data_3FZP
# 
_entry.id   3FZP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3FZP         
RCSB  RCSB051239   
WWPDB D_1000051239 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3FZO 'PYK2 apo structure' unspecified 
PDB 3FZR .                    unspecified 
PDB 3FZS .                    unspecified 
PDB 3FZT .                    unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3FZP 
_pdbx_database_status.recvd_initial_deposition_date   2009-01-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
_audit_author.name           'Han, S.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
;Structural characterization of proline-rich tyrosine kinase 2 (PYK2) reveals a unique (DFG-out) conformation and enables inhibitor design.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            284 
_citation.page_first                13193 
_citation.page_last                 13201 
_citation.year                      2009 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19244237 
_citation.pdbx_database_id_DOI      10.1074/jbc.M809038200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Han, S.'        1  
primary 'Mistry, A.'     2  
primary 'Chang, J.S.'    3  
primary 'Cunningham, D.' 4  
primary 'Griffor, M.'    5  
primary 'Bonnette, P.C.' 6  
primary 'Wang, H.'       7  
primary 'Chrunyk, B.A.'  8  
primary 'Aspnes, G.E.'   9  
primary 'Walker, D.P.'   10 
primary 'Brosius, A.D.'  11 
primary 'Buckbinder, L.' 12 
# 
_cell.entry_id           3FZP 
_cell.length_a           36.946 
_cell.length_b           92.663 
_cell.length_c           42.671 
_cell.angle_alpha        90.00 
_cell.angle_beta         92.45 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3FZP 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'Protein tyrosine kinase 2 beta'             32190.320 1   2.7.10.2 ? 
'UNP residues 416-692, Protein kinase domain' ? 
2 non-polymer syn 'PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER' 523.247   1   ?        ? ? ? 
3 non-polymer syn 'SULFATE ION'                                96.063    2   ?        ? ? ? 
4 water       nat water                                        18.015    105 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Focal adhesion kinase 2, FADK 2, Proline-rich tyrosine kinase 2, Cell adhesion kinase beta, CAK beta, Calcium-dependent tyrosine kinase, CADTK, Related adhesion focal tyrosine kinase, RAFTK
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;PQYGIAREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKNLDHPHIVKLIGIIEE
EPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYLESINCVHRDIAVRNILVASPECVKLGDFGLSRYIE
DEDYYKASVTRLPIKWMSPESINFRRFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLY
TLMTRCWDYDPSDRPRFTELVCSLSDVYQMEKDIAME
;
_entity_poly.pdbx_seq_one_letter_code_can   
;PQYGIAREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKNLDHPHIVKLIGIIEE
EPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYLESINCVHRDIAVRNILVASPECVKLGDFGLSRYIE
DEDYYKASVTRLPIKWMSPESINFRRFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLY
TLMTRCWDYDPSDRPRFTELVCSLSDVYQMEKDIAME
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   GLN n 
1 3   TYR n 
1 4   GLY n 
1 5   ILE n 
1 6   ALA n 
1 7   ARG n 
1 8   GLU n 
1 9   ASP n 
1 10  VAL n 
1 11  VAL n 
1 12  LEU n 
1 13  ASN n 
1 14  ARG n 
1 15  ILE n 
1 16  LEU n 
1 17  GLY n 
1 18  GLU n 
1 19  GLY n 
1 20  PHE n 
1 21  PHE n 
1 22  GLY n 
1 23  GLU n 
1 24  VAL n 
1 25  TYR n 
1 26  GLU n 
1 27  GLY n 
1 28  VAL n 
1 29  TYR n 
1 30  THR n 
1 31  ASN n 
1 32  HIS n 
1 33  LYS n 
1 34  GLY n 
1 35  GLU n 
1 36  LYS n 
1 37  ILE n 
1 38  ASN n 
1 39  VAL n 
1 40  ALA n 
1 41  VAL n 
1 42  LYS n 
1 43  THR n 
1 44  CYS n 
1 45  LYS n 
1 46  LYS n 
1 47  ASP n 
1 48  CYS n 
1 49  THR n 
1 50  LEU n 
1 51  ASP n 
1 52  ASN n 
1 53  LYS n 
1 54  GLU n 
1 55  LYS n 
1 56  PHE n 
1 57  MET n 
1 58  SER n 
1 59  GLU n 
1 60  ALA n 
1 61  VAL n 
1 62  ILE n 
1 63  MET n 
1 64  LYS n 
1 65  ASN n 
1 66  LEU n 
1 67  ASP n 
1 68  HIS n 
1 69  PRO n 
1 70  HIS n 
1 71  ILE n 
1 72  VAL n 
1 73  LYS n 
1 74  LEU n 
1 75  ILE n 
1 76  GLY n 
1 77  ILE n 
1 78  ILE n 
1 79  GLU n 
1 80  GLU n 
1 81  GLU n 
1 82  PRO n 
1 83  THR n 
1 84  TRP n 
1 85  ILE n 
1 86  ILE n 
1 87  MET n 
1 88  GLU n 
1 89  LEU n 
1 90  TYR n 
1 91  PRO n 
1 92  TYR n 
1 93  GLY n 
1 94  GLU n 
1 95  LEU n 
1 96  GLY n 
1 97  HIS n 
1 98  TYR n 
1 99  LEU n 
1 100 GLU n 
1 101 ARG n 
1 102 ASN n 
1 103 LYS n 
1 104 ASN n 
1 105 SER n 
1 106 LEU n 
1 107 LYS n 
1 108 VAL n 
1 109 LEU n 
1 110 THR n 
1 111 LEU n 
1 112 VAL n 
1 113 LEU n 
1 114 TYR n 
1 115 SER n 
1 116 LEU n 
1 117 GLN n 
1 118 ILE n 
1 119 CYS n 
1 120 LYS n 
1 121 ALA n 
1 122 MET n 
1 123 ALA n 
1 124 TYR n 
1 125 LEU n 
1 126 GLU n 
1 127 SER n 
1 128 ILE n 
1 129 ASN n 
1 130 CYS n 
1 131 VAL n 
1 132 HIS n 
1 133 ARG n 
1 134 ASP n 
1 135 ILE n 
1 136 ALA n 
1 137 VAL n 
1 138 ARG n 
1 139 ASN n 
1 140 ILE n 
1 141 LEU n 
1 142 VAL n 
1 143 ALA n 
1 144 SER n 
1 145 PRO n 
1 146 GLU n 
1 147 CYS n 
1 148 VAL n 
1 149 LYS n 
1 150 LEU n 
1 151 GLY n 
1 152 ASP n 
1 153 PHE n 
1 154 GLY n 
1 155 LEU n 
1 156 SER n 
1 157 ARG n 
1 158 TYR n 
1 159 ILE n 
1 160 GLU n 
1 161 ASP n 
1 162 GLU n 
1 163 ASP n 
1 164 TYR n 
1 165 TYR n 
1 166 LYS n 
1 167 ALA n 
1 168 SER n 
1 169 VAL n 
1 170 THR n 
1 171 ARG n 
1 172 LEU n 
1 173 PRO n 
1 174 ILE n 
1 175 LYS n 
1 176 TRP n 
1 177 MET n 
1 178 SER n 
1 179 PRO n 
1 180 GLU n 
1 181 SER n 
1 182 ILE n 
1 183 ASN n 
1 184 PHE n 
1 185 ARG n 
1 186 ARG n 
1 187 PHE n 
1 188 THR n 
1 189 THR n 
1 190 ALA n 
1 191 SER n 
1 192 ASP n 
1 193 VAL n 
1 194 TRP n 
1 195 MET n 
1 196 PHE n 
1 197 ALA n 
1 198 VAL n 
1 199 CYS n 
1 200 MET n 
1 201 TRP n 
1 202 GLU n 
1 203 ILE n 
1 204 LEU n 
1 205 SER n 
1 206 PHE n 
1 207 GLY n 
1 208 LYS n 
1 209 GLN n 
1 210 PRO n 
1 211 PHE n 
1 212 PHE n 
1 213 TRP n 
1 214 LEU n 
1 215 GLU n 
1 216 ASN n 
1 217 LYS n 
1 218 ASP n 
1 219 VAL n 
1 220 ILE n 
1 221 GLY n 
1 222 VAL n 
1 223 LEU n 
1 224 GLU n 
1 225 LYS n 
1 226 GLY n 
1 227 ASP n 
1 228 ARG n 
1 229 LEU n 
1 230 PRO n 
1 231 LYS n 
1 232 PRO n 
1 233 ASP n 
1 234 LEU n 
1 235 CYS n 
1 236 PRO n 
1 237 PRO n 
1 238 VAL n 
1 239 LEU n 
1 240 TYR n 
1 241 THR n 
1 242 LEU n 
1 243 MET n 
1 244 THR n 
1 245 ARG n 
1 246 CYS n 
1 247 TRP n 
1 248 ASP n 
1 249 TYR n 
1 250 ASP n 
1 251 PRO n 
1 252 SER n 
1 253 ASP n 
1 254 ARG n 
1 255 PRO n 
1 256 ARG n 
1 257 PHE n 
1 258 THR n 
1 259 GLU n 
1 260 LEU n 
1 261 VAL n 
1 262 CYS n 
1 263 SER n 
1 264 LEU n 
1 265 SER n 
1 266 ASP n 
1 267 VAL n 
1 268 TYR n 
1 269 GLN n 
1 270 MET n 
1 271 GLU n 
1 272 LYS n 
1 273 ASP n 
1 274 ILE n 
1 275 ALA n 
1 276 MET n 
1 277 GLU n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                Human 
_entity_src_nat.pdbx_organism_scientific   'Homo sapiens' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9606 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    FAK2_HUMAN 
_struct_ref.pdbx_db_accession          Q14289 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PQYGIAREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKNLDHPHIVKLIGIIEE
EPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYLESINCVHRDIAVRNILVASPECVKLGDFGLSRYIE
DEDYYKASVTRLPIKWMSPESINFRRFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLY
TLMTRCWDYDPSDRPRFTELVCSLSDVYQMEKDIAME
;
_struct_ref.pdbx_align_begin           416 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3FZP 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 277 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q14289 
_struct_ref_seq.db_align_beg                  416 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  692 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       416 
_struct_ref_seq.pdbx_auth_seq_align_end       692 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
AGS non-polymer         . 'PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER' 
;ATP-GAMMA-S; ADENOSINE 5'-(3-THIOTRIPHOSPHATE); ADENOSINE 5'-(GAMMA-THIOTRIPHOSPHATE); ADENOSINE-5'-DIPHOSPHATE MONOTHIOPHOSPHATE
;
'C10 H16 N5 O12 P3 S' 523.247 
ALA 'L-peptide linking' y ALANINE                                      ? 'C3 H7 N O2'          89.093  
ARG 'L-peptide linking' y ARGININE                                     ? 'C6 H15 N4 O2 1'      175.209 
ASN 'L-peptide linking' y ASPARAGINE                                   ? 'C4 H8 N2 O3'         132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                              ? 'C4 H7 N O4'          133.103 
CYS 'L-peptide linking' y CYSTEINE                                     ? 'C3 H7 N O2 S'        121.158 
GLN 'L-peptide linking' y GLUTAMINE                                    ? 'C5 H10 N2 O3'        146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                              ? 'C5 H9 N O4'          147.129 
GLY 'peptide linking'   y GLYCINE                                      ? 'C2 H5 N O2'          75.067  
HIS 'L-peptide linking' y HISTIDINE                                    ? 'C6 H10 N3 O2 1'      156.162 
HOH non-polymer         . WATER                                        ? 'H2 O'                18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                   ? 'C6 H13 N O2'         131.173 
LEU 'L-peptide linking' y LEUCINE                                      ? 'C6 H13 N O2'         131.173 
LYS 'L-peptide linking' y LYSINE                                       ? 'C6 H15 N2 O2 1'      147.195 
MET 'L-peptide linking' y METHIONINE                                   ? 'C5 H11 N O2 S'       149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                ? 'C9 H11 N O2'         165.189 
PRO 'L-peptide linking' y PROLINE                                      ? 'C5 H9 N O2'          115.130 
SER 'L-peptide linking' y SERINE                                       ? 'C3 H7 N O3'          105.093 
SO4 non-polymer         . 'SULFATE ION'                                ? 'O4 S -2'             96.063  
THR 'L-peptide linking' y THREONINE                                    ? 'C4 H9 N O3'          119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                   ? 'C11 H12 N2 O2'       204.225 
TYR 'L-peptide linking' y TYROSINE                                     ? 'C9 H11 N O3'         181.189 
VAL 'L-peptide linking' y VALINE                                       ? 'C5 H11 N O2'         117.146 
# 
_exptl.entry_id          3FZP 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.27 
_exptl_crystal.density_percent_sol   45.74 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_details    
'0.1M Citrate, 0.5-1.5M Lithium Sulfate, 0.2-0.4M Ammonium Sulfate, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2007-01-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3FZP 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30 
_reflns.d_resolution_high            2.1 
_reflns.number_obs                   15837 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         94.1 
_reflns.pdbx_Rmerge_I_obs            0.04 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        18.4 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.1 
_reflns_shell.d_res_low              2.18 
_reflns_shell.percent_possible_all   90.5 
_reflns_shell.Rmerge_I_obs           0.24 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.7 
_reflns_shell.pdbx_redundancy        2.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1527 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3FZP 
_refine.ls_number_reflns_obs                     14989 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    94.06 
_refine.ls_R_factor_obs                          0.21227 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.21071 
_refine.ls_R_factor_R_free                       0.23898 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  802 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.946 
_refine.correlation_coeff_Fo_to_Fc_free          0.925 
_refine.B_iso_mean                               47.727 
_refine.aniso_B[1][1]                            -0.19 
_refine.aniso_B[2][2]                            -1.58 
_refine.aniso_B[3][3]                            1.70 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.77 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.271 
_refine.pdbx_overall_ESU_R_Free                  0.199 
_refine.overall_SU_ML                            0.147 
_refine.overall_SU_B                             5.401 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2098 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         41 
_refine_hist.number_atoms_solvent             105 
_refine_hist.number_atoms_total               2244 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.015  0.022  ? 2188 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.713  1.992  ? 2969 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       7.007  5.000  ? 257  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       39.202 24.105 ? 95   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       18.547 15.000 ? 393  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.604 15.000 ? 12   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.147  0.200  ? 326  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.020  ? 1602 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.221  0.200  ? 998  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.313  0.200  ? 1459 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.205  0.200  ? 87   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.220  0.200  ? 48   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.252  0.200  ? 3    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.050  1.500  ? 1343 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.726  2.000  ? 2104 'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.248  3.000  ? 996  'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.455  4.500  ? 865  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.100 
_refine_ls_shell.d_res_low                        2.154 
_refine_ls_shell.number_reflns_R_work             1080 
_refine_ls_shell.R_factor_R_work                  0.234 
_refine_ls_shell.percent_reflns_obs               90.77 
_refine_ls_shell.R_factor_R_free                  0.270 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             51 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3FZP 
_struct.title                     'Crystal structure of PYK2 complexed with ATPgS' 
_struct.pdbx_descriptor           'Protein tyrosine kinase 2 beta (E.C.2.7.10.2)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3FZP 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;Kinase, ATPgS, DFG, Alternative splicing, ATP-binding, Cell membrane, Cytoplasm, Membrane, Nucleotide-binding, Phosphoprotein, Polymorphism, Transferase, Tyrosine-protein kinase
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 6   ? GLU A 8   ? ALA A 421 GLU A 423 5 ? 3  
HELX_P HELX_P2  2  CYS A 48  ? LEU A 66  ? CYS A 463 LEU A 481 1 ? 19 
HELX_P HELX_P3  3  GLU A 94  ? ASN A 102 ? GLU A 509 ASN A 517 1 ? 9  
HELX_P HELX_P4  4  LYS A 107 ? ILE A 128 ? LYS A 522 ILE A 543 1 ? 22 
HELX_P HELX_P5  5  ALA A 136 ? ARG A 138 ? ALA A 551 ARG A 553 5 ? 3  
HELX_P HELX_P6  6  PRO A 173 ? MET A 177 ? PRO A 588 MET A 592 5 ? 5  
HELX_P HELX_P7  7  SER A 178 ? ARG A 185 ? SER A 593 ARG A 600 1 ? 8  
HELX_P HELX_P8  8  THR A 188 ? SER A 205 ? THR A 603 SER A 620 1 ? 18 
HELX_P HELX_P9  9  GLU A 215 ? LYS A 217 ? GLU A 630 LYS A 632 5 ? 3  
HELX_P HELX_P10 10 ASP A 218 ? LYS A 225 ? ASP A 633 LYS A 640 1 ? 8  
HELX_P HELX_P11 11 PRO A 236 ? TRP A 247 ? PRO A 651 TRP A 662 1 ? 12 
HELX_P HELX_P12 12 ASP A 250 ? ARG A 254 ? ASP A 665 ARG A 669 5 ? 5  
HELX_P HELX_P13 13 ARG A 256 ? GLU A 277 ? ARG A 671 GLU A 692 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLU 
_struct_mon_prot_cis.label_seq_id           81 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLU 
_struct_mon_prot_cis.auth_seq_id            496 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    82 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     497 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -6.38 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 10  ? GLY A 19  ? VAL A 425 GLY A 434 
A 2 GLY A 22  ? THR A 30  ? GLY A 437 THR A 445 
A 3 LYS A 36  ? THR A 43  ? LYS A 451 THR A 458 
A 4 TRP A 84  ? GLU A 88  ? TRP A 499 GLU A 503 
A 5 LEU A 74  ? ILE A 78  ? LEU A 489 ILE A 493 
B 1 ILE A 140 ? SER A 144 ? ILE A 555 SER A 559 
B 2 CYS A 147 ? LEU A 150 ? CYS A 562 LEU A 565 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ASN A 13  ? N ASN A 428 O GLU A 26  ? O GLU A 441 
A 2 3 N TYR A 29  ? N TYR A 444 O ILE A 37  ? O ILE A 452 
A 3 4 N LYS A 42  ? N LYS A 457 O ILE A 85  ? O ILE A 500 
A 4 5 O ILE A 86  ? O ILE A 501 N ILE A 75  ? N ILE A 490 
B 1 2 N LEU A 141 ? N LEU A 556 O LYS A 149 ? O LYS A 564 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE AGS A 999' 
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A 2'   
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A 3'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 14 HOH E .   ? HOH A 16  . ? 1_555 ? 
2  AC1 14 GLY A 19  ? GLY A 434 . ? 1_555 ? 
3  AC1 14 PHE A 20  ? PHE A 435 . ? 1_555 ? 
4  AC1 14 PHE A 21  ? PHE A 436 . ? 1_555 ? 
5  AC1 14 VAL A 24  ? VAL A 439 . ? 1_555 ? 
6  AC1 14 ALA A 40  ? ALA A 455 . ? 1_555 ? 
7  AC1 14 LYS A 42  ? LYS A 457 . ? 1_555 ? 
8  AC1 14 GLU A 59  ? GLU A 474 . ? 1_555 ? 
9  AC1 14 GLU A 88  ? GLU A 503 . ? 1_555 ? 
10 AC1 14 LEU A 89  ? LEU A 504 . ? 1_555 ? 
11 AC1 14 TYR A 90  ? TYR A 505 . ? 1_555 ? 
12 AC1 14 GLU A 94  ? GLU A 509 . ? 1_555 ? 
13 AC1 14 LEU A 141 ? LEU A 556 . ? 1_555 ? 
14 AC1 14 PHE A 153 ? PHE A 568 . ? 1_555 ? 
15 AC2 4  HOH E .   ? HOH A 11  . ? 1_555 ? 
16 AC2 4  HOH E .   ? HOH A 36  . ? 1_555 ? 
17 AC2 4  LYS A 208 ? LYS A 623 . ? 1_555 ? 
18 AC2 4  ASP A 233 ? ASP A 648 . ? 1_555 ? 
19 AC3 4  HOH E .   ? HOH A 6   . ? 1_555 ? 
20 AC3 4  HOH E .   ? HOH A 83  . ? 1_555 ? 
21 AC3 4  HIS A 68  ? HIS A 483 . ? 1_555 ? 
22 AC3 4  LYS A 120 ? LYS A 535 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3FZP 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3FZP 
_atom_sites.fract_transf_matrix[1][1]   0.027067 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001157 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010792 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.023457 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . GLY A 1 4   ? -8.633  -12.554 1.089   1.00 57.60  ? 419 GLY A N     1 
ATOM   2    C CA    . GLY A 1 4   ? -7.236  -12.604 1.649   1.00 58.73  ? 419 GLY A CA    1 
ATOM   3    C C     . GLY A 1 4   ? -6.222  -13.544 0.958   1.00 59.16  ? 419 GLY A C     1 
ATOM   4    O O     . GLY A 1 4   ? -6.353  -13.861 -0.226  1.00 59.11  ? 419 GLY A O     1 
ATOM   5    N N     . ILE A 1 5   ? -5.178  -13.978 1.660   1.00 59.52  ? 420 ILE A N     1 
ATOM   6    C CA    . ILE A 1 5   ? -4.255  -14.890 0.994   1.00 58.73  ? 420 ILE A CA    1 
ATOM   7    C C     . ILE A 1 5   ? -4.324  -16.307 1.532   1.00 58.29  ? 420 ILE A C     1 
ATOM   8    O O     . ILE A 1 5   ? -4.428  -16.517 2.726   1.00 58.44  ? 420 ILE A O     1 
ATOM   9    C CB    . ILE A 1 5   ? -2.778  -14.348 0.798   1.00 58.53  ? 420 ILE A CB    1 
ATOM   10   C CG1   . ILE A 1 5   ? -1.781  -15.059 1.673   1.00 59.66  ? 420 ILE A CG1   1 
ATOM   11   C CG2   . ILE A 1 5   ? -2.672  -12.867 0.764   1.00 57.81  ? 420 ILE A CG2   1 
ATOM   12   C CD1   . ILE A 1 5   ? -1.175  -16.235 0.892   1.00 63.03  ? 420 ILE A CD1   1 
ATOM   13   N N     . ALA A 1 6   ? -4.314  -17.276 0.626   1.00 58.02  ? 421 ALA A N     1 
ATOM   14   C CA    . ALA A 1 6   ? -4.358  -18.662 1.013   1.00 58.11  ? 421 ALA A CA    1 
ATOM   15   C C     . ALA A 1 6   ? -3.054  -19.378 0.709   1.00 57.93  ? 421 ALA A C     1 
ATOM   16   O O     . ALA A 1 6   ? -2.412  -19.101 -0.290  1.00 58.12  ? 421 ALA A O     1 
ATOM   17   C CB    . ALA A 1 6   ? -5.516  -19.369 0.365   1.00 58.61  ? 421 ALA A CB    1 
ATOM   18   N N     . ARG A 1 7   ? -2.688  -20.298 1.586   1.00 57.88  ? 422 ARG A N     1 
ATOM   19   C CA    . ARG A 1 7   ? -1.433  -21.058 1.492   1.00 58.89  ? 422 ARG A CA    1 
ATOM   20   C C     . ARG A 1 7   ? -1.151  -21.604 0.088   1.00 58.88  ? 422 ARG A C     1 
ATOM   21   O O     . ARG A 1 7   ? -0.009  -21.819 -0.259  1.00 59.32  ? 422 ARG A O     1 
ATOM   22   C CB    . ARG A 1 7   ? -1.437  -22.215 2.491   1.00 57.98  ? 422 ARG A CB    1 
ATOM   23   C CG    . ARG A 1 7   ? -0.097  -22.972 2.606   1.00 58.64  ? 422 ARG A CG    1 
ATOM   24   C CD    . ARG A 1 7   ? 0.594   -22.680 3.933   1.00 60.45  ? 422 ARG A CD    1 
ATOM   25   N NE    . ARG A 1 7   ? -0.256  -22.993 5.089   1.00 57.95  ? 422 ARG A NE    1 
ATOM   26   C CZ    . ARG A 1 7   ? 0.034   -22.653 6.341   1.00 60.76  ? 422 ARG A CZ    1 
ATOM   27   N NH1   . ARG A 1 7   ? 1.149   -22.006 6.616   1.00 60.47  ? 422 ARG A NH1   1 
ATOM   28   N NH2   . ARG A 1 7   ? -0.801  -22.947 7.326   1.00 62.22  ? 422 ARG A NH2   1 
ATOM   29   N N     . GLU A 1 8   ? -2.203  -21.872 -0.689  1.00 59.52  ? 423 GLU A N     1 
ATOM   30   C CA    . GLU A 1 8   ? -2.053  -22.468 -2.018  1.00 58.95  ? 423 GLU A CA    1 
ATOM   31   C C     . GLU A 1 8   ? -1.402  -21.462 -2.915  1.00 56.91  ? 423 GLU A C     1 
ATOM   32   O O     . GLU A 1 8   ? -0.675  -21.810 -3.847  1.00 57.01  ? 423 GLU A O     1 
ATOM   33   C CB    . GLU A 1 8   ? -3.429  -22.938 -2.565  1.00 60.33  ? 423 GLU A CB    1 
ATOM   34   C CG    . GLU A 1 8   ? -3.865  -22.361 -3.945  1.00 63.77  ? 423 GLU A CG    1 
ATOM   35   C CD    . GLU A 1 8   ? -4.892  -23.238 -4.713  1.00 71.33  ? 423 GLU A CD    1 
ATOM   36   O OE1   . GLU A 1 8   ? -6.113  -22.870 -4.788  1.00 72.49  ? 423 GLU A OE1   1 
ATOM   37   O OE2   . GLU A 1 8   ? -4.471  -24.299 -5.252  1.00 74.82  ? 423 GLU A OE2   1 
ATOM   38   N N     . ASP A 1 9   ? -1.644  -20.195 -2.609  1.00 56.03  ? 424 ASP A N     1 
ATOM   39   C CA    . ASP A 1 9   ? -1.201  -19.085 -3.466  1.00 54.55  ? 424 ASP A CA    1 
ATOM   40   C C     . ASP A 1 9   ? 0.260   -18.788 -3.268  1.00 52.42  ? 424 ASP A C     1 
ATOM   41   O O     . ASP A 1 9   ? 0.826   -17.927 -3.978  1.00 51.59  ? 424 ASP A O     1 
ATOM   42   C CB    . ASP A 1 9   ? -1.969  -17.806 -3.140  1.00 55.36  ? 424 ASP A CB    1 
ATOM   43   C CG    . ASP A 1 9   ? -3.465  -18.041 -2.913  1.00 58.79  ? 424 ASP A CG    1 
ATOM   44   O OD1   . ASP A 1 9   ? -4.069  -18.835 -3.666  1.00 59.27  ? 424 ASP A OD1   1 
ATOM   45   O OD2   . ASP A 1 9   ? -4.024  -17.412 -1.965  1.00 60.71  ? 424 ASP A OD2   1 
ATOM   46   N N     . VAL A 1 10  ? 0.867   -19.469 -2.298  1.00 50.81  ? 425 VAL A N     1 
ATOM   47   C CA    . VAL A 1 10  ? 2.282   -19.238 -1.939  1.00 50.10  ? 425 VAL A CA    1 
ATOM   48   C C     . VAL A 1 10  ? 3.181   -20.494 -1.963  1.00 50.44  ? 425 VAL A C     1 
ATOM   49   O O     . VAL A 1 10  ? 2.959   -21.462 -1.226  1.00 52.38  ? 425 VAL A O     1 
ATOM   50   C CB    . VAL A 1 10  ? 2.358   -18.543 -0.562  1.00 50.41  ? 425 VAL A CB    1 
ATOM   51   C CG1   . VAL A 1 10  ? 3.826   -18.317 -0.099  1.00 50.63  ? 425 VAL A CG1   1 
ATOM   52   C CG2   . VAL A 1 10  ? 1.541   -17.271 -0.579  1.00 47.61  ? 425 VAL A CG2   1 
ATOM   53   N N     . VAL A 1 11  ? 4.223   -20.452 -2.773  1.00 48.52  ? 426 VAL A N     1 
ATOM   54   C CA    . VAL A 1 11  ? 5.169   -21.524 -2.930  1.00 48.71  ? 426 VAL A CA    1 
ATOM   55   C C     . VAL A 1 11  ? 6.610   -21.095 -2.434  1.00 49.16  ? 426 VAL A C     1 
ATOM   56   O O     . VAL A 1 11  ? 7.061   -19.996 -2.765  1.00 49.12  ? 426 VAL A O     1 
ATOM   57   C CB    . VAL A 1 11  ? 5.226   -21.892 -4.424  1.00 48.55  ? 426 VAL A CB    1 
ATOM   58   C CG1   . VAL A 1 11  ? 6.354   -22.812 -4.684  1.00 50.27  ? 426 VAL A CG1   1 
ATOM   59   C CG2   . VAL A 1 11  ? 3.864   -22.544 -4.890  1.00 46.67  ? 426 VAL A CG2   1 
ATOM   60   N N     . LEU A 1 12  ? 7.305   -21.946 -1.659  1.00 48.92  ? 427 LEU A N     1 
ATOM   61   C CA    . LEU A 1 12  ? 8.667   -21.654 -1.087  1.00 48.10  ? 427 LEU A CA    1 
ATOM   62   C C     . LEU A 1 12  ? 9.723   -22.194 -2.028  1.00 49.93  ? 427 LEU A C     1 
ATOM   63   O O     . LEU A 1 12  ? 9.674   -23.362 -2.428  1.00 49.92  ? 427 LEU A O     1 
ATOM   64   C CB    . LEU A 1 12  ? 8.869   -22.325 0.291   1.00 47.03  ? 427 LEU A CB    1 
ATOM   65   C CG    . LEU A 1 12  ? 7.873   -22.010 1.409   1.00 46.71  ? 427 LEU A CG    1 
ATOM   66   C CD1   . LEU A 1 12  ? 8.091   -22.690 2.772   1.00 46.57  ? 427 LEU A CD1   1 
ATOM   67   C CD2   . LEU A 1 12  ? 7.927   -20.483 1.584   1.00 47.53  ? 427 LEU A CD2   1 
ATOM   68   N N     . ASN A 1 13  ? 10.686  -21.375 -2.418  1.00 50.87  ? 428 ASN A N     1 
ATOM   69   C CA    . ASN A 1 13  ? 11.657  -21.832 -3.385  1.00 50.47  ? 428 ASN A CA    1 
ATOM   70   C C     . ASN A 1 13  ? 13.036  -22.087 -2.823  1.00 50.67  ? 428 ASN A C     1 
ATOM   71   O O     . ASN A 1 13  ? 13.669  -23.069 -3.174  1.00 48.98  ? 428 ASN A O     1 
ATOM   72   C CB    . ASN A 1 13  ? 11.662  -20.950 -4.617  1.00 51.60  ? 428 ASN A CB    1 
ATOM   73   C CG    . ASN A 1 13  ? 10.347  -21.064 -5.375  1.00 54.81  ? 428 ASN A CG    1 
ATOM   74   O OD1   . ASN A 1 13  ? 9.660   -22.089 -5.283  1.00 59.29  ? 428 ASN A OD1   1 
ATOM   75   N ND2   . ASN A 1 13  ? 9.963   -20.006 -6.082  1.00 55.79  ? 428 ASN A ND2   1 
ATOM   76   N N     . ARG A 1 14  ? 13.483  -21.214 -1.928  1.00 50.29  ? 429 ARG A N     1 
ATOM   77   C CA    . ARG A 1 14  ? 14.740  -21.425 -1.227  1.00 50.32  ? 429 ARG A CA    1 
ATOM   78   C C     . ARG A 1 14  ? 14.749  -20.720 0.125   1.00 49.68  ? 429 ARG A C     1 
ATOM   79   O O     . ARG A 1 14  ? 13.862  -19.950 0.447   1.00 50.31  ? 429 ARG A O     1 
ATOM   80   C CB    . ARG A 1 14  ? 15.900  -20.911 -2.059  1.00 49.36  ? 429 ARG A CB    1 
ATOM   81   C CG    . ARG A 1 14  ? 15.718  -19.517 -2.533  1.00 51.41  ? 429 ARG A CG    1 
ATOM   82   C CD    . ARG A 1 14  ? 17.056  -18.941 -3.006  1.00 56.10  ? 429 ARG A CD    1 
ATOM   83   N NE    . ARG A 1 14  ? 17.485  -19.582 -4.232  1.00 58.23  ? 429 ARG A NE    1 
ATOM   84   C CZ    . ARG A 1 14  ? 18.616  -20.284 -4.388  1.00 63.07  ? 429 ARG A CZ    1 
ATOM   85   N NH1   . ARG A 1 14  ? 19.479  -20.448 -3.378  1.00 60.20  ? 429 ARG A NH1   1 
ATOM   86   N NH2   . ARG A 1 14  ? 18.891  -20.828 -5.587  1.00 62.27  ? 429 ARG A NH2   1 
ATOM   87   N N     . ILE A 1 15  ? 15.765  -21.005 0.901   1.00 49.76  ? 430 ILE A N     1 
ATOM   88   C CA    . ILE A 1 15  ? 15.989  -20.303 2.126   1.00 51.01  ? 430 ILE A CA    1 
ATOM   89   C C     . ILE A 1 15  ? 16.432  -18.891 1.873   1.00 50.49  ? 430 ILE A C     1 
ATOM   90   O O     . ILE A 1 15  ? 17.140  -18.617 0.906   1.00 50.14  ? 430 ILE A O     1 
ATOM   91   C CB    . ILE A 1 15  ? 16.993  -21.099 2.960   1.00 51.77  ? 430 ILE A CB    1 
