data_3FYA
# 
_entry.id   3FYA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3FYA         pdb_00003fya 10.2210/pdb3fya/pdb 
RCSB  RCSB051189   ?            ?                   
WWPDB D_1000051189 ?            ?                   
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3CLC 
_pdbx_database_related.details        'Wild type protein complexed with 35mer DNA' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        3FYA 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2009-01-22 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ball, N.J.'     1 
'McGeehan, J.E.' 2 
'Thresh, S.J.'   3 
'Streeter, S.D.' 4 
'Kneale, G.G.'   5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structure of the restriction-modification controller protein C.Esp1396I.'                                  
'Acta Crystallogr.,Sect.D' 65 900  905  2009 ABCRE6 DK 0907-4449 0766 ? 19690367 10.1107/S0907444909020514 
1       'Structural analysis of the genetic switch that regulates the expression of restriction-modification genes' 
'Nucleic Acids Res.'       36 4778 4787 2008 NARHAD UK 0305-1048 0389 ? 18644840 10.1093/nar/gkn448        
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ball, N.'       1  ? 
primary 'Streeter, S.D.' 2  ? 
primary 'Kneale, G.G.'   3  ? 
primary 'McGeehan, J.E.' 4  ? 
1       'McGeehan, J.E.' 5  ? 
1       'Streeter, S.D.' 6  ? 
1       'Thresh, S.'     7  ? 
1       'Ball, N.'       8  ? 
1       'Ravelli, R.B.'  9  ? 
1       'Kneale, G.G.'   10 ? 
# 
_cell.length_a           48.435 
_cell.length_b           48.435 
_cell.length_c           135.780 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           3FYA 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              12 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 65' 
_symmetry.entry_id                         3FYA 
_symmetry.Int_Tables_number                170 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Regulatory protein' 
_entity.formula_weight             11324.147 
_entity.pdbx_number_of_molecules   2 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              R35A 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSHMESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDATYISGIERNSRNLTIKSLELIMKGL
EVSDVVFFEMLIKEILKHD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSHMESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDATYISGIERNSRNLTIKSLELIMKGL
EVSDVVFFEMLIKEILKHD
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  GLY n 
1 3  SER n 
1 4  SER n 
1 5  HIS n 
1 6  HIS n 
1 7  HIS n 
1 8  HIS n 
1 9  HIS n 
1 10 HIS n 
1 11 SER n 
1 12 SER n 
1 13 GLY n 
1 14 LEU n 
1 15 VAL n 
1 16 PRO n 
1 17 ARG n 
1 18 GLY n 
1 19 SER n 
1 20 HIS n 
1 21 MET n 
1 22 GLU n 
1 23 SER n 
1 24 PHE n 
1 25 LEU n 
1 26 LEU n 
1 27 SER n 
1 28 LYS n 
1 29 VAL n 
1 30 SER n 
1 31 PHE n 
1 32 VAL n 
1 33 ILE n 
1 34 LYS n 
1 35 LYS n 
1 36 ILE n 
1 37 ARG n 
1 38 LEU n 
1 39 GLU n 
1 40 LYS n 
1 41 GLY n 
1 42 MET n 
1 43 THR n 
1 44 GLN n 
1 45 GLU n 
1 46 ASP n 
1 47 LEU n 
1 48 ALA n 
1 49 TYR n 
1 50 LYS n 
1 51 SER n 
1 52 ASN n 
1 53 LEU n 
1 54 ASP n 
1 55 ALA n 
1 56 THR n 
1 57 TYR n 
1 58 ILE n 
1 59 SER n 
1 60 GLY n 
1 61 ILE n 
1 62 GLU n 
1 63 ARG n 
1 64 ASN n 
1 65 SER n 
1 66 ARG n 
1 67 ASN n 
1 68 LEU n 
1 69 THR n 
1 70 ILE n 
1 71 LYS n 
1 72 SER n 
1 73 LEU n 
1 74 GLU n 
1 75 LEU n 
1 76 ILE n 
1 77 MET n 
1 78 LYS n 
1 79 GLY n 
1 80 LEU n 
1 81 GLU n 
1 82 VAL n 
1 83 SER n 
1 84 ASP n 
1 85 VAL n 
1 86 VAL n 
1 87 PHE n 
1 88 PHE n 
1 89 GLU n 
1 90 MET n 
1 91 LEU n 
1 92 ILE n 
1 93 LYS n 
1 94 GLU n 
1 95 ILE n 
1 96 LEU n 
1 97 LYS n 
1 98 HIS n 
1 99 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 esp1396IC 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    RFL1396 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacter sp.' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     211595 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)GOLD' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q8GGH0_9ENTR 
_struct_ref.pdbx_db_accession          Q8GGH0 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   MESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILKHD 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3FYA A 21 ? 99 ? Q8GGH0 1 ? 79 ? 1 79 
2 1 3FYA B 21 ? 99 ? Q8GGH0 1 ? 79 ? 1 79 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3FYA MET A 1  ? UNP Q8GGH0 ?   ?  'expression tag'      -19 1  
1 3FYA GLY A 2  ? UNP Q8GGH0 ?   ?  'expression tag'      -18 2  
1 3FYA SER A 3  ? UNP Q8GGH0 ?   ?  'expression tag'      -17 3  
1 3FYA SER A 4  ? UNP Q8GGH0 ?   ?  'expression tag'      -16 4  
1 3FYA HIS A 5  ? UNP Q8GGH0 ?   ?  'expression tag'      -15 5  
1 3FYA HIS A 6  ? UNP Q8GGH0 ?   ?  'expression tag'      -14 6  
1 3FYA HIS A 7  ? UNP Q8GGH0 ?   ?  'expression tag'      -13 7  
1 3FYA HIS A 8  ? UNP Q8GGH0 ?   ?  'expression tag'      -12 8  
1 3FYA HIS A 9  ? UNP Q8GGH0 ?   ?  'expression tag'      -11 9  
1 3FYA HIS A 10 ? UNP Q8GGH0 ?   ?  'expression tag'      -10 10 
1 3FYA SER A 11 ? UNP Q8GGH0 ?   ?  'expression tag'      -9  11 
1 3FYA SER A 12 ? UNP Q8GGH0 ?   ?  'expression tag'      -8  12 
1 3FYA GLY A 13 ? UNP Q8GGH0 ?   ?  'expression tag'      -7  13 
1 3FYA LEU A 14 ? UNP Q8GGH0 ?   ?  'expression tag'      -6  14 
1 3FYA VAL A 15 ? UNP Q8GGH0 ?   ?  'expression tag'      -5  15 
1 3FYA PRO A 16 ? UNP Q8GGH0 ?   ?  'expression tag'      -4  16 
1 3FYA ARG A 17 ? UNP Q8GGH0 ?   ?  'expression tag'      -3  17 
1 3FYA GLY A 18 ? UNP Q8GGH0 ?   ?  'expression tag'      -2  18 
1 3FYA SER A 19 ? UNP Q8GGH0 ?   ?  'expression tag'      -1  19 
1 3FYA HIS A 20 ? UNP Q8GGH0 ?   ?  'expression tag'      0   20 
1 3FYA ALA A 55 ? UNP Q8GGH0 ARG 35 'engineered mutation' 35  21 
2 3FYA MET B 1  ? UNP Q8GGH0 ?   ?  'expression tag'      -19 22 
2 3FYA GLY B 2  ? UNP Q8GGH0 ?   ?  'expression tag'      -18 23 
2 3FYA SER B 3  ? UNP Q8GGH0 ?   ?  'expression tag'      -17 24 
2 3FYA SER B 4  ? UNP Q8GGH0 ?   ?  'expression tag'      -16 25 
2 3FYA HIS B 5  ? UNP Q8GGH0 ?   ?  'expression tag'      -15 26 
2 3FYA HIS B 6  ? UNP Q8GGH0 ?   ?  'expression tag'      -14 27 
2 3FYA HIS B 7  ? UNP Q8GGH0 ?   ?  'expression tag'      -13 28 
2 3FYA HIS B 8  ? UNP Q8GGH0 ?   ?  'expression tag'      -12 29 
2 3FYA HIS B 9  ? UNP Q8GGH0 ?   ?  'expression tag'      -11 30 
2 3FYA HIS B 10 ? UNP Q8GGH0 ?   ?  'expression tag'      -10 31 
2 3FYA SER B 11 ? UNP Q8GGH0 ?   ?  'expression tag'      -9  32 
2 3FYA SER B 12 ? UNP Q8GGH0 ?   ?  'expression tag'      -8  33 
2 3FYA GLY B 13 ? UNP Q8GGH0 ?   ?  'expression tag'      -7  34 
2 3FYA LEU B 14 ? UNP Q8GGH0 ?   ?  'expression tag'      -6  35 
2 3FYA VAL B 15 ? UNP Q8GGH0 ?   ?  'expression tag'      -5  36 
2 3FYA PRO B 16 ? UNP Q8GGH0 ?   ?  'expression tag'      -4  37 
2 3FYA ARG B 17 ? UNP Q8GGH0 ?   ?  'expression tag'      -3  38 
2 3FYA GLY B 18 ? UNP Q8GGH0 ?   ?  'expression tag'      -2  39 
2 3FYA SER B 19 ? UNP Q8GGH0 ?   ?  'expression tag'      -1  40 
2 3FYA HIS B 20 ? UNP Q8GGH0 ?   ?  'expression tag'      0   41 
2 3FYA ALA B 55 ? UNP Q8GGH0 ARG 35 'engineered mutation' 35  42 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3FYA 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.03 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   39.41 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          precipitation 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.pdbx_details    
'150 mM NaCl, 40 mM Tris-HCl, 5 % w/v glycerol, 2.5 mM CaCl2, pH 8.0, precipitation, temperature 277K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2008-11-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9330 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_wavelength_list        0.9330 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
# 
_reflns.entry_id                     3FYA 
_reflns.d_resolution_high            2.952 
_reflns.d_resolution_low             41.959 
_reflns.number_all                   3840 
_reflns.number_obs                   3839 
_reflns.pdbx_Rmerge_I_obs            0.263 
_reflns.pdbx_netI_over_sigmaI        1.394 
_reflns.pdbx_Rsym_value              0.263 
_reflns.pdbx_redundancy              7.600 
_reflns.percent_possible_obs         100.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.B_iso_Wilson_estimate        86 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.95 3.11  ? 3041 ? 0.412 1.9 0.412 ? 5.50  ? 553 100.00 1  1 
3.11 3.30  ? 2922 ? 0.229 3.2 0.229 ? 5.50  ? 528 100.00 2  1 
3.30 3.53  ? 2760 ? 0.147 5.1 0.147 ? 5.60  ? 496 100.00 3  1 
3.53 3.81  ? 2555 ? 0.105 6.8 0.105 ? 5.50  ? 466 100.00 4  1 
3.81 4.17  ? 3308 ? 0.300 1.5 0.300 ? 8.00  ? 414 100.00 5  1 
4.17 4.66  ? 4244 ? 0.388 1.3 0.388 ? 10.90 ? 388 100.00 6  1 
4.66 5.39  ? 3844 ? 0.388 1.4 0.388 ? 11.00 ? 348 100.00 7  1 
5.39 6.60  ? 3104 ? 0.339 1.5 0.339 ? 10.70 ? 289 100.00 8  1 
6.60 9.33  ? 2251 ? 0.243 1.7 0.243 ? 9.90  ? 227 100.00 9  1 
9.33 41.92 ? 1040 ? 0.104 4.3 0.104 ? 8.00  ? 130 98.90  10 1 
# 
_refine.entry_id                                 3FYA 
_refine.ls_d_res_high                            3.000 
_refine.ls_d_res_low                             35.690 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    100.000 
_refine.ls_number_reflns_obs                     3615 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.249 
_refine.ls_R_factor_R_work                       0.248 
_refine.ls_wR_factor_R_work                      0.248 
_refine.ls_R_factor_R_free                       0.267 
_refine.ls_wR_factor_R_free                      0.269 
_refine.ls_percent_reflns_R_free                 4.500 
_refine.ls_number_reflns_R_free                  164 
_refine.B_iso_mean                               56.744 
_refine.aniso_B[1][1]                            0.420 
_refine.aniso_B[2][2]                            0.420 
_refine.aniso_B[3][3]                            -0.630 
_refine.aniso_B[1][2]                            0.210 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.910 
_refine.correlation_coeff_Fo_to_Fc_free          0.895 
_refine.overall_SU_R_Cruickshank_DPI             0.453 
_refine.overall_SU_R_free                        0.486 
_refine.pdbx_overall_ESU_R_Free                  0.478 
_refine.overall_SU_ML                            0.406 
_refine.overall_SU_B                             50.745 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.overall_FOM_work_R_set                   0.811 
_refine.B_iso_max                                65.28 
_refine.B_iso_min                                20.00 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3CLC' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1208 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               1208 
_refine_hist.d_res_high                       3.000 
_refine_hist.d_res_low                        35.690 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         1207 0.014  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1614 1.690  1.998  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   150  5.971  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   45   27.249 24.667 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   256  24.613 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   6    23.701 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           199  0.126  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     824  0.005  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            643  0.261  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          840  0.326  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    39   0.168  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   21   0.409  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 5    0.350  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              781  0.401  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1213 0.623  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              478  0.803  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             401  1.264  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 1 'TIGHT POSITIONAL' A 524 0.080 0.050 'X-RAY DIFFRACTION' 1 ? ? ? 
1 1 'TIGHT THERMAL'    A 524 0.090 0.500 'X-RAY DIFFRACTION' 2 ? ? ? 
# 
_refine_ls_shell.d_res_high                       3.001 
_refine_ls_shell.d_res_low                        3.078 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               100.000 
_refine_ls_shell.number_reflns_R_work             239 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.305 
_refine_ls_shell.R_factor_R_free                  0.238 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             17 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                256 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 B 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
1 1 1 A 3  A 36 1 . . . . A 3  A 36 ? 
1 2 1 B 3  B 36 1 . . . . B 3  B 36 ? 
1 1 2 A 38 A 43 1 . . . . A 38 A 43 ? 
1 2 2 B 38 B 43 1 . . . . B 38 B 43 ? 
1 1 3 A 47 A 75 1 . . . . A 47 A 75 ? 
1 2 3 B 47 B 75 1 . . . . B 47 B 75 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  3FYA 
_struct.title                     
'Crystal Structure of an R35A mutant of the Restriction-Modification Controller Protein C.Esp1396I' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3FYA 
_struct_keywords.text            'transcriptional regulator, helix-turn-helix, Restriction-modification, TRANSCRIPTION REGULATOR' 
_struct_keywords.pdbx_keywords   'TRANSCRIPTION REGULATOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 23 ? LYS A 40 ? SER A 3  LYS A 20 1 ? 18 
HELX_P HELX_P2  2  THR A 43 ? SER A 51 ? THR A 23 SER A 31 1 ? 9  
HELX_P HELX_P3  3  ASP A 54 ? ARG A 63 ? ASP A 34 ARG A 43 1 ? 10 
HELX_P HELX_P4  4  THR A 69 ? GLU A 81 ? THR A 49 GLU A 61 1 ? 13 
HELX_P HELX_P5  5  SER A 83 ? LEU A 96 ? SER A 63 LEU A 76 1 ? 14 
HELX_P HELX_P6  6  SER B 23 ? LYS B 40 ? SER B 3  LYS B 20 1 ? 18 
HELX_P HELX_P7  7  THR B 43 ? SER B 51 ? THR B 23 SER B 31 1 ? 9  
HELX_P HELX_P8  8  ASP B 54 ? ARG B 63 ? ASP B 34 ARG B 43 1 ? 10 
HELX_P HELX_P9  9  THR B 69 ? LEU B 80 ? THR B 49 LEU B 60 1 ? 12 
HELX_P HELX_P10 10 SER B 83 ? LYS B 97 ? SER B 63 LYS B 77 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    3FYA 
_atom_sites.fract_transf_matrix[1][1]   0.020646 
_atom_sites.fract_transf_matrix[1][2]   0.011920 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.023840 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007365 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . GLU A 1 22 ? 25.331 -0.712  18.359  1.00 57.90 ? 2  GLU A N   1 
ATOM 2    C CA  . GLU A 1 22 ? 24.420 -0.384  17.215  1.00 58.10 ? 2  GLU A CA  1 
ATOM 3    C C   . GLU A 1 22 ? 25.161 0.367   16.070  1.00 57.84 ? 2  GLU A C   1 
ATOM 4    O O   . GLU A 1 22 ? 26.353 0.626   16.174  1.00 58.30 ? 2  GLU A O   1 
ATOM 5    C CB  . GLU A 1 22 ? 23.239 0.440   17.706  1.00 20.00 ? 2  GLU A CB  1 
ATOM 6    N N   . SER A 1 23 ? 24.470 0.657   14.967  1.00 56.96 ? 3  SER A N   1 
ATOM 7    C CA  . SER A 1 23 ? 24.983 1.545   13.921  1.00 56.34 ? 3  SER A CA  1 
ATOM 8    C C   . SER A 1 23 ? 24.298 2.896   14.041  1.00 56.49 ? 3  SER A C   1 
ATOM 9    O O   . SER A 1 23 ? 23.075 2.991   13.861  1.00 56.25 ? 3  SER A O   1 
ATOM 10   C CB  . SER A 1 23 ? 24.675 0.981   12.530  1.00 56.59 ? 3  SER A CB  1 
ATOM 11   O OG  . SER A 1 23 ? 24.254 2.005   11.627  1.00 54.84 ? 3  SER A OG  1 
ATOM 12   N N   . PHE A 1 24 ? 25.078 3.938   14.324  1.00 56.62 ? 4  PHE A N   1 
ATOM 13   C CA  . PHE A 1 24 ? 24.546 5.299   14.413  1.00 57.02 ? 4  PHE A CA  1 
ATOM 14   C C   . PHE A 1 24 ? 23.708 5.701   13.195  1.00 57.54 ? 4  PHE A C   1 
ATOM 15   O O   . PHE A 1 24 ? 22.725 6.446   13.317  1.00 57.70 ? 4  PHE A O   1 
