.587  1.00 29.91  ? 294 LEU D CB  1 
ATOM   10128 C  CG  . LEU D  1 294 ? 9.268   43.683  30.766  1.00 36.19  ? 294 LEU D CG  1 
ATOM   10129 C  CD1 . LEU D  1 294 ? 8.332   44.703  31.402  1.00 37.38  ? 294 LEU D CD1 1 
ATOM   10130 C  CD2 . LEU D  1 294 ? 10.674  44.256  30.622  1.00 30.34  ? 294 LEU D CD2 1 
ATOM   10131 N  N   . CYS D  1 295 ? 6.489   41.956  29.964  1.00 39.26  ? 295 CYS D N   1 
ATOM   10132 C  CA  . CYS D  1 295 ? 5.814   41.566  28.736  1.00 32.40  ? 295 CYS D CA  1 
ATOM   10133 C  C   . CYS D  1 295 ? 6.782   41.479  27.569  1.00 35.13  ? 295 CYS D C   1 
ATOM   10134 O  O   . CYS D  1 295 ? 7.695   42.299  27.453  1.00 34.73  ? 295 CYS D O   1 
ATOM   10135 C  CB  . CYS D  1 295 ? 4.700   42.556  28.403  1.00 40.64  ? 295 CYS D CB  1 
ATOM   10136 S  SG  . CYS D  1 295 ? 5.295   44.247  28.206  1.00 38.29  ? 295 CYS D SG  1 
ATOM   10137 N  N   . PRO D  1 296 ? 6.584   40.481  26.689  1.00 34.87  ? 296 PRO D N   1 
ATOM   10138 C  CA  . PRO D  1 296 ? 7.374   40.447  25.457  1.00 36.00  ? 296 PRO D CA  1 
ATOM   10139 C  C   . PRO D  1 296 ? 7.136   41.697  24.614  1.00 41.62  ? 296 PRO D C   1 
ATOM   10140 O  O   . PRO D  1 296 ? 6.051   42.277  24.654  1.00 38.90  ? 296 PRO D O   1 
ATOM   10141 C  CB  . PRO D  1 296 ? 6.805   39.241  24.711  1.00 36.42  ? 296 PRO D CB  1 
ATOM   10142 C  CG  . PRO D  1 296 ? 6.193   38.374  25.782  1.00 40.09  ? 296 PRO D CG  1 
ATOM   10143 C  CD  . PRO D  1 296 ? 5.627   39.366  26.767  1.00 37.51  ? 296 PRO D CD  1 
ATOM   10144 N  N   . GLY D  1 297 ? 8.138   42.098  23.845  1.00 40.72  ? 297 GLY D N   1 
ATOM   10145 C  CA  . GLY D  1 297 ? 7.948   43.141  22.855  1.00 34.74  ? 297 GLY D CA  1 
ATOM   10146 C  C   . GLY D  1 297 ? 8.497   42.724  21.505  1.00 38.52  ? 297 GLY D C   1 
ATOM   10147 O  O   . GLY D  1 297 ? 8.472   41.541  21.153  1.00 33.77  ? 297 GLY D O   1 
ATOM   10148 N  N   . GLY D  1 298 ? 8.989   43.694  20.741  1.00 37.34  ? 298 GLY D N   1 
ATOM   10149 C  CA  . GLY D  1 298 ? 9.492   43.412  19.408  1.00 35.53  ? 298 GLY D CA  1 
ATOM   10150 C  C   . GLY D  1 298 ? 8.411   43.237  18.348  1.00 34.47  ? 298 GLY D C   1 
ATOM   10151 O  O   . GLY D  1 298 ? 7.212   43.147  18.638  1.00 32.22  ? 298 GLY D O   1 
ATOM   10152 N  N   . ARG D  1 299 ? 8.848   43.184  17.098  1.00 28.35  ? 299 ARG D N   1 
ATOM   10153 C  CA  . ARG D  1 299 ? 7.947   43.035  15.959  1.00 35.70  ? 299 ARG D CA  1 
ATOM   10154 C  C   . ARG D  1 299 ? 7.063   41.775  16.022  1.00 34.31  ? 299 ARG D C   1 
ATOM   10155 O  O   . ARG D  1 299 ? 5.848   41.853  15.834  1.00 38.55  ? 299 ARG D O   1 
ATOM   10156 C  CB  . ARG D  1 299 ? 8.777   43.054  14.675  1.00 39.31  ? 299 ARG D CB  1 
ATOM   10157 C  CG  . ARG D  1 299 ? 8.037   42.774  13.386  1.00 37.70  ? 299 ARG D CG  1 
ATOM   10158 C  CD  . ARG D  1 299 ? 8.982   43.099  12.245  1.00 39.11  ? 299 ARG D CD  1 
ATOM   10159 N  NE  . ARG D  1 299 ? 8.383   42.936  10.930  1.00 43.86  ? 299 ARG D NE  1 
ATOM   10160 C  CZ  . ARG D  1 299 ? 9.013   43.188  9.789   1.00 39.56  ? 299 ARG D CZ  1 
ATOM   10161 N  NH1 . ARG D  1 299 ? 10.266  43.627  9.799   1.00 36.76  ? 299 ARG D NH1 1 
ATOM   10162 N  NH2 . ARG D  1 299 ? 8.390   42.993  8.636   1.00 35.62  ? 299 ARG D NH2 1 
ATOM   10163 N  N   . LEU D  1 300 ? 7.665   40.620  16.302  1.00 34.31  ? 300 LEU D N   1 
ATOM   10164 C  CA  . LEU D  1 300 ? 6.917   39.365  16.261  1.00 33.93  ? 300 LEU D CA  1 
ATOM   10165 C  C   . LEU D  1 300 ? 5.755   39.395  17.245  1.00 34.15  ? 300 LEU D C   1 
ATOM   10166 O  O   . LEU D  1 300 ? 4.630   39.064  16.893  1.00 35.18  ? 300 LEU D O   1 
ATOM   10167 C  CB  . LEU D  1 300 ? 7.826   38.147  16.520  1.00 35.22  ? 300 LEU D CB  1 
ATOM   10168 C  CG  . LEU D  1 300 ? 7.145   36.768  16.336  1.00 35.04  ? 300 LEU D CG  1 
ATOM   10169 C  CD1 . LEU D  1 300 ? 6.628   36.535  14.899  1.00 26.09  ? 300 LEU D CD1 1 
ATOM   10170 C  CD2 . LEU D  1 300 ? 8.072   35.654  16.740  1.00 29.40  ? 300 LEU D CD2 1 
ATOM   10171 N  N   . ARG D  1 301 ? 6.025   39.797  18.479  1.00 32.61  ? 301 ARG D N   1 
ATOM   10172 C  CA  . ARG D  1 301 ? 4.966   39.884  19.473  1.00 33.60  ? 301 ARG D CA  1 
ATOM   10173 C  C   . ARG D  1 301 ? 3.822   40.764  18.958  1.00 38.65  ? 301 ARG D C   1 
ATOM   10174 O  O   . ARG D  1 301 ? 2.642   40.394  19.036  1.00 36.27  ? 301 ARG D O   1 
ATOM   10175 C  CB  . ARG D  1 301 ? 5.509   40.454  20.779  1.00 31.30  ? 301 ARG D CB  1 
ATOM   10176 C  CG  . ARG D  1 301 ? 4.469   40.540  21.867  1.00 33.27  ? 301 ARG D CG  1 
ATOM   10177 C  CD  . ARG D  1 301 ? 3.904   39.153  22.183  1.00 31.50  ? 301 ARG D CD  1 
ATOM   10178 N  NE  . ARG D  1 301 ? 3.263   39.136  23.498  1.00 38.39  ? 301 ARG D NE  1 
ATOM   10179 C  CZ  . ARG D  1 301 ? 2.864   38.034  24.130  1.00 36.93  ? 301 ARG D CZ  1 
ATOM   10180 N  NH1 . ARG D  1 301 ? 3.027   36.853  23.559  1.00 32.53  ? 301 ARG D NH1 1 
ATOM   10181 N  NH2 . ARG D  1 301 ? 2.296   38.115  25.331  1.00 31.42  ? 301 ARG D NH2 1 
ATOM   10182 N  N   . MET D  1 302 ? 4.175   41.932  18.427  1.00 38.97  ? 302 MET D N   1 
ATOM   10183 C  CA  . MET D  1 302 ? 3.170   42.870  17.933  1.00 36.13  ? 302 MET D CA  1 
ATOM   10184 C  C   . MET D  1 302 ? 2.375   42.239  16.794  1.00 33.82  ? 302 MET D C   1 
ATOM   10185 O  O   . MET D  1 302 ? 1.141   42.242  16.793  1.00 31.91  ? 302 MET D O   1 
ATOM   10186 C  CB  . MET D  1 302 ? 3.818   44.193  17.486  1.00 34.66  ? 302 MET D CB  1 
ATOM   10187 C  CG  . MET D  1 302 ? 4.398   45.038  18.638  1.00 33.79  ? 302 MET D CG  1 
ATOM   10188 S  SD  . MET D  1 302 ? 3.196   45.511  19.932  1.00 35.97  ? 302 MET D SD  1 
ATOM   10189 C  CE  . MET D  1 302 ? 3.536   44.208  21.126  1.00 29.52  ? 302 MET D CE  1 
ATOM   10190 N  N   . GLU D  1 303 ? 3.085   41.677  15.831  1.00 31.70  ? 303 GLU D N   1 
ATOM   10191 C  CA  . GLU D  1 303 ? 2.417   41.021  14.711  1.00 36.61  ? 303 GLU D CA  1 
ATOM   10192 C  C   . GLU D  1 303 ? 1.458   39.928  15.159  1.00 35.92  ? 303 GLU D C   1 
ATOM   10193 O  O   . GLU D  1 303 ? 0.352   39.780  14.615  1.00 33.50  ? 303 GLU D O   1 
ATOM   10194 C  CB  . GLU D  1 303 ? 3.448   40.456  13.747  1.00 37.15  ? 303 GLU D CB  1 
ATOM   10195 C  CG  . GLU D  1 303 ? 4.038   41.526  12.859  1.00 41.96  ? 303 GLU D CG  1 
ATOM   10196 C  CD  . GLU D  1 303 ? 5.162   41.003  12.005  1.00 43.68  ? 303 GLU D CD  1 
ATOM   10197 O  OE1 . GLU D  1 303 ? 5.662   39.890  12.308  1.00 43.63  ? 303 GLU D OE1 1 
ATOM   10198 O  OE2 . GLU D  1 303 ? 5.552   41.713  11.052  1.00 37.43  ? 303 GLU D OE2 1 
ATOM   10199 N  N   . ARG D  1 304 ? 1.871   39.164  16.159  1.00 31.71  ? 304 ARG D N   1 
ATOM   10200 C  CA  . ARG D  1 304 ? 1.015   38.088  16.628  1.00 33.41  ? 304 ARG D CA  1 
ATOM   10201 C  C   . ARG D  1 304 ? -0.236  38.618  17.321  1.00 36.67  ? 304 ARG D C   1 
ATOM   10202 O  O   . ARG D  1 304 ? -1.329  38.083  17.129  1.00 35.90  ? 304 ARG D O   1 
ATOM   10203 C  CB  . ARG D  1 304 ? 1.785   37.150  17.546  1.00 35.05  ? 304 ARG D CB  1 
ATOM   10204 C  CG  . ARG D  1 304 ? 2.939   36.451  16.837  1.00 41.02  ? 304 ARG D CG  1 
ATOM   10205 C  CD  . ARG D  1 304 ? 2.777   34.976  16.933  1.00 38.81  ? 304 ARG D CD  1 
ATOM   10206 N  NE  . ARG D  1 304 ? 3.712   34.246  16.091  1.00 39.86  ? 304 ARG D NE  1 
ATOM   10207 C  CZ  . ARG D  1 304 ? 4.672   33.462  16.563  1.00 35.23  ? 304 ARG D CZ  1 
ATOM   10208 N  NH1 . ARG D  1 304 ? 4.839   33.341  17.871  1.00 29.91  ? 304 ARG D NH1 1 
ATOM   10209 N  NH2 . ARG D  1 304 ? 5.465   32.814  15.726  1.00 35.74  ? 304 ARG D NH2 1 
ATOM   10210 N  N   . LEU D  1 305 ? -0.081  39.669  18.123  1.00 34.92  ? 305 LEU D N   1 