ATOM   92   C CG1   . ILE A 1 15  ? 16.188  -22.069 3.796   1.00 50.25  ? 430 ILE A CG1   1 
ATOM   93   C CG2   . ILE A 1 15  ? 17.891  -20.218 3.857   1.00 53.82  ? 430 ILE A CG2   1 
ATOM   94   C CD1   . ILE A 1 15  ? 16.824  -23.352 3.844   1.00 56.15  ? 430 ILE A CD1   1 
ATOM   95   N N     . LEU A 1 16  ? 15.958  -17.966 2.698   1.00 50.63  ? 431 LEU A N     1 
ATOM   96   C CA    . LEU A 1 16  ? 16.559  -16.629 2.683   1.00 51.51  ? 431 LEU A CA    1 
ATOM   97   C C     . LEU A 1 16  ? 17.497  -16.442 3.904   1.00 51.92  ? 431 LEU A C     1 
ATOM   98   O O     . LEU A 1 16  ? 18.565  -15.863 3.783   1.00 52.99  ? 431 LEU A O     1 
ATOM   99   C CB    . LEU A 1 16  ? 15.515  -15.515 2.698   1.00 50.70  ? 431 LEU A CB    1 
ATOM   100  C CG    . LEU A 1 16  ? 14.974  -14.777 1.498   1.00 53.03  ? 431 LEU A CG    1 
ATOM   101  C CD1   . LEU A 1 16  ? 13.913  -13.759 1.936   1.00 49.65  ? 431 LEU A CD1   1 
ATOM   102  C CD2   . LEU A 1 16  ? 16.099  -14.070 0.645   1.00 54.00  ? 431 LEU A CD2   1 
ATOM   103  N N     . GLY A 1 17  ? 17.067  -16.867 5.071   1.00 51.50  ? 432 GLY A N     1 
ATOM   104  C CA    . GLY A 1 17  ? 17.885  -16.673 6.236   1.00 54.09  ? 432 GLY A CA    1 
ATOM   105  C C     . GLY A 1 17  ? 17.116  -16.815 7.552   1.00 54.89  ? 432 GLY A C     1 
ATOM   106  O O     . GLY A 1 17  ? 15.889  -16.750 7.574   1.00 54.58  ? 432 GLY A O     1 
ATOM   107  N N     . GLU A 1 18  ? 17.865  -17.009 8.637   1.00 55.20  ? 433 GLU A N     1 
ATOM   108  C CA    . GLU A 1 18  ? 17.310  -17.128 9.980   1.00 56.85  ? 433 GLU A CA    1 
ATOM   109  C C     . GLU A 1 18  ? 16.900  -15.789 10.588  1.00 55.31  ? 433 GLU A C     1 
ATOM   110  O O     . GLU A 1 18  ? 17.746  -14.912 10.802  1.00 55.10  ? 433 GLU A O     1 
ATOM   111  C CB    . GLU A 1 18  ? 18.321  -17.783 10.917  1.00 57.41  ? 433 GLU A CB    1 
ATOM   112  C CG    . GLU A 1 18  ? 18.025  -19.197 11.291  1.00 62.70  ? 433 GLU A CG    1 
ATOM   113  C CD    . GLU A 1 18  ? 16.655  -19.413 11.976  1.00 67.95  ? 433 GLU A CD    1 
ATOM   114  O OE1   . GLU A 1 18  ? 16.227  -18.532 12.774  1.00 69.80  ? 433 GLU A OE1   1 
ATOM   115  O OE2   . GLU A 1 18  ? 16.039  -20.494 11.731  1.00 66.33  ? 433 GLU A OE2   1 
ATOM   116  N N     . GLY A 1 19  ? 15.615  -15.635 10.859  1.00 54.49  ? 434 GLY A N     1 
ATOM   117  C CA    . GLY A 1 19  ? 15.141  -14.512 11.681  1.00 55.67  ? 434 GLY A CA    1 
ATOM   118  C C     . GLY A 1 19  ? 15.004  -14.916 13.162  1.00 56.11  ? 434 GLY A C     1 
ATOM   119  O O     . GLY A 1 19  ? 15.122  -16.105 13.495  1.00 55.39  ? 434 GLY A O     1 
ATOM   120  N N     . PHE A 1 20  ? 14.736  -13.957 14.050  1.00 56.04  ? 435 PHE A N     1 
ATOM   121  C CA    . PHE A 1 20  ? 14.748  -14.248 15.493  1.00 56.63  ? 435 PHE A CA    1 
ATOM   122  C C     . PHE A 1 20  ? 13.852  -15.421 15.788  1.00 55.28  ? 435 PHE A C     1 
ATOM   123  O O     . PHE A 1 20  ? 14.270  -16.416 16.374  1.00 56.51  ? 435 PHE A O     1 
ATOM   124  C CB    . PHE A 1 20  ? 14.298  -13.030 16.332  1.00 58.73  ? 435 PHE A CB    1 
ATOM   125  C CG    . PHE A 1 20  ? 14.400  -13.245 17.830  1.00 61.36  ? 435 PHE A CG    1 
ATOM   126  C CD1   . PHE A 1 20  ? 15.165  -12.383 18.617  1.00 67.12  ? 435 PHE A CD1   1 
ATOM   127  C CD2   . PHE A 1 20  ? 13.757  -14.330 18.452  1.00 65.79  ? 435 PHE A CD2   1 
ATOM   128  C CE1   . PHE A 1 20  ? 15.241  -12.600 20.047  1.00 68.67  ? 435 PHE A CE1   1 
ATOM   129  C CE2   . PHE A 1 20  ? 13.842  -14.573 19.861  1.00 65.75  ? 435 PHE A CE2   1 
ATOM   130  C CZ    . PHE A 1 20  ? 14.572  -13.715 20.647  1.00 66.72  ? 435 PHE A CZ    1 
ATOM   131  N N     . PHE A 1 21  ? 12.609  -15.328 15.361  1.00 53.70  ? 436 PHE A N     1 
ATOM   132  C CA    . PHE A 1 21  ? 11.659  -16.397 15.599  1.00 51.89  ? 436 PHE A CA    1 
ATOM   133  C C     . PHE A 1 21  ? 11.753  -17.620 14.694  1.00 50.29  ? 436 PHE A C     1 
ATOM   134  O O     . PHE A 1 21  ? 11.003  -18.593 14.903  1.00 47.80  ? 436 PHE A O     1 
ATOM   135  C CB    . PHE A 1 21  ? 10.256  -15.838 15.479  1.00 52.71  ? 436 PHE A CB    1 
ATOM   136  C CG    . PHE A 1 21  ? 10.004  -14.631 16.343  1.00 54.59  ? 436 PHE A CG    1 
ATOM   137  C CD1   . PHE A 1 21  ? 10.284  -13.361 15.875  1.00 57.06  ? 436 PHE A CD1   1 
ATOM   138  C CD2   . PHE A 1 21  ? 9.478   -14.778 17.619  1.00 54.96  ? 436 PHE A CD2   1 
ATOM   139  C CE1   . PHE A 1 21  ? 10.026  -12.254 16.665  1.00 58.75  ? 436 PHE A CE1   1 
ATOM   140  C CE2   . PHE A 1 21  ? 9.230   -13.695 18.399  1.00 56.83  ? 436 PHE A CE2   1 
ATOM   141  C CZ    . PHE A 1 21  ? 9.475   -12.423 17.914  1.00 57.58  ? 436 PHE A CZ    1 
ATOM   142  N N     . GLY A 1 22  ? 12.561  -17.567 13.635  1.00 48.69  ? 437 GLY A N     1 
ATOM   143  C CA    . GLY A 1 22  ? 12.516  -18.686 12.699  1.00 46.97  ? 437 GLY A CA    1 
ATOM   144  C C     . GLY A 1 22  ? 13.000  -18.374 11.299  1.00 47.72  ? 437 GLY A C     1 
ATOM   145  O O     . GLY A 1 22  ? 13.432  -17.245 11.002  1.00 48.38  ? 437 GLY A O     1 
ATOM   146  N N     . GLU A 1 23  ? 12.933  -19.367 10.415  1.00 46.67  ? 438 GLU A N     1 
ATOM   147  C CA    . GLU A 1 23  ? 13.513  -19.241 9.051   1.00 45.41  ? 438 GLU A CA    1 
ATOM   148  C C     . GLU A 1 23  ? 12.720  -18.330 8.136   1.00 44.50  ? 438 GLU A C     1 
ATOM   149  O O     . GLU A 1 23  ? 11.475  -18.279 8.200   1.00 43.83  ? 438 GLU A O     1 
ATOM   150  C CB    . GLU A 1 23  ? 13.620  -20.649 8.427   1.00 47.13  ? 438 GLU A CB    1 
ATOM   151  C CG    . GLU A 1 23  ? 14.607  -20.759 7.289   1.00 51.51  ? 438 GLU A CG    1 
ATOM   152  C CD    . GLU A 1 23  ? 16.054  -20.511 7.718   1.00 54.50  ? 438 GLU A CD    1 
ATOM   153  O OE1   . GLU A 1 23  ? 16.426  -20.848 8.869   1.00 59.16  ? 438 GLU A OE1   1 
ATOM   154  O OE2   . GLU A 1 23  ? 16.808  -19.989 6.890   1.00 53.45  ? 438 GLU A OE2   1 
ATOM   155  N N     . VAL A 1 24  ? 13.431  -17.566 7.303   1.00 43.93  ? 439 VAL A N     1 
ATOM   156  C CA    . VAL A 1 24  ? 12.776  -16.779 6.288   1.00 44.80  ? 439 VAL A CA    1 
ATOM   157  C C     . VAL A 1 24  ? 13.087  -17.373 4.969   1.00 44.03  ? 439 VAL A C     1 
ATOM   158  O O     . VAL A 1 24  ? 14.204  -17.763 4.734   1.00 43.10  ? 439 VAL A O     1 
ATOM   159  C CB    . VAL A 1 24  ? 13.187  -15.285 6.296   1.00 45.34  ? 439 VAL A CB    1 
ATOM   160  C CG1   . VAL A 1 24  ? 12.378  -14.509 5.292   1.00 44.02  ? 439 VAL A CG1   1 
ATOM   161  C CG2   . VAL A 1 24  ? 12.962  -14.689 7.689   1.00 46.76  ? 439 VAL A CG2   1 
ATOM   162  N N     . TYR A 1 25  ? 12.061  -17.508 4.129   1.00 44.36  ? 440 TYR A N     1 
ATOM   163  C CA    . TYR A 1 25  ? 12.233  -18.220 2.866   1.00 44.41  ? 440 TYR A CA    1 
ATOM   164  C C     . TYR A 1 25  ? 11.907  -17.293 1.759   1.00 45.23  ? 440 TYR A C     1 
ATOM   165  O O     . TYR A 1 25  ? 11.092  -16.373 1.932   1.00 45.69  ? 440 TYR A O     1 
ATOM   166  C CB    . TYR A 1 25  ? 11.258  -19.392 2.764   1.00 44.47  ? 440 TYR A CB    1 
ATOM   167  C CG    . TYR A 1 25  ? 11.464  -20.426 3.807   1.00 43.01  ? 440 TYR A CG    1 
ATOM   168  C CD1   . TYR A 1 25  ? 10.774  -20.348 5.003   1.00 44.78  ? 440 TYR A CD1   1 
ATOM   169  C CD2   . TYR A 1 25  ? 12.371  -21.512 3.604   1.00 41.62  ? 440 TYR A CD2   1 
ATOM   170  C CE1   . TYR A 1 25  ? 10.972  -21.316 6.019   1.00 42.84  ? 440 TYR A CE1   1 
ATOM   171  C CE2   . TYR A 1 25  ? 12.572  -22.479 4.600   1.00 39.13  ? 440 TYR A CE2   1 
ATOM   172  C CZ    . TYR A 1 25  ? 11.846  -22.359 5.794   1.00 42.26  ? 440 TYR A CZ    1 
ATOM   173  O OH    . TYR A 1 25  ? 11.996  -23.231 6.804   1.00 45.20  ? 440 TYR A OH    1 
ATOM   174  N N     . GLU A 1 26  ? 12.468  -17.580 0.586   1.00 45.55  ? 441 GLU A N     1 
ATOM   175  C CA    . GLU A 1 26  ? 12.101  -16.875 -0.610  1.00 46.06  ? 441 GLU A CA    1 
ATOM   176  C C     . GLU A 1 26  ? 10.984  -17.679 -1.344  1.00 45.41  ? 441 GLU A C     1 
ATOM   177  O O     . GLU A 1 26  ? 11.083  -18.906 -1.492  1.00 44.71  ? 441 GLU A O     1 
ATOM   178  C CB    . GLU A 1 26  ? 13.402  -16.727 -1.430  1.00 47.62  ? 441 GLU A CB    1 
ATOM   179  C CG    . GLU A 1 26  ? 13.359  -15.905 -2.653  1.00 53.14  ? 441 GLU A CG    1 
ATOM   180  C CD    . GLU A 1 26  ? 14.708  -15.923 -3.439  1.00 61.46  ? 441 GLU A CD    1 
ATOM   181  O OE1   . GLU A 1 26  ? 15.810  -15.854 -2.806  1.00 60.73  ? 441 GLU A OE1   1 
ATOM   182  O OE2   . GLU A 1 26  ? 14.638  -16.001 -4.707  1.00 63.26  ? 441 GLU A OE2   1 
ATOM   183  N N     . GLY A 1 27  ? 9.954   -17.003 -1.829  1.00 44.97  ? 442 GLY A N     1 
ATOM   184  C CA    . GLY A 1 27  ? 8.869   -17.693 -2.557  1.00 45.39  ? 442 GLY A CA    1 
ATOM   185  C C     . GLY A 1 27  ? 8.175   -16.889 -3.645  1.00 46.14  ? 442 GLY A C     1 
ATOM   186  O O     . GLY A 1 27  ? 8.569   -15.769 -3.980  1.00 45.98  ? 442 GLY A O     1 
ATOM   187  N N     . VAL A 1 28  ? 7.089   -17.426 -4.186  1.00 45.89  ? 443 VAL A N     1 
ATOM   188  C CA    . VAL A 1 28  ? 6.324   -16.670 -5.161  1.00 45.33  ? 443 VAL A CA    1 
ATOM   189  C C     . VAL A 1 28  ? 4.909   -16.736 -4.749  1.00 45.96  ? 443 VAL A C     1 
ATOM   190  O O     . VAL A 1 28  ? 4.388   -17.846 -4.576  1.00 45.05  ? 443 VAL A O     1 
ATOM   191  C CB    . VAL A 1 28  ? 6.382   -17.331 -6.574  1.00 46.58  ? 443 VAL A CB    1 
ATOM   192  C CG1   . VAL A 1 28  ? 5.375   -16.687 -7.469  1.00 43.44  ? 443 VAL A CG1   1 
ATOM   193  C CG2   . VAL A 1 28  ? 7.849   -17.237 -7.141  1.00 43.58  ? 443 VAL A CG2   1 
ATOM   194  N N     . TYR A 1 29  ? 4.291   -15.570 -4.561  1.00 46.49  ? 444 TYR A N     1 
ATOM   195  C CA    . TYR A 1 29  ? 2.878   -15.485 -4.288  1.00 48.40  ? 444 TYR A CA    1 
ATOM   196  C C     . TYR A 1 29  ? 2.151   -15.194 -5.589  1.00 50.36  ? 444 TYR A C     1 
ATOM   197  O O     . TYR A 1 29  ? 2.600   -14.356 -6.404  1.00 49.38  ? 444 TYR A O     1 
ATOM   198  C CB    . TYR A 1 29  ? 2.620   -14.370 -3.293  1.00 49.14  ? 444 TYR A CB    1 
ATOM   199  C CG    . TYR A 1 29  ? 1.224   -13.856 -3.214  1.00 53.08  ? 444 TYR A CG    1 
ATOM   200  C CD1   . TYR A 1 29  ? 0.150   -14.703 -2.921  1.00 58.39  ? 444 TYR A CD1   1 
ATOM   201  C CD2   . TYR A 1 29  ? 0.960   -12.502 -3.429  1.00 56.11  ? 444 TYR A CD2   1 
ATOM   202  C CE1   . TYR A 1 29  ? -1.152  -14.201 -2.833  1.00 59.57  ? 444 TYR A CE1   1 
ATOM   203  C CE2   . TYR A 1 29  ? -0.326  -12.008 -3.362  1.00 57.15  ? 444 TYR A CE2   1 
ATOM   204  C CZ    . TYR A 1 29  ? -1.376  -12.855 -3.063  1.00 59.12  ? 444 TYR A CZ    1 
ATOM   205  O OH    . TYR A 1 29  ? -2.662  -12.327 -2.998  1.00 60.52  ? 444 TYR A OH    1 
ATOM   206  N N     . THR A 1 30  ? 1.037   -15.892 -5.803  1.00 51.96  ? 445 THR A N     1 
ATOM   207  C CA    . THR A 1 30  ? 0.194   -15.559 -6.954  1.00 54.78  ? 445 THR A CA    1 
ATOM   208  C C     . THR A 1 30  ? -1.095  -14.893 -6.506  1.00 56.79  ? 445 THR A C     1 
ATOM   209  O O     . THR A 1 30  ? -1.883  -15.454 -5.713  1.00 54.61  ? 445 THR A O     1 
ATOM   210  C CB    . THR A 1 30  ? -0.144  -16.812 -7.805  1.00 56.11  ? 445 THR A CB    1 
ATOM   211  O OG1   . THR A 1 30  ? 1.079   -17.380 -8.275  1.00 54.48  ? 445 THR A OG1   1 
ATOM   212  C CG2   . THR A 1 30  ? -1.013  -16.432 -8.991  1.00 54.02  ? 445 THR A CG2   1 
ATOM   213  N N     . ASN A 1 31  ? -1.241  -13.673 -7.004  1.00 59.55  ? 446 ASN A N     1 
ATOM   214  C CA    . ASN A 1 31  ? -2.405  -12.800 -6.808  1.00 63.00  ? 446 ASN A CA    1 
ATOM   215  C C     . ASN A 1 31  ? -3.802  -13.333 -6.958  1.00 63.86  ? 446 ASN A C     1 
ATOM   216  O O     . ASN A 1 31  ? -4.021  -14.424 -7.479  1.00 64.10  ? 446 ASN A O     1 
ATOM   217  C CB    . ASN A 1 31  ? -2.312  -11.659 -7.841  1.00 63.60  ? 446 ASN A CB    1 
ATOM   218  C CG    . ASN A 1 31  ? -1.816  -10.449 -7.230  1.00 65.70  ? 446 ASN A CG    1 
ATOM   219  O OD1   . ASN A 1 31  ? -1.545  -10.441 -6.031  1.00 72.35  ? 446 ASN A OD1   1 
ATOM   220  N ND2   . ASN A 1 31  ? -1.692  -9.409  -7.988  1.00 66.17  ? 446 ASN A ND2   1 
ATOM   221  N N     . HIS A 1 32  ? -4.764  -12.485 -6.576  1.00 65.61  ? 447 HIS A N     1 
ATOM   222  C CA    . HIS A 1 32  ? -6.159  -12.708 -6.974  1.00 67.38  ? 447 HIS A CA    1 
ATOM   223  C C     . HIS A 1 32  ? -6.307  -12.399 -8.472  1.00 67.17  ? 447 HIS A C     1 
ATOM   224  O O     . HIS A 1 32  ? -7.199  -12.909 -9.105  1.00 67.39  ? 447 HIS A O     1 
ATOM   225  C CB    . HIS A 1 32  ? -7.158  -11.915 -6.105  1.00 67.73  ? 447 HIS A CB    1 
ATOM   226  C CG    . HIS A 1 32  ? -7.167  -10.435 -6.372  1.00 70.45  ? 447 HIS A CG    1 
ATOM   227  N ND1   . HIS A 1 32  ? -6.248  -9.565  -5.812  1.00 73.82  ? 447 HIS A ND1   1 
ATOM   228  C CD2   . HIS A 1 32  ? -8.009  -9.666  -7.104  1.00 71.17  ? 447 HIS A CD2   1 
ATOM   229  C CE1   . HIS A 1 32  ? -6.499  -8.333  -6.219  1.00 71.88  ? 447 HIS A CE1   1 
ATOM   230  N NE2   . HIS A 1 32  ? -7.564  -8.367  -7.002  1.00 72.17  ? 447 HIS A NE2   1 
ATOM   231  N N     . LYS A 1 33  ? -5.386  -11.601 -9.023  1.00 67.92  ? 448 LYS A N     1 
ATOM   232  C CA    . LYS A 1 33  ? -5.315  -11.290 -10.465 1.00 68.21  ? 448 LYS A CA    1 
ATOM   233  C C     . LYS A 1 33  ? -4.311  -12.154 -11.239 1.00 67.59  ? 448 LYS A C     1 
ATOM   234  O O     . LYS A 1 33  ? -3.973  -11.843 -12.377 1.00 67.56  ? 448 LYS A O     1 
ATOM   235  C CB    . LYS A 1 33  ? -4.939  -9.821  -10.674 1.00 68.29  ? 448 LYS A CB    1 
ATOM   236  C CG    . LYS A 1 33  ? -5.656  -8.874  -9.725  1.00 70.56  ? 448 LYS A CG    1 
ATOM   237  C CD    . LYS A 1 33  ? -5.589  -7.414  -10.175 1.00 72.03  ? 448 LYS A CD    1 
ATOM   238  C CE    . LYS A 1 33  ? -4.198  -6.822  -9.978  1.00 73.49  ? 448 LYS A CE    1 
ATOM   239  N NZ    . LYS A 1 33  ? -4.136  -5.444  -10.581 1.00 74.99  ? 448 LYS A NZ    1 
ATOM   240  N N     . GLY A 1 34  ? -3.806  -13.201 -10.603 1.00 67.09  ? 449 GLY A N     1 
ATOM   241  C CA    . GLY A 1 34  ? -2.871  -14.139 -11.247 1.00 66.36  ? 449 GLY A CA    1 
ATOM   242  C C     . GLY A 1 34  ? -1.442  -13.663 -11.424 1.00 65.49  ? 449 GLY A C     1 
ATOM   243  O O     . GLY A 1 34  ? -0.632  -14.354 -12.049 1.00 65.61  ? 449 GLY A O     1 
ATOM   244  N N     . GLU A 1 35  ? -1.131  -12.484 -10.884 1.00 64.99  ? 450 GLU A N     1 
ATOM   245  C CA    . GLU A 1 35  ? 0.233   -11.932 -10.892 1.00 64.51  ? 450 GLU A CA    1 
ATOM   246  C C     . GLU A 1 35  ? 1.179   -12.688 -9.949  1.00 63.42  ? 450 GLU A C     1 
ATOM   247  O O     . GLU A 1 35  ? 0.831   -12.986 -8.783  1.00 63.32  ? 450 GLU A O     1 
ATOM   248  C CB    . GLU A 1 35  ? 0.218   -10.486 -10.445 1.00 64.66  ? 450 GLU A CB    1 
ATOM   249  C CG    . GLU A 1 35  ? 0.056   -9.530  -11.550 1.00 67.83  ? 450 GLU A CG    1 
ATOM   250  C CD    . GLU A 1 35  ? -0.888  -8.429  -11.166 1.00 71.56  ? 450 GLU A CD    1 
ATOM   251  O OE1   . GLU A 1 35  ? -0.599  -7.748  -10.159 1.00 70.23  ? 450 GLU A OE1   1 
ATOM   252  O OE2   . GLU A 1 35  ? -1.917  -8.242  -11.872 1.00 75.14  ? 450 GLU A OE2   1 
ATOM   253  N N     . LYS A 1 36  ? 2.373   -12.982 -10.437 1.00 61.90  ? 451 LYS A N     1 
ATOM   254  C CA    . LYS A 1 36  ? 3.336   -13.678 -9.605  1.00 60.33  ? 451 LYS A CA    1 
ATOM   255  C C     . LYS A 1 36  ? 4.218   -12.645 -8.898  1.00 58.56  ? 451 LYS A C     1 
ATOM   256  O O     . LYS A 1 36  ? 4.946   -11.903 -9.532  1.00 57.38  ? 451 LYS A O     1 
ATOM   257  C CB    . LYS A 1 36  ? 4.158   -14.648 -10.439 1.00 61.80  ? 451 LYS A CB    1 
ATOM   258  C CG    . LYS A 1 36  ? 3.368   -15.805 -11.013 1.00 63.08  ? 451 LYS A CG    1 
ATOM   259  C CD    . LYS A 1 36  ? 4.311   -16.627 -11.900 1.00 68.70  ? 451 LYS A CD    1 
ATOM   260  C CE    . LYS A 1 36  ? 3.545   -17.576 -12.878 1.00 71.93  ? 451 LYS A CE    1 
ATOM   261  N NZ    . LYS A 1 36  ? 4.278   -17.697 -14.215 1.00 75.11  ? 451 LYS A NZ    1 
ATOM   262  N N     . ILE A 1 37  ? 4.105   -12.586 -7.571  1.00 56.21  ? 452 ILE A N     1 
ATOM   263  C CA    . ILE A 1 37  ? 4.864   -11.652 -6.760  1.00 53.88  ? 452 ILE A CA    1 
ATOM   264  C C     . ILE A 1 37  ? 5.948   -12.436 -6.026  1.00 52.17  ? 452 ILE A C     1 
ATOM   265  O O     . ILE A 1 37  ? 5.663   -13.436 -5.346  1.00 51.61  ? 452 ILE A O     1 
ATOM   266  C CB    . ILE A 1 37  ? 3.923   -11.030 -5.715  1.00 55.37  ? 452 ILE A CB    1 
ATOM   267  C CG1   . ILE A 1 37  ? 2.522   -10.688 -6.335  1.00 56.69  ? 452 ILE A CG1   1 
ATOM   268  C CG2   . ILE A 1 37  ? 4.602   -9.959  -4.912  1.00 54.55  ? 452 ILE A CG2   1 
ATOM   269  C CD1   . ILE A 1 37  ? 2.442   -9.451  -7.225  1.00 58.59  ? 452 ILE A CD1   1 
ATOM   270  N N     . ASN A 1 38  ? 7.196   -12.002 -6.166  1.00 49.51  ? 453 ASN A N     1 
ATOM   271  C CA    . ASN A 1 38  ? 8.309   -12.546 -5.370  1.00 47.18  ? 453 ASN A CA    1 
ATOM   272  C C     . ASN A 1 38  ? 8.215   -12.065 -3.931  1.00 45.44  ? 453 ASN A C     1 
ATOM   273  O O     . ASN A 1 38  ? 8.069   -10.886 -3.701  1.00 44.71  ? 453 ASN A O     1 
ATOM   274  C CB    . ASN A 1 38  ? 9.573   -12.082 -5.995  1.00 47.36  ? 453 ASN A CB    1 
ATOM   275  C CG    . ASN A 1 38  ? 9.772   -12.697 -7.347  1.00 50.29  ? 453 ASN A CG    1 
ATOM   276  O OD1   . ASN A 1 38  ? 9.553   -13.889 -7.503  1.00 54.76  ? 453 ASN A OD1   1 
ATOM   277  N ND2   . ASN A 1 38  ? 10.145  -11.898 -8.335  1.00 53.44  ? 453 ASN A ND2   1 
ATOM   278  N N     . VAL A 1 39  ? 8.200   -12.975 -2.979  1.00 43.34  ? 454 VAL A N     1 
ATOM   279  C CA    . VAL A 1 39  ? 7.938   -12.606 -1.595  1.00 41.40  ? 454 VAL A CA    1 
ATOM   280  C C     . VAL A 1 39  ? 8.982   -13.214 -0.684  1.00 40.97  ? 454 VAL A C     1 
ATOM   281  O O     . VAL A 1 39  ? 9.685   -14.176 -1.058  1.00 41.12  ? 454 VAL A O     1 
ATOM   282  C CB    . VAL A 1 39  ? 6.588   -13.140 -1.126  1.00 40.52  ? 454 VAL A CB    1 
ATOM   283  C CG1   . VAL A 1 39  ? 5.467   -12.493 -1.873  1.00 41.83  ? 454 VAL A CG1   1 
ATOM   284  C CG2   . VAL A 1 39  ? 6.520   -14.702 -1.320  1.00 39.50  ? 454 VAL A CG2   1 
ATOM   285  N N     . ALA A 1 40  ? 9.114   -12.646 0.509   1.00 39.81  ? 455 ALA A N     1 
ATOM   286  C CA    . ALA A 1 40  ? 9.840   -13.326 1.562   1.00 40.26  ? 455 ALA A CA    1 
ATOM   287  C C     . ALA A 1 40  ? 8.826   -13.867 2.566   1.00 40.72  ? 455 ALA A C     1 
ATOM   288  O O     . ALA A 1 40  ? 7.880   -13.179 2.926   1.00 42.60  ? 455 ALA A O     1 
ATOM   289  C CB    . ALA A 1 40  ? 10.870  -12.370 2.271   1.00 39.36  ? 455 ALA A CB    1 
ATOM   290  N N     . VAL A 1 41  ? 8.991   -15.094 3.027   1.00 41.12  ? 456 VAL A N     1 
ATOM   291  C CA    . VAL A 1 41  ? 7.942   -15.650 3.858   1.00 42.05  ? 456 VAL A CA    1 
ATOM   292  C C     . VAL A 1 41  ? 8.563   -15.855 5.245   1.00 42.59  ? 456 VAL A C     1 
ATOM   293  O O     . VAL A 1 41  ? 9.454   -16.645 5.424   1.00 41.64  ? 456 VAL A O     1 
ATOM   294  C CB    . VAL A 1 41  ? 7.349   -16.959 3.320   1.00 42.34  ? 456 VAL A CB    1 
ATOM   295  C CG1   . VAL A 1 41  ? 6.243   -17.527 4.303   1.00 43.00  ? 456 VAL A CG1   1 
ATOM   296  C CG2   . VAL A 1 41  ? 6.814   -16.814 1.901   1.00 41.49  ? 456 VAL A CG2   1 
ATOM   297  N N     . LYS A 1 42  ? 8.113   -15.092 6.216   1.00 44.46  ? 457 LYS A N     1 
ATOM   298  C CA    . LYS A 1 42  ? 8.605   -15.336 7.591   1.00 46.14  ? 457 LYS A CA    1 
ATOM   299  C C     . LYS A 1 42  ? 7.832   -16.409 8.312   1.00 45.61  ? 457 LYS A C     1 
ATOM   300  O O     . LYS A 1 42  ? 6.619   -16.505 8.246   1.00 45.10  ? 457 LYS A O     1 
ATOM   301  C CB    . LYS A 1 42  ? 8.666   -14.079 8.441   1.00 44.73  ? 457 LYS A CB    1 
ATOM   302  C CG    . LYS A 1 42  ? 9.162   -12.888 7.661   1.00 48.61  ? 457 LYS A CG    1 
ATOM   303  C CD    . LYS A 1 42  ? 9.129   -11.639 8.537   1.00 53.00  ? 457 LYS A CD    1 
ATOM   304  C CE    . LYS A 1 42  ? 10.410  -11.583 9.375   1.00 54.44  ? 457 LYS A CE    1 
ATOM   305  N NZ    . LYS A 1 42  ? 10.495  -10.388 10.267  1.00 56.05  ? 457 LYS A NZ    1 
ATOM   306  N N     . THR A 1 43  ? 8.604   -17.204 9.033   1.00 47.06  ? 458 THR A N     1 
ATOM   307  C CA    . THR A 1 43  ? 8.151   -18.411 9.707   1.00 47.55  ? 458 THR A CA    1 
ATOM   308  C C     . THR A 1 43  ? 8.492   -18.317 11.240  1.00 48.18  ? 458 THR A C     1 
ATOM   309  O O     . THR A 1 43  ? 9.446   -17.642 11.639  1.00 47.16  ? 458 THR A O     1 
ATOM   310  C CB    . THR A 1 43  ? 8.866   -19.570 8.961   1.00 48.37  ? 458 THR A CB    1 
ATOM   311  O OG1   . THR A 1 43  ? 7.930   -20.220 8.043   1.00 49.37  ? 458 THR A OG1   1 
ATOM   312  C CG2   . THR A 1 43  ? 9.562   -20.461 9.878   1.00 45.24  ? 458 THR A CG2   1 
ATOM   313  N N     . CYS A 1 44  ? 7.662   -18.909 12.089  1.00 50.11  ? 459 CYS A N     1 
ATOM   314  C CA    . CYS A 1 44  ? 7.936   -18.951 13.547  1.00 52.90  ? 459 CYS A CA    1 
ATOM   315  C C     . CYS A 1 44  ? 8.219   -20.397 13.950  1.00 54.04  ? 459 CYS A C     1 
ATOM   316  O O     . CYS A 1 44  ? 7.387   -21.264 13.705  1.00 54.04  ? 459 CYS A O     1 
ATOM   317  C CB    . CYS A 1 44  ? 6.771   -18.431 14.378  1.00 52.15  ? 459 CYS A CB    1 
ATOM   318  S SG    . CYS A 1 44  ? 7.193   -18.234 16.187  1.00 57.30  ? 459 CYS A SG    1 
ATOM   319  N N     . LYS A 1 45  ? 9.388   -20.654 14.524  1.00 56.53  ? 460 LYS A N     1 
ATOM   320  C CA    . LYS A 1 45  ? 9.728   -22.010 15.010  1.00 61.14  ? 460 LYS A CA    1 
ATOM   321  C C     . LYS A 1 45  ? 8.684   -22.613 15.958  1.00 62.86  ? 460 LYS A C     1 
ATOM   322  O O     . LYS A 1 45  ? 8.398   -22.038 16.998  1.00 61.67  ? 460 LYS A O     1 
ATOM   323  C CB    . LYS A 1 45  ? 11.068  -21.983 15.737  1.00 61.08  ? 460 LYS A CB    1 
ATOM   324  C CG    . LYS A 1 45  ? 12.244  -22.084 14.824  1.00 63.05  ? 460 LYS A CG    1 
ATOM   325  C CD    . LYS A 1 45  ? 13.470  -21.545 15.538  1.00 69.84  ? 460 LYS A CD    1 
ATOM   326  C CE    . LYS A 1 45  ? 13.681  -22.227 16.912  1.00 70.90  ? 460 LYS A CE    1 
ATOM   327  N NZ    . LYS A 1 45  ? 15.154  -22.248 17.299  1.00 73.41  ? 460 LYS A NZ    1 
ATOM   328  N N     . LYS A 1 46  ? 8.126   -23.762 15.601  1.00 67.13  ? 461 LYS A N     1 
ATOM   329  C CA    . LYS A 1 46  ? 7.103   -24.436 16.437  1.00 71.69  ? 461 LYS A CA    1 
ATOM   330  C C     . LYS A 1 46  ? 7.501   -24.668 17.923  1.00 74.06  ? 461 LYS A C     1 
ATOM   331  O O     . LYS A 1 46  ? 7.670   -25.803 18.356  1.00 74.38  ? 461 LYS A O     1 
ATOM   332  C CB    . LYS A 1 46  ? 6.686   -25.759 15.796  1.00 71.64  ? 461 LYS A CB    1 
ATOM   333  C CG    . LYS A 1 46  ? 5.559   -25.622 14.771  1.00 73.23  ? 461 LYS A CG    1 
ATOM   334  C CD    . LYS A 1 46  ? 5.307   -26.962 14.065  1.00 76.01  ? 461 LYS A CD    1 
ATOM   335  C CE    . LYS A 1 46  ? 4.957   -28.082 15.089  1.00 78.27  ? 461 LYS A CE    1 
ATOM   336  N NZ    . LYS A 1 46  ? 4.334   -29.330 14.520  1.00 78.21  ? 461 LYS A NZ    1 
ATOM   337  N N     . ASP A 1 47  ? 7.632   -23.579 18.688  1.00 77.62  ? 462 ASP A N     1 
ATOM   338  C CA    . ASP A 1 47  ? 8.221   -23.623 20.033  1.00 80.34  ? 462 ASP A CA    1 
ATOM   339  C C     . ASP A 1 47  ? 7.467   -22.851 21.111  1.00 81.75  ? 462 ASP A C     1 
ATOM   340  O O     . ASP A 1 47  ? 6.378   -23.272 21.542  1.00 82.07  ? 462 ASP A O     1 
ATOM   341  C CB    . ASP A 1 47  ? 9.677   -23.139 20.023  1.00 80.83  ? 462 ASP A CB    1 
ATOM   342  C CG    . ASP A 1 47  ? 10.615  -24.162 19.445  1.00 81.89  ? 462 ASP A CG    1 
ATOM   343  O OD1   . ASP A 1 47  ? 10.124  -25.276 19.159  1.00 81.24  ? 462 ASP A OD1   1 
ATOM   344  O OD2   . ASP A 1 47  ? 11.823  -23.850 19.270  1.00 83.00  ? 462 ASP A OD2   1 
ATOM   345  N N     . CYS A 1 48  ? 8.059   -21.723 21.526  1.00 83.00  ? 463 CYS A N     1 
ATOM   346  C CA    . CYS A 1 48  ? 7.872   -21.185 22.882  1.00 84.34  ? 463 CYS A CA    1 
ATOM   347  C C     . CYS A 1 48  ? 6.427   -20.925 23.294  1.00 84.59  ? 463 CYS A C     1 
ATOM   348  O O     . CYS A 1 48  ? 6.031   -19.784 23.592  1.00 84.01  ? 463 CYS A O     1 
ATOM   349  C CB    . CYS A 1 48  ? 8.748   -19.964 23.137  1.00 84.45  ? 463 CYS A CB    1 
ATOM   350  S SG    . CYS A 1 48  ? 8.668   -19.466 24.872  1.00 87.44  ? 463 CYS A SG    1 
ATOM   351  N N     . THR A 1 49  ? 5.671   -22.031 23.334  1.00 85.17  ? 464 THR A N     1 
ATOM   352  C CA    . THR A 1 49  ? 4.213   -22.021 23.497  1.00 85.33  ? 464 THR A CA    1 
ATOM   353  C C     . THR A 1 49  ? 3.619   -20.643 23.114  1.00 85.36  ? 464 THR A C     1 
ATOM   354  O O     . THR A 1 49  ? 3.970   -20.071 22.067  1.00 85.44  ? 464 THR A O     1 
ATOM   355  C CB    . THR A 1 49  ? 3.771   -22.553 24.918  1.00 85.35  ? 464 THR A CB    1 
ATOM   356  O OG1   . THR A 1 49  ? 4.762   -22.217 25.915  1.00 84.04  ? 464 THR A OG1   1 
ATOM   357  C CG2   . THR A 1 49  ? 3.559   -24.092 24.868  1.00 84.63  ? 464 THR A CG2   1 
ATOM   358  N N     . LEU A 1 50  ? 2.743   -20.115 23.958  1.00 84.93  ? 465 LEU A N     1 
ATOM   359  C CA    . LEU A 1 50  ? 2.157   -18.796 23.728  1.00 84.52  ? 465 LEU A CA    1 
ATOM   360  C C     . LEU A 1 50  ? 3.137   -17.594 23.492  1.00 83.59  ? 465 LEU A C     1 
ATOM   361  O O     . LEU A 1 50  ? 2.924   -16.841 22.562  1.00 84.42  ? 465 LEU A O     1 
ATOM   362  C CB    . LEU A 1 50  ? 1.125   -18.475 24.840  1.00 85.24  ? 465 LEU A CB    1 
ATOM   363  C CG    . LEU A 1 50  ? -0.280  -19.137 24.823  1.00 85.82  ? 465 LEU A CG    1 
ATOM   364  C CD1   . LEU A 1 50  ? -0.220  -20.647 25.103  1.00 86.26  ? 465 LEU A CD1   1 
ATOM   365  C CD2   . LEU A 1 50  ? -1.295  -18.449 25.772  1.00 85.71  ? 465 LEU A CD2   1 
ATOM   366  N N     . ASP A 1 51  ? 4.204   -17.439 24.276  1.00 81.68  ? 466 ASP A N     1 
ATOM   367  C CA    . ASP A 1 51  ? 4.870   -16.134 24.415  1.00 80.34  ? 466 ASP A CA    1 
ATOM   368  C C     . ASP A 1 51  ? 5.654   -15.576 23.206  1.00 78.72  ? 466 ASP A C     1 
ATOM   369  O O     . ASP A 1 51  ? 5.492   -14.407 22.823  1.00 77.86  ? 466 ASP A O     1 
ATOM   370  C CB    . ASP A 1 51  ? 5.779   -16.112 25.658  1.00 80.77  ? 466 ASP A CB    1 
ATOM   371  C CG    . ASP A 1 51  ? 5.433   -14.958 26.631  1.00 83.21  ? 466 ASP A CG    1 
ATOM   372  O OD1   . ASP A 1 51  ? 4.424   -15.094 27.374  1.00 84.16  ? 466 ASP A OD1   1 
ATOM   373  O OD2   . ASP A 1 51  ? 6.169   -13.928 26.665  1.00 84.64  ? 466 ASP A OD2   1 
ATOM   374  N N     . ASN A 1 52  ? 6.545   -16.377 22.640  1.00 76.48  ? 467 ASN A N     1 
ATOM   375  C CA    . ASN A 1 52  ? 7.284   -15.917 21.490  1.00 74.93  ? 467 ASN A CA    1 
ATOM   376  C C     . ASN A 1 52  ? 6.421   -15.962 20.246  1.00 73.47  ? 467 ASN A C     1 
ATOM   377  O O     . ASN A 1 52  ? 6.595   -15.178 19.322  1.00 72.81  ? 467 ASN A O     1 
ATOM   378  C CB    . ASN A 1 52  ? 8.562   -16.708 21.313  1.00 75.16  ? 467 ASN A CB    1 
ATOM   379  C CG    . ASN A 1 52  ? 9.753   -16.003 21.908  1.00 76.68  ? 467 ASN A CG    1 
ATOM   380  O OD1   . ASN A 1 52  ? 10.689  -16.630 22.428  1.00 76.80  ? 467 ASN A OD1   1 
ATOM   381  N ND2   . ASN A 1 52  ? 9.738   -14.676 21.817  1.00 77.48  ? 467 ASN A ND2   1 
ATOM   382  N N     . LYS A 1 53  ? 5.461   -16.874 20.265  1.00 72.05  ? 468 LYS A N     1 