ATOM 16   C CB  . PHE A 1 24 ? 25.679 6.297   14.591  1.00 56.82 ? 4  PHE A CB  1 
ATOM 17   C CG  . PHE A 1 24 ? 25.246 7.735   14.487  1.00 56.84 ? 4  PHE A CG  1 
ATOM 18   C CD1 . PHE A 1 24 ? 24.669 8.387   15.579  1.00 57.02 ? 4  PHE A CD1 1 
ATOM 19   C CD2 . PHE A 1 24 ? 25.425 8.442   13.299  1.00 56.61 ? 4  PHE A CD2 1 
ATOM 20   C CE1 . PHE A 1 24 ? 24.277 9.717   15.481  1.00 56.86 ? 4  PHE A CE1 1 
ATOM 21   C CE2 . PHE A 1 24 ? 25.037 9.770   13.189  1.00 55.99 ? 4  PHE A CE2 1 
ATOM 22   C CZ  . PHE A 1 24 ? 24.466 10.409  14.280  1.00 56.58 ? 4  PHE A CZ  1 
ATOM 23   N N   . LEU A 1 25 ? 24.097 5.215   12.019  1.00 57.99 ? 5  LEU A N   1 
ATOM 24   C CA  . LEU A 1 25 ? 23.385 5.566   10.794  1.00 58.34 ? 5  LEU A CA  1 
ATOM 25   C C   . LEU A 1 25 ? 21.976 4.989   10.864  1.00 58.84 ? 5  LEU A C   1 
ATOM 26   O O   . LEU A 1 25 ? 21.009 5.751   10.960  1.00 59.49 ? 5  LEU A O   1 
ATOM 27   C CB  . LEU A 1 25 ? 24.098 5.046   9.540   1.00 58.30 ? 5  LEU A CB  1 
ATOM 28   C CG  . LEU A 1 25 ? 24.361 5.921   8.305   1.00 57.48 ? 5  LEU A CG  1 
ATOM 29   C CD1 . LEU A 1 25 ? 23.959 5.222   7.011   1.00 56.44 ? 5  LEU A CD1 1 
ATOM 30   C CD2 . LEU A 1 25 ? 23.824 7.341   8.385   1.00 56.48 ? 5  LEU A CD2 1 
ATOM 31   N N   . LEU A 1 26 ? 21.874 3.652   10.821  1.00 58.65 ? 6  LEU A N   1 
ATOM 32   C CA  . LEU A 1 26 ? 20.632 2.913   11.032  1.00 57.97 ? 6  LEU A CA  1 
ATOM 33   C C   . LEU A 1 26 ? 19.752 3.736   11.977  1.00 58.09 ? 6  LEU A C   1 
ATOM 34   O O   . LEU A 1 26 ? 18.631 4.105   11.605  1.00 58.40 ? 6  LEU A O   1 
ATOM 35   C CB  . LEU A 1 26 ? 20.978 1.546   11.632  1.00 58.07 ? 6  LEU A CB  1 
ATOM 36   C CG  . LEU A 1 26 ? 20.326 0.213   11.260  1.00 57.54 ? 6  LEU A CG  1 
ATOM 37   C CD1 . LEU A 1 26 ? 19.962 0.097   9.806   1.00 57.01 ? 6  LEU A CD1 1 
ATOM 38   C CD2 . LEU A 1 26 ? 21.140 -1.000  11.746  1.00 56.00 ? 6  LEU A CD2 1 
ATOM 39   N N   . SER A 1 27 ? 20.288 4.084   13.156  1.00 57.89 ? 7  SER A N   1 
ATOM 40   C CA  . SER A 1 27 ? 19.555 4.863   14.161  1.00 58.09 ? 7  SER A CA  1 
ATOM 41   C C   . SER A 1 27 ? 18.818 6.020   13.503  1.00 58.03 ? 7  SER A C   1 
ATOM 42   O O   . SER A 1 27 ? 17.580 6.084   13.545  1.00 58.18 ? 7  SER A O   1 
ATOM 43   C CB  . SER A 1 27 ? 20.473 5.340   15.325  1.00 58.38 ? 7  SER A CB  1 
ATOM 44   O OG  . SER A 1 27 ? 20.552 6.762   15.454  1.00 58.67 ? 7  SER A OG  1 
ATOM 45   N N   . LYS A 1 28 ? 19.578 6.902   12.859  1.00 58.05 ? 8  LYS A N   1 
ATOM 46   C CA  . LYS A 1 28 ? 18.995 8.090   12.225  1.00 58.11 ? 8  LYS A CA  1 
ATOM 47   C C   . LYS A 1 28 ? 18.124 7.867   10.947  1.00 57.98 ? 8  LYS A C   1 
ATOM 48   O O   . LYS A 1 28 ? 17.158 8.609   10.727  1.00 58.22 ? 8  LYS A O   1 
ATOM 49   C CB  . LYS A 1 28 ? 20.043 9.210   12.075  1.00 57.77 ? 8  LYS A CB  1 
ATOM 50   C CG  . LYS A 1 28 ? 19.756 10.351  13.001  1.00 57.52 ? 8  LYS A CG  1 
ATOM 51   C CD  . LYS A 1 28 ? 20.972 10.755  13.740  1.00 58.30 ? 8  LYS A CD  1 
ATOM 52   C CE  . LYS A 1 28 ? 20.630 11.084  15.178  1.00 58.70 ? 8  LYS A CE  1 
ATOM 53   N NZ  . LYS A 1 28 ? 20.213 9.853   15.904  1.00 59.72 ? 8  LYS A NZ  1 
ATOM 54   N N   . VAL A 1 29 ? 18.444 6.866   10.124  1.00 57.76 ? 9  VAL A N   1 
ATOM 55   C CA  . VAL A 1 29 ? 17.607 6.541   8.951   1.00 57.36 ? 9  VAL A CA  1 
ATOM 56   C C   . VAL A 1 29 ? 16.281 6.083   9.492   1.00 57.50 ? 9  VAL A C   1 
ATOM 57   O O   . VAL A 1 29 ? 15.217 6.648   9.176   1.00 57.32 ? 9  VAL A O   1 
ATOM 58   C CB  . VAL A 1 29 ? 18.247 5.428   8.052   1.00 57.11 ? 9  VAL A CB  1 
ATOM 59   C CG1 . VAL A 1 29 ? 17.240 4.714   7.222   1.00 56.21 ? 9  VAL A CG1 1 
ATOM 60   C CG2 . VAL A 1 29 ? 19.283 6.025   7.145   1.00 56.77 ? 9  VAL A CG2 1 
ATOM 61   N N   . SER A 1 30 ? 16.370 5.084   10.359  1.00 57.48 ? 10 SER A N   1 
ATOM 62   C CA  . SER A 1 30 ? 15.191 4.479   10.911  1.00 57.80 ? 10 SER A CA  1 
ATOM 63   C C   . SER A 1 30 ? 14.330 5.541   11.571  1.00 57.52 ? 10 SER A C   1 
ATOM 64   O O   . SER A 1 30 ? 13.100 5.523   11.449  1.00 57.39 ? 10 SER A O   1 
ATOM 65   C CB  . SER A 1 30 ? 15.565 3.403   11.905  1.00 57.62 ? 10 SER A CB  1 
ATOM 66   O OG  . SER A 1 30 ? 14.620 3.431   12.939  1.00 59.21 ? 10 SER A OG  1 
ATOM 67   N N   . PHE A 1 31 ? 14.981 6.481   12.246  1.00 57.46 ? 11 PHE A N   1 
ATOM 68   C CA  . PHE A 1 31 ? 14.244 7.563   12.892  1.00 57.66 ? 11 PHE A CA  1 
ATOM 69   C C   . PHE A 1 31 ? 13.451 8.441   11.892  1.00 57.22 ? 11 PHE A C   1 
ATOM 70   O O   . PHE A 1 31 ? 12.264 8.732   12.097  1.00 57.49 ? 11 PHE A O   1 
ATOM 71   C CB  . PHE A 1 31 ? 15.138 8.412   13.815  1.00 57.69 ? 11 PHE A CB  1 
ATOM 72   C CG  . PHE A 1 31 ? 14.370 9.425   14.611  1.00 58.30 ? 11 PHE A CG  1 
ATOM 73   C CD1 . PHE A 1 31 ? 13.679 9.043   15.765  1.00 59.50 ? 11 PHE A CD1 1 
ATOM 74   C CD2 . PHE A 1 31 ? 14.298 10.749  14.184  1.00 58.08 ? 11 PHE A CD2 1 
ATOM 75   C CE1 . PHE A 1 31 ? 12.947 9.979   16.493  1.00 59.85 ? 11 PHE A CE1 1 
ATOM 76   C CE2 . PHE A 1 31 ? 13.581 11.691  14.893  1.00 58.25 ? 11 PHE A CE2 1 
ATOM 77   C CZ  . PHE A 1 31 ? 12.902 11.313  16.052  1.00 59.13 ? 11 PHE A CZ  1 
ATOM 78   N N   . VAL A 1 32 ? 14.091 8.848   10.811  1.00 56.40 ? 12 VAL A N   1 
ATOM 79   C CA  . VAL A 1 32 ? 13.405 9.708   9.881   1.00 56.05 ? 12 VAL A CA  1 
ATOM 80   C C   . VAL A 1 32 ? 12.234 8.940   9.211   1.00 56.02 ? 12 VAL A C   1 
ATOM 81   O O   . VAL A 1 32 ? 11.162 9.509   8.979   1.00 56.38 ? 12 VAL A O   1 
ATOM 82   C CB  . VAL A 1 32 ? 14.379 10.379  8.889   1.00 55.87 ? 12 VAL A CB  1 
ATOM 83   C CG1 . VAL A 1 32 ? 13.723 11.562  8.231   1.00 55.62 ? 12 VAL A CG1 1 
ATOM 84   C CG2 . VAL A 1 32 ? 15.590 10.881  9.614   1.00 55.72 ? 12 VAL A CG2 1 
ATOM 85   N N   . ILE A 1 33 ? 12.425 7.648   8.947   1.00 55.43 ? 13 ILE A N   1 
ATOM 86   C CA  . ILE A 1 33 ? 11.333 6.772   8.510   1.00 54.58 ? 13 ILE A CA  1 
ATOM 87   C C   . ILE A 1 33 ? 10.091 6.877   9.434   1.00 54.76 ? 13 ILE A C   1 
ATOM 88   O O   . ILE A 1 33 ? 8.988  7.200   8.973   1.00 54.46 ? 13 ILE A O   1 
ATOM 89   C CB  . ILE A 1 33 ? 11.821 5.315   8.429   1.00 54.62 ? 13 ILE A CB  1 
ATOM 90   C CG1 . ILE A 1 33 ? 12.642 5.088   7.152   1.00 54.59 ? 13 ILE A CG1 1 
ATOM 91   C CG2 . ILE A 1 33 ? 10.662 4.367   8.530   1.00 53.93 ? 13 ILE A CG2 1 
ATOM 92   C CD1 . ILE A 1 33 ? 13.121 3.647   6.949   1.00 53.92 ? 13 ILE A CD1 1 
ATOM 93   N N   . LYS A 1 34 ? 10.282 6.627   10.735  1.00 54.80 ? 14 LYS A N   1 
ATOM 94   C CA  . LYS A 1 34 ? 9.189  6.692   11.708  1.00 54.66 ? 14 LYS A CA  1 
ATOM 95   C C   . LYS A 1 34 ? 8.521  8.045   11.636  1.00 54.91 ? 14 LYS A C   1 
ATOM 96   O O   . LYS A 1 34 ? 7.295  8.125   11.507  1.00 55.13 ? 14 LYS A O   1 
ATOM 97   C CB  . LYS A 1 34 ? 9.689  6.437   13.133  1.00 54.45 ? 14 LYS A CB  1 
ATOM 98   C CG  . LYS A 1 34 ? 8.588  6.296   14.201  1.00 53.67 ? 14 LYS A CG  1 
ATOM 99   C CD  . LYS A 1 34 ? 9.102  5.516   15.423  1.00 53.39 ? 14 LYS A CD  1 
ATOM 100  C CE  . LYS A 1 34 ? 7.984  5.093   16.400  1.00 54.09 ? 14 LYS A CE  1 
ATOM 101  N NZ  . LYS A 1 34 ? 7.777  6.019   17.575  1.00 54.45 ? 14 LYS A NZ  1 
ATOM 102  N N   . LYS A 1 35 ? 9.342  9.095   11.698  1.00 55.01 ? 15 LYS A N   1 
ATOM 103  C CA  . LYS A 1 35 ? 8.875  10.487  11.709  1.00 55.27 ? 15 LYS A CA  1 
ATOM 104  C C   . LYS A 1 35 ? 7.872  10.766  10.597  1.00 55.22 ? 15 LYS A C   1 
ATOM 105  O O   . LYS A 1 35 ? 6.746  11.228  10.837  1.00 54.94 ? 15 LYS A O   1 
ATOM 106  C CB  . LYS A 1 35 ? 10.061 11.447  11.572  1.00 55.08 ? 15 LYS A CB  1 
ATOM 107  C CG  . LYS A 1 35 ? 9.650  12.907  11.345  1.00 55.71 ? 15 LYS A CG  1 
ATOM 108  C CD  . LYS A 1 35 ? 10.855 13.838  11.176  1.00 55.75 ? 15 LYS A CD  1 
ATOM 109  C CE  . LYS A 1 35 ? 11.324 14.439  12.498  1.00 55.62 ? 15 LYS A CE  1 
ATOM 110  N NZ  . LYS A 1 35 ? 12.658 15.073  12.351  1.00 55.86 ? 15 LYS A NZ  1 
ATOM 111  N N   . ILE A 1 36 ? 8.316  10.474  9.380   1.00 55.29 ? 16 ILE A N   1 
ATOM 112  C CA  . ILE A 1 36 ? 7.536  10.694  8.180   1.00 55.22 ? 16 ILE A CA  1 
ATOM 113  C C   . ILE A 1 36 ? 6.325  9.766   8.168   1.00 55.43 ? 16 ILE A C   1 
ATOM 114  O O   . ILE A 1 36 ? 5.206  10.210  7.921   1.00 55.25 ? 16 ILE A O   1 
ATOM 115  C CB  . ILE A 1 36 ? 8.411  10.554  6.908   1.00 55.02 ? 16 ILE A CB  1 
ATOM 116  C CG1 . ILE A 1 36 ? 9.767  11.247  7.142   1.00 54.92 ? 16 ILE A CG1 1 
ATOM 117  C CG2 . ILE A 1 36 ? 7.689  11.164  5.709   1.00 55.02 ? 16 ILE A CG2 1 
ATOM 118  C CD1 . ILE A 1 36 ? 10.759 11.191  5.986   1.00 54.76 ? 16 ILE A CD1 1 
ATOM 119  N N   . ARG A 1 37 ? 6.554  8.489   8.473   1.00 55.64 ? 17 ARG A N   1 
ATOM 120  C CA  . ARG A 1 37 ? 5.467  7.530   8.623   1.00 55.74 ? 17 ARG A CA  1 
ATOM 121  C C   . ARG A 1 37 ? 4.402  8.078   9.575   1.00 55.82 ? 17 ARG A C   1 
ATOM 122  O O   . ARG A 1 37 ? 3.197  8.024   9.291   1.00 55.38 ? 17 ARG A O   1 
ATOM 123  C CB  . ARG A 1 37 ? 5.994  6.195   9.136   1.00 55.55 ? 17 ARG A CB  1 
ATOM 124  C CG  . ARG A 1 37 ? 4.874  5.204   9.435   1.00 55.57 ? 17 ARG A CG  1 
ATOM 125  C CD  . ARG A 1 37 ? 5.398  3.848   9.900   1.00 55.45 ? 17 ARG A CD  1 
ATOM 126  N NE  . ARG A 1 37 ? 5.874  3.865   11.288  1.00 54.97 ? 17 ARG A NE  1 
ATOM 127  C CZ  . ARG A 1 37 ? 5.124  4.183   12.342  1.00 55.18 ? 17 ARG A CZ  1 
ATOM 128  N NH1 . ARG A 1 37 ? 3.848  4.540   12.196  1.00 54.69 ? 17 ARG A NH1 1 
ATOM 129  N NH2 . ARG A 1 37 ? 5.663  4.167   13.549  1.00 55.57 ? 17 ARG A NH2 1 
ATOM 130  N N   . LEU A 1 38 ? 4.875  8.613   10.697  1.00 56.10 ? 18 LEU A N   1 
ATOM 131  C CA  . LEU A 1 38 ? 4.019  9.284   11.648  1.00 56.51 ? 18 LEU A CA  1 
ATOM 132  C C   . LEU A 1 38 ? 3.402  10.554  11.062  1.00 56.96 ? 18 LEU A C   1 
ATOM 133  O O   . LEU A 1 38 ? 2.184  10.730  11.154  1.00 57.30 ? 18 LEU A O   1 
ATOM 134  C CB  . LEU A 1 38 ? 4.776  9.578   12.928  1.00 56.26 ? 18 LEU A CB  1 
ATOM 135  C CG  . LEU A 1 38 ? 4.995  8.332   13.776  1.00 56.62 ? 18 LEU A CG  1 
ATOM 136  C CD1 . LEU A 1 38 ? 5.785  8.720   15.001  1.00 57.08 ? 18 LEU A CD1 1 
ATOM 137  C CD2 . LEU A 1 38 ? 3.672  7.664   14.175  1.00 55.89 ? 18 LEU A CD2 1 
ATOM 138  N N   . GLU A 1 39 ? 4.218  11.419  10.449  1.00 57.15 ? 19 GLU A N   1 
ATOM 139  C CA  . GLU A 1 39 ? 3.707  12.644  9.805   1.00 57.27 ? 19 GLU A CA  1 
ATOM 140  C C   . GLU A 1 39 ? 2.609  12.333  8.798   1.00 56.89 ? 19 GLU A C   1 
ATOM 141  O O   . GLU A 1 39 ? 1.712  13.136  8.598   1.00 56.95 ? 19 GLU A O   1 
ATOM 142  C CB  . GLU A 1 39 ? 4.819  13.404  9.090   1.00 57.22 ? 19 GLU A CB  1 
ATOM 143  C CG  . GLU A 1 39 ? 5.671  14.287  9.986   1.00 58.08 ? 19 GLU A CG  1 
ATOM 144  C CD  . GLU A 1 39 ? 6.704  15.093  9.207   1.00 58.17 ? 19 GLU A CD  1 
ATOM 145  O OE1 . GLU A 1 39 ? 6.717  15.008  7.953   1.00 58.86 ? 19 GLU A OE1 1 
ATOM 146  O OE2 . GLU A 1 39 ? 7.500  15.817  9.851   1.00 59.24 ? 19 GLU A OE2 1 
ATOM 147  N N   . LYS A 1 40 ? 2.690  11.151  8.193   1.00 56.54 ? 20 LYS A N   1 
ATOM 148  C CA  . LYS A 1 40 ? 1.789  10.722  7.140   1.00 56.27 ? 20 LYS A CA  1 
ATOM 149  C C   . LYS A 1 40 ? 0.529  10.032  7.661   1.00 55.95 ? 20 LYS A C   1 
ATOM 150  O O   . LYS A 1 40 ? -0.210 9.414   6.900   1.00 55.64 ? 20 LYS A O   1 
ATOM 151  C CB  . LYS A 1 40 ? 2.538  9.798   6.172   1.00 56.65 ? 20 LYS A CB  1 
ATOM 152  C CG  . LYS A 1 40 ? 3.180  10.479  4.950   1.00 57.33 ? 20 LYS A CG  1 
ATOM 153  C CD  . LYS A 1 40 ? 2.094  10.858  3.937   1.00 60.08 ? 20 LYS A CD  1 
ATOM 154  C CE  . LYS A 1 40 ? 2.588  10.912  2.502   1.00 60.06 ? 20 LYS A CE  1 
ATOM 155  N NZ  . LYS A 1 40 ? 1.371  10.890  1.618   1.00 60.68 ? 20 LYS A NZ  1 
ATOM 156  N N   . GLY A 1 41 ? 0.274  10.148  8.957   1.00 55.99 ? 21 GLY A N   1 
ATOM 157  C CA  . GLY A 1 41 ? -0.929 9.569   9.560   1.00 56.27 ? 21 GLY A CA  1 
ATOM 158  C C   . GLY A 1 41 ? -0.985 8.124   9.150   1.00 56.35 ? 21 GLY A C   1 
ATOM 159  O O   . GLY A 1 41 ? -2.041 7.562   8.865   1.00 56.56 ? 21 GLY A O   1 
ATOM 160  N N   . MET A 1 42 ? 0.194  7.538   9.107   1.00 56.61 ? 22 MET A N   1 
ATOM 161  C CA  . MET A 1 42 ? 0.380  6.220   8.571   1.00 56.98 ? 22 MET A CA  1 
ATOM 162  C C   . MET A 1 42 ? 0.767  5.320   9.720   1.00 57.38 ? 22 MET A C   1 
ATOM 163  O O   . MET A 1 42 ? 1.427  5.773   10.662  1.00 57.83 ? 22 MET A O   1 
ATOM 164  C CB  . MET A 1 42 ? 1.503  6.269   7.534   1.00 56.56 ? 22 MET A CB  1 
ATOM 165  C CG  . MET A 1 42 ? 1.277  5.369   6.347   1.00 56.48 ? 22 MET A CG  1 
ATOM 166  S SD  . MET A 1 42 ? 2.271  5.772   4.887   1.00 57.33 ? 22 MET A SD  1 
ATOM 167  C CE  . MET A 1 42 ? 1.462  7.256   4.332   1.00 57.89 ? 22 MET A CE  1 
ATOM 168  N N   . THR A 1 43 ? 0.358  4.055   9.657   1.00 57.59 ? 23 THR A N   1 
ATOM 169  C CA  . THR A 1 43 ? 0.844  3.045   10.616  1.00 57.87 ? 23 THR A CA  1 
ATOM 170  C C   . THR A 1 43 ? 1.919  2.122   9.996   1.00 57.98 ? 23 THR A C   1 
ATOM 171  O O   . THR A 1 43 ? 2.329  2.330   8.859   1.00 58.40 ? 23 THR A O   1 
ATOM 172  C CB  . THR A 1 43 ? -0.301 2.209   11.171  1.00 57.83 ? 23 THR A CB  1 
ATOM 173  O OG1 . THR A 1 43 ? -0.826 1.394   10.119  1.00 57.95 ? 23 THR A OG1 1 
ATOM 174  C CG2 . THR A 1 43 ? -1.408 3.114   11.761  1.00 57.83 ? 23 THR A CG2 1 
ATOM 175  N N   . GLN A 1 44 ? 2.377  1.109   10.731  1.00 58.02 ? 24 GLN A N   1 
ATOM 176  C CA  . GLN A 1 44 ? 3.470  0.247   10.241  1.00 57.92 ? 24 GLN A CA  1 
ATOM 177  C C   . GLN A 1 44 ? 3.033  -0.719  9.143   1.00 58.24 ? 24 GLN A C   1 
ATOM 178  O O   . GLN A 1 44 ? 3.660  -0.782  8.085   1.00 58.14 ? 24 GLN A O   1 
ATOM 179  C CB  . GLN A 1 44 ? 4.166  -0.482  11.395  1.00 57.72 ? 24 GLN A CB  1 
ATOM 180  C CG  . GLN A 1 44 ? 5.140  0.423   12.188  1.00 57.27 ? 24 GLN A CG  1 
ATOM 181  C CD  . GLN A 1 44 ? 5.824  -0.314  13.309  1.00 57.44 ? 24 GLN A CD  1 
ATOM 182  O OE1 . GLN A 1 44 ? 5.293  -1.296  13.816  1.00 57.23 ? 24 GLN A OE1 1 
ATOM 183  N NE2 . GLN A 1 44 ? 7.006  0.145   13.700  1.00 57.40 ? 24 GLN A NE2 1 
ATOM 184  N N   . GLU A 1 45 ? 1.948  -1.449  9.405   1.00 58.58 ? 25 GLU A N   1 
ATOM 185  C CA  . GLU A 1 45 ? 1.308  -2.347  8.426   1.00 58.95 ? 25 GLU A CA  1 
ATOM 186  C C   . GLU A 1 45 ? 0.723  -1.592  7.215   1.00 58.82 ? 25 GLU A C   1 
ATOM 187  O O   . GLU A 1 45 ? 0.549  -2.172  6.131   1.00 58.79 ? 25 GLU A O   1 
ATOM 188  C CB  . GLU A 1 45 ? 0.252  -3.242  9.097   1.00 58.86 ? 25 GLU A CB  1 
ATOM 189  C CG  . GLU A 1 45 ? -0.516 -2.595  10.281  1.00 60.37 ? 25 GLU A CG  1 
ATOM 190  C CD  . GLU A 1 45 ? 0.346  -2.344  11.545  1.00 62.46 ? 25 GLU A CD  1 
ATOM 191  O OE1 . GLU A 1 45 ? 0.883  -3.318  12.135  1.00 63.31 ? 25 GLU A OE1 1 
ATOM 192  O OE2 . GLU A 1 45 ? 0.474  -1.162  11.961  1.00 62.79 ? 25 GLU A OE2 1 
ATOM 193  N N   . ASP A 1 46 ? 0.421  -0.306  7.427   1.00 58.62 ? 26 ASP A N   1 
ATOM 194  C CA  . ASP A 1 46 ? 0.124  0.651   6.357   1.00 58.52 ? 26 ASP A CA  1 
ATOM 195  C C   . ASP A 1 46 ? 1.318  0.740   5.414   1.00 58.28 ? 26 ASP A C   1 
ATOM 196  O O   . ASP A 1 46 ? 1.215  0.470   4.211   1.00 58.25 ? 26 ASP A O   1 
ATOM 197  C CB  . ASP A 1 46 ? -0.114 2.052   6.950   1.00 58.62 ? 26 ASP A CB  1 
ATOM 198  C CG  . ASP A 1 46 ? -1.578 2.380   7.157   1.00 59.13 ? 26 ASP A CG  1 
ATOM 199  O OD1 . ASP A 1 46 ? -2.407 1.509   6.892   1.00 60.59 ? 26 ASP A OD1 1 
ATOM 200  O OD2 . ASP A 1 46 ? -1.908 3.512   7.589   1.00 58.89 ? 26 ASP A OD2 1 
ATOM 201  N N   . LEU A 1 47 ? 2.457  1.114   5.987   1.00 58.04 ? 27 LEU A N   1 
ATOM 202  C CA  . LEU A 1 47 ? 3.680  1.297   5.224   1.00 58.06 ? 27 LEU A CA  1 
ATOM 203  C C   . LEU A 1 47 ? 4.190  -0.030  4.664   1.00 58.16 ? 27 LEU A C   1 
ATOM 204  O O   . LEU A 1 47 ? 4.808  -0.056  3.600   1.00 58.46 ? 27 LEU A O   1 
ATOM 205  C CB  . LEU A 1 47 ? 4.752  2.024   6.051   1.00 57.43 ? 27 LEU A CB  1 
ATOM 206  C CG  . LEU A 1 47 ? 6.122  2.251   5.376   1.00 57.64 ? 27 LEU A CG  1 