ATOM   10211 C  CA  . LEU D  1 305 ? -1.220  40.204  18.855  1.00 38.66  ? 305 LEU D CA  1 
ATOM   10212 C  C   . LEU D  1 305 ? -2.153  40.894  17.875  1.00 34.37  ? 305 LEU D C   1 
ATOM   10213 O  O   . LEU D  1 305 ? -3.373  40.890  18.036  1.00 32.08  ? 305 LEU D O   1 
ATOM   10214 C  CB  . LEU D  1 305 ? -0.757  41.165  19.956  1.00 40.26  ? 305 LEU D CB  1 
ATOM   10215 C  CG  . LEU D  1 305 ? 0.095   40.474  21.025  1.00 44.88  ? 305 LEU D CG  1 
ATOM   10216 C  CD1 . LEU D  1 305 ? 0.453   41.408  22.172  1.00 48.53  ? 305 LEU D CD1 1 
ATOM   10217 C  CD2 . LEU D  1 305 ? -0.608  39.225  21.546  1.00 46.20  ? 305 LEU D CD2 1 
ATOM   10218 N  N   . ILE D  1 306 ? -1.558  41.485  16.851  1.00 31.73  ? 306 ILE D N   1 
ATOM   10219 C  CA  . ILE D  1 306 ? -2.332  42.144  15.823  1.00 39.05  ? 306 ILE D CA  1 
ATOM   10220 C  C   . ILE D  1 306 ? -3.252  41.123  15.113  1.00 39.47  ? 306 ILE D C   1 
ATOM   10221 O  O   . ILE D  1 306 ? -4.422  41.414  14.847  1.00 32.99  ? 306 ILE D O   1 
ATOM   10222 C  CB  . ILE D  1 306 ? -1.412  42.905  14.845  1.00 34.77  ? 306 ILE D CB  1 
ATOM   10223 C  CG1 . ILE D  1 306 ? -1.017  44.263  15.453  1.00 30.96  ? 306 ILE D CG1 1 
ATOM   10224 C  CG2 . ILE D  1 306 ? -2.113  43.100  13.507  1.00 34.71  ? 306 ILE D CG2 1 
ATOM   10225 C  CD1 . ILE D  1 306 ? 0.193   44.898  14.805  1.00 28.60  ? 306 ILE D CD1 1 
ATOM   10226 N  N   . ASP D  1 307 ? -2.737  39.922  14.850  1.00 35.45  ? 307 ASP D N   1 
ATOM   10227 C  CA  . ASP D  1 307 ? -3.554  38.893  14.195  1.00 36.82  ? 307 ASP D CA  1 
ATOM   10228 C  C   . ASP D  1 307 ? -4.731  38.527  15.086  1.00 38.01  ? 307 ASP D C   1 
ATOM   10229 O  O   . ASP D  1 307 ? -5.856  38.360  14.611  1.00 34.48  ? 307 ASP D O   1 
ATOM   10230 C  CB  . ASP D  1 307 ? -2.723  37.657  13.822  1.00 34.60  ? 307 ASP D CB  1 
ATOM   10231 C  CG  . ASP D  1 307 ? -2.155  37.742  12.409  1.00 36.37  ? 307 ASP D CG  1 
ATOM   10232 O  OD1 . ASP D  1 307 ? -2.202  38.832  11.824  1.00 34.14  ? 307 ASP D OD1 1 
ATOM   10233 O  OD2 . ASP D  1 307 ? -1.692  36.723  11.856  1.00 41.20  ? 307 ASP D OD2 1 
ATOM   10234 N  N   . LEU D  1 308 ? -4.477  38.432  16.386  1.00 37.21  ? 308 LEU D N   1 
ATOM   10235 C  CA  . LEU D  1 308 ? -5.544  38.151  17.343  1.00 40.81  ? 308 LEU D CA  1 
ATOM   10236 C  C   . LEU D  1 308 ? -6.665  39.203  17.302  1.00 37.07  ? 308 LEU D C   1 
ATOM   10237 O  O   . LEU D  1 308 ? -7.850  38.872  17.370  1.00 40.52  ? 308 LEU D O   1 
ATOM   10238 C  CB  . LEU D  1 308 ? -4.972  37.996  18.757  1.00 35.55  ? 308 LEU D CB  1 
ATOM   10239 C  CG  . LEU D  1 308 ? -4.114  36.737  18.961  1.00 32.20  ? 308 LEU D CG  1 
ATOM   10240 C  CD1 . LEU D  1 308 ? -3.391  36.774  20.289  1.00 29.08  ? 308 LEU D CD1 1 
ATOM   10241 C  CD2 . LEU D  1 308 ? -4.955  35.452  18.837  1.00 31.30  ? 308 LEU D CD2 1 
ATOM   10242 N  N   . VAL D  1 309 ? -6.291  40.469  17.170  1.00 42.10  ? 309 VAL D N   1 
ATOM   10243 C  CA  . VAL D  1 309 ? -7.279  41.542  17.052  1.00 34.08  ? 309 VAL D CA  1 
ATOM   10244 C  C   . VAL D  1 309 ? -7.932  41.521  15.683  1.00 39.73  ? 309 VAL D C   1 
ATOM   10245 O  O   . VAL D  1 309 ? -9.150  41.657  15.547  1.00 39.09  ? 309 VAL D O   1 
ATOM   10246 C  CB  . VAL D  1 309 ? -6.632  42.930  17.233  1.00 36.82  ? 309 VAL D CB  1 
ATOM   10247 C  CG1 . VAL D  1 309 ? -7.682  44.010  17.110  1.00 34.31  ? 309 VAL D CG1 1 
ATOM   10248 C  CG2 . VAL D  1 309 ? -5.902  43.017  18.589  1.00 37.75  ? 309 VAL D CG2 1 
ATOM   10249 N  N   . PHE D  1 310 ? -7.099  41.383  14.664  1.00 42.75  ? 310 PHE D N   1 
ATOM   10250 C  CA  . PHE D  1 310 ? -7.565  41.401  13.287  1.00 38.33  ? 310 PHE D CA  1 
ATOM   10251 C  C   . PHE D  1 310 ? -8.593  40.297  12.998  1.00 37.90  ? 310 PHE D C   1 
ATOM   10252 O  O   . PHE D  1 310 ? -9.586  40.538  12.311  1.00 35.31  ? 310 PHE D O   1 
ATOM   10253 C  CB  . PHE D  1 310 ? -6.374  41.286  12.340  1.00 36.31  ? 310 PHE D CB  1 
ATOM   10254 C  CG  . PHE D  1 310 ? -6.746  41.380  10.898  1.00 39.59  ? 310 PHE D CG  1 
ATOM   10255 C  CD1 . PHE D  1 310 ? -6.934  42.616  10.299  1.00 42.33  ? 310 PHE D CD1 1 
ATOM   10256 C  CD2 . PHE D  1 310 ? -6.915  40.231  10.138  1.00 41.47  ? 310 PHE D CD2 1 
ATOM   10257 C  CE1 . PHE D  1 310 ? -7.285  42.714  8.953   1.00 47.14  ? 310 PHE D CE1 1 
ATOM   10258 C  CE2 . PHE D  1 310 ? -7.259  40.306  8.798   1.00 44.17  ? 310 PHE D CE2 1 
ATOM   10259 C  CZ  . PHE D  1 310 ? -7.450  41.551  8.198   1.00 52.17  ? 310 PHE D CZ  1 
ATOM   10260 N  N   . TYR D  1 311 ? -8.358  39.089  13.512  1.00 30.64  ? 311 TYR D N   1 
ATOM   10261 C  CA  . TYR D  1 311 ? -9.293  37.986  13.273  1.00 31.34  ? 311 TYR D CA  1 
ATOM   10262 C  C   . TYR D  1 311 ? -10.256 37.849  14.438  1.00 34.25  ? 311 TYR D C   1 
ATOM   10263 O  O   . TYR D  1 311 ? -10.857 36.798  14.652  1.00 39.32  ? 311 TYR D O   1 
ATOM   10264 C  CB  . TYR D  1 311 ? -8.564  36.675  13.016  1.00 31.24  ? 311 TYR D CB  1 
ATOM   10265 C  CG  . TYR D  1 311 ? -7.718  36.688  11.762  1.00 39.30  ? 311 TYR D CG  1 
ATOM   10266 C  CD1 . TYR D  1 311 ? -8.317  36.727  10.503  1.00 35.41  ? 311 TYR D CD1 1 
ATOM   10267 C  CD2 . TYR D  1 311 ? -6.322  36.640  11.830  1.00 34.49  ? 311 TYR D CD2 1 
ATOM   10268 C  CE1 . TYR D  1 311 ? -7.559  36.731  9.348   1.00 37.32  ? 311 TYR D CE1 1 
ATOM   10269 C  CE2 . TYR D  1 311 ? -5.548  36.650  10.671  1.00 38.55  ? 311 TYR D CE2 1 
ATOM   10270 C  CZ  . TYR D  1 311 ? -6.182  36.693  9.430   1.00 43.63  ? 311 TYR D CZ  1 
ATOM   10271 O  OH  . TYR D  1 311 ? -5.454  36.697  8.261   1.00 44.59  ? 311 TYR D OH  1 
ATOM   10272 N  N   . LYS D  1 312 ? -10.363 38.927  15.200  1.00 33.89  ? 312 LYS D N   1 
ATOM   10273 C  CA  . LYS D  1 312 ? -11.383 39.063  16.225  1.00 41.19  ? 312 LYS D CA  1 
ATOM   10274 C  C   . LYS D  1 312 ? -11.334 37.954  17.262  1.00 42.02  ? 312 LYS D C   1 
ATOM   10275 O  O   . LYS D  1 312 ? -12.379 37.500  17.726  1.00 40.68  ? 312 LYS D O   1 
ATOM   10276 C  CB  . LYS D  1 312 ? -12.774 39.120  15.590  1.00 44.36  ? 312 LYS D CB  1 
ATOM   10277 C  CG  . LYS D  1 312 ? -12.916 40.176  14.481  1.00 48.39  ? 312 LYS D CG  1 
ATOM   10278 C  CD  . LYS D  1 312 ? -14.364 40.308  14.035  1.00 50.71  ? 312 LYS D CD  1 
ATOM   10279 C  CE  . LYS D  1 312 ? -14.463 40.869  12.632  1.00 57.53  ? 312 LYS D CE  1 
ATOM   10280 N  NZ  . LYS D  1 312 ? -14.114 42.301  12.596  1.00 59.82  ? 312 LYS D NZ  1 
ATOM   10281 N  N   . ARG D  1 313 ? -10.128 37.519  17.632  1.00 34.19  ? 313 ARG D N   1 
ATOM   10282 C  CA  . ARG D  1 313 ? -10.004 36.547  18.711  1.00 33.66  ? 313 ARG D CA  1 
ATOM   10283 C  C   . ARG D  1 313 ? -10.222 37.283  20.030  1.00 36.58  ? 313 ARG D C   1 
ATOM   10284 O  O   . ARG D  1 313 ? -10.658 36.704  21.019  1.00 40.71  ? 313 ARG D O   1 
ATOM   10285 C  CB  . ARG D  1 313 ? -8.638  35.873  18.675  1.00 31.29  ? 313 ARG D CB  1 
ATOM   10286 C  CG  . ARG D  1 313 ? -8.307  35.292  17.301  1.00 32.14  ? 313 ARG D CG  1 
ATOM   10287 C  CD  . ARG D  1 313 ? -9.396  34.338  16.810  1.00 30.70  ? 313 ARG D CD  1 
ATOM   10288 N  NE  . ARG D  1 313 ? -8.933  33.533  15.680  1.00 32.86  ? 313 ARG D NE  1 
ATOM   10289 C  CZ  . ARG D  1 313 ? -9.725  32.817  14.879  1.00 38.81  ? 313 ARG D CZ  1 
ATOM   10290 N  NH1 . ARG D  1 313 ? -11.049 32.808  15.056  1.00 33.80  ? 313 ARG D NH1 1 
ATOM   10291 N  NH2 . ARG D  1 313 ? -9.192  32.125  13.880  1.00 35.76  ? 313 ARG D NH2 1 
ATOM   10292 N  N   . VAL D  1 314 ? -9.937  38.578  20.018  1.00 36.85  ? 314 VAL D N   1 
ATOM   10293 C  CA  . VAL D  1 314 ? -10.118 39.432  21.186  1.00 41.97  ? 314 VAL D CA  1 
ATOM   10294 C  C   . VAL D  1 314 ? -10.489 40.847  20.715  1.00 48.77  ? 314 VAL D C   1 