ATOM   383  C CA    . LYS A 1 53  ? 4.520   -17.059 19.166  1.00 71.36  ? 468 LYS A CA    1 
ATOM   384  C C     . LYS A 1 53  ? 3.436   -15.955 19.140  1.00 70.08  ? 468 LYS A C     1 
ATOM   385  O O     . LYS A 1 53  ? 2.929   -15.579 18.062  1.00 68.35  ? 468 LYS A O     1 
ATOM   386  C CB    . LYS A 1 53  ? 3.920   -18.467 19.256  1.00 71.46  ? 468 LYS A CB    1 
ATOM   387  C CG    . LYS A 1 53  ? 2.702   -18.758 18.383  1.00 74.61  ? 468 LYS A CG    1 
ATOM   388  C CD    . LYS A 1 53  ? 2.483   -20.298 18.236  1.00 79.20  ? 468 LYS A CD    1 
ATOM   389  C CE    . LYS A 1 53  ? 2.451   -21.024 19.594  1.00 80.30  ? 468 LYS A CE    1 
ATOM   390  N NZ    . LYS A 1 53  ? 3.306   -22.261 19.566  1.00 83.81  ? 468 LYS A NZ    1 
ATOM   391  N N     . GLU A 1 54  ? 3.104   -15.457 20.334  1.00 68.53  ? 469 GLU A N     1 
ATOM   392  C CA    . GLU A 1 54  ? 2.249   -14.307 20.477  1.00 68.05  ? 469 GLU A CA    1 
ATOM   393  C C     . GLU A 1 54  ? 3.026   -13.096 19.982  1.00 66.43  ? 469 GLU A C     1 
ATOM   394  O O     . GLU A 1 54  ? 2.499   -12.338 19.180  1.00 65.96  ? 469 GLU A O     1 
ATOM   395  C CB    . GLU A 1 54  ? 1.780   -14.136 21.946  1.00 69.59  ? 469 GLU A CB    1 
ATOM   396  C CG    . GLU A 1 54  ? 2.746   -13.309 22.871  1.00 72.61  ? 469 GLU A CG    1 
ATOM   397  C CD    . GLU A 1 54  ? 2.220   -13.077 24.302  1.00 76.91  ? 469 GLU A CD    1 
ATOM   398  O OE1   . GLU A 1 54  ? 2.926   -12.384 25.075  1.00 77.17  ? 469 GLU A OE1   1 
ATOM   399  O OE2   . GLU A 1 54  ? 1.118   -13.579 24.647  1.00 77.06  ? 469 GLU A OE2   1 
ATOM   400  N N     . LYS A 1 55  ? 4.281   -12.930 20.419  1.00 64.94  ? 470 LYS A N     1 
ATOM   401  C CA    . LYS A 1 55  ? 5.107   -11.790 19.954  1.00 64.56  ? 470 LYS A CA    1 
ATOM   402  C C     . LYS A 1 55  ? 5.334   -11.755 18.421  1.00 62.96  ? 470 LYS A C     1 
ATOM   403  O O     . LYS A 1 55  ? 5.459   -10.657 17.825  1.00 61.93  ? 470 LYS A O     1 
ATOM   404  C CB    . LYS A 1 55  ? 6.457   -11.703 20.687  1.00 65.36  ? 470 LYS A CB    1 
ATOM   405  C CG    . LYS A 1 55  ? 6.444   -10.931 22.015  1.00 69.87  ? 470 LYS A CG    1 
ATOM   406  C CD    . LYS A 1 55  ? 6.012   -9.434  21.846  1.00 75.95  ? 470 LYS A CD    1 
ATOM   407  C CE    . LYS A 1 55  ? 4.535   -9.128  22.297  1.00 78.17  ? 470 LYS A CE    1 
ATOM   408  N NZ    . LYS A 1 55  ? 4.455   -8.593  23.710  1.00 79.94  ? 470 LYS A NZ    1 
ATOM   409  N N     . PHE A 1 56  ? 5.379   -12.953 17.813  1.00 60.32  ? 471 PHE A N     1 
ATOM   410  C CA    . PHE A 1 56  ? 5.530   -13.121 16.355  1.00 58.28  ? 471 PHE A CA    1 
ATOM   411  C C     . PHE A 1 56  ? 4.340   -12.526 15.662  1.00 57.22  ? 471 PHE A C     1 
ATOM   412  O O     . PHE A 1 56  ? 4.484   -11.758 14.700  1.00 55.92  ? 471 PHE A O     1 
ATOM   413  C CB    . PHE A 1 56  ? 5.597   -14.618 15.979  1.00 57.32  ? 471 PHE A CB    1 
ATOM   414  C CG    . PHE A 1 56  ? 5.957   -14.882 14.534  1.00 56.21  ? 471 PHE A CG    1 
ATOM   415  C CD1   . PHE A 1 56  ? 7.183   -14.488 14.026  1.00 54.85  ? 471 PHE A CD1   1 
ATOM   416  C CD2   . PHE A 1 56  ? 5.063   -15.545 13.685  1.00 52.46  ? 471 PHE A CD2   1 
ATOM   417  C CE1   . PHE A 1 56  ? 7.502   -14.742 12.692  1.00 52.86  ? 471 PHE A CE1   1 
ATOM   418  C CE2   . PHE A 1 56  ? 5.383   -15.794 12.386  1.00 53.33  ? 471 PHE A CE2   1 
ATOM   419  C CZ    . PHE A 1 56  ? 6.601   -15.401 11.885  1.00 51.69  ? 471 PHE A CZ    1 
ATOM   420  N N     . MET A 1 57  ? 3.161   -12.899 16.140  1.00 56.04  ? 472 MET A N     1 
ATOM   421  C CA    . MET A 1 57  ? 1.908   -12.503 15.487  1.00 56.58  ? 472 MET A CA    1 
ATOM   422  C C     . MET A 1 57  ? 1.645   -11.047 15.728  1.00 55.36  ? 472 MET A C     1 
ATOM   423  O O     . MET A 1 57  ? 1.192   -10.318 14.846  1.00 56.21  ? 472 MET A O     1 
ATOM   424  C CB    . MET A 1 57  ? 0.727   -13.295 16.035  1.00 56.01  ? 472 MET A CB    1 
ATOM   425  C CG    . MET A 1 57  ? 0.115   -14.220 15.075  1.00 62.30  ? 472 MET A CG    1 
ATOM   426  S SD    . MET A 1 57  ? -0.557  -13.249 13.687  1.00 68.91  ? 472 MET A SD    1 
ATOM   427  C CE    . MET A 1 57  ? -0.959  -14.594 12.593  1.00 67.57  ? 472 MET A CE    1 
ATOM   428  N N     . SER A 1 58  ? 1.930   -10.619 16.943  1.00 53.65  ? 473 SER A N     1 
ATOM   429  C CA    . SER A 1 58  ? 1.716   -9.237  17.310  1.00 52.76  ? 473 SER A CA    1 
ATOM   430  C C     . SER A 1 58  ? 2.625   -8.285  16.495  1.00 51.53  ? 473 SER A C     1 
ATOM   431  O O     . SER A 1 58  ? 2.259   -7.166  16.166  1.00 50.30  ? 473 SER A O     1 
ATOM   432  C CB    . SER A 1 58  ? 1.861   -9.094  18.837  1.00 52.12  ? 473 SER A CB    1 
ATOM   433  O OG    . SER A 1 58  ? 2.607   -7.956  19.188  1.00 55.91  ? 473 SER A OG    1 
ATOM   434  N N     . GLU A 1 59  ? 3.809   -8.735  16.131  1.00 50.55  ? 474 GLU A N     1 
ATOM   435  C CA    . GLU A 1 59  ? 4.683   -7.872  15.363  1.00 50.13  ? 474 GLU A CA    1 
ATOM   436  C C     . GLU A 1 59  ? 4.217   -7.828  13.898  1.00 47.22  ? 474 GLU A C     1 
ATOM   437  O O     . GLU A 1 59  ? 4.237   -6.812  13.281  1.00 47.13  ? 474 GLU A O     1 
ATOM   438  C CB    . GLU A 1 59  ? 6.132   -8.334  15.480  1.00 51.97  ? 474 GLU A CB    1 
ATOM   439  C CG    . GLU A 1 59  ? 7.131   -7.374  14.777  1.00 59.15  ? 474 GLU A CG    1 
ATOM   440  C CD    . GLU A 1 59  ? 8.127   -8.109  13.885  1.00 68.62  ? 474 GLU A CD    1 
ATOM   441  O OE1   . GLU A 1 59  ? 8.809   -9.075  14.357  1.00 69.47  ? 474 GLU A OE1   1 
ATOM   442  O OE2   . GLU A 1 59  ? 8.217   -7.708  12.688  1.00 74.19  ? 474 GLU A OE2   1 
ATOM   443  N N     . ALA A 1 60  ? 3.769   -8.953  13.386  1.00 46.04  ? 475 ALA A N     1 
ATOM   444  C CA    . ALA A 1 60  ? 3.140   -9.067  12.071  1.00 44.71  ? 475 ALA A CA    1 
ATOM   445  C C     . ALA A 1 60  ? 1.949   -8.097  11.899  1.00 43.14  ? 475 ALA A C     1 
ATOM   446  O O     . ALA A 1 60  ? 1.763   -7.523  10.868  1.00 39.66  ? 475 ALA A O     1 
ATOM   447  C CB    . ALA A 1 60  ? 2.653   -10.533 11.860  1.00 43.40  ? 475 ALA A CB    1 
ATOM   448  N N     . VAL A 1 61  ? 1.129   -7.962  12.938  1.00 43.37  ? 476 VAL A N     1 
ATOM   449  C CA    . VAL A 1 61  ? -0.100  -7.154  12.813  1.00 43.54  ? 476 VAL A CA    1 
ATOM   450  C C     . VAL A 1 61  ? 0.199   -5.652  12.810  1.00 42.87  ? 476 VAL A C     1 
ATOM   451  O O     . VAL A 1 61  ? -0.305  -4.855  11.965  1.00 42.20  ? 476 VAL A O     1 
ATOM   452  C CB    . VAL A 1 61  ? -1.158  -7.587  13.815  1.00 44.29  ? 476 VAL A CB    1 
ATOM   453  C CG1   . VAL A 1 61  ? -2.418  -6.768  13.653  1.00 44.72  ? 476 VAL A CG1   1 
ATOM   454  C CG2   . VAL A 1 61  ? -1.476  -9.035  13.535  1.00 45.26  ? 476 VAL A CG2   1 
ATOM   455  N N     . ILE A 1 62  ? 1.094   -5.246  13.683  1.00 41.77  ? 477 ILE A N     1 
ATOM   456  C CA    . ILE A 1 62  ? 1.680   -3.933  13.477  1.00 42.65  ? 477 ILE A CA    1 
ATOM   457  C C     . ILE A 1 62  ? 2.219   -3.730  12.038  1.00 41.06  ? 477 ILE A C     1 
ATOM   458  O O     . ILE A 1 62  ? 1.807   -2.815  11.365  1.00 38.74  ? 477 ILE A O     1 
ATOM   459  C CB    . ILE A 1 62  ? 2.751   -3.616  14.522  1.00 43.32  ? 477 ILE A CB    1 
ATOM   460  C CG1   . ILE A 1 62  ? 2.047   -3.511  15.892  1.00 47.75  ? 477 ILE A CG1   1 
ATOM   461  C CG2   . ILE A 1 62  ? 3.357   -2.279  14.230  1.00 45.64  ? 477 ILE A CG2   1 
ATOM   462  C CD1   . ILE A 1 62  ? 2.986   -3.731  17.114  1.00 55.26  ? 477 ILE A CD1   1 
ATOM   463  N N     . MET A 1 63  ? 3.086   -4.612  11.548  1.00 40.69  ? 478 MET A N     1 
ATOM   464  C CA    . MET A 1 63  ? 3.680   -4.342  10.202  1.00 42.00  ? 478 MET A CA    1 
ATOM   465  C C     . MET A 1 63  ? 2.580   -4.358  9.179   1.00 41.94  ? 478 MET A C     1 
ATOM   466  O O     . MET A 1 63  ? 2.660   -3.611  8.199   1.00 42.99  ? 478 MET A O     1 
ATOM   467  C CB    . MET A 1 63  ? 4.772   -5.349  9.816   1.00 41.71  ? 478 MET A CB    1 
ATOM   468  C CG    . MET A 1 63  ? 5.975   -5.365  10.811  1.00 45.13  ? 478 MET A CG    1 
ATOM   469  S SD    . MET A 1 63  ? 6.804   -3.767  10.937  1.00 53.02  ? 478 MET A SD    1 
ATOM   470  C CE    . MET A 1 63  ? 6.812   -3.455  9.151   1.00 42.44  ? 478 MET A CE    1 
ATOM   471  N N     . LYS A 1 64  ? 1.535   -5.176  9.420   1.00 42.78  ? 479 LYS A N     1 
ATOM   472  C CA    . LYS A 1 64  ? 0.417   -5.243  8.486   1.00 43.48  ? 479 LYS A CA    1 
ATOM   473  C C     . LYS A 1 64  ? -0.258  -3.896  8.450   1.00 43.13  ? 479 LYS A C     1 
ATOM   474  O O     . LYS A 1 64  ? -0.681  -3.441  7.431   1.00 41.91  ? 479 LYS A O     1 
ATOM   475  C CB    . LYS A 1 64  ? -0.579  -6.329  8.902   1.00 44.92  ? 479 LYS A CB    1 
ATOM   476  C CG    . LYS A 1 64  ? -1.806  -6.481  7.961   1.00 47.26  ? 479 LYS A CG    1 
ATOM   477  C CD    . LYS A 1 64  ? -2.708  -7.652  8.397   1.00 52.43  ? 479 LYS A CD    1 
ATOM   478  C CE    . LYS A 1 64  ? -4.089  -7.229  8.863   1.00 58.92  ? 479 LYS A CE    1 
ATOM   479  N NZ    . LYS A 1 64  ? -4.081  -6.462  10.189  1.00 60.81  ? 479 LYS A NZ    1 
ATOM   480  N N     . ASN A 1 65  ? -0.372  -3.254  9.589   1.00 41.81  ? 480 ASN A N     1 
ATOM   481  C CA    . ASN A 1 65  ? -0.976  -1.948  9.587   1.00 43.89  ? 480 ASN A CA    1 
ATOM   482  C C     . ASN A 1 65  ? -0.041  -0.815  9.184   1.00 44.87  ? 480 ASN A C     1 
ATOM   483  O O     . ASN A 1 65  ? -0.433  0.342   9.135   1.00 46.60  ? 480 ASN A O     1 
ATOM   484  C CB    . ASN A 1 65  ? -1.541  -1.694  10.993  1.00 43.49  ? 480 ASN A CB    1 
ATOM   485  C CG    . ASN A 1 65  ? -2.814  -2.468  11.198  1.00 41.83  ? 480 ASN A CG    1 
ATOM   486  O OD1   . ASN A 1 65  ? -3.861  -2.042  10.763  1.00 37.46  ? 480 ASN A OD1   1 
ATOM   487  N ND2   . ASN A 1 65  ? -2.697  -3.643  11.699  1.00 40.25  ? 480 ASN A ND2   1 
ATOM   488  N N     . LEU A 1 66  ? 1.245   -1.111  9.072   1.00 44.82  ? 481 LEU A N     1 
ATOM   489  C CA    . LEU A 1 66  ? 2.134   -0.051  8.723   1.00 44.94  ? 481 LEU A CA    1 
ATOM   490  C C     . LEU A 1 66  ? 2.033   0.093   7.212   1.00 46.26  ? 481 LEU A C     1 
ATOM   491  O O     . LEU A 1 66  ? 1.960   -0.904  6.470   1.00 45.79  ? 481 LEU A O     1 
ATOM   492  C CB    . LEU A 1 66  ? 3.548   -0.375  9.234   1.00 45.14  ? 481 LEU A CB    1 
ATOM   493  C CG    . LEU A 1 66  ? 3.862   0.088   10.629  1.00 43.29  ? 481 LEU A CG    1 
ATOM   494  C CD1   . LEU A 1 66  ? 5.329   -0.167  11.010  1.00 46.30  ? 481 LEU A CD1   1 
ATOM   495  C CD2   . LEU A 1 66  ? 3.522   1.587   10.708  1.00 44.59  ? 481 LEU A CD2   1 
ATOM   496  N N     . ASP A 1 67  ? 1.891   1.302   6.733   1.00 48.45  ? 482 ASP A N     1 
ATOM   497  C CA    . ASP A 1 67  ? 2.092   1.466   5.307   1.00 51.32  ? 482 ASP A CA    1 
ATOM   498  C C     . ASP A 1 67  ? 2.742   2.790   4.993   1.00 50.41  ? 482 ASP A C     1 
ATOM   499  O O     . ASP A 1 67  ? 2.045   3.822   4.916   1.00 52.79  ? 482 ASP A O     1 
ATOM   500  C CB    . ASP A 1 67  ? 0.823   1.368   4.502   1.00 53.58  ? 482 ASP A CB    1 
ATOM   501  C CG    . ASP A 1 67  ? 1.125   1.380   3.022   1.00 60.42  ? 482 ASP A CG    1 
ATOM   502  O OD1   . ASP A 1 67  ? 1.849   2.334   2.578   1.00 65.69  ? 482 ASP A OD1   1 
ATOM   503  O OD2   . ASP A 1 67  ? 0.689   0.431   2.319   1.00 68.11  ? 482 ASP A OD2   1 
ATOM   504  N N     . HIS A 1 68  ? 4.058   2.763   4.856   1.00 46.46  ? 483 HIS A N     1 
ATOM   505  C CA    . HIS A 1 68  ? 4.800   3.916   4.455   1.00 43.59  ? 483 HIS A CA    1 
ATOM   506  C C     . HIS A 1 68  ? 5.640   3.442   3.285   1.00 41.61  ? 483 HIS A C     1 
ATOM   507  O O     . HIS A 1 68  ? 6.083   2.338   3.303   1.00 41.09  ? 483 HIS A O     1 
ATOM   508  C CB    . HIS A 1 68  ? 5.755   4.364   5.557   1.00 42.35  ? 483 HIS A CB    1 
ATOM   509  C CG    . HIS A 1 68  ? 6.441   5.636   5.236   1.00 38.60  ? 483 HIS A CG    1 
ATOM   510  N ND1   . HIS A 1 68  ? 7.587   5.676   4.494   1.00 36.37  ? 483 HIS A ND1   1 
ATOM   511  C CD2   . HIS A 1 68  ? 6.043   6.923   5.386   1.00 41.52  ? 483 HIS A CD2   1 
ATOM   512  C CE1   . HIS A 1 68  ? 7.955   6.942   4.322   1.00 39.82  ? 483 HIS A CE1   1 
ATOM   513  N NE2   . HIS A 1 68  ? 7.003   7.717   4.804   1.00 39.98  ? 483 HIS A NE2   1 
ATOM   514  N N     . PRO A 1 69  ? 5.862   4.291   2.267   1.00 40.46  ? 484 PRO A N     1 
ATOM   515  C CA    . PRO A 1 69  ? 6.719   3.833   1.157   1.00 39.63  ? 484 PRO A CA    1 
ATOM   516  C C     . PRO A 1 69  ? 8.173   3.417   1.561   1.00 37.72  ? 484 PRO A C     1 
ATOM   517  O O     . PRO A 1 69  ? 8.890   2.835   0.760   1.00 37.56  ? 484 PRO A O     1 
ATOM   518  C CB    . PRO A 1 69  ? 6.706   5.014   0.137   1.00 39.49  ? 484 PRO A CB    1 
ATOM   519  C CG    . PRO A 1 69  ? 5.863   6.120   0.740   1.00 42.50  ? 484 PRO A CG    1 
ATOM   520  C CD    . PRO A 1 69  ? 5.194   5.579   2.026   1.00 41.19  ? 484 PRO A CD    1 
ATOM   521  N N     . HIS A 1 70  ? 8.621   3.740   2.760   1.00 36.14  ? 485 HIS A N     1 
ATOM   522  C CA    . HIS A 1 70  ? 9.997   3.390   3.126   1.00 36.93  ? 485 HIS A CA    1 
ATOM   523  C C     . HIS A 1 70  ? 10.042  2.520   4.373   1.00 36.67  ? 485 HIS A C     1 
ATOM   524  O O     . HIS A 1 70  ? 11.033  2.508   5.106   1.00 35.69  ? 485 HIS A O     1 
ATOM   525  C CB    . HIS A 1 70  ? 10.874  4.671   3.193   1.00 34.97  ? 485 HIS A CB    1 
ATOM   526  C CG    . HIS A 1 70  ? 10.984  5.324   1.849   1.00 39.22  ? 485 HIS A CG    1 
ATOM   527  N ND1   . HIS A 1 70  ? 11.586  4.686   0.781   1.00 36.35  ? 485 HIS A ND1   1 
ATOM   528  C CD2   . HIS A 1 70  ? 10.455  6.469   1.354   1.00 36.98  ? 485 HIS A CD2   1 
ATOM   529  C CE1   . HIS A 1 70  ? 11.510  5.451   -0.287  1.00 39.06  ? 485 HIS A CE1   1 
ATOM   530  N NE2   . HIS A 1 70  ? 10.824  6.535   0.031   1.00 39.08  ? 485 HIS A NE2   1 
ATOM   531  N N     . ILE A 1 71  ? 8.941   1.775   4.576   1.00 37.04  ? 486 ILE A N     1 
ATOM   532  C CA    . ILE A 1 71  ? 8.917   0.691   5.554   1.00 35.67  ? 486 ILE A CA    1 
ATOM   533  C C     . ILE A 1 71  ? 8.586   -0.581  4.778   1.00 36.39  ? 486 ILE A C     1 
ATOM   534  O O     . ILE A 1 71  ? 7.756   -0.522  3.850   1.00 35.77  ? 486 ILE A O     1 
ATOM   535  C CB    . ILE A 1 71  ? 7.856   0.950   6.618   1.00 34.80  ? 486 ILE A CB    1 
ATOM   536  C CG1   . ILE A 1 71  ? 8.257   2.235   7.337   1.00 35.59  ? 486 ILE A CG1   1 
ATOM   537  C CG2   . ILE A 1 71  ? 7.676   -0.335  7.579   1.00 34.76  ? 486 ILE A CG2   1 
ATOM   538  C CD1   . ILE A 1 71  ? 7.304   2.700   8.552   1.00 36.48  ? 486 ILE A CD1   1 
ATOM   539  N N     . VAL A 1 72  ? 9.234   -1.694  5.139   1.00 36.50  ? 487 VAL A N     1 
ATOM   540  C CA    . VAL A 1 72  ? 8.953   -2.972  4.552   1.00 37.75  ? 487 VAL A CA    1 
ATOM   541  C C     . VAL A 1 72  ? 7.463   -3.274  4.455   1.00 38.42  ? 487 VAL A C     1 
ATOM   542  O O     . VAL A 1 72  ? 6.662   -3.009  5.410   1.00 37.76  ? 487 VAL A O     1 
ATOM   543  C CB    . VAL A 1 72  ? 9.715   -4.133  5.243   1.00 38.12  ? 487 VAL A CB    1 
ATOM   544  C CG1   . VAL A 1 72  ? 11.246  -3.931  4.965   1.00 37.31  ? 487 VAL A CG1   1 
ATOM   545  C CG2   . VAL A 1 72  ? 9.333   -4.238  6.791   1.00 38.42  ? 487 VAL A CG2   1 
ATOM   546  N N     . LYS A 1 73  ? 7.102   -3.864  3.314   1.00 37.22  ? 488 LYS A N     1 
ATOM   547  C CA    . LYS A 1 73  ? 5.696   -4.023  2.975   1.00 38.92  ? 488 LYS A CA    1 
ATOM   548  C C     . LYS A 1 73  ? 5.250   -5.459  3.303   1.00 38.38  ? 488 LYS A C     1 
ATOM   549  O O     . LYS A 1 73  ? 5.838   -6.416  2.785   1.00 37.82  ? 488 LYS A O     1 
ATOM   550  C CB    . LYS A 1 73  ? 5.512   -3.769  1.483   1.00 40.19  ? 488 LYS A CB    1 
ATOM   551  C CG    . LYS A 1 73  ? 4.073   -3.787  1.016   1.00 43.93  ? 488 LYS A CG    1 
ATOM   552  C CD    . LYS A 1 73  ? 3.974   -3.479  -0.457  1.00 49.23  ? 488 LYS A CD    1 
ATOM   553  C CE    . LYS A 1 73  ? 2.609   -3.857  -0.990  1.00 54.95  ? 488 LYS A CE    1 
ATOM   554  N NZ    . LYS A 1 73  ? 2.407   -5.347  -0.966  1.00 61.29  ? 488 LYS A NZ    1 
ATOM   555  N N     . LEU A 1 74  ? 4.248   -5.585  4.176   1.00 38.38  ? 489 LEU A N     1 
ATOM   556  C CA    . LEU A 1 74  ? 3.606   -6.858  4.558   1.00 39.86  ? 489 LEU A CA    1 
ATOM   557  C C     . LEU A 1 74  ? 2.511   -7.119  3.533   1.00 40.92  ? 489 LEU A C     1 
ATOM   558  O O     . LEU A 1 74  ? 1.672   -6.259  3.298   1.00 42.53  ? 489 LEU A O     1 
ATOM   559  C CB    . LEU A 1 74  ? 2.986   -6.808  5.988   1.00 39.08  ? 489 LEU A CB    1 
ATOM   560  C CG    . LEU A 1 74  ? 2.267   -8.163  6.357   1.00 40.46  ? 489 LEU A CG    1 
ATOM   561  C CD1   . LEU A 1 74  ? 2.404   -8.512  7.826   1.00 44.34  ? 489 LEU A CD1   1 
ATOM   562  C CD2   . LEU A 1 74  ? 0.759   -8.130  5.985   1.00 41.76  ? 489 LEU A CD2   1 
ATOM   563  N N     . ILE A 1 75  ? 2.525   -8.264  2.903   1.00 41.86  ? 490 ILE A N     1 
ATOM   564  C CA    . ILE A 1 75  ? 1.558   -8.547  1.846   1.00 44.34  ? 490 ILE A CA    1 
ATOM   565  C C     . ILE A 1 75  ? 0.385   -9.311  2.439   1.00 45.19  ? 490 ILE A C     1 
ATOM   566  O O     . ILE A 1 75  ? -0.764  -8.940  2.244   1.00 46.68  ? 490 ILE A O     1 
ATOM   567  C CB    . ILE A 1 75  ? 2.215   -9.327  0.658   1.00 43.61  ? 490 ILE A CB    1 
ATOM   568  C CG1   . ILE A 1 75  ? 2.999   -8.338  -0.225  1.00 43.65  ? 490 ILE A CG1   1 
ATOM   569  C CG2   . ILE A 1 75  ? 1.169   -9.975  -0.195  1.00 45.26  ? 490 ILE A CG2   1 
ATOM   570  C CD1   . ILE A 1 75  ? 4.009   -9.036  -1.152  1.00 40.60  ? 490 ILE A CD1   1 
ATOM   571  N N     . GLY A 1 76  ? 0.659   -10.349 3.201   1.00 45.58  ? 491 GLY A N     1 
ATOM   572  C CA    . GLY A 1 76  ? -0.455  -10.963 3.933   1.00 46.29  ? 491 GLY A CA    1 
ATOM   573  C C     . GLY A 1 76  ? 0.034   -11.860 5.021   1.00 46.48  ? 491 GLY A C     1 
ATOM   574  O O     . GLY A 1 76  ? 1.248   -12.010 5.182   1.00 44.39  ? 491 GLY A O     1 
ATOM   575  N N     . ILE A 1 77  ? -0.912  -12.420 5.781   1.00 46.82  ? 492 ILE A N     1 
ATOM   576  C CA    . ILE A 1 77  ? -0.596  -13.317 6.877   1.00 47.24  ? 492 ILE A CA    1 
ATOM   577  C C     . ILE A 1 77  ? -1.385  -14.603 6.736   1.00 47.91  ? 492 ILE A C     1 
ATOM   578  O O     . ILE A 1 77  ? -2.590  -14.552 6.541   1.00 46.69  ? 492 ILE A O     1 
ATOM   579  C CB    . ILE A 1 77  ? -1.051  -12.697 8.264   1.00 47.29  ? 492 ILE A CB    1 
ATOM   580  C CG1   . ILE A 1 77  ? -0.350  -11.361 8.514   1.00 48.11  ? 492 ILE A CG1   1 
ATOM   581  C CG2   . ILE A 1 77  ? -0.768  -13.700 9.341   1.00 45.96  ? 492 ILE A CG2   1 
ATOM   582  C CD1   . ILE A 1 77  ? -0.622  -10.711 9.935   1.00 53.07  ? 492 ILE A CD1   1 
ATOM   583  N N     . ILE A 1 78  ? -0.714  -15.740 6.816   1.00 48.79  ? 493 ILE A N     1 
ATOM   584  C CA    . ILE A 1 78  ? -1.388  -17.029 6.873   1.00 51.63  ? 493 ILE A CA    1 
ATOM   585  C C     . ILE A 1 78  ? -1.268  -17.539 8.287   1.00 53.18  ? 493 ILE A C     1 
ATOM   586  O O     . ILE A 1 78  ? -0.219  -17.993 8.701   1.00 52.62  ? 493 ILE A O     1 
ATOM   587  C CB    . ILE A 1 78  ? -0.799  -18.063 5.907   1.00 50.88  ? 493 ILE A CB    1 
ATOM   588  C CG1   . ILE A 1 78  ? -1.004  -17.568 4.475   1.00 50.18  ? 493 ILE A CG1   1 
ATOM   589  C CG2   . ILE A 1 78  ? -1.524  -19.441 6.094   1.00 52.45  ? 493 ILE A CG2   1 
ATOM   590  C CD1   . ILE A 1 78  ? -0.117  -18.271 3.449   1.00 51.05  ? 493 ILE A CD1   1 
ATOM   591  N N     . GLU A 1 79  ? -2.371  -17.447 9.019   1.00 57.04  ? 494 GLU A N     1 
ATOM   592  C CA    . GLU A 1 79  ? -2.390  -17.677 10.458  1.00 60.54  ? 494 GLU A CA    1 
ATOM   593  C C     . GLU A 1 79  ? -2.369  -19.162 10.875  1.00 61.69  ? 494 GLU A C     1 
ATOM   594  O O     . GLU A 1 79  ? -1.579  -19.580 11.733  1.00 62.17  ? 494 GLU A O     1 
ATOM   595  C CB    . GLU A 1 79  ? -3.595  -16.947 11.018  1.00 61.26  ? 494 GLU A CB    1 
ATOM   596  C CG    . GLU A 1 79  ? -3.867  -17.183 12.490  1.00 67.34  ? 494 GLU A CG    1 
ATOM   597  C CD    . GLU A 1 79  ? -5.135  -16.443 12.902  1.00 73.66  ? 494 GLU A CD    1 
ATOM   598  O OE1   . GLU A 1 79  ? -6.172  -17.111 13.214  1.00 77.11  ? 494 GLU A OE1   1 
ATOM   599  O OE2   . GLU A 1 79  ? -5.094  -15.183 12.854  1.00 74.98  ? 494 GLU A OE2   1 
ATOM   600  N N     . GLU A 1 80  ? -3.201  -19.984 10.262  1.00 63.92  ? 495 GLU A N     1 
ATOM   601  C CA    . GLU A 1 80  ? -3.133  -21.422 10.579  1.00 66.00  ? 495 GLU A CA    1 
ATOM   602  C C     . GLU A 1 80  ? -1.695  -21.993 10.640  1.00 65.77  ? 495 GLU A C     1 
ATOM   603  O O     . GLU A 1 80  ? -0.852  -21.698 9.756   1.00 65.24  ? 495 GLU A O     1 
ATOM   604  C CB    . GLU A 1 80  ? -3.996  -22.235 9.606   1.00 66.95  ? 495 GLU A CB    1 
ATOM   605  C CG    . GLU A 1 80  ? -5.458  -22.470 10.122  1.00 71.43  ? 495 GLU A CG    1 
ATOM   606  C CD    . GLU A 1 80  ? -5.620  -23.698 11.048  1.00 73.99  ? 495 GLU A CD    1 
ATOM   607  O OE1   . GLU A 1 80  ? -6.782  -24.129 11.209  1.00 74.15  ? 495 GLU A OE1   1 
ATOM   608  O OE2   . GLU A 1 80  ? -4.610  -24.224 11.608  1.00 75.54  ? 495 GLU A OE2   1 
ATOM   609  N N     . GLU A 1 81  ? -1.415  -22.807 11.668  1.00 64.98  ? 496 GLU A N     1 
ATOM   610  C CA    . GLU A 1 81  ? -0.113  -23.506 11.771  1.00 65.10  ? 496 GLU A CA    1 
ATOM   611  C C     . GLU A 1 81  ? 0.267   -24.215 10.446  1.00 63.36  ? 496 GLU A C     1 
ATOM   612  O O     . GLU A 1 81  ? -0.571  -24.893 9.831   1.00 63.87  ? 496 GLU A O     1 
ATOM   613  C CB    . GLU A 1 81  ? -0.119  -24.509 12.970  1.00 66.64  ? 496 GLU A CB    1 
ATOM   614  C CG    . GLU A 1 81  ? -0.988  -25.871 12.777  1.00 68.58  ? 496 GLU A CG    1 
ATOM   615  C CD    . GLU A 1 81  ? -1.455  -26.577 14.119  1.00 73.42  ? 496 GLU A CD    1 
ATOM   616  O OE1   . GLU A 1 81  ? -1.130  -26.115 15.256  1.00 72.70  ? 496 GLU A OE1   1 
ATOM   617  O OE2   . GLU A 1 81  ? -2.158  -27.611 14.028  1.00 75.09  ? 496 GLU A OE2   1 
ATOM   618  N N     . PRO A 1 82  ? 1.520   -24.057 9.974   1.00 61.84  ? 497 PRO A N     1 
ATOM   619  C CA    . PRO A 1 82  ? 2.543   -23.194 10.489  1.00 60.79  ? 497 PRO A CA    1 
ATOM   620  C C     . PRO A 1 82  ? 2.357   -21.768 9.911   1.00 59.54  ? 497 PRO A C     1 
ATOM   621  O O     . PRO A 1 82  ? 2.191   -21.579 8.709   1.00 58.24  ? 497 PRO A O     1 
ATOM   622  C CB    . PRO A 1 82  ? 3.825   -23.845 9.956   1.00 61.14  ? 497 PRO A CB    1 
ATOM   623  C CG    . PRO A 1 82  ? 3.445   -24.345 8.615   1.00 60.88  ? 497 PRO A CG    1 
ATOM   624  C CD    . PRO A 1 82  ? 1.999   -24.801 8.787   1.00 61.35  ? 497 PRO A CD    1 
ATOM   625  N N     . THR A 1 83  ? 2.371   -20.796 10.801  1.00 58.39  ? 498 THR A N     1 
ATOM   626  C CA    . THR A 1 83  ? 2.056   -19.428 10.465  1.00 57.34  ? 498 THR A CA    1 
ATOM   627  C C     . THR A 1 83  ? 3.094   -18.869 9.485   1.00 55.33  ? 498 THR A C     1 
ATOM   628  O O     . THR A 1 83  ? 4.308   -19.022 9.696   1.00 55.66  ? 498 THR A O     1 
ATOM   629  C CB    . THR A 1 83  ? 2.040   -18.604 11.747  1.00 58.00  ? 498 THR A CB    1 
ATOM   630  O OG1   . THR A 1 83  ? 1.236   -19.294 12.720  1.00 60.72  ? 498 THR A OG1   1 
ATOM   631  C CG2   . THR A 1 83  ? 1.471   -17.208 11.498  1.00 57.91  ? 498 THR A CG2   1 
ATOM   632  N N     . TRP A 1 84  ? 2.604   -18.248 8.417   1.00 51.63  ? 499 TRP A N     1 
ATOM   633  C CA    . TRP A 1 84  ? 3.448   -17.596 7.425   1.00 49.44  ? 499 TRP A CA    1 
ATOM   634  C C     . TRP A 1 84  ? 3.125   -16.114 7.330   1.00 47.92  ? 499 TRP A C     1 
ATOM   635  O O     . TRP A 1 84  ? 1.999   -15.749 6.987   1.00 46.75  ? 499 TRP A O     1 
ATOM   636  C CB    . TRP A 1 84  ? 3.172   -18.220 6.055   1.00 49.71  ? 499 TRP A CB    1 
ATOM   637  C CG    . TRP A 1 84  ? 3.779   -19.545 5.862   1.00 49.85  ? 499 TRP A CG    1 
ATOM   638  C CD1   . TRP A 1 84  ? 4.442   -20.292 6.802   1.00 48.97  ? 499 TRP A CD1   1 
ATOM   639  C CD2   . TRP A 1 84  ? 3.813   -20.310 4.636   1.00 49.59  ? 499 TRP A CD2   1 
ATOM   640  N NE1   . TRP A 1 84  ? 4.878   -21.468 6.232   1.00 47.97  ? 499 TRP A NE1   1 
ATOM   641  C CE2   . TRP A 1 84  ? 4.525   -21.492 4.905   1.00 49.19  ? 499 TRP A CE2   1 
ATOM   642  C CE3   . TRP A 1 84  ? 3.339   -20.088 3.334   1.00 51.35  ? 499 TRP A CE3   1 
ATOM   643  C CZ2   . TRP A 1 84  ? 4.736   -22.469 3.938   1.00 50.50  ? 499 TRP A CZ2   1 
ATOM   644  C CZ3   . TRP A 1 84  ? 3.539   -21.060 2.381   1.00 53.61  ? 499 TRP A CZ3   1 
ATOM   645  C CH2   . TRP A 1 84  ? 4.247   -22.238 2.684   1.00 53.22  ? 499 TRP A CH2   1 
ATOM   646  N N     . ILE A 1 85  ? 4.119   -15.274 7.571   1.00 45.75  ? 500 ILE A N     1 
ATOM   647  C CA    . ILE A 1 85  ? 4.058   -13.835 7.221   1.00 44.35  ? 500 ILE A CA    1 
ATOM   648  C C     . ILE A 1 85  ? 4.712   -13.587 5.824   1.00 43.21  ? 500 ILE A C     1 
ATOM   649  O O     . ILE A 1 85  ? 5.908   -13.803 5.654   1.00 42.91  ? 500 ILE A O     1 
ATOM   650  C CB    . ILE A 1 85  ? 4.825   -12.976 8.217   1.00 43.81  ? 500 ILE A CB    1 
ATOM   651  C CG1   . ILE A 1 85  ? 4.482   -13.339 9.657   1.00 46.53  ? 500 ILE A CG1   1 
ATOM   652  C CG2   . ILE A 1 85  ? 4.617   -11.460 7.943   1.00 42.33  ? 500 ILE A CG2   1 
ATOM   653  C CD1   . ILE A 1 85  ? 5.383   -12.513 10.702  1.00 49.50  ? 500 ILE A CD1   1 
ATOM   654  N N     . ILE A 1 86  ? 3.906   -13.146 4.866   1.00 41.55  ? 501 ILE A N     1 
ATOM   655  C CA    . ILE A 1 86  ? 4.346   -12.859 3.477   1.00 40.74  ? 501 ILE A CA    1 
ATOM   656  C C     . ILE A 1 86  ? 4.672   -11.383 3.246   1.00 39.62  ? 501 ILE A C     1 
ATOM   657  O O     . ILE A 1 86  ? 3.810   -10.499 3.325   1.00 40.72  ? 501 ILE A O     1 
ATOM   658  C CB    . ILE A 1 86  ? 3.298   -13.299 2.504   1.00 40.89  ? 501 ILE A CB    1 
ATOM   659  C CG1   . ILE A 1 86  ? 2.940   -14.796 2.744   1.00 42.24  ? 501 ILE A CG1   1 
ATOM   660  C CG2   . ILE A 1 86  ? 3.791   -13.067 1.011   1.00 41.62  ? 501 ILE A CG2   1 
ATOM   661  C CD1   . ILE A 1 86  ? 1.468   -14.992 2.617   1.00 45.39  ? 501 ILE A CD1   1 
ATOM   662  N N     . MET A 1 87  ? 5.942   -11.103 3.042   1.00 37.76  ? 502 MET A N     1 
ATOM   663  C CA    . MET A 1 87  ? 6.436   -9.758  2.885   1.00 39.93  ? 502 MET A CA    1 
ATOM   664  C C     . MET A 1 87  ? 6.857   -9.583  1.417   1.00 40.05  ? 502 MET A C     1 
ATOM   665  O O     . MET A 1 87  ? 7.146   -10.589 0.782   1.00 41.42  ? 502 MET A O     1 
ATOM   666  C CB    . MET A 1 87  ? 7.694   -9.632  3.693   1.00 37.24  ? 502 MET A CB    1 
ATOM   667  C CG    . MET A 1 87  ? 7.515   -9.975  5.187   1.00 43.24  ? 502 MET A CG    1 
ATOM   668  S SD    . MET A 1 87  ? 6.293   -8.889  6.023   1.00 44.54  ? 502 MET A SD    1 
ATOM   669  C CE    . MET A 1 87  ? 7.087   -7.275  5.928   1.00 40.57  ? 502 MET A CE    1 
ATOM   670  N N     . GLU A 1 88  ? 6.986   -8.348  0.917   1.00 40.52  ? 503 GLU A N     1 
ATOM   671  C CA    . GLU A 1 88  ? 7.618   -8.131  -0.423  1.00 39.05  ? 503 GLU A CA    1 
ATOM   672  C C     . GLU A 1 88  ? 9.027   -8.546  -0.337  1.00 38.40  ? 503 GLU A C     1 