ATOM 207  C CD1 . LEU A 1 47 ? 6.096  2.880   3.969   1.00 56.09 ? 27 LEU A CD1 1 
ATOM 208  C CD2 . LEU A 1 47 ? 7.063  3.053   6.277   1.00 58.10 ? 27 LEU A CD2 1 
ATOM 209  N N   . ALA A 1 48 ? 3.910  -1.128  5.367   1.00 58.24 ? 28 ALA A N   1 
ATOM 210  C CA  . ALA A 1 48 ? 4.263  -2.457  4.880   1.00 58.05 ? 28 ALA A CA  1 
ATOM 211  C C   . ALA A 1 48 ? 3.488  -2.694  3.606   1.00 58.12 ? 28 ALA A C   1 
ATOM 212  O O   . ALA A 1 48 ? 3.972  -3.322  2.670   1.00 58.08 ? 28 ALA A O   1 
ATOM 213  C CB  . ALA A 1 48 ? 3.914  -3.496  5.905   1.00 57.88 ? 28 ALA A CB  1 
ATOM 214  N N   . TYR A 1 49 ? 2.280  -2.145  3.572   1.00 58.50 ? 29 TYR A N   1 
ATOM 215  C CA  . TYR A 1 49 ? 1.350  -2.424  2.496   1.00 58.51 ? 29 TYR A CA  1 
ATOM 216  C C   . TYR A 1 49 ? 1.611  -1.606  1.263   1.00 58.57 ? 29 TYR A C   1 
ATOM 217  O O   . TYR A 1 49 ? 1.543  -2.136  0.163   1.00 58.71 ? 29 TYR A O   1 
ATOM 218  C CB  . TYR A 1 49 ? -0.061 -2.142  2.923   1.00 58.46 ? 29 TYR A CB  1 
ATOM 219  C CG  . TYR A 1 49 ? -0.953 -2.135  1.729   1.00 59.14 ? 29 TYR A CG  1 
ATOM 220  C CD1 . TYR A 1 49 ? -1.339 -3.342  1.131   1.00 59.73 ? 29 TYR A CD1 1 
ATOM 221  C CD2 . TYR A 1 49 ? -1.403 -0.929  1.165   1.00 59.86 ? 29 TYR A CD2 1 
ATOM 222  C CE1 . TYR A 1 49 ? -2.183 -3.365  0.009   1.00 59.40 ? 29 TYR A CE1 1 
ATOM 223  C CE2 . TYR A 1 49 ? -2.247 -0.929  0.030   1.00 60.28 ? 29 TYR A CE2 1 
ATOM 224  C CZ  . TYR A 1 49 ? -2.627 -2.159  -0.539  1.00 59.69 ? 29 TYR A CZ  1 
ATOM 225  O OH  . TYR A 1 49 ? -3.425 -2.185  -1.655  1.00 58.89 ? 29 TYR A OH  1 
ATOM 226  N N   . LYS A 1 50 ? 1.835  -0.302  1.456   1.00 58.58 ? 30 LYS A N   1 
ATOM 227  C CA  . LYS A 1 50 ? 2.139  0.628   0.367   1.00 58.35 ? 30 LYS A CA  1 
ATOM 228  C C   . LYS A 1 50 ? 3.529  0.384   -0.219  1.00 58.35 ? 30 LYS A C   1 
ATOM 229  O O   . LYS A 1 50 ? 3.737  0.572   -1.432  1.00 58.55 ? 30 LYS A O   1 
ATOM 230  C CB  . LYS A 1 50 ? 2.073  2.073   0.848   1.00 58.15 ? 30 LYS A CB  1 
ATOM 231  C CG  . LYS A 1 50 ? 0.689  2.628   0.988   1.00 59.25 ? 30 LYS A CG  1 
ATOM 232  C CD  . LYS A 1 50 ? 0.651  4.108   0.598   1.00 60.41 ? 30 LYS A CD  1 
ATOM 233  C CE  . LYS A 1 50 ? -0.289 4.365   -0.571  1.00 60.50 ? 30 LYS A CE  1 
ATOM 234  N NZ  . LYS A 1 50 ? -0.204 3.322   -1.626  1.00 60.99 ? 30 LYS A NZ  1 
ATOM 235  N N   . SER A 1 51 ? 4.464  -0.032  0.641   1.00 57.96 ? 31 SER A N   1 
ATOM 236  C CA  . SER A 1 51 ? 5.874  -0.201  0.276   1.00 57.80 ? 31 SER A CA  1 
ATOM 237  C C   . SER A 1 51 ? 6.256  -1.634  -0.104  1.00 57.99 ? 31 SER A C   1 
ATOM 238  O O   . SER A 1 51 ? 7.410  -1.910  -0.436  1.00 58.05 ? 31 SER A O   1 
ATOM 239  C CB  . SER A 1 51 ? 6.770  0.216   1.441   1.00 57.71 ? 31 SER A CB  1 
ATOM 240  O OG  . SER A 1 51 ? 6.903  -0.875  2.336   1.00 56.40 ? 31 SER A OG  1 
ATOM 241  N N   . ASN A 1 52 ? 5.313  -2.560  -0.005  1.00 58.40 ? 32 ASN A N   1 
ATOM 242  C CA  . ASN A 1 52 ? 5.540  -3.936  -0.481  1.00 58.53 ? 32 ASN A CA  1 
ATOM 243  C C   . ASN A 1 52 ? 6.479  -4.765  0.382   1.00 58.18 ? 32 ASN A C   1 
ATOM 244  O O   . ASN A 1 52 ? 7.080  -5.711  -0.110  1.00 58.43 ? 32 ASN A O   1 
ATOM 245  C CB  . ASN A 1 52 ? 6.038  -3.940  -1.955  1.00 58.89 ? 32 ASN A CB  1 
ATOM 246  N N   . LEU A 1 53 ? 6.619  -4.412  1.653   1.00 57.65 ? 33 LEU A N   1 
ATOM 247  C CA  . LEU A 1 53 ? 7.333  -5.277  2.581   1.00 57.38 ? 33 LEU A CA  1 
ATOM 248  C C   . LEU A 1 53 ? 6.400  -5.900  3.644   1.00 57.52 ? 33 LEU A C   1 
ATOM 249  O O   . LEU A 1 53 ? 5.196  -5.601  3.685   1.00 57.19 ? 33 LEU A O   1 
ATOM 250  C CB  . LEU A 1 53 ? 8.512  -4.537  3.241   1.00 57.19 ? 33 LEU A CB  1 
ATOM 251  C CG  . LEU A 1 53 ? 9.843  -4.211  2.559   1.00 56.56 ? 33 LEU A CG  1 
ATOM 252  C CD1 . LEU A 1 53 ? 10.133 -5.183  1.437   1.00 55.78 ? 33 LEU A CD1 1 
ATOM 253  C CD2 . LEU A 1 53 ? 9.906  -2.753  2.066   1.00 56.06 ? 33 LEU A CD2 1 
ATOM 254  N N   . ASP A 1 54 ? 6.978  -6.774  4.478   1.00 57.68 ? 34 ASP A N   1 
ATOM 255  C CA  . ASP A 1 54 ? 6.311  -7.370  5.650   1.00 57.98 ? 34 ASP A CA  1 
ATOM 256  C C   . ASP A 1 54 ? 6.274  -6.430  6.870   1.00 58.05 ? 34 ASP A C   1 
ATOM 257  O O   . ASP A 1 54 ? 7.227  -5.707  7.128   1.00 58.09 ? 34 ASP A O   1 
ATOM 258  C CB  . ASP A 1 54 ? 7.000  -8.685  6.053   1.00 58.07 ? 34 ASP A CB  1 
ATOM 259  C CG  . ASP A 1 54 ? 6.419  -9.910  5.352   1.00 58.82 ? 34 ASP A CG  1 
ATOM 260  O OD1 . ASP A 1 54 ? 5.312  -9.829  4.767   1.00 59.82 ? 34 ASP A OD1 1 
ATOM 261  O OD2 . ASP A 1 54 ? 7.073  -10.977 5.400   1.00 59.20 ? 34 ASP A OD2 1 
ATOM 262  N N   . ALA A 1 55 ? 5.181  -6.467  7.631   1.00 58.22 ? 35 ALA A N   1 
ATOM 263  C CA  . ALA A 1 55 ? 5.020  -5.638  8.825   1.00 58.19 ? 35 ALA A CA  1 
ATOM 264  C C   . ALA A 1 55 ? 6.099  -5.949  9.845   1.00 58.72 ? 35 ALA A C   1 
ATOM 265  O O   . ALA A 1 55 ? 6.682  -5.013  10.430  1.00 58.95 ? 35 ALA A O   1 
ATOM 266  C CB  . ALA A 1 55 ? 3.676  -5.844  9.427   1.00 58.02 ? 35 ALA A CB  1 
ATOM 267  N N   . THR A 1 56 ? 6.353  -7.255  10.051  1.00 58.98 ? 36 THR A N   1 
ATOM 268  C CA  . THR A 1 56 ? 7.499  -7.771  10.841  1.00 59.00 ? 36 THR A CA  1 
ATOM 269  C C   . THR A 1 56 ? 8.764  -6.955  10.580  1.00 58.98 ? 36 THR A C   1 
ATOM 270  O O   . THR A 1 56 ? 9.430  -6.519  11.521  1.00 58.91 ? 36 THR A O   1 
ATOM 271  C CB  . THR A 1 56 ? 7.835  -9.259  10.490  1.00 59.14 ? 36 THR A CB  1 
ATOM 272  O OG1 . THR A 1 56 ? 7.236  -9.616  9.227   1.00 59.55 ? 36 THR A OG1 1 
ATOM 273  C CG2 . THR A 1 56 ? 7.362  -10.215 11.577  1.00 58.77 ? 36 THR A CG2 1 
ATOM 274  N N   . TYR A 1 57 ? 9.063  -6.769  9.289   1.00 59.16 ? 37 TYR A N   1 
ATOM 275  C CA  . TYR A 1 57 ? 10.221 -6.025  8.816   1.00 59.52 ? 37 TYR A CA  1 
ATOM 276  C C   . TYR A 1 57 ? 10.138 -4.538  9.165   1.00 59.53 ? 37 TYR A C   1 
ATOM 277  O O   . TYR A 1 57 ? 11.129 -3.956  9.595   1.00 60.49 ? 37 TYR A O   1 
ATOM 278  C CB  . TYR A 1 57 ? 10.439 -6.227  7.306   1.00 59.60 ? 37 TYR A CB  1 
ATOM 279  C CG  . TYR A 1 57 ? 11.846 -5.920  6.841   1.00 59.76 ? 37 TYR A CG  1 
ATOM 280  C CD1 . TYR A 1 57 ? 12.833 -6.892  6.874   1.00 60.58 ? 37 TYR A CD1 1 
ATOM 281  C CD2 . TYR A 1 57 ? 12.187 -4.659  6.364   1.00 59.95 ? 37 TYR A CD2 1 
ATOM 282  C CE1 . TYR A 1 57 ? 14.125 -6.617  6.454   1.00 60.96 ? 37 TYR A CE1 1 
ATOM 283  C CE2 . TYR A 1 57 ? 13.473 -4.369  5.931   1.00 59.85 ? 37 TYR A CE2 1 
ATOM 284  C CZ  . TYR A 1 57 ? 14.440 -5.353  5.985   1.00 60.94 ? 37 TYR A CZ  1 
ATOM 285  O OH  . TYR A 1 57 ? 15.729 -5.084  5.571   1.00 60.63 ? 37 TYR A OH  1 
ATOM 286  N N   . ILE A 1 58 ? 8.978  -3.921  9.005   1.00 58.93 ? 38 ILE A N   1 
ATOM 287  C CA  . ILE A 1 58 ? 8.852  -2.507  9.331   1.00 58.50 ? 38 ILE A CA  1 
ATOM 288  C C   . ILE A 1 58 ? 8.972  -2.210  10.838  1.00 58.55 ? 38 ILE A C   1 
ATOM 289  O O   . ILE A 1 58 ? 9.665  -1.271  11.228  1.00 59.00 ? 38 ILE A O   1 
ATOM 290  C CB  . ILE A 1 58 ? 7.574  -1.896  8.765   1.00 58.43 ? 38 ILE A CB  1 
ATOM 291  C CG1 . ILE A 1 58 ? 7.473  -2.153  7.265   1.00 57.61 ? 38 ILE A CG1 1 
ATOM 292  C CG2 . ILE A 1 58 ? 7.558  -0.401  9.024   1.00 58.67 ? 38 ILE A CG2 1 
ATOM 293  C CD1 . ILE A 1 58 ? 8.450  -1.354  6.457   1.00 56.42 ? 38 ILE A CD1 1 
ATOM 294  N N   . SER A 1 59 ? 8.316  -2.990  11.688  1.00 58.15 ? 39 SER A N   1 
ATOM 295  C CA  . SER A 1 59 ? 8.574  -2.864  13.125  1.00 58.26 ? 39 SER A CA  1 
ATOM 296  C C   . SER A 1 59 ? 10.053 -2.944  13.391  1.00 57.93 ? 39 SER A C   1 
ATOM 297  O O   . SER A 1 59 ? 10.620 -2.002  13.901  1.00 58.22 ? 39 SER A O   1 
ATOM 298  C CB  . SER A 1 59 ? 7.902  -3.969  13.916  1.00 58.36 ? 39 SER A CB  1 
ATOM 299  O OG  . SER A 1 59 ? 6.513  -3.942  13.662  1.00 60.08 ? 39 SER A OG  1 
ATOM 300  N N   . GLY A 1 60 ? 10.671 -4.062  13.017  1.00 57.60 ? 40 GLY A N   1 
ATOM 301  C CA  . GLY A 1 60 ? 12.092 -4.320  13.283  1.00 57.26 ? 40 GLY A CA  1 
ATOM 302  C C   . GLY A 1 60 ? 13.050 -3.200  12.939  1.00 56.90 ? 40 GLY A C   1 
ATOM 303  O O   . GLY A 1 60 ? 13.834 -2.748  13.785  1.00 56.45 ? 40 GLY A O   1 
ATOM 304  N N   . ILE A 1 61 ? 12.971 -2.773  11.682  1.00 57.00 ? 41 ILE A N   1 
ATOM 305  C CA  . ILE A 1 61 ? 13.636 -1.582  11.176  1.00 57.11 ? 41 ILE A CA  1 
ATOM 306  C C   . ILE A 1 61 ? 13.549 -0.376  12.149  1.00 57.47 ? 41 ILE A C   1 
ATOM 307  O O   . ILE A 1 61 ? 14.564 0.245   12.477  1.00 58.14 ? 41 ILE A O   1 
ATOM 308  C CB  . ILE A 1 61 ? 13.080 -1.245  9.776   1.00 56.72 ? 41 ILE A CB  1 
ATOM 309  C CG1 . ILE A 1 61 ? 13.948 -1.877  8.697   1.00 56.46 ? 41 ILE A CG1 1 
ATOM 310  C CG2 . ILE A 1 61 ? 12.962 0.249   9.548   1.00 57.10 ? 41 ILE A CG2 1 
ATOM 311  C CD1 . ILE A 1 61 ? 13.488 -1.533  7.283   1.00 56.56 ? 41 ILE A CD1 1 
ATOM 312  N N   . GLU A 1 62 ? 12.356 -0.071  12.636  1.00 57.49 ? 42 GLU A N   1 
ATOM 313  C CA  . GLU A 1 62 ? 12.162 1.097   13.485  1.00 57.82 ? 42 GLU A CA  1 
ATOM 314  C C   . GLU A 1 62 ? 12.670 0.998   14.947  1.00 58.15 ? 42 GLU A C   1 
ATOM 315  O O   . GLU A 1 62 ? 12.652 1.995   15.681  1.00 58.43 ? 42 GLU A O   1 
ATOM 316  C CB  . GLU A 1 62 ? 10.705 1.536   13.427  1.00 57.53 ? 42 GLU A CB  1 
ATOM 317  C CG  . GLU A 1 62 ? 10.341 1.966   12.029  1.00 58.54 ? 42 GLU A CG  1 
ATOM 318  C CD  . GLU A 1 62 ? 8.973  2.618   11.903  1.00 59.31 ? 42 GLU A CD  1 
ATOM 319  O OE1 . GLU A 1 62 ? 8.531  2.763   10.749  1.00 60.26 ? 42 GLU A OE1 1 
ATOM 320  O OE2 . GLU A 1 62 ? 8.334  2.984   12.919  1.00 59.88 ? 42 GLU A OE2 1 
ATOM 321  N N   . ARG A 1 63 ? 13.118 -0.182  15.375  1.00 58.14 ? 43 ARG A N   1 
ATOM 322  C CA  . ARG A 1 63 ? 13.646 -0.330  16.716  1.00 58.23 ? 43 ARG A CA  1 
ATOM 323  C C   . ARG A 1 63 ? 15.124 -0.576  16.556  1.00 59.05 ? 43 ARG A C   1 
ATOM 324  O O   . ARG A 1 63 ? 15.789 -1.004  17.469  1.00 58.89 ? 43 ARG A O   1 
ATOM 325  C CB  . ARG A 1 63 ? 12.970 -1.476  17.430  1.00 57.89 ? 43 ARG A CB  1 
ATOM 326  C CG  . ARG A 1 63 ? 11.484 -1.421  17.335  1.00 58.10 ? 43 ARG A CG  1 
ATOM 327  C CD  . ARG A 1 63 ? 10.821 -2.612  17.988  1.00 58.22 ? 43 ARG A CD  1 
ATOM 328  N NE  . ARG A 1 63 ? 11.265 -3.902  17.466  1.00 56.99 ? 43 ARG A NE  1 
ATOM 329  C CZ  . ARG A 1 63 ? 12.026 -4.755  18.141  1.00 56.46 ? 43 ARG A CZ  1 
ATOM 330  N NH1 . ARG A 1 63 ? 12.447 -4.463  19.355  1.00 56.51 ? 43 ARG A NH1 1 
ATOM 331  N NH2 . ARG A 1 63 ? 12.373 -5.905  17.602  1.00 56.51 ? 43 ARG A NH2 1 
ATOM 332  N N   . ASN A 1 64 ? 15.656 -0.203  15.384  1.00 59.99 ? 44 ASN A N   1 
ATOM 333  C CA  . ASN A 1 64 ? 17.061 -0.488  14.996  1.00 60.54 ? 44 ASN A CA  1 
ATOM 334  C C   . ASN A 1 64 ? 17.364 -1.917  15.301  1.00 60.73 ? 44 ASN A C   1 
ATOM 335  O O   . ASN A 1 64 ? 18.340 -2.220  15.980  1.00 61.06 ? 44 ASN A O   1 
ATOM 336  C CB  . ASN A 1 64 ? 18.087 0.380   15.729  1.00 60.39 ? 44 ASN A CB  1 
ATOM 337  C CG  . ASN A 1 64 ? 17.815 1.857   15.591  1.00 61.36 ? 44 ASN A CG  1 
ATOM 338  O OD1 . ASN A 1 64 ? 18.070 2.620   16.527  1.00 61.79 ? 44 ASN A OD1 1 
ATOM 339  N ND2 . ASN A 1 64 ? 17.292 2.278   14.431  1.00 61.32 ? 44 ASN A ND2 1 
ATOM 340  N N   . SER A 1 65 ? 16.486 -2.783  14.814  1.00 61.13 ? 45 SER A N   1 
ATOM 341  C CA  . SER A 1 65 ? 16.580 -4.212  15.020  1.00 61.16 ? 45 SER A CA  1 
ATOM 342  C C   . SER A 1 65 ? 16.490 -4.996  13.701  1.00 60.87 ? 45 SER A C   1 
ATOM 343  O O   . SER A 1 65 ? 16.292 -6.213  13.719  1.00 60.71 ? 45 SER A O   1 
ATOM 344  C CB  . SER A 1 65 ? 15.469 -4.641  15.961  1.00 61.37 ? 45 SER A CB  1 
ATOM 345  O OG  . SER A 1 65 ? 15.683 -5.970  16.398  1.00 63.26 ? 45 SER A OG  1 
ATOM 346  N N   . ARG A 1 66 ? 16.607 -4.288  12.567  1.00 60.64 ? 46 ARG A N   1 
ATOM 347  C CA  . ARG A 1 66 ? 16.730 -4.898  11.237  1.00 59.96 ? 46 ARG A CA  1 
ATOM 348  C C   . ARG A 1 66 ? 17.680 -4.103  10.355  1.00 59.72 ? 46 ARG A C   1 
ATOM 349  O O   . ARG A 1 66 ? 17.848 -2.898  10.508  1.00 59.41 ? 46 ARG A O   1 
ATOM 350  C CB  . ARG A 1 66 ? 15.376 -5.026  10.547  1.00 59.84 ? 46 ARG A CB  1 
ATOM 351  C CG  . ARG A 1 66 ? 14.480 -6.114  11.062  1.00 60.25 ? 46 ARG A CG  1 
ATOM 352  C CD  . ARG A 1 66 ? 14.865 -7.523  10.602  1.00 62.32 ? 46 ARG A CD  1 
ATOM 353  N NE  . ARG A 1 66 ? 13.731 -8.235  9.976   1.00 65.12 ? 46 ARG A NE  1 
ATOM 354  C CZ  . ARG A 1 66 ? 12.562 -8.554  10.564  1.00 65.28 ? 46 ARG A CZ  1 
ATOM 355  N NH1 . ARG A 1 66 ? 12.315 -8.237  11.839  1.00 64.54 ? 46 ARG A NH1 1 
ATOM 356  N NH2 . ARG A 1 66 ? 11.620 -9.194  9.862   1.00 64.44 ? 46 ARG A NH2 1 
ATOM 357  N N   . ASN A 1 67 ? 18.293 -4.804  9.417   1.00 60.19 ? 47 ASN A N   1 
ATOM 358  C CA  . ASN A 1 67 ? 19.240 -4.204  8.493   1.00 60.16 ? 47 ASN A CA  1 
ATOM 359  C C   . ASN A 1 67 ? 18.644 -4.033  7.106   1.00 59.88 ? 47 ASN A C   1 
ATOM 360  O O   . ASN A 1 67 ? 18.465 -5.001  6.365   1.00 60.16 ? 47 ASN A O   1 
ATOM 361  C CB  . ASN A 1 67 ? 20.498 -5.057  8.410   1.00 60.27 ? 47 ASN A CB  1 
ATOM 362  C CG  . ASN A 1 67 ? 21.687 -4.264  7.950   1.00 61.77 ? 47 ASN A CG  1 
ATOM 363  O OD1 . ASN A 1 67 ? 21.552 -3.077  7.576   1.00 62.32 ? 47 ASN A OD1 1 
ATOM 364  N ND2 . ASN A 1 67 ? 22.877 -4.899  7.970   1.00 62.42 ? 47 ASN A ND2 1 
ATOM 365  N N   . LEU A 1 68 ? 18.321 -2.803  6.747   1.00 59.43 ? 48 LEU A N   1 
ATOM 366  C CA  . LEU A 1 68 ? 17.714 -2.578  5.435   1.00 58.87 ? 48 LEU A CA  1 
ATOM 367  C C   . LEU A 1 68 ? 18.735 -2.233  4.363   1.00 58.20 ? 48 LEU A C   1 
ATOM 368  O O   . LEU A 1 68 ? 19.662 -1.461  4.599   1.00 57.94 ? 48 LEU A O   1 
ATOM 369  C CB  . LEU A 1 68 ? 16.572 -1.558  5.487   1.00 58.79 ? 48 LEU A CB  1 
ATOM 370  C CG  . LEU A 1 68 ? 16.910 -0.084  5.393   1.00 58.65 ? 48 LEU A CG  1 
ATOM 371  C CD1 . LEU A 1 68 ? 15.638 0.684   5.127   1.00 58.67 ? 48 LEU A CD1 1 
ATOM 372  C CD2 . LEU A 1 68 ? 17.546 0.394   6.676   1.00 58.54 ? 48 LEU A CD2 1 
ATOM 373  N N   . THR A 1 69 ? 18.540 -2.831  3.192   1.00 57.53 ? 49 THR A N   1 
ATOM 374  C CA  . THR A 1 69 ? 19.355 -2.570  2.027   1.00 56.99 ? 49 THR A CA  1 
ATOM 375  C C   . THR A 1 69 ? 18.845 -1.327  1.318   1.00 57.19 ? 49 THR A C   1 
ATOM 376  O O   . THR A 1 69 ? 17.731 -0.871  1.567   1.00 57.41 ? 49 THR A O   1 
ATOM 377  C CB  . THR A 1 69 ? 19.294 -3.749  1.044   1.00 56.74 ? 49 THR A CB  1 
ATOM 378  O OG1 . THR A 1 69 ? 18.210 -3.556  0.138   1.00 56.69 ? 49 THR A OG1 1 
ATOM 379  C CG2 . THR A 1 69 ? 19.098 -5.078  1.774   1.00 56.81 ? 49 THR A CG2 1 
ATOM 380  N N   . ILE A 1 70 ? 19.648 -0.793  0.405   1.00 57.48 ? 50 ILE A N   1 
ATOM 381  C CA  . ILE A 1 70 ? 19.256 0.382   -0.402  1.00 57.56 ? 50 ILE A CA  1 
ATOM 382  C C   . ILE A 1 70 ? 17.926 0.241   -1.181  1.00 57.68 ? 50 ILE A C   1 
ATOM 383  O O   . ILE A 1 70 ? 17.203 1.232   -1.372  1.00 58.25 ? 50 ILE A O   1 
ATOM 384  C CB  . ILE A 1 70 ? 20.408 0.835   -1.340  1.00 57.25 ? 50 ILE A CB  1 
ATOM 385  C CG1 . ILE A 1 70 ? 21.202 1.961   -0.677  1.00 57.85 ? 50 ILE A CG1 1 
ATOM 386  C CG2 . ILE A 1 70 ? 19.880 1.407   -2.600  1.00 56.77 ? 50 ILE A CG2 1 
ATOM 387  C CD1 . ILE A 1 70 ? 21.674 1.668   0.752   1.00 57.95 ? 50 ILE A CD1 1 
ATOM 388  N N   . LYS A 1 71 ? 17.620 -0.979  -1.628  1.00 57.17 ? 51 LYS A N   1 
ATOM 389  C CA  . LYS A 1 71 ? 16.344 -1.294  -2.273  1.00 56.56 ? 51 LYS A CA  1 
ATOM 390  C C   . LYS A 1 71 ? 15.160 -1.137  -1.290  1.00 56.40 ? 51 LYS A C   1 
ATOM 391  O O   . LYS A 1 71 ? 14.175 -0.429  -1.571  1.00 56.16 ? 51 LYS A O   1 
ATOM 392  C CB  . LYS A 1 71 ? 16.382 -2.733  -2.828  1.00 56.86 ? 51 LYS A CB  1 
ATOM 393  C CG  . LYS A 1 71 ? 17.635 -3.110  -3.645  1.00 56.11 ? 51 LYS A CG  1 
ATOM 394  C CD  . LYS A 1 71 ? 17.471 -2.815  -5.116  1.00 55.17 ? 51 LYS A CD  1 
ATOM 395  C CE  . LYS A 1 71 ? 18.301 -3.769  -5.934  1.00 56.35 ? 51 LYS A CE  1 
ATOM 396  N NZ  . LYS A 1 71 ? 17.925 -5.215  -5.775  1.00 57.26 ? 51 LYS A NZ  1 
ATOM 397  N N   . SER A 1 72 ? 15.275 -1.792  -0.133  1.00 55.51 ? 52 SER A N   1 
ATOM 398  C CA  . SER A 1 72 ? 14.221 -1.790  0.845   1.00 54.65 ? 52 SER A CA  1 