ATOM   10295 O  O   . VAL D  1 314 ? -10.038 41.281  19.650  1.00 47.02  ? 314 VAL D O   1 
ATOM   10296 C  CB  . VAL D  1 314 ? -8.832  39.469  22.049  1.00 36.86  ? 314 VAL D CB  1 
ATOM   10297 C  CG1 . VAL D  1 314 ? -7.626  39.856  21.202  1.00 36.48  ? 314 VAL D CG1 1 
ATOM   10298 C  CG2 . VAL D  1 314 ? -8.985  40.424  23.223  1.00 38.31  ? 314 VAL D CG2 1 
ATOM   10299 N  N   . ASP D  1 315 ? -11.319 41.543  21.499  1.00 50.71  ? 315 ASP D N   1 
ATOM   10300 C  CA  . ASP D  1 315 ? -11.734 42.924  21.212  1.00 43.68  ? 315 ASP D CA  1 
ATOM   10301 C  C   . ASP D  1 315 ? -11.232 43.870  22.312  1.00 44.23  ? 315 ASP D C   1 
ATOM   10302 O  O   . ASP D  1 315 ? -11.891 44.056  23.331  1.00 46.01  ? 315 ASP D O   1 
ATOM   10303 C  CB  . ASP D  1 315 ? -13.270 43.012  21.084  1.00 41.69  ? 315 ASP D CB  1 
ATOM   10304 C  CG  . ASP D  1 315 ? -13.765 44.432  20.740  1.00 52.99  ? 315 ASP D CG  1 
ATOM   10305 O  OD1 . ASP D  1 315 ? -12.926 45.347  20.554  1.00 53.17  ? 315 ASP D OD1 1 
ATOM   10306 O  OD2 . ASP D  1 315 ? -14.998 44.632  20.646  1.00 53.78  ? 315 ASP D OD2 1 
ATOM   10307 N  N   . PRO D  1 316 ? -10.056 44.474  22.101  1.00 44.73  ? 316 PRO D N   1 
ATOM   10308 C  CA  . PRO D  1 316 ? -9.387  45.325  23.099  1.00 42.51  ? 316 PRO D CA  1 
ATOM   10309 C  C   . PRO D  1 316 ? -10.090 46.674  23.347  1.00 43.36  ? 316 PRO D C   1 
ATOM   10310 O  O   . PRO D  1 316 ? -9.751  47.365  24.312  1.00 38.60  ? 316 PRO D O   1 
ATOM   10311 C  CB  . PRO D  1 316 ? -8.005  45.588  22.480  1.00 40.54  ? 316 PRO D CB  1 
ATOM   10312 C  CG  . PRO D  1 316 ? -7.963  44.823  21.171  1.00 39.98  ? 316 PRO D CG  1 
ATOM   10313 C  CD  . PRO D  1 316 ? -9.346  44.435  20.813  1.00 43.44  ? 316 PRO D CD  1 
ATOM   10314 N  N   . SER D  1 317 ? -11.044 47.051  22.497  1.00 39.37  ? 317 SER D N   1 
ATOM   10315 C  CA  . SER D  1 317 ? -11.645 48.382  22.599  1.00 41.06  ? 317 SER D CA  1 
ATOM   10316 C  C   . SER D  1 317 ? -12.413 48.573  23.908  1.00 42.46  ? 317 SER D C   1 
ATOM   10317 O  O   . SER D  1 317 ? -12.566 49.697  24.379  1.00 42.55  ? 317 SER D O   1 
ATOM   10318 C  CB  . SER D  1 317 ? -12.560 48.675  21.403  1.00 43.25  ? 317 SER D CB  1 
ATOM   10319 O  OG  . SER D  1 317 ? -13.771 47.950  21.518  1.00 46.51  ? 317 SER D OG  1 
ATOM   10320 N  N   . LYS D  1 318 ? -12.886 47.482  24.503  1.00 45.19  ? 318 LYS D N   1 
ATOM   10321 C  CA  . LYS D  1 318 ? -13.646 47.590  25.746  1.00 47.35  ? 318 LYS D CA  1 
ATOM   10322 C  C   . LYS D  1 318 ? -12.782 47.985  26.931  1.00 52.36  ? 318 LYS D C   1 
ATOM   10323 O  O   . LYS D  1 318 ? -13.298 48.207  28.021  1.00 59.43  ? 318 LYS D O   1 
ATOM   10324 C  CB  . LYS D  1 318 ? -14.383 46.297  26.061  1.00 52.57  ? 318 LYS D CB  1 
ATOM   10325 C  CG  . LYS D  1 318 ? -15.219 45.776  24.909  1.00 63.63  ? 318 LYS D CG  1 
ATOM   10326 C  CD  . LYS D  1 318 ? -16.111 46.866  24.324  1.00 69.39  ? 318 LYS D CD  1 
ATOM   10327 C  CE  . LYS D  1 318 ? -16.867 46.343  23.112  1.00 73.61  ? 318 LYS D CE  1 
ATOM   10328 N  NZ  . LYS D  1 318 ? -17.526 47.448  22.362  1.00 81.65  ? 318 LYS D NZ  1 
ATOM   10329 N  N   . LEU D  1 319 ? -11.472 48.070  26.720  1.00 47.31  ? 319 LEU D N   1 
ATOM   10330 C  CA  . LEU D  1 319 ? -10.569 48.586  27.746  1.00 50.02  ? 319 LEU D CA  1 
ATOM   10331 C  C   . LEU D  1 319 ? -10.642 50.112  27.822  1.00 52.37  ? 319 LEU D C   1 
ATOM   10332 O  O   . LEU D  1 319 ? -10.330 50.717  28.850  1.00 54.69  ? 319 LEU D O   1 
ATOM   10333 C  CB  . LEU D  1 319 ? -9.122  48.174  27.453  1.00 44.19  ? 319 LEU D CB  1 
ATOM   10334 C  CG  . LEU D  1 319 ? -8.839  46.674  27.410  1.00 41.18  ? 319 LEU D CG  1 
ATOM   10335 C  CD1 . LEU D  1 319 ? -7.357  46.416  27.067  1.00 32.01  ? 319 LEU D CD1 1 
ATOM   10336 C  CD2 . LEU D  1 319 ? -9.241  46.035  28.743  1.00 41.07  ? 319 LEU D CD2 1 
ATOM   10337 N  N   . VAL D  1 320 ? -11.036 50.729  26.717  1.00 51.52  ? 320 VAL D N   1 
ATOM   10338 C  CA  . VAL D  1 320 ? -10.957 52.174  26.593  1.00 53.51  ? 320 VAL D CA  1 
ATOM   10339 C  C   . VAL D  1 320 ? -12.245 52.834  27.061  1.00 55.90  ? 320 VAL D C   1 
ATOM   10340 O  O   . VAL D  1 320 ? -13.296 52.667  26.452  1.00 53.47  ? 320 VAL D O   1 
ATOM   10341 C  CB  . VAL D  1 320 ? -10.630 52.571  25.150  1.00 49.81  ? 320 VAL D CB  1 
ATOM   10342 C  CG1 . VAL D  1 320 ? -10.496 54.085  25.017  1.00 47.03  ? 320 VAL D CG1 1 
ATOM   10343 C  CG2 . VAL D  1 320 ? -9.353  51.859  24.719  1.00 43.31  ? 320 VAL D CG2 1 
ATOM   10344 N  N   . THR D  1 321 ? -12.155 53.565  28.166  1.00 55.66  ? 321 THR D N   1 
ATOM   10345 C  CA  . THR D  1 321 ? -13.320 54.214  28.748  1.00 55.04  ? 321 THR D CA  1 
ATOM   10346 C  C   . THR D  1 321 ? -13.278 55.724  28.549  1.00 59.03  ? 321 THR D C   1 
ATOM   10347 O  O   . THR D  1 321 ? -14.291 56.401  28.701  1.00 61.65  ? 321 THR D O   1 
ATOM   10348 C  CB  . THR D  1 321 ? -13.460 53.886  30.254  1.00 50.86  ? 321 THR D CB  1 
ATOM   10349 O  OG1 . THR D  1 321 ? -12.321 54.384  30.969  1.00 55.44  ? 321 THR D OG1 1 
ATOM   10350 C  CG2 . THR D  1 321 ? -13.583 52.362  30.464  1.00 39.56  ? 321 THR D CG2 1 
ATOM   10351 N  N   . HIS D  1 322 ? -12.107 56.250  28.205  1.00 57.49  ? 322 HIS D N   1 
ATOM   10352 C  CA  . HIS D  1 322 ? -11.963 57.683  27.980  1.00 59.38  ? 322 HIS D CA  1 
ATOM   10353 C  C   . HIS D  1 322 ? -11.163 57.944  26.723  1.00 55.86  ? 322 HIS D C   1 
ATOM   10354 O  O   . HIS D  1 322 ? -10.075 57.383  26.543  1.00 53.02  ? 322 HIS D O   1 
ATOM   10355 C  CB  . HIS D  1 322 ? -11.268 58.350  29.162  1.00 60.73  ? 322 HIS D CB  1 
ATOM   10356 C  CG  . HIS D  1 322 ? -12.085 58.367  30.412  1.00 63.82  ? 322 HIS D CG  1 
ATOM   10357 N  ND1 . HIS D  1 322 ? -12.265 57.249  31.198  1.00 64.79  ? 322 HIS D ND1 1 
ATOM   10358 C  CD2 . HIS D  1 322 ? -12.765 59.368  31.020  1.00 63.36  ? 322 HIS D CD2 1 
ATOM   10359 C  CE1 . HIS D  1 322 ? -13.022 57.560  32.235  1.00 69.05  ? 322 HIS D CE1 1 
ATOM   10360 N  NE2 . HIS D  1 322 ? -13.340 58.840  32.150  1.00 67.59  ? 322 HIS D NE2 1 
ATOM   10361 N  N   . VAL D  1 323 ? -11.704 58.790  25.853  1.00 46.43  ? 323 VAL D N   1 
ATOM   10362 C  CA  . VAL D  1 323 ? -11.005 59.151  24.632  1.00 51.12  ? 323 VAL D CA  1 
ATOM   10363 C  C   . VAL D  1 323 ? -10.794 60.668  24.551  1.00 55.71  ? 323 VAL D C   1 
ATOM   10364 O  O   . VAL D  1 323 ? -11.741 61.450  24.658  1.00 57.88  ? 323 VAL D O   1 
ATOM   10365 C  CB  . VAL D  1 323 ? -11.735 58.632  23.375  1.00 49.33  ? 323 VAL D CB  1 
ATOM   10366 C  CG1 . VAL D  1 323 ? -10.943 58.972  22.128  1.00 53.91  ? 323 VAL D CG1 1 
ATOM   10367 C  CG2 . VAL D  1 323 ? -11.938 57.129  23.458  1.00 46.84  ? 323 VAL D CG2 1 
ATOM   10368 N  N   . PHE D  1 324 ? -9.541  61.077  24.388  1.00 47.75  ? 324 PHE D N   1 
ATOM   10369 C  CA  . PHE D  1 324 ? -9.229  62.486  24.235  1.00 54.10  ? 324 PHE D CA  1 
ATOM   10370 C  C   . PHE D  1 324 ? -8.640  62.740  22.863  1.00 53.74  ? 324 PHE D C   1 
ATOM   10371 O  O   . PHE D  1 324 ? -8.170  61.817  22.197  1.00 48.73  ? 324 PHE D O   1 
ATOM   10372 C  CB  . PHE D  1 324 ? -8.243  62.957  25.300  1.00 55.72  ? 324 PHE D CB  1 
ATOM   10373 C  CG  . PHE D  1 324 ? -8.760  62.851  26.701  1.00 60.97  ? 324 PHE D CG  1 
ATOM   10374 C  CD1 . PHE D  1 324 ? -9.589  63.825  27.221  1.00 66.91  ? 324 PHE D CD1 1 
ATOM   10375 C  CD2 . PHE D  1 324 ? -8.392  61.788  27.511  1.00 62.49  ? 324 PHE D CD2 1 
ATOM   10376 C  CE1 . PHE D  1 324 ? -10.056 63.731  28.519  1.00 71.85  ? 324 PHE D CE1 1 
ATOM   10377 C  CE2 . PHE D  1 324 ? -8.849  61.692  28.811  1.00 64.68  ? 324 PHE D CE2 1 