ATOM   673  O O     . GLU A 1 88  ? 9.680   -8.250  0.709   1.00 37.79  ? 503 GLU A O     1 
ATOM   674  C CB    . GLU A 1 88  ? 7.752   -6.660  -0.722  1.00 38.66  ? 503 GLU A CB    1 
ATOM   675  C CG    . GLU A 1 88  ? 6.651   -6.047  -1.510  1.00 45.76  ? 503 GLU A CG    1 
ATOM   676  C CD    . GLU A 1 88  ? 7.078   -4.679  -2.062  1.00 51.41  ? 503 GLU A CD    1 
ATOM   677  O OE1   . GLU A 1 88  ? 7.225   -3.719  -1.260  1.00 52.47  ? 503 GLU A OE1   1 
ATOM   678  O OE2   . GLU A 1 88  ? 7.297   -4.578  -3.293  1.00 53.55  ? 503 GLU A OE2   1 
ATOM   679  N N     . LEU A 1 89  ? 9.566   -9.146  -1.418  1.00 36.36  ? 504 LEU A N     1 
ATOM   680  C CA    . LEU A 1 89  ? 10.956  -9.567  -1.389  1.00 37.70  ? 504 LEU A CA    1 
ATOM   681  C C     . LEU A 1 89  ? 11.763  -8.408  -1.895  1.00 37.83  ? 504 LEU A C     1 
ATOM   682  O O     . LEU A 1 89  ? 11.397  -7.815  -2.887  1.00 39.63  ? 504 LEU A O     1 
ATOM   683  C CB    . LEU A 1 89  ? 11.230  -10.747 -2.310  1.00 39.44  ? 504 LEU A CB    1 
ATOM   684  C CG    . LEU A 1 89  ? 12.738  -11.141 -2.377  1.00 39.44  ? 504 LEU A CG    1 
ATOM   685  C CD1   . LEU A 1 89  ? 13.091  -11.807 -1.182  1.00 36.96  ? 504 LEU A CD1   1 
ATOM   686  C CD2   . LEU A 1 89  ? 12.994  -12.044 -3.518  1.00 48.03  ? 504 LEU A CD2   1 
ATOM   687  N N     . TYR A 1 90  ? 12.839  -8.075  -1.227  1.00 37.87  ? 505 TYR A N     1 
ATOM   688  C CA    . TYR A 1 90  ? 13.643  -6.909  -1.622  1.00 40.40  ? 505 TYR A CA    1 
ATOM   689  C C     . TYR A 1 90  ? 14.924  -7.522  -2.110  1.00 42.02  ? 505 TYR A C     1 
ATOM   690  O O     . TYR A 1 90  ? 15.744  -8.044  -1.308  1.00 41.80  ? 505 TYR A O     1 
ATOM   691  C CB    . TYR A 1 90  ? 13.822  -5.860  -0.478  1.00 40.18  ? 505 TYR A CB    1 
ATOM   692  C CG    . TYR A 1 90  ? 12.487  -5.256  -0.069  1.00 42.07  ? 505 TYR A CG    1 
ATOM   693  C CD1   . TYR A 1 90  ? 11.963  -5.464  1.190   1.00 41.90  ? 505 TYR A CD1   1 
ATOM   694  C CD2   . TYR A 1 90  ? 11.717  -4.547  -0.974  1.00 40.09  ? 505 TYR A CD2   1 
ATOM   695  C CE1   . TYR A 1 90  ? 10.735  -4.958  1.546   1.00 39.75  ? 505 TYR A CE1   1 
ATOM   696  C CE2   . TYR A 1 90  ? 10.448  -4.075  -0.636  1.00 43.53  ? 505 TYR A CE2   1 
ATOM   697  C CZ    . TYR A 1 90  ? 9.979   -4.268  0.643   1.00 42.21  ? 505 TYR A CZ    1 
ATOM   698  O OH    . TYR A 1 90  ? 8.740   -3.775  0.993   1.00 41.94  ? 505 TYR A OH    1 
ATOM   699  N N     . PRO A 1 91  ? 15.101  -7.457  -3.457  1.00 43.27  ? 506 PRO A N     1 
ATOM   700  C CA    . PRO A 1 91  ? 16.069  -8.233  -4.208  1.00 43.66  ? 506 PRO A CA    1 
ATOM   701  C C     . PRO A 1 91  ? 17.492  -7.841  -4.018  1.00 44.03  ? 506 PRO A C     1 
ATOM   702  O O     . PRO A 1 91  ? 18.360  -8.553  -4.495  1.00 46.13  ? 506 PRO A O     1 
ATOM   703  C CB    . PRO A 1 91  ? 15.668  -8.003  -5.710  1.00 43.52  ? 506 PRO A CB    1 
ATOM   704  C CG    . PRO A 1 91  ? 15.024  -6.654  -5.747  1.00 43.70  ? 506 PRO A CG    1 
ATOM   705  C CD    . PRO A 1 91  ? 14.395  -6.455  -4.294  1.00 43.41  ? 506 PRO A CD    1 
ATOM   706  N N     . TYR A 1 92  ? 17.772  -6.698  -3.403  1.00 43.38  ? 507 TYR A N     1 
ATOM   707  C CA    . TYR A 1 92  ? 19.184  -6.276  -3.196  1.00 41.34  ? 507 TYR A CA    1 
ATOM   708  C C     . TYR A 1 92  ? 19.595  -6.543  -1.745  1.00 40.81  ? 507 TYR A C     1 
ATOM   709  O O     . TYR A 1 92  ? 20.688  -6.212  -1.326  1.00 41.55  ? 507 TYR A O     1 
ATOM   710  C CB    . TYR A 1 92  ? 19.367  -4.794  -3.548  1.00 41.31  ? 507 TYR A CB    1 
ATOM   711  C CG    . TYR A 1 92  ? 19.269  -4.494  -4.998  1.00 41.67  ? 507 TYR A CG    1 
ATOM   712  C CD1   . TYR A 1 92  ? 18.055  -4.205  -5.572  1.00 46.59  ? 507 TYR A CD1   1 
ATOM   713  C CD2   . TYR A 1 92  ? 20.395  -4.524  -5.817  1.00 47.15  ? 507 TYR A CD2   1 
ATOM   714  C CE1   . TYR A 1 92  ? 17.933  -3.940  -6.912  1.00 49.10  ? 507 TYR A CE1   1 
ATOM   715  C CE2   . TYR A 1 92  ? 20.292  -4.269  -7.184  1.00 50.71  ? 507 TYR A CE2   1 
ATOM   716  C CZ    . TYR A 1 92  ? 19.048  -3.976  -7.718  1.00 51.24  ? 507 TYR A CZ    1 
ATOM   717  O OH    . TYR A 1 92  ? 18.878  -3.711  -9.046  1.00 52.58  ? 507 TYR A OH    1 
ATOM   718  N N     . GLY A 1 93  ? 18.707  -7.151  -0.962  1.00 40.88  ? 508 GLY A N     1 
ATOM   719  C CA    . GLY A 1 93  ? 19.112  -7.584  0.413   1.00 41.07  ? 508 GLY A CA    1 
ATOM   720  C C     . GLY A 1 93  ? 19.356  -6.404  1.345   1.00 39.78  ? 508 GLY A C     1 
ATOM   721  O O     . GLY A 1 93  ? 18.768  -5.349  1.168   1.00 39.18  ? 508 GLY A O     1 
ATOM   722  N N     . GLU A 1 94  ? 20.173  -6.607  2.371   1.00 39.57  ? 509 GLU A N     1 
ATOM   723  C CA    . GLU A 1 94  ? 20.410  -5.610  3.394   1.00 40.05  ? 509 GLU A CA    1 
ATOM   724  C C     . GLU A 1 94  ? 21.301  -4.467  2.929   1.00 40.24  ? 509 GLU A C     1 
ATOM   725  O O     . GLU A 1 94  ? 22.293  -4.680  2.187   1.00 39.71  ? 509 GLU A O     1 
ATOM   726  C CB    . GLU A 1 94  ? 21.014  -6.227  4.662   1.00 40.48  ? 509 GLU A CB    1 
ATOM   727  C CG    . GLU A 1 94  ? 20.123  -7.307  5.337   1.00 40.61  ? 509 GLU A CG    1 
ATOM   728  C CD    . GLU A 1 94  ? 20.840  -8.034  6.488   1.00 47.97  ? 509 GLU A CD    1 
ATOM   729  O OE1   . GLU A 1 94  ? 22.045  -7.699  6.817   1.00 46.09  ? 509 GLU A OE1   1 
ATOM   730  O OE2   . GLU A 1 94  ? 20.177  -8.934  7.065   1.00 49.74  ? 509 GLU A OE2   1 
ATOM   731  N N     . LEU A 1 95  ? 20.914  -3.258  3.373   1.00 39.40  ? 510 LEU A N     1 
ATOM   732  C CA    . LEU A 1 95  ? 21.642  -2.039  3.090   1.00 38.98  ? 510 LEU A CA    1 
ATOM   733  C C     . LEU A 1 95  ? 23.118  -2.132  3.489   1.00 39.30  ? 510 LEU A C     1 
ATOM   734  O O     . LEU A 1 95  ? 23.961  -1.708  2.754   1.00 40.28  ? 510 LEU A O     1 
ATOM   735  C CB    . LEU A 1 95  ? 20.995  -0.806  3.743   1.00 37.90  ? 510 LEU A CB    1 
ATOM   736  C CG    . LEU A 1 95  ? 21.648  0.537   3.397   1.00 33.09  ? 510 LEU A CG    1 
ATOM   737  C CD1   . LEU A 1 95  ? 21.659  0.707   1.872   1.00 35.24  ? 510 LEU A CD1   1 
ATOM   738  C CD2   . LEU A 1 95  ? 20.862  1.697   3.953   1.00 31.52  ? 510 LEU A CD2   1 
ATOM   739  N N     . GLY A 1 96  ? 23.420  -2.628  4.670   1.00 40.90  ? 511 GLY A N     1 
ATOM   740  C CA    . GLY A 1 96  ? 24.831  -2.688  5.052   1.00 40.54  ? 511 GLY A CA    1 
ATOM   741  C C     . GLY A 1 96  ? 25.683  -3.470  4.034   1.00 40.73  ? 511 GLY A C     1 
ATOM   742  O O     . GLY A 1 96  ? 26.746  -2.992  3.633   1.00 40.08  ? 511 GLY A O     1 
ATOM   743  N N     . HIS A 1 97  ? 25.251  -4.677  3.668   1.00 40.06  ? 512 HIS A N     1 
ATOM   744  C CA    . HIS A 1 97  ? 25.915  -5.456  2.586   1.00 40.88  ? 512 HIS A CA    1 
ATOM   745  C C     . HIS A 1 97  ? 25.942  -4.741  1.278   1.00 40.30  ? 512 HIS A C     1 
ATOM   746  O O     . HIS A 1 97  ? 26.938  -4.726  0.629   1.00 39.64  ? 512 HIS A O     1 
ATOM   747  C CB    . HIS A 1 97  ? 25.241  -6.811  2.402   1.00 41.12  ? 512 HIS A CB    1 
ATOM   748  C CG    . HIS A 1 97  ? 25.307  -7.638  3.628   1.00 43.65  ? 512 HIS A CG    1 
ATOM   749  N ND1   . HIS A 1 97  ? 24.264  -8.422  4.063   1.00 46.13  ? 512 HIS A ND1   1 
ATOM   750  C CD2   . HIS A 1 97  ? 26.289  -7.758  4.551   1.00 40.58  ? 512 HIS A CD2   1 
ATOM   751  C CE1   . HIS A 1 97  ? 24.632  -9.049  5.171   1.00 45.27  ? 512 HIS A CE1   1 
ATOM   752  N NE2   . HIS A 1 97  ? 25.860  -8.665  5.479   1.00 45.74  ? 512 HIS A NE2   1 
ATOM   753  N N     . TYR A 1 98  ? 24.837  -4.088  0.917   1.00 40.84  ? 513 TYR A N     1 
ATOM   754  C CA    . TYR A 1 98  ? 24.692  -3.443  -0.380  1.00 40.97  ? 513 TYR A CA    1 
ATOM   755  C C     . TYR A 1 98  ? 25.637  -2.241  -0.458  1.00 42.59  ? 513 TYR A C     1 
ATOM   756  O O     . TYR A 1 98  ? 26.228  -1.952  -1.511  1.00 42.83  ? 513 TYR A O     1 
ATOM   757  C CB    . TYR A 1 98  ? 23.256  -2.962  -0.516  1.00 40.47  ? 513 TYR A CB    1 
ATOM   758  C CG    . TYR A 1 98  ? 23.009  -2.268  -1.784  1.00 39.77  ? 513 TYR A CG    1 
ATOM   759  C CD1   . TYR A 1 98  ? 22.724  -2.971  -2.957  1.00 41.22  ? 513 TYR A CD1   1 
ATOM   760  C CD2   . TYR A 1 98  ? 23.065  -0.892  -1.841  1.00 40.73  ? 513 TYR A CD2   1 
ATOM   761  C CE1   . TYR A 1 98  ? 22.541  -2.280  -4.158  1.00 41.65  ? 513 TYR A CE1   1 
ATOM   762  C CE2   . TYR A 1 98  ? 22.859  -0.234  -2.986  1.00 39.79  ? 513 TYR A CE2   1 
ATOM   763  C CZ    . TYR A 1 98  ? 22.607  -0.927  -4.155  1.00 42.69  ? 513 TYR A CZ    1 
ATOM   764  O OH    . TYR A 1 98  ? 22.398  -0.166  -5.313  1.00 47.14  ? 513 TYR A OH    1 
ATOM   765  N N     . LEU A 1 99  ? 25.805  -1.544  0.666   1.00 42.06  ? 514 LEU A N     1 
ATOM   766  C CA    . LEU A 1 99  ? 26.788  -0.441  0.711   1.00 42.89  ? 514 LEU A CA    1 
ATOM   767  C C     . LEU A 1 99  ? 28.207  -0.962  0.593   1.00 44.49  ? 514 LEU A C     1 
ATOM   768  O O     . LEU A 1 99  ? 29.046  -0.316  -0.018  1.00 45.06  ? 514 LEU A O     1 
ATOM   769  C CB    . LEU A 1 99  ? 26.707  0.370   1.999   1.00 41.44  ? 514 LEU A CB    1 
ATOM   770  C CG    . LEU A 1 99  ? 25.430  1.173   2.268   1.00 42.95  ? 514 LEU A CG    1 
ATOM   771  C CD1   . LEU A 1 99  ? 25.273  1.527   3.773   1.00 33.06  ? 514 LEU A CD1   1 
ATOM   772  C CD2   . LEU A 1 99  ? 25.363  2.407   1.339   1.00 39.34  ? 514 LEU A CD2   1 
ATOM   773  N N     . GLU A 1 100 ? 28.482  -2.092  1.232   1.00 46.16  ? 515 GLU A N     1 
ATOM   774  C CA    . GLU A 1 100 ? 29.801  -2.694  1.161   1.00 48.65  ? 515 GLU A CA    1 
ATOM   775  C C     . GLU A 1 100 ? 30.163  -3.066  -0.266  1.00 48.57  ? 515 GLU A C     1 
ATOM   776  O O     . GLU A 1 100 ? 31.256  -2.725  -0.694  1.00 48.01  ? 515 GLU A O     1 
ATOM   777  C CB    . GLU A 1 100 ? 29.952  -3.913  2.118   1.00 49.80  ? 515 GLU A CB    1 
ATOM   778  C CG    . GLU A 1 100 ? 30.049  -3.504  3.599   1.00 53.01  ? 515 GLU A CG    1 
ATOM   779  C CD    . GLU A 1 100 ? 29.349  -4.469  4.589   1.00 59.21  ? 515 GLU A CD    1 
ATOM   780  O OE1   . GLU A 1 100 ? 28.641  -3.902  5.452   1.00 63.00  ? 515 GLU A OE1   1 
ATOM   781  O OE2   . GLU A 1 100 ? 29.461  -5.734  4.502   1.00 58.60  ? 515 GLU A OE2   1 
ATOM   782  N N     . ARG A 1 101 ? 29.256  -3.727  -0.987  1.00 48.87  ? 516 ARG A N     1 
ATOM   783  C CA    . ARG A 1 101 ? 29.489  -4.169  -2.367  1.00 50.53  ? 516 ARG A CA    1 
ATOM   784  C C     . ARG A 1 101 ? 29.704  -2.993  -3.325  1.00 49.95  ? 516 ARG A C     1 
ATOM   785  O O     . ARG A 1 101 ? 30.595  -3.018  -4.195  1.00 49.76  ? 516 ARG A O     1 
ATOM   786  C CB    . ARG A 1 101 ? 28.327  -5.022  -2.883  1.00 50.76  ? 516 ARG A CB    1 
ATOM   787  C CG    . ARG A 1 101 ? 27.996  -6.168  -1.982  1.00 56.77  ? 516 ARG A CG    1 
ATOM   788  C CD    . ARG A 1 101 ? 28.392  -7.535  -2.640  1.00 64.22  ? 516 ARG A CD    1 
ATOM   789  N NE    . ARG A 1 101 ? 28.755  -8.519  -1.611  1.00 68.56  ? 516 ARG A NE    1 
ATOM   790  C CZ    . ARG A 1 101 ? 29.956  -9.069  -1.482  1.00 64.54  ? 516 ARG A CZ    1 
ATOM   791  N NH1   . ARG A 1 101 ? 30.910  -8.770  -2.330  1.00 62.11  ? 516 ARG A NH1   1 
ATOM   792  N NH2   . ARG A 1 101 ? 30.180  -9.913  -0.496  1.00 66.31  ? 516 ARG A NH2   1 
ATOM   793  N N     . ASN A 1 102 ? 28.907  -1.954  -3.144  1.00 49.11  ? 517 ASN A N     1 
ATOM   794  C CA    . ASN A 1 102 ? 28.849  -0.850  -4.076  1.00 48.77  ? 517 ASN A CA    1 
ATOM   795  C C     . ASN A 1 102 ? 29.536  0.413   -3.604  1.00 49.64  ? 517 ASN A C     1 
ATOM   796  O O     . ASN A 1 102 ? 29.249  1.499   -4.104  1.00 49.55  ? 517 ASN A O     1 
ATOM   797  C CB    . ASN A 1 102 ? 27.392  -0.585  -4.408  1.00 48.22  ? 517 ASN A CB    1 
ATOM   798  C CG    . ASN A 1 102 ? 26.723  -1.814  -4.939  1.00 49.17  ? 517 ASN A CG    1 
ATOM   799  O OD1   . ASN A 1 102 ? 26.940  -2.190  -6.079  1.00 55.89  ? 517 ASN A OD1   1 
ATOM   800  N ND2   . ASN A 1 102 ? 25.991  -2.502  -4.098  1.00 45.96  ? 517 ASN A ND2   1 
ATOM   801  N N     . LYS A 1 103 ? 30.430  0.252   -2.638  1.00 50.42  ? 518 LYS A N     1 
ATOM   802  C CA    . LYS A 1 103 ? 31.315  1.294   -2.133  1.00 53.05  ? 518 LYS A CA    1 
ATOM   803  C C     . LYS A 1 103 ? 31.982  2.150   -3.241  1.00 54.29  ? 518 LYS A C     1 
ATOM   804  O O     . LYS A 1 103 ? 32.079  3.374   -3.123  1.00 54.70  ? 518 LYS A O     1 
ATOM   805  C CB    . LYS A 1 103 ? 32.423  0.621   -1.335  1.00 53.94  ? 518 LYS A CB    1 
ATOM   806  C CG    . LYS A 1 103 ? 32.706  1.251   -0.037  1.00 57.90  ? 518 LYS A CG    1 
ATOM   807  C CD    . LYS A 1 103 ? 34.172  1.156   0.366   1.00 62.57  ? 518 LYS A CD    1 
ATOM   808  C CE    . LYS A 1 103 ? 34.965  2.415   -0.054  1.00 61.26  ? 518 LYS A CE    1 
ATOM   809  N NZ    . LYS A 1 103 ? 34.647  3.569   0.803   1.00 65.39  ? 518 LYS A NZ    1 
ATOM   810  N N     . ASN A 1 104 ? 32.469  1.525   -4.310  1.00 53.88  ? 519 ASN A N     1 
ATOM   811  C CA    . ASN A 1 104 ? 33.168  2.323   -5.315  1.00 54.79  ? 519 ASN A CA    1 
ATOM   812  C C     . ASN A 1 104 ? 32.256  3.158   -6.217  1.00 54.68  ? 519 ASN A C     1 
ATOM   813  O O     . ASN A 1 104 ? 32.701  4.137   -6.806  1.00 54.69  ? 519 ASN A O     1 
ATOM   814  C CB    . ASN A 1 104 ? 34.088  1.474   -6.188  1.00 55.80  ? 519 ASN A CB    1 
ATOM   815  C CG    . ASN A 1 104 ? 35.150  0.762   -5.394  1.00 56.47  ? 519 ASN A CG    1 
ATOM   816  O OD1   . ASN A 1 104 ? 35.651  1.285   -4.402  1.00 56.85  ? 519 ASN A OD1   1 
ATOM   817  N ND2   . ASN A 1 104 ? 35.516  -0.458  -5.848  1.00 61.65  ? 519 ASN A ND2   1 
ATOM   818  N N     . SER A 1 105 ? 30.996  2.794   -6.334  1.00 53.86  ? 520 SER A N     1 
ATOM   819  C CA    . SER A 1 105 ? 30.160  3.471   -7.339  1.00 54.33  ? 520 SER A CA    1 
ATOM   820  C C     . SER A 1 105 ? 29.039  4.367   -6.693  1.00 54.33  ? 520 SER A C     1 
ATOM   821  O O     . SER A 1 105 ? 28.551  5.322   -7.303  1.00 55.31  ? 520 SER A O     1 
ATOM   822  C CB    . SER A 1 105 ? 29.586  2.387   -8.212  1.00 54.85  ? 520 SER A CB    1 
ATOM   823  O OG    . SER A 1 105 ? 29.226  1.320   -7.348  1.00 54.26  ? 520 SER A OG    1 
ATOM   824  N N     . LEU A 1 106 ? 28.693  4.111   -5.432  1.00 51.80  ? 521 LEU A N     1 
ATOM   825  C CA    . LEU A 1 106 ? 27.730  4.961   -4.746  1.00 51.19  ? 521 LEU A CA    1 
ATOM   826  C C     . LEU A 1 106 ? 28.240  6.388   -4.517  1.00 50.00  ? 521 LEU A C     1 
ATOM   827  O O     . LEU A 1 106 ? 29.300  6.618   -3.947  1.00 49.03  ? 521 LEU A O     1 
ATOM   828  C CB    . LEU A 1 106 ? 27.330  4.362   -3.374  1.00 50.54  ? 521 LEU A CB    1 
ATOM   829  C CG    . LEU A 1 106 ? 26.490  3.081   -3.462  1.00 53.21  ? 521 LEU A CG    1 
ATOM   830  C CD1   . LEU A 1 106 ? 26.358  2.472   -2.066  1.00 53.97  ? 521 LEU A CD1   1 
ATOM   831  C CD2   . LEU A 1 106 ? 25.095  3.284   -4.132  1.00 48.44  ? 521 LEU A CD2   1 
ATOM   832  N N     . LYS A 1 107 ? 27.439  7.356   -4.877  1.00 48.66  ? 522 LYS A N     1 
ATOM   833  C CA    . LYS A 1 107 ? 27.845  8.701   -4.597  1.00 47.87  ? 522 LYS A CA    1 
ATOM   834  C C     . LYS A 1 107 ? 27.031  9.312   -3.427  1.00 46.85  ? 522 LYS A C     1 
ATOM   835  O O     . LYS A 1 107 ? 26.010  8.751   -2.964  1.00 43.80  ? 522 LYS A O     1 
ATOM   836  C CB    . LYS A 1 107 ? 27.715  9.522   -5.863  1.00 50.05  ? 522 LYS A CB    1 
ATOM   837  C CG    . LYS A 1 107 ? 28.870  9.294   -6.872  1.00 50.99  ? 522 LYS A CG    1 
ATOM   838  C CD    . LYS A 1 107 ? 30.214  9.822   -6.321  1.00 56.64  ? 522 LYS A CD    1 
ATOM   839  C CE    . LYS A 1 107 ? 30.094  11.220  -5.570  1.00 54.75  ? 522 LYS A CE    1 
ATOM   840  N NZ    . LYS A 1 107 ? 29.603  12.308  -6.374  1.00 49.50  ? 522 LYS A NZ    1 
ATOM   841  N N     . VAL A 1 108 ? 27.498  10.465  -2.964  1.00 44.79  ? 523 VAL A N     1 
ATOM   842  C CA    . VAL A 1 108 ? 26.910  11.089  -1.796  1.00 44.38  ? 523 VAL A CA    1 
ATOM   843  C C     . VAL A 1 108 ? 25.437  11.357  -1.959  1.00 43.72  ? 523 VAL A C     1 
ATOM   844  O O     . VAL A 1 108 ? 24.683  11.176  -1.003  1.00 41.84  ? 523 VAL A O     1 
ATOM   845  C CB    . VAL A 1 108 ? 27.666  12.354  -1.343  1.00 46.49  ? 523 VAL A CB    1 
ATOM   846  C CG1   . VAL A 1 108 ? 26.931  13.017  -0.143  1.00 43.34  ? 523 VAL A CG1   1 
ATOM   847  C CG2   . VAL A 1 108 ? 29.101  11.938  -0.930  1.00 46.85  ? 523 VAL A CG2   1 
ATOM   848  N N     . LEU A 1 109 ? 25.004  11.734  -3.169  1.00 41.81  ? 524 LEU A N     1 
ATOM   849  C CA    . LEU A 1 109 ? 23.577  11.994  -3.406  1.00 41.94  ? 524 LEU A CA    1 
ATOM   850  C C     . LEU A 1 109 ? 22.693  10.839  -2.879  1.00 40.60  ? 524 LEU A C     1 
ATOM   851  O O     . LEU A 1 109 ? 21.656  11.036  -2.190  1.00 39.99  ? 524 LEU A O     1 
ATOM   852  C CB    . LEU A 1 109 ? 23.347  12.165  -4.929  1.00 42.00  ? 524 LEU A CB    1 
ATOM   853  C CG    . LEU A 1 109 ? 21.933  12.351  -5.417  1.00 42.79  ? 524 LEU A CG    1 
ATOM   854  C CD1   . LEU A 1 109 ? 21.482  13.578  -4.708  1.00 42.71  ? 524 LEU A CD1   1 
ATOM   855  C CD2   . LEU A 1 109 ? 21.884  12.615  -7.008  1.00 40.55  ? 524 LEU A CD2   1 
ATOM   856  N N     . THR A 1 110 ? 23.110  9.628   -3.236  1.00 39.95  ? 525 THR A N     1 
ATOM   857  C CA    . THR A 1 110 ? 22.363  8.444   -2.893  1.00 40.25  ? 525 THR A CA    1 
ATOM   858  C C     . THR A 1 110 ? 22.403  8.189   -1.372  1.00 40.24  ? 525 THR A C     1 
ATOM   859  O O     . THR A 1 110 ? 21.368  7.848   -0.753  1.00 39.13  ? 525 THR A O     1 
ATOM   860  C CB    . THR A 1 110 ? 22.843  7.238   -3.702  1.00 41.54  ? 525 THR A CB    1 
ATOM   861  O OG1   . THR A 1 110 ? 23.002  7.658   -5.061  1.00 43.37  ? 525 THR A OG1   1 
ATOM   862  C CG2   . THR A 1 110 ? 21.791  6.122   -3.713  1.00 40.57  ? 525 THR A CG2   1 
ATOM   863  N N     . LEU A 1 111 ? 23.582  8.334   -0.784  1.00 39.73  ? 526 LEU A N     1 
ATOM   864  C CA    . LEU A 1 111 ? 23.679  8.097   0.643   1.00 40.49  ? 526 LEU A CA    1 
ATOM   865  C C     . LEU A 1 111 ? 22.707  9.040   1.337   1.00 39.48  ? 526 LEU A C     1 
ATOM   866  O O     . LEU A 1 111 ? 22.065  8.649   2.286   1.00 40.46  ? 526 LEU A O     1 
ATOM   867  C CB    . LEU A 1 111 ? 25.137  8.256   1.129   1.00 40.33  ? 526 LEU A CB    1 
ATOM   868  C CG    . LEU A 1 111 ? 26.147  7.375   0.330   1.00 38.81  ? 526 LEU A CG    1 
ATOM   869  C CD1   . LEU A 1 111 ? 27.598  7.614   0.749   1.00 34.08  ? 526 LEU A CD1   1 
ATOM   870  C CD2   . LEU A 1 111 ? 25.879  5.868   0.409   1.00 41.41  ? 526 LEU A CD2   1 
ATOM   871  N N     . VAL A 1 112 ? 22.547  10.274  0.833   1.00 39.01  ? 527 VAL A N     1 
ATOM   872  C CA    . VAL A 1 112 ? 21.708  11.267  1.477   1.00 38.18  ? 527 VAL A CA    1 
ATOM   873  C C     . VAL A 1 112 ? 20.227  10.904  1.238   1.00 39.58  ? 527 VAL A C     1 
ATOM   874  O O     . VAL A 1 112 ? 19.378  10.973  2.149   1.00 37.73  ? 527 VAL A O     1 
ATOM   875  C CB    . VAL A 1 112 ? 22.065  12.715  1.022   1.00 39.33  ? 527 VAL A CB    1 
ATOM   876  C CG1   . VAL A 1 112 ? 21.073  13.755  1.601   1.00 36.88  ? 527 VAL A CG1   1 
ATOM   877  C CG2   . VAL A 1 112 ? 23.516  13.066  1.426   1.00 34.52  ? 527 VAL A CG2   1 
ATOM   878  N N     . LEU A 1 113 ? 19.953  10.414  0.028   1.00 39.57  ? 528 LEU A N     1 
ATOM   879  C CA    . LEU A 1 113 ? 18.620  9.933   -0.283  1.00 40.41  ? 528 LEU A CA    1 
ATOM   880  C C     . LEU A 1 113 ? 18.194  8.756   0.606   1.00 39.04  ? 528 LEU A C     1 
ATOM   881  O O     . LEU A 1 113 ? 17.080  8.737   1.009   1.00 40.28  ? 528 LEU A O     1 
ATOM   882  C CB    . LEU A 1 113 ? 18.520  9.441   -1.739  1.00 40.20  ? 528 LEU A CB    1 
ATOM   883  C CG    . LEU A 1 113 ? 17.102  9.042   -2.186  1.00 42.14  ? 528 LEU A CG    1 
ATOM   884  C CD1   . LEU A 1 113 ? 16.045  10.231  -2.033  1.00 38.72  ? 528 LEU A CD1   1 
ATOM   885  C CD2   . LEU A 1 113 ? 17.169  8.468   -3.643  1.00 42.17  ? 528 LEU A CD2   1 
ATOM   886  N N     . TYR A 1 114 ? 19.038  7.749   0.819   1.00 37.93  ? 529 TYR A N     1 
ATOM   887  C CA    . TYR A 1 114 ? 18.659  6.638   1.720   1.00 37.23  ? 529 TYR A CA    1 
ATOM   888  C C     . TYR A 1 114 ? 18.390  7.210   3.113   1.00 35.99  ? 529 TYR A C     1 
ATOM   889  O O     . TYR A 1 114 ? 17.431  6.822   3.739   1.00 35.31  ? 529 TYR A O     1 
ATOM   890  C CB    . TYR A 1 114 ? 19.733  5.571   1.827   1.00 36.41  ? 529 TYR A CB    1 
ATOM   891  C CG    . TYR A 1 114 ? 20.029  4.839   0.585   1.00 39.90  ? 529 TYR A CG    1 
ATOM   892  C CD1   . TYR A 1 114 ? 19.199  4.948   -0.556  1.00 38.87  ? 529 TYR A CD1   1 
ATOM   893  C CD2   . TYR A 1 114 ? 21.239  4.102   0.467   1.00 42.62  ? 529 TYR A CD2   1 
ATOM   894  C CE1   . TYR A 1 114 ? 19.513  4.276   -1.676  1.00 38.71  ? 529 TYR A CE1   1 
ATOM   895  C CE2   . TYR A 1 114 ? 21.566  3.426   -0.718  1.00 39.85  ? 529 TYR A CE2   1 
ATOM   896  C CZ    . TYR A 1 114 ? 20.685  3.500   -1.756  1.00 40.54  ? 529 TYR A CZ    1 
ATOM   897  O OH    . TYR A 1 114 ? 21.008  2.852   -2.954  1.00 41.61  ? 529 TYR A OH    1 
ATOM   898  N N     . SER A 1 115 ? 19.267  8.099   3.591   1.00 34.28  ? 530 SER A N     1 
ATOM   899  C CA    . SER A 1 115 ? 19.060  8.779   4.890   1.00 35.21  ? 530 SER A CA    1 
ATOM   900  C C     . SER A 1 115 ? 17.699  9.482   4.961   1.00 34.67  ? 530 SER A C     1 
ATOM   901  O O     . SER A 1 115 ? 17.000  9.412   5.956   1.00 35.04  ? 530 SER A O     1 
ATOM   902  C CB    . SER A 1 115 ? 20.191  9.816   5.168   1.00 35.18  ? 530 SER A CB    1 
ATOM   903  O OG    . SER A 1 115 ? 21.428  9.125   5.431   1.00 35.23  ? 530 SER A OG    1 
ATOM   904  N N     . LEU A 1 116 ? 17.311  10.167  3.889   1.00 35.57  ? 531 LEU A N     1 
ATOM   905  C CA    . LEU A 1 116 ? 16.092  10.946  3.893   1.00 34.64  ? 531 LEU A CA    1 
ATOM   906  C C     . LEU A 1 116 ? 14.891  9.984   3.940   1.00 35.74  ? 531 LEU A C     1 
ATOM   907  O O     . LEU A 1 116 ? 13.901  10.193  4.673   1.00 35.72  ? 531 LEU A O     1 
ATOM   908  C CB    . LEU A 1 116 ? 16.052  11.808  2.621   1.00 35.74  ? 531 LEU A CB    1 
ATOM   909  C CG    . LEU A 1 116 ? 14.813  12.643  2.336   1.00 35.06  ? 531 LEU A CG    1 
ATOM   910  C CD1   . LEU A 1 116 ? 14.429  13.470  3.585   1.00 34.39  ? 531 LEU A CD1   1 
ATOM   911  C CD2   . LEU A 1 116 ? 14.950  13.562  1.048   1.00 33.33  ? 531 LEU A CD2   1 
ATOM   912  N N     . GLN A 1 117 ? 14.963  8.931   3.150   1.00 35.33  ? 532 GLN A N     1 
ATOM   913  C CA    . GLN A 1 117 ? 13.884  7.914   3.113   1.00 36.67  ? 532 GLN A CA    1 
ATOM   914  C C     . GLN A 1 117 ? 13.639  7.324   4.464   1.00 37.74  ? 532 GLN A C     1 
ATOM   915  O O     . GLN A 1 117 ? 12.492  7.252   4.887   1.00 39.67  ? 532 GLN A O     1 
ATOM   916  C CB    . GLN A 1 117 ? 14.226  6.810   2.123   1.00 35.19  ? 532 GLN A CB    1 
ATOM   917  C CG    . GLN A 1 117 ? 14.299  7.460   0.675   1.00 37.43  ? 532 GLN A CG    1 
ATOM   918  C CD    . GLN A 1 117 ? 14.614  6.493   -0.407  1.00 37.68  ? 532 GLN A CD    1 
ATOM   919  O OE1   . GLN A 1 117 ? 15.217  5.447   -0.152  1.00 38.09  ? 532 GLN A OE1   1 
ATOM   920  N NE2   . GLN A 1 117 ? 14.218  6.829   -1.657  1.00 38.43  ? 532 GLN A NE2   1 
ATOM   921  N N     . ILE A 1 118 ? 14.703  6.915   5.155   1.00 37.22  ? 533 ILE A N     1 
ATOM   922  C CA    . ILE A 1 118 ? 14.551  6.335   6.475   1.00 38.08  ? 533 ILE A CA    1 
ATOM   923  C C     . ILE A 1 118 ? 13.916  7.374   7.415   1.00 36.88  ? 533 ILE A C     1 
ATOM   924  O O     . ILE A 1 118 ? 12.988  7.092   8.146   1.00 39.84  ? 533 ILE A O     1 
ATOM   925  C CB    . ILE A 1 118 ? 15.936  5.767   7.040   1.00 37.26  ? 533 ILE A CB    1 
ATOM   926  C CG1   . ILE A 1 118 ? 16.414  4.619   6.114   1.00 40.63  ? 533 ILE A CG1   1 
ATOM   927  C CG2   . ILE A 1 118 ? 15.736  5.259   8.440   1.00 35.79  ? 533 ILE A CG2   1 
ATOM   928  C CD1   . ILE A 1 118 ? 15.306  3.459   5.852   1.00 38.29  ? 533 ILE A CD1   1 
ATOM   929  N N     . CYS A 1 119 ? 14.363  8.598   7.316   1.00 37.39  ? 534 CYS A N     1 
ATOM   930  C CA    . CYS A 1 119 ? 13.908  9.651   8.182   1.00 37.71  ? 534 CYS A CA    1 
ATOM   931  C C     . CYS A 1 119 ? 12.424  9.985   7.945   1.00 37.07  ? 534 CYS A C     1 
ATOM   932  O O     . CYS A 1 119 ? 11.683  10.327  8.889   1.00 35.58  ? 534 CYS A O     1 
ATOM   933  C CB    . CYS A 1 119 ? 14.828  10.854  7.926   1.00 39.10  ? 534 CYS A CB    1 
ATOM   934  S SG    . CYS A 1 119 ? 14.626  12.241  9.015   1.00 40.03  ? 534 CYS A SG    1 
ATOM   935  N N     . LYS A 1 120 ? 11.986  9.873   6.693   1.00 36.62  ? 535 LYS A N     1 
ATOM   936  C CA    . LYS A 1 120 ? 10.516  9.950   6.371   1.00 37.62  ? 535 LYS A CA    1 
ATOM   937  C C     . LYS A 1 120 ? 9.741   8.839   7.032   1.00 37.03  ? 535 LYS A C     1 
ATOM   938  O O     . LYS A 1 120 ? 8.687   9.101   7.559   1.00 37.67  ? 535 LYS A O     1 
ATOM   939  C CB    . LYS A 1 120 ? 10.221  9.942   4.836   1.00 37.31  ? 535 LYS A CB    1 
ATOM   940  C CG    . LYS A 1 120 ? 10.484  11.287  4.199   1.00 37.22  ? 535 LYS A CG    1 
ATOM   941  C CD    . LYS A 1 120 ? 10.688  11.167  2.697   1.00 40.32  ? 535 LYS A CD    1 
ATOM   942  C CE    . LYS A 1 120 ? 10.773  12.549  2.120   1.00 42.92  ? 535 LYS A CE    1 
ATOM   943  N NZ    . LYS A 1 120 ? 10.686  12.534  0.608   1.00 42.87  ? 535 LYS A NZ    1 
ATOM   944  N N     . ALA A 1 121 ? 10.282  7.609   7.018   1.00 35.79  ? 536 ALA A N     1 
ATOM   945  C CA    . ALA A 1 121 ? 9.648   6.494   7.687   1.00 35.74  ? 536 ALA A CA    1 
ATOM   946  C C     . ALA A 1 121 ? 9.573   6.783   9.201   1.00 36.57  ? 536 ALA A C     1 
ATOM   947  O O     . ALA A 1 121 ? 8.547   6.547   9.858   1.00 37.21  ? 536 ALA A O     1 
ATOM   948  C CB    . ALA A 1 121 ? 10.425  5.223   7.423   1.00 34.48  ? 536 ALA A CB    1 
ATOM   949  N N     . MET A 1 122 ? 10.644  7.340   9.756   1.00 36.50  ? 537 MET A N     1 
ATOM   950  C CA    . MET A 1 122 ? 10.660  7.597   11.182  1.00 36.93  ? 537 MET A CA    1 
ATOM   951  C C     . MET A 1 122 ? 9.708   8.743   11.528  1.00 37.77  ? 537 MET A C     1 
ATOM   952  O O     . MET A 1 122 ? 9.239   8.810   12.690  1.00 36.44  ? 537 MET A O     1 
ATOM   953  C CB    . MET A 1 122 ? 12.062  7.987   11.669  1.00 36.51  ? 537 MET A CB    1 
ATOM   954  C CG    . MET A 1 122 ? 13.060  6.749   11.748  1.00 37.49  ? 537 MET A CG    1 
ATOM   955  S SD    . MET A 1 122 ? 12.366  5.226   12.427  1.00 42.26  ? 537 MET A SD    1 
ATOM   956  C CE    . MET A 1 122 ? 11.907  5.859   14.100  1.00 40.89  ? 537 MET A CE    1 
ATOM   957  N N     . ALA A 1 123 ? 9.523   9.687   10.588  1.00 37.77  ? 538 ALA A N     1 
ATOM   958  C CA    . ALA A 1 123 ? 8.673   10.829  10.883  1.00 39.88  ? 538 ALA A CA    1 
ATOM   959  C C     . ALA A 1 123 ? 7.278   10.253  11.037  1.00 41.27  ? 538 ALA A C     1 
ATOM   960  O O     . ALA A 1 123 ? 6.555   10.611  11.971  1.00 40.92  ? 538 ALA A O     1 
ATOM   961  C CB    . ALA A 1 123 ? 8.757   11.970  9.816   1.00 38.04  ? 538 ALA A CB    1 
ATOM   962  N N     . TYR A 1 124 ? 6.940   9.287   10.172  1.00 42.79  ? 539 TYR A N     1 