ATOM 399  C C   . SER A 1 72 ? 13.951 -0.380  1.208   1.00 54.63 ? 52 SER A C   1 
ATOM 400  O O   . SER A 1 72 ? 12.821 -0.046  1.467   1.00 54.91 ? 52 SER A O   1 
ATOM 401  C CB  . SER A 1 72 ? 14.648 -2.535  2.079   1.00 54.56 ? 52 SER A CB  1 
ATOM 402  O OG  . SER A 1 72 ? 15.104 -3.824  1.735   1.00 54.64 ? 52 SER A OG  1 
ATOM 403  N N   . LEU A 1 73 ? 14.998 0.443   1.217   1.00 54.89 ? 53 LEU A N   1 
ATOM 404  C CA  . LEU A 1 73 ? 14.899 1.876   1.532   1.00 54.98 ? 53 LEU A CA  1 
ATOM 405  C C   . LEU A 1 73 ? 14.130 2.658   0.444   1.00 55.49 ? 53 LEU A C   1 
ATOM 406  O O   . LEU A 1 73 ? 13.324 3.582   0.740   1.00 55.42 ? 53 LEU A O   1 
ATOM 407  C CB  . LEU A 1 73 ? 16.283 2.479   1.775   1.00 54.23 ? 53 LEU A CB  1 
ATOM 408  C CG  . LEU A 1 73 ? 16.162 3.936   2.193   1.00 54.34 ? 53 LEU A CG  1 
ATOM 409  C CD1 . LEU A 1 73 ? 15.197 4.169   3.336   1.00 53.50 ? 53 LEU A CD1 1 
ATOM 410  C CD2 . LEU A 1 73 ? 17.483 4.670   2.406   1.00 53.85 ? 53 LEU A CD2 1 
ATOM 411  N N   . GLU A 1 74 ? 14.379 2.279   -0.808  1.00 55.39 ? 54 GLU A N   1 
ATOM 412  C CA  . GLU A 1 74 ? 13.650 2.855   -1.918  1.00 55.70 ? 54 GLU A CA  1 
ATOM 413  C C   . GLU A 1 74 ? 12.176 2.369   -1.867  1.00 55.55 ? 54 GLU A C   1 
ATOM 414  O O   . GLU A 1 74 ? 11.240 3.181   -1.994  1.00 55.88 ? 54 GLU A O   1 
ATOM 415  C CB  . GLU A 1 74 ? 14.341 2.508   -3.243  1.00 55.69 ? 54 GLU A CB  1 
ATOM 416  C CG  . GLU A 1 74 ? 13.814 3.271   -4.474  1.00 56.49 ? 54 GLU A CG  1 
ATOM 417  C CD  . GLU A 1 74 ? 14.828 3.388   -5.654  1.00 56.95 ? 54 GLU A CD  1 
ATOM 418  O OE1 . GLU A 1 74 ? 14.659 4.343   -6.472  1.00 57.33 ? 54 GLU A OE1 1 
ATOM 419  O OE2 . GLU A 1 74 ? 15.764 2.537   -5.767  1.00 56.99 ? 54 GLU A OE2 1 
ATOM 420  N N   . LEU A 1 75 ? 11.970 1.060   -1.664  1.00 54.90 ? 55 LEU A N   1 
ATOM 421  C CA  . LEU A 1 75 ? 10.624 0.504   -1.545  1.00 53.73 ? 55 LEU A CA  1 
ATOM 422  C C   . LEU A 1 75 ? 9.922  1.330   -0.496  1.00 54.24 ? 55 LEU A C   1 
ATOM 423  O O   . LEU A 1 75 ? 8.814  1.828   -0.723  1.00 54.18 ? 55 LEU A O   1 
ATOM 424  C CB  . LEU A 1 75 ? 10.672 -0.949  -1.092  1.00 53.27 ? 55 LEU A CB  1 
ATOM 425  C CG  . LEU A 1 75 ? 10.297 -2.087  -2.007  1.00 50.94 ? 55 LEU A CG  1 
ATOM 426  C CD1 . LEU A 1 75 ? 10.807 -1.836  -3.359  1.00 50.73 ? 55 LEU A CD1 1 
ATOM 427  C CD2 . LEU A 1 75 ? 10.842 -3.355  -1.470  1.00 50.97 ? 55 LEU A CD2 1 
ATOM 428  N N   . ILE A 1 76 ? 10.598 1.519   0.636   1.00 54.52 ? 56 ILE A N   1 
ATOM 429  C CA  . ILE A 1 76 ? 10.032 2.258   1.760   1.00 55.31 ? 56 ILE A CA  1 
ATOM 430  C C   . ILE A 1 76 ? 9.686  3.712   1.363   1.00 56.44 ? 56 ILE A C   1 
ATOM 431  O O   . ILE A 1 76 ? 8.520  4.158   1.510   1.00 56.84 ? 56 ILE A O   1 
ATOM 432  C CB  . ILE A 1 76 ? 10.900 2.099   3.031   1.00 54.77 ? 56 ILE A CB  1 
ATOM 433  C CG1 . ILE A 1 76 ? 10.758 0.666   3.531   1.00 54.04 ? 56 ILE A CG1 1 
ATOM 434  C CG2 . ILE A 1 76 ? 10.464 3.015   4.119   1.00 54.39 ? 56 ILE A CG2 1 
ATOM 435  C CD1 . ILE A 1 76 ? 11.580 0.372   4.660   1.00 52.81 ? 56 ILE A CD1 1 
ATOM 436  N N   . MET A 1 77 ? 10.653 4.418   0.786   1.00 57.08 ? 57 MET A N   1 
ATOM 437  C CA  . MET A 1 77 ? 10.395 5.753   0.216   1.00 57.76 ? 57 MET A CA  1 
ATOM 438  C C   . MET A 1 77 ? 9.214  5.874   -0.781  1.00 56.68 ? 57 MET A C   1 
ATOM 439  O O   . MET A 1 77 ? 8.581  6.930   -0.858  1.00 56.39 ? 57 MET A O   1 
ATOM 440  C CB  . MET A 1 77 ? 11.655 6.267   -0.439  1.00 57.55 ? 57 MET A CB  1 
ATOM 441  C CG  . MET A 1 77 ? 12.594 6.906   0.502   1.00 58.33 ? 57 MET A CG  1 
ATOM 442  S SD  . MET A 1 77 ? 13.922 7.467   -0.565  1.00 61.44 ? 57 MET A SD  1 
ATOM 443  C CE  . MET A 1 77 ? 15.256 6.334   -0.179  1.00 61.55 ? 57 MET A CE  1 
ATOM 444  N N   . LYS A 1 78 ? 8.894  4.832   -1.502  1.00 56.27 ? 58 LYS A N   1 
ATOM 445  C CA  . LYS A 1 78 ? 7.688  4.926   -2.271  1.00 56.13 ? 58 LYS A CA  1 
ATOM 446  C C   . LYS A 1 78 ? 6.472  4.615   -1.413  1.00 56.42 ? 58 LYS A C   1 
ATOM 447  O O   . LYS A 1 78 ? 5.437  5.203   -1.595  1.00 56.98 ? 58 LYS A O   1 
ATOM 448  C CB  . LYS A 1 78 ? 7.774  4.155   -3.573  1.00 20.00 ? 58 LYS A CB  1 
ATOM 449  C CG  . LYS A 1 78 ? 7.567  2.700   -3.513  1.00 20.00 ? 58 LYS A CG  1 
ATOM 450  C CD  . LYS A 1 78 ? 6.941  2.235   -4.819  1.00 20.00 ? 58 LYS A CD  1 
ATOM 451  C CE  . LYS A 1 78 ? 7.323  0.816   -5.175  1.00 20.00 ? 58 LYS A CE  1 
ATOM 452  N NZ  . LYS A 1 78 ? 6.744  -0.190  -4.257  1.00 20.00 ? 58 LYS A NZ  1 
ATOM 453  N N   . GLY A 1 79 ? 6.599  3.757   -0.423  1.00 55.77 ? 59 GLY A N   1 
ATOM 454  C CA  . GLY A 1 79 ? 5.516  3.629   0.539   1.00 55.45 ? 59 GLY A CA  1 
ATOM 455  C C   . GLY A 1 79 ? 5.175  4.966   1.173   1.00 55.44 ? 59 GLY A C   1 
ATOM 456  O O   . GLY A 1 79 ? 3.997  5.334   1.314   1.00 55.70 ? 59 GLY A O   1 
ATOM 457  N N   . LEU A 1 80 ? 6.221  5.706   1.528   1.00 55.36 ? 60 LEU A N   1 
ATOM 458  C CA  . LEU A 1 80 ? 6.081  6.992   2.214   1.00 55.48 ? 60 LEU A CA  1 
ATOM 459  C C   . LEU A 1 80 ? 5.571  8.134   1.330   1.00 55.63 ? 60 LEU A C   1 
ATOM 460  O O   . LEU A 1 80 ? 5.029  9.129   1.853   1.00 55.62 ? 60 LEU A O   1 
ATOM 461  C CB  . LEU A 1 80 ? 7.409  7.416   2.844   1.00 55.11 ? 60 LEU A CB  1 
ATOM 462  C CG  . LEU A 1 80 ? 8.045  6.759   4.072   1.00 54.56 ? 60 LEU A CG  1 
ATOM 463  C CD1 . LEU A 1 80 ? 9.427  7.325   4.176   1.00 54.72 ? 60 LEU A CD1 1 
ATOM 464  C CD2 . LEU A 1 80 ? 7.317  7.005   5.365   1.00 54.51 ? 60 LEU A CD2 1 
ATOM 465  N N   . GLU A 1 81 ? 5.763  7.994   0.015   1.00 55.65 ? 61 GLU A N   1 
ATOM 466  C CA  . GLU A 1 81 ? 5.389  9.033   -0.950  1.00 56.69 ? 61 GLU A CA  1 
ATOM 467  C C   . GLU A 1 81 ? 6.236  10.295  -0.754  1.00 55.94 ? 61 GLU A C   1 
ATOM 468  O O   . GLU A 1 81 ? 5.727  11.418  -0.842  1.00 55.80 ? 61 GLU A O   1 
ATOM 469  C CB  . GLU A 1 81 ? 3.886  9.412   -0.853  1.00 56.93 ? 61 GLU A CB  1 
ATOM 470  C CG  . GLU A 1 81 ? 2.870  8.496   -1.580  1.00 58.34 ? 61 GLU A CG  1 
ATOM 471  C CD  . GLU A 1 81 ? 1.390  8.780   -1.167  1.00 58.91 ? 61 GLU A CD  1 
ATOM 472  O OE1 . GLU A 1 81 ? 1.025  8.534   0.024   1.00 62.40 ? 61 GLU A OE1 1 
ATOM 473  O OE2 . GLU A 1 81 ? 0.587  9.233   -2.034  1.00 61.91 ? 61 GLU A OE2 1 
ATOM 474  N N   . VAL A 1 82 ? 7.519  10.106  -0.470  1.00 55.50 ? 62 VAL A N   1 
ATOM 475  C CA  . VAL A 1 82 ? 8.434  11.232  -0.231  1.00 55.31 ? 62 VAL A CA  1 
ATOM 476  C C   . VAL A 1 82 ? 9.618  11.163  -1.175  1.00 55.53 ? 62 VAL A C   1 
ATOM 477  O O   . VAL A 1 82 ? 10.205 10.103  -1.377  1.00 56.19 ? 62 VAL A O   1 
ATOM 478  C CB  . VAL A 1 82 ? 8.925  11.297  1.252   1.00 54.94 ? 62 VAL A CB  1 
ATOM 479  C CG1 . VAL A 1 82 ? 8.270  10.227  2.031   1.00 55.30 ? 62 VAL A CG1 1 
ATOM 480  C CG2 . VAL A 1 82 ? 10.410 11.123  1.378   1.00 53.47 ? 62 VAL A CG2 1 
ATOM 481  N N   . SER A 1 83 ? 9.983  12.298  -1.742  1.00 55.34 ? 63 SER A N   1 
ATOM 482  C CA  . SER A 1 83 ? 11.116 12.341  -2.626  1.00 55.50 ? 63 SER A CA  1 
ATOM 483  C C   . SER A 1 83 ? 12.406 12.003  -1.922  1.00 55.76 ? 63 SER A C   1 
ATOM 484  O O   . SER A 1 83 ? 12.484 11.902  -0.704  1.00 55.69 ? 63 SER A O   1 
ATOM 485  C CB  . SER A 1 83 ? 11.239 13.724  -3.251  1.00 55.74 ? 63 SER A CB  1 
ATOM 486  O OG  . SER A 1 83 ? 10.954 14.737  -2.308  1.00 56.31 ? 63 SER A OG  1 
ATOM 487  N N   . ASP A 1 84 ? 13.440 11.852  -2.717  1.00 56.40 ? 64 ASP A N   1 
ATOM 488  C CA  . ASP A 1 84 ? 14.755 11.570  -2.194  1.00 57.10 ? 64 ASP A CA  1 
ATOM 489  C C   . ASP A 1 84 ? 15.427 12.854  -1.651  1.00 56.95 ? 64 ASP A C   1 
ATOM 490  O O   . ASP A 1 84 ? 16.174 12.806  -0.665  1.00 57.22 ? 64 ASP A O   1 
ATOM 491  C CB  . ASP A 1 84 ? 15.591 10.897  -3.292  1.00 57.78 ? 64 ASP A CB  1 
ATOM 492  C CG  . ASP A 1 84 ? 14.783 9.856   -4.119  1.00 59.17 ? 64 ASP A CG  1 
ATOM 493  O OD1 . ASP A 1 84 ? 13.528 9.888   -4.109  1.00 60.23 ? 64 ASP A OD1 1 
ATOM 494  O OD2 . ASP A 1 84 ? 15.411 9.000   -4.787  1.00 61.23 ? 64 ASP A OD2 1 
ATOM 495  N N   . VAL A 1 85 ? 15.163 13.999  -2.280  1.00 56.45 ? 65 VAL A N   1 
ATOM 496  C CA  . VAL A 1 85 ? 15.652 15.264  -1.741  1.00 55.82 ? 65 VAL A CA  1 
ATOM 497  C C   . VAL A 1 85 ? 15.023 15.523  -0.370  1.00 55.83 ? 65 VAL A C   1 
ATOM 498  O O   . VAL A 1 85 ? 15.750 15.718  0.598   1.00 56.19 ? 65 VAL A O   1 
ATOM 499  C CB  . VAL A 1 85 ? 15.437 16.449  -2.688  1.00 55.82 ? 65 VAL A CB  1 
ATOM 500  C CG1 . VAL A 1 85 ? 15.897 17.742  -2.039  1.00 55.59 ? 65 VAL A CG1 1 
ATOM 501  C CG2 . VAL A 1 85 ? 16.184 16.230  -3.985  1.00 55.63 ? 65 VAL A CG2 1 
ATOM 502  N N   . VAL A 1 86 ? 13.696 15.473  -0.259  1.00 55.45 ? 66 VAL A N   1 
ATOM 503  C CA  . VAL A 1 86 ? 13.035 15.766  1.026   1.00 55.26 ? 66 VAL A CA  1 
ATOM 504  C C   . VAL A 1 86 ? 13.499 14.851  2.150   1.00 55.35 ? 66 VAL A C   1 
ATOM 505  O O   . VAL A 1 86 ? 13.793 15.309  3.254   1.00 55.50 ? 66 VAL A O   1 
ATOM 506  C CB  . VAL A 1 86 ? 11.499 15.741  0.901   1.00 55.07 ? 66 VAL A CB  1 
ATOM 507  C CG1 . VAL A 1 86 ? 10.813 15.499  2.249   1.00 54.40 ? 66 VAL A CG1 1 
ATOM 508  C CG2 . VAL A 1 86 ? 10.988 16.994  0.186   1.00 54.86 ? 66 VAL A CG2 1 
ATOM 509  N N   . PHE A 1 87 ? 13.584 13.562  1.849   1.00 55.55 ? 67 PHE A N   1 
ATOM 510  C CA  . PHE A 1 87 ? 14.026 12.555  2.823   1.00 55.65 ? 67 PHE A CA  1 
ATOM 511  C C   . PHE A 1 87 ? 15.399 12.871  3.391   1.00 55.72 ? 67 PHE A C   1 
ATOM 512  O O   . PHE A 1 87 ? 15.581 12.973  4.603   1.00 55.38 ? 67 PHE A O   1 
ATOM 513  C CB  . PHE A 1 87 ? 14.041 11.147  2.192   1.00 55.45 ? 67 PHE A CB  1 
ATOM 514  C CG  . PHE A 1 87 ? 14.395 10.066  3.157   1.00 55.27 ? 67 PHE A CG  1 
ATOM 515  C CD1 . PHE A 1 87 ? 13.405 9.393   3.865   1.00 54.83 ? 67 PHE A CD1 1 
ATOM 516  C CD2 . PHE A 1 87 ? 15.724 9.739   3.387   1.00 56.17 ? 67 PHE A CD2 1 
ATOM 517  C CE1 . PHE A 1 87 ? 13.739 8.401   4.783   1.00 54.91 ? 67 PHE A CE1 1 
ATOM 518  C CE2 . PHE A 1 87 ? 16.066 8.745   4.318   1.00 55.71 ? 67 PHE A CE2 1 
ATOM 519  C CZ  . PHE A 1 87 ? 15.069 8.077   5.007   1.00 55.11 ? 67 PHE A CZ  1 
ATOM 520  N N   . PHE A 1 88 ? 16.359 13.017  2.491   1.00 56.14 ? 68 PHE A N   1 
ATOM 521  C CA  . PHE A 1 88 ? 17.745 13.175  2.881   1.00 56.97 ? 68 PHE A CA  1 
ATOM 522  C C   . PHE A 1 88 ? 18.015 14.540  3.512   1.00 57.19 ? 68 PHE A C   1 
ATOM 523  O O   . PHE A 1 88 ? 18.932 14.677  4.328   1.00 57.17 ? 68 PHE A O   1 
ATOM 524  C CB  . PHE A 1 88 ? 18.683 12.898  1.698   1.00 57.16 ? 68 PHE A CB  1 
ATOM 525  C CG  . PHE A 1 88 ? 18.754 11.440  1.300   1.00 57.43 ? 68 PHE A CG  1 
ATOM 526  C CD1 . PHE A 1 88 ? 19.400 10.511  2.112   1.00 57.72 ? 68 PHE A CD1 1 
ATOM 527  C CD2 . PHE A 1 88 ? 18.183 11.003  0.113   1.00 57.22 ? 68 PHE A CD2 1 
ATOM 528  C CE1 . PHE A 1 88 ? 19.474 9.172   1.751   1.00 57.68 ? 68 PHE A CE1 1 
ATOM 529  C CE2 . PHE A 1 88 ? 18.239 9.664   -0.259  1.00 57.47 ? 68 PHE A CE2 1 
ATOM 530  C CZ  . PHE A 1 88 ? 18.891 8.747   0.565   1.00 58.18 ? 68 PHE A CZ  1 
ATOM 531  N N   . GLU A 1 89 ? 17.202 15.531  3.136   1.00 57.41 ? 69 GLU A N   1 
ATOM 532  C CA  . GLU A 1 89 ? 17.145 16.816  3.834   1.00 57.64 ? 69 GLU A CA  1 
ATOM 533  C C   . GLU A 1 89 ? 16.684 16.613  5.273   1.00 58.03 ? 69 GLU A C   1 
ATOM 534  O O   . GLU A 1 89 ? 17.188 17.265  6.185   1.00 58.17 ? 69 GLU A O   1 
ATOM 535  C CB  . GLU A 1 89 ? 16.173 17.769  3.153   1.00 57.46 ? 69 GLU A CB  1 
ATOM 536  C CG  . GLU A 1 89 ? 16.777 18.592  2.063   1.00 57.11 ? 69 GLU A CG  1 
ATOM 537  C CD  . GLU A 1 89 ? 15.789 19.585  1.526   1.00 56.94 ? 69 GLU A CD  1 
ATOM 538  O OE1 . GLU A 1 89 ? 16.211 20.488  0.766   1.00 57.29 ? 69 GLU A OE1 1 
ATOM 539  O OE2 . GLU A 1 89 ? 14.590 19.459  1.876   1.00 56.07 ? 69 GLU A OE2 1 
ATOM 540  N N   . MET A 1 90 ? 15.716 15.716  5.466   1.00 58.31 ? 70 MET A N   1 
ATOM 541  C CA  . MET A 1 90 ? 15.212 15.388  6.803   1.00 58.61 ? 70 MET A CA  1 
ATOM 542  C C   . MET A 1 90 ? 16.146 14.445  7.563   1.00 58.13 ? 70 MET A C   1 
ATOM 543  O O   . MET A 1 90 ? 16.033 14.318  8.774   1.00 58.49 ? 70 MET A O   1 
ATOM 544  C CB  . MET A 1 90 ? 13.814 14.779  6.718   1.00 58.76 ? 70 MET A CB  1 
ATOM 545  C CG  . MET A 1 90 ? 12.712 15.762  6.372   1.00 59.24 ? 70 MET A CG  1 
ATOM 546  S SD  . MET A 1 90 ? 11.146 14.886  6.188   1.00 59.86 ? 70 MET A SD  1 
ATOM 547  C CE  . MET A 1 90 ? 10.091 16.221  5.581   1.00 60.36 ? 70 MET A CE  1 
ATOM 548  N N   . LEU A 1 91 ? 17.057 13.794  6.844   1.00 57.53 ? 71 LEU A N   1 
ATOM 549  C CA  . LEU A 1 91 ? 18.051 12.902  7.428   1.00 56.83 ? 71 LEU A CA  1 
ATOM 550  C C   . LEU A 1 91 ? 19.183 13.699  8.083   1.00 56.55 ? 71 LEU A C   1 
ATOM 551  O O   . LEU A 1 91 ? 19.506 13.497  9.259   1.00 56.50 ? 71 LEU A O   1 
ATOM 552  C CB  . LEU A 1 91 ? 18.583 11.993  6.322   1.00 56.84 ? 71 LEU A CB  1 
ATOM 553  C CG  . LEU A 1 91 ? 19.524 10.801  6.494   1.00 56.38 ? 71 LEU A CG  1 
ATOM 554  C CD1 . LEU A 1 91 ? 20.911 11.187  6.893   1.00 56.27 ? 71 LEU A CD1 1 
ATOM 555  C CD2 . LEU A 1 91 ? 18.979 9.720   7.366   1.00 56.28 ? 71 LEU A CD2 1 
ATOM 556  N N   . ILE A 1 92 ? 19.774 14.606  7.307   1.00 56.17 ? 72 ILE A N   1 
ATOM 557  C CA  . ILE A 1 92 ? 20.809 15.535  7.779   1.00 55.73 ? 72 ILE A CA  1 
ATOM 558  C C   . ILE A 1 92 ? 20.373 16.323  9.015   1.00 55.82 ? 72 ILE A C   1 
ATOM 559  O O   . ILE A 1 92 ? 21.147 16.482  9.949   1.00 55.66 ? 72 ILE A O   1 
ATOM 560  C CB  . ILE A 1 92 ? 21.166 16.531  6.684   1.00 55.45 ? 72 ILE A CB  1 
ATOM 561  C CG1 . ILE A 1 92 ? 21.727 15.801  5.465   1.00 54.77 ? 72 ILE A CG1 1 
ATOM 562  C CG2 . ILE A 1 92 ? 22.143 17.555  7.207   1.00 55.65 ? 72 ILE A CG2 1 
ATOM 563  C CD1 . ILE A 1 92 ? 21.526 16.559  4.167   1.00 53.91 ? 72 ILE A CD1 1 
ATOM 564  N N   . LYS A 1 93 ? 19.133 16.819  8.992   1.00 56.24 ? 73 LYS A N   1 
ATOM 565  C CA  . LYS A 1 93 ? 18.484 17.501  10.132  1.00 56.43 ? 73 LYS A CA  1 
ATOM 566  C C   . LYS A 1 93 ? 18.483 16.671  11.409  1.00 56.30 ? 73 LYS A C   1 
ATOM 567  O O   . LYS A 1 93 ? 18.703 17.205  12.496  1.00 56.46 ? 73 LYS A O   1 
ATOM 568  C CB  . LYS A 1 93 ? 17.031 17.893  9.782   1.00 56.63 ? 73 LYS A CB  1 
ATOM 569  C CG  . LYS A 1 93 ? 16.179 18.491  10.949  1.00 56.77 ? 73 LYS A CG  1 
ATOM 570  C CD  . LYS A 1 93 ? 14.791 19.001  10.472  1.00 56.89 ? 73 LYS A CD  1 
ATOM 571  C CE  . LYS A 1 93 ? 13.987 19.667  11.600  1.00 56.87 ? 73 LYS A CE  1 
ATOM 572  N NZ  . LYS A 1 93 ? 12.935 20.598  11.076  1.00 57.24 ? 73 LYS A NZ  1 
ATOM 573  N N   . GLU A 1 94 ? 18.202 15.378  11.270  1.00 56.08 ? 74 GLU A N   1 
ATOM 574  C CA  . GLU A 1 94 ? 18.262 14.462  12.389  1.00 56.04 ? 74 GLU A CA  1 
ATOM 575  C C   . GLU A 1 94 ? 19.692 14.212  12.842  1.00 56.07 ? 74 GLU A C   1 
ATOM 576  O O   . GLU A 1 94 ? 19.963 14.134  14.055  1.00 56.36 ? 74 GLU A O   1 
ATOM 577  C CB  . GLU A 1 94 ? 17.529 13.168  12.078  1.00 55.98 ? 74 GLU A CB  1 
ATOM 578  C CG  . GLU A 1 94 ? 16.291 12.982  12.931  1.00 56.86 ? 74 GLU A CG  1 
ATOM 579  C CD  . GLU A 1 94 ? 15.695 14.288  13.442  1.00 57.96 ? 74 GLU A CD  1 
ATOM 580  O OE1 . GLU A 1 94 ? 15.584 14.434  14.677  1.00 58.35 ? 74 GLU A OE1 1 
ATOM 581  O OE2 . GLU A 1 94 ? 15.345 15.165  12.620  1.00 57.90 ? 74 GLU A OE2 1 
ATOM 582  N N   . ILE A 1 95 ? 20.614 14.129  11.883  1.00 55.71 ? 75 ILE A N   1 
ATOM 583  C CA  . ILE A 1 95 ? 22.052 14.149  12.197  1.00 55.33 ? 75 ILE A CA  1 
ATOM 584  C C   . ILE A 1 95 ? 22.418 15.420  13.006  1.00 55.39 ? 75 ILE A C   1 
ATOM 585  O O   . ILE A 1 95 ? 23.458 15.475  13.671  1.00 55.39 ? 75 ILE A O   1 
ATOM 586  C CB  . ILE A 1 95 ? 22.870 14.035  10.909  1.00 55.13 ? 75 ILE A CB  1 
ATOM 587  C CG1 . ILE A 1 95 ? 22.605 12.688  10.248  1.00 54.48 ? 75 ILE A CG1 1 
ATOM 588  C CG2 . ILE A 1 95 ? 24.348 14.214  11.174  1.00 55.41 ? 75 ILE A CG2 1 
ATOM 589  C CD1 . ILE A 1 95 ? 22.754 12.741  8.765   1.00 53.62 ? 75 ILE A CD1 1 