ATOM   10378 C  CZ  . PHE D  1 324 ? -9.685  62.663  29.315  1.00 70.31  ? 324 PHE D CZ  1 
ATOM   10379 N  N   . ARG D  1 325 ? -8.676  64.003  22.455  1.00 52.36  ? 325 ARG D N   1 
ATOM   10380 C  CA  . ARG D  1 325 ? -8.081  64.440  21.201  1.00 62.56  ? 325 ARG D CA  1 
ATOM   10381 C  C   . ARG D  1 325 ? -7.103  65.593  21.412  1.00 61.59  ? 325 ARG D C   1 
ATOM   10382 O  O   . ARG D  1 325 ? -7.322  66.478  22.243  1.00 60.48  ? 325 ARG D O   1 
ATOM   10383 C  CB  . ARG D  1 325 ? -9.165  64.829  20.184  1.00 66.07  ? 325 ARG D CB  1 
ATOM   10384 C  CG  . ARG D  1 325 ? -9.703  63.636  19.416  1.00 75.61  ? 325 ARG D CG  1 
ATOM   10385 C  CD  . ARG D  1 325 ? -10.814 63.990  18.442  1.00 82.52  ? 325 ARG D CD  1 
ATOM   10386 N  NE  . ARG D  1 325 ? -11.027 62.900  17.489  1.00 88.68  ? 325 ARG D NE  1 
ATOM   10387 C  CZ  . ARG D  1 325 ? -11.650 61.758  17.776  1.00 90.71  ? 325 ARG D CZ  1 
ATOM   10388 N  NH1 . ARG D  1 325 ? -12.135 61.549  18.993  1.00 87.49  ? 325 ARG D NH1 1 
ATOM   10389 N  NH2 . ARG D  1 325 ? -11.790 60.821  16.845  1.00 93.18  ? 325 ARG D NH2 1 
ATOM   10390 N  N   . GLY D  1 326 ? -6.012  65.566  20.661  1.00 57.63  ? 326 GLY D N   1 
ATOM   10391 C  CA  . GLY D  1 326 ? -5.072  66.660  20.683  1.00 61.41  ? 326 GLY D CA  1 
ATOM   10392 C  C   . GLY D  1 326 ? -3.930  66.455  21.647  1.00 57.54  ? 326 GLY D C   1 
ATOM   10393 O  O   . GLY D  1 326 ? -4.116  66.041  22.791  1.00 50.66  ? 326 GLY D O   1 
ATOM   10394 N  N   . PHE D  1 327 ? -2.742  66.788  21.163  1.00 67.38  ? 327 PHE D N   1 
ATOM   10395 C  CA  . PHE D  1 327 ? -1.498  66.650  21.905  1.00 75.45  ? 327 PHE D CA  1 
ATOM   10396 C  C   . PHE D  1 327 ? -1.547  67.172  23.344  1.00 74.88  ? 327 PHE D C   1 
ATOM   10397 O  O   . PHE D  1 327 ? -0.810  66.701  24.211  1.00 74.57  ? 327 PHE D O   1 
ATOM   10398 C  CB  . PHE D  1 327 ? -0.384  67.347  21.130  1.00 81.95  ? 327 PHE D CB  1 
ATOM   10399 C  CG  . PHE D  1 327 ? 0.978   66.872  21.491  1.00 92.85  ? 327 PHE D CG  1 
ATOM   10400 C  CD1 . PHE D  1 327 ? 1.391   65.600  21.137  1.00 94.00  ? 327 PHE D CD1 1 
ATOM   10401 C  CD2 . PHE D  1 327 ? 1.850   67.692  22.186  1.00 97.42  ? 327 PHE D CD2 1 
ATOM   10402 C  CE1 . PHE D  1 327 ? 2.649   65.154  21.467  1.00 99.12  ? 327 PHE D CE1 1 
ATOM   10403 C  CE2 . PHE D  1 327 ? 3.111   67.254  22.518  1.00 100.76 ? 327 PHE D CE2 1 
ATOM   10404 C  CZ  . PHE D  1 327 ? 3.512   65.982  22.161  1.00 102.41 ? 327 PHE D CZ  1 
ATOM   10405 N  N   . ASP D  1 328 ? -2.417  68.139  23.599  1.00 73.41  ? 328 ASP D N   1 
ATOM   10406 C  CA  . ASP D  1 328 ? -2.477  68.772  24.910  1.00 74.38  ? 328 ASP D CA  1 
ATOM   10407 C  C   . ASP D  1 328 ? -3.096  67.882  25.981  1.00 70.09  ? 328 ASP D C   1 
ATOM   10408 O  O   . ASP D  1 328 ? -2.710  67.953  27.152  1.00 72.21  ? 328 ASP D O   1 
ATOM   10409 C  CB  . ASP D  1 328 ? -3.236  70.094  24.827  1.00 79.02  ? 328 ASP D CB  1 
ATOM   10410 C  CG  . ASP D  1 328 ? -2.521  71.114  23.973  1.00 87.08  ? 328 ASP D CG  1 
ATOM   10411 O  OD1 . ASP D  1 328 ? -1.272  71.058  23.912  1.00 89.94  ? 328 ASP D OD1 1 
ATOM   10412 O  OD2 . ASP D  1 328 ? -3.204  71.968  23.367  1.00 87.23  ? 328 ASP D OD2 1 
ATOM   10413 N  N   . ASN D  1 329 ? -4.053  67.049  25.590  1.00 56.11  ? 329 ASN D N   1 
ATOM   10414 C  CA  . ASN D  1 329 ? -4.750  66.226  26.571  1.00 56.40  ? 329 ASN D CA  1 
ATOM   10415 C  C   . ASN D  1 329 ? -3.894  65.100  27.138  1.00 56.09  ? 329 ASN D C   1 
ATOM   10416 O  O   . ASN D  1 329 ? -4.345  64.356  28.014  1.00 57.97  ? 329 ASN D O   1 
ATOM   10417 C  CB  . ASN D  1 329 ? -6.049  65.657  25.997  1.00 52.04  ? 329 ASN D CB  1 
ATOM   10418 C  CG  . ASN D  1 329 ? -7.181  66.671  25.994  1.00 60.77  ? 329 ASN D CG  1 
ATOM   10419 O  OD1 . ASN D  1 329 ? -7.320  67.481  26.918  1.00 58.90  ? 329 ASN D OD1 1 
ATOM   10420 N  ND2 . ASN D  1 329 ? -7.999  66.627  24.952  1.00 61.16  ? 329 ASN D ND2 1 
ATOM   10421 N  N   . ILE D  1 330 ? -2.667  64.964  26.642  1.00 50.54  ? 330 ILE D N   1 
ATOM   10422 C  CA  . ILE D  1 330 ? -1.789  63.922  27.162  1.00 52.01  ? 330 ILE D CA  1 
ATOM   10423 C  C   . ILE D  1 330 ? -1.653  64.098  28.656  1.00 48.35  ? 330 ILE D C   1 
ATOM   10424 O  O   . ILE D  1 330 ? -1.624  63.125  29.408  1.00 49.18  ? 330 ILE D O   1 
ATOM   10425 C  CB  . ILE D  1 330 ? -0.392  63.949  26.536  1.00 51.56  ? 330 ILE D CB  1 
ATOM   10426 C  CG1 . ILE D  1 330 ? -0.438  63.437  25.099  1.00 46.76  ? 330 ILE D CG1 1 
ATOM   10427 C  CG2 . ILE D  1 330 ? 0.558   63.059  27.338  1.00 49.28  ? 330 ILE D CG2 1 
ATOM   10428 C  CD1 . ILE D  1 330 ? 0.929   63.190  24.511  1.00 44.29  ? 330 ILE D CD1 1 
ATOM   10429 N  N   . GLU D  1 331 ? -1.573  65.357  29.075  1.00 51.31  ? 331 GLU D N   1 
ATOM   10430 C  CA  . GLU D  1 331 ? -1.393  65.691  30.480  1.00 55.69  ? 331 GLU D CA  1 
ATOM   10431 C  C   . GLU D  1 331 ? -2.599  65.242  31.295  1.00 54.01  ? 331 GLU D C   1 
ATOM   10432 O  O   . GLU D  1 331 ? -2.470  64.503  32.273  1.00 54.46  ? 331 GLU D O   1 
ATOM   10433 C  CB  . GLU D  1 331 ? -1.175  67.196  30.642  1.00 54.12  ? 331 GLU D CB  1 
ATOM   10434 C  CG  . GLU D  1 331 ? -0.760  67.581  32.047  1.00 63.68  ? 331 GLU D CG  1 
ATOM   10435 C  CD  . GLU D  1 331 ? -0.514  69.077  32.204  1.00 71.00  ? 331 GLU D CD  1 
ATOM   10436 O  OE1 . GLU D  1 331 ? -0.768  69.835  31.237  1.00 70.22  ? 331 GLU D OE1 1 
ATOM   10437 O  OE2 . GLU D  1 331 ? -0.068  69.489  33.300  1.00 74.42  ? 331 GLU D OE2 1 
ATOM   10438 N  N   . LYS D  1 332 ? -3.770  65.700  30.870  1.00 56.96  ? 332 LYS D N   1 
ATOM   10439 C  CA  . LYS D  1 332 ? -5.039  65.292  31.453  1.00 60.41  ? 332 LYS D CA  1 
ATOM   10440 C  C   . LYS D  1 332 ? -5.127  63.770  31.577  1.00 59.77  ? 332 LYS D C   1 
ATOM   10441 O  O   . LYS D  1 332 ? -5.499  63.245  32.624  1.00 64.28  ? 332 LYS D O   1 
ATOM   10442 C  CB  . LYS D  1 332 ? -6.183  65.829  30.583  1.00 67.26  ? 332 LYS D CB  1 
ATOM   10443 C  CG  . LYS D  1 332 ? -7.588  65.475  31.053  1.00 72.43  ? 332 LYS D CG  1 
ATOM   10444 C  CD  . LYS D  1 332 ? -8.632  66.192  30.207  1.00 76.38  ? 332 LYS D CD  1 
ATOM   10445 C  CE  . LYS D  1 332 ? -9.999  66.189  30.878  1.00 81.95  ? 332 LYS D CE  1 
ATOM   10446 N  NZ  . LYS D  1 332 ? -10.956 67.122  30.201  1.00 85.48  ? 332 LYS D NZ  1 
ATOM   10447 N  N   . ALA D  1 333 ? -4.773  63.065  30.506  1.00 50.81  ? 333 ALA D N   1 
ATOM   10448 C  CA  . ALA D  1 333 ? -4.886  61.611  30.481  1.00 48.97  ? 333 ALA D CA  1 
ATOM   10449 C  C   . ALA D  1 333 ? -3.972  60.975  31.522  1.00 57.74  ? 333 ALA D C   1 
ATOM   10450 O  O   . ALA D  1 333 ? -4.339  59.992  32.177  1.00 47.98  ? 333 ALA D O   1 
ATOM   10451 C  CB  . ALA D  1 333 ? -4.559  61.083  29.100  1.00 40.06  ? 333 ALA D CB  1 
ATOM   10452 N  N   . PHE D  1 334 ? -2.782  61.548  31.675  1.00 58.30  ? 334 PHE D N   1 
ATOM   10453 C  CA  . PHE D  1 334 ? -1.811  61.014  32.610  1.00 60.18  ? 334 PHE D CA  1 
ATOM   10454 C  C   . PHE D  1 334 ? -2.327  61.182  34.032  1.00 65.73  ? 334 PHE D C   1 
ATOM   10455 O  O   . PHE D  1 334 ? -2.394  60.222  34.791  1.00 68.39  ? 334 PHE D O   1 
ATOM   10456 C  CB  . PHE D  1 334 ? -0.460  61.709  32.422  1.00 64.70  ? 334 PHE D CB  1 
ATOM   10457 C  CG  . PHE D  1 334 ? 0.602   61.245  33.371  1.00 64.91  ? 334 PHE D CG  1 
ATOM   10458 C  CD1 . PHE D  1 334 ? 1.416   60.175  33.051  1.00 63.23  ? 334 PHE D CD1 1 
ATOM   10459 C  CD2 . PHE D  1 334 ? 0.794   61.887  34.582  1.00 67.72  ? 334 PHE D CD2 1 
ATOM   10460 C  CE1 . PHE D  1 334 ? 2.394   59.748  33.920  1.00 59.95  ? 334 PHE D CE1 1 
ATOM   10461 C  CE2 . PHE D  1 334 ? 1.775   61.459  35.457  1.00 66.92  ? 334 PHE D CE2 1 