ATOM   963  C CA    . TYR A 1 124 ? 5.686   8.617   10.319  1.00 44.08  ? 539 TYR A CA    1 
ATOM   964  C C     . TYR A 1 124 ? 5.537   7.941   11.656  1.00 44.11  ? 539 TYR A C     1 
ATOM   965  O O     . TYR A 1 124 ? 4.577   8.136   12.347  1.00 42.88  ? 539 TYR A O     1 
ATOM   966  C CB    . TYR A 1 124 ? 5.401   7.617   9.219   1.00 45.50  ? 539 TYR A CB    1 
ATOM   967  C CG    . TYR A 1 124 ? 4.063   6.965   9.485   1.00 47.26  ? 539 TYR A CG    1 
ATOM   968  C CD1   . TYR A 1 124 ? 2.866   7.636   9.222   1.00 50.42  ? 539 TYR A CD1   1 
ATOM   969  C CD2   . TYR A 1 124 ? 3.993   5.722   10.099  1.00 52.20  ? 539 TYR A CD2   1 
ATOM   970  C CE1   . TYR A 1 124 ? 1.622   7.044   9.522   1.00 52.76  ? 539 TYR A CE1   1 
ATOM   971  C CE2   . TYR A 1 124 ? 2.795   5.147   10.374  1.00 52.78  ? 539 TYR A CE2   1 
ATOM   972  C CZ    . TYR A 1 124 ? 1.607   5.795   10.114  1.00 52.17  ? 539 TYR A CZ    1 
ATOM   973  O OH    . TYR A 1 124 ? 0.406   5.134   10.421  1.00 55.41  ? 539 TYR A OH    1 
ATOM   974  N N     . LEU A 1 125 ? 6.484   7.104   12.019  1.00 45.44  ? 540 LEU A N     1 
ATOM   975  C CA    . LEU A 1 125 ? 6.443   6.491   13.352  1.00 45.59  ? 540 LEU A CA    1 
ATOM   976  C C     . LEU A 1 125 ? 6.342   7.528   14.466  1.00 46.34  ? 540 LEU A C     1 
ATOM   977  O O     . LEU A 1 125 ? 5.700   7.295   15.510  1.00 47.24  ? 540 LEU A O     1 
ATOM   978  C CB    . LEU A 1 125 ? 7.687   5.646   13.553  1.00 44.68  ? 540 LEU A CB    1 
ATOM   979  C CG    . LEU A 1 125 ? 7.749   4.488   12.594  1.00 45.81  ? 540 LEU A CG    1 
ATOM   980  C CD1   . LEU A 1 125 ? 8.965   3.638   12.937  1.00 46.69  ? 540 LEU A CD1   1 
ATOM   981  C CD2   . LEU A 1 125 ? 6.443   3.617   12.687  1.00 41.59  ? 540 LEU A CD2   1 
ATOM   982  N N     . GLU A 1 126 ? 6.992   8.672   14.260  1.00 46.85  ? 541 GLU A N     1 
ATOM   983  C CA    . GLU A 1 126 ? 7.053   9.675   15.283  1.00 47.84  ? 541 GLU A CA    1 
ATOM   984  C C     . GLU A 1 126 ? 5.663   10.240  15.518  1.00 49.91  ? 541 GLU A C     1 
ATOM   985  O O     . GLU A 1 126 ? 5.294   10.537  16.659  1.00 51.01  ? 541 GLU A O     1 
ATOM   986  C CB    . GLU A 1 126 ? 7.979   10.799  14.890  1.00 46.74  ? 541 GLU A CB    1 
ATOM   987  C CG    . GLU A 1 126 ? 8.050   11.974  15.896  1.00 44.61  ? 541 GLU A CG    1 
ATOM   988  C CD    . GLU A 1 126 ? 8.970   13.063  15.391  1.00 45.97  ? 541 GLU A CD    1 
ATOM   989  O OE1   . GLU A 1 126 ? 8.592   13.759  14.372  1.00 40.34  ? 541 GLU A OE1   1 
ATOM   990  O OE2   . GLU A 1 126 ? 10.102  13.186  15.968  1.00 46.92  ? 541 GLU A OE2   1 
ATOM   991  N N     . SER A 1 127 ? 4.925   10.404  14.427  1.00 50.87  ? 542 SER A N     1 
ATOM   992  C CA    . SER A 1 127 ? 3.572   10.904  14.459  1.00 51.12  ? 542 SER A CA    1 
ATOM   993  C C     . SER A 1 127 ? 2.659   10.002  15.309  1.00 52.66  ? 542 SER A C     1 
ATOM   994  O O     . SER A 1 127 ? 1.657   10.474  15.864  1.00 52.28  ? 542 SER A O     1 
ATOM   995  C CB    . SER A 1 127 ? 3.067   11.083  13.025  1.00 51.68  ? 542 SER A CB    1 
ATOM   996  O OG    . SER A 1 127 ? 2.758   9.846   12.423  1.00 52.51  ? 542 SER A OG    1 
ATOM   997  N N     . ILE A 1 128 ? 2.990   8.706   15.447  1.00 52.98  ? 543 ILE A N     1 
ATOM   998  C CA    . ILE A 1 128 ? 2.155   7.875   16.330  1.00 52.60  ? 543 ILE A CA    1 
ATOM   999  C C     . ILE A 1 128 ? 2.803   7.515   17.667  1.00 52.86  ? 543 ILE A C     1 
ATOM   1000 O O     . ILE A 1 128 ? 2.408   6.560   18.299  1.00 53.41  ? 543 ILE A O     1 
ATOM   1001 C CB    . ILE A 1 128 ? 1.714   6.568   15.680  1.00 52.31  ? 543 ILE A CB    1 
ATOM   1002 C CG1   . ILE A 1 128 ? 2.896   5.856   15.053  1.00 50.54  ? 543 ILE A CG1   1 
ATOM   1003 C CG2   . ILE A 1 128 ? 0.600   6.811   14.657  1.00 53.27  ? 543 ILE A CG2   1 
ATOM   1004 C CD1   . ILE A 1 128 ? 2.571   4.524   14.624  1.00 47.70  ? 543 ILE A CD1   1 
ATOM   1005 N N     . ASN A 1 129 ? 3.802   8.258   18.074  1.00 53.77  ? 544 ASN A N     1 
ATOM   1006 C CA    . ASN A 1 129 ? 4.605   7.943   19.271  1.00 55.84  ? 544 ASN A CA    1 
ATOM   1007 C C     . ASN A 1 129 ? 4.962   6.514   19.358  1.00 54.47  ? 544 ASN A C     1 
ATOM   1008 O O     . ASN A 1 129 ? 4.839   5.968   20.420  1.00 53.88  ? 544 ASN A O     1 
ATOM   1009 C CB    . ASN A 1 129 ? 3.878   8.256   20.572  1.00 57.29  ? 544 ASN A CB    1 
ATOM   1010 C CG    . ASN A 1 129 ? 3.382   9.649   20.623  1.00 63.21  ? 544 ASN A CG    1 
ATOM   1011 O OD1   . ASN A 1 129 ? 2.167   9.897   20.483  1.00 71.81  ? 544 ASN A OD1   1 
ATOM   1012 N ND2   . ASN A 1 129 ? 4.301   10.600  20.820  1.00 68.82  ? 544 ASN A ND2   1 
ATOM   1013 N N     . CYS A 1 130 ? 5.362   5.911   18.242  1.00 54.14  ? 545 CYS A N     1 
ATOM   1014 C CA    . CYS A 1 130 ? 5.774   4.516   18.201  1.00 54.44  ? 545 CYS A CA    1 
ATOM   1015 C C     . CYS A 1 130 ? 7.304   4.419   18.061  1.00 53.43  ? 545 CYS A C     1 
ATOM   1016 O O     . CYS A 1 130 ? 7.894   5.075   17.196  1.00 52.99  ? 545 CYS A O     1 
ATOM   1017 C CB    . CYS A 1 130 ? 5.043   3.853   17.051  1.00 54.79  ? 545 CYS A CB    1 
ATOM   1018 S SG    . CYS A 1 130 ? 5.488   2.175   16.726  1.00 64.78  ? 545 CYS A SG    1 
ATOM   1019 N N     . VAL A 1 131 ? 7.962   3.669   18.953  1.00 52.75  ? 546 VAL A N     1 
ATOM   1020 C CA    . VAL A 1 131 ? 9.401   3.699   18.988  1.00 51.44  ? 546 VAL A CA    1 
ATOM   1021 C C     . VAL A 1 131 ? 9.977   2.482   18.282  1.00 50.63  ? 546 VAL A C     1 
ATOM   1022 O O     . VAL A 1 131 ? 9.549   1.350   18.497  1.00 50.03  ? 546 VAL A O     1 
ATOM   1023 C CB    . VAL A 1 131 ? 10.009  3.932   20.431  1.00 52.37  ? 546 VAL A CB    1 
ATOM   1024 C CG1   . VAL A 1 131 ? 9.260   5.093   21.165  1.00 51.58  ? 546 VAL A CG1   1 
ATOM   1025 C CG2   . VAL A 1 131 ? 9.925   2.684   21.207  1.00 54.33  ? 546 VAL A CG2   1 
ATOM   1026 N N     . HIS A 1 132 ? 10.910  2.740   17.371  1.00 48.57  ? 547 HIS A N     1 
ATOM   1027 C CA    . HIS A 1 132 ? 11.526  1.697   16.621  1.00 48.00  ? 547 HIS A CA    1 
ATOM   1028 C C     . HIS A 1 132 ? 12.893  1.508   17.275  1.00 48.56  ? 547 HIS A C     1 
ATOM   1029 O O     . HIS A 1 132 ? 13.615  2.437   17.550  1.00 51.91  ? 547 HIS A O     1 
ATOM   1030 C CB    . HIS A 1 132 ? 11.705  2.102   15.152  1.00 46.09  ? 547 HIS A CB    1 
ATOM   1031 C CG    . HIS A 1 132 ? 12.213  0.985   14.304  1.00 43.80  ? 547 HIS A CG    1 
ATOM   1032 N ND1   . HIS A 1 132 ? 11.479  0.444   13.269  1.00 45.53  ? 547 HIS A ND1   1 
ATOM   1033 C CD2   . HIS A 1 132 ? 13.370  0.292   14.347  1.00 38.68  ? 547 HIS A CD2   1 
ATOM   1034 C CE1   . HIS A 1 132 ? 12.170  -0.529  12.695  1.00 38.93  ? 547 HIS A CE1   1 
ATOM   1035 N NE2   . HIS A 1 132 ? 13.332  -0.630  13.319  1.00 44.08  ? 547 HIS A NE2   1 
ATOM   1036 N N     . ARG A 1 133 ? 13.290  0.340   17.609  1.00 48.57  ? 548 ARG A N     1 
ATOM   1037 C CA    . ARG A 1 133 ? 14.503  0.444   18.439  1.00 47.43  ? 548 ARG A CA    1 
ATOM   1038 C C     . ARG A 1 133 ? 15.713  -0.138  17.725  1.00 46.08  ? 548 ARG A C     1 
ATOM   1039 O O     . ARG A 1 133 ? 16.724  -0.467  18.321  1.00 45.85  ? 548 ARG A O     1 
ATOM   1040 C CB    . ARG A 1 133 ? 14.218  -0.248  19.784  1.00 48.62  ? 548 ARG A CB    1 
ATOM   1041 C CG    . ARG A 1 133 ? 13.498  0.713   20.716  1.00 51.01  ? 548 ARG A CG    1 
ATOM   1042 C CD    . ARG A 1 133 ? 12.244  0.137   21.351  1.00 56.32  ? 548 ARG A CD    1 
ATOM   1043 N NE    . ARG A 1 133 ? 12.559  -0.970  22.203  1.00 57.34  ? 548 ARG A NE    1 
ATOM   1044 C CZ    . ARG A 1 133 ? 12.173  -1.098  23.486  1.00 62.50  ? 548 ARG A CZ    1 
ATOM   1045 N NH1   . ARG A 1 133 ? 11.373  -0.188  24.100  1.00 60.55  ? 548 ARG A NH1   1 
ATOM   1046 N NH2   . ARG A 1 133 ? 12.566  -2.187  24.146  1.00 54.61  ? 548 ARG A NH2   1 
ATOM   1047 N N     . ASP A 1 134 ? 15.587  -0.232  16.412  1.00 44.87  ? 549 ASP A N     1 
ATOM   1048 C CA    . ASP A 1 134 ? 16.550  -0.951  15.625  1.00 44.34  ? 549 ASP A CA    1 
ATOM   1049 C C     . ASP A 1 134 ? 16.702  -0.219  14.284  1.00 41.90  ? 549 ASP A C     1 
ATOM   1050 O O     . ASP A 1 134 ? 16.348  -0.776  13.274  1.00 41.33  ? 549 ASP A O     1 
ATOM   1051 C CB    . ASP A 1 134 ? 16.029  -2.380  15.347  1.00 43.18  ? 549 ASP A CB    1 
ATOM   1052 C CG    . ASP A 1 134 ? 17.133  -3.295  14.760  1.00 49.53  ? 549 ASP A CG    1 
ATOM   1053 O OD1   . ASP A 1 134 ? 18.326  -2.864  14.667  1.00 50.65  ? 549 ASP A OD1   1 
ATOM   1054 O OD2   . ASP A 1 134 ? 16.812  -4.451  14.434  1.00 48.98  ? 549 ASP A OD2   1 
ATOM   1055 N N     . ILE A 1 135 ? 17.151  1.033   14.319  1.00 40.25  ? 550 ILE A N     1 
ATOM   1056 C CA    . ILE A 1 135 ? 17.377  1.851   13.098  1.00 40.20  ? 550 ILE A CA    1 
ATOM   1057 C C     . ILE A 1 135 ? 18.863  1.736   12.783  1.00 39.81  ? 550 ILE A C     1 
ATOM   1058 O O     . ILE A 1 135 ? 19.684  2.462   13.387  1.00 40.17  ? 550 ILE A O     1 
ATOM   1059 C CB    . ILE A 1 135 ? 16.965  3.310   13.316  1.00 39.93  ? 550 ILE A CB    1 
ATOM   1060 C CG1   . ILE A 1 135 ? 15.561  3.336   14.004  1.00 40.75  ? 550 ILE A CG1   1 
ATOM   1061 C CG2   . ILE A 1 135 ? 16.911  4.046   11.998  1.00 40.82  ? 550 ILE A CG2   1 
ATOM   1062 C CD1   . ILE A 1 135 ? 15.108  4.661   14.604  1.00 39.67  ? 550 ILE A CD1   1 
ATOM   1063 N N     . ALA A 1 136 ? 19.184  0.719   11.969  1.00 37.57  ? 551 ALA A N     1 
ATOM   1064 C CA    . ALA A 1 136 ? 20.566  0.322   11.624  1.00 36.78  ? 551 ALA A CA    1 
ATOM   1065 C C     . ALA A 1 136 ? 20.601  -0.248  10.191  1.00 37.23  ? 551 ALA A C     1 
ATOM   1066 O O     . ALA A 1 136 ? 19.603  -0.828  9.673   1.00 36.36  ? 551 ALA A O     1 
ATOM   1067 C CB    . ALA A 1 136 ? 21.125  -0.717  12.682  1.00 36.22  ? 551 ALA A CB    1 
ATOM   1068 N N     . VAL A 1 137 ? 21.726  -0.100  9.499   1.00 38.42  ? 552 VAL A N     1 
ATOM   1069 C CA    . VAL A 1 137 ? 21.778  -0.648  8.108   1.00 37.82  ? 552 VAL A CA    1 
ATOM   1070 C C     . VAL A 1 137 ? 21.512  -2.162  7.980   1.00 39.65  ? 552 VAL A C     1 
ATOM   1071 O O     . VAL A 1 137 ? 20.966  -2.601  6.946   1.00 40.31  ? 552 VAL A O     1 
ATOM   1072 C CB    . VAL A 1 137 ? 23.037  -0.183  7.313   1.00 38.22  ? 552 VAL A CB    1 
ATOM   1073 C CG1   . VAL A 1 137 ? 23.007  1.338   7.281   1.00 36.52  ? 552 VAL A CG1   1 
ATOM   1074 C CG2   . VAL A 1 137 ? 24.386  -0.757  7.918   1.00 34.20  ? 552 VAL A CG2   1 
ATOM   1075 N N     . ARG A 1 138 ? 21.914  -2.962  8.984   1.00 40.46  ? 553 ARG A N     1 
ATOM   1076 C CA    . ARG A 1 138 ? 21.561  -4.391  8.984   1.00 41.64  ? 553 ARG A CA    1 
ATOM   1077 C C     . ARG A 1 138 ? 20.006  -4.600  8.941   1.00 40.47  ? 553 ARG A C     1 
ATOM   1078 O O     . ARG A 1 138 ? 19.541  -5.551  8.347   1.00 39.35  ? 553 ARG A O     1 
ATOM   1079 C CB    . ARG A 1 138 ? 22.204  -5.170  10.159  1.00 43.03  ? 553 ARG A CB    1 
ATOM   1080 C CG    . ARG A 1 138 ? 21.986  -6.709  10.156  1.00 47.15  ? 553 ARG A CG    1 
ATOM   1081 C CD    . ARG A 1 138 ? 22.944  -7.546  11.143  1.00 55.82  ? 553 ARG A CD    1 
ATOM   1082 N NE    . ARG A 1 138 ? 22.209  -8.663  11.787  1.00 64.32  ? 553 ARG A NE    1 
ATOM   1083 C CZ    . ARG A 1 138 ? 22.724  -9.825  12.245  1.00 66.90  ? 553 ARG A CZ    1 
ATOM   1084 N NH1   . ARG A 1 138 ? 24.035  -10.093 12.179  1.00 67.37  ? 553 ARG A NH1   1 
ATOM   1085 N NH2   . ARG A 1 138 ? 21.905  -10.739 12.783  1.00 66.74  ? 553 ARG A NH2   1 
ATOM   1086 N N     . ASN A 1 139 ? 19.233  -3.657  9.466   1.00 39.85  ? 554 ASN A N     1 
ATOM   1087 C CA    . ASN A 1 139 ? 17.758  -3.759  9.508   1.00 39.20  ? 554 ASN A CA    1 
ATOM   1088 C C     . ASN A 1 139 ? 16.994  -2.924  8.446   1.00 38.54  ? 554 ASN A C     1 
ATOM   1089 O O     . ASN A 1 139 ? 15.866  -2.536  8.667   1.00 35.41  ? 554 ASN A O     1 
ATOM   1090 C CB    . ASN A 1 139 ? 17.251  -3.389  10.949  1.00 39.58  ? 554 ASN A CB    1 
ATOM   1091 C CG    . ASN A 1 139 ? 15.718  -3.759  11.154  1.00 41.03  ? 554 ASN A CG    1 
ATOM   1092 O OD1   . ASN A 1 139 ? 14.927  -2.951  11.579  1.00 47.35  ? 554 ASN A OD1   1 
ATOM   1093 N ND2   . ASN A 1 139 ? 15.347  -4.945  10.793  1.00 41.89  ? 554 ASN A ND2   1 
ATOM   1094 N N     . ILE A 1 140 ? 17.631  -2.649  7.293   1.00 36.35  ? 555 ILE A N     1 
ATOM   1095 C CA    . ILE A 1 140 ? 17.076  -1.784  6.308   1.00 35.59  ? 555 ILE A CA    1 
ATOM   1096 C C     . ILE A 1 140 ? 17.320  -2.531  4.984   1.00 35.33  ? 555 ILE A C     1 
ATOM   1097 O O     . ILE A 1 140 ? 18.458  -3.016  4.743   1.00 33.72  ? 555 ILE A O     1 
ATOM   1098 C CB    . ILE A 1 140 ? 17.823  -0.422  6.229   1.00 35.93  ? 555 ILE A CB    1 
ATOM   1099 C CG1   . ILE A 1 140 ? 17.535  0.444   7.416   1.00 35.32  ? 555 ILE A CG1   1 
ATOM   1100 C CG2   . ILE A 1 140 ? 17.441  0.399   4.906   1.00 34.09  ? 555 ILE A CG2   1 
ATOM   1101 C CD1   . ILE A 1 140 ? 18.430  1.588   7.399   1.00 33.53  ? 555 ILE A CD1   1 
ATOM   1102 N N     . LEU A 1 141 ? 16.255  -2.682  4.208   1.00 33.64  ? 556 LEU A N     1 
ATOM   1103 C CA    . LEU A 1 141 ? 16.268  -3.572  3.033   1.00 36.49  ? 556 LEU A CA    1 
ATOM   1104 C C     . LEU A 1 141 ? 16.377  -2.737  1.760   1.00 34.86  ? 556 LEU A C     1 
ATOM   1105 O O     . LEU A 1 141 ? 15.947  -1.633  1.777   1.00 34.58  ? 556 LEU A O     1 
ATOM   1106 C CB    . LEU A 1 141 ? 15.038  -4.525  2.952   1.00 36.75  ? 556 LEU A CB    1 
ATOM   1107 C CG    . LEU A 1 141 ? 15.184  -5.596  4.032   1.00 42.35  ? 556 LEU A CG    1 
ATOM   1108 C CD1   . LEU A 1 141 ? 13.885  -6.309  4.218   1.00 44.36  ? 556 LEU A CD1   1 
ATOM   1109 C CD2   . LEU A 1 141 ? 16.286  -6.593  3.640   1.00 42.91  ? 556 LEU A CD2   1 
ATOM   1110 N N     . VAL A 1 142 ? 16.954  -3.271  0.672   1.00 35.26  ? 557 VAL A N     1 
ATOM   1111 C CA    . VAL A 1 142 ? 17.151  -2.456  -0.521  1.00 35.63  ? 557 VAL A CA    1 
ATOM   1112 C C     . VAL A 1 142 ? 16.192  -2.938  -1.641  1.00 36.87  ? 557 VAL A C     1 
ATOM   1113 O O     . VAL A 1 142 ? 16.304  -4.091  -2.165  1.00 34.79  ? 557 VAL A O     1 
ATOM   1114 C CB    . VAL A 1 142 ? 18.661  -2.371  -1.007  1.00 37.13  ? 557 VAL A CB    1 
ATOM   1115 C CG1   . VAL A 1 142 ? 18.780  -1.438  -2.180  1.00 35.56  ? 557 VAL A CG1   1 
ATOM   1116 C CG2   . VAL A 1 142 ? 19.611  -1.863  0.125   1.00 33.42  ? 557 VAL A CG2   1 
ATOM   1117 N N     . ALA A 1 143 ? 15.233  -2.071  -1.947  1.00 36.30  ? 558 ALA A N     1 
ATOM   1118 C CA    . ALA A 1 143 ? 14.222  -2.393  -2.902  1.00 37.41  ? 558 ALA A CA    1 
ATOM   1119 C C     . ALA A 1 143 ? 14.775  -2.072  -4.310  1.00 39.24  ? 558 ALA A C     1 
ATOM   1120 O O     . ALA A 1 143 ? 14.575  -2.824  -5.224  1.00 39.22  ? 558 ALA A O     1 
ATOM   1121 C CB    . ALA A 1 143 ? 12.981  -1.549  -2.643  1.00 36.49  ? 558 ALA A CB    1 
ATOM   1122 N N     . SER A 1 144 ? 15.507  -0.973  -4.453  1.00 38.82  ? 559 SER A N     1 
ATOM   1123 C CA    . SER A 1 144 ? 16.085  -0.674  -5.734  1.00 41.26  ? 559 SER A CA    1 
ATOM   1124 C C     . SER A 1 144 ? 17.262  0.257   -5.490  1.00 40.75  ? 559 SER A C     1 
ATOM   1125 O O     . SER A 1 144 ? 17.416  0.763   -4.348  1.00 40.00  ? 559 SER A O     1 
ATOM   1126 C CB    . SER A 1 144 ? 15.025  -0.124  -6.699  1.00 40.89  ? 559 SER A CB    1 
ATOM   1127 O OG    . SER A 1 144 ? 14.741  1.187   -6.337  1.00 43.14  ? 559 SER A OG    1 
ATOM   1128 N N     . PRO A 1 145 ? 18.151  0.431   -6.516  1.00 41.37  ? 560 PRO A N     1 
ATOM   1129 C CA    . PRO A 1 145 ? 19.235  1.367   -6.234  1.00 40.95  ? 560 PRO A CA    1 
ATOM   1130 C C     . PRO A 1 145 ? 18.699  2.674   -5.659  1.00 41.66  ? 560 PRO A C     1 
ATOM   1131 O O     . PRO A 1 145 ? 19.420  3.334   -4.908  1.00 44.02  ? 560 PRO A O     1 
ATOM   1132 C CB    . PRO A 1 145 ? 19.912  1.579   -7.635  1.00 41.54  ? 560 PRO A CB    1 
ATOM   1133 C CG    . PRO A 1 145 ? 19.734  0.179   -8.268  1.00 40.79  ? 560 PRO A CG    1 
ATOM   1134 C CD    . PRO A 1 145 ? 18.297  -0.189  -7.861  1.00 40.17  ? 560 PRO A CD    1 
ATOM   1135 N N     . GLU A 1 146 ? 17.476  3.083   -5.981  1.00 40.38  ? 561 GLU A N     1 
ATOM   1136 C CA    . GLU A 1 146 ? 17.011  4.319   -5.400  1.00 42.66  ? 561 GLU A CA    1 
ATOM   1137 C C     . GLU A 1 146 ? 15.971  4.233   -4.298  1.00 41.22  ? 561 GLU A C     1 
ATOM   1138 O O     . GLU A 1 146 ? 15.290  5.219   -4.043  1.00 41.61  ? 561 GLU A O     1 
ATOM   1139 C CB    . GLU A 1 146 ? 16.521  5.291   -6.469  1.00 43.95  ? 561 GLU A CB    1 
ATOM   1140 C CG    . GLU A 1 146 ? 17.467  5.305   -7.687  1.00 51.90  ? 561 GLU A CG    1 
ATOM   1141 C CD    . GLU A 1 146 ? 17.280  6.571   -8.499  1.00 61.01  ? 561 GLU A CD    1 
ATOM   1142 O OE1   . GLU A 1 146 ? 18.177  7.456   -8.502  1.00 64.17  ? 561 GLU A OE1   1 
ATOM   1143 O OE2   . GLU A 1 146 ? 16.184  6.693   -9.079  1.00 65.83  ? 561 GLU A OE2   1 
ATOM   1144 N N     . CYS A 1 147 ? 15.883  3.115   -3.578  1.00 40.72  ? 562 CYS A N     1 
ATOM   1145 C CA    . CYS A 1 147 ? 14.750  2.990   -2.634  1.00 40.08  ? 562 CYS A CA    1 
ATOM   1146 C C     . CYS A 1 147 ? 15.074  1.985   -1.567  1.00 38.47  ? 562 CYS A C     1 
ATOM   1147 O O     . CYS A 1 147 ? 15.352  0.883   -1.881  1.00 38.93  ? 562 CYS A O     1 
ATOM   1148 C CB    . CYS A 1 147 ? 13.460  2.555   -3.359  1.00 39.65  ? 562 CYS A CB    1 
ATOM   1149 S SG    . CYS A 1 147 ? 11.993  2.327   -2.208  1.00 46.49  ? 562 CYS A SG    1 
ATOM   1150 N N     . VAL A 1 148 ? 15.089  2.399   -0.315  1.00 37.19  ? 563 VAL A N     1 
ATOM   1151 C CA    . VAL A 1 148 ? 15.287  1.473   0.811   1.00 37.05  ? 563 VAL A CA    1 
ATOM   1152 C C     . VAL A 1 148 ? 14.072  1.471   1.697   1.00 36.54  ? 563 VAL A C     1 
ATOM   1153 O O     . VAL A 1 148 ? 13.276  2.388   1.648   1.00 35.30  ? 563 VAL A O     1 
ATOM   1154 C CB    . VAL A 1 148 ? 16.519  1.877   1.681   1.00 36.55  ? 563 VAL A CB    1 
ATOM   1155 C CG1   . VAL A 1 148 ? 17.788  1.834   0.790   1.00 34.64  ? 563 VAL A CG1   1 
ATOM   1156 C CG2   . VAL A 1 148 ? 16.298  3.271   2.292   1.00 35.01  ? 563 VAL A CG2   1 
ATOM   1157 N N     . LYS A 1 149 ? 13.971  0.431   2.516   1.00 38.14  ? 564 LYS A N     1 
ATOM   1158 C CA    . LYS A 1 149 ? 12.851  0.250   3.416   1.00 38.38  ? 564 LYS A CA    1 
ATOM   1159 C C     . LYS A 1 149 ? 13.338  -0.179  4.786   1.00 38.16  ? 564 LYS A C     1 
ATOM   1160 O O     . LYS A 1 149 ? 14.030  -1.174  4.932   1.00 38.12  ? 564 LYS A O     1 
ATOM   1161 C CB    . LYS A 1 149 ? 11.976  -0.894  2.929   1.00 37.92  ? 564 LYS A CB    1 
ATOM   1162 C CG    . LYS A 1 149 ? 11.720  -0.874  1.510   1.00 40.12  ? 564 LYS A CG    1 
ATOM   1163 C CD    . LYS A 1 149 ? 10.335  -0.393  1.254   1.00 37.30  ? 564 LYS A CD    1 
ATOM   1164 C CE    . LYS A 1 149 ? 10.177  -0.511  -0.260  1.00 44.95  ? 564 LYS A CE    1 
ATOM   1165 N NZ    . LYS A 1 149 ? 9.081   0.365   -0.652  1.00 45.75  ? 564 LYS A NZ    1 
ATOM   1166 N N     . LEU A 1 150 ? 12.884  0.549   5.777   1.00 37.36  ? 565 LEU A N     1 
ATOM   1167 C CA    . LEU A 1 150 ? 13.130  0.236   7.179   1.00 37.85  ? 565 LEU A CA    1 
ATOM   1168 C C     . LEU A 1 150 ? 12.429  -1.084  7.642   1.00 38.78  ? 565 LEU A C     1 
ATOM   1169 O O     . LEU A 1 150 ? 11.187  -1.292  7.461   1.00 37.73  ? 565 LEU A O     1 
ATOM   1170 C CB    . LEU A 1 150 ? 12.685  1.433   8.004   1.00 36.77  ? 565 LEU A CB    1 
ATOM   1171 C CG    . LEU A 1 150 ? 12.686  1.158   9.514   1.00 38.56  ? 565 LEU A CG    1 
ATOM   1172 C CD1   . LEU A 1 150 ? 14.160  0.943   9.925   1.00 39.79  ? 565 LEU A CD1   1 
ATOM   1173 C CD2   . LEU A 1 150 ? 12.118  2.389   10.140  1.00 37.42  ? 565 LEU A CD2   1 
ATOM   1174 N N     . GLY A 1 151 ? 13.246  -2.000  8.153   1.00 39.54  ? 566 GLY A N     1 
ATOM   1175 C CA    . GLY A 1 151 ? 12.785  -3.324  8.491   1.00 42.91  ? 566 GLY A CA    1 
ATOM   1176 C C     . GLY A 1 151 ? 11.972  -3.391  9.790   1.00 47.65  ? 566 GLY A C     1 
ATOM   1177 O O     . GLY A 1 151 ? 11.687  -2.385  10.439  1.00 47.47  ? 566 GLY A O     1 
ATOM   1178 N N     . ASP A 1 152 ? 11.615  -4.592  10.188  1.00 51.35  ? 567 ASP A N     1 
ATOM   1179 C CA    . ASP A 1 152 ? 10.550  -4.725  11.137  1.00 56.73  ? 567 ASP A CA    1 
ATOM   1180 C C     . ASP A 1 152 ? 11.125  -5.009  12.472  1.00 59.22  ? 567 ASP A C     1 
ATOM   1181 O O     . ASP A 1 152 ? 11.147  -6.178  12.880  1.00 60.85  ? 567 ASP A O     1 
ATOM   1182 C CB    . ASP A 1 152 ? 9.518   -5.825  10.713  1.00 58.11  ? 567 ASP A CB    1 
ATOM   1183 C CG    . ASP A 1 152 ? 10.124  -7.219  10.485  1.00 60.06  ? 567 ASP A CG    1 
ATOM   1184 O OD1   . ASP A 1 152 ? 11.059  -7.651  11.211  1.00 61.98  ? 567 ASP A OD1   1 
ATOM   1185 O OD2   . ASP A 1 152 ? 9.616   -7.906  9.548   1.00 66.55  ? 567 ASP A OD2   1 
ATOM   1186 N N     . PHE A 1 153 ? 11.640  -3.994  13.158  1.00 61.47  ? 568 PHE A N     1 
ATOM   1187 C CA    . PHE A 1 153 ? 12.268  -4.342  14.431  1.00 65.28  ? 568 PHE A CA    1 
ATOM   1188 C C     . PHE A 1 153 ? 11.797  -3.551  15.652  1.00 65.54  ? 568 PHE A C     1 
ATOM   1189 O O     . PHE A 1 153 ? 12.541  -3.396  16.641  1.00 64.32  ? 568 PHE A O     1 
ATOM   1190 C CB    . PHE A 1 153 ? 13.797  -4.371  14.314  1.00 65.67  ? 568 PHE A CB    1 
ATOM   1191 C CG    . PHE A 1 153 ? 14.388  -5.757  14.371  1.00 69.40  ? 568 PHE A CG    1 
ATOM   1192 C CD1   . PHE A 1 153 ? 15.168  -6.242  13.325  1.00 71.25  ? 568 PHE A CD1   1 
ATOM   1193 C CD2   . PHE A 1 153 ? 14.112  -6.604  15.448  1.00 72.87  ? 568 PHE A CD2   1 
ATOM   1194 C CE1   . PHE A 1 153 ? 15.715  -7.512  13.385  1.00 72.59  ? 568 PHE A CE1   1 
ATOM   1195 C CE2   . PHE A 1 153 ? 14.624  -7.902  15.504  1.00 73.79  ? 568 PHE A CE2   1 
ATOM   1196 C CZ    . PHE A 1 153 ? 15.441  -8.355  14.479  1.00 74.68  ? 568 PHE A CZ    1 
ATOM   1197 N N     . GLY A 1 154 ? 10.560  -3.059  15.540  1.00 66.27  ? 569 GLY A N     1 
ATOM   1198 C CA    . GLY A 1 154 ? 9.907   -2.309  16.614  1.00 66.92  ? 569 GLY A CA    1 
ATOM   1199 C C     . GLY A 1 154 ? 8.718   -1.527  16.097  1.00 67.29  ? 569 GLY A C     1 
ATOM   1200 O O     . GLY A 1 154 ? 8.116   -1.917  15.090  1.00 68.44  ? 569 GLY A O     1 
ATOM   1201 N N     . THR A 1 170 ? 19.561  -10.061 26.884  1.00 80.23  ? 585 THR A N     1 
ATOM   1202 C CA    . THR A 1 170 ? 19.040  -9.444  25.663  1.00 80.10  ? 585 THR A CA    1 
ATOM   1203 C C     . THR A 1 170 ? 20.107  -8.507  25.066  1.00 79.31  ? 585 THR A C     1 
ATOM   1204 O O     . THR A 1 170 ? 20.008  -7.282  25.244  1.00 79.76  ? 585 THR A O     1 
ATOM   1205 C CB    . THR A 1 170 ? 17.728  -8.606  25.946  1.00 80.56  ? 585 THR A CB    1 
ATOM   1206 O OG1   . THR A 1 170 ? 17.040  -9.101  27.118  1.00 81.33  ? 585 THR A OG1   1 
ATOM   1207 C CG2   . THR A 1 170 ? 16.779  -8.588  24.709  1.00 80.30  ? 585 THR A CG2   1 
ATOM   1208 N N     . ARG A 1 171 ? 21.128  -9.075  24.398  1.00 77.67  ? 586 ARG A N     1 
ATOM   1209 C CA    . ARG A 1 171 ? 22.213  -8.279  23.737  1.00 75.83  ? 586 ARG A CA    1 
ATOM   1210 C C     . ARG A 1 171 ? 21.691  -7.076  22.912  1.00 72.92  ? 586 ARG A C     1 
ATOM   1211 O O     . ARG A 1 171 ? 21.326  -7.221  21.740  1.00 73.11  ? 586 ARG A O     1 
ATOM   1212 C CB    . ARG A 1 171 ? 23.081  -9.169  22.838  1.00 76.60  ? 586 ARG A CB    1 
ATOM   1213 C CG    . ARG A 1 171 ? 22.251  -10.069 21.879  1.00 79.92  ? 586 ARG A CG    1 
ATOM   1214 C CD    . ARG A 1 171 ? 22.904  -10.294 20.488  1.00 83.48  ? 586 ARG A CD    1 
ATOM   1215 N NE    . ARG A 1 171 ? 22.352  -11.489 19.831  1.00 86.82  ? 586 ARG A NE    1 
ATOM   1216 C CZ    . ARG A 1 171 ? 22.797  -12.736 20.026  1.00 87.89  ? 586 ARG A CZ    1 
ATOM   1217 N NH1   . ARG A 1 171 ? 23.808  -12.987 20.862  1.00 87.13  ? 586 ARG A NH1   1 
ATOM   1218 N NH2   . ARG A 1 171 ? 22.223  -13.741 19.383  1.00 88.39  ? 586 ARG A NH2   1 
ATOM   1219 N N     . LEU A 1 172 ? 21.648  -5.907  23.548  1.00 69.22  ? 587 LEU A N     1 
ATOM   1220 C CA    . LEU A 1 172 ? 21.136  -4.652  22.965  1.00 65.82  ? 587 LEU A CA    1 
ATOM   1221 C C     . LEU A 1 172 ? 22.147  -4.028  22.001  1.00 61.85  ? 587 LEU A C     1 
ATOM   1222 O O     . LEU A 1 172 ? 23.335  -4.348  22.110  1.00 61.87  ? 587 LEU A O     1 
ATOM   1223 C CB    . LEU A 1 172 ? 20.897  -3.661  24.093  1.00 66.51  ? 587 LEU A CB    1 
ATOM   1224 C CG    . LEU A 1 172 ? 19.663  -3.863  24.975  1.00 67.69  ? 587 LEU A CG    1 
ATOM   1225 C CD1   . LEU A 1 172 ? 19.576  -2.739  25.938  1.00 67.63  ? 587 LEU A CD1   1 
ATOM   1226 C CD2   . LEU A 1 172 ? 18.358  -3.972  24.129  1.00 70.16  ? 587 LEU A CD2   1 
ATOM   1227 N N     . PRO A 1 173 ? 21.693  -3.151  21.061  1.00 57.55  ? 588 PRO A N     1 
ATOM   1228 C CA    . PRO A 1 173 ? 22.673  -2.534  20.141  1.00 54.58  ? 588 PRO A CA    1 
ATOM   1229 C C     . PRO A 1 173 ? 23.343  -1.361  20.798  1.00 50.98  ? 588 PRO A C     1 
ATOM   1230 O O     . PRO A 1 173 ? 23.086  -0.211  20.466  1.00 49.90  ? 588 PRO A O     1 
ATOM   1231 C CB    . PRO A 1 173 ? 21.821  -2.109  18.929  1.00 54.63  ? 588 PRO A CB    1 
ATOM   1232 C CG    . PRO A 1 173 ? 20.472  -1.848  19.496  1.00 55.30  ? 588 PRO A CG    1 
ATOM   1233 C CD    . PRO A 1 173 ? 20.309  -2.875  20.631  1.00 57.32  ? 588 PRO A CD    1 
ATOM   1234 N N     . ILE A 1 174 ? 24.205  -1.669  21.759  1.00 48.52  ? 589 ILE A N     1 
ATOM   1235 C CA    . ILE A 1 174 ? 24.790  -0.635  22.610  1.00 46.92  ? 589 ILE A CA    1 
ATOM   1236 C C     . ILE A 1 174 ? 25.462  0.521   21.827  1.00 44.96  ? 589 ILE A C     1 
ATOM   1237 O O     . ILE A 1 174 ? 25.346  1.698   22.230  1.00 45.41  ? 589 ILE A O     1 
ATOM   1238 C CB    . ILE A 1 174 ? 25.819  -1.246  23.564  1.00 46.46  ? 589 ILE A CB    1 
ATOM   1239 C CG1   . ILE A 1 174 ? 25.097  -2.147  24.585  1.00 46.84  ? 589 ILE A CG1   1 
ATOM   1240 C CG2   . ILE A 1 174 ? 26.628  -0.153  24.185  1.00 45.43  ? 589 ILE A CG2   1 
ATOM   1241 C CD1   . ILE A 1 174 ? 24.206  -1.389  25.522  1.00 45.64  ? 589 ILE A CD1   1 
ATOM   1242 N N     . LYS A 1 175 ? 26.166  0.175   20.739  1.00 42.52  ? 590 LYS A N     1 
ATOM   1243 C CA    . LYS A 1 175 ? 26.937  1.165   19.916  1.00 41.99  ? 590 LYS A CA    1 
ATOM   1244 C C     . LYS A 1 175 ? 26.034  2.047   19.080  1.00 41.05  ? 590 LYS A C     1 
ATOM   1245 O O     . LYS A 1 175 ? 26.513  2.976   18.439  1.00 41.51  ? 590 LYS A O     1 
ATOM   1246 C CB    . LYS A 1 175 ? 27.899  0.406   18.964  1.00 41.27  ? 590 LYS A CB    1 
ATOM   1247 C CG    . LYS A 1 175 ? 29.082  -0.163  19.704  1.00 43.52  ? 590 LYS A CG    1 
ATOM   1248 C CD    . LYS A 1 175 ? 29.933  -1.147  18.915  1.00 42.01  ? 590 LYS A CD    1 
ATOM   1249 C CE    . LYS A 1 175 ? 31.141  -1.554  19.789  1.00 40.69  ? 590 LYS A CE    1 
ATOM   1250 N NZ    . LYS A 1 175 ? 31.930  -2.523  18.987  1.00 43.57  ? 590 LYS A NZ    1 
ATOM   1251 N N     . TRP A 1 176 ? 24.740  1.689   18.998  1.00 40.24  ? 591 TRP A N     1 
ATOM   1252 C CA    . TRP A 1 176 ? 23.745  2.475   18.271  1.00 39.82  ? 591 TRP A CA    1 
ATOM   1253 C C     . TRP A 1 176 ? 22.883  3.294   19.224  1.00 40.34  ? 591 TRP A C     1 