ATOM 590  N N   . LEU A 1 96 ? 21.662 16.481  12.844  1.00 56.29 ? 76 LEU A N   1 
ATOM 591  C CA  . LEU A 1 96 ? 22.099 17.703  13.450  1.00 56.06 ? 76 LEU A CA  1 
ATOM 592  C C   . LEU A 1 96 ? 21.444 17.753  14.776  1.00 56.11 ? 76 LEU A C   1 
ATOM 593  O O   . LEU A 1 96 ? 21.180 16.710  15.323  1.00 55.96 ? 76 LEU A O   1 
ATOM 594  C CB  . LEU A 1 96 ? 21.721 18.886  12.605  1.00 20.00 ? 76 LEU A CB  1 
ATOM 595  C CG  . LEU A 1 96 ? 22.989 19.365  11.952  1.00 20.00 ? 76 LEU A CG  1 
ATOM 596  C CD1 . LEU A 1 96 ? 23.944 18.248  12.055  1.00 20.00 ? 76 LEU A CD1 1 
ATOM 597  C CD2 . LEU A 1 96 ? 22.746 19.720  10.528  1.00 20.00 ? 76 LEU A CD2 1 
ATOM 598  N N   . SER B 1 23 ? 17.941 0.408   -9.803  1.00 56.23 ? 3  SER B N   1 
ATOM 599  C CA  . SER B 1 23 ? 17.497 1.377   -8.761  1.00 56.11 ? 3  SER B CA  1 
ATOM 600  C C   . SER B 1 23 ? 18.080 2.765   -8.945  1.00 56.20 ? 3  SER B C   1 
ATOM 601  O O   . SER B 1 23 ? 19.258 2.963   -8.700  1.00 55.95 ? 3  SER B O   1 
ATOM 602  C CB  . SER B 1 23 ? 17.877 0.866   -7.365  1.00 56.38 ? 3  SER B CB  1 
ATOM 603  O OG  . SER B 1 23 ? 18.155 1.940   -6.474  1.00 54.86 ? 3  SER B OG  1 
ATOM 604  N N   . PHE B 1 24 ? 17.252 3.733   -9.329  1.00 56.50 ? 4  PHE B N   1 
ATOM 605  C CA  . PHE B 1 24 ? 17.697 5.132   -9.448  1.00 56.97 ? 4  PHE B CA  1 
ATOM 606  C C   . PHE B 1 24 ? 18.499 5.597   -8.227  1.00 57.51 ? 4  PHE B C   1 
ATOM 607  O O   . PHE B 1 24 ? 19.468 6.360   -8.369  1.00 57.68 ? 4  PHE B O   1 
ATOM 608  C CB  . PHE B 1 24 ? 16.504 6.073   -9.693  1.00 56.76 ? 4  PHE B CB  1 
ATOM 609  C CG  . PHE B 1 24 ? 16.848 7.558   -9.633  1.00 56.79 ? 4  PHE B CG  1 
ATOM 610  C CD1 . PHE B 1 24 ? 17.441 8.200   -10.716 1.00 56.95 ? 4  PHE B CD1 1 
ATOM 611  C CD2 . PHE B 1 24 ? 16.555 8.321   -8.493  1.00 56.73 ? 4  PHE B CD2 1 
ATOM 612  C CE1 . PHE B 1 24 ? 17.751 9.576   -10.663 1.00 56.85 ? 4  PHE B CE1 1 
ATOM 613  C CE2 . PHE B 1 24 ? 16.867 9.696   -8.430  1.00 55.97 ? 4  PHE B CE2 1 
ATOM 614  C CZ  . PHE B 1 24 ? 17.462 10.318  -9.517  1.00 56.46 ? 4  PHE B CZ  1 
ATOM 615  N N   . LEU B 1 25 ? 18.094 5.147   -7.033  1.00 58.10 ? 5  LEU B N   1 
ATOM 616  C CA  . LEU B 1 25 ? 18.766 5.563   -5.790  1.00 58.45 ? 5  LEU B CA  1 
ATOM 617  C C   . LEU B 1 25 ? 20.197 5.030   -5.782  1.00 58.75 ? 5  LEU B C   1 
ATOM 618  O O   . LEU B 1 25 ? 21.138 5.829   -5.867  1.00 59.44 ? 5  LEU B O   1 
ATOM 619  C CB  . LEU B 1 25 ? 17.989 5.161   -4.522  1.00 58.36 ? 5  LEU B CB  1 
ATOM 620  C CG  . LEU B 1 25 ? 18.459 5.949   -3.293  1.00 57.59 ? 5  LEU B CG  1 
ATOM 621  C CD1 . LEU B 1 25 ? 18.157 7.458   -3.382  1.00 56.50 ? 5  LEU B CD1 1 
ATOM 622  C CD2 . LEU B 1 25 ? 18.039 5.326   -1.960  1.00 56.56 ? 5  LEU B CD2 1 
ATOM 623  N N   . LEU B 1 26 ? 20.355 3.703   -5.734  1.00 58.34 ? 6  LEU B N   1 
ATOM 624  C CA  . LEU B 1 26 ? 21.654 3.074   -5.956  1.00 58.02 ? 6  LEU B CA  1 
ATOM 625  C C   . LEU B 1 26 ? 22.538 3.899   -6.909  1.00 58.04 ? 6  LEU B C   1 
ATOM 626  O O   . LEU B 1 26 ? 23.676 4.248   -6.579  1.00 58.12 ? 6  LEU B O   1 
ATOM 627  C CB  . LEU B 1 26 ? 21.465 1.678   -6.543  1.00 58.09 ? 6  LEU B CB  1 
ATOM 628  C CG  . LEU B 1 26 ? 21.455 0.443   -5.649  1.00 57.66 ? 6  LEU B CG  1 
ATOM 629  C CD1 . LEU B 1 26 ? 21.164 -0.843  -6.442  1.00 56.09 ? 6  LEU B CD1 1 
ATOM 630  C CD2 . LEU B 1 26 ? 22.706 0.328   -4.756  1.00 57.06 ? 6  LEU B CD2 1 
ATOM 631  N N   . SER B 1 27 ? 21.990 4.225   -8.077  1.00 57.80 ? 7  SER B N   1 
ATOM 632  C CA  . SER B 1 27 ? 22.714 4.970   -9.090  1.00 57.93 ? 7  SER B CA  1 
ATOM 633  C C   . SER B 1 27 ? 23.353 6.204   -8.503  1.00 57.76 ? 7  SER B C   1 
ATOM 634  O O   . SER B 1 27 ? 24.550 6.397   -8.647  1.00 57.90 ? 7  SER B O   1 
ATOM 635  C CB  . SER B 1 27 ? 21.812 5.321   -10.294 1.00 58.36 ? 7  SER B CB  1 
ATOM 636  O OG  . SER B 1 27 ? 21.632 6.722   -10.492 1.00 58.79 ? 7  SER B OG  1 
ATOM 637  N N   . LYS B 1 28 ? 22.565 7.028   -7.822  1.00 57.84 ? 8  LYS B N   1 
ATOM 638  C CA  . LYS B 1 28 ? 23.092 8.296   -7.259  1.00 58.02 ? 8  LYS B CA  1 
ATOM 639  C C   . LYS B 1 28 ? 23.922 8.228   -5.957  1.00 57.85 ? 8  LYS B C   1 
ATOM 640  O O   . LYS B 1 28 ? 24.808 9.055   -5.759  1.00 57.84 ? 8  LYS B O   1 
ATOM 641  C CB  . LYS B 1 28 ? 22.006 9.379   -7.173  1.00 57.92 ? 8  LYS B CB  1 
ATOM 642  C CG  . LYS B 1 28 ? 22.265 10.529  -8.145  1.00 57.75 ? 8  LYS B CG  1 
ATOM 643  C CD  . LYS B 1 28 ? 21.016 10.909  -8.909  1.00 58.26 ? 8  LYS B CD  1 
ATOM 644  C CE  . LYS B 1 28 ? 21.354 11.231  -10.360 1.00 58.63 ? 8  LYS B CE  1 
ATOM 645  N NZ  . LYS B 1 28 ? 21.826 10.015  -11.091 1.00 59.73 ? 8  LYS B NZ  1 
ATOM 646  N N   . VAL B 1 29 ? 23.627 7.254   -5.088  1.00 57.71 ? 9  VAL B N   1 
ATOM 647  C CA  . VAL B 1 29 ? 24.484 6.940   -3.939  1.00 57.34 ? 9  VAL B CA  1 
ATOM 648  C C   . VAL B 1 29 ? 25.841 6.496   -4.504  1.00 57.57 ? 9  VAL B C   1 
ATOM 649  O O   . VAL B 1 29 ? 26.865 7.158   -4.289  1.00 57.45 ? 9  VAL B O   1 
ATOM 650  C CB  . VAL B 1 29 ? 23.853 5.857   -2.983  1.00 57.05 ? 9  VAL B CB  1 
ATOM 651  C CG1 . VAL B 1 29 ? 24.900 5.247   -2.057  1.00 56.34 ? 9  VAL B CG1 1 
ATOM 652  C CG2 . VAL B 1 29 ? 22.734 6.451   -2.165  1.00 56.38 ? 9  VAL B CG2 1 
ATOM 653  N N   . SER B 1 30 ? 25.826 5.403   -5.268  1.00 57.58 ? 10 SER B N   1 
ATOM 654  C CA  . SER B 1 30 ? 27.036 4.857   -5.845  1.00 57.73 ? 10 SER B CA  1 
ATOM 655  C C   . SER B 1 30 ? 27.899 5.949   -6.491  1.00 57.48 ? 10 SER B C   1 
ATOM 656  O O   . SER B 1 30 ? 29.127 5.989   -6.299  1.00 57.28 ? 10 SER B O   1 
ATOM 657  C CB  . SER B 1 30 ? 26.688 3.770   -6.859  1.00 57.67 ? 10 SER B CB  1 
ATOM 658  O OG  . SER B 1 30 ? 27.611 3.811   -7.944  1.00 59.29 ? 10 SER B OG  1 
ATOM 659  N N   . PHE B 1 31 ? 27.241 6.830   -7.241  1.00 57.44 ? 11 PHE B N   1 
ATOM 660  C CA  . PHE B 1 31 ? 27.930 7.911   -7.942  1.00 57.64 ? 11 PHE B CA  1 
ATOM 661  C C   . PHE B 1 31 ? 28.644 8.906   -7.002  1.00 57.32 ? 11 PHE B C   1 
ATOM 662  O O   . PHE B 1 31 ? 29.799 9.293   -7.267  1.00 57.48 ? 11 PHE B O   1 
ATOM 663  C CB  . PHE B 1 31 ? 27.001 8.652   -8.921  1.00 57.80 ? 11 PHE B CB  1 
ATOM 664  C CG  . PHE B 1 31 ? 27.714 9.687   -9.743  1.00 58.32 ? 11 PHE B CG  1 
ATOM 665  C CD1 . PHE B 1 31 ? 28.484 9.304   -10.847 1.00 59.50 ? 11 PHE B CD1 1 
ATOM 666  C CD2 . PHE B 1 31 ? 27.660 11.042  -9.392  1.00 58.19 ? 11 PHE B CD2 1 
ATOM 667  C CE1 . PHE B 1 31 ? 29.187 10.267  -11.608 1.00 59.82 ? 11 PHE B CE1 1 
ATOM 668  C CE2 . PHE B 1 31 ? 28.351 12.013  -10.142 1.00 58.43 ? 11 PHE B CE2 1 
ATOM 669  C CZ  . PHE B 1 31 ? 29.117 11.624  -11.253 1.00 59.05 ? 11 PHE B CZ  1 
ATOM 670  N N   . VAL B 1 32 ? 27.975 9.324   -5.925  1.00 56.57 ? 12 VAL B N   1 
ATOM 671  C CA  . VAL B 1 32 ? 28.608 10.241  -4.970  1.00 56.09 ? 12 VAL B CA  1 
ATOM 672  C C   . VAL B 1 32 ? 29.790 9.554   -4.254  1.00 56.02 ? 12 VAL B C   1 
ATOM 673  O O   . VAL B 1 32 ? 30.783 10.216  -3.942  1.00 56.50 ? 12 VAL B O   1 
ATOM 674  C CB  . VAL B 1 32 ? 27.599 10.886  -3.971  1.00 55.93 ? 12 VAL B CB  1 
ATOM 675  C CG1 . VAL B 1 32 ? 28.234 12.058  -3.261  1.00 55.57 ? 12 VAL B CG1 1 
ATOM 676  C CG2 . VAL B 1 32 ? 26.349 11.374  -4.703  1.00 55.77 ? 12 VAL B CG2 1 
ATOM 677  N N   . ILE B 1 33 ? 29.687 8.235   -4.039  1.00 55.29 ? 13 ILE B N   1 
ATOM 678  C CA  . ILE B 1 33 ? 30.780 7.408   -3.529  1.00 54.53 ? 13 ILE B CA  1 
ATOM 679  C C   . ILE B 1 33 ? 32.047 7.524   -4.386  1.00 54.79 ? 13 ILE B C   1 
ATOM 680  O O   . ILE B 1 33 ? 33.122 7.910   -3.885  1.00 54.53 ? 13 ILE B O   1 
ATOM 681  C CB  . ILE B 1 33 ? 30.328 5.934   -3.402  1.00 54.62 ? 13 ILE B CB  1 
ATOM 682  C CG1 . ILE B 1 33 ? 29.654 5.711   -2.038  1.00 54.62 ? 13 ILE B CG1 1 
ATOM 683  C CG2 . ILE B 1 33 ? 31.490 4.981   -3.584  1.00 54.30 ? 13 ILE B CG2 1 
ATOM 684  C CD1 . ILE B 1 33 ? 29.202 4.304   -1.758  1.00 53.90 ? 13 ILE B CD1 1 
ATOM 685  N N   . LYS B 1 34 ? 31.903 7.205   -5.678  1.00 54.91 ? 14 LYS B N   1 
ATOM 686  C CA  . LYS B 1 34 ? 32.998 7.287   -6.664  1.00 54.73 ? 14 LYS B CA  1 
ATOM 687  C C   . LYS B 1 34 ? 33.599 8.673   -6.664  1.00 54.86 ? 14 LYS B C   1 
ATOM 688  O O   . LYS B 1 34 ? 34.805 8.793   -6.540  1.00 55.03 ? 14 LYS B O   1 
ATOM 689  C CB  . LYS B 1 34 ? 32.505 6.927   -8.079  1.00 54.51 ? 14 LYS B CB  1 
ATOM 690  C CG  . LYS B 1 34 ? 33.597 6.773   -9.125  1.00 53.65 ? 14 LYS B CG  1 
ATOM 691  C CD  . LYS B 1 34 ? 33.105 5.925   -10.307 1.00 53.55 ? 14 LYS B CD  1 
ATOM 692  C CE  . LYS B 1 34 ? 34.207 5.636   -11.362 1.00 54.16 ? 14 LYS B CE  1 
ATOM 693  N NZ  . LYS B 1 34 ? 34.399 6.679   -12.452 1.00 54.32 ? 14 LYS B NZ  1 
ATOM 694  N N   . LYS B 1 35 ? 32.741 9.699   -6.784  1.00 55.09 ? 15 LYS B N   1 
ATOM 695  C CA  . LYS B 1 35 ? 33.125 11.129  -6.839  1.00 55.25 ? 15 LYS B CA  1 
ATOM 696  C C   . LYS B 1 35 ? 34.097 11.538  -5.743  1.00 55.13 ? 15 LYS B C   1 
ATOM 697  O O   . LYS B 1 35 ? 35.177 12.063  -6.024  1.00 54.83 ? 15 LYS B O   1 
ATOM 698  C CB  . LYS B 1 35 ? 31.887 12.037  -6.752  1.00 55.12 ? 15 LYS B CB  1 
ATOM 699  C CG  . LYS B 1 35 ? 32.244 13.525  -6.582  1.00 55.68 ? 15 LYS B CG  1 
ATOM 700  C CD  . LYS B 1 35 ? 31.038 14.431  -6.445  1.00 55.55 ? 15 LYS B CD  1 
ATOM 701  C CE  . LYS B 1 35 ? 30.600 14.954  -7.802  1.00 55.69 ? 15 LYS B CE  1 
ATOM 702  N NZ  . LYS B 1 35 ? 29.213 15.511  -7.778  1.00 56.02 ? 15 LYS B NZ  1 
ATOM 703  N N   . ILE B 1 36 ? 33.675 11.293  -4.503  1.00 55.22 ? 16 ILE B N   1 
ATOM 704  C CA  . ILE B 1 36 ? 34.447 11.591  -3.309  1.00 55.21 ? 16 ILE B CA  1 
ATOM 705  C C   . ILE B 1 36 ? 35.713 10.698  -3.225  1.00 55.57 ? 16 ILE B C   1 
ATOM 706  O O   . ILE B 1 36 ? 36.827 11.210  -2.985  1.00 55.24 ? 16 ILE B O   1 
ATOM 707  C CB  . ILE B 1 36 ? 33.565 11.491  -2.025  1.00 55.20 ? 16 ILE B CB  1 
ATOM 708  C CG1 . ILE B 1 36 ? 32.156 12.032  -2.291  1.00 54.84 ? 16 ILE B CG1 1 
ATOM 709  C CG2 . ILE B 1 36 ? 34.208 12.278  -0.876  1.00 55.11 ? 16 ILE B CG2 1 
ATOM 710  C CD1 . ILE B 1 36 ? 31.234 12.030  -1.097  1.00 54.73 ? 16 ILE B CD1 1 
ATOM 711  N N   . ARG B 1 37 ? 35.543 9.383   -3.446  1.00 55.78 ? 17 ARG B N   1 
ATOM 712  C CA  . ARG B 1 37 ? 36.690 8.447   -3.606  1.00 55.85 ? 17 ARG B CA  1 
ATOM 713  C C   . ARG B 1 37 ? 37.767 8.990   -4.589  1.00 55.87 ? 17 ARG B C   1 
ATOM 714  O O   . ARG B 1 37 ? 38.973 8.942   -4.319  1.00 55.34 ? 17 ARG B O   1 
ATOM 715  C CB  . ARG B 1 37 ? 36.200 7.056   -4.050  1.00 55.63 ? 17 ARG B CB  1 
ATOM 716  C CG  . ARG B 1 37 ? 37.315 6.075   -4.287  1.00 55.25 ? 17 ARG B CG  1 
ATOM 717  C CD  . ARG B 1 37 ? 36.797 4.731   -4.708  1.00 55.23 ? 17 ARG B CD  1 
ATOM 718  N NE  . ARG B 1 37 ? 36.307 4.719   -6.077  1.00 54.55 ? 17 ARG B NE  1 
ATOM 719  C CZ  . ARG B 1 37 ? 37.065 4.934   -7.142  1.00 54.90 ? 17 ARG B CZ  1 
ATOM 720  N NH1 . ARG B 1 37 ? 38.356 5.222   -7.026  1.00 54.75 ? 17 ARG B NH1 1 
ATOM 721  N NH2 . ARG B 1 37 ? 36.524 4.878   -8.338  1.00 55.43 ? 17 ARG B NH2 1 
ATOM 722  N N   . LEU B 1 38 ? 37.294 9.502   -5.723  1.00 56.07 ? 18 LEU B N   1 
ATOM 723  C CA  . LEU B 1 38 ? 38.129 10.160  -6.709  1.00 56.48 ? 18 LEU B CA  1 
ATOM 724  C C   . LEU B 1 38 ? 38.689 11.477  -6.184  1.00 56.91 ? 18 LEU B C   1 
ATOM 725  O O   . LEU B 1 38 ? 39.897 11.715  -6.292  1.00 56.99 ? 18 LEU B O   1 
ATOM 726  C CB  . LEU B 1 38 ? 37.348 10.399  -8.006  1.00 56.32 ? 18 LEU B CB  1 
ATOM 727  C CG  . LEU B 1 38 ? 37.100 9.138   -8.825  1.00 56.52 ? 18 LEU B CG  1 
ATOM 728  C CD1 . LEU B 1 38 ? 36.231 9.439   -10.044 1.00 57.05 ? 18 LEU B CD1 1 
ATOM 729  C CD2 . LEU B 1 38 ? 38.412 8.479   -9.211  1.00 55.68 ? 18 LEU B CD2 1 
ATOM 730  N N   . GLU B 1 39 ? 37.818 12.331  -5.627  1.00 57.20 ? 19 GLU B N   1 
ATOM 731  C CA  . GLU B 1 39 ? 38.244 13.612  -5.032  1.00 57.30 ? 19 GLU B CA  1 
ATOM 732  C C   . GLU B 1 39 ? 39.344 13.354  -4.023  1.00 57.03 ? 19 GLU B C   1 
ATOM 733  O O   . GLU B 1 39 ? 40.296 14.138  -3.912  1.00 56.98 ? 19 GLU B O   1 
ATOM 734  C CB  . GLU B 1 39 ? 37.091 14.316  -4.313  1.00 57.30 ? 19 GLU B CB  1 
ATOM 735  C CG  . GLU B 1 39 ? 36.195 15.167  -5.199  1.00 58.02 ? 19 GLU B CG  1 
ATOM 736  C CD  . GLU B 1 39 ? 35.062 15.840  -4.416  1.00 58.04 ? 19 GLU B CD  1 
ATOM 737  O OE1 . GLU B 1 39 ? 34.972 15.652  -3.177  1.00 58.56 ? 19 GLU B OE1 1 
ATOM 738  O OE2 . GLU B 1 39 ? 34.255 16.559  -5.051  1.00 59.17 ? 19 GLU B OE2 1 
ATOM 739  N N   . LYS B 1 40 ? 39.204 12.233  -3.311  1.00 56.74 ? 20 LYS B N   1 
ATOM 740  C CA  . LYS B 1 40 ? 40.110 11.837  -2.236  1.00 56.46 ? 20 LYS B CA  1 
ATOM 741  C C   . LYS B 1 40 ? 41.445 11.209  -2.697  1.00 56.07 ? 20 LYS B C   1 
ATOM 742  O O   . LYS B 1 40 ? 42.182 10.642  -1.892  1.00 55.66 ? 20 LYS B O   1 
ATOM 743  C CB  . LYS B 1 40 ? 39.357 10.914  -1.261  1.00 56.75 ? 20 LYS B CB  1 
ATOM 744  C CG  . LYS B 1 40 ? 38.710 11.625  -0.052  1.00 57.26 ? 20 LYS B CG  1 
ATOM 745  C CD  . LYS B 1 40 ? 39.798 12.016  0.952   1.00 60.08 ? 20 LYS B CD  1 
ATOM 746  C CE  . LYS B 1 40 ? 39.319 12.178  2.398   1.00 59.90 ? 20 LYS B CE  1 
ATOM 747  N NZ  . LYS B 1 40 ? 40.529 12.161  3.321   1.00 60.58 ? 20 LYS B NZ  1 
ATOM 748  N N   . GLY B 1 41 ? 41.763 11.335  -3.982  1.00 56.10 ? 21 GLY B N   1 
ATOM 749  C CA  . GLY B 1 41 ? 42.964 10.714  -4.537  1.00 56.30 ? 21 GLY B CA  1 
ATOM 750  C C   . GLY B 1 41 ? 43.020 9.251   -4.140  1.00 56.44 ? 21 GLY B C   1 
ATOM 751  O O   . GLY B 1 41 ? 44.093 8.690   -3.938  1.00 56.67 ? 21 GLY B O   1 
ATOM 752  N N   . MET B 1 42 ? 41.842 8.643   -4.037  1.00 56.62 ? 22 MET B N   1 
ATOM 753  C CA  . MET B 1 42 ? 41.692 7.313   -3.505  1.00 56.84 ? 22 MET B CA  1 
ATOM 754  C C   . MET B 1 42 ? 41.311 6.357   -4.624  1.00 57.19 ? 22 MET B C   1 
ATOM 755  O O   . MET B 1 42 ? 40.575 6.744   -5.534  1.00 57.34 ? 22 MET B O   1 
ATOM 756  C CB  . MET B 1 42 ? 40.602 7.343   -2.440  1.00 56.61 ? 22 MET B CB  1 
ATOM 757  C CG  . MET B 1 42 ? 40.880 6.451   -1.249  1.00 56.45 ? 22 MET B CG  1 
ATOM 758  S SD  . MET B 1 42 ? 39.977 6.826   0.268   1.00 57.01 ? 22 MET B SD  1 
ATOM 759  C CE  . MET B 1 42 ? 40.660 8.376   0.797   1.00 57.79 ? 22 MET B CE  1 
ATOM 760  N N   . THR B 1 43 ? 41.828 5.125   -4.563  1.00 57.49 ? 23 THR B N   1 
ATOM 761  C CA  . THR B 1 43 ? 41.425 4.046   -5.484  1.00 57.73 ? 23 THR B CA  1 
ATOM 762  C C   . THR B 1 43 ? 40.465 3.104   -4.766  1.00 57.82 ? 23 THR B C   1 
ATOM 763  O O   . THR B 1 43 ? 40.156 3.325   -3.599  1.00 58.11 ? 23 THR B O   1 
ATOM 764  C CB  . THR B 1 43 ? 42.620 3.232   -6.010  1.00 57.77 ? 23 THR B CB  1 
ATOM 765  O OG1 . THR B 1 43 ? 43.171 2.459   -4.939  1.00 58.05 ? 23 THR B OG1 1 
ATOM 766  C CG2 . THR B 1 43 ? 43.700 4.136   -6.616  1.00 57.67 ? 23 THR B CG2 1 
ATOM 767  N N   . GLN B 1 44 ? 39.995 2.058   -5.449  1.00 57.99 ? 24 GLN B N   1 
ATOM 768  C CA  . GLN B 1 44 ? 38.910 1.203   -4.903  1.00 57.96 ? 24 GLN B CA  1 
ATOM 769  C C   . GLN B 1 44 ? 39.383 0.288   -3.776  1.00 58.32 ? 24 GLN B C   1 
ATOM 770  O O   . GLN B 1 44 ? 38.739 0.196   -2.727  1.00 58.25 ? 24 GLN B O   1 
ATOM 771  C CB  . GLN B 1 44 ? 38.229 0.376   -6.004  1.00 57.80 ? 24 GLN B CB  1 
ATOM 772  C CG  . GLN B 1 44 ? 37.203 1.153   -6.817  1.00 57.21 ? 24 GLN B CG  1 
ATOM 773  C CD  . GLN B 1 44 ? 36.618 0.351   -7.978  1.00 57.43 ? 24 GLN B CD  1 
ATOM 774  O OE1 . GLN B 1 44 ? 37.246 -0.564  -8.516  1.00 57.11 ? 24 GLN B OE1 1 
ATOM 775  N NE2 . GLN B 1 44 ? 35.410 0.709   -8.378  1.00 57.45 ? 24 GLN B NE2 1 
ATOM 776  N N   . GLU B 1 45 ? 40.512 -0.382  -4.006  1.00 58.64 ? 25 GLU B N   1 
ATOM 777  C CA  . GLU B 1 45 ? 41.143 -1.254  -3.007  1.00 58.93 ? 25 GLU B CA  1 
ATOM 778  C C   . GLU B 1 45 ? 41.624 -0.456  -1.798  1.00 58.79 ? 25 GLU B C   1 
ATOM 779  O O   . GLU B 1 45 ? 41.641 -0.986  -0.677  1.00 58.72 ? 25 GLU B O   1 
ATOM 780  C CB  . GLU B 1 45 ? 42.284 -2.080  -3.630  1.00 58.94 ? 25 GLU B CB  1 