ATOM   10462 C  CZ  . PHE D  1 334 ? 2.573   60.389  35.122  1.00 62.70  ? 334 PHE D CZ  1 
ATOM   10463 N  N   . MET D  1 335 ? -2.711  62.403  34.387  1.00 71.43  ? 335 MET D N   1 
ATOM   10464 C  CA  . MET D  1 335 ? -3.189  62.660  35.739  1.00 73.83  ? 335 MET D CA  1 
ATOM   10465 C  C   . MET D  1 335 ? -4.436  61.829  36.032  1.00 71.70  ? 335 MET D C   1 
ATOM   10466 O  O   . MET D  1 335 ? -4.684  61.437  37.171  1.00 72.95  ? 335 MET D O   1 
ATOM   10467 C  CB  . MET D  1 335 ? -3.445  64.154  35.962  1.00 70.58  ? 335 MET D CB  1 
ATOM   10468 C  CG  . MET D  1 335 ? -2.181  65.019  35.877  1.00 70.55  ? 335 MET D CG  1 
ATOM   10469 S  SD  . MET D  1 335 ? -0.808  64.435  36.921  1.00 74.33  ? 335 MET D SD  1 
ATOM   10470 C  CE  . MET D  1 335 ? -1.528  64.564  38.556  1.00 83.61  ? 335 MET D CE  1 
ATOM   10471 N  N   . LEU D  1 336 ? -5.207  61.541  34.994  1.00 65.54  ? 336 LEU D N   1 
ATOM   10472 C  CA  . LEU D  1 336 ? -6.372  60.683  35.143  1.00 68.19  ? 336 LEU D CA  1 
ATOM   10473 C  C   . LEU D  1 336 ? -5.965  59.334  35.739  1.00 71.11  ? 336 LEU D C   1 
ATOM   10474 O  O   . LEU D  1 336 ? -6.704  58.750  36.529  1.00 75.36  ? 336 LEU D O   1 
ATOM   10475 C  CB  . LEU D  1 336 ? -7.052  60.491  33.789  1.00 71.65  ? 336 LEU D CB  1 
ATOM   10476 C  CG  . LEU D  1 336 ? -8.576  60.400  33.754  1.00 70.36  ? 336 LEU D CG  1 
ATOM   10477 C  CD1 . LEU D  1 336 ? -9.203  61.372  34.730  1.00 74.08  ? 336 LEU D CD1 1 
ATOM   10478 C  CD2 . LEU D  1 336 ? -9.050  60.686  32.348  1.00 69.45  ? 336 LEU D CD2 1 
ATOM   10479 N  N   . MET D  1 337 ? -4.780  58.853  35.372  1.00 69.34  ? 337 MET D N   1 
ATOM   10480 C  CA  . MET D  1 337 ? -4.276  57.580  35.886  1.00 69.57  ? 337 MET D CA  1 
ATOM   10481 C  C   . MET D  1 337 ? -3.763  57.711  37.312  1.00 72.99  ? 337 MET D C   1 
ATOM   10482 O  O   . MET D  1 337 ? -3.469  56.713  37.962  1.00 68.86  ? 337 MET D O   1 
ATOM   10483 C  CB  . MET D  1 337 ? -3.146  57.034  35.007  1.00 68.00  ? 337 MET D CB  1 
ATOM   10484 C  CG  . MET D  1 337 ? -3.570  56.645  33.611  1.00 69.42  ? 337 MET D CG  1 
ATOM   10485 S  SD  . MET D  1 337 ? -4.749  55.293  33.624  1.00 65.14  ? 337 MET D SD  1 
ATOM   10486 C  CE  . MET D  1 337 ? -3.677  53.927  34.108  1.00 65.70  ? 337 MET D CE  1 
ATOM   10487 N  N   . LYS D  1 338 ? -3.634  58.939  37.795  1.00 79.46  ? 338 LYS D N   1 
ATOM   10488 C  CA  . LYS D  1 338 ? -3.135  59.144  39.145  1.00 82.67  ? 338 LYS D CA  1 
ATOM   10489 C  C   . LYS D  1 338 ? -4.294  59.138  40.132  1.00 80.89  ? 338 LYS D C   1 
ATOM   10490 O  O   . LYS D  1 338 ? -4.270  58.417  41.127  1.00 81.16  ? 338 LYS D O   1 
ATOM   10491 C  CB  . LYS D  1 338 ? -2.330  60.442  39.236  1.00 90.56  ? 338 LYS D CB  1 
ATOM   10492 C  CG  . LYS D  1 338 ? -1.358  60.495  40.408  1.00 98.46  ? 338 LYS D CG  1 
ATOM   10493 C  CD  . LYS D  1 338 ? -1.984  61.114  41.651  1.00 105.67 ? 338 LYS D CD  1 
ATOM   10494 C  CE  . LYS D  1 338 ? -2.163  62.617  41.488  1.00 110.38 ? 338 LYS D CE  1 
ATOM   10495 N  NZ  . LYS D  1 338 ? -2.738  63.256  42.706  1.00 113.06 ? 338 LYS D NZ  1 
ATOM   10496 N  N   . ASP D  1 339 ? -5.322  59.927  39.839  1.00 84.67  ? 339 ASP D N   1 
ATOM   10497 C  CA  . ASP D  1 339 ? -6.474  60.023  40.729  1.00 90.84  ? 339 ASP D CA  1 
ATOM   10498 C  C   . ASP D  1 339 ? -7.427  58.835  40.591  1.00 81.54  ? 339 ASP D C   1 
ATOM   10499 O  O   . ASP D  1 339 ? -8.186  58.537  41.513  1.00 76.79  ? 339 ASP D O   1 
ATOM   10500 C  CB  . ASP D  1 339 ? -7.208  61.361  40.548  1.00 102.89 ? 339 ASP D CB  1 
ATOM   10501 C  CG  . ASP D  1 339 ? -7.158  61.874  39.119  1.00 112.35 ? 339 ASP D CG  1 
ATOM   10502 O  OD1 . ASP D  1 339 ? -7.276  61.053  38.184  1.00 116.67 ? 339 ASP D OD1 1 
ATOM   10503 O  OD2 . ASP D  1 339 ? -7.007  63.103  38.933  1.00 114.01 ? 339 ASP D OD2 1 
ATOM   10504 N  N   . LYS D  1 340 ? -7.375  58.166  39.440  1.00 79.62  ? 340 LYS D N   1 
ATOM   10505 C  CA  . LYS D  1 340 ? -8.119  56.924  39.206  1.00 81.74  ? 340 LYS D CA  1 
ATOM   10506 C  C   . LYS D  1 340 ? -9.621  57.000  39.469  1.00 85.61  ? 340 LYS D C   1 
ATOM   10507 O  O   . LYS D  1 340 ? -10.105 56.428  40.444  1.00 88.63  ? 340 LYS D O   1 
ATOM   10508 C  CB  . LYS D  1 340 ? -7.522  55.780  40.030  1.00 83.88  ? 340 LYS D CB  1 
ATOM   10509 C  CG  . LYS D  1 340 ? -6.494  54.955  39.284  1.00 86.03  ? 340 LYS D CG  1 
ATOM   10510 C  CD  . LYS D  1 340 ? -7.109  54.333  38.042  1.00 87.13  ? 340 LYS D CD  1 
ATOM   10511 C  CE  . LYS D  1 340 ? -6.275  53.183  37.525  1.00 88.80  ? 340 LYS D CE  1 
ATOM   10512 N  NZ  . LYS D  1 340 ? -6.849  52.624  36.278  1.00 92.76  ? 340 LYS D NZ  1 
ATOM   10513 N  N   . PRO D  1 341 ? -10.363 57.693  38.587  1.00 84.64  ? 341 PRO D N   1 
ATOM   10514 C  CA  . PRO D  1 341 ? -11.827 57.762  38.657  1.00 85.15  ? 341 PRO D CA  1 
ATOM   10515 C  C   . PRO D  1 341 ? -12.471 56.376  38.696  1.00 88.15  ? 341 PRO D C   1 
ATOM   10516 O  O   . PRO D  1 341 ? -11.881 55.404  38.226  1.00 88.07  ? 341 PRO D O   1 
ATOM   10517 C  CB  . PRO D  1 341 ? -12.204 58.462  37.351  1.00 84.57  ? 341 PRO D CB  1 
ATOM   10518 C  CG  . PRO D  1 341 ? -11.007 59.256  36.991  1.00 83.39  ? 341 PRO D CG  1 
ATOM   10519 C  CD  . PRO D  1 341 ? -9.825  58.474  37.460  1.00 82.67  ? 341 PRO D CD  1 
ATOM   10520 N  N   . LYS D  1 342 ? -13.681 56.297  39.240  1.00 90.78  ? 342 LYS D N   1 
ATOM   10521 C  CA  . LYS D  1 342 ? -14.383 55.027  39.370  1.00 90.40  ? 342 LYS D CA  1 
ATOM   10522 C  C   . LYS D  1 342 ? -14.763 54.444  38.011  1.00 82.26  ? 342 LYS D C   1 
ATOM   10523 O  O   . LYS D  1 342 ? -14.861 53.229  37.856  1.00 80.09  ? 342 LYS D O   1 
ATOM   10524 C  CB  . LYS D  1 342 ? -15.640 55.197  40.229  1.00 99.18  ? 342 LYS D CB  1 
ATOM   10525 C  CG  . LYS D  1 342 ? -16.409 53.903  40.452  1.00 108.02 ? 342 LYS D CG  1 
ATOM   10526 C  CD  . LYS D  1 342 ? -17.862 54.155  40.839  1.00 114.18 ? 342 LYS D CD  1 
ATOM   10527 C  CE  . LYS D  1 342 ? -18.672 52.860  40.796  1.00 116.03 ? 342 LYS D CE  1 
ATOM   10528 N  NZ  . LYS D  1 342 ? -20.122 53.059  41.088  1.00 117.24 ? 342 LYS D NZ  1 
ATOM   10529 N  N   . ASP D  1 343 ? -14.979 55.316  37.031  1.00 78.65  ? 343 ASP D N   1 
ATOM   10530 C  CA  . ASP D  1 343 ? -15.471 54.900  35.722  1.00 74.29  ? 343 ASP D CA  1 
ATOM   10531 C  C   . ASP D  1 343 ? -14.352 54.640  34.716  1.00 63.40  ? 343 ASP D C   1 
ATOM   10532 O  O   . ASP D  1 343 ? -14.609 54.353  33.549  1.00 65.27  ? 343 ASP D O   1 
ATOM   10533 C  CB  . ASP D  1 343 ? -16.444 55.946  35.167  1.00 82.25  ? 343 ASP D CB  1 
ATOM   10534 C  CG  . ASP D  1 343 ? -15.880 57.362  35.220  1.00 89.77  ? 343 ASP D CG  1 
ATOM   10535 O  OD1 . ASP D  1 343 ? -14.675 57.520  35.513  1.00 92.45  ? 343 ASP D OD1 1 
ATOM   10536 O  OD2 . ASP D  1 343 ? -16.645 58.320  34.968  1.00 92.24  ? 343 ASP D OD2 1 
ATOM   10537 N  N   . LEU D  1 344 ? -13.113 54.731  35.177  1.00 55.68  ? 344 LEU D N   1 
ATOM   10538 C  CA  . LEU D  1 344 ? -11.955 54.602  34.297  1.00 61.63  ? 344 LEU D CA  1 
ATOM   10539 C  C   . LEU D  1 344 ? -11.354 53.196  34.249  1.00 62.62  ? 344 LEU D C   1 
ATOM   10540 O  O   . LEU D  1 344 ? -11.073 52.585  35.283  1.00 67.28  ? 344 LEU D O   1 
ATOM   10541 C  CB  . LEU D  1 344 ? -10.861 55.587  34.716  1.00 66.85  ? 344 LEU D CB  1 
ATOM   10542 C  CG  . LEU D  1 344 ? -9.537  55.469  33.957  1.00 69.65  ? 344 LEU D CG  1 
ATOM   10543 C  CD1 . LEU D  1 344 ? -9.707  55.908  32.509  1.00 70.74  ? 344 LEU D CD1 1 
ATOM   10544 C  CD2 . LEU D  1 344 ? -8.440  56.271  34.637  1.00 68.46  ? 344 LEU D CD2 1 