ATOM   1254 O O     . TRP A 1 176 ? 22.072  4.104   18.787  1.00 39.15  ? 591 TRP A O     1 
ATOM   1255 C CB    . TRP A 1 176 ? 22.813  1.575   17.429  1.00 39.95  ? 591 TRP A CB    1 
ATOM   1256 C CG    . TRP A 1 176 ? 23.436  1.018   16.174  1.00 36.21  ? 591 TRP A CG    1 
ATOM   1257 C CD1   . TRP A 1 176 ? 23.300  1.489   14.829  1.00 36.92  ? 591 TRP A CD1   1 
ATOM   1258 C CD2   . TRP A 1 176 ? 24.259  -0.153  16.107  1.00 38.82  ? 591 TRP A CD2   1 
ATOM   1259 N NE1   . TRP A 1 176 ? 24.062  0.643   13.956  1.00 33.43  ? 591 TRP A NE1   1 
ATOM   1260 C CE2   . TRP A 1 176 ? 24.639  -0.353  14.722  1.00 35.58  ? 591 TRP A CE2   1 
ATOM   1261 C CE3   . TRP A 1 176 ? 24.779  -1.014  17.081  1.00 36.28  ? 591 TRP A CE3   1 
ATOM   1262 C CZ2   . TRP A 1 176 ? 25.469  -1.403  14.330  1.00 36.03  ? 591 TRP A CZ2   1 
ATOM   1263 C CZ3   . TRP A 1 176 ? 25.592  -2.056  16.686  1.00 38.20  ? 591 TRP A CZ3   1 
ATOM   1264 C CH2   . TRP A 1 176 ? 25.925  -2.253  15.285  1.00 36.29  ? 591 TRP A CH2   1 
ATOM   1265 N N     . MET A 1 177 ? 23.065  3.072   20.535  1.00 41.01  ? 592 MET A N     1 
ATOM   1266 C CA    . MET A 1 177 ? 22.071  3.568   21.553  1.00 40.48  ? 592 MET A CA    1 
ATOM   1267 C C     . MET A 1 177 ? 22.394  4.877   22.194  1.00 39.97  ? 592 MET A C     1 
ATOM   1268 O O     . MET A 1 177 ? 23.583  5.208   22.372  1.00 39.32  ? 592 MET A O     1 
ATOM   1269 C CB    . MET A 1 177 ? 21.810  2.483   22.616  1.00 40.69  ? 592 MET A CB    1 
ATOM   1270 C CG    . MET A 1 177 ? 20.859  1.378   22.113  1.00 40.65  ? 592 MET A CG    1 
ATOM   1271 S SD    . MET A 1 177 ? 20.962  -0.165  23.099  1.00 48.74  ? 592 MET A SD    1 
ATOM   1272 C CE    . MET A 1 177 ? 20.500  0.494   24.733  1.00 46.42  ? 592 MET A CE    1 
ATOM   1273 N N     . SER A 1 178 ? 21.337  5.653   22.489  1.00 39.05  ? 593 SER A N     1 
ATOM   1274 C CA    . SER A 1 178 ? 21.435  6.923   23.140  1.00 40.49  ? 593 SER A CA    1 
ATOM   1275 C C     . SER A 1 178 ? 21.915  6.674   24.568  1.00 40.50  ? 593 SER A C     1 
ATOM   1276 O O     . SER A 1 178 ? 21.764  5.573   25.059  1.00 39.76  ? 593 SER A O     1 
ATOM   1277 C CB    . SER A 1 178 ? 20.059  7.611   23.236  1.00 40.32  ? 593 SER A CB    1 
ATOM   1278 O OG    . SER A 1 178 ? 19.174  6.833   24.039  1.00 43.23  ? 593 SER A OG    1 
ATOM   1279 N N     . PRO A 1 179 ? 22.519  7.682   25.212  1.00 41.45  ? 594 PRO A N     1 
ATOM   1280 C CA    . PRO A 1 179 ? 22.925  7.529   26.601  1.00 43.23  ? 594 PRO A CA    1 
ATOM   1281 C C     . PRO A 1 179 ? 21.759  7.064   27.529  1.00 45.50  ? 594 PRO A C     1 
ATOM   1282 O O     . PRO A 1 179 ? 21.982  6.118   28.355  1.00 45.83  ? 594 PRO A O     1 
ATOM   1283 C CB    . PRO A 1 179 ? 23.442  8.934   26.997  1.00 42.07  ? 594 PRO A CB    1 
ATOM   1284 C CG    . PRO A 1 179 ? 23.852  9.575   25.710  1.00 43.51  ? 594 PRO A CG    1 
ATOM   1285 C CD    . PRO A 1 179 ? 22.849  9.003   24.670  1.00 40.40  ? 594 PRO A CD    1 
ATOM   1286 N N     . GLU A 1 180 ? 20.553  7.665   27.389  1.00 47.49  ? 595 GLU A N     1 
ATOM   1287 C CA    . GLU A 1 180 ? 19.389  7.292   28.242  1.00 50.26  ? 595 GLU A CA    1 
ATOM   1288 C C     . GLU A 1 180 ? 19.128  5.817   28.092  1.00 50.36  ? 595 GLU A C     1 
ATOM   1289 O O     . GLU A 1 180 ? 18.719  5.143   29.046  1.00 52.06  ? 595 GLU A O     1 
ATOM   1290 C CB    . GLU A 1 180 ? 17.999  7.893   27.841  1.00 51.16  ? 595 GLU A CB    1 
ATOM   1291 C CG    . GLU A 1 180 ? 17.750  9.198   27.205  1.00 50.64  ? 595 GLU A CG    1 
ATOM   1292 C CD    . GLU A 1 180 ? 18.350  9.397   25.848  1.00 49.76  ? 595 GLU A CD    1 
ATOM   1293 O OE1   . GLU A 1 180 ? 17.592  9.490   24.856  1.00 44.75  ? 595 GLU A OE1   1 
ATOM   1294 O OE2   . GLU A 1 180 ? 19.583  9.571   25.802  1.00 50.93  ? 595 GLU A OE2   1 
ATOM   1295 N N     . SER A 1 181 ? 19.243  5.327   26.852  1.00 50.00  ? 596 SER A N     1 
ATOM   1296 C CA    . SER A 1 181 ? 18.908  3.942   26.564  1.00 50.18  ? 596 SER A CA    1 
ATOM   1297 C C     . SER A 1 181 ? 19.945  3.004   27.179  1.00 49.61  ? 596 SER A C     1 
ATOM   1298 O O     . SER A 1 181 ? 19.611  1.898   27.648  1.00 49.21  ? 596 SER A O     1 
ATOM   1299 C CB    . SER A 1 181 ? 18.856  3.686   25.034  1.00 49.57  ? 596 SER A CB    1 
ATOM   1300 O OG    . SER A 1 181 ? 17.799  4.440   24.492  1.00 52.28  ? 596 SER A OG    1 
ATOM   1301 N N     . ILE A 1 182 ? 21.205  3.415   27.109  1.00 49.50  ? 597 ILE A N     1 
ATOM   1302 C CA    . ILE A 1 182 ? 22.295  2.546   27.587  1.00 49.85  ? 597 ILE A CA    1 
ATOM   1303 C C     . ILE A 1 182 ? 22.246  2.540   29.146  1.00 51.76  ? 597 ILE A C     1 
ATOM   1304 O O     . ILE A 1 182 ? 22.374  1.486   29.795  1.00 50.84  ? 597 ILE A O     1 
ATOM   1305 C CB    . ILE A 1 182 ? 23.662  3.057   27.105  1.00 50.79  ? 597 ILE A CB    1 
ATOM   1306 C CG1   . ILE A 1 182 ? 23.866  2.831   25.581  1.00 48.05  ? 597 ILE A CG1   1 
ATOM   1307 C CG2   . ILE A 1 182 ? 24.857  2.400   27.930  1.00 49.49  ? 597 ILE A CG2   1 
ATOM   1308 C CD1   . ILE A 1 182 ? 25.185  3.400   25.112  1.00 45.60  ? 597 ILE A CD1   1 
ATOM   1309 N N     . ASN A 1 183 ? 21.979  3.723   29.702  1.00 53.07  ? 598 ASN A N     1 
ATOM   1310 C CA    . ASN A 1 183 ? 21.979  3.958   31.132  1.00 54.57  ? 598 ASN A CA    1 
ATOM   1311 C C     . ASN A 1 183 ? 20.724  3.421   31.803  1.00 55.36  ? 598 ASN A C     1 
ATOM   1312 O O     . ASN A 1 183 ? 20.799  2.645   32.752  1.00 56.13  ? 598 ASN A O     1 
ATOM   1313 C CB    . ASN A 1 183 ? 22.148  5.452   31.407  1.00 53.92  ? 598 ASN A CB    1 
ATOM   1314 C CG    . ASN A 1 183 ? 23.605  5.897   31.318  1.00 52.13  ? 598 ASN A CG    1 
ATOM   1315 O OD1   . ASN A 1 183 ? 23.906  7.068   31.125  1.00 53.91  ? 598 ASN A OD1   1 
ATOM   1316 N ND2   . ASN A 1 183 ? 24.500  4.961   31.492  1.00 54.06  ? 598 ASN A ND2   1 
ATOM   1317 N N     . PHE A 1 184 ? 19.566  3.793   31.279  1.00 56.32  ? 599 PHE A N     1 
ATOM   1318 C CA    . PHE A 1 184 ? 18.317  3.434   31.925  1.00 56.40  ? 599 PHE A CA    1 
ATOM   1319 C C     . PHE A 1 184 ? 17.382  2.594   31.104  1.00 56.69  ? 599 PHE A C     1 
ATOM   1320 O O     . PHE A 1 184 ? 16.263  2.384   31.525  1.00 56.44  ? 599 PHE A O     1 
ATOM   1321 C CB    . PHE A 1 184 ? 17.639  4.708   32.385  1.00 56.65  ? 599 PHE A CB    1 
ATOM   1322 C CG    . PHE A 1 184 ? 18.621  5.688   32.967  1.00 57.77  ? 599 PHE A CG    1 
ATOM   1323 C CD1   . PHE A 1 184 ? 18.867  6.923   32.356  1.00 56.36  ? 599 PHE A CD1   1 
ATOM   1324 C CD2   . PHE A 1 184 ? 19.385  5.329   34.070  1.00 57.78  ? 599 PHE A CD2   1 
ATOM   1325 C CE1   . PHE A 1 184 ? 19.837  7.792   32.867  1.00 56.02  ? 599 PHE A CE1   1 
ATOM   1326 C CE2   . PHE A 1 184 ? 20.352  6.228   34.591  1.00 58.17  ? 599 PHE A CE2   1 
ATOM   1327 C CZ    . PHE A 1 184 ? 20.584  7.435   33.982  1.00 54.75  ? 599 PHE A CZ    1 
ATOM   1328 N N     . ARG A 1 185 ? 17.802  2.100   29.937  1.00 55.87  ? 600 ARG A N     1 
ATOM   1329 C CA    . ARG A 1 185 ? 16.822  1.380   29.103  1.00 56.20  ? 600 ARG A CA    1 
ATOM   1330 C C     . ARG A 1 185 ? 15.553  2.243   28.792  1.00 54.53  ? 600 ARG A C     1 
ATOM   1331 O O     . ARG A 1 185 ? 14.477  1.686   28.595  1.00 54.54  ? 600 ARG A O     1 
ATOM   1332 C CB    . ARG A 1 185 ? 16.405  0.059   29.809  1.00 56.74  ? 600 ARG A CB    1 
ATOM   1333 C CG    . ARG A 1 185 ? 16.831  -1.258  29.105  1.00 61.93  ? 600 ARG A CG    1 
ATOM   1334 C CD    . ARG A 1 185 ? 15.617  -2.253  29.063  1.00 69.40  ? 600 ARG A CD    1 
ATOM   1335 N NE    . ARG A 1 185 ? 15.317  -2.795  27.730  1.00 71.76  ? 600 ARG A NE    1 
ATOM   1336 C CZ    . ARG A 1 185 ? 14.106  -3.147  27.303  1.00 73.80  ? 600 ARG A CZ    1 
ATOM   1337 N NH1   . ARG A 1 185 ? 13.023  -3.002  28.057  1.00 77.30  ? 600 ARG A NH1   1 
ATOM   1338 N NH2   . ARG A 1 185 ? 13.970  -3.639  26.096  1.00 77.16  ? 600 ARG A NH2   1 
ATOM   1339 N N     . ARG A 1 186 ? 15.684  3.581   28.799  1.00 53.16  ? 601 ARG A N     1 
ATOM   1340 C CA    . ARG A 1 186 ? 14.650  4.511   28.304  1.00 53.04  ? 601 ARG A CA    1 
ATOM   1341 C C     . ARG A 1 186 ? 14.741  4.592   26.773  1.00 52.02  ? 601 ARG A C     1 
ATOM   1342 O O     . ARG A 1 186 ? 15.842  4.825   26.228  1.00 50.95  ? 601 ARG A O     1 
ATOM   1343 C CB    . ARG A 1 186 ? 14.830  5.952   28.852  1.00 53.72  ? 601 ARG A CB    1 
ATOM   1344 C CG    . ARG A 1 186 ? 14.249  6.209   30.235  1.00 57.72  ? 601 ARG A CG    1 
ATOM   1345 C CD    . ARG A 1 186 ? 13.913  7.711   30.476  1.00 63.56  ? 601 ARG A CD    1 
ATOM   1346 N NE    . ARG A 1 186 ? 13.729  7.941   31.909  1.00 72.64  ? 601 ARG A NE    1 
ATOM   1347 C CZ    . ARG A 1 186 ? 13.083  8.963   32.488  1.00 76.92  ? 601 ARG A CZ    1 
ATOM   1348 N NH1   . ARG A 1 186 ? 12.498  9.928   31.769  1.00 77.15  ? 601 ARG A NH1   1 
ATOM   1349 N NH2   . ARG A 1 186 ? 13.025  9.006   33.815  1.00 77.32  ? 601 ARG A NH2   1 
ATOM   1350 N N     . PHE A 1 187 ? 13.592  4.437   26.106  1.00 50.53  ? 602 PHE A N     1 
ATOM   1351 C CA    . PHE A 1 187 ? 13.514  4.491   24.682  1.00 50.41  ? 602 PHE A CA    1 
ATOM   1352 C C     . PHE A 1 187 ? 12.350  5.371   24.404  1.00 50.26  ? 602 PHE A C     1 
ATOM   1353 O O     . PHE A 1 187 ? 11.263  5.090   24.864  1.00 51.37  ? 602 PHE A O     1 
ATOM   1354 C CB    . PHE A 1 187 ? 13.229  3.086   24.097  1.00 51.79  ? 602 PHE A CB    1 
ATOM   1355 C CG    . PHE A 1 187 ? 14.379  2.130   24.265  1.00 54.23  ? 602 PHE A CG    1 
ATOM   1356 C CD1   . PHE A 1 187 ? 14.462  1.297   25.382  1.00 57.97  ? 602 PHE A CD1   1 
ATOM   1357 C CD2   . PHE A 1 187 ? 15.405  2.098   23.353  1.00 54.47  ? 602 PHE A CD2   1 
ATOM   1358 C CE1   . PHE A 1 187 ? 15.549  0.434   25.554  1.00 57.19  ? 602 PHE A CE1   1 
ATOM   1359 C CE2   . PHE A 1 187 ? 16.483  1.232   23.536  1.00 55.49  ? 602 PHE A CE2   1 
ATOM   1360 C CZ    . PHE A 1 187 ? 16.549  0.403   24.626  1.00 55.64  ? 602 PHE A CZ    1 
ATOM   1361 N N     . THR A 1 188 ? 12.561  6.444   23.658  1.00 48.51  ? 603 THR A N     1 
ATOM   1362 C CA    . THR A 1 188 ? 11.534  7.399   23.348  1.00 46.59  ? 603 THR A CA    1 
ATOM   1363 C C     . THR A 1 188 ? 11.786  7.792   21.873  1.00 46.98  ? 603 THR A C     1 
ATOM   1364 O O     . THR A 1 188 ? 12.747  7.254   21.253  1.00 46.38  ? 603 THR A O     1 
ATOM   1365 C CB    . THR A 1 188 ? 11.709  8.624   24.193  1.00 46.98  ? 603 THR A CB    1 
ATOM   1366 O OG1   . THR A 1 188 ? 12.979  9.159   23.929  1.00 44.80  ? 603 THR A OG1   1 
ATOM   1367 C CG2   . THR A 1 188 ? 11.602  8.343   25.785  1.00 46.98  ? 603 THR A CG2   1 
ATOM   1368 N N     . THR A 1 189 ? 10.994  8.716   21.301  1.00 45.11  ? 604 THR A N     1 
ATOM   1369 C CA    . THR A 1 189 ? 11.231  9.070   19.932  1.00 45.50  ? 604 THR A CA    1 
ATOM   1370 C C     . THR A 1 189 ? 12.559  9.799   19.840  1.00 44.42  ? 604 THR A C     1 
ATOM   1371 O O     . THR A 1 189 ? 13.284  9.675   18.865  1.00 44.92  ? 604 THR A O     1 
ATOM   1372 C CB    . THR A 1 189 ? 10.072  9.812   19.278  1.00 46.81  ? 604 THR A CB    1 
ATOM   1373 O OG1   . THR A 1 189 ? 9.847   11.027  19.994  1.00 51.03  ? 604 THR A OG1   1 
ATOM   1374 C CG2   . THR A 1 189 ? 8.786   8.928   19.279  1.00 48.08  ? 604 THR A CG2   1 
ATOM   1375 N N     . ALA A 1 190 ? 12.924  10.493  20.895  1.00 43.20  ? 605 ALA A N     1 
ATOM   1376 C CA    . ALA A 1 190 ? 14.204  11.189  20.922  1.00 42.21  ? 605 ALA A CA    1 
ATOM   1377 C C     . ALA A 1 190 ? 15.440  10.225  20.953  1.00 41.98  ? 605 ALA A C     1 
ATOM   1378 O O     . ALA A 1 190 ? 16.542  10.558  20.399  1.00 40.48  ? 605 ALA A O     1 
ATOM   1379 C CB    . ALA A 1 190 ? 14.244  12.226  22.077  1.00 42.88  ? 605 ALA A CB    1 
ATOM   1380 N N     . SER A 1 191 ? 15.301  9.075   21.585  1.00 39.08  ? 606 SER A N     1 
ATOM   1381 C CA    . SER A 1 191 ? 16.406  8.099   21.509  1.00 40.10  ? 606 SER A CA    1 
ATOM   1382 C C     . SER A 1 191 ? 16.450  7.473   20.103  1.00 38.51  ? 606 SER A C     1 
ATOM   1383 O O     . SER A 1 191 ? 17.504  7.217   19.606  1.00 38.00  ? 606 SER A O     1 
ATOM   1384 C CB    . SER A 1 191 ? 16.327  7.016   22.595  1.00 39.25  ? 606 SER A CB    1 
ATOM   1385 O OG    . SER A 1 191 ? 15.244  6.177   22.336  1.00 42.78  ? 606 SER A OG    1 
ATOM   1386 N N     . ASP A 1 192 ? 15.293  7.311   19.467  1.00 37.52  ? 607 ASP A N     1 
ATOM   1387 C CA    . ASP A 1 192 ? 15.261  6.905   18.041  1.00 38.84  ? 607 ASP A CA    1 
ATOM   1388 C C     . ASP A 1 192 ? 15.957  7.981   17.192  1.00 36.83  ? 607 ASP A C     1 
ATOM   1389 O O     . ASP A 1 192 ? 16.658  7.623   16.256  1.00 38.67  ? 607 ASP A O     1 
ATOM   1390 C CB    . ASP A 1 192 ? 13.821  6.723   17.546  1.00 37.58  ? 607 ASP A CB    1 
ATOM   1391 C CG    . ASP A 1 192 ? 13.308  5.341   17.747  1.00 40.51  ? 607 ASP A CG    1 
ATOM   1392 O OD1   . ASP A 1 192 ? 14.050  4.436   18.214  1.00 40.01  ? 607 ASP A OD1   1 
ATOM   1393 O OD2   . ASP A 1 192 ? 12.159  5.143   17.297  1.00 41.29  ? 607 ASP A OD2   1 
ATOM   1394 N N     . VAL A 1 193 ? 15.803  9.263   17.523  1.00 36.98  ? 608 VAL A N     1 
ATOM   1395 C CA    . VAL A 1 193 ? 16.546  10.305  16.792  1.00 35.86  ? 608 VAL A CA    1 
ATOM   1396 C C     . VAL A 1 193 ? 18.102  10.114  16.892  1.00 37.48  ? 608 VAL A C     1 
ATOM   1397 O O     . VAL A 1 193 ? 18.830  10.215  15.858  1.00 36.74  ? 608 VAL A O     1 
ATOM   1398 C CB    . VAL A 1 193 ? 16.144  11.762  17.147  1.00 35.93  ? 608 VAL A CB    1 
ATOM   1399 C CG1   . VAL A 1 193 ? 17.201  12.791  16.632  1.00 34.32  ? 608 VAL A CG1   1 
ATOM   1400 C CG2   . VAL A 1 193 ? 14.785  12.204  16.476  1.00 33.23  ? 608 VAL A CG2   1 
ATOM   1401 N N     . TRP A 1 194 ? 18.606  9.964   18.122  1.00 35.85  ? 609 TRP A N     1 
ATOM   1402 C CA    . TRP A 1 194 ? 19.986  9.561   18.335  1.00 37.43  ? 609 TRP A CA    1 
ATOM   1403 C C     . TRP A 1 194 ? 20.348  8.343   17.457  1.00 36.33  ? 609 TRP A C     1 
ATOM   1404 O O     . TRP A 1 194 ? 21.293  8.388   16.696  1.00 40.19  ? 609 TRP A O     1 
ATOM   1405 C CB    . TRP A 1 194 ? 20.244  9.239   19.830  1.00 37.13  ? 609 TRP A CB    1 
ATOM   1406 C CG    . TRP A 1 194 ? 21.632  8.773   20.105  1.00 36.53  ? 609 TRP A CG    1 
ATOM   1407 C CD1   . TRP A 1 194 ? 22.172  7.642   19.702  1.00 36.62  ? 609 TRP A CD1   1 
ATOM   1408 C CD2   . TRP A 1 194 ? 22.642  9.474   20.868  1.00 35.66  ? 609 TRP A CD2   1 
ATOM   1409 N NE1   . TRP A 1 194 ? 23.503  7.555   20.130  1.00 37.71  ? 609 TRP A NE1   1 
ATOM   1410 C CE2   . TRP A 1 194 ? 23.805  8.683   20.842  1.00 36.93  ? 609 TRP A CE2   1 
ATOM   1411 C CE3   . TRP A 1 194 ? 22.662  10.692  21.536  1.00 33.33  ? 609 TRP A CE3   1 
ATOM   1412 C CZ2   . TRP A 1 194 ? 24.982  9.052   21.455  1.00 39.22  ? 609 TRP A CZ2   1 
ATOM   1413 C CZ3   . TRP A 1 194 ? 23.826  11.066  22.171  1.00 39.92  ? 609 TRP A CZ3   1 
ATOM   1414 C CH2   . TRP A 1 194 ? 24.987  10.239  22.121  1.00 38.21  ? 609 TRP A CH2   1 
ATOM   1415 N N     . MET A 1 195 ? 19.586  7.271   17.511  1.00 35.56  ? 610 MET A N     1 
ATOM   1416 C CA    . MET A 1 195 ? 19.955  6.074   16.807  1.00 35.65  ? 610 MET A CA    1 
ATOM   1417 C C     . MET A 1 195 ? 19.892  6.326   15.277  1.00 35.71  ? 610 MET A C     1 
ATOM   1418 O O     . MET A 1 195 ? 20.695  5.799   14.503  1.00 35.66  ? 610 MET A O     1 
ATOM   1419 C CB    . MET A 1 195 ? 18.978  4.949   17.238  1.00 36.21  ? 610 MET A CB    1 
ATOM   1420 C CG    . MET A 1 195 ? 19.182  3.655   16.539  1.00 40.30  ? 610 MET A CG    1 
ATOM   1421 S SD    . MET A 1 195 ? 18.133  2.371   17.221  1.00 42.27  ? 610 MET A SD    1 
ATOM   1422 C CE    . MET A 1 195 ? 19.252  0.980   17.211  1.00 41.62  ? 610 MET A CE    1 
ATOM   1423 N N     . PHE A 1 196 ? 18.894  7.083   14.823  1.00 36.09  ? 611 PHE A N     1 
ATOM   1424 C CA    . PHE A 1 196 ? 18.785  7.377   13.390  1.00 36.84  ? 611 PHE A CA    1 
ATOM   1425 C C     . PHE A 1 196 ? 20.040  8.065   12.866  1.00 36.11  ? 611 PHE A C     1 
ATOM   1426 O O     . PHE A 1 196 ? 20.480  7.767   11.775  1.00 38.76  ? 611 PHE A O     1 
ATOM   1427 C CB    . PHE A 1 196 ? 17.588  8.289   13.104  1.00 35.15  ? 611 PHE A CB    1 
ATOM   1428 C CG    . PHE A 1 196 ? 17.600  8.880   11.681  1.00 39.57  ? 611 PHE A CG    1 
ATOM   1429 C CD1   . PHE A 1 196 ? 17.249  8.102   10.590  1.00 39.99  ? 611 PHE A CD1   1 
ATOM   1430 C CD2   . PHE A 1 196 ? 17.972  10.226  11.462  1.00 39.57  ? 611 PHE A CD2   1 
ATOM   1431 C CE1   . PHE A 1 196 ? 17.256  8.621   9.301   1.00 37.19  ? 611 PHE A CE1   1 
ATOM   1432 C CE2   . PHE A 1 196 ? 17.969  10.778  10.175  1.00 38.49  ? 611 PHE A CE2   1 
ATOM   1433 C CZ    . PHE A 1 196 ? 17.619  9.955   9.100   1.00 37.15  ? 611 PHE A CZ    1 
ATOM   1434 N N     . ALA A 1 197 ? 20.609  8.987   13.647  1.00 36.33  ? 612 ALA A N     1 
ATOM   1435 C CA    . ALA A 1 197 ? 21.869  9.651   13.266  1.00 35.47  ? 612 ALA A CA    1 
ATOM   1436 C C     . ALA A 1 197 ? 23.002  8.633   13.246  1.00 36.01  ? 612 ALA A C     1 
ATOM   1437 O O     . ALA A 1 197 ? 23.888  8.674   12.371  1.00 37.10  ? 612 ALA A O     1 
ATOM   1438 C CB    . ALA A 1 197 ? 22.176  10.841  14.198  1.00 35.48  ? 612 ALA A CB    1 
ATOM   1439 N N     . VAL A 1 198 ? 23.013  7.701   14.201  1.00 34.70  ? 613 VAL A N     1 
ATOM   1440 C CA    . VAL A 1 198 ? 24.046  6.643   14.103  1.00 34.32  ? 613 VAL A CA    1 
ATOM   1441 C C     . VAL A 1 198 ? 23.908  5.850   12.728  1.00 34.85  ? 613 VAL A C     1 
ATOM   1442 O O     . VAL A 1 198 ? 24.893  5.510   12.115  1.00 33.49  ? 613 VAL A O     1 
ATOM   1443 C CB    . VAL A 1 198 ? 24.029  5.635   15.275  1.00 35.14  ? 613 VAL A CB    1 
ATOM   1444 C CG1   . VAL A 1 198 ? 25.175  4.602   15.079  1.00 32.61  ? 613 VAL A CG1   1 
ATOM   1445 C CG2   . VAL A 1 198 ? 24.165  6.352   16.623  1.00 31.52  ? 613 VAL A CG2   1 
ATOM   1446 N N     . CYS A 1 199 ? 22.674  5.567   12.310  1.00 35.01  ? 614 CYS A N     1 
ATOM   1447 C CA    . CYS A 1 199 ? 22.378  4.920   11.081  1.00 34.06  ? 614 CYS A CA    1 
ATOM   1448 C C     . CYS A 1 199 ? 22.872  5.759   9.876   1.00 34.47  ? 614 CYS A C     1 
ATOM   1449 O O     . CYS A 1 199 ? 23.464  5.190   8.980   1.00 34.74  ? 614 CYS A O     1 
ATOM   1450 C CB    . CYS A 1 199 ? 20.876  4.648   10.967  1.00 35.45  ? 614 CYS A CB    1 
ATOM   1451 S SG    . CYS A 1 199 ? 20.343  3.746   9.445   1.00 37.59  ? 614 CYS A SG    1 
ATOM   1452 N N     . MET A 1 200 ? 22.642  7.080   9.868   1.00 35.05  ? 615 MET A N     1 
ATOM   1453 C CA    . MET A 1 200 ? 23.263  7.974   8.885   1.00 36.30  ? 615 MET A CA    1 
ATOM   1454 C C     . MET A 1 200 ? 24.784  7.822   8.759   1.00 35.61  ? 615 MET A C     1 
ATOM   1455 O O     . MET A 1 200 ? 25.385  7.791   7.675   1.00 35.51  ? 615 MET A O     1 
ATOM   1456 C CB    . MET A 1 200 ? 22.905  9.424   9.229   1.00 36.29  ? 615 MET A CB    1 
ATOM   1457 C CG    . MET A 1 200 ? 21.483  9.735   8.828   1.00 38.43  ? 615 MET A CG    1 
ATOM   1458 S SD    . MET A 1 200 ? 21.078  11.491  8.736   1.00 43.27  ? 615 MET A SD    1 
ATOM   1459 C CE    . MET A 1 200 ? 21.617  12.152  10.275  1.00 42.33  ? 615 MET A CE    1 
ATOM   1460 N N     . TRP A 1 201 ? 25.418  7.747   9.907   1.00 34.98  ? 616 TRP A N     1 
ATOM   1461 C CA    . TRP A 1 201 ? 26.816  7.479   10.016  1.00 34.07  ? 616 TRP A CA    1 
ATOM   1462 C C     . TRP A 1 201 ? 27.234  6.164   9.419   1.00 35.14  ? 616 TRP A C     1 
ATOM   1463 O O     . TRP A 1 201 ? 28.315  6.102   8.743   1.00 35.89  ? 616 TRP A O     1 
ATOM   1464 C CB    . TRP A 1 201 ? 27.252  7.585   11.491  1.00 34.76  ? 616 TRP A CB    1 
ATOM   1465 C CG    . TRP A 1 201 ? 28.786  7.515   11.629  1.00 36.03  ? 616 TRP A CG    1 
ATOM   1466 C CD1   . TRP A 1 201 ? 29.674  8.583   11.719  1.00 35.53  ? 616 TRP A CD1   1 
ATOM   1467 C CD2   . TRP A 1 201 ? 29.573  6.326   11.750  1.00 34.11  ? 616 TRP A CD2   1 
ATOM   1468 N NE1   . TRP A 1 201 ? 30.950  8.107   11.849  1.00 35.82  ? 616 TRP A NE1   1 
ATOM   1469 C CE2   . TRP A 1 201 ? 30.916  6.728   11.882  1.00 35.84  ? 616 TRP A CE2   1 
ATOM   1470 C CE3   . TRP A 1 201 ? 29.269  4.959   11.723  1.00 32.46  ? 616 TRP A CE3   1 
ATOM   1471 C CZ2   . TRP A 1 201 ? 31.960  5.816   12.003  1.00 36.21  ? 616 TRP A CZ2   1 
ATOM   1472 C CZ3   . TRP A 1 201 ? 30.305  4.064   11.824  1.00 36.05  ? 616 TRP A CZ3   1 
ATOM   1473 C CH2   . TRP A 1 201 ? 31.640  4.499   12.008  1.00 34.86  ? 616 TRP A CH2   1 
ATOM   1474 N N     . GLU A 1 202 ? 26.420  5.112   9.623   1.00 34.13  ? 617 GLU A N     1 
ATOM   1475 C CA    . GLU A 1 202 ? 26.663  3.839   8.942   1.00 34.52  ? 617 GLU A CA    1 
ATOM   1476 C C     . GLU A 1 202 ? 26.539  3.972   7.467   1.00 34.74  ? 617 GLU A C     1 
ATOM   1477 O O     . GLU A 1 202 ? 27.319  3.350   6.720   1.00 35.60  ? 617 GLU A O     1 
ATOM   1478 C CB    . GLU A 1 202 ? 25.650  2.727   9.344   1.00 32.11  ? 617 GLU A CB    1 
ATOM   1479 C CG    . GLU A 1 202 ? 25.752  2.317   10.805  1.00 36.62  ? 617 GLU A CG    1 
ATOM   1480 C CD    . GLU A 1 202 ? 24.702  1.213   11.116  1.00 33.50  ? 617 GLU A CD    1 
ATOM   1481 O OE1   . GLU A 1 202 ? 23.517  1.486   10.949  1.00 38.28  ? 617 GLU A OE1   1 
ATOM   1482 O OE2   . GLU A 1 202 ? 25.072  0.108   11.451  1.00 39.92  ? 617 GLU A OE2   1 
ATOM   1483 N N     . ILE A 1 203 ? 25.478  4.645   7.022   1.00 34.34  ? 618 ILE A N     1 
ATOM   1484 C CA    . ILE A 1 203 ? 25.276  4.825   5.613   1.00 34.91  ? 618 ILE A CA    1 
ATOM   1485 C C     . ILE A 1 203 ? 26.454  5.602   4.945   1.00 36.54  ? 618 ILE A C     1 
ATOM   1486 O O     . ILE A 1 203 ? 27.034  5.199   3.871   1.00 35.20  ? 618 ILE A O     1 
ATOM   1487 C CB    . ILE A 1 203 ? 23.895  5.507   5.324   1.00 34.88  ? 618 ILE A CB    1 
ATOM   1488 C CG1   . ILE A 1 203 ? 22.739  4.578   5.662   1.00 33.21  ? 618 ILE A CG1   1 
ATOM   1489 C CG2   . ILE A 1 203 ? 23.781  5.912   3.809   1.00 32.87  ? 618 ILE A CG2   1 
ATOM   1490 C CD1   . ILE A 1 203 ? 21.278  5.266   5.589   1.00 33.85  ? 618 ILE A CD1   1 
ATOM   1491 N N     . LEU A 1 204 ? 26.767  6.738   5.529   1.00 35.38  ? 619 LEU A N     1 
ATOM   1492 C CA    . LEU A 1 204 ? 27.860  7.584   4.994   1.00 37.50  ? 619 LEU A CA    1 
ATOM   1493 C C     . LEU A 1 204 ? 29.256  6.965   5.097   1.00 38.97  ? 619 LEU A C     1 
ATOM   1494 O O     . LEU A 1 204 ? 30.169  7.379   4.345   1.00 39.27  ? 619 LEU A O     1 
ATOM   1495 C CB    . LEU A 1 204 ? 27.873  9.001   5.654   1.00 36.20  ? 619 LEU A CB    1 
ATOM   1496 C CG    . LEU A 1 204 ? 26.772  9.964   5.120   1.00 39.61  ? 619 LEU A CG    1 
ATOM   1497 C CD1   . LEU A 1 204 ? 27.081  10.398  3.659   1.00 41.79  ? 619 LEU A CD1   1 
ATOM   1498 C CD2   . LEU A 1 204 ? 25.460  9.345   5.111   1.00 41.08  ? 619 LEU A CD2   1 
ATOM   1499 N N     . SER A 1 205 ? 29.418  6.026   6.034   1.00 38.85  ? 620 SER A N     1 
ATOM   1500 C CA    . SER A 1 205 ? 30.631  5.226   6.165   1.00 40.00  ? 620 SER A CA    1 
ATOM   1501 C C     . SER A 1 205 ? 30.594  3.930   5.347   1.00 39.39  ? 620 SER A C     1 
ATOM   1502 O O     . SER A 1 205 ? 31.427  3.037   5.590   1.00 39.98  ? 620 SER A O     1 
ATOM   1503 C CB    . SER A 1 205 ? 30.813  4.757   7.653   1.00 39.81  ? 620 SER A CB    1 
ATOM   1504 O OG    . SER A 1 205 ? 30.823  5.871   8.534   1.00 44.45  ? 620 SER A OG    1 
ATOM   1505 N N     . PHE A 1 206 ? 29.612  3.748   4.477   1.00 39.31  ? 621 PHE A N     1 
ATOM   1506 C CA    . PHE A 1 206 ? 29.566  2.521   3.671   1.00 40.02  ? 621 PHE A CA    1 
ATOM   1507 C C     . PHE A 1 206 ? 29.482  1.279   4.547   1.00 41.03  ? 621 PHE A C     1 
ATOM   1508 O O     . PHE A 1 206 ? 30.014  0.202   4.194   1.00 40.65  ? 621 PHE A O     1 
ATOM   1509 C CB    . PHE A 1 206 ? 30.790  2.461   2.763   1.00 39.84  ? 621 PHE A CB    1 
ATOM   1510 C CG    . PHE A 1 206 ? 30.761  3.527   1.706   1.00 40.08  ? 621 PHE A CG    1 
ATOM   1511 C CD1   . PHE A 1 206 ? 31.526  4.655   1.843   1.00 44.19  ? 621 PHE A CD1   1 
ATOM   1512 C CD2   . PHE A 1 206 ? 29.862  3.420   0.612   1.00 42.91  ? 621 PHE A CD2   1 
ATOM   1513 C CE1   . PHE A 1 206 ? 31.433  5.683   0.889   1.00 42.99  ? 621 PHE A CE1   1 
ATOM   1514 C CE2   . PHE A 1 206 ? 29.753  4.400   -0.339  1.00 39.52  ? 621 PHE A CE2   1 
ATOM   1515 C CZ    . PHE A 1 206 ? 30.540  5.510   -0.241  1.00 42.35  ? 621 PHE A CZ    1 
ATOM   1516 N N     . GLY A 1 207 ? 28.807  1.405   5.693   1.00 41.13  ? 622 GLY A N     1 
ATOM   1517 C CA    . GLY A 1 207 ? 28.457  0.200   6.457   1.00 40.22  ? 622 GLY A CA    1 
ATOM   1518 C C     . GLY A 1 207 ? 29.437  -0.122  7.548   1.00 40.13  ? 622 GLY A C     1 
ATOM   1519 O O     . GLY A 1 207 ? 29.408  -1.210  8.097   1.00 41.89  ? 622 GLY A O     1 
ATOM   1520 N N     . LYS A 1 208 ? 30.310  0.791   7.913   1.00 37.90  ? 623 LYS A N     1 
ATOM   1521 C CA    . LYS A 1 208 ? 31.144  0.500   9.035   1.00 38.88  ? 623 LYS A CA    1 
ATOM   1522 C C     . LYS A 1 208 ? 30.273  0.379   10.298  1.00 39.35  ? 623 LYS A C     1 
ATOM   1523 O O     . LYS A 1 208 ? 29.280  1.114   10.428  1.00 39.68  ? 623 LYS A O     1 
ATOM   1524 C CB    . LYS A 1 208 ? 32.163  1.632   9.207   1.00 38.18  ? 623 LYS A CB    1 
ATOM   1525 C CG    . LYS A 1 208 ? 33.267  1.648   8.082   1.00 41.86  ? 623 LYS A CG    1 
ATOM   1526 C CD    . LYS A 1 208 ? 34.274  2.831   8.362   1.00 40.97  ? 623 LYS A CD    1 
ATOM   1527 C CE    . LYS A 1 208 ? 34.907  3.203   7.010   1.00 41.77  ? 623 LYS A CE    1 
ATOM   1528 N NZ    . LYS A 1 208 ? 35.413  1.888   6.592   1.00 47.79  ? 623 LYS A NZ    1 
ATOM   1529 N N     . GLN A 1 209 ? 30.632  -0.490  11.234  1.00 39.41  ? 624 GLN A N     1 
ATOM   1530 C CA    . GLN A 1 209 ? 29.916  -0.529  12.543  1.00 39.96  ? 624 GLN A CA    1 
ATOM   1531 C C     . GLN A 1 209 ? 30.351  0.664   13.379  1.00 39.62  ? 624 GLN A C     1 
ATOM   1532 O O     . GLN A 1 209 ? 31.562  1.009   13.389  1.00 38.39  ? 624 GLN A O     1 
ATOM   1533 C CB    . GLN A 1 209 ? 30.308  -1.797  13.280  1.00 41.48  ? 624 GLN A CB    1 
ATOM   1534 C CG    . GLN A 1 209 ? 29.709  -1.902  14.732  1.00 45.18  ? 624 GLN A CG    1 
ATOM   1535 C CD    . GLN A 1 209 ? 30.447  -2.892  15.607  1.00 49.31  ? 624 GLN A CD    1 
ATOM   1536 O OE1   . GLN A 1 209 ? 31.542  -2.605  16.155  1.00 53.19  ? 624 GLN A OE1   1 
ATOM   1537 N NE2   . GLN A 1 209 ? 29.830  -4.039  15.815  1.00 51.39  ? 624 GLN A NE2   1 
ATOM   1538 N N     . PRO A 1 210 ? 29.393  1.311   14.093  1.00 40.09  ? 625 PRO A N     1 
ATOM   1539 C CA    . PRO A 1 210 ? 29.776  2.487   14.870  1.00 39.78  ? 625 PRO A CA    1 
ATOM   1540 C C     . PRO A 1 210 ? 30.652  2.030   16.042  1.00 40.52  ? 625 PRO A C     1 
ATOM   1541 O O     . PRO A 1 210 ? 30.424  0.940   16.590  1.00 41.81  ? 625 PRO A O     1 
ATOM   1542 C CB    . PRO A 1 210 ? 28.422  3.049   15.377  1.00 38.65  ? 625 PRO A CB    1 
ATOM   1543 C CG    . PRO A 1 210 ? 27.518  1.777   15.393  1.00 41.39  ? 625 PRO A CG    1 