ATOM 781  C CG  . GLU B 1 45 ? 42.991 -1.425  -4.821  1.00 60.26 ? 25 GLU B CG  1 
ATOM 782  C CD  . GLU B 1 45 ? 42.045 -1.204  -6.008  1.00 62.36 ? 25 GLU B CD  1 
ATOM 783  O OE1 . GLU B 1 45 ? 41.504 -2.208  -6.543  1.00 63.36 ? 25 GLU B OE1 1 
ATOM 784  O OE2 . GLU B 1 45 ? 41.824 -0.024  -6.387  1.00 62.45 ? 25 GLU B OE2 1 
ATOM 785  N N   . ASP B 1 46 ? 42.015 0.802   -2.055  1.00 58.60 ? 26 ASP B N   1 
ATOM 786  C CA  . ASP B 1 46 ? 42.262 1.825   -1.026  1.00 58.49 ? 26 ASP B CA  1 
ATOM 787  C C   . ASP B 1 46 ? 41.046 1.918   -0.087  1.00 58.23 ? 26 ASP B C   1 
ATOM 788  O O   . ASP B 1 46 ? 41.160 1.736   1.131   1.00 58.08 ? 26 ASP B O   1 
ATOM 789  C CB  . ASP B 1 46 ? 42.518 3.212   -1.676  1.00 58.71 ? 26 ASP B CB  1 
ATOM 790  C CG  . ASP B 1 46 ? 44.032 3.526   -1.953  1.00 59.28 ? 26 ASP B CG  1 
ATOM 791  O OD1 . ASP B 1 46 ? 44.917 2.677   -1.683  1.00 60.66 ? 26 ASP B OD1 1 
ATOM 792  O OD2 . ASP B 1 46 ? 44.339 4.648   -2.453  1.00 58.79 ? 26 ASP B OD2 1 
ATOM 793  N N   . LEU B 1 47 ? 39.882 2.195   -0.671  1.00 57.99 ? 27 LEU B N   1 
ATOM 794  C CA  . LEU B 1 47 ? 38.635 2.364   0.095   1.00 58.08 ? 27 LEU B CA  1 
ATOM 795  C C   . LEU B 1 47 ? 38.111 1.057   0.686   1.00 58.13 ? 27 LEU B C   1 
ATOM 796  O O   . LEU B 1 47 ? 37.480 1.072   1.748   1.00 58.25 ? 27 LEU B O   1 
ATOM 797  C CB  . LEU B 1 47 ? 37.541 3.060   -0.742  1.00 57.76 ? 27 LEU B CB  1 
ATOM 798  C CG  . LEU B 1 47 ? 36.180 3.322   -0.088  1.00 57.55 ? 27 LEU B CG  1 
ATOM 799  C CD1 . LEU B 1 47 ? 36.309 4.094   1.215   1.00 55.90 ? 27 LEU B CD1 1 
ATOM 800  C CD2 . LEU B 1 47 ? 35.267 4.040   -1.059  1.00 57.92 ? 27 LEU B CD2 1 
ATOM 801  N N   . ALA B 1 48 ? 38.370 -0.053  -0.012  1.00 58.13 ? 28 ALA B N   1 
ATOM 802  C CA  . ALA B 1 48 ? 38.122 -1.390  0.512   1.00 58.03 ? 28 ALA B CA  1 
ATOM 803  C C   . ALA B 1 48 ? 38.942 -1.590  1.779   1.00 58.19 ? 28 ALA B C   1 
ATOM 804  O O   . ALA B 1 48 ? 38.491 -2.230  2.730   1.00 57.98 ? 28 ALA B O   1 
ATOM 805  C CB  . ALA B 1 48 ? 38.501 -2.426  -0.516  1.00 57.94 ? 28 ALA B CB  1 
ATOM 806  N N   . TYR B 1 49 ? 40.153 -1.027  1.776   1.00 58.54 ? 29 TYR B N   1 
ATOM 807  C CA  . TYR B 1 49 ? 41.070 -1.183  2.886   1.00 58.56 ? 29 TYR B CA  1 
ATOM 808  C C   . TYR B 1 49 ? 40.677 -0.313  4.080   1.00 58.54 ? 29 TYR B C   1 
ATOM 809  O O   . TYR B 1 49 ? 40.553 -0.827  5.192   1.00 58.68 ? 29 TYR B O   1 
ATOM 810  C CB  . TYR B 1 49 ? 42.517 -0.900  2.468   1.00 58.68 ? 29 TYR B CB  1 
ATOM 811  C CG  . TYR B 1 49 ? 43.401 -0.846  3.672   1.00 59.13 ? 29 TYR B CG  1 
ATOM 812  C CD1 . TYR B 1 49 ? 43.843 -2.022  4.278   1.00 59.49 ? 29 TYR B CD1 1 
ATOM 813  C CD2 . TYR B 1 49 ? 43.730 0.366   4.254   1.00 59.72 ? 29 TYR B CD2 1 
ATOM 814  C CE1 . TYR B 1 49 ? 44.611 -2.000  5.404   1.00 59.08 ? 29 TYR B CE1 1 
ATOM 815  C CE2 . TYR B 1 49 ? 44.494 0.399   5.385   1.00 60.33 ? 29 TYR B CE2 1 
ATOM 816  C CZ  . TYR B 1 49 ? 44.939 -0.795  5.960   1.00 59.57 ? 29 TYR B CZ  1 
ATOM 817  O OH  . TYR B 1 49 ? 45.721 -0.787  7.095   1.00 59.10 ? 29 TYR B OH  1 
ATOM 818  N N   . LYS B 1 50 ? 40.504 0.992   3.845   1.00 58.43 ? 30 LYS B N   1 
ATOM 819  C CA  . LYS B 1 50 ? 40.184 1.948   4.910   1.00 58.34 ? 30 LYS B CA  1 
ATOM 820  C C   . LYS B 1 50 ? 38.816 1.692   5.509   1.00 58.27 ? 30 LYS B C   1 
ATOM 821  O O   . LYS B 1 50 ? 38.656 1.787   6.725   1.00 58.36 ? 30 LYS B O   1 
ATOM 822  C CB  . LYS B 1 50 ? 40.232 3.390   4.412   1.00 58.30 ? 30 LYS B CB  1 
ATOM 823  C CG  . LYS B 1 50 ? 41.611 3.959   4.217   1.00 59.20 ? 30 LYS B CG  1 
ATOM 824  C CD  . LYS B 1 50 ? 41.621 5.453   4.545   1.00 60.56 ? 30 LYS B CD  1 
ATOM 825  C CE  . LYS B 1 50 ? 42.564 5.772   5.726   1.00 60.70 ? 30 LYS B CE  1 
ATOM 826  N NZ  . LYS B 1 50 ? 42.415 4.846   6.891   1.00 60.91 ? 30 LYS B NZ  1 
ATOM 827  N N   . SER B 1 51 ? 37.841 1.385   4.646   1.00 58.17 ? 31 SER B N   1 
ATOM 828  C CA  . SER B 1 51 ? 36.451 1.113   5.052   1.00 57.83 ? 31 SER B CA  1 
ATOM 829  C C   . SER B 1 51 ? 36.230 -0.330  5.530   1.00 57.96 ? 31 SER B C   1 
ATOM 830  O O   . SER B 1 51 ? 35.133 -0.680  5.968   1.00 58.12 ? 31 SER B O   1 
ATOM 831  C CB  . SER B 1 51 ? 35.494 1.428   3.900   1.00 57.66 ? 31 SER B CB  1 
ATOM 832  O OG  . SER B 1 51 ? 35.374 0.330   3.014   1.00 56.54 ? 31 SER B OG  1 
ATOM 833  N N   . ASN B 1 52 ? 37.278 -1.148  5.434   1.00 58.00 ? 32 ASN B N   1 
ATOM 834  C CA  . ASN B 1 52 ? 37.239 -2.575  5.795   1.00 58.12 ? 32 ASN B CA  1 
ATOM 835  C C   . ASN B 1 52 ? 36.255 -3.514  5.058   1.00 57.73 ? 32 ASN B C   1 
ATOM 836  O O   . ASN B 1 52 ? 35.796 -4.501  5.626   1.00 57.60 ? 32 ASN B O   1 
ATOM 837  C CB  . ASN B 1 52 ? 37.173 -2.766  7.315   1.00 58.27 ? 32 ASN B CB  1 
ATOM 838  C CG  . ASN B 1 52 ? 38.373 -3.537  7.854   1.00 59.78 ? 32 ASN B CG  1 
ATOM 839  O OD1 . ASN B 1 52 ? 39.542 -3.163  7.641   1.00 61.85 ? 32 ASN B OD1 1 
ATOM 840  N ND2 . ASN B 1 52 ? 38.090 -4.633  8.548   1.00 61.02 ? 32 ASN B ND2 1 
ATOM 841  N N   . LEU B 1 53 ? 35.967 -3.218  3.794   1.00 57.47 ? 33 LEU B N   1 
ATOM 842  C CA  . LEU B 1 53 ? 35.288 -4.167  2.916   1.00 57.32 ? 33 LEU B CA  1 
ATOM 843  C C   . LEU B 1 53 ? 36.232 -4.849  1.881   1.00 57.65 ? 33 LEU B C   1 
ATOM 844  O O   . LEU B 1 53 ? 37.456 -4.574  1.826   1.00 57.37 ? 33 LEU B O   1 
ATOM 845  C CB  . LEU B 1 53 ? 34.104 -3.492  2.205   1.00 57.14 ? 33 LEU B CB  1 
ATOM 846  C CG  . LEU B 1 53 ? 32.731 -3.233  2.867   1.00 56.65 ? 33 LEU B CG  1 
ATOM 847  C CD1 . LEU B 1 53 ? 32.418 -4.233  3.984   1.00 56.01 ? 33 LEU B CD1 1 
ATOM 848  C CD2 . LEU B 1 53 ? 32.561 -1.794  3.363   1.00 55.98 ? 33 LEU B CD2 1 
ATOM 849  N N   . ASP B 1 54 ? 35.643 -5.744  1.075   1.00 57.87 ? 34 ASP B N   1 
ATOM 850  C CA  . ASP B 1 54 ? 36.310 -6.391  -0.071  1.00 58.14 ? 34 ASP B CA  1 
ATOM 851  C C   . ASP B 1 54 ? 36.284 -5.560  -1.355  1.00 58.28 ? 34 ASP B C   1 
ATOM 852  O O   . ASP B 1 54 ? 35.216 -5.043  -1.746  1.00 58.00 ? 34 ASP B O   1 
ATOM 853  C CB  . ASP B 1 54 ? 35.669 -7.745  -0.376  1.00 58.10 ? 34 ASP B CB  1 
ATOM 854  C CG  . ASP B 1 54 ? 36.351 -8.885  0.343   1.00 58.77 ? 34 ASP B CG  1 
ATOM 855  O OD1 . ASP B 1 54 ? 37.451 -8.666  0.905   1.00 59.68 ? 34 ASP B OD1 1 
ATOM 856  O OD2 . ASP B 1 54 ? 35.786 -10.006 0.335   1.00 59.13 ? 34 ASP B OD2 1 
ATOM 857  N N   . ALA B 1 55 ? 37.457 -5.469  -2.011  1.00 58.44 ? 35 ALA B N   1 
ATOM 858  C CA  . ALA B 1 55 ? 37.613 -4.782  -3.303  1.00 58.32 ? 35 ALA B CA  1 
ATOM 859  C C   . ALA B 1 55 ? 36.473 -5.170  -4.252  1.00 58.67 ? 35 ALA B C   1 
ATOM 860  O O   . ALA B 1 55 ? 35.790 -4.295  -4.790  1.00 58.75 ? 35 ALA B O   1 
ATOM 861  C CB  . ALA B 1 55 ? 38.965 -5.091  -3.916  1.00 57.87 ? 35 ALA B CB  1 
ATOM 862  N N   . THR B 1 56 ? 36.257 -6.485  -4.399  1.00 58.99 ? 36 THR B N   1 
ATOM 863  C CA  . THR B 1 56 ? 35.160 -7.083  -5.195  1.00 58.90 ? 36 THR B CA  1 
ATOM 864  C C   . THR B 1 56 ? 33.838 -6.355  -5.058  1.00 58.74 ? 36 THR B C   1 
ATOM 865  O O   . THR B 1 56 ? 33.161 -6.087  -6.053  1.00 58.53 ? 36 THR B O   1 
ATOM 866  C CB  . THR B 1 56 ? 34.902 -8.580  -4.824  1.00 58.98 ? 36 THR B CB  1 
ATOM 867  O OG1 . THR B 1 56 ? 35.411 -8.863  -3.513  1.00 59.31 ? 36 THR B OG1 1 
ATOM 868  C CG2 . THR B 1 56 ? 35.542 -9.521  -5.832  1.00 58.66 ? 36 THR B CG2 1 
ATOM 869  N N   . TYR B 1 57 ? 33.474 -6.056  -3.817  1.00 58.72 ? 37 TYR B N   1 
ATOM 870  C CA  . TYR B 1 57 ? 32.209 -5.399  -3.547  1.00 58.99 ? 37 TYR B CA  1 
ATOM 871  C C   . TYR B 1 57 ? 32.248 -3.895  -3.853  1.00 59.25 ? 37 TYR B C   1 
ATOM 872  O O   . TYR B 1 57 ? 31.244 -3.348  -4.343  1.00 59.41 ? 37 TYR B O   1 
ATOM 873  C CB  . TYR B 1 57 ? 31.766 -5.653  -2.127  1.00 59.06 ? 37 TYR B CB  1 
ATOM 874  N N   . ILE B 1 58 ? 33.392 -3.238  -3.580  1.00 59.05 ? 38 ILE B N   1 
ATOM 875  C CA  . ILE B 1 58 ? 33.565 -1.808  -3.907  1.00 58.58 ? 38 ILE B CA  1 
ATOM 876  C C   . ILE B 1 58 ? 33.413 -1.591  -5.424  1.00 58.58 ? 38 ILE B C   1 
ATOM 877  O O   . ILE B 1 58 ? 32.657 -0.709  -5.840  1.00 59.04 ? 38 ILE B O   1 
ATOM 878  C CB  . ILE B 1 58 ? 34.890 -1.162  -3.326  1.00 58.40 ? 38 ILE B CB  1 
ATOM 879  C CG1 . ILE B 1 58 ? 34.979 -1.316  -1.804  1.00 57.74 ? 38 ILE B CG1 1 
ATOM 880  C CG2 . ILE B 1 58 ? 34.971 0.330   -3.637  1.00 58.77 ? 38 ILE B CG2 1 
ATOM 881  C CD1 . ILE B 1 58 ? 33.952 -0.517  -1.009  1.00 56.37 ? 38 ILE B CD1 1 
ATOM 882  N N   . SER B 1 59 ? 34.083 -2.395  -6.249  1.00 58.14 ? 39 SER B N   1 
ATOM 883  C CA  . SER B 1 59 ? 33.852 -2.309  -7.688  1.00 58.15 ? 39 SER B CA  1 
ATOM 884  C C   . SER B 1 59 ? 32.360 -2.492  -7.976  1.00 57.85 ? 39 SER B C   1 
ATOM 885  O O   . SER B 1 59 ? 31.737 -1.616  -8.571  1.00 57.87 ? 39 SER B O   1 
ATOM 886  C CB  . SER B 1 59 ? 34.667 -3.352  -8.448  1.00 58.30 ? 39 SER B CB  1 
ATOM 887  O OG  . SER B 1 59 ? 36.053 -3.217  -8.186  1.00 59.88 ? 39 SER B OG  1 
ATOM 888  N N   . GLY B 1 60 ? 31.801 -3.617  -7.509  1.00 57.62 ? 40 GLY B N   1 
ATOM 889  C CA  . GLY B 1 60 ? 30.403 -4.020  -7.739  1.00 57.11 ? 40 GLY B CA  1 
ATOM 890  C C   . GLY B 1 60 ? 29.383 -2.945  -7.450  1.00 56.83 ? 40 GLY B C   1 
ATOM 891  O O   . GLY B 1 60 ? 28.562 -2.621  -8.291  1.00 56.52 ? 40 GLY B O   1 
ATOM 892  N N   . ILE B 1 61 ? 29.446 -2.403  -6.243  1.00 56.99 ? 41 ILE B N   1 
ATOM 893  C CA  . ILE B 1 61 ? 28.735 -1.168  -5.838  1.00 57.16 ? 41 ILE B CA  1 
ATOM 894  C C   . ILE B 1 61 ? 28.776 0.014   -6.826  1.00 57.47 ? 41 ILE B C   1 
ATOM 895  O O   . ILE B 1 61 ? 27.749 0.635   -7.096  1.00 57.72 ? 41 ILE B O   1 
ATOM 896  C CB  . ILE B 1 61 ? 29.264 -0.694  -4.456  1.00 56.93 ? 41 ILE B CB  1 
ATOM 897  C CG1 . ILE B 1 61 ? 28.414 -1.280  -3.348  1.00 56.56 ? 41 ILE B CG1 1 
ATOM 898  C CG2 . ILE B 1 61 ? 29.331 0.836   -4.322  1.00 57.07 ? 41 ILE B CG2 1 
ATOM 899  C CD1 . ILE B 1 61 ? 28.947 -0.939  -1.979  1.00 56.63 ? 41 ILE B CD1 1 
ATOM 900  N N   . GLU B 1 62 ? 29.960 0.325   -7.347  1.00 57.62 ? 42 GLU B N   1 
ATOM 901  C CA  . GLU B 1 62 ? 30.139 1.492   -8.208  1.00 58.07 ? 42 GLU B CA  1 
ATOM 902  C C   . GLU B 1 62 ? 29.695 1.316   -9.689  1.00 58.21 ? 42 GLU B C   1 
ATOM 903  O O   . GLU B 1 62 ? 29.656 2.304   -10.433 1.00 58.42 ? 42 GLU B O   1 
ATOM 904  C CB  . GLU B 1 62 ? 31.587 2.018   -8.096  1.00 57.97 ? 42 GLU B CB  1 
ATOM 905  C CG  . GLU B 1 62 ? 31.923 2.624   -6.704  1.00 58.64 ? 42 GLU B CG  1 
ATOM 906  C CD  . GLU B 1 62 ? 33.283 3.332   -6.631  1.00 59.01 ? 42 GLU B CD  1 
ATOM 907  O OE1 . GLU B 1 62 ? 33.749 3.550   -5.499  1.00 59.85 ? 42 GLU B OE1 1 
ATOM 908  O OE2 . GLU B 1 62 ? 33.883 3.679   -7.679  1.00 59.87 ? 42 GLU B OE2 1 
ATOM 909  N N   . ARG B 1 63 ? 29.349 0.089   -10.107 1.00 58.25 ? 43 ARG B N   1 
ATOM 910  C CA  . ARG B 1 63 ? 28.889 -0.166  -11.483 1.00 58.49 ? 43 ARG B CA  1 
ATOM 911  C C   . ARG B 1 63 ? 27.511 -0.785  -11.546 1.00 59.25 ? 43 ARG B C   1 
ATOM 912  O O   . ARG B 1 63 ? 26.533 -0.146  -11.895 1.00 59.19 ? 43 ARG B O   1 
ATOM 913  C CB  . ARG B 1 63 ? 29.764 -1.185  -12.178 1.00 58.17 ? 43 ARG B CB  1 
ATOM 914  C CG  . ARG B 1 63 ? 31.236 -0.982  -12.122 1.00 58.34 ? 43 ARG B CG  1 
ATOM 915  C CD  . ARG B 1 63 ? 31.937 -2.210  -12.704 1.00 58.19 ? 43 ARG B CD  1 
ATOM 916  N NE  . ARG B 1 63 ? 31.523 -3.456  -12.042 1.00 57.29 ? 43 ARG B NE  1 
ATOM 917  C CZ  . ARG B 1 63 ? 30.701 -4.357  -12.573 1.00 56.81 ? 43 ARG B CZ  1 
ATOM 918  N NH1 . ARG B 1 63 ? 30.181 -4.171  -13.786 1.00 56.95 ? 43 ARG B NH1 1 
ATOM 919  N NH2 . ARG B 1 63 ? 30.401 -5.453  -11.890 1.00 56.75 ? 43 ARG B NH2 1 
ATOM 920  N N   . ASN B 1 64 ? 27.439 -2.059  -11.181 1.00 60.35 ? 44 ASN B N   1 
ATOM 921  C CA  . ASN B 1 64 ? 26.157 -2.731  -11.052 1.00 61.09 ? 44 ASN B CA  1 
ATOM 922  C C   . ASN B 1 64 ? 25.480 -2.258  -9.774  1.00 61.58 ? 44 ASN B C   1 
ATOM 923  O O   . ASN B 1 64 ? 24.540 -2.885  -9.284  1.00 61.50 ? 44 ASN B O   1 
ATOM 924  C CB  . ASN B 1 64 ? 26.343 -4.248  -11.026 1.00 61.07 ? 44 ASN B CB  1 
ATOM 925  C CG  . ASN B 1 64 ? 27.789 -4.662  -11.212 1.00 61.36 ? 44 ASN B CG  1 
ATOM 926  O OD1 . ASN B 1 64 ? 28.161 -5.212  -12.248 1.00 59.63 ? 44 ASN B OD1 1 
ATOM 927  N ND2 . ASN B 1 64 ? 28.615 -4.397  -10.205 1.00 62.97 ? 44 ASN B ND2 1 
ATOM 928  N N   . SER B 1 65 ? 25.998 -1.181  -9.196  1.00 62.18 ? 45 SER B N   1 
ATOM 929  C CA  . SER B 1 65 ? 25.502 -0.707  -7.912  1.00 63.16 ? 45 SER B CA  1 
ATOM 930  C C   . SER B 1 65 ? 25.083 -1.877  -7.020  1.00 63.37 ? 45 SER B C   1 
ATOM 931  O O   . SER B 1 65 ? 23.929 -1.960  -6.600  1.00 63.98 ? 45 SER B O   1 
ATOM 932  C CB  . SER B 1 65 ? 24.327 0.251   -8.111  1.00 63.35 ? 45 SER B CB  1 
ATOM 933  O OG  . SER B 1 65 ? 24.611 1.206   -9.119  1.00 63.63 ? 45 SER B OG  1 
ATOM 934  N N   . ARG B 1 66 ? 25.988 -2.818  -6.765  1.00 63.11 ? 46 ARG B N   1 
ATOM 935  C CA  . ARG B 1 66 ? 25.633 -4.002  -5.977  1.00 62.54 ? 46 ARG B CA  1 
ATOM 936  C C   . ARG B 1 66 ? 24.924 -3.596  -4.686  1.00 61.95 ? 46 ARG B C   1 
ATOM 937  O O   . ARG B 1 66 ? 25.215 -2.533  -4.138  1.00 61.85 ? 46 ARG B O   1 
ATOM 938  C CB  . ARG B 1 66 ? 26.880 -4.828  -5.657  1.00 62.97 ? 46 ARG B CB  1 
ATOM 939  C CG  . ARG B 1 66 ? 26.658 -6.331  -5.709  1.00 63.05 ? 46 ARG B CG  1 
ATOM 940  C CD  . ARG B 1 66 ? 25.514 -6.689  -6.643  1.00 62.62 ? 46 ARG B CD  1 
ATOM 941  N NE  . ARG B 1 66 ? 25.235 -8.122  -6.641  1.00 63.96 ? 46 ARG B NE  1 
ATOM 942  C CZ  . ARG B 1 66 ? 24.923 -8.822  -5.555  1.00 64.89 ? 46 ARG B CZ  1 
ATOM 943  N NH1 . ARG B 1 66 ? 24.851 -8.220  -4.375  1.00 65.22 ? 46 ARG B NH1 1 
ATOM 944  N NH2 . ARG B 1 66 ? 24.685 -10.123 -5.647  1.00 64.86 ? 46 ARG B NH2 1 
ATOM 945  N N   . ASN B 1 67 ? 23.998 -4.419  -4.190  1.00 60.87 ? 47 ASN B N   1 
ATOM 946  C CA  . ASN B 1 67 ? 23.306 -4.029  -2.982  1.00 60.41 ? 47 ASN B CA  1 
ATOM 947  C C   . ASN B 1 67 ? 23.934 -3.779  -1.617  1.00 59.93 ? 47 ASN B C   1 
ATOM 948  O O   . ASN B 1 67 ? 24.061 -4.700  -0.806  1.00 60.09 ? 47 ASN B O   1 
ATOM 949  C CB  . ASN B 1 67 ? 22.118 -4.968  -2.900  1.00 60.28 ? 47 ASN B CB  1 
ATOM 950  C CG  . ASN B 1 67 ? 20.843 -4.225  -2.584  1.00 61.66 ? 47 ASN B CG  1 
ATOM 951  O OD1 . ASN B 1 67 ? 20.852 -3.008  -2.315  1.00 62.48 ? 47 ASN B OD1 1 
ATOM 952  N ND2 . ASN B 1 67 ? 19.728 -4.942  -2.618  1.00 62.27 ? 47 ASN B ND2 1 
ATOM 953  N N   . LEU B 1 68 ? 24.324 -2.530  -1.368  1.00 59.31 ? 48 LEU B N   1 
ATOM 954  C CA  . LEU B 1 68 ? 24.857 -2.181  -0.059  1.00 58.80 ? 48 LEU B CA  1 
ATOM 955  C C   . LEU B 1 68 ? 23.757 -1.809  0.947   1.00 58.39 ? 48 LEU B C   1 
ATOM 956  O O   . LEU B 1 68 ? 22.799 -1.079  0.620   1.00 57.82 ? 48 LEU B O   1 
ATOM 957  C CB  . LEU B 1 68 ? 25.905 -1.066  -0.133  1.00 58.89 ? 48 LEU B CB  1 
ATOM 958  C CG  . LEU B 1 68 ? 25.464 0.408   -0.146  1.00 58.79 ? 48 LEU B CG  1 
ATOM 959  C CD1 . LEU B 1 68 ? 26.617 1.310   0.283   1.00 58.61 ? 48 LEU B CD1 1 
ATOM 960  C CD2 . LEU B 1 68 ? 24.912 0.825   -1.521  1.00 58.34 ? 48 LEU B CD2 1 
ATOM 961  N N   . THR B 1 69 ? 23.938 -2.340  2.165   1.00 57.84 ? 49 THR B N   1 
ATOM 962  C CA  . THR B 1 69 ? 23.120 -2.051  3.337   1.00 57.13 ? 49 THR B CA  1 
ATOM 963  C C   . THR B 1 69 ? 23.584 -0.759  3.993   1.00 57.36 ? 49 THR B C   1 
ATOM 964  O O   . THR B 1 69 ? 24.698 -0.266  3.710   1.00 57.45 ? 49 THR B O   1 
ATOM 965  C CB  . THR B 1 69 ? 23.239 -3.163  4.370   1.00 56.71 ? 49 THR B CB  1 
ATOM 966  O OG1 . THR B 1 69 ? 24.322 -2.878  5.259   1.00 56.30 ? 49 THR B OG1 1 
ATOM 967  C CG2 . THR B 1 69 ? 23.474 -4.483  3.684   1.00 56.68 ? 49 THR B CG2 1 
ATOM 968  N N   . ILE B 1 70 ? 22.735 -0.224  4.874   1.00 57.42 ? 50 ILE B N   1 
ATOM 969  C CA  . ILE B 1 70 ? 23.047 1.000   5.617   1.00 57.42 ? 50 ILE B CA  1 
ATOM 970  C C   . ILE B 1 70 ? 24.351 0.936   6.416   1.00 57.49 ? 50 ILE B C   1 
ATOM 971  O O   . ILE B 1 70 ? 25.039 1.946   6.549   1.00 58.04 ? 50 ILE B O   1 
ATOM 972  C CB  . ILE B 1 70 ? 21.893 1.405   6.522   1.00 57.31 ? 50 ILE B CB  1 