ATOM   10545 N  N   . ILE D  1 345 ? -11.158 52.690  33.039  1.00 59.67  ? 345 ILE D N   1 
ATOM   10546 C  CA  . ILE D  1 345 ? -10.255 51.569  32.841  1.00 63.99  ? 345 ILE D CA  1 
ATOM   10547 C  C   . ILE D  1 345 ? -8.980  52.137  32.238  1.00 62.80  ? 345 ILE D C   1 
ATOM   10548 O  O   . ILE D  1 345 ? -7.954  52.241  32.906  1.00 67.12  ? 345 ILE D O   1 
ATOM   10549 C  CB  . ILE D  1 345 ? -10.828 50.490  31.898  1.00 65.89  ? 345 ILE D CB  1 
ATOM   10550 C  CG1 . ILE D  1 345 ? -12.068 49.832  32.505  1.00 63.86  ? 345 ILE D CG1 1 
ATOM   10551 C  CG2 . ILE D  1 345 ? -9.773  49.423  31.606  1.00 62.57  ? 345 ILE D CG2 1 
ATOM   10552 C  CD1 . ILE D  1 345 ? -12.674 48.755  31.620  1.00 63.89  ? 345 ILE D CD1 1 
ATOM   10553 N  N   . LYS D  1 346 ? -9.067  52.545  30.976  1.00 56.46  ? 346 LYS D N   1 
ATOM   10554 C  CA  . LYS D  1 346 ? -7.903  53.045  30.268  1.00 52.78  ? 346 LYS D CA  1 
ATOM   10555 C  C   . LYS D  1 346 ? -8.268  54.264  29.407  1.00 53.95  ? 346 LYS D C   1 
ATOM   10556 O  O   . LYS D  1 346 ? -9.244  54.226  28.644  1.00 38.81  ? 346 LYS D O   1 
ATOM   10557 C  CB  . LYS D  1 346 ? -7.300  51.915  29.424  1.00 56.15  ? 346 LYS D CB  1 
ATOM   10558 C  CG  . LYS D  1 346 ? -5.887  52.144  28.920  1.00 54.12  ? 346 LYS D CG  1 
ATOM   10559 C  CD  . LYS D  1 346 ? -4.790  51.574  29.832  1.00 42.55  ? 346 LYS D CD  1 
ATOM   10560 C  CE  . LYS D  1 346 ? -3.439  51.733  29.122  1.00 40.65  ? 346 LYS D CE  1 
ATOM   10561 N  NZ  . LYS D  1 346 ? -2.221  51.650  29.989  1.00 49.50  ? 346 LYS D NZ  1 
ATOM   10562 N  N   . PRO D  1 347 ? -7.496  55.363  29.556  1.00 49.86  ? 347 PRO D N   1 
ATOM   10563 C  CA  . PRO D  1 347 ? -7.624  56.583  28.756  1.00 50.94  ? 347 PRO D CA  1 
ATOM   10564 C  C   . PRO D  1 347 ? -6.761  56.522  27.497  1.00 49.47  ? 347 PRO D C   1 
ATOM   10565 O  O   . PRO D  1 347 ? -5.663  55.982  27.545  1.00 53.68  ? 347 PRO D O   1 
ATOM   10566 C  CB  . PRO D  1 347 ? -7.081  57.684  29.690  1.00 53.37  ? 347 PRO D CB  1 
ATOM   10567 C  CG  . PRO D  1 347 ? -6.577  56.967  30.951  1.00 51.20  ? 347 PRO D CG  1 
ATOM   10568 C  CD  . PRO D  1 347 ? -6.480  55.512  30.608  1.00 46.43  ? 347 PRO D CD  1 
ATOM   10569 N  N   . VAL D  1 348 ? -7.250  57.093  26.399  1.00 51.57  ? 348 VAL D N   1 
ATOM   10570 C  CA  . VAL D  1 348 ? -6.512  57.152  25.139  1.00 51.41  ? 348 VAL D CA  1 
ATOM   10571 C  C   . VAL D  1 348 ? -6.532  58.570  24.580  1.00 55.22  ? 348 VAL D C   1 
ATOM   10572 O  O   . VAL D  1 348 ? -7.565  59.238  24.602  1.00 56.12  ? 348 VAL D O   1 
ATOM   10573 C  CB  . VAL D  1 348 ? -7.146  56.234  24.068  1.00 45.92  ? 348 VAL D CB  1 
ATOM   10574 C  CG1 . VAL D  1 348 ? -6.627  56.590  22.668  1.00 37.32  ? 348 VAL D CG1 1 
ATOM   10575 C  CG2 . VAL D  1 348 ? -6.885  54.768  24.389  1.00 49.10  ? 348 VAL D CG2 1 
ATOM   10576 N  N   . VAL D  1 349 ? -5.397  59.024  24.063  1.00 53.29  ? 349 VAL D N   1 
ATOM   10577 C  CA  . VAL D  1 349 ? -5.332  60.341  23.439  1.00 51.60  ? 349 VAL D CA  1 
ATOM   10578 C  C   . VAL D  1 349 ? -5.056  60.210  21.952  1.00 49.69  ? 349 VAL D C   1 
ATOM   10579 O  O   . VAL D  1 349 ? -3.993  59.741  21.539  1.00 45.39  ? 349 VAL D O   1 
ATOM   10580 C  CB  . VAL D  1 349 ? -4.277  61.262  24.112  1.00 45.45  ? 349 VAL D CB  1 
ATOM   10581 C  CG1 . VAL D  1 349 ? -4.346  62.690  23.546  1.00 41.78  ? 349 VAL D CG1 1 
ATOM   10582 C  CG2 . VAL D  1 349 ? -4.497  61.292  25.608  1.00 48.39  ? 349 VAL D CG2 1 
ATOM   10583 N  N   . ILE D  1 350 ? -6.041  60.622  21.159  1.00 49.55  ? 350 ILE D N   1 
ATOM   10584 C  CA  . ILE D  1 350 ? -5.962  60.587  19.711  1.00 43.93  ? 350 ILE D CA  1 
ATOM   10585 C  C   . ILE D  1 350 ? -5.388  61.898  19.199  1.00 53.80  ? 350 ILE D C   1 
ATOM   10586 O  O   . ILE D  1 350 ? -5.844  62.977  19.574  1.00 51.90  ? 350 ILE D O   1 
ATOM   10587 C  CB  . ILE D  1 350 ? -7.354  60.334  19.110  1.00 51.24  ? 350 ILE D CB  1 
ATOM   10588 C  CG1 . ILE D  1 350 ? -7.880  58.981  19.608  1.00 64.71  ? 350 ILE D CG1 1 
ATOM   10589 C  CG2 . ILE D  1 350 ? -7.304  60.343  17.585  1.00 47.03  ? 350 ILE D CG2 1 
ATOM   10590 C  CD1 . ILE D  1 350 ? -9.207  58.578  19.018  1.00 70.93  ? 350 ILE D CD1 1 
ATOM   10591 N  N   . LEU D  1 351 ? -4.379  61.803  18.345  1.00 59.15  ? 351 LEU D N   1 
ATOM   10592 C  CA  . LEU D  1 351 ? -3.645  62.986  17.923  1.00 61.65  ? 351 LEU D CA  1 
ATOM   10593 C  C   . LEU D  1 351 ? -4.026  63.449  16.527  1.00 74.43  ? 351 LEU D C   1 
ATOM   10594 O  O   . LEU D  1 351 ? -4.179  64.645  16.276  1.00 80.27  ? 351 LEU D O   1 
ATOM   10595 C  CB  . LEU D  1 351 ? -2.150  62.717  17.995  1.00 54.02  ? 351 LEU D CB  1 
ATOM   10596 C  CG  . LEU D  1 351 ? -1.689  62.441  19.427  1.00 56.42  ? 351 LEU D CG  1 
ATOM   10597 C  CD1 . LEU D  1 351 ? -0.257  61.914  19.459  1.00 61.23  ? 351 LEU D CD1 1 
ATOM   10598 C  CD2 . LEU D  1 351 ? -1.821  63.698  20.274  1.00 53.08  ? 351 LEU D CD2 1 
ATOM   10599 N  N   . ALA D  1 352 ? -4.164  62.497  15.618  1.00 84.36  ? 352 ALA D N   1 
ATOM   10600 C  CA  . ALA D  1 352 ? -4.580  62.804  14.260  1.00 96.72  ? 352 ALA D CA  1 
ATOM   10601 C  C   . ALA D  1 352 ? -5.317  61.610  13.667  1.00 99.36  ? 352 ALA D C   1 
ATOM   10602 O  O   . ALA D  1 352 ? -6.409  61.747  13.115  1.00 99.86  ? 352 ALA D O   1 
ATOM   10603 C  CB  . ALA D  1 352 ? -3.374  63.183  13.403  1.00 98.58  ? 352 ALA D CB  1 
ATOM   10604 O  OXT . ALA D  1 352 ? -4.841  60.477  13.746  1.00 99.32  ? 352 ALA D OXT 1 
HETATM 10605 ZN ZN  . ZN  E  2 .   ? 29.424  19.814  9.391   1.00 36.60  ? 354 ZN  A ZN  1 
HETATM 10606 C  C   . ACT F  3 .   ? 26.162  20.372  9.350   1.00 33.85  ? 353 ACT A C   1 
HETATM 10607 O  O   . ACT F  3 .   ? 25.154  20.443  10.072  1.00 39.69  ? 353 ACT A O   1 
HETATM 10608 O  OXT . ACT F  3 .   ? 27.178  19.922  9.902   1.00 27.20  ? 353 ACT A OXT 1 
HETATM 10609 C  CH3 . ACT F  3 .   ? 26.149  20.794  7.925   1.00 35.75  ? 353 ACT A CH3 1 
HETATM 10610 C  C1  . EDO G  4 .   ? 29.860  4.193   12.624  1.00 51.85  ? 355 EDO A C1  1 
HETATM 10611 O  O1  . EDO G  4 .   ? 28.492  3.830   12.881  1.00 45.71  ? 355 EDO A O1  1 
HETATM 10612 C  C2  . EDO G  4 .   ? 30.809  3.125   13.185  1.00 47.70  ? 355 EDO A C2  1 
HETATM 10613 O  O2  . EDO G  4 .   ? 30.626  1.905   12.457  1.00 37.20  ? 355 EDO A O2  1 
HETATM 10614 C  C1  . EDO H  4 .   ? 9.149   16.583  23.196  1.00 57.53  ? 356 EDO A C1  1 
HETATM 10615 O  O1  . EDO H  4 .   ? 10.021  17.461  23.939  1.00 42.45  ? 356 EDO A O1  1 
HETATM 10616 C  C2  . EDO H  4 .   ? 7.875   17.271  22.699  1.00 57.15  ? 356 EDO A C2  1 
HETATM 10617 O  O2  . EDO H  4 .   ? 8.175   18.233  21.678  1.00 62.26  ? 356 EDO A O2  1 
HETATM 10618 C  C1  . EDO I  4 .   ? 22.284  28.030  22.734  1.00 58.97  ? 358 EDO A C1  1 
HETATM 10619 O  O1  . EDO I  4 .   ? 21.560  26.912  22.202  1.00 62.56  ? 358 EDO A O1  1 
HETATM 10620 C  C2  . EDO I  4 .   ? 22.894  27.633  24.076  1.00 53.12  ? 358 EDO A C2  1 
HETATM 10621 O  O2  . EDO I  4 .   ? 23.717  26.466  23.911  1.00 48.12  ? 358 EDO A O2  1 
HETATM 10622 C  C1  . EDO J  4 .   ? 49.936  28.504  1.482   1.00 90.54  ? 359 EDO A C1  1 
HETATM 10623 O  O1  . EDO J  4 .   ? 49.917  29.071  2.799   1.00 86.62  ? 359 EDO A O1  1 
HETATM 10624 C  C2  . EDO J  4 .   ? 51.144  27.582  1.337   1.00 93.39  ? 359 EDO A C2  1 
HETATM 10625 O  O2  . EDO J  4 .   ? 51.061  26.506  2.283   1.00 92.50  ? 359 EDO A O2  1 
HETATM 10626 C  C1  . EDO K  4 .   ? 26.864  30.785  31.138  1.00 68.18  ? 360 EDO A C1  1 
HETATM 10627 O  O1  . EDO K  4 .   ? 25.798  30.738  30.175  1.00 64.82  ? 360 EDO A O1  1 
HETATM 10628 C  C2  . EDO K  4 .   ? 27.912  29.703  30.882  1.00 62.96  ? 360 EDO A C2  1 