ATOM   1544 C CD    . PRO A 1 210 ? 27.953  0.980   14.214  1.00 39.13  ? 625 PRO A CD    1 
ATOM   1545 N N     . PHE A 1 211 ? 31.628  2.859   16.434  1.00 39.97  ? 626 PHE A N     1 
ATOM   1546 C CA    . PHE A 1 211 ? 32.505  2.516   17.546  1.00 39.14  ? 626 PHE A CA    1 
ATOM   1547 C C     . PHE A 1 211 ? 33.160  1.146   17.407  1.00 40.51  ? 626 PHE A C     1 
ATOM   1548 O O     . PHE A 1 211 ? 33.415  0.464   18.420  1.00 40.37  ? 626 PHE A O     1 
ATOM   1549 C CB    . PHE A 1 211 ? 31.755  2.629   18.873  1.00 38.12  ? 626 PHE A CB    1 
ATOM   1550 C CG    . PHE A 1 211 ? 31.301  4.018   19.155  1.00 38.32  ? 626 PHE A CG    1 
ATOM   1551 C CD1   . PHE A 1 211 ? 32.237  5.044   19.355  1.00 35.39  ? 626 PHE A CD1   1 
ATOM   1552 C CD2   . PHE A 1 211 ? 29.962  4.343   19.160  1.00 38.82  ? 626 PHE A CD2   1 
ATOM   1553 C CE1   . PHE A 1 211 ? 31.843  6.331   19.565  1.00 36.14  ? 626 PHE A CE1   1 
ATOM   1554 C CE2   . PHE A 1 211 ? 29.578  5.633   19.427  1.00 37.10  ? 626 PHE A CE2   1 
ATOM   1555 C CZ    . PHE A 1 211 ? 30.533  6.633   19.626  1.00 37.73  ? 626 PHE A CZ    1 
ATOM   1556 N N     . PHE A 1 212 ? 33.433  0.746   16.166  1.00 41.51  ? 627 PHE A N     1 
ATOM   1557 C CA    . PHE A 1 212 ? 34.035  -0.550  15.883  1.00 43.00  ? 627 PHE A CA    1 
ATOM   1558 C C     . PHE A 1 212 ? 35.323  -0.685  16.699  1.00 44.65  ? 627 PHE A C     1 
ATOM   1559 O O     . PHE A 1 212 ? 35.717  -1.766  17.089  1.00 45.37  ? 627 PHE A O     1 
ATOM   1560 C CB    . PHE A 1 212 ? 34.255  -0.764  14.373  1.00 42.21  ? 627 PHE A CB    1 
ATOM   1561 C CG    . PHE A 1 212 ? 35.231  0.206   13.733  1.00 42.87  ? 627 PHE A CG    1 
ATOM   1562 C CD1   . PHE A 1 212 ? 36.625  -0.019  13.788  1.00 42.92  ? 627 PHE A CD1   1 
ATOM   1563 C CD2   . PHE A 1 212 ? 34.769  1.303   13.030  1.00 39.88  ? 627 PHE A CD2   1 
ATOM   1564 C CE1   . PHE A 1 212 ? 37.510  0.866   13.206  1.00 42.41  ? 627 PHE A CE1   1 
ATOM   1565 C CE2   . PHE A 1 212 ? 35.662  2.217   12.446  1.00 42.37  ? 627 PHE A CE2   1 
ATOM   1566 C CZ    . PHE A 1 212 ? 37.025  1.992   12.532  1.00 43.95  ? 627 PHE A CZ    1 
ATOM   1567 N N     . TRP A 1 213 ? 35.975  0.435   16.963  1.00 46.46  ? 628 TRP A N     1 
ATOM   1568 C CA    . TRP A 1 213 ? 37.202  0.405   17.698  1.00 47.65  ? 628 TRP A CA    1 
ATOM   1569 C C     . TRP A 1 213 ? 36.983  0.263   19.198  1.00 50.34  ? 628 TRP A C     1 
ATOM   1570 O O     . TRP A 1 213 ? 37.961  0.122   19.937  1.00 52.69  ? 628 TRP A O     1 
ATOM   1571 C CB    . TRP A 1 213 ? 38.003  1.672   17.477  1.00 46.27  ? 628 TRP A CB    1 
ATOM   1572 C CG    . TRP A 1 213 ? 37.293  2.912   17.842  1.00 43.18  ? 628 TRP A CG    1 
ATOM   1573 C CD1   . TRP A 1 213 ? 37.444  3.669   18.985  1.00 40.85  ? 628 TRP A CD1   1 
ATOM   1574 C CD2   . TRP A 1 213 ? 36.323  3.581   17.043  1.00 40.69  ? 628 TRP A CD2   1 
ATOM   1575 N NE1   . TRP A 1 213 ? 36.602  4.761   18.932  1.00 42.04  ? 628 TRP A NE1   1 
ATOM   1576 C CE2   . TRP A 1 213 ? 35.916  4.721   17.738  1.00 40.86  ? 628 TRP A CE2   1 
ATOM   1577 C CE3   . TRP A 1 213 ? 35.771  3.330   15.794  1.00 41.60  ? 628 TRP A CE3   1 
ATOM   1578 C CZ2   . TRP A 1 213 ? 35.014  5.591   17.220  1.00 38.41  ? 628 TRP A CZ2   1 
ATOM   1579 C CZ3   . TRP A 1 213 ? 34.866  4.206   15.315  1.00 40.84  ? 628 TRP A CZ3   1 
ATOM   1580 C CH2   . TRP A 1 213 ? 34.509  5.326   16.019  1.00 38.28  ? 628 TRP A CH2   1 
ATOM   1581 N N     . LEU A 1 214 ? 35.740  0.256   19.681  1.00 50.02  ? 629 LEU A N     1 
ATOM   1582 C CA    . LEU A 1 214 ? 35.555  -0.079  21.099  1.00 49.06  ? 629 LEU A CA    1 
ATOM   1583 C C     . LEU A 1 214 ? 34.857  -1.427  21.309  1.00 50.33  ? 629 LEU A C     1 
ATOM   1584 O O     . LEU A 1 214 ? 34.458  -2.091  20.361  1.00 50.11  ? 629 LEU A O     1 
ATOM   1585 C CB    . LEU A 1 214 ? 34.784  1.029   21.809  1.00 47.94  ? 629 LEU A CB    1 
ATOM   1586 C CG    . LEU A 1 214 ? 35.272  2.453   21.582  1.00 45.13  ? 629 LEU A CG    1 
ATOM   1587 C CD1   . LEU A 1 214 ? 34.179  3.426   22.035  1.00 45.00  ? 629 LEU A CD1   1 
ATOM   1588 C CD2   . LEU A 1 214 ? 36.614  2.666   22.321  1.00 41.44  ? 629 LEU A CD2   1 
ATOM   1589 N N     . GLU A 1 215 ? 34.755  -1.832  22.579  1.00 52.42  ? 630 GLU A N     1 
ATOM   1590 C CA    . GLU A 1 215 ? 33.993  -3.006  23.028  1.00 54.25  ? 630 GLU A CA    1 
ATOM   1591 C C     . GLU A 1 215 ? 32.753  -2.376  23.604  1.00 53.90  ? 630 GLU A C     1 
ATOM   1592 O O     . GLU A 1 215 ? 32.836  -1.240  24.057  1.00 53.52  ? 630 GLU A O     1 
ATOM   1593 C CB    . GLU A 1 215 ? 34.719  -3.717  24.175  1.00 54.81  ? 630 GLU A CB    1 
ATOM   1594 C CG    . GLU A 1 215 ? 36.076  -4.353  23.823  1.00 58.57  ? 630 GLU A CG    1 
ATOM   1595 C CD    . GLU A 1 215 ? 36.556  -5.357  24.906  1.00 67.08  ? 630 GLU A CD    1 
ATOM   1596 O OE1   . GLU A 1 215 ? 35.846  -6.387  25.191  1.00 65.29  ? 630 GLU A OE1   1 
ATOM   1597 O OE2   . GLU A 1 215 ? 37.656  -5.094  25.470  1.00 70.24  ? 630 GLU A OE2   1 
ATOM   1598 N N     . ASN A 1 216 ? 31.617  -3.079  23.616  1.00 54.38  ? 631 ASN A N     1 
ATOM   1599 C CA    . ASN A 1 216 ? 30.378  -2.472  24.150  1.00 54.69  ? 631 ASN A CA    1 
ATOM   1600 C C     . ASN A 1 216 ? 30.547  -1.758  25.488  1.00 55.23  ? 631 ASN A C     1 
ATOM   1601 O O     . ASN A 1 216 ? 29.989  -0.687  25.709  1.00 54.86  ? 631 ASN A O     1 
ATOM   1602 C CB    . ASN A 1 216 ? 29.235  -3.490  24.278  1.00 54.52  ? 631 ASN A CB    1 
ATOM   1603 C CG    . ASN A 1 216 ? 28.639  -3.933  22.926  1.00 56.36  ? 631 ASN A CG    1 
ATOM   1604 O OD1   . ASN A 1 216 ? 29.067  -3.512  21.860  1.00 53.77  ? 631 ASN A OD1   1 
ATOM   1605 N ND2   . ASN A 1 216 ? 27.636  -4.810  22.990  1.00 55.61  ? 631 ASN A ND2   1 
ATOM   1606 N N     . LYS A 1 217 ? 31.281  -2.347  26.424  1.00 56.36  ? 632 LYS A N     1 
ATOM   1607 C CA    . LYS A 1 217 ? 31.218  -1.827  27.828  1.00 57.75  ? 632 LYS A CA    1 
ATOM   1608 C C     . LYS A 1 217 ? 31.788  -0.418  27.851  1.00 56.19  ? 632 LYS A C     1 
ATOM   1609 O O     . LYS A 1 217 ? 31.544  0.344   28.780  1.00 54.80  ? 632 LYS A O     1 
ATOM   1610 C CB    . LYS A 1 217 ? 32.024  -2.732  28.819  1.00 59.72  ? 632 LYS A CB    1 
ATOM   1611 C CG    . LYS A 1 217 ? 31.643  -2.509  30.345  1.00 65.28  ? 632 LYS A CG    1 
ATOM   1612 C CD    . LYS A 1 217 ? 32.744  -2.949  31.381  1.00 70.22  ? 632 LYS A CD    1 
ATOM   1613 C CE    . LYS A 1 217 ? 32.705  -2.047  32.676  1.00 71.16  ? 632 LYS A CE    1 
ATOM   1614 N NZ    . LYS A 1 217 ? 31.448  -2.213  33.481  1.00 68.91  ? 632 LYS A NZ    1 
ATOM   1615 N N     . ASP A 1 218 ? 32.576  -0.104  26.810  1.00 55.40  ? 633 ASP A N     1 
ATOM   1616 C CA    . ASP A 1 218 ? 33.358  1.140   26.751  1.00 54.71  ? 633 ASP A CA    1 
ATOM   1617 C C     . ASP A 1 218 ? 32.640  2.367   26.172  1.00 52.21  ? 633 ASP A C     1 
ATOM   1618 O O     . ASP A 1 218 ? 33.134  3.485   26.231  1.00 50.93  ? 633 ASP A O     1 
ATOM   1619 C CB    . ASP A 1 218 ? 34.521  0.912   25.809  1.00 56.59  ? 633 ASP A CB    1 
ATOM   1620 C CG    . ASP A 1 218 ? 35.739  0.430   26.504  1.00 60.81  ? 633 ASP A CG    1 
ATOM   1621 O OD1   . ASP A 1 218 ? 35.934  0.769   27.721  1.00 64.39  ? 633 ASP A OD1   1 
ATOM   1622 O OD2   . ASP A 1 218 ? 36.495  -0.293  25.799  1.00 67.26  ? 633 ASP A OD2   1 
ATOM   1623 N N     . VAL A 1 219 ? 31.534  2.121   25.516  1.00 50.26  ? 634 VAL A N     1 
ATOM   1624 C CA    . VAL A 1 219 ? 30.846  3.142   24.709  1.00 48.88  ? 634 VAL A CA    1 
ATOM   1625 C C     . VAL A 1 219 ? 30.275  4.278   25.547  1.00 46.98  ? 634 VAL A C     1 
ATOM   1626 O O     . VAL A 1 219 ? 30.550  5.438   25.340  1.00 45.58  ? 634 VAL A O     1 
ATOM   1627 C CB    . VAL A 1 219 ? 29.709  2.450   23.892  1.00 48.25  ? 634 VAL A CB    1 
ATOM   1628 C CG1   . VAL A 1 219 ? 28.810  3.492   23.220  1.00 48.00  ? 634 VAL A CG1   1 
ATOM   1629 C CG2   . VAL A 1 219 ? 30.314  1.507   22.909  1.00 48.56  ? 634 VAL A CG2   1 
ATOM   1630 N N     . ILE A 1 220 ? 29.495  3.927   26.559  1.00 48.90  ? 635 ILE A N     1 
ATOM   1631 C CA    . ILE A 1 220 ? 28.909  4.938   27.444  1.00 47.77  ? 635 ILE A CA    1 
ATOM   1632 C C     . ILE A 1 220 ? 29.922  5.913   28.021  1.00 48.06  ? 635 ILE A C     1 
ATOM   1633 O O     . ILE A 1 220 ? 29.740  7.150   28.032  1.00 49.60  ? 635 ILE A O     1 
ATOM   1634 C CB    . ILE A 1 220 ? 28.091  4.296   28.589  1.00 48.56  ? 635 ILE A CB    1 
ATOM   1635 C CG1   . ILE A 1 220 ? 27.378  5.403   29.366  1.00 45.94  ? 635 ILE A CG1   1 
ATOM   1636 C CG2   . ILE A 1 220 ? 28.946  3.402   29.497  1.00 47.53  ? 635 ILE A CG2   1 
ATOM   1637 C CD1   . ILE A 1 220 ? 26.275  6.052   28.467  1.00 46.04  ? 635 ILE A CD1   1 
ATOM   1638 N N     . GLY A 1 221 ? 31.020  5.392   28.505  1.00 48.06  ? 636 GLY A N     1 
ATOM   1639 C CA    . GLY A 1 221 ? 31.997  6.290   29.067  1.00 47.92  ? 636 GLY A CA    1 
ATOM   1640 C C     . GLY A 1 221 ? 32.565  7.238   28.036  1.00 47.22  ? 636 GLY A C     1 
ATOM   1641 O O     . GLY A 1 221 ? 32.882  8.363   28.338  1.00 45.32  ? 636 GLY A O     1 
ATOM   1642 N N     . VAL A 1 222 ? 32.721  6.773   26.791  1.00 48.92  ? 637 VAL A N     1 
ATOM   1643 C CA    . VAL A 1 222 ? 33.206  7.659   25.709  1.00 49.08  ? 637 VAL A CA    1 
ATOM   1644 C C     . VAL A 1 222 ? 32.172  8.728   25.459  1.00 48.74  ? 637 VAL A C     1 
ATOM   1645 O O     . VAL A 1 222 ? 32.499  9.914   25.293  1.00 48.07  ? 637 VAL A O     1 
ATOM   1646 C CB    . VAL A 1 222 ? 33.419  6.803   24.421  1.00 50.18  ? 637 VAL A CB    1 
ATOM   1647 C CG1   . VAL A 1 222 ? 33.426  7.636   23.130  1.00 49.94  ? 637 VAL A CG1   1 
ATOM   1648 C CG2   . VAL A 1 222 ? 34.680  5.875   24.600  1.00 51.66  ? 637 VAL A CG2   1 
ATOM   1649 N N     . LEU A 1 223 ? 30.904  8.295   25.404  1.00 49.38  ? 638 LEU A N     1 
ATOM   1650 C CA    . LEU A 1 223 ? 29.778  9.232   25.193  1.00 50.19  ? 638 LEU A CA    1 
ATOM   1651 C C     . LEU A 1 223 ? 29.680  10.255  26.315  1.00 51.64  ? 638 LEU A C     1 
ATOM   1652 O O     . LEU A 1 223 ? 29.537  11.457  26.057  1.00 50.39  ? 638 LEU A O     1 
ATOM   1653 C CB    . LEU A 1 223 ? 28.446  8.475   25.133  1.00 48.53  ? 638 LEU A CB    1 
ATOM   1654 C CG    . LEU A 1 223 ? 28.270  7.583   23.878  1.00 49.57  ? 638 LEU A CG    1 
ATOM   1655 C CD1   . LEU A 1 223 ? 26.908  6.886   23.895  1.00 41.04  ? 638 LEU A CD1   1 
ATOM   1656 C CD2   . LEU A 1 223 ? 28.483  8.388   22.587  1.00 47.39  ? 638 LEU A CD2   1 
ATOM   1657 N N     . GLU A 1 224 ? 29.723  9.740   27.556  1.00 52.84  ? 639 GLU A N     1 
ATOM   1658 C CA    . GLU A 1 224 ? 29.647  10.577  28.761  1.00 55.52  ? 639 GLU A CA    1 
ATOM   1659 C C     . GLU A 1 224 ? 30.658  11.698  28.734  1.00 56.53  ? 639 GLU A C     1 
ATOM   1660 O O     . GLU A 1 224 ? 30.370  12.769  29.236  1.00 58.76  ? 639 GLU A O     1 
ATOM   1661 C CB    . GLU A 1 224 ? 29.913  9.752   30.021  1.00 55.94  ? 639 GLU A CB    1 
ATOM   1662 C CG    . GLU A 1 224 ? 28.800  8.852   30.408  1.00 58.05  ? 639 GLU A CG    1 
ATOM   1663 C CD    . GLU A 1 224 ? 27.608  9.666   30.776  1.00 60.08  ? 639 GLU A CD    1 
ATOM   1664 O OE1   . GLU A 1 224 ? 26.503  9.098   30.891  1.00 63.85  ? 639 GLU A OE1   1 
ATOM   1665 O OE2   . GLU A 1 224 ? 27.793  10.888  30.927  1.00 61.43  ? 639 GLU A OE2   1 
ATOM   1666 N N     . LYS A 1 225 ? 31.849  11.481  28.168  1.00 56.77  ? 640 LYS A N     1 
ATOM   1667 C CA    . LYS A 1 225 ? 32.778  12.618  28.054  1.00 56.14  ? 640 LYS A CA    1 
ATOM   1668 C C     . LYS A 1 225 ? 32.586  13.503  26.803  1.00 55.00  ? 640 LYS A C     1 
ATOM   1669 O O     . LYS A 1 225 ? 33.429  14.343  26.523  1.00 55.18  ? 640 LYS A O     1 
ATOM   1670 C CB    . LYS A 1 225 ? 34.256  12.222  28.230  1.00 56.95  ? 640 LYS A CB    1 
ATOM   1671 C CG    . LYS A 1 225 ? 34.736  11.066  27.414  1.00 60.39  ? 640 LYS A CG    1 
ATOM   1672 C CD    . LYS A 1 225 ? 36.100  10.636  27.877  1.00 66.32  ? 640 LYS A CD    1 
ATOM   1673 C CE    . LYS A 1 225 ? 36.198  9.105   27.933  1.00 68.01  ? 640 LYS A CE    1 
ATOM   1674 N NZ    . LYS A 1 225 ? 36.652  8.710   29.325  1.00 72.77  ? 640 LYS A NZ    1 
ATOM   1675 N N     . GLY A 1 226 ? 31.481  13.355  26.069  1.00 52.97  ? 641 GLY A N     1 
ATOM   1676 C CA    . GLY A 1 226 ? 31.250  14.231  24.907  1.00 49.80  ? 641 GLY A CA    1 
ATOM   1677 C C     . GLY A 1 226 ? 31.900  13.804  23.599  1.00 48.00  ? 641 GLY A C     1 
ATOM   1678 O O     . GLY A 1 226 ? 31.825  14.505  22.595  1.00 47.53  ? 641 GLY A O     1 
ATOM   1679 N N     . ASP A 1 227 ? 32.547  12.660  23.586  1.00 46.90  ? 642 ASP A N     1 
ATOM   1680 C CA    . ASP A 1 227 ? 33.168  12.208  22.335  1.00 47.83  ? 642 ASP A CA    1 
ATOM   1681 C C     . ASP A 1 227 ? 32.119  11.587  21.407  1.00 47.10  ? 642 ASP A C     1 
ATOM   1682 O O     . ASP A 1 227 ? 31.191  10.957  21.891  1.00 45.94  ? 642 ASP A O     1 
ATOM   1683 C CB    . ASP A 1 227 ? 34.211  11.154  22.605  1.00 47.63  ? 642 ASP A CB    1 
ATOM   1684 C CG    . ASP A 1 227 ? 35.449  11.741  23.233  1.00 53.46  ? 642 ASP A CG    1 
ATOM   1685 O OD1   . ASP A 1 227 ? 35.740  12.972  23.029  1.00 56.23  ? 642 ASP A OD1   1 
ATOM   1686 O OD2   . ASP A 1 227 ? 36.115  10.932  23.907  1.00 57.50  ? 642 ASP A OD2   1 
ATOM   1687 N N     . ARG A 1 228 ? 32.269  11.786  20.093  1.00 45.54  ? 643 ARG A N     1 
ATOM   1688 C CA    . ARG A 1 228 ? 31.238  11.321  19.190  1.00 44.38  ? 643 ARG A CA    1 
ATOM   1689 C C     . ARG A 1 228 ? 31.862  10.589  17.991  1.00 43.35  ? 643 ARG A C     1 
ATOM   1690 O O     . ARG A 1 228 ? 33.076  10.662  17.769  1.00 40.60  ? 643 ARG A O     1 
ATOM   1691 C CB    . ARG A 1 228 ? 30.391  12.540  18.728  1.00 43.64  ? 643 ARG A CB    1 
ATOM   1692 C CG    . ARG A 1 228 ? 29.563  13.316  19.811  1.00 41.42  ? 643 ARG A CG    1 
ATOM   1693 C CD    . ARG A 1 228 ? 28.521  12.433  20.476  1.00 35.57  ? 643 ARG A CD    1 
ATOM   1694 N NE    . ARG A 1 228 ? 27.672  13.127  21.426  1.00 37.07  ? 643 ARG A NE    1 
ATOM   1695 C CZ    . ARG A 1 228 ? 27.735  12.976  22.778  1.00 41.82  ? 643 ARG A CZ    1 
ATOM   1696 N NH1   . ARG A 1 228 ? 28.702  12.256  23.365  1.00 44.02  ? 643 ARG A NH1   1 
ATOM   1697 N NH2   . ARG A 1 228 ? 26.877  13.599  23.559  1.00 35.01  ? 643 ARG A NH2   1 
ATOM   1698 N N     . LEU A 1 229 ? 31.026  9.908   17.208  1.00 41.20  ? 644 LEU A N     1 
ATOM   1699 C CA    . LEU A 1 229 ? 31.514  9.268   16.000  1.00 41.30  ? 644 LEU A CA    1 
ATOM   1700 C C     . LEU A 1 229 ? 32.091  10.358  15.080  1.00 40.86  ? 644 LEU A C     1 
ATOM   1701 O O     . LEU A 1 229 ? 31.491  11.373  14.847  1.00 42.41  ? 644 LEU A O     1 
ATOM   1702 C CB    . LEU A 1 229 ? 30.380  8.485   15.299  1.00 40.80  ? 644 LEU A CB    1 
ATOM   1703 C CG    . LEU A 1 229 ? 29.599  7.383   16.065  1.00 39.44  ? 644 LEU A CG    1 
ATOM   1704 C CD1   . LEU A 1 229 ? 28.233  7.137   15.451  1.00 38.71  ? 644 LEU A CD1   1 
ATOM   1705 C CD2   . LEU A 1 229 ? 30.337  6.049   16.053  1.00 38.20  ? 644 LEU A CD2   1 
ATOM   1706 N N     . PRO A 1 230 ? 33.281  10.139  14.528  1.00 42.07  ? 645 PRO A N     1 
ATOM   1707 C CA    . PRO A 1 230 ? 33.860  11.238  13.697  1.00 41.63  ? 645 PRO A CA    1 
ATOM   1708 C C     . PRO A 1 230 ? 33.130  11.345  12.341  1.00 41.52  ? 645 PRO A C     1 
ATOM   1709 O O     . PRO A 1 230 ? 32.446  10.416  11.904  1.00 41.51  ? 645 PRO A O     1 
ATOM   1710 C CB    . PRO A 1 230 ? 35.291  10.756  13.446  1.00 42.45  ? 645 PRO A CB    1 
ATOM   1711 C CG    . PRO A 1 230 ? 35.143  9.150   13.377  1.00 43.96  ? 645 PRO A CG    1 
ATOM   1712 C CD    . PRO A 1 230 ? 34.029  8.859   14.459  1.00 41.41  ? 645 PRO A CD    1 
ATOM   1713 N N     . LYS A 1 231 ? 33.300  12.443  11.669  1.00 41.00  ? 646 LYS A N     1 
ATOM   1714 C CA    . LYS A 1 231 ? 32.611  12.670  10.409  1.00 42.85  ? 646 LYS A CA    1 
ATOM   1715 C C     . LYS A 1 231 ? 33.200  11.748  9.362   1.00 42.57  ? 646 LYS A C     1 
ATOM   1716 O O     . LYS A 1 231 ? 34.420  11.741  9.180   1.00 41.19  ? 646 LYS A O     1 
ATOM   1717 C CB    . LYS A 1 231 ? 32.798  14.126  9.971   1.00 43.37  ? 646 LYS A CB    1 
ATOM   1718 C CG    . LYS A 1 231 ? 32.090  14.502  8.648   1.00 44.94  ? 646 LYS A CG    1 
ATOM   1719 C CD    . LYS A 1 231 ? 32.479  15.907  8.185   1.00 48.08  ? 646 LYS A CD    1 
ATOM   1720 C CE    . LYS A 1 231 ? 33.775  15.960  7.323   1.00 47.94  ? 646 LYS A CE    1 
ATOM   1721 N NZ    . LYS A 1 231 ? 33.591  15.205  6.040   1.00 45.97  ? 646 LYS A NZ    1 
ATOM   1722 N N     . PRO A 1 232 ? 32.326  10.938  8.699   1.00 42.29  ? 647 PRO A N     1 
ATOM   1723 C CA    . PRO A 1 232 ? 32.765  10.105  7.610   1.00 42.58  ? 647 PRO A CA    1 
ATOM   1724 C C     . PRO A 1 232 ? 33.326  10.961  6.478   1.00 44.08  ? 647 PRO A C     1 
ATOM   1725 O O     . PRO A 1 232 ? 32.900  12.072  6.254   1.00 43.72  ? 647 PRO A O     1 
ATOM   1726 C CB    . PRO A 1 232 ? 31.497  9.393   7.196   1.00 40.84  ? 647 PRO A CB    1 
ATOM   1727 C CG    . PRO A 1 232 ? 30.680  9.396   8.511   1.00 39.47  ? 647 PRO A CG    1 
ATOM   1728 C CD    . PRO A 1 232 ? 30.879  10.787  8.934   1.00 41.15  ? 647 PRO A CD    1 
ATOM   1729 N N     . ASP A 1 233 ? 34.240  10.381  5.741   1.00 47.10  ? 648 ASP A N     1 
ATOM   1730 C CA    . ASP A 1 233 ? 34.965  11.108  4.758   1.00 48.81  ? 648 ASP A CA    1 
ATOM   1731 C C     . ASP A 1 233 ? 34.096  11.754  3.684   1.00 49.63  ? 648 ASP A C     1 
ATOM   1732 O O     . ASP A 1 233 ? 34.377  12.856  3.282   1.00 49.81  ? 648 ASP A O     1 
ATOM   1733 C CB    . ASP A 1 233 ? 35.959  10.176  4.109   1.00 50.96  ? 648 ASP A CB    1 
ATOM   1734 C CG    . ASP A 1 233 ? 37.037  10.958  3.379   1.00 54.85  ? 648 ASP A CG    1 
ATOM   1735 O OD1   . ASP A 1 233 ? 37.754  11.741  4.051   1.00 57.66  ? 648 ASP A OD1   1 
ATOM   1736 O OD2   . ASP A 1 233 ? 37.097  10.833  2.150   1.00 61.04  ? 648 ASP A OD2   1 
ATOM   1737 N N     . LEU A 1 234 ? 33.053  11.065  3.217   1.00 50.15  ? 649 LEU A N     1 
ATOM   1738 C CA    . LEU A 1 234 ? 32.185  11.587  2.180   1.00 50.63  ? 649 LEU A CA    1 
ATOM   1739 C C     . LEU A 1 234 ? 30.992  12.356  2.742   1.00 50.02  ? 649 LEU A C     1 
ATOM   1740 O O     . LEU A 1 234 ? 30.118  12.765  1.990   1.00 48.90  ? 649 LEU A O     1 
ATOM   1741 C CB    . LEU A 1 234 ? 31.692  10.463  1.290   1.00 51.81  ? 649 LEU A CB    1 
ATOM   1742 C CG    . LEU A 1 234 ? 32.773  9.797   0.394   1.00 56.64  ? 649 LEU A CG    1 
ATOM   1743 C CD1   . LEU A 1 234 ? 32.139  8.881   -0.701  1.00 57.15  ? 649 LEU A CD1   1 
ATOM   1744 C CD2   . LEU A 1 234 ? 33.760  10.811  -0.239  1.00 56.46  ? 649 LEU A CD2   1 
ATOM   1745 N N     . CYS A 1 235 ? 30.941  12.538  4.070   1.00 48.10  ? 650 CYS A N     1 
ATOM   1746 C CA    . CYS A 1 235 ? 29.778  13.207  4.673   1.00 45.15  ? 650 CYS A CA    1 
ATOM   1747 C C     . CYS A 1 235 ? 30.012  14.697  4.613   1.00 44.42  ? 650 CYS A C     1 
ATOM   1748 O O     . CYS A 1 235 ? 31.031  15.165  5.081   1.00 44.93  ? 650 CYS A O     1 
ATOM   1749 C CB    . CYS A 1 235 ? 29.557  12.712  6.123   1.00 43.82  ? 650 CYS A CB    1 
ATOM   1750 S SG    . CYS A 1 235 ? 28.328  13.662  7.013   1.00 41.82  ? 650 CYS A SG    1 
ATOM   1751 N N     . PRO A 1 236 ? 29.071  15.456  4.033   1.00 44.96  ? 651 PRO A N     1 
ATOM   1752 C CA    . PRO A 1 236 ? 29.129  16.927  3.970   1.00 45.06  ? 651 PRO A CA    1 
ATOM   1753 C C     . PRO A 1 236 ? 29.088  17.476  5.385   1.00 44.84  ? 651 PRO A C     1 
ATOM   1754 O O     . PRO A 1 236 ? 28.314  16.928  6.236   1.00 44.43  ? 651 PRO A O     1 
ATOM   1755 C CB    . PRO A 1 236 ? 27.800  17.303  3.283   1.00 46.02  ? 651 PRO A CB    1 
ATOM   1756 C CG    . PRO A 1 236 ? 27.358  16.073  2.562   1.00 46.85  ? 651 PRO A CG    1 
ATOM   1757 C CD    . PRO A 1 236 ? 27.899  14.900  3.327   1.00 44.51  ? 651 PRO A CD    1 
ATOM   1758 N N     . PRO A 1 237 ? 29.879  18.548  5.662   1.00 44.91  ? 652 PRO A N     1 
ATOM   1759 C CA    . PRO A 1 237 ? 29.877  19.128  7.003   1.00 43.81  ? 652 PRO A CA    1 
ATOM   1760 C C     . PRO A 1 237 ? 28.523  19.529  7.513   1.00 43.06  ? 652 PRO A C     1 
ATOM   1761 O O     . PRO A 1 237 ? 28.231  19.403  8.713   1.00 43.56  ? 652 PRO A O     1 
ATOM   1762 C CB    . PRO A 1 237 ? 30.760  20.353  6.833   1.00 44.89  ? 652 PRO A CB    1 
ATOM   1763 C CG    . PRO A 1 237 ? 31.848  19.811  5.898   1.00 44.65  ? 652 PRO A CG    1 
ATOM   1764 C CD    . PRO A 1 237 ? 31.110  18.919  4.925   1.00 43.82  ? 652 PRO A CD    1 
ATOM   1765 N N     . VAL A 1 238 ? 27.693  19.996  6.611   1.00 42.87  ? 653 VAL A N     1 
ATOM   1766 C CA    . VAL A 1 238 ? 26.364  20.411  6.987   1.00 42.14  ? 653 VAL A CA    1 
ATOM   1767 C C     . VAL A 1 238 ? 25.609  19.215  7.520   1.00 40.92  ? 653 VAL A C     1 
ATOM   1768 O O     . VAL A 1 238 ? 24.807  19.328  8.471   1.00 40.31  ? 653 VAL A O     1 
ATOM   1769 C CB    . VAL A 1 238 ? 25.584  21.085  5.803   1.00 42.11  ? 653 VAL A CB    1 
ATOM   1770 C CG1   . VAL A 1 238 ? 25.363  20.097  4.639   1.00 41.46  ? 653 VAL A CG1   1 
ATOM   1771 C CG2   . VAL A 1 238 ? 24.230  21.598  6.324   1.00 42.55  ? 653 VAL A CG2   1 
ATOM   1772 N N     . LEU A 1 239 ? 25.870  18.058  6.929   1.00 40.32  ? 654 LEU A N     1 
ATOM   1773 C CA    . LEU A 1 239 ? 25.141  16.865  7.333   1.00 41.89  ? 654 LEU A CA    1 
ATOM   1774 C C     . LEU A 1 239 ? 25.704  16.317  8.666   1.00 41.55  ? 654 LEU A C     1 
ATOM   1775 O O     . LEU A 1 239 ? 24.923  15.791  9.510   1.00 42.06  ? 654 LEU A O     1 
ATOM   1776 C CB    . LEU A 1 239 ? 25.240  15.794  6.278   1.00 41.57  ? 654 LEU A CB    1 
ATOM   1777 C CG    . LEU A 1 239 ? 24.473  14.508  6.603   1.00 43.06  ? 654 LEU A CG    1 
ATOM   1778 C CD1   . LEU A 1 239 ? 22.961  14.764  6.877   1.00 38.79  ? 654 LEU A CD1   1 
ATOM   1779 C CD2   . LEU A 1 239 ? 24.685  13.470  5.462   1.00 39.68  ? 654 LEU A CD2   1 
ATOM   1780 N N     . TYR A 1 240 ? 27.016  16.475  8.855   1.00 39.05  ? 655 TYR A N     1 
ATOM   1781 C CA    . TYR A 1 240 ? 27.655  16.049  10.127  1.00 39.82  ? 655 TYR A CA    1 
ATOM   1782 C C     . TYR A 1 240 ? 27.153  16.923  11.318  1.00 39.74  ? 655 TYR A C     1 
ATOM   1783 O O     . TYR A 1 240 ? 26.908  16.457  12.440  1.00 38.00  ? 655 TYR A O     1 
ATOM   1784 C CB    . TYR A 1 240 ? 29.169  16.137  10.030  1.00 37.91  ? 655 TYR A CB    1 
ATOM   1785 C CG    . TYR A 1 240 ? 29.809  15.541  11.252  1.00 38.40  ? 655 TYR A CG    1 
ATOM   1786 C CD1   . TYR A 1 240 ? 29.486  14.225  11.676  1.00 39.29  ? 655 TYR A CD1   1 
ATOM   1787 C CD2   . TYR A 1 240 ? 30.673  16.286  12.030  1.00 44.04  ? 655 TYR A CD2   1 
ATOM   1788 C CE1   . TYR A 1 240 ? 30.060  13.693  12.786  1.00 37.80  ? 655 TYR A CE1   1 
ATOM   1789 C CE2   . TYR A 1 240 ? 31.250  15.749  13.187  1.00 43.15  ? 655 TYR A CE2   1 
ATOM   1790 C CZ    . TYR A 1 240 ? 30.956  14.474  13.547  1.00 38.33  ? 655 TYR A CZ    1 
ATOM   1791 O OH    . TYR A 1 240 ? 31.521  13.988  14.691  1.00 38.75  ? 655 TYR A OH    1 
ATOM   1792 N N     . THR A 1 241 ? 26.944  18.204  11.032  1.00 41.14  ? 656 THR A N     1 
ATOM   1793 C CA    . THR A 1 241 ? 26.332  19.103  12.042  1.00 42.43  ? 656 THR A CA    1 
ATOM   1794 C C     . THR A 1 241 ? 24.927  18.664  12.441  1.00 42.19  ? 656 THR A C     1 
ATOM   1795 O O     . THR A 1 241 ? 24.569  18.701  13.623  1.00 42.02  ? 656 THR A O     1 
ATOM   1796 C CB    . THR A 1 241 ? 26.299  20.531  11.540  1.00 43.05  ? 656 THR A CB    1 
ATOM   1797 O OG1   . THR A 1 241 ? 27.657  20.939  11.253  1.00 43.61  ? 656 THR A OG1   1 
ATOM   1798 C CG2   . THR A 1 241 ? 25.705  21.428  12.631  1.00 45.54  ? 656 THR A CG2   1 
ATOM   1799 N N     . LEU A 1 242 ? 24.141  18.215  11.472  1.00 41.24  ? 657 LEU A N     1 
ATOM   1800 C CA    . LEU A 1 242 ? 22.868  17.595  11.771  1.00 42.22  ? 657 LEU A CA    1 
ATOM   1801 C C     . LEU A 1 242 ? 23.043  16.360  12.634  1.00 41.21  ? 657 LEU A C     1 
ATOM   1802 O O     . LEU A 1 242 ? 22.280  16.161  13.570  1.00 41.62  ? 657 LEU A O     1 
ATOM   1803 C CB    . LEU A 1 242 ? 22.159  17.108  10.495  1.00 42.79  ? 657 LEU A CB    1 
ATOM   1804 C CG    . LEU A 1 242 ? 20.887  17.778  9.983   1.00 47.59  ? 657 LEU A CG    1 
ATOM   1805 C CD1   . LEU A 1 242 ? 20.861  19.250  10.206  1.00 42.36  ? 657 LEU A CD1   1 
ATOM   1806 C CD2   . LEU A 1 242 ? 20.643  17.437  8.485   1.00 49.78  ? 657 LEU A CD2   1 
ATOM   1807 N N     . MET A 1 243 ? 23.955  15.472  12.267  1.00 39.76  ? 658 MET A N     1 
ATOM   1808 C CA    . MET A 1 243 ? 24.205  14.284  13.098  1.00 38.27  ? 658 MET A CA    1 
ATOM   1809 C C     . MET A 1 243 ? 24.606  14.653  14.525  1.00 38.18  ? 658 MET A C     1 
ATOM   1810 O O     . MET A 1 243 ? 24.045  14.107  15.474  1.00 37.74  ? 658 MET A O     1 
ATOM   1811 C CB    . MET A 1 243 ? 25.223  13.345  12.478  1.00 36.97  ? 658 MET A CB    1 
ATOM   1812 C CG    . MET A 1 243 ? 24.921  12.882  10.960  1.00 39.16  ? 658 MET A CG    1 
ATOM   1813 S SD    . MET A 1 243 ? 26.413  11.893  10.506  1.00 46.12  ? 658 MET A SD    1 
ATOM   1814 C CE    . MET A 1 243 ? 26.201  11.370  8.825   1.00 46.55  ? 658 MET A CE    1 
ATOM   1815 N N     . THR A 1 244 ? 25.486  15.640  14.653  1.00 37.47  ? 659 THR A N     1 
ATOM   1816 C CA    . THR A 1 244 ? 25.886  16.230  15.933  1.00 40.92  ? 659 THR A CA    1 
ATOM   1817 C C     . THR A 1 244 ? 24.713  16.713  16.837  1.00 40.65  ? 659 THR A C     1 
ATOM   1818 O O     . THR A 1 244 ? 24.692  16.441  18.036  1.00 40.00  ? 659 THR A O     1 
ATOM   1819 C CB    . THR A 1 244 ? 26.975  17.372  15.683  1.00 38.90  ? 659 THR A CB    1 
ATOM   1820 O OG1   . THR A 1 244 ? 28.160  16.686  15.328  1.00 42.36  ? 659 THR A OG1   1 
ATOM   1821 C CG2   . THR A 1 244 ? 27.369  18.052  17.004  1.00 45.81  ? 659 THR A CG2   1 
ATOM   1822 N N     . ARG A 1 245 ? 23.743  17.396  16.230  1.00 40.85  ? 660 ARG A N     1 
ATOM   1823 C CA    . ARG A 1 245 ? 22.568  17.828  16.952  1.00 41.48  ? 660 ARG A CA    1 
ATOM   1824 C C     . ARG A 1 245 ? 21.745  16.634  17.424  1.00 41.38  ? 660 ARG A C     1 
ATOM   1825 O O     . ARG A 1 245 ? 21.196  16.646  18.575  1.00 41.97  ? 660 ARG A O     1 
ATOM   1826 C CB    . ARG A 1 245 ? 21.699  18.750  16.091  1.00 41.59  ? 660 ARG A CB    1 
ATOM   1827 C CG    . ARG A 1 245 ? 22.341  20.078  15.752  1.00 48.87  ? 660 ARG A CG    1 
ATOM   1828 C CD    . ARG A 1 245 ? 21.222  21.113  15.540  1.00 63.92  ? 660 ARG A CD    1 
ATOM   1829 N NE    . ARG A 1 245 ? 20.244  20.705  14.507  1.00 71.45  ? 660 ARG A NE    1 
ATOM   1830 C CZ    . ARG A 1 245 ? 19.099  21.346  14.274  1.00 74.54  ? 660 ARG A CZ    1 
ATOM   1831 N NH1   . ARG A 1 245 ? 18.809  22.426  15.003  1.00 77.11  ? 660 ARG A NH1   1 
ATOM   1832 N NH2   . ARG A 1 245 ? 18.252  20.915  13.333  1.00 74.75  ? 660 ARG A NH2   1 
ATOM   1833 N N     . CYS A 1 246 ? 21.659  15.618  16.566  1.00 38.33  ? 661 CYS A N     1 
ATOM   1834 C CA    . CYS A 1 246 ? 20.994  14.359  16.960  1.00 38.23  ? 661 CYS A CA    1 