ATOM 973  C CG1 . ILE B 1 70 ? 20.991 2.407   5.796   1.00 57.89 ? 50 ILE B CG1 1 
ATOM 974  C CG2 . ILE B 1 70 ? 22.407 2.067   7.778   1.00 56.95 ? 50 ILE B CG2 1 
ATOM 975  C CD1 . ILE B 1 70 ? 20.567 1.997   4.401   1.00 57.85 ? 50 ILE B CD1 1 
ATOM 976  N N   . LYS B 1 71 ? 24.689 -0.246  6.923   1.00 56.97 ? 51 LYS B N   1 
ATOM 977  C CA  . LYS B 1 71 ? 25.963 -0.459  7.590   1.00 56.55 ? 51 LYS B CA  1 
ATOM 978  C C   . LYS B 1 71 ? 27.176 -0.307  6.636   1.00 56.44 ? 51 LYS B C   1 
ATOM 979  O O   . LYS B 1 71 ? 28.176 0.394   6.944   1.00 56.43 ? 51 LYS B O   1 
ATOM 980  C CB  . LYS B 1 71 ? 25.963 -1.844  8.217   1.00 56.82 ? 51 LYS B CB  1 
ATOM 981  C CG  . LYS B 1 71 ? 24.687 -2.207  8.986   1.00 56.26 ? 51 LYS B CG  1 
ATOM 982  C CD  . LYS B 1 71 ? 24.844 -1.906  10.471  1.00 55.24 ? 51 LYS B CD  1 
ATOM 983  C CE  . LYS B 1 71 ? 24.104 -2.896  11.329  1.00 55.84 ? 51 LYS B CE  1 
ATOM 984  N NZ  . LYS B 1 71 ? 24.557 -4.303  11.172  1.00 56.72 ? 51 LYS B NZ  1 
ATOM 985  N N   . SER B 1 72 ? 27.087 -0.964  5.480   1.00 55.68 ? 52 SER B N   1 
ATOM 986  C CA  . SER B 1 72 ? 28.154 -0.912  4.497   1.00 54.83 ? 52 SER B CA  1 
ATOM 987  C C   . SER B 1 72 ? 28.404 0.535   4.127   1.00 54.78 ? 52 SER B C   1 
ATOM 988  O O   . SER B 1 72 ? 29.560 0.972   4.036   1.00 54.76 ? 52 SER B O   1 
ATOM 989  C CB  . SER B 1 72 ? 27.793 -1.756  3.290   1.00 54.57 ? 52 SER B CB  1 
ATOM 990  O OG  . SER B 1 72 ? 27.616 -3.097  3.713   1.00 54.56 ? 52 SER B OG  1 
ATOM 991  N N   . LEU B 1 73 ? 27.316 1.292   3.968   1.00 55.01 ? 53 LEU B N   1 
ATOM 992  C CA  . LEU B 1 73 ? 27.405 2.734   3.678   1.00 55.10 ? 53 LEU B CA  1 
ATOM 993  C C   . LEU B 1 73 ? 28.190 3.488   4.763   1.00 55.40 ? 53 LEU B C   1 
ATOM 994  O O   . LEU B 1 73 ? 29.096 4.296   4.480   1.00 55.27 ? 53 LEU B O   1 
ATOM 995  C CB  . LEU B 1 73 ? 26.017 3.354   3.535   1.00 54.60 ? 53 LEU B CB  1 
ATOM 996  C CG  . LEU B 1 73 ? 25.853 4.419   2.438   1.00 54.71 ? 53 LEU B CG  1 
ATOM 997  C CD1 . LEU B 1 73 ? 24.765 5.502   2.716   1.00 53.96 ? 53 LEU B CD1 1 
ATOM 998  C CD2 . LEU B 1 73 ? 27.168 5.019   1.956   1.00 53.59 ? 53 LEU B CD2 1 
ATOM 999  N N   . GLU B 1 74 ? 27.844 3.213   6.012   1.00 55.35 ? 54 GLU B N   1 
ATOM 1000 C CA  . GLU B 1 74 ? 28.542 3.839   7.094   1.00 55.47 ? 54 GLU B CA  1 
ATOM 1001 C C   . GLU B 1 74 ? 30.000 3.422   7.041   1.00 55.33 ? 54 GLU B C   1 
ATOM 1002 O O   . GLU B 1 74 ? 30.864 4.292   7.124   1.00 55.75 ? 54 GLU B O   1 
ATOM 1003 C CB  . GLU B 1 74 ? 27.903 3.507   8.435   1.00 55.60 ? 54 GLU B CB  1 
ATOM 1004 C CG  . GLU B 1 74 ? 28.407 4.391   9.572   1.00 56.41 ? 54 GLU B CG  1 
ATOM 1005 C CD  . GLU B 1 74 ? 27.486 4.424   10.778  1.00 56.98 ? 54 GLU B CD  1 
ATOM 1006 O OE1 . GLU B 1 74 ? 27.569 5.410   11.549  1.00 57.41 ? 54 GLU B OE1 1 
ATOM 1007 O OE2 . GLU B 1 74 ? 26.683 3.475   10.961  1.00 57.19 ? 54 GLU B OE2 1 
ATOM 1008 N N   . LEU B 1 75 ? 30.269 2.115   6.887   1.00 54.73 ? 55 LEU B N   1 
ATOM 1009 C CA  . LEU B 1 75 ? 31.652 1.600   6.751   1.00 53.75 ? 55 LEU B CA  1 
ATOM 1010 C C   . LEU B 1 75 ? 32.442 2.416   5.712   1.00 54.23 ? 55 LEU B C   1 
ATOM 1011 O O   . LEU B 1 75 ? 33.530 2.959   5.974   1.00 53.70 ? 55 LEU B O   1 
ATOM 1012 C CB  . LEU B 1 75 ? 31.639 0.111   6.351   1.00 53.38 ? 55 LEU B CB  1 
ATOM 1013 C CG  . LEU B 1 75 ? 32.049 -1.005  7.311   1.00 51.45 ? 55 LEU B CG  1 
ATOM 1014 C CD1 . LEU B 1 75 ? 31.552 -0.745  8.693   1.00 51.09 ? 55 LEU B CD1 1 
ATOM 1015 C CD2 . LEU B 1 75 ? 31.510 -2.332  6.846   1.00 51.81 ? 55 LEU B CD2 1 
ATOM 1016 N N   . ILE B 1 76 ? 31.843 2.509   4.533   1.00 54.68 ? 56 ILE B N   1 
ATOM 1017 C CA  . ILE B 1 76 ? 32.429 3.212   3.413   1.00 55.28 ? 56 ILE B CA  1 
ATOM 1018 C C   . ILE B 1 76 ? 32.634 4.703   3.731   1.00 56.19 ? 56 ILE B C   1 
ATOM 1019 O O   . ILE B 1 76 ? 33.700 5.253   3.481   1.00 56.03 ? 56 ILE B O   1 
ATOM 1020 C CB  . ILE B 1 76 ? 31.578 2.968   2.166   1.00 54.83 ? 56 ILE B CB  1 
ATOM 1021 C CG1 . ILE B 1 76 ? 31.735 1.508   1.755   1.00 54.08 ? 56 ILE B CG1 1 
ATOM 1022 C CG2 . ILE B 1 76 ? 32.006 3.861   1.043   1.00 54.42 ? 56 ILE B CG2 1 
ATOM 1023 C CD1 . ILE B 1 76 ? 30.969 1.138   0.557   1.00 52.92 ? 56 ILE B CD1 1 
ATOM 1024 N N   . MET B 1 77 ? 31.609 5.335   4.312   1.00 57.19 ? 57 MET B N   1 
ATOM 1025 C CA  . MET B 1 77 ? 31.689 6.738   4.785   1.00 57.78 ? 57 MET B CA  1 
ATOM 1026 C C   . MET B 1 77 ? 32.854 7.067   5.722   1.00 56.83 ? 57 MET B C   1 
ATOM 1027 O O   . MET B 1 77 ? 33.242 8.219   5.828   1.00 56.32 ? 57 MET B O   1 
ATOM 1028 C CB  . MET B 1 77 ? 30.368 7.160   5.442   1.00 57.56 ? 57 MET B CB  1 
ATOM 1029 C CG  . MET B 1 77 ? 29.474 7.911   4.502   1.00 58.37 ? 57 MET B CG  1 
ATOM 1030 S SD  . MET B 1 77 ? 28.122 8.616   5.419   1.00 60.06 ? 57 MET B SD  1 
ATOM 1031 C CE  . MET B 1 77 ? 26.856 7.391   5.059   1.00 61.52 ? 57 MET B CE  1 
ATOM 1032 N N   . LYS B 1 78 ? 33.389 6.060   6.404   1.00 56.85 ? 58 LYS B N   1 
ATOM 1033 C CA  . LYS B 1 78 ? 34.553 6.263   7.272   1.00 56.93 ? 58 LYS B CA  1 
ATOM 1034 C C   . LYS B 1 78 ? 35.873 5.885   6.572   1.00 56.64 ? 58 LYS B C   1 
ATOM 1035 O O   . LYS B 1 78 ? 36.915 6.473   6.857   1.00 56.56 ? 58 LYS B O   1 
ATOM 1036 C CB  . LYS B 1 78 ? 34.364 5.576   8.626   1.00 57.07 ? 58 LYS B CB  1 
ATOM 1037 C CG  . LYS B 1 78 ? 33.247 6.232   9.451   1.00 57.70 ? 58 LYS B CG  1 
ATOM 1038 C CD  . LYS B 1 78 ? 32.788 5.367   10.611  1.00 57.81 ? 58 LYS B CD  1 
ATOM 1039 C CE  . LYS B 1 78 ? 31.666 6.040   11.351  1.00 57.46 ? 58 LYS B CE  1 
ATOM 1040 N NZ  . LYS B 1 78 ? 30.922 5.054   12.167  1.00 58.44 ? 58 LYS B NZ  1 
ATOM 1041 N N   . GLY B 1 79 ? 35.811 4.939   5.635   1.00 56.17 ? 59 GLY B N   1 
ATOM 1042 C CA  . GLY B 1 79 ? 36.860 4.807   4.633   1.00 55.50 ? 59 GLY B CA  1 
ATOM 1043 C C   . GLY B 1 79 ? 37.100 6.155   3.962   1.00 55.42 ? 59 GLY B C   1 
ATOM 1044 O O   . GLY B 1 79 ? 38.241 6.587   3.848   1.00 55.75 ? 59 GLY B O   1 
ATOM 1045 N N   . LEU B 1 80 ? 36.024 6.831   3.548   1.00 55.46 ? 60 LEU B N   1 
ATOM 1046 C CA  . LEU B 1 80 ? 36.085 8.116   2.807   1.00 55.37 ? 60 LEU B CA  1 
ATOM 1047 C C   . LEU B 1 80 ? 36.539 9.344   3.612   1.00 55.44 ? 60 LEU B C   1 
ATOM 1048 O O   . LEU B 1 80 ? 36.894 10.358  3.016   1.00 55.57 ? 60 LEU B O   1 
ATOM 1049 C CB  . LEU B 1 80 ? 34.727 8.458   2.155   1.00 55.24 ? 60 LEU B CB  1 
ATOM 1050 C CG  . LEU B 1 80 ? 34.082 7.781   0.928   1.00 54.76 ? 60 LEU B CG  1 
ATOM 1051 C CD1 . LEU B 1 80 ? 32.646 8.231   0.786   1.00 54.66 ? 60 LEU B CD1 1 
ATOM 1052 C CD2 . LEU B 1 80 ? 34.805 8.049   -0.375  1.00 54.55 ? 60 LEU B CD2 1 
ATOM 1053 N N   . GLU B 1 81 ? 36.533 9.263   4.944   1.00 55.49 ? 61 GLU B N   1 
ATOM 1054 C CA  . GLU B 1 81 ? 36.775 10.432  5.839   1.00 55.55 ? 61 GLU B CA  1 
ATOM 1055 C C   . GLU B 1 81 ? 35.877 11.652  5.547   1.00 55.55 ? 61 GLU B C   1 
ATOM 1056 O O   . GLU B 1 81 ? 36.374 12.789  5.471   1.00 55.66 ? 61 GLU B O   1 
ATOM 1057 C CB  . GLU B 1 81 ? 38.285 10.835  5.884   1.00 55.48 ? 61 GLU B CB  1 
ATOM 1058 N N   . VAL B 1 82 ? 34.569 11.390  5.384   1.00 55.37 ? 62 VAL B N   1 
ATOM 1059 C CA  . VAL B 1 82 ? 33.540 12.401  5.070   1.00 55.21 ? 62 VAL B CA  1 
ATOM 1060 C C   . VAL B 1 82 ? 32.339 12.267  5.993   1.00 55.53 ? 62 VAL B C   1 
ATOM 1061 O O   . VAL B 1 82 ? 31.871 11.154  6.263   1.00 56.19 ? 62 VAL B O   1 
ATOM 1062 C CB  . VAL B 1 82 ? 33.078 12.370  3.557   1.00 54.97 ? 62 VAL B CB  1 
ATOM 1063 C CG1 . VAL B 1 82 ? 33.778 11.293  2.798   1.00 55.15 ? 62 VAL B CG1 1 
ATOM 1064 C CG2 . VAL B 1 82 ? 31.554 12.218  3.390   1.00 53.75 ? 62 VAL B CG2 1 
ATOM 1065 N N   . SER B 1 83 ? 31.834 13.404  6.464   1.00 55.50 ? 63 SER B N   1 
ATOM 1066 C CA  . SER B 1 83 ? 30.660 13.422  7.341   1.00 55.67 ? 63 SER B CA  1 
ATOM 1067 C C   . SER B 1 83 ? 29.374 12.950  6.670   1.00 55.86 ? 63 SER B C   1 
ATOM 1068 O O   . SER B 1 83 ? 29.305 12.731  5.459   1.00 55.73 ? 63 SER B O   1 
ATOM 1069 C CB  . SER B 1 83 ? 30.451 14.813  7.961   1.00 55.76 ? 63 SER B CB  1 
ATOM 1070 O OG  . SER B 1 83 ? 30.748 15.851  7.041   1.00 56.56 ? 63 SER B OG  1 
ATOM 1071 N N   . ASP B 1 84 ? 28.352 12.776  7.488   1.00 56.45 ? 64 ASP B N   1 
ATOM 1072 C CA  . ASP B 1 84 ? 27.031 12.439  6.993   1.00 57.05 ? 64 ASP B CA  1 
ATOM 1073 C C   . ASP B 1 84 ? 26.362 13.694  6.410   1.00 56.96 ? 64 ASP B C   1 
ATOM 1074 O O   . ASP B 1 84 ? 25.630 13.607  5.415   1.00 57.34 ? 64 ASP B O   1 
ATOM 1075 C CB  . ASP B 1 84 ? 26.167 11.818  8.102   1.00 57.46 ? 64 ASP B CB  1 
ATOM 1076 C CG  . ASP B 1 84 ? 26.931 10.823  8.974   1.00 58.97 ? 64 ASP B CG  1 
ATOM 1077 O OD1 . ASP B 1 84 ? 28.186 10.924  9.082   1.00 60.40 ? 64 ASP B OD1 1 
ATOM 1078 O OD2 . ASP B 1 84 ? 26.256 9.950   9.573   1.00 60.89 ? 64 ASP B OD2 1 
ATOM 1079 N N   . VAL B 1 85 ? 26.611 14.855  7.024   1.00 56.57 ? 65 VAL B N   1 
ATOM 1080 C CA  . VAL B 1 85 ? 26.119 16.106  6.472   1.00 55.91 ? 65 VAL B CA  1 
ATOM 1081 C C   . VAL B 1 85 ? 26.758 16.325  5.097   1.00 55.84 ? 65 VAL B C   1 
ATOM 1082 O O   . VAL B 1 85 ? 26.012 16.423  4.122   1.00 56.06 ? 65 VAL B O   1 
ATOM 1083 C CB  . VAL B 1 85 ? 26.255 17.328  7.434   1.00 55.87 ? 65 VAL B CB  1 
ATOM 1084 C CG1 . VAL B 1 85 ? 25.675 18.598  6.795   1.00 55.48 ? 65 VAL B CG1 1 
ATOM 1085 C CG2 . VAL B 1 85 ? 25.553 17.045  8.763   1.00 55.57 ? 65 VAL B CG2 1 
ATOM 1086 N N   . VAL B 1 86 ? 28.092 16.357  4.965   1.00 55.43 ? 66 VAL B N   1 
ATOM 1087 C CA  . VAL B 1 86 ? 28.605 16.655  3.606   1.00 55.31 ? 66 VAL B CA  1 
ATOM 1088 C C   . VAL B 1 86 ? 28.208 15.620  2.546   1.00 55.51 ? 66 VAL B C   1 
ATOM 1089 O O   . VAL B 1 86 ? 27.831 16.006  1.437   1.00 55.56 ? 66 VAL B O   1 
ATOM 1090 C CB  . VAL B 1 86 ? 30.108 17.149  3.446   1.00 55.15 ? 66 VAL B CB  1 
ATOM 1091 C CG1 . VAL B 1 86 ? 30.693 17.744  4.714   1.00 54.95 ? 66 VAL B CG1 1 
ATOM 1092 C CG2 . VAL B 1 86 ? 31.012 16.132  2.749   1.00 54.53 ? 66 VAL B CG2 1 
ATOM 1093 N N   . PHE B 1 87 ? 28.249 14.329  2.894   1.00 55.62 ? 67 PHE B N   1 
ATOM 1094 C CA  . PHE B 1 87 ? 27.917 13.270  1.944   1.00 55.53 ? 67 PHE B CA  1 
ATOM 1095 C C   . PHE B 1 87 ? 26.519 13.472  1.356   1.00 55.99 ? 67 PHE B C   1 
ATOM 1096 O O   . PHE B 1 87 ? 26.330 13.476  0.124   1.00 55.79 ? 67 PHE B O   1 
ATOM 1097 C CB  . PHE B 1 87 ? 27.993 11.891  2.590   1.00 55.28 ? 67 PHE B CB  1 
ATOM 1098 C CG  . PHE B 1 87 ? 27.643 10.776  1.647   1.00 55.29 ? 67 PHE B CG  1 
ATOM 1099 C CD1 . PHE B 1 87 ? 28.639 10.106  0.956   1.00 54.87 ? 67 PHE B CD1 1 
ATOM 1100 C CD2 . PHE B 1 87 ? 26.313 10.422  1.414   1.00 55.90 ? 67 PHE B CD2 1 
ATOM 1101 C CE1 . PHE B 1 87 ? 28.328 9.089   0.070   1.00 54.75 ? 67 PHE B CE1 1 
ATOM 1102 C CE2 . PHE B 1 87 ? 25.993 9.412   0.523   1.00 55.47 ? 67 PHE B CE2 1 
ATOM 1103 C CZ  . PHE B 1 87 ? 27.005 8.740   -0.150  1.00 55.10 ? 67 PHE B CZ  1 
ATOM 1104 N N   . PHE B 1 88 ? 25.542 13.620  2.250   1.00 56.44 ? 68 PHE B N   1 
ATOM 1105 C CA  . PHE B 1 88 ? 24.142 13.720  1.856   1.00 56.92 ? 68 PHE B CA  1 
ATOM 1106 C C   . PHE B 1 88 ? 23.809 15.047  1.155   1.00 57.22 ? 68 PHE B C   1 
ATOM 1107 O O   . PHE B 1 88 ? 22.926 15.089  0.283   1.00 57.37 ? 68 PHE B O   1 
ATOM 1108 C CB  . PHE B 1 88 ? 23.247 13.449  3.058   1.00 57.02 ? 68 PHE B CB  1 
ATOM 1109 C CG  . PHE B 1 88 ? 23.260 12.012  3.499   1.00 57.42 ? 68 PHE B CG  1 
ATOM 1110 C CD1 . PHE B 1 88 ? 22.674 11.017  2.702   1.00 57.75 ? 68 PHE B CD1 1 
ATOM 1111 C CD2 . PHE B 1 88 ? 23.849 11.644  4.706   1.00 57.01 ? 68 PHE B CD2 1 
ATOM 1112 C CE1 . PHE B 1 88 ? 22.680 9.683   3.106   1.00 57.61 ? 68 PHE B CE1 1 
ATOM 1113 C CE2 . PHE B 1 88 ? 23.862 10.315  5.117   1.00 57.03 ? 68 PHE B CE2 1 
ATOM 1114 C CZ  . PHE B 1 88 ? 23.278 9.334   4.321   1.00 57.79 ? 68 PHE B CZ  1 
ATOM 1115 N N   . GLU B 1 89 ? 24.535 16.111  1.522   1.00 57.49 ? 69 GLU B N   1 
ATOM 1116 C CA  . GLU B 1 89 ? 24.527 17.383  0.785   1.00 57.66 ? 69 GLU B CA  1 
ATOM 1117 C C   . GLU B 1 89 ? 25.014 17.174  -0.646  1.00 58.00 ? 69 GLU B C   1 
ATOM 1118 O O   . GLU B 1 89 ? 24.487 17.795  -1.586  1.00 58.15 ? 69 GLU B O   1 
ATOM 1119 C CB  . GLU B 1 89 ? 25.433 18.405  1.460   1.00 57.53 ? 69 GLU B CB  1 
ATOM 1120 C CG  . GLU B 1 89 ? 24.807 19.178  2.597   1.00 57.05 ? 69 GLU B CG  1 
ATOM 1121 C CD  . GLU B 1 89 ? 25.694 20.307  3.065   1.00 56.82 ? 69 GLU B CD  1 
ATOM 1122 O OE1 . GLU B 1 89 ? 25.169 21.176  3.783   1.00 57.22 ? 69 GLU B OE1 1 
ATOM 1123 O OE2 . GLU B 1 89 ? 26.904 20.333  2.713   1.00 56.18 ? 69 GLU B OE2 1 
ATOM 1124 N N   . MET B 1 90 ? 26.019 16.303  -0.790  1.00 58.11 ? 70 MET B N   1 
ATOM 1125 C CA  . MET B 1 90 ? 26.559 15.918  -2.089  1.00 58.50 ? 70 MET B CA  1 
ATOM 1126 C C   . MET B 1 90 ? 25.652 14.940  -2.824  1.00 58.10 ? 70 MET B C   1 
ATOM 1127 O O   . MET B 1 90 ? 25.706 14.836  -4.053  1.00 58.45 ? 70 MET B O   1 
ATOM 1128 C CB  . MET B 1 90 ? 27.960 15.330  -1.931  1.00 58.70 ? 70 MET B CB  1 
ATOM 1129 C CG  . MET B 1 90 ? 29.042 16.379  -1.704  1.00 59.28 ? 70 MET B CG  1 
ATOM 1130 S SD  . MET B 1 90 ? 30.686 15.673  -1.587  1.00 59.74 ? 70 MET B SD  1 
ATOM 1131 C CE  . MET B 1 90 ? 31.595 17.093  -0.944  1.00 60.27 ? 70 MET B CE  1 
ATOM 1132 N N   . LEU B 1 91 ? 24.812 14.237  -2.073  1.00 57.55 ? 71 LEU B N   1 
ATOM 1133 C CA  . LEU B 1 91 ? 23.849 13.317  -2.662  1.00 56.95 ? 71 LEU B CA  1 
ATOM 1134 C C   . LEU B 1 91 ? 22.693 14.053  -3.344  1.00 56.55 ? 71 LEU B C   1 
ATOM 1135 O O   . LEU B 1 91 ? 22.444 13.857  -4.540  1.00 56.53 ? 71 LEU B O   1 
ATOM 1136 C CB  . LEU B 1 91 ? 23.347 12.333  -1.603  1.00 57.04 ? 71 LEU B CB  1 
ATOM 1137 C CG  . LEU B 1 91 ? 22.476 11.249  -2.238  1.00 56.45 ? 71 LEU B CG  1 
ATOM 1138 C CD1 . LEU B 1 91 ? 23.048 9.868   -2.139  1.00 56.10 ? 71 LEU B CD1 1 
ATOM 1139 C CD2 . LEU B 1 91 ? 21.063 11.342  -1.749  1.00 56.50 ? 71 LEU B CD2 1 
ATOM 1140 N N   . ILE B 1 92 ? 22.009 14.898  -2.575  1.00 55.99 ? 72 ILE B N   1 
ATOM 1141 C CA  . ILE B 1 92 ? 20.975 15.792  -3.087  1.00 55.69 ? 72 ILE B CA  1 
ATOM 1142 C C   . ILE B 1 92 ? 21.396 16.520  -4.370  1.00 55.76 ? 72 ILE B C   1 
ATOM 1143 O O   . ILE B 1 92 ? 20.638 16.576  -5.325  1.00 55.58 ? 72 ILE B O   1 
ATOM 1144 C CB  . ILE B 1 92 ? 20.598 16.827  -2.020  1.00 55.51 ? 72 ILE B CB  1 
ATOM 1145 C CG1 . ILE B 1 92 ? 20.073 16.130  -0.768  1.00 54.89 ? 72 ILE B CG1 1 
ATOM 1146 C CG2 . ILE B 1 92 ? 19.559 17.795  -2.549  1.00 55.72 ? 72 ILE B CG2 1 
ATOM 1147 C CD1 . ILE B 1 92 ? 20.068 16.999  0.479   1.00 53.94 ? 72 ILE B CD1 1 
ATOM 1148 N N   . LYS B 1 93 ? 22.607 17.074  -4.364  1.00 56.24 ? 73 LYS B N   1 
ATOM 1149 C CA  . LYS B 1 93 ? 23.193 17.779  -5.508  1.00 56.47 ? 73 LYS B CA  1 
ATOM 1150 C C   . LYS B 1 93 ? 23.207 16.909  -6.774  1.00 56.39 ? 73 LYS B C   1 
ATOM 1151 O O   . LYS B 1 93 ? 22.875 17.390  -7.871  1.00 56.55 ? 73 LYS B O   1 
ATOM 1152 C CB  . LYS B 1 93 ? 24.615 18.286  -5.152  1.00 56.69 ? 73 LYS B CB  1 
ATOM 1153 C CG  . LYS B 1 93 ? 25.447 18.907  -6.330  1.00 56.92 ? 73 LYS B CG  1 
ATOM 1154 C CD  . LYS B 1 93 ? 26.842 19.424  -5.876  1.00 56.88 ? 73 LYS B CD  1 
ATOM 1155 C CE  . LYS B 1 93 ? 27.646 20.013  -7.043  1.00 56.80 ? 73 LYS B CE  1 
ATOM 1156 N NZ  . LYS B 1 93 ? 28.619 21.051  -6.582  1.00 57.27 ? 73 LYS B NZ  1 
ATOM 1157 N N   . GLU B 1 94 ? 23.589 15.641  -6.617  1.00 56.05 ? 74 GLU B N   1 
ATOM 1158 C CA  . GLU B 1 94 ? 23.595 14.710  -7.729  1.00 55.89 ? 74 GLU B CA  1 
ATOM 1159 C C   . GLU B 1 94 ? 22.200 14.394  -8.179  1.00 55.75 ? 74 GLU B C   1 
ATOM 1160 O O   . GLU B 1 94 ? 21.952 14.240  -9.375  1.00 56.06 ? 74 GLU B O   1 
ATOM 1161 C CB  . GLU B 1 94 ? 24.359 13.451  -7.371  1.00 56.03 ? 74 GLU B CB  1 
ATOM 1162 C CG  . GLU B 1 94 ? 25.631 13.310  -8.173  1.00 56.84 ? 74 GLU B CG  1 
ATOM 1163 C CD  . GLU B 1 94 ? 26.121 14.641  -8.750  1.00 58.09 ? 74 GLU B CD  1 