HETATM 10629 O  O2  . EDO K  4 .   ? 28.451  29.875  29.569  1.00 60.51  ? 360 EDO A O2  1 
HETATM 10630 CL CL  . CL  L  5 .   ? 24.256  43.606  11.927  1.00 87.40  ? 357 CL  A CL  1 
HETATM 10631 ZN ZN  . ZN  M  2 .   ? 13.704  12.246  53.841  1.00 36.38  ? 355 ZN  B ZN  1 
HETATM 10632 C  C   . ACT N  3 .   ? 11.485  14.208  52.444  1.00 40.84  ? 353 ACT B C   1 
HETATM 10633 O  O   . ACT N  3 .   ? 10.947  14.895  51.550  1.00 37.44  ? 353 ACT B O   1 
HETATM 10634 O  OXT . ACT N  3 .   ? 12.575  13.694  52.142  1.00 41.73  ? 353 ACT B OXT 1 
HETATM 10635 C  CH3 . ACT N  3 .   ? 10.868  14.010  53.789  1.00 39.22  ? 353 ACT B CH3 1 
HETATM 10636 C  C1  . EDO O  4 .   ? 27.081  -1.450  40.877  1.00 52.45  ? 354 EDO B C1  1 
HETATM 10637 O  O1  . EDO O  4 .   ? 27.355  -0.420  41.825  1.00 55.65  ? 354 EDO B O1  1 
HETATM 10638 C  C2  . EDO O  4 .   ? 27.751  -1.057  39.573  1.00 52.97  ? 354 EDO B C2  1 
HETATM 10639 O  O2  . EDO O  4 .   ? 27.174  -1.809  38.505  1.00 56.56  ? 354 EDO B O2  1 
HETATM 10640 CL CL  . CL  P  5 .   ? 35.329  11.385  48.564  1.00 80.75  ? 356 CL  B CL  1 
HETATM 10641 C  C1  A EDO Q  4 .   ? 3.655   -1.685  37.220  0.44 34.91  ? 358 EDO B C1  1 
HETATM 10642 C  C1  B EDO Q  4 .   ? 7.372   -0.802  36.015  0.56 31.23  ? 358 EDO B C1  1 
HETATM 10643 O  O1  A EDO Q  4 .   ? 3.005   -2.825  36.638  0.44 35.55  ? 358 EDO B O1  1 
HETATM 10644 O  O1  B EDO Q  4 .   ? 7.741   0.570   35.862  0.56 30.84  ? 358 EDO B O1  1 
HETATM 10645 C  C2  A EDO Q  4 .   ? 4.932   -1.405  36.439  0.44 35.35  ? 358 EDO B C2  1 
HETATM 10646 C  C2  B EDO Q  4 .   ? 5.861   -0.868  36.193  0.56 31.63  ? 358 EDO B C2  1 
HETATM 10647 O  O2  A EDO Q  4 .   ? 5.495   -2.652  36.003  0.44 34.22  ? 358 EDO B O2  1 
HETATM 10648 O  O2  B EDO Q  4 .   ? 5.422   0.238   36.988  0.56 22.05  ? 358 EDO B O2  1 
HETATM 10649 CL CL  . CL  R  5 .   ? 19.380  -2.878  35.575  1.00 79.00  ? 359 CL  B CL  1 
HETATM 10650 CL CL  . CL  S  5 .   ? -4.734  -10.339 50.649  1.00 70.49  ? 360 CL  B CL  1 
HETATM 10651 C  C1  . EDO T  4 .   ? -10.117 12.586  38.617  1.00 60.99  ? 356 EDO C C1  1 
HETATM 10652 O  O1  . EDO T  4 .   ? -11.242 13.328  39.107  1.00 66.08  ? 356 EDO C O1  1 
HETATM 10653 C  C2  . EDO T  4 .   ? -10.221 11.133  39.061  1.00 64.26  ? 356 EDO C C2  1 
HETATM 10654 O  O2  . EDO T  4 .   ? -10.576 11.081  40.447  1.00 66.55  ? 356 EDO C O2  1 
HETATM 10655 C  C1  . EDO U  4 .   ? -10.539 -5.915  46.525  1.00 76.30  ? 359 EDO C C1  1 
HETATM 10656 O  O1  . EDO U  4 .   ? -11.514 -6.897  46.905  1.00 79.05  ? 359 EDO C O1  1 
HETATM 10657 C  C2  . EDO U  4 .   ? -10.030 -6.199  45.115  1.00 71.75  ? 359 EDO C C2  1 
HETATM 10658 O  O2  . EDO U  4 .   ? -9.287  -7.425  45.112  1.00 71.58  ? 359 EDO C O2  1 
HETATM 10659 ZN ZN  . ZN  V  2 .   ? -13.119 6.958   17.609  1.00 38.27  ? 353 ZN  C ZN  1 
HETATM 10660 C  C   . ACT W  3 .   ? 1.733   0.167   0.270   1.00 124.37 ? 354 ACT C C   1 
HETATM 10661 O  O   . ACT W  3 .   ? 2.371   -0.315  1.229   1.00 123.07 ? 354 ACT C O   1 
HETATM 10662 O  OXT . ACT W  3 .   ? 0.557   0.513   0.516   1.00 124.69 ? 354 ACT C OXT 1 
HETATM 10663 C  CH3 . ACT W  3 .   ? 2.344   0.320   -1.092  1.00 125.20 ? 354 ACT C CH3 1 
HETATM 10664 C  C   . ACT X  3 .   ? -9.778  6.814   18.079  1.00 46.32  ? 355 ACT C C   1 
HETATM 10665 O  O   . ACT X  3 .   ? -10.678 6.031   17.757  1.00 40.78  ? 355 ACT C O   1 
HETATM 10666 O  OXT . ACT X  3 .   ? -10.137 7.952   18.417  1.00 42.74  ? 355 ACT C OXT 1 
HETATM 10667 C  CH3 . ACT X  3 .   ? -8.350  6.397   18.046  1.00 47.14  ? 355 ACT C CH3 1 
HETATM 10668 CL CL  . CL  Y  5 .   ? -36.215 5.960   22.256  1.00 77.51  ? 357 CL  C CL  1 
HETATM 10669 C  C1  A EDO Z  4 .   ? -3.347  17.023  27.436  0.48 38.01  ? 358 EDO C C1  1 
HETATM 10670 C  C1  B EDO Z  4 .   ? 0.639   19.259  26.002  0.52 44.02  ? 358 EDO C C1  1 
HETATM 10671 O  O1  A EDO Z  4 .   ? -3.208  15.808  28.180  0.48 46.68  ? 358 EDO C O1  1 
HETATM 10672 O  O1  B EDO Z  4 .   ? -0.730  19.648  26.150  0.52 47.75  ? 358 EDO C O1  1 
HETATM 10673 C  C2  A EDO Z  4 .   ? -1.965  17.513  27.019  0.48 35.56  ? 358 EDO C C2  1 
HETATM 10674 C  C2  B EDO Z  4 .   ? 0.724   18.196  24.918  0.52 40.17  ? 358 EDO C C2  1 
HETATM 10675 O  O2  A EDO Z  4 .   ? -1.261  16.446  26.373  0.48 37.94  ? 358 EDO C O2  1 
HETATM 10676 O  O2  B EDO Z  4 .   ? -0.084  17.083  25.308  0.52 37.71  ? 358 EDO C O2  1 
HETATM 10677 C  C1  . EDO AA 4 .   ? -0.574  13.588  26.118  1.00 54.49  ? 360 EDO C C1  1 
HETATM 10678 O  O1  . EDO AA 4 .   ? -1.764  13.051  26.698  1.00 41.96  ? 360 EDO C O1  1 
HETATM 10679 C  C2  . EDO AA 4 .   ? 0.525   12.573  26.323  1.00 58.79  ? 360 EDO C C2  1 
HETATM 10680 O  O2  . EDO AA 4 .   ? 0.190   11.854  27.516  1.00 67.78  ? 360 EDO C O2  1 
HETATM 10681 ZN ZN  . ZN  BA 2 .   ? 3.199   50.053  30.967  1.00 44.78  ? 357 ZN  D ZN  1 
HETATM 10682 CL CL  . CL  CA 5 .   ? 22.143  46.876  15.368  1.00 82.52  ? 353 CL  D CL  1 
HETATM 10683 O  O   . HOH DA 6 .   ? 34.046  26.937  12.390  1.00 30.19  ? 361 HOH A O   1 
HETATM 10684 O  O   . HOH DA 6 .   ? 43.717  21.002  34.373  1.00 47.87  ? 362 HOH A O   1 
HETATM 10685 O  O   . HOH DA 6 .   ? 28.560  44.152  21.117  1.00 40.57  ? 363 HOH A O   1 
HETATM 10686 O  O   . HOH DA 6 .   ? 34.396  33.327  4.124   0.70 29.67  ? 364 HOH A O   1 
HETATM 10687 O  O   . HOH DA 6 .   ? 34.204  21.396  8.086   1.00 32.29  ? 365 HOH A O   1 
HETATM 10688 O  O   . HOH DA 6 .   ? 24.058  20.029  12.423  1.00 30.55  ? 366 HOH A O   1 
HETATM 10689 O  O   . HOH DA 6 .   ? 15.051  16.577  29.218  0.89 29.21  ? 367 HOH A O   1 
HETATM 10690 O  O   . HOH DA 6 .   ? 51.881  11.840  4.403   1.00 45.80  ? 368 HOH A O   1 
HETATM 10691 O  O   . HOH DA 6 .   ? 29.340  27.052  32.950  1.00 25.16  ? 369 HOH A O   1 
HETATM 10692 O  O   . HOH DA 6 .   ? 27.569  25.735  15.036  1.00 29.51  ? 370 HOH A O   1 
HETATM 10693 O  O   . HOH DA 6 .   ? 27.898  9.640   13.324  1.00 32.62  ? 371 HOH A O   1 
HETATM 10694 O  O   . HOH DA 6 .   ? 41.366  29.931  -9.117  1.00 60.54  ? 372 HOH A O   1 
HETATM 10695 O  O   . HOH DA 6 .   ? 33.682  20.499  14.849  1.00 29.17  ? 373 HOH A O   1 
HETATM 10696 O  O   . HOH DA 6 .   ? 13.199  3.132   31.049  1.00 45.90  ? 374 HOH A O   1 
HETATM 10697 O  O   . HOH DA 6 .   ? 32.218  14.906  10.086  1.00 31.85  ? 375 HOH A O   1 
HETATM 10698 O  O   . HOH DA 6 .   ? 3.938   12.618  19.451  1.00 28.98  ? 376 HOH A O   1 
HETATM 10699 O  O   . HOH DA 6 .   ? 16.407  18.396  26.587  1.00 32.84  ? 377 HOH A O   1 
HETATM 10700 O  O   . HOH DA 6 .   ? 13.773  19.801  27.462  1.00 66.43  ? 378 HOH A O   1 
HETATM 10701 O  O   . HOH DA 6 .   ? 42.859  14.656  27.014  0.49 40.32  ? 379 HOH A O   1 
HETATM 10702 O  O   . HOH DA 6 .   ? 13.229  18.778  10.413  1.00 30.96  ? 380 HOH A O   1 
HETATM 10703 O  O   . HOH DA 6 .   ? 24.197  30.859  20.445  1.00 30.71  ? 381 HOH A O   1 
HETATM 10704 O  O   . HOH DA 6 .   ? 30.465  33.325  8.964   1.00 34.25  ? 382 HOH A O   1 
HETATM 10705 O  O   . HOH DA 6 .   ? 28.970  29.644  -3.234  1.00 52.00  ? 383 HOH A O   1 
HETATM 10706 O  O   . HOH DA 6 .   ? 22.199  9.766   4.136   1.00 64.62  ? 384 HOH A O   1 
HETATM 10707 O  O   . HOH DA 6 .   ? 34.212  19.994  5.615   1.00 35.11  ? 385 HOH A O   1 
HETATM 10708 O  O   . HOH DA 6 .   ? 34.018  36.206  27.248  1.00 59.39  ? 386 HOH A O   1 
HETATM 10709 O  O   . HOH DA 6 .   ? 36.471  33.665  2.288   0.84 33.55  ? 387 HOH A O   1 
HETATM 10710 O  O   . HOH DA 6 .   ? 21.952  18.292  12.813  0.94 24.90  ? 388 HOH A O   1 
HETATM 10711 O  O   . HOH DA 6 .   ? 7.890   9.687   29.890  1.00 43.75  ? 389 HOH A O   1 
HETATM 10712 O  O   . HOH DA 6 .   ? 46.975  36.162  -0.751  1.00 64.79  ? 390 HOH A O   1 