ATOM 1164 O OE1 . GLU B 1 94 ? 26.165 14.785  -10.003 1.00 58.50 ? 74 GLU B OE1 1 
ATOM 1165 O OE2 . GLU B 1 94 ? 26.448 15.548  -7.948  1.00 57.95 ? 74 GLU B OE2 1 
ATOM 1166 N N   . ILE B 1 95 ? 21.294 14.322  -7.211  1.00 55.34 ? 75 ILE B N   1 
ATOM 1167 C CA  . ILE B 1 95 ? 19.867 14.222  -7.481  1.00 54.99 ? 75 ILE B CA  1 
ATOM 1168 C C   . ILE B 1 95 ? 19.289 15.443  -8.187  1.00 54.77 ? 75 ILE B C   1 
ATOM 1169 O O   . ILE B 1 95 ? 18.405 15.309  -9.046  1.00 54.91 ? 75 ILE B O   1 
ATOM 1170 C CB  . ILE B 1 95 ? 19.073 14.090  -6.183  1.00 54.92 ? 75 ILE B CB  1 
ATOM 1171 C CG1 . ILE B 1 95 ? 19.430 12.790  -5.466  1.00 54.38 ? 75 ILE B CG1 1 
ATOM 1172 C CG2 . ILE B 1 95 ? 17.571 14.189  -6.477  1.00 55.32 ? 75 ILE B CG2 1 
ATOM 1173 C CD1 . ILE B 1 95 ? 19.158 12.831  -3.992  1.00 53.36 ? 75 ILE B CD1 1 
ATOM 1174 N N   . LEU B 1 96 ? 19.735 16.630  -7.768  1.00 54.07 ? 76 LEU B N   1 
ATOM 1175 C CA  . LEU B 1 96 ? 19.139 17.887  -8.240  1.00 53.33 ? 76 LEU B CA  1 
ATOM 1176 C C   . LEU B 1 96 ? 19.684 18.332  -9.624  1.00 53.27 ? 76 LEU B C   1 
ATOM 1177 O O   . LEU B 1 96 ? 18.902 18.800  -10.468 1.00 52.54 ? 76 LEU B O   1 
ATOM 1178 C CB  . LEU B 1 96 ? 19.182 18.992  -7.151  1.00 52.97 ? 76 LEU B CB  1 
ATOM 1179 C CG  . LEU B 1 96 ? 18.249 18.904  -5.905  1.00 51.64 ? 76 LEU B CG  1 
ATOM 1180 C CD1 . LEU B 1 96 ? 18.634 19.873  -4.804  1.00 50.38 ? 76 LEU B CD1 1 
ATOM 1181 C CD2 . LEU B 1 96 ? 16.772 19.104  -6.198  1.00 50.53 ? 76 LEU B CD2 1 
ATOM 1182 N N   . LYS B 1 97 ? 20.954 18.061  -9.883  1.00 53.17 ? 77 LYS B N   1 
ATOM 1183 C CA  . LYS B 1 97 ? 21.561 18.358  -11.169 1.00 52.82 ? 77 LYS B CA  1 
ATOM 1184 C C   . LYS B 1 97 ? 20.913 17.633  -12.316 1.00 52.70 ? 77 LYS B C   1 
ATOM 1185 O O   . LYS B 1 97 ? 20.621 16.455  -12.230 1.00 52.30 ? 77 LYS B O   1 
ATOM 1186 C CB  . LYS B 1 97 ? 23.038 18.064  -11.123 1.00 20.00 ? 77 LYS B CB  1 
ATOM 1187 C CG  . LYS B 1 97 ? 23.690 18.864  -10.046 1.00 20.00 ? 77 LYS B CG  1 
ATOM 1188 C CD  . LYS B 1 97 ? 22.667 19.790  -9.430  1.00 20.00 ? 77 LYS B CD  1 
ATOM 1189 C CE  . LYS B 1 97 ? 23.232 20.520  -8.234  1.00 20.00 ? 77 LYS B CE  1 
ATOM 1190 N NZ  . LYS B 1 97 ? 23.904 21.806  -8.585  1.00 20.00 ? 77 LYS B NZ  1 
ATOM 1191 N N   . HIS B 1 98 ? 20.703 18.379  -13.399 1.00 52.84 ? 78 HIS B N   1 
ATOM 1192 C CA  . HIS B 1 98 ? 19.848 17.936  -14.552 1.00 52.59 ? 78 HIS B CA  1 
ATOM 1193 C C   . HIS B 1 98 ? 20.325 18.318  -15.990 1.00 52.51 ? 78 HIS B C   1 
ATOM 1194 O O   . HIS B 1 98 ? 21.427 18.835  -16.170 1.00 52.54 ? 78 HIS B O   1 
ATOM 1195 C CB  . HIS B 1 98 ? 18.355 18.322  -14.321 1.00 52.60 ? 78 HIS B CB  1 
ATOM 1196 C CG  . HIS B 1 98 ? 18.011 19.767  -14.593 1.00 52.28 ? 78 HIS B CG  1 
ATOM 1197 N ND1 . HIS B 1 98 ? 17.909 20.716  -13.595 1.00 51.48 ? 78 HIS B ND1 1 
ATOM 1198 C CD2 . HIS B 1 98 ? 17.687 20.405  -15.744 1.00 52.04 ? 78 HIS B CD2 1 
ATOM 1199 C CE1 . HIS B 1 98 ? 17.580 21.881  -14.124 1.00 51.39 ? 78 HIS B CE1 1 
ATOM 1200 N NE2 . HIS B 1 98 ? 17.441 21.720  -15.428 1.00 51.73 ? 78 HIS B NE2 1 
ATOM 1201 N N   . ASP B 1 99 ? 19.479 18.054  -16.993 1.00 52.59 ? 79 ASP B N   1 
ATOM 1202 C CA  . ASP B 1 99 ? 19.741 18.360  -18.422 1.00 52.56 ? 79 ASP B CA  1 
ATOM 1203 C C   . ASP B 1 99 ? 20.873 17.538  -19.033 1.00 52.72 ? 79 ASP B C   1 
ATOM 1204 O O   . ASP B 1 99 ? 21.213 17.721  -20.206 1.00 52.77 ? 79 ASP B O   1 
ATOM 1205 C CB  . ASP B 1 99 ? 19.995 19.857  -18.664 1.00 52.54 ? 79 ASP B CB  1 
ATOM 1206 C CG  . ASP B 1 99 ? 18.743 20.688  -18.543 1.00 52.01 ? 79 ASP B CG  1 
ATOM 1207 O OD1 . ASP B 1 99 ? 17.659 20.186  -18.888 1.00 51.07 ? 79 ASP B OD1 1 
ATOM 1208 O OD2 . ASP B 1 99 ? 18.836 21.851  -18.100 1.00 51.76 ? 79 ASP B OD2 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  -19 ?  ?   ?   A . n 
A 1 2  GLY 2  -18 ?  ?   ?   A . n 
A 1 3  SER 3  -17 ?  ?   ?   A . n 
A 1 4  SER 4  -16 ?  ?   ?   A . n 
A 1 5  HIS 5  -15 ?  ?   ?   A . n 
A 1 6  HIS 6  -14 ?  ?   ?   A . n 
A 1 7  HIS 7  -13 ?  ?   ?   A . n 
A 1 8  HIS 8  -12 ?  ?   ?   A . n 
A 1 9  HIS 9  -11 ?  ?   ?   A . n 
A 1 10 HIS 10 -10 ?  ?   ?   A . n 
A 1 11 SER 11 -9  ?  ?   ?   A . n 
A 1 12 SER 12 -8  ?  ?   ?   A . n 
A 1 13 GLY 13 -7  ?  ?   ?   A . n 
A 1 14 LEU 14 -6  ?  ?   ?   A . n 
A 1 15 VAL 15 -5  ?  ?   ?   A . n 
A 1 16 PRO 16 -4  ?  ?   ?   A . n 
A 1 17 ARG 17 -3  ?  ?   ?   A . n 
A 1 18 GLY 18 -2  ?  ?   ?   A . n 
A 1 19 SER 19 -1  ?  ?   ?   A . n 
A 1 20 HIS 20 0   ?  ?   ?   A . n 
A 1 21 MET 21 1   ?  ?   ?   A . n 
A 1 22 GLU 22 2   2  GLU ALA A . n 
A 1 23 SER 23 3   3  SER SER A . n 
A 1 24 PHE 24 4   4  PHE PHE A . n 
A 1 25 LEU 25 5   5  LEU LEU A . n 
A 1 26 LEU 26 6   6  LEU LEU A . n 
A 1 27 SER 27 7   7  SER SER A . n 
A 1 28 LYS 28 8   8  LYS LYS A . n 
A 1 29 VAL 29 9   9  VAL VAL A . n 
A 1 30 SER 30 10  10 SER SER A . n 
A 1 31 PHE 31 11  11 PHE PHE A . n 
A 1 32 VAL 32 12  12 VAL VAL A . n 
A 1 33 ILE 33 13  13 ILE ILE A . n 
A 1 34 LYS 34 14  14 LYS LYS A . n 
A 1 35 LYS 35 15  15 LYS LYS A . n 
A 1 36 ILE 36 16  16 ILE ILE A . n 
A 1 37 ARG 37 17  17 ARG ARG A . n 
A 1 38 LEU 38 18  18 LEU LEU A . n 
A 1 39 GLU 39 19  19 GLU GLU A . n 
A 1 40 LYS 40 20  20 LYS LYS A . n 
A 1 41 GLY 41 21  21 GLY GLY A . n 
A 1 42 MET 42 22  22 MET MET A . n 
A 1 43 THR 43 23  23 THR THR A . n 
A 1 44 GLN 44 24  24 GLN GLN A . n 
A 1 45 GLU 45 25  25 GLU GLU A . n 
A 1 46 ASP 46 26  26 ASP ASP A . n 
A 1 47 LEU 47 27  27 LEU LEU A . n 
A 1 48 ALA 48 28  28 ALA ALA A . n 
A 1 49 TYR 49 29  29 TYR TYR A . n 
A 1 50 LYS 50 30  30 LYS LYS A . n 
A 1 51 SER 51 31  31 SER SER A . n 
A 1 52 ASN 52 32  32 ASN ALA A . n 
A 1 53 LEU 53 33  33 LEU LEU A . n 
A 1 54 ASP 54 34  34 ASP ASP A . n 
A 1 55 ALA 55 35  35 ALA ALA A . n 
A 1 56 THR 56 36  36 THR THR A . n 
A 1 57 TYR 57 37  37 TYR TYR A . n 
A 1 58 ILE 58 38  38 ILE ILE A . n 
A 1 59 SER 59 39  39 SER SER A . n 
A 1 60 GLY 60 40  40 GLY GLY A . n 
A 1 61 ILE 61 41  41 ILE ILE A . n 
A 1 62 GLU 62 42  42 GLU GLU A . n 
A 1 63 ARG 63 43  43 ARG ARG A . n 
A 1 64 ASN 64 44  44 ASN ASN A . n 
A 1 65 SER 65 45  45 SER SER A . n 
A 1 66 ARG 66 46  46 ARG ARG A . n 
A 1 67 ASN 67 47  47 ASN ASN A . n 
A 1 68 LEU 68 48  48 LEU LEU A . n 
A 1 69 THR 69 49  49 THR THR A . n 
A 1 70 ILE 70 50  50 ILE ILE A . n 
A 1 71 LYS 71 51  51 LYS LYS A . n 
A 1 72 SER 72 52  52 SER SER A . n 
A 1 73 LEU 73 53  53 LEU LEU A . n 
A 1 74 GLU 74 54  54 GLU GLU A . n 
A 1 75 LEU 75 55  55 LEU LEU A . n 
A 1 76 ILE 76 56  56 ILE ILE A . n 
A 1 77 MET 77 57  57 MET MET A . n 
A 1 78 LYS 78 58  58 LYS LYS A . n 
A 1 79 GLY 79 59  59 GLY GLY A . n 
A 1 80 LEU 80 60  60 LEU LEU A . n 
A 1 81 GLU 81 61  61 GLU GLU A . n 
A 1 82 VAL 82 62  62 VAL VAL A . n 
A 1 83 SER 83 63  63 SER SER A . n 
A 1 84 ASP 84 64  64 ASP ASP A . n 
A 1 85 VAL 85 65  65 VAL VAL A . n 
A 1 86 VAL 86 66  66 VAL VAL A . n 
A 1 87 PHE 87 67  67 PHE PHE A . n 
A 1 88 PHE 88 68  68 PHE PHE A . n 
A 1 89 GLU 89 69  69 GLU GLU A . n 
A 1 90 MET 90 70  70 MET MET A . n 
A 1 91 LEU 91 71  71 LEU LEU A . n 
A 1 92 ILE 92 72  72 ILE ILE A . n 
A 1 93 LYS 93 73  73 LYS LYS A . n 
A 1 94 GLU 94 74  74 GLU GLU A . n 
A 1 95 ILE 95 75  75 ILE ILE A . n 
A 1 96 LEU 96 76  76 LEU LEU A . n 
A 1 97 LYS 97 77  ?  ?   ?   A . n 
A 1 98 HIS 98 78  ?  ?   ?   A . n 
A 1 99 ASP 99 79  ?  ?   ?   A . n 
B 1 1  MET 1  -19 ?  ?   ?   B . n 
B 1 2  GLY 2  -18 ?  ?   ?   B . n 
B 1 3  SER 3  -17 ?  ?   ?   B . n 
B 1 4  SER 4  -16 ?  ?   ?   B . n 
B 1 5  HIS 5  -15 ?  ?   ?   B . n 
B 1 6  HIS 6  -14 ?  ?   ?   B . n 
B 1 7  HIS 7  -13 ?  ?   ?   B . n 
B 1 8  HIS 8  -12 ?  ?   ?   B . n 
B 1 9  HIS 9  -11 ?  ?   ?   B . n 
B 1 10 HIS 10 -10 ?  ?   ?   B . n 
B 1 11 SER 11 -9  ?  ?   ?   B . n 
B 1 12 SER 12 -8  ?  ?   ?   B . n 
B 1 13 GLY 13 -7  ?  ?   ?   B . n 
B 1 14 LEU 14 -6  ?  ?   ?   B . n 
B 1 15 VAL 15 -5  ?  ?   ?   B . n 
B 1 16 PRO 16 -4  ?  ?   ?   B . n 
B 1 17 ARG 17 -3  ?  ?   ?   B . n 
B 1 18 GLY 18 -2  ?  ?   ?   B . n 
B 1 19 SER 19 -1  ?  ?   ?   B . n 
B 1 20 HIS 20 0   ?  ?   ?   B . n 
B 1 21 MET 21 1   ?  ?   ?   B . n 
B 1 22 GLU 22 2   ?  ?   ?   B . n 
B 1 23 SER 23 3   3  SER SER B . n 
B 1 24 PHE 24 4   4  PHE PHE B . n 
B 1 25 LEU 25 5   5  LEU LEU B . n 
B 1 26 LEU 26 6   6  LEU LEU B . n 
B 1 27 SER 27 7   7  SER SER B . n 
B 1 28 LYS 28 8   8  LYS LYS B . n 
B 1 29 VAL 29 9   9  VAL VAL B . n 
B 1 30 SER 30 10  10 SER SER B . n 
B 1 31 PHE 31 11  11 PHE PHE B . n 
B 1 32 VAL 32 12  12 VAL VAL B . n 
B 1 33 ILE 33 13  13 ILE ILE B . n 
B 1 34 LYS 34 14  14 LYS LYS B . n 
B 1 35 LYS 35 15  15 LYS LYS B . n 
B 1 36 ILE 36 16  16 ILE ILE B . n 
B 1 37 ARG 37 17  17 ARG ARG B . n 
B 1 38 LEU 38 18  18 LEU LEU B . n 
B 1 39 GLU 39 19  19 GLU GLU B . n 
B 1 40 LYS 40 20  20 LYS LYS B . n 
B 1 41 GLY 41 21  21 GLY GLY B . n 
B 1 42 MET 42 22  22 MET MET B . n 
B 1 43 THR 43 23  23 THR THR B . n 
B 1 44 GLN 44 24  24 GLN GLN B . n 
B 1 45 GLU 45 25  25 GLU GLU B . n 
B 1 46 ASP 46 26  26 ASP ASP B . n 
B 1 47 LEU 47 27  27 LEU LEU B . n 
B 1 48 ALA 48 28  28 ALA ALA B . n 
B 1 49 TYR 49 29  29 TYR TYR B . n 
B 1 50 LYS 50 30  30 LYS LYS B . n 
B 1 51 SER 51 31  31 SER SER B . n 
B 1 52 ASN 52 32  32 ASN ASN B . n 
B 1 53 LEU 53 33  33 LEU LEU B . n 
B 1 54 ASP 54 34  34 ASP ASP B . n 
B 1 55 ALA 55 35  35 ALA ALA B . n 
B 1 56 THR 56 36  36 THR THR B . n 
B 1 57 TYR 57 37  37 TYR ALA B . n 
B 1 58 ILE 58 38  38 ILE ILE B . n 
B 1 59 SER 59 39  39 SER SER B . n 
B 1 60 GLY 60 40  40 GLY GLY B . n 
B 1 61 ILE 61 41  41 ILE ILE B . n 
B 1 62 GLU 62 42  42 GLU GLU B . n 
B 1 63 ARG 63 43  43 ARG ARG B . n 
B 1 64 ASN 64 44  44 ASN ASN B . n 
B 1 65 SER 65 45  45 SER SER B . n 
B 1 66 ARG 66 46  46 ARG ARG B . n 
B 1 67 ASN 67 47  47 ASN ASN B . n 
B 1 68 LEU 68 48  48 LEU LEU B . n 
B 1 69 THR 69 49  49 THR THR B . n 
B 1 70 ILE 70 50  50 ILE ILE B . n 
B 1 71 LYS 71 51  51 LYS LYS B . n 
B 1 72 SER 72 52  52 SER SER B . n 
B 1 73 LEU 73 53  53 LEU LEU B . n 
B 1 74 GLU 74 54  54 GLU GLU B . n 
B 1 75 LEU 75 55  55 LEU LEU B . n 
B 1 76 ILE 76 56  56 ILE ILE B . n 
B 1 77 MET 77 57  57 MET MET B . n 
B 1 78 LYS 78 58  58 LYS LYS B . n 
B 1 79 GLY 79 59  59 GLY GLY B . n 
B 1 80 LEU 80 60  60 LEU LEU B . n 
B 1 81 GLU 81 61  61 GLU ALA B . n 
B 1 82 VAL 82 62  62 VAL VAL B . n 
B 1 83 SER 83 63  63 SER SER B . n 
B 1 84 ASP 84 64  64 ASP ASP B . n 
B 1 85 VAL 85 65  65 VAL VAL B . n 
B 1 86 VAL 86 66  66 VAL VAL B . n 
B 1 87 PHE 87 67  67 PHE PHE B . n 
B 1 88 PHE 88 68  68 PHE PHE B . n 
B 1 89 GLU 89 69  69 GLU GLU B . n 
B 1 90 MET 90 70  70 MET MET B . n 
B 1 91 LEU 91 71  71 LEU LEU B . n 
B 1 92 ILE 92 72  72 ILE ILE B . n 
B 1 93 LYS 93 73  73 LYS LYS B . n 
B 1 94 GLU 94 74  74 GLU GLU B . n 
B 1 95 ILE 95 75  75 ILE ILE B . n 
B 1 96 LEU 96 76  76 LEU LEU B . n 
B 1 97 LYS 97 77  77 LYS LYS B . n 
B 1 98 HIS 98 78  78 HIS HIS B . n 
B 1 99 ASP 99 79  79 ASP ASP B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1970 ? 
1 MORE         -21  ? 
1 'SSA (A^2)'  7810 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-08-25 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2012-03-28 
4 'Structure model' 1 3 2021-10-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Source and taxonomy'       
3 2 'Structure model' 'Version format compliance' 
4 3 'Structure model' 'Database references'       
5 4 'Structure model' 'Database references'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2         
2 4 'Structure model' struct_ref_seq_dif 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_struct_ref_seq_dif.details'         
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 11.8108 4.5072 6.9148  -0.3289 0.2140 -0.1637 0.0324  -0.0144 0.0742 12.3308 6.6956 15.8733 0.1278  5.9300 -4.3753 
-0.5287 0.0457  0.4830 -0.3370 0.2507  0.1607  0.6800  -1.0882 0.1207 'X-RAY DIFFRACTION' 
2 ? refined 29.9081 5.9774 -2.2473 -0.0936 0.4162 0.2487  -0.1471 -0.0450 0.1537 9.5146  2.0107 4.5993  -3.0602 0.3386 -0.3308 
-0.1236 -0.3265 0.4502 -0.0358 -0.1526 -0.2928 -0.5419 -0.2744 0.1971 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A A 75 ? 2 . . . . 'X-RAY DIFFRACTION' ? 
2 2 B B 79 ? 3 . . . . 'X-RAY DIFFRACTION' ? 
# 
_pdbx_phasing_MR.entry_id                     3FYA 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                'Phaser MODE: MR_AUTO' 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          ? 
_pdbx_phasing_MR.d_res_low_rotation           ? 
_pdbx_phasing_MR.d_res_high_translation       ? 
_pdbx_phasing_MR.d_res_low_translation        ? 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
MOSFLM      .      ?               package 'Andrew G.W. Leslie' andrew@mrc-lmb.cam.ac.uk    'data reduction'  
http://www.mrc-lmb.cam.ac.uk/harry/mosflm/   ?          ? 1 
SCALA       3.2.25 21/9/2006       other   'Phil R. Evans'      pre@mrc-lmb.cam.ac.uk       'data scaling'    
http://www.ccp4.ac.uk/dist/html/scala.html   Fortran_77 ? 2 
PHASER      .      ?               program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/  ?          ? 3 
REFMAC      .      ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk       refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 4 
PDB_EXTRACT 3.006  'June 11, 2008' package PDB                  help@deposit.rcsb.org       'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 5 
MxCuBE      .      ?               ?       ?                    ?                           'data collection' ? ?          ? 6 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 6  ? ? -29.47  -55.37 
2 1 LEU B 6  ? ? -29.89  -52.95 
3 1 ARG B 43 ? ? -122.04 -72.91 
4 1 SER B 45 ? ? 34.64   56.12  
5 1 ASN B 47 ? ? -61.41  90.45  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 2  ? CG  ? A GLU 22 CG  
2  1 Y 1 A GLU 2  ? CD  ? A GLU 22 CD  
3  1 Y 1 A GLU 2  ? OE1 ? A GLU 22 OE1 
4  1 Y 1 A GLU 2  ? OE2 ? A GLU 22 OE2 
5  1 Y 1 A ASN 32 ? CG  ? A ASN 52 CG  
6  1 Y 1 A ASN 32 ? OD1 ? A ASN 52 OD1 
7  1 Y 1 A ASN 32 ? ND2 ? A ASN 52 ND2 
8  1 Y 1 B TYR 37 ? CG  ? B TYR 57 CG  
9  1 Y 1 B TYR 37 ? CD1 ? B TYR 57 CD1 
10 1 Y 1 B TYR 37 ? CD2 ? B TYR 57 CD2 
11 1 Y 1 B TYR 37 ? CE1 ? B TYR 57 CE1 
12 1 Y 1 B TYR 37 ? CE2 ? B TYR 57 CE2 
13 1 Y 1 B TYR 37 ? CZ  ? B TYR 57 CZ  
14 1 Y 1 B TYR 37 ? OH  ? B TYR 57 OH  
15 1 Y 1 B GLU 61 ? CG  ? B GLU 81 CG  
16 1 Y 1 B GLU 61 ? CD  ? B GLU 81 CD  
17 1 Y 1 B GLU 61 ? OE1 ? B GLU 81 OE1 
18 1 Y 1 B GLU 61 ? OE2 ? B GLU 81 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -19 ? A MET 1  
2  1 Y 1 A GLY -18 ? A GLY 2  
3  1 Y 1 A SER -17 ? A SER 3  
4  1 Y 1 A SER -16 ? A SER 4  
5  1 Y 1 A HIS -15 ? A HIS 5  
6  1 Y 1 A HIS -14 ? A HIS 6  
7  1 Y 1 A HIS -13 ? A HIS 7  
8  1 Y 1 A HIS -12 ? A HIS 8  
9  1 Y 1 A HIS -11 ? A HIS 9  
10 1 Y 1 A HIS -10 ? A HIS 10 
11 1 Y 1 A SER -9  ? A SER 11 
12 1 Y 1 A SER -8  ? A SER 12 
13 1 Y 1 A GLY -7  ? A GLY 13 
14 1 Y 1 A LEU -6  ? A LEU 14 
15 1 Y 1 A VAL -5  ? A VAL 15 
16 1 Y 1 A PRO -4  ? A PRO 16 
17 1 Y 1 A ARG -3  ? A ARG 17 
18 1 Y 1 A GLY -2  ? A GLY 18 
19 1 Y 1 A SER -1  ? A SER 19 
20 1 Y 1 A HIS 0   ? A HIS 20 
21 1 Y 1 A MET 1   ? A MET 21 
22 1 Y 1 A LYS 77  ? A LYS 97 
23 1 Y 1 A HIS 78  ? A HIS 98 
24 1 Y 1 A ASP 79  ? A ASP 99 
25 1 Y 1 B MET -19 ? B MET 1  
26 1 Y 1 B GLY -18 ? B GLY 2  
27 1 Y 1 B SER -17 ? B SER 3  
28 1 Y 1 B SER -16 ? B SER 4  
29 1 Y 1 B HIS -15 ? B HIS 5  
30 1 Y 1 B HIS -14 ? B HIS 6  
31 1 Y 1 B HIS -13 ? B HIS 7  
32 1 Y 1 B HIS -12 ? B HIS 8  
33 1 Y 1 B HIS -11 ? B HIS 9  
34 1 Y 1 B HIS -10 ? B HIS 10 
35 1 Y 1 B SER -9  ? B SER 11 
36 1 Y 1 B SER -8  ? B SER 12 
37 1 Y 1 B GLY -7  ? B GLY 13 
38 1 Y 1 B LEU -6  ? B LEU 14 
39 1 Y 1 B VAL -5  ? B VAL 15 
40 1 Y 1 B PRO -4  ? B PRO 16 
41 1 Y 1 B ARG -3  ? B ARG 17 
42 1 Y 1 B GLY -2  ? B GLY 18 
43 1 Y 1 B SER -1  ? B SER 19 
44 1 Y 1 B HIS 0   ? B HIS 20 
45 1 Y 1 B MET 1   ? B MET 21 
46 1 Y 1 B GLU 2   ? B GLU 22 
#