HETATM 10713 O  O   . HOH DA 6 .   ? 31.661  41.892  4.431   1.00 45.91  ? 391 HOH A O   1 
HETATM 10714 O  O   . HOH DA 6 .   ? 42.119  15.984  34.938  1.00 53.70  ? 392 HOH A O   1 
HETATM 10715 O  O   . HOH DA 6 .   ? 27.736  17.271  11.252  0.90 47.69  ? 393 HOH A O   1 
HETATM 10716 O  O   . HOH DA 6 .   ? 6.695   14.637  22.553  1.00 55.42  ? 394 HOH A O   1 
HETATM 10717 O  O   . HOH DA 6 .   ? 13.390  9.699   35.188  1.00 34.15  ? 395 HOH A O   1 
HETATM 10718 O  O   . HOH DA 6 .   ? 12.762  4.578   7.285   1.00 39.39  ? 396 HOH A O   1 
HETATM 10719 O  O   . HOH DA 6 .   ? 43.203  5.762   14.208  1.00 43.05  ? 397 HOH A O   1 
HETATM 10720 O  O   . HOH DA 6 .   ? 28.173  29.619  8.859   1.00 35.60  ? 398 HOH A O   1 
HETATM 10721 O  O   . HOH DA 6 .   ? 33.521  16.586  35.350  1.00 43.65  ? 399 HOH A O   1 
HETATM 10722 O  O   . HOH DA 6 .   ? 25.272  38.971  10.471  1.00 35.99  ? 400 HOH A O   1 
HETATM 10723 O  O   . HOH DA 6 .   ? 22.630  -8.633  20.274  1.00 42.57  ? 401 HOH A O   1 
HETATM 10724 O  O   . HOH DA 6 .   ? 29.584  11.824  11.968  1.00 28.72  ? 402 HOH A O   1 
HETATM 10725 O  O   . HOH DA 6 .   ? 44.995  7.024   12.808  1.00 40.13  ? 403 HOH A O   1 
HETATM 10726 O  O   . HOH DA 6 .   ? 11.716  20.696  20.535  1.00 42.07  ? 404 HOH A O   1 
HETATM 10727 O  O   . HOH DA 6 .   ? 3.698   13.239  22.019  0.94 31.32  ? 405 HOH A O   1 
HETATM 10728 O  O   . HOH DA 6 .   ? 24.047  9.792   32.708  1.00 27.53  ? 406 HOH A O   1 
HETATM 10729 O  O   . HOH DA 6 .   ? 36.008  47.950  16.069  1.00 48.52  ? 407 HOH A O   1 
HETATM 10730 O  O   . HOH DA 6 .   ? 23.936  39.098  12.744  0.68 26.25  ? 408 HOH A O   1 
HETATM 10731 O  O   . HOH DA 6 .   ? 5.917   11.856  22.383  0.88 35.35  ? 409 HOH A O   1 
HETATM 10732 O  O   . HOH DA 6 .   ? 13.592  19.442  23.801  1.00 44.44  ? 410 HOH A O   1 
HETATM 10733 O  O   . HOH DA 6 .   ? 34.618  12.633  27.863  1.00 38.46  ? 411 HOH A O   1 
HETATM 10734 O  O   . HOH DA 6 .   ? 43.171  31.864  28.344  1.00 47.85  ? 412 HOH A O   1 
HETATM 10735 O  O   . HOH DA 6 .   ? 25.422  -6.982  17.592  0.94 39.53  ? 413 HOH A O   1 
HETATM 10736 O  O   . HOH DA 6 .   ? 34.979  31.793  25.460  1.00 43.17  ? 414 HOH A O   1 
HETATM 10737 O  O   . HOH DA 6 .   ? 10.177  22.400  16.606  1.00 38.42  ? 415 HOH A O   1 
HETATM 10738 O  O   . HOH DA 6 .   ? 9.164   39.718  19.285  0.93 37.76  ? 416 HOH A O   1 
HETATM 10739 O  O   . HOH DA 6 .   ? 40.777  42.359  0.710   0.82 53.96  ? 417 HOH A O   1 
HETATM 10740 O  O   . HOH DA 6 .   ? 12.953  28.507  3.762   1.00 47.15  ? 418 HOH A O   1 
HETATM 10741 O  O   . HOH DA 6 .   ? 24.581  -4.125  29.403  1.00 53.31  ? 419 HOH A O   1 
HETATM 10742 O  O   . HOH DA 6 .   ? 37.703  18.408  28.755  1.00 35.30  ? 420 HOH A O   1 
HETATM 10743 O  O   . HOH DA 6 .   ? 14.386  0.435   28.130  1.00 43.11  ? 421 HOH A O   1 
HETATM 10744 O  O   . HOH DA 6 .   ? 25.555  37.711  6.504   0.72 28.28  ? 422 HOH A O   1 
HETATM 10745 O  O   . HOH DA 6 .   ? 27.603  -4.588  24.347  1.00 45.12  ? 423 HOH A O   1 
HETATM 10746 O  O   . HOH DA 6 .   ? 36.081  19.705  36.602  1.00 48.27  ? 424 HOH A O   1 
HETATM 10747 O  O   . HOH DA 6 .   ? 14.386  -10.417 19.733  1.00 42.84  ? 425 HOH A O   1 
HETATM 10748 O  O   . HOH DA 6 .   ? 20.722  25.280  1.505   1.00 43.17  ? 426 HOH A O   1 
HETATM 10749 O  O   . HOH DA 6 .   ? 44.770  27.189  22.660  1.00 56.92  ? 427 HOH A O   1 
HETATM 10750 O  O   . HOH DA 6 .   ? 47.382  35.400  19.417  1.00 58.69  ? 428 HOH A O   1 
HETATM 10751 O  O   . HOH DA 6 .   ? 11.573  -7.800  17.135  1.00 64.09  ? 429 HOH A O   1 
HETATM 10752 O  O   . HOH DA 6 .   ? 50.753  17.498  1.691   1.00 55.57  ? 430 HOH A O   1 
HETATM 10753 O  O   . HOH DA 6 .   ? 37.780  31.347  2.809   1.00 41.31  ? 431 HOH A O   1 
HETATM 10754 O  O   . HOH DA 6 .   ? 44.763  37.656  -1.011  1.00 72.98  ? 432 HOH A O   1 
HETATM 10755 O  O   . HOH DA 6 .   ? 20.673  22.603  26.569  0.98 36.91  ? 433 HOH A O   1 
HETATM 10756 O  O   . HOH DA 6 .   ? 19.395  9.776   3.026   1.00 51.00  ? 434 HOH A O   1 
HETATM 10757 O  O   . HOH DA 6 .   ? 6.027   0.382   20.033  1.00 56.41  ? 435 HOH A O   1 
HETATM 10758 O  O   . HOH DA 6 .   ? 15.225  -10.586 26.273  1.00 65.63  ? 436 HOH A O   1 
HETATM 10759 O  O   . HOH DA 6 .   ? 33.740  30.194  33.842  1.00 50.13  ? 437 HOH A O   1 
HETATM 10760 O  O   . HOH DA 6 .   ? 20.288  7.927   11.529  0.98 47.36  ? 438 HOH A O   1 
HETATM 10761 O  O   . HOH DA 6 .   ? 20.217  27.234  3.359   1.00 47.83  ? 439 HOH A O   1 
HETATM 10762 O  O   . HOH DA 6 .   ? 43.970  11.536  2.086   1.00 53.67  ? 440 HOH A O   1 
HETATM 10763 O  O   . HOH DA 6 .   ? 36.880  -2.514  19.708  1.00 50.41  ? 441 HOH A O   1 
HETATM 10764 O  O   . HOH DA 6 .   ? 36.392  36.591  -1.364  0.88 40.49  ? 442 HOH A O   1 
HETATM 10765 O  O   . HOH DA 6 .   ? 28.473  41.280  6.220   1.00 54.06  ? 443 HOH A O   1 
HETATM 10766 O  O   . HOH DA 6 .   ? 43.961  35.263  22.086  1.00 56.40  ? 444 HOH A O   1 
HETATM 10767 O  O   . HOH DA 6 .   ? 40.400  46.653  17.046  1.00 59.53  ? 445 HOH A O   1 
HETATM 10768 O  O   . HOH DA 6 .   ? 29.502  14.668  10.414  0.98 41.85  ? 446 HOH A O   1 
HETATM 10769 O  O   . HOH DA 6 .   ? 38.197  45.713  18.674  1.00 56.01  ? 447 HOH A O   1 
HETATM 10770 O  O   . HOH DA 6 .   ? 21.204  33.086  9.129   1.00 45.99  ? 448 HOH A O   1 
HETATM 10771 O  O   . HOH DA 6 .   ? 7.824   -2.181  8.162   1.00 50.87  ? 449 HOH A O   1 
HETATM 10772 O  O   . HOH DA 6 .   ? 21.192  -10.712 20.093  1.00 59.53  ? 450 HOH A O   1 
HETATM 10773 O  O   . HOH DA 6 .   ? 33.517  10.089  11.760  1.00 50.14  ? 451 HOH A O   1 
HETATM 10774 O  O   . HOH DA 6 .   ? 15.609  40.458  16.275  0.73 53.38  ? 452 HOH A O   1 
HETATM 10775 O  O   . HOH DA 6 .   ? 28.014  36.756  5.764   1.00 41.59  ? 453 HOH A O   1 
HETATM 10776 O  O   . HOH DA 6 .   ? 28.888  44.213  9.224   1.00 47.81  ? 454 HOH A O   1 
HETATM 10777 O  O   . HOH DA 6 .   ? 39.449  12.120  29.171  1.00 45.94  ? 455 HOH A O   1 
HETATM 10778 O  O   . HOH DA 6 .   ? 26.819  -7.066  20.013  1.00 62.54  ? 456 HOH A O   1 
HETATM 10779 O  O   . HOH DA 6 .   ? 32.801  10.976  5.687   0.60 30.18  ? 457 HOH A O   1 
HETATM 10780 O  O   . HOH DA 6 .   ? 40.768  35.354  22.374  1.00 43.65  ? 458 HOH A O   1 
HETATM 10781 O  O   . HOH DA 6 .   ? 22.620  32.559  5.003   0.88 40.69  ? 459 HOH A O   1 
HETATM 10782 O  O   . HOH DA 6 .   ? 6.256   -1.057  17.883  1.00 51.67  ? 460 HOH A O   1 
HETATM 10783 O  O   . HOH DA 6 .   ? 14.249  2.588   33.137  1.00 50.67  ? 461 HOH A O   1 
HETATM 10784 O  O   . HOH DA 6 .   ? 34.462  48.612  8.679   1.00 52.69  ? 462 HOH A O   1 
HETATM 10785 O  O   . HOH DA 6 .   ? 32.290  12.190  10.988  1.00 66.85  ? 463 HOH A O   1 
HETATM 10786 O  O   . HOH DA 6 .   ? 36.494  7.449   -1.768  1.00 54.90  ? 464 HOH A O   1 
HETATM 10787 O  O   . HOH DA 6 .   ? 33.901  34.376  24.468  0.99 39.52  ? 465 HOH A O   1 
HETATM 10788 O  O   . HOH DA 6 .   ? 34.634  18.151  38.058  1.00 41.24  ? 466 HOH A O   1 
HETATM 10789 O  O   . HOH DA 6 .   ? 18.993  7.326   2.306   1.00 53.97  ? 467 HOH A O   1 
HETATM 10790 O  O   . HOH DA 6 .   ? 39.728  7.414   20.158  1.00 31.20  ? 468 HOH A O   1 
HETATM 10791 O  O   . HOH DA 6 .   ? 26.472  2.397   11.642  1.00 43.60  ? 469 HOH A O   1 
HETATM 10792 O  O   . HOH DA 6 .   ? 43.893  5.823   7.978   1.00 39.73  ? 470 HOH A O   1 
HETATM 10793 O  O   . HOH DA 6 .   ? 17.148  -10.810 12.899  1.00 57.48  ? 471 HOH A O   1 
HETATM 10794 O  O   . HOH DA 6 .   ? 17.755  25.294  18.661  1.00 43.85  ? 472 HOH A O   1 
HETATM 10795 O  O   . HOH DA 6 .   ? 40.484  18.702  37.300  1.00 66.38  ? 473 HOH A O   1 
HETATM 10796 O  O   .