ATOM   1835 C C     . CYS A 1 246 ? 21.622  13.680  18.183  1.00 37.60  ? 661 CYS A C     1 
ATOM   1836 O O     . CYS A 1 246 ? 20.949  12.921  18.881  1.00 35.37  ? 661 CYS A O     1 
ATOM   1837 C CB    . CYS A 1 246 ? 20.978  13.365  15.783  1.00 35.54  ? 661 CYS A CB    1 
ATOM   1838 S SG    . CYS A 1 246 ? 19.847  13.963  14.489  1.00 38.48  ? 661 CYS A SG    1 
ATOM   1839 N N     . TRP A 1 247 ? 22.930  13.873  18.369  1.00 38.29  ? 662 TRP A N     1 
ATOM   1840 C CA    . TRP A 1 247 ? 23.661  13.195  19.442  1.00 38.88  ? 662 TRP A CA    1 
ATOM   1841 C C     . TRP A 1 247 ? 23.824  14.134  20.640  1.00 41.43  ? 662 TRP A C     1 
ATOM   1842 O O     . TRP A 1 247 ? 24.788  14.016  21.422  1.00 43.34  ? 662 TRP A O     1 
ATOM   1843 C CB    . TRP A 1 247 ? 25.023  12.733  18.932  1.00 37.04  ? 662 TRP A CB    1 
ATOM   1844 C CG    . TRP A 1 247 ? 24.961  11.699  17.880  1.00 35.05  ? 662 TRP A CG    1 
ATOM   1845 C CD1   . TRP A 1 247 ? 24.020  10.677  17.762  1.00 31.31  ? 662 TRP A CD1   1 
ATOM   1846 C CD2   . TRP A 1 247 ? 25.875  11.554  16.753  1.00 33.01  ? 662 TRP A CD2   1 
ATOM   1847 N NE1   . TRP A 1 247 ? 24.347  9.897   16.648  1.00 34.73  ? 662 TRP A NE1   1 
ATOM   1848 C CE2   . TRP A 1 247 ? 25.450  10.426  16.008  1.00 33.50  ? 662 TRP A CE2   1 
ATOM   1849 C CE3   . TRP A 1 247 ? 27.004  12.276  16.315  1.00 36.22  ? 662 TRP A CE3   1 
ATOM   1850 C CZ2   . TRP A 1 247 ? 26.083  10.030  14.818  1.00 32.71  ? 662 TRP A CZ2   1 
ATOM   1851 C CZ3   . TRP A 1 247 ? 27.653  11.869  15.171  1.00 35.15  ? 662 TRP A CZ3   1 
ATOM   1852 C CH2   . TRP A 1 247 ? 27.212  10.725  14.445  1.00 30.16  ? 662 TRP A CH2   1 
ATOM   1853 N N     . ASP A 1 248 ? 22.948  15.126  20.736  1.00 42.43  ? 663 ASP A N     1 
ATOM   1854 C CA    . ASP A 1 248 ? 22.917  15.980  21.931  1.00 43.83  ? 663 ASP A CA    1 
ATOM   1855 C C     . ASP A 1 248 ? 22.743  15.046  23.136  1.00 42.32  ? 663 ASP A C     1 
ATOM   1856 O O     . ASP A 1 248 ? 21.900  14.144  23.161  1.00 39.79  ? 663 ASP A O     1 
ATOM   1857 C CB    . ASP A 1 248 ? 21.743  16.977  21.837  1.00 44.25  ? 663 ASP A CB    1 
ATOM   1858 C CG    . ASP A 1 248 ? 22.058  18.193  20.987  1.00 51.98  ? 663 ASP A CG    1 
ATOM   1859 O OD1   . ASP A 1 248 ? 21.117  19.009  20.759  1.00 58.59  ? 663 ASP A OD1   1 
ATOM   1860 O OD2   . ASP A 1 248 ? 23.226  18.345  20.497  1.00 57.70  ? 663 ASP A OD2   1 
ATOM   1861 N N     . TYR A 1 249 ? 23.528  15.247  24.162  1.00 43.03  ? 664 TYR A N     1 
ATOM   1862 C CA    . TYR A 1 249 ? 23.361  14.364  25.340  1.00 44.54  ? 664 TYR A CA    1 
ATOM   1863 C C     . TYR A 1 249 ? 21.913  14.424  25.835  1.00 43.65  ? 664 TYR A C     1 
ATOM   1864 O O     . TYR A 1 249 ? 21.338  13.422  26.221  1.00 44.91  ? 664 TYR A O     1 
ATOM   1865 C CB    . TYR A 1 249 ? 24.359  14.734  26.461  1.00 43.68  ? 664 TYR A CB    1 
ATOM   1866 C CG    . TYR A 1 249 ? 24.335  13.739  27.562  1.00 46.31  ? 664 TYR A CG    1 
ATOM   1867 C CD1   . TYR A 1 249 ? 25.114  12.576  27.491  1.00 44.81  ? 664 TYR A CD1   1 
ATOM   1868 C CD2   . TYR A 1 249 ? 23.531  13.927  28.664  1.00 46.17  ? 664 TYR A CD2   1 
ATOM   1869 C CE1   . TYR A 1 249 ? 25.085  11.631  28.490  1.00 48.54  ? 664 TYR A CE1   1 
ATOM   1870 C CE2   . TYR A 1 249 ? 23.520  12.969  29.682  1.00 50.17  ? 664 TYR A CE2   1 
ATOM   1871 C CZ    . TYR A 1 249 ? 24.285  11.841  29.584  1.00 51.84  ? 664 TYR A CZ    1 
ATOM   1872 O OH    . TYR A 1 249 ? 24.227  10.888  30.578  1.00 55.89  ? 664 TYR A OH    1 
ATOM   1873 N N     . ASP A 1 250 ? 21.351  15.619  25.803  1.00 43.91  ? 665 ASP A N     1 
ATOM   1874 C CA    . ASP A 1 250 ? 20.048  15.942  26.395  1.00 45.87  ? 665 ASP A CA    1 
ATOM   1875 C C     . ASP A 1 250 ? 18.977  15.662  25.363  1.00 44.48  ? 665 ASP A C     1 
ATOM   1876 O O     . ASP A 1 250 ? 18.964  16.320  24.323  1.00 46.41  ? 665 ASP A O     1 
ATOM   1877 C CB    . ASP A 1 250 ? 20.041  17.471  26.788  1.00 45.59  ? 665 ASP A CB    1 
ATOM   1878 C CG    . ASP A 1 250 ? 18.708  17.932  27.434  1.00 47.89  ? 665 ASP A CG    1 
ATOM   1879 O OD1   . ASP A 1 250 ? 18.606  19.103  27.911  1.00 50.26  ? 665 ASP A OD1   1 
ATOM   1880 O OD2   . ASP A 1 250 ? 17.731  17.160  27.415  1.00 46.46  ? 665 ASP A OD2   1 
ATOM   1881 N N     . PRO A 1 251 ? 18.088  14.703  25.629  1.00 45.13  ? 666 PRO A N     1 
ATOM   1882 C CA    . PRO A 1 251 ? 17.126  14.334  24.587  1.00 44.86  ? 666 PRO A CA    1 
ATOM   1883 C C     . PRO A 1 251 ? 16.180  15.456  24.104  1.00 45.80  ? 666 PRO A C     1 
ATOM   1884 O O     . PRO A 1 251 ? 15.699  15.374  22.949  1.00 45.57  ? 666 PRO A O     1 
ATOM   1885 C CB    . PRO A 1 251 ? 16.328  13.152  25.232  1.00 45.69  ? 666 PRO A CB    1 
ATOM   1886 C CG    . PRO A 1 251 ? 16.560  13.290  26.720  1.00 46.75  ? 666 PRO A CG    1 
ATOM   1887 C CD    . PRO A 1 251 ? 18.009  13.783  26.794  1.00 44.05  ? 666 PRO A CD    1 
ATOM   1888 N N     . SER A 1 252 ? 15.933  16.494  24.948  1.00 45.99  ? 667 SER A N     1 
ATOM   1889 C CA    . SER A 1 252 ? 14.973  17.576  24.652  1.00 45.70  ? 667 SER A CA    1 
ATOM   1890 C C     . SER A 1 252 ? 15.537  18.467  23.608  1.00 45.15  ? 667 SER A C     1 
ATOM   1891 O O     . SER A 1 252 ? 14.798  19.199  22.969  1.00 44.23  ? 667 SER A O     1 
ATOM   1892 C CB    . SER A 1 252 ? 14.741  18.495  25.898  1.00 46.01  ? 667 SER A CB    1 
ATOM   1893 O OG    . SER A 1 252 ? 14.790  17.683  27.065  1.00 49.98  ? 667 SER A OG    1 
ATOM   1894 N N     . ASP A 1 253 ? 16.866  18.468  23.513  1.00 44.53  ? 668 ASP A N     1 
ATOM   1895 C CA    . ASP A 1 253 ? 17.562  19.370  22.585  1.00 43.93  ? 668 ASP A CA    1 
ATOM   1896 C C     . ASP A 1 253 ? 17.765  18.760  21.181  1.00 43.14  ? 668 ASP A C     1 
ATOM   1897 O O     . ASP A 1 253 ? 18.159  19.462  20.236  1.00 40.50  ? 668 ASP A O     1 
ATOM   1898 C CB    . ASP A 1 253 ? 18.893  19.805  23.178  1.00 44.59  ? 668 ASP A CB    1 
ATOM   1899 C CG    . ASP A 1 253 ? 18.719  20.879  24.294  1.00 48.69  ? 668 ASP A CG    1 
ATOM   1900 O OD1   . ASP A 1 253 ? 17.574  21.340  24.550  1.00 51.77  ? 668 ASP A OD1   1 
ATOM   1901 O OD2   . ASP A 1 253 ? 19.724  21.286  24.903  1.00 51.86  ? 668 ASP A OD2   1 
ATOM   1902 N N     . ARG A 1 254 ? 17.487  17.462  21.052  1.00 42.12  ? 669 ARG A N     1 
ATOM   1903 C CA    . ARG A 1 254 ? 17.603  16.820  19.738  1.00 41.01  ? 669 ARG A CA    1 
ATOM   1904 C C     . ARG A 1 254 ? 16.464  17.278  18.820  1.00 41.42  ? 669 ARG A C     1 
ATOM   1905 O O     . ARG A 1 254 ? 15.321  17.489  19.270  1.00 42.25  ? 669 ARG A O     1 
ATOM   1906 C CB    . ARG A 1 254 ? 17.657  15.321  19.879  1.00 39.88  ? 669 ARG A CB    1 
ATOM   1907 C CG    . ARG A 1 254 ? 18.904  14.795  20.666  1.00 38.68  ? 669 ARG A CG    1 
ATOM   1908 C CD    . ARG A 1 254 ? 18.720  13.290  21.041  1.00 38.24  ? 669 ARG A CD    1 
ATOM   1909 N NE    . ARG A 1 254 ? 19.612  12.931  22.142  1.00 34.33  ? 669 ARG A NE    1 
ATOM   1910 C CZ    . ARG A 1 254 ? 19.444  11.905  22.974  1.00 40.22  ? 669 ARG A CZ    1 
ATOM   1911 N NH1   . ARG A 1 254 ? 18.421  11.065  22.783  1.00 38.73  ? 669 ARG A NH1   1 
ATOM   1912 N NH2   . ARG A 1 254 ? 20.355  11.662  23.959  1.00 38.67  ? 669 ARG A NH2   1 
ATOM   1913 N N     . PRO A 1 255 ? 16.758  17.391  17.519  1.00 41.25  ? 670 PRO A N     1 
ATOM   1914 C CA    . PRO A 1 255 ? 15.665  17.666  16.618  1.00 40.43  ? 670 PRO A CA    1 
ATOM   1915 C C     . PRO A 1 255 ? 14.637  16.557  16.679  1.00 39.84  ? 670 PRO A C     1 
ATOM   1916 O O     . PRO A 1 255 ? 14.899  15.462  17.227  1.00 37.66  ? 670 PRO A O     1 
ATOM   1917 C CB    . PRO A 1 255 ? 16.353  17.750  15.225  1.00 41.69  ? 670 PRO A CB    1 
ATOM   1918 C CG    . PRO A 1 255 ? 17.582  17.017  15.350  1.00 41.49  ? 670 PRO A CG    1 
ATOM   1919 C CD    . PRO A 1 255 ? 18.010  17.078  16.820  1.00 39.66  ? 670 PRO A CD    1 
ATOM   1920 N N     . ARG A 1 256 ? 13.457  16.877  16.193  1.00 38.03  ? 671 ARG A N     1 
ATOM   1921 C CA    . ARG A 1 256 ? 12.430  15.902  15.925  1.00 39.80  ? 671 ARG A CA    1 
ATOM   1922 C C     . ARG A 1 256 ? 12.558  15.429  14.480  1.00 38.18  ? 671 ARG A C     1 
ATOM   1923 O O     . ARG A 1 256 ? 13.114  16.132  13.606  1.00 37.21  ? 671 ARG A O     1 
ATOM   1924 C CB    . ARG A 1 256 ? 11.047  16.545  16.086  1.00 40.59  ? 671 ARG A CB    1 
ATOM   1925 C CG    . ARG A 1 256 ? 10.763  17.168  17.513  1.00 47.29  ? 671 ARG A CG    1 
ATOM   1926 C CD    . ARG A 1 256 ? 9.810   16.362  18.397  1.00 56.58  ? 671 ARG A CD    1 
ATOM   1927 N NE    . ARG A 1 256 ? 8.475   16.221  17.811  1.00 64.48  ? 671 ARG A NE    1 
ATOM   1928 C CZ    . ARG A 1 256 ? 7.638   15.224  18.113  1.00 68.48  ? 671 ARG A CZ    1 
ATOM   1929 N NH1   . ARG A 1 256 ? 7.989   14.272  18.978  1.00 70.24  ? 671 ARG A NH1   1 
ATOM   1930 N NH2   . ARG A 1 256 ? 6.449   15.151  17.540  1.00 69.58  ? 671 ARG A NH2   1 
ATOM   1931 N N     . PHE A 1 257 ? 12.010  14.271  14.202  1.00 38.17  ? 672 PHE A N     1 
ATOM   1932 C CA    . PHE A 1 257 ? 12.048  13.764  12.836  1.00 39.80  ? 672 PHE A CA    1 
ATOM   1933 C C     . PHE A 1 257 ? 11.399  14.652  11.758  1.00 41.02  ? 672 PHE A C     1 
ATOM   1934 O O     . PHE A 1 257 ? 11.857  14.630  10.550  1.00 41.74  ? 672 PHE A O     1 
ATOM   1935 C CB    . PHE A 1 257 ? 11.451  12.366  12.766  1.00 39.10  ? 672 PHE A CB    1 
ATOM   1936 C CG    . PHE A 1 257 ? 12.314  11.302  13.394  1.00 38.96  ? 672 PHE A CG    1 
ATOM   1937 C CD1   . PHE A 1 257 ? 13.509  10.938  12.779  1.00 35.21  ? 672 PHE A CD1   1 
ATOM   1938 C CD2   . PHE A 1 257 ? 11.896  10.623  14.550  1.00 34.19  ? 672 PHE A CD2   1 
ATOM   1939 C CE1   . PHE A 1 257 ? 14.281  9.921   13.271  1.00 35.73  ? 672 PHE A CE1   1 
ATOM   1940 C CE2   . PHE A 1 257 ? 12.679  9.616   15.061  1.00 39.41  ? 672 PHE A CE2   1 
ATOM   1941 C CZ    . PHE A 1 257 ? 13.895  9.258   14.392  1.00 34.14  ? 672 PHE A CZ    1 
ATOM   1942 N N     . THR A 1 258 ? 10.352  15.412  12.122  1.00 41.76  ? 673 THR A N     1 
ATOM   1943 C CA    . THR A 1 258 ? 9.669   16.229  11.109  1.00 43.52  ? 673 THR A CA    1 
ATOM   1944 C C     . THR A 1 258 ? 10.649  17.297  10.723  1.00 43.29  ? 673 THR A C     1 
ATOM   1945 O O     . THR A 1 258 ? 10.784  17.614  9.551   1.00 41.95  ? 673 THR A O     1 
ATOM   1946 C CB    . THR A 1 258 ? 8.394   16.963  11.589  1.00 44.40  ? 673 THR A CB    1 
ATOM   1947 O OG1   . THR A 1 258 ? 8.597   17.400  12.933  1.00 48.35  ? 673 THR A OG1   1 
ATOM   1948 C CG2   . THR A 1 258 ? 7.229   16.062  11.555  1.00 46.45  ? 673 THR A CG2   1 
ATOM   1949 N N     . GLU A 1 259 ? 11.372  17.863  11.696  1.00 43.40  ? 674 GLU A N     1 
ATOM   1950 C CA    . GLU A 1 259 ? 12.398  18.825  11.260  1.00 44.51  ? 674 GLU A CA    1 
ATOM   1951 C C     . GLU A 1 259 ? 13.578  18.231  10.511  1.00 42.82  ? 674 GLU A C     1 
ATOM   1952 O O     . GLU A 1 259 ? 14.109  18.909  9.612   1.00 41.22  ? 674 GLU A O     1 
ATOM   1953 C CB    . GLU A 1 259 ? 12.902  19.715  12.400  1.00 45.70  ? 674 GLU A CB    1 
ATOM   1954 C CG    . GLU A 1 259 ? 12.921  18.993  13.718  1.00 53.46  ? 674 GLU A CG    1 
ATOM   1955 C CD    . GLU A 1 259 ? 13.347  19.951  14.837  1.00 57.37  ? 674 GLU A CD    1 
ATOM   1956 O OE1   . GLU A 1 259 ? 12.594  20.121  15.797  1.00 55.41  ? 674 GLU A OE1   1 
ATOM   1957 O OE2   . GLU A 1 259 ? 14.420  20.584  14.674  1.00 64.72  ? 674 GLU A OE2   1 
ATOM   1958 N N     . LEU A 1 260 ? 14.006  16.998  10.877  1.00 41.13  ? 675 LEU A N     1 
ATOM   1959 C CA    . LEU A 1 260 ? 15.106  16.330  10.120  1.00 39.33  ? 675 LEU A CA    1 
ATOM   1960 C C     . LEU A 1 260 ? 14.695  16.124  8.693   1.00 38.90  ? 675 LEU A C     1 
ATOM   1961 O O     . LEU A 1 260 ? 15.543  16.190  7.790   1.00 37.17  ? 675 LEU A O     1 
ATOM   1962 C CB    . LEU A 1 260 ? 15.495  14.972  10.727  1.00 38.40  ? 675 LEU A CB    1 
ATOM   1963 C CG    . LEU A 1 260 ? 16.104  15.156  12.152  1.00 40.07  ? 675 LEU A CG    1 
ATOM   1964 C CD1   . LEU A 1 260 ? 16.282  13.828  12.890  1.00 39.18  ? 675 LEU A CD1   1 
ATOM   1965 C CD2   . LEU A 1 260 ? 17.459  15.978  12.068  1.00 37.85  ? 675 LEU A CD2   1 
ATOM   1966 N N     . VAL A 1 261 ? 13.416  15.798  8.479   1.00 39.01  ? 676 VAL A N     1 
ATOM   1967 C CA    . VAL A 1 261 ? 13.010  15.534  7.113   1.00 40.31  ? 676 VAL A CA    1 
ATOM   1968 C C     . VAL A 1 261 ? 13.260  16.814  6.283   1.00 41.37  ? 676 VAL A C     1 
ATOM   1969 O O     . VAL A 1 261 ? 13.781  16.724  5.191   1.00 41.86  ? 676 VAL A O     1 
ATOM   1970 C CB    . VAL A 1 261 ? 11.554  15.068  6.986   1.00 40.98  ? 676 VAL A CB    1 
ATOM   1971 C CG1   . VAL A 1 261 ? 11.101  15.117  5.513   1.00 41.29  ? 676 VAL A CG1   1 
ATOM   1972 C CG2   . VAL A 1 261 ? 11.420  13.622  7.487   1.00 40.83  ? 676 VAL A CG2   1 
ATOM   1973 N N     . CYS A 1 262 ? 12.899  17.995  6.817   1.00 41.25  ? 677 CYS A N     1 
ATOM   1974 C CA    . CYS A 1 262 ? 13.079  19.257  6.099   1.00 42.22  ? 677 CYS A CA    1 
ATOM   1975 C C     . CYS A 1 262 ? 14.574  19.559  5.874   1.00 42.03  ? 677 CYS A C     1 
ATOM   1976 O O     . CYS A 1 262 ? 14.989  19.892  4.746   1.00 39.55  ? 677 CYS A O     1 
ATOM   1977 C CB    . CYS A 1 262 ? 12.408  20.437  6.843   1.00 42.08  ? 677 CYS A CB    1 
ATOM   1978 S SG    . CYS A 1 262 ? 10.673  20.199  7.005   1.00 49.29  ? 677 CYS A SG    1 
ATOM   1979 N N     . SER A 1 263 ? 15.393  19.434  6.923   1.00 40.84  ? 678 SER A N     1 
ATOM   1980 C CA    . SER A 1 263 ? 16.859  19.704  6.737   1.00 42.52  ? 678 SER A CA    1 
ATOM   1981 C C     . SER A 1 263 ? 17.443  18.691  5.707   1.00 42.21  ? 678 SER A C     1 
ATOM   1982 O O     . SER A 1 263 ? 18.283  19.050  4.851   1.00 41.71  ? 678 SER A O     1 
ATOM   1983 C CB    . SER A 1 263 ? 17.598  19.540  8.075   1.00 43.21  ? 678 SER A CB    1 
ATOM   1984 O OG    . SER A 1 263 ? 16.857  20.160  9.173   1.00 43.80  ? 678 SER A OG    1 
ATOM   1985 N N     . LEU A 1 264 ? 16.999  17.416  5.789   1.00 40.98  ? 679 LEU A N     1 
ATOM   1986 C CA    . LEU A 1 264 ? 17.585  16.397  4.956   1.00 40.09  ? 679 LEU A CA    1 
ATOM   1987 C C     . LEU A 1 264 ? 17.138  16.584  3.506   1.00 39.70  ? 679 LEU A C     1 
ATOM   1988 O O     . LEU A 1 264 ? 17.889  16.248  2.589   1.00 39.33  ? 679 LEU A O     1 
ATOM   1989 C CB    . LEU A 1 264 ? 17.290  14.968  5.466   1.00 40.06  ? 679 LEU A CB    1 
ATOM   1990 C CG    . LEU A 1 264 ? 18.193  14.361  6.555   1.00 43.26  ? 679 LEU A CG    1 
ATOM   1991 C CD1   . LEU A 1 264 ? 17.692  12.949  6.909   1.00 45.56  ? 679 LEU A CD1   1 
ATOM   1992 C CD2   . LEU A 1 264 ? 19.646  14.309  6.048   1.00 44.58  ? 679 LEU A CD2   1 
ATOM   1993 N N     . SER A 1 265 ? 15.923  17.088  3.286   1.00 40.00  ? 680 SER A N     1 
ATOM   1994 C CA    . SER A 1 265 ? 15.496  17.346  1.897   1.00 42.96  ? 680 SER A CA    1 
ATOM   1995 C C     . SER A 1 265 ? 16.344  18.441  1.344   1.00 42.46  ? 680 SER A C     1 
ATOM   1996 O O     . SER A 1 265 ? 16.707  18.422  0.155   1.00 43.53  ? 680 SER A O     1 
ATOM   1997 C CB    . SER A 1 265 ? 14.050  17.821  1.782   1.00 44.46  ? 680 SER A CB    1 
ATOM   1998 O OG    . SER A 1 265 ? 13.253  17.080  2.662   1.00 53.56  ? 680 SER A OG    1 
ATOM   1999 N N     . ASP A 1 266 ? 16.654  19.432  2.178   1.00 43.18  ? 681 ASP A N     1 
ATOM   2000 C CA    . ASP A 1 266 ? 17.504  20.556  1.693   1.00 42.52  ? 681 ASP A CA    1 
ATOM   2001 C C     . ASP A 1 266 ? 18.916  20.078  1.294   1.00 41.99  ? 681 ASP A C     1 
ATOM   2002 O O     . ASP A 1 266 ? 19.416  20.408  0.184   1.00 40.62  ? 681 ASP A O     1 
ATOM   2003 C CB    . ASP A 1 266 ? 17.580  21.642  2.722   1.00 43.98  ? 681 ASP A CB    1 
ATOM   2004 C CG    . ASP A 1 266 ? 16.257  22.431  2.840   1.00 49.38  ? 681 ASP A CG    1 
ATOM   2005 O OD1   . ASP A 1 266 ? 15.486  22.432  1.857   1.00 50.33  ? 681 ASP A OD1   1 
ATOM   2006 O OD2   . ASP A 1 266 ? 16.028  23.053  3.911   1.00 53.64  ? 681 ASP A OD2   1 
ATOM   2007 N N     . VAL A 1 267 ? 19.525  19.257  2.160   1.00 39.56  ? 682 VAL A N     1 
ATOM   2008 C CA    . VAL A 1 267 ? 20.837  18.689  1.874   1.00 38.51  ? 682 VAL A CA    1 
ATOM   2009 C C     . VAL A 1 267 ? 20.774  17.883  0.611   1.00 39.17  ? 682 VAL A C     1 
ATOM   2010 O O     . VAL A 1 267 ? 21.664  17.977  -0.229  1.00 37.92  ? 682 VAL A O     1 
ATOM   2011 C CB    . VAL A 1 267 ? 21.380  17.843  3.019   1.00 38.01  ? 682 VAL A CB    1 
ATOM   2012 C CG1   . VAL A 1 267 ? 22.716  17.187  2.603   1.00 35.37  ? 682 VAL A CG1   1 
ATOM   2013 C CG2   . VAL A 1 267 ? 21.562  18.747  4.237   1.00 39.49  ? 682 VAL A CG2   1 
ATOM   2014 N N     . TYR A 1 268 ? 19.725  17.085  0.486   1.00 38.68  ? 683 TYR A N     1 
ATOM   2015 C CA    . TYR A 1 268 ? 19.595  16.220  -0.696  1.00 39.71  ? 683 TYR A CA    1 
ATOM   2016 C C     . TYR A 1 268 ? 19.490  17.120  -1.878  1.00 40.83  ? 683 TYR A C     1 
ATOM   2017 O O     . TYR A 1 268 ? 20.140  16.891  -2.892  1.00 38.29  ? 683 TYR A O     1 
ATOM   2018 C CB    . TYR A 1 268 ? 18.330  15.393  -0.636  1.00 40.06  ? 683 TYR A CB    1 
ATOM   2019 C CG    . TYR A 1 268 ? 18.021  14.623  -1.899  1.00 41.47  ? 683 TYR A CG    1 
ATOM   2020 C CD1   . TYR A 1 268 ? 18.852  13.603  -2.333  1.00 41.97  ? 683 TYR A CD1   1 
ATOM   2021 C CD2   . TYR A 1 268 ? 16.910  14.954  -2.677  1.00 44.66  ? 683 TYR A CD2   1 
ATOM   2022 C CE1   . TYR A 1 268 ? 18.594  12.923  -3.522  1.00 45.13  ? 683 TYR A CE1   1 
ATOM   2023 C CE2   . TYR A 1 268 ? 16.613  14.248  -3.855  1.00 45.88  ? 683 TYR A CE2   1 
ATOM   2024 C CZ    . TYR A 1 268 ? 17.472  13.244  -4.268  1.00 46.68  ? 683 TYR A CZ    1 
ATOM   2025 O OH    . TYR A 1 268 ? 17.227  12.541  -5.431  1.00 50.53  ? 683 TYR A OH    1 
ATOM   2026 N N     . GLN A 1 269 ? 18.665  18.150  -1.760  1.00 40.45  ? 684 GLN A N     1 
ATOM   2027 C CA    . GLN A 1 269 ? 18.477  18.933  -2.960  1.00 44.16  ? 684 GLN A CA    1 
ATOM   2028 C C     . GLN A 1 269 ? 19.779  19.630  -3.407  1.00 43.18  ? 684 GLN A C     1 
ATOM   2029 O O     . GLN A 1 269 ? 20.084  19.712  -4.627  1.00 44.45  ? 684 GLN A O     1 
ATOM   2030 C CB    . GLN A 1 269 ? 17.274  19.872  -2.833  1.00 43.75  ? 684 GLN A CB    1 
ATOM   2031 C CG    . GLN A 1 269 ? 16.935  20.609  -4.108  1.00 51.76  ? 684 GLN A CG    1 
ATOM   2032 C CD    . GLN A 1 269 ? 16.607  19.683  -5.266  1.00 55.49  ? 684 GLN A CD    1 
ATOM   2033 O OE1   . GLN A 1 269 ? 15.794  18.778  -5.115  1.00 59.01  ? 684 GLN A OE1   1 
ATOM   2034 N NE2   . GLN A 1 269 ? 17.252  19.900  -6.428  1.00 51.41  ? 684 GLN A NE2   1 
ATOM   2035 N N     . MET A 1 270 ? 20.571  20.082  -2.442  1.00 42.79  ? 685 MET A N     1 
ATOM   2036 C CA    . MET A 1 270 ? 21.908  20.625  -2.718  1.00 41.23  ? 685 MET A CA    1 
ATOM   2037 C C     . MET A 1 270 ? 22.895  19.591  -3.311  1.00 42.55  ? 685 MET A C     1 
ATOM   2038 O O     . MET A 1 270 ? 23.654  19.891  -4.280  1.00 41.30  ? 685 MET A O     1 
ATOM   2039 C CB    . MET A 1 270 ? 22.509  21.255  -1.476  1.00 42.15  ? 685 MET A CB    1 
ATOM   2040 C CG    . MET A 1 270 ? 23.980  21.570  -1.657  1.00 42.27  ? 685 MET A CG    1 
ATOM   2041 S SD    . MET A 1 270 ? 24.667  22.459  -0.276  1.00 50.78  ? 685 MET A SD    1 
ATOM   2042 C CE    . MET A 1 270 ? 24.978  21.118  0.849   1.00 50.07  ? 685 MET A CE    1 
ATOM   2043 N N     . GLU A 1 271 ? 22.903  18.373  -2.765  1.00 41.00  ? 686 GLU A N     1 
ATOM   2044 C CA    . GLU A 1 271 ? 23.779  17.402  -3.350  1.00 42.66  ? 686 GLU A CA    1 
ATOM   2045 C C     . GLU A 1 271 ? 23.358  17.010  -4.811  1.00 42.88  ? 686 GLU A C     1 
ATOM   2046 O O     . GLU A 1 271 ? 24.224  16.639  -5.629  1.00 42.60  ? 686 GLU A O     1 
ATOM   2047 C CB    . GLU A 1 271 ? 23.887  16.184  -2.462  1.00 43.13  ? 686 GLU A CB    1 
ATOM   2048 C CG    . GLU A 1 271 ? 24.528  16.458  -1.100  1.00 45.83  ? 686 GLU A CG    1 
ATOM   2049 C CD    . GLU A 1 271 ? 25.913  17.043  -1.243  1.00 52.60  ? 686 GLU A CD    1 
ATOM   2050 O OE1   . GLU A 1 271 ? 26.671  16.712  -2.212  1.00 47.70  ? 686 GLU A OE1   1 
ATOM   2051 O OE2   . GLU A 1 271 ? 26.226  17.872  -0.375  1.00 56.16  ? 686 GLU A OE2   1 
ATOM   2052 N N     . LYS A 1 272 ? 22.056  17.030  -5.105  1.00 42.52  ? 687 LYS A N     1 
ATOM   2053 C CA    . LYS A 1 272 ? 21.594  16.724  -6.472  1.00 45.13  ? 687 LYS A CA    1 
ATOM   2054 C C     . LYS A 1 272 ? 22.090  17.829  -7.411  1.00 45.45  ? 687 LYS A C     1 
ATOM   2055 O O     . LYS A 1 272 ? 22.657  17.545  -8.428  1.00 46.12  ? 687 LYS A O     1 
ATOM   2056 C CB    . LYS A 1 272 ? 20.060  16.658  -6.523  1.00 45.00  ? 687 LYS A CB    1 
ATOM   2057 C CG    . LYS A 1 272 ? 19.402  15.918  -7.719  1.00 48.14  ? 687 LYS A CG    1 
ATOM   2058 C CD    . LYS A 1 272 ? 17.925  16.433  -7.981  1.00 53.56  ? 687 LYS A CD    1 
ATOM   2059 C CE    . LYS A 1 272 ? 17.837  17.587  -9.081  1.00 63.83  ? 687 LYS A CE    1 
ATOM   2060 N NZ    . LYS A 1 272 ? 16.421  18.023  -9.615  1.00 63.94  ? 687 LYS A NZ    1 
ATOM   2061 N N     . ASP A 1 273 ? 21.822  19.097  -7.090  1.00 47.16  ? 688 ASP A N     1 
ATOM   2062 C CA    . ASP A 1 273 ? 22.305  20.189  -7.933  1.00 47.91  ? 688 ASP A CA    1 
ATOM   2063 C C     . ASP A 1 273 ? 23.806  20.058  -8.096  1.00 47.80  ? 688 ASP A C     1 
ATOM   2064 O O     . ASP A 1 273 ? 24.356  20.110  -9.235  1.00 49.13  ? 688 ASP A O     1 
ATOM   2065 C CB    . ASP A 1 273 ? 21.935  21.574  -7.377  1.00 47.25  ? 688 ASP A CB    1 
ATOM   2066 C CG    . ASP A 1 273 ? 20.460  21.806  -7.343  1.00 50.06  ? 688 ASP A CG    1 
ATOM   2067 O OD1   . ASP A 1 273 ? 19.698  21.049  -7.980  1.00 51.87  ? 688 ASP A OD1   1 
ATOM   2068 O OD2   . ASP A 1 273 ? 20.020  22.731  -6.626  1.00 56.57  ? 688 ASP A OD2   1 
ATOM   2069 N N     . ILE A 1 274 ? 24.511  19.882  -6.997  1.00 48.18  ? 689 ILE A N     1 
ATOM   2070 C CA    . ILE A 1 274 ? 25.949  19.707  -7.192  1.00 48.40  ? 689 ILE A CA    1 
ATOM   2071 C C     . ILE A 1 274 ? 26.299  18.548  -8.109  1.00 49.10  ? 689 ILE A C     1 
ATOM   2072 O O     . ILE A 1 274 ? 27.165  18.693  -8.927  1.00 50.49  ? 689 ILE A O     1 
ATOM   2073 C CB    . ILE A 1 274 ? 26.891  19.765  -5.940  1.00 48.41  ? 689 ILE A CB    1 
ATOM   2074 C CG1   . ILE A 1 274 ? 27.674  18.501  -5.742  1.00 49.19  ? 689 ILE A CG1   1 
ATOM   2075 C CG2   . ILE A 1 274 ? 26.423  20.686  -4.671  1.00 46.88  ? 689 ILE A CG2   1 
ATOM   2076 C CD1   . ILE A 1 274 ? 29.106  18.778  -5.959  1.00 53.42  ? 689 ILE A CD1   1 
ATOM   2077 N N     . ALA A 1 275 ? 25.638  17.407  -7.994  1.00 49.10  ? 690 ALA A N     1 
ATOM   2078 C CA    . ALA A 1 275 ? 25.956  16.238  -8.843  1.00 50.40  ? 690 ALA A CA    1 
ATOM   2079 C C     . ALA A 1 275 ? 25.620  16.496  -10.330 1.00 51.61  ? 690 ALA A C     1 
ATOM   2080 O O     . ALA A 1 275 ? 26.300  16.007  -11.209 1.00 51.47  ? 690 ALA A O     1 
ATOM   2081 C CB    . ALA A 1 275 ? 25.140  15.055  -8.364  1.00 49.56  ? 690 ALA A CB    1 
ATOM   2082 N N     . MET A 1 276 ? 24.518  17.213  -10.571 1.00 53.39  ? 691 MET A N     1 
ATOM   2083 C CA    . MET A 1 276 ? 24.014  17.486  -11.903 1.00 54.94  ? 691 MET A CA    1 
ATOM   2084 C C     . MET A 1 276 ? 24.787  18.589  -12.639 1.00 56.65  ? 691 MET A C     1 
ATOM   2085 O O     . MET A 1 276 ? 24.620  18.715  -13.827 1.00 57.22  ? 691 MET A O     1 
ATOM   2086 C CB    . MET A 1 276 ? 22.527  17.864  -11.860 1.00 55.18  ? 691 MET A CB    1 
ATOM   2087 C CG    . MET A 1 276 ? 21.553  16.772  -11.382 1.00 54.62  ? 691 MET A CG    1 
ATOM   2088 S SD    . MET A 1 276 ? 21.476  15.201  -12.327 1.00 60.16  ? 691 MET A SD    1 
ATOM   2089 C CE    . MET A 1 276 ? 22.519  14.052  -11.402 1.00 56.38  ? 691 MET A CE    1 
ATOM   2090 N N     . GLU A 1 277 ? 25.596  19.404  -11.954 1.00 57.76  ? 692 GLU A N     1 
ATOM   2091 C CA    . GLU A 1 277 ? 26.216  20.580  -12.624 1.00 59.18  ? 692 GLU A CA    1 
ATOM   2092 C C     . GLU A 1 277 ? 27.760  20.629  -12.671 1.00 58.79  ? 692 GLU A C     1 
ATOM   2093 O O     . GLU A 1 277 ? 28.425  19.633  -12.381 1.00 58.57  ? 692 GLU A O     1 
ATOM   2094 C CB    . GLU A 1 277 ? 25.700  21.855  -11.992 1.00 59.26  ? 692 GLU A CB    1 
ATOM   2095 C CG    . GLU A 1 277 ? 24.184  21.998  -12.063 1.00 61.61  ? 692 GLU A CG    1 
ATOM   2096 C CD    . GLU A 1 277 ? 23.775  23.395  -11.648 1.00 62.64  ? 692 GLU A CD    1 
ATOM   2097 O OE1   . GLU A 1 277 ? 24.698  24.154  -11.213 1.00 62.10  ? 692 GLU A OE1   1 
ATOM   2098 O OE2   . GLU A 1 277 ? 22.558  23.729  -11.778 1.00 61.96  ? 692 GLU A OE2   1 
HETATM 2099 P PG    . AGS B 2 .   ? 11.770  -11.779 12.954  1.00 101.02 ? 999 AGS A PG    1 
HETATM 2100 S S1G   . AGS B 2 .   ? 12.073  -13.681 12.558  1.00 100.09 ? 999 AGS A S1G   1 
HETATM 2101 O O2G   . AGS B 2 .   ? 12.274  -11.398 14.321  1.00 101.49 ? 999 AGS A O2G   1 
HETATM 2102 O O3G   . AGS B 2 .   ? 10.342  -11.374 12.633  1.00 99.80  ? 999 AGS A O3G   1 
HETATM 2103 P PB    . AGS B 2 .   ? 14.442  -10.857 12.304  1.00 89.80  ? 999 AGS A PB    1 
HETATM 2104 O O1B   . AGS B 2 .   ? 14.769  -9.392  12.219  1.00 92.12  ? 999 AGS A O1B   1 
HETATM 2105 O O2B   . AGS B 2 .   ? 14.859  -11.659 13.505  1.00 90.04  ? 999 AGS A O2B   1 
HETATM 2106 O O3B   . AGS B 2 .   ? 12.843  -10.978 12.004  1.00 94.92  ? 999 AGS A O3B   1 
HETATM 2107 P PA    . AGS B 2 .   ? 14.732  -10.780 9.499   1.00 77.54  ? 999 AGS A PA    1 
HETATM 2108 O O1A   . AGS B 2 .   ? 13.300  -10.281 9.527   1.00 75.09  ? 999 AGS A O1A   1 
HETATM 2109 O O2A   . AGS B 2 .   ? 15.878  -9.803  9.475   1.00 79.35  ? 999 AGS A O2A   1 
HETATM 2110 O O3A   . AGS B 2 .   ? 14.913  -11.543 10.904  1.00 84.36  ? 999 AGS A O3A   1 
HETATM 2111 O "O5'" . AGS B 2 .   ? 15.103  -11.895 8.353   1.00 70.34  ? 999 AGS A "O5'" 1 
HETATM 2112 C "C5'" . AGS B 2 .   ? 16.472  -12.258 8.297   1.00 66.77  ? 999 AGS A "C5'" 1 
HETATM 2113 C "C4'" . AGS B 2 .   ? 17.049  -12.583 6.909   1.00 63.61  ? 999 AGS A "C4'" 1 
HETATM 2114 O "O4'" . AGS B 2 .   ? 16.062  -12.547 5.870   1.00 57.74  ? 999 AGS A "O4'" 1 
HETATM 2115 C "C3'" . AGS B 2 .   ? 18.070  -11.498 6.566   1.00 64.50  ? 999 AGS A "C3'" 1 
HETATM 2116 O "O3'" . AGS B 2 .   ? 18.906  -11.870 5.459   1.00 65.44  ? 999 AGS A "O3'" 1 
HETATM 2117 C "C2'" . AGS B 2 .   ? 17.167  -10.450 6.021   1.00 61.54  ? 999 AGS A "C2'" 1 
HETATM 2118 O "O2'" . AGS B 2 .   ? 17.960  -9.609  5.232   1.00 65.90  ? 999 AGS A "O2'" 1 
HETATM 2119 C "C1'" . AGS B 2 .   ? 16.276  -11.319 5.143   1.00 58.44  ? 999 AGS A "C1'" 1 
HETATM 2120 N N9    . AGS B 2 .   ? 14.992  -10.704 4.814   1.00 50.09  ? 999 AGS A N9    1 
HETATM 2121 C C8    . AGS B 2 .   ? 13.941  -10.518 5.654   1.00 49.31  ? 999 AGS A C8    1 
HETATM 2122 N N7    . AGS B 2 .   ? 12.944  -9.949  5.012   1.00 47.32  ? 999 AGS A N7    1 
HETATM 2123 C C5    . AGS B 2 .   ? 13.361  -9.796  3.703   1.00 45.80  ? 999 AGS A C5    1 
HETATM 2124 C C6    . AGS B 2 .   ? 12.721  -9.260  2.587   1.00 45.28  ? 999 AGS A C6    1 
HETATM 2125 N N6    . AGS B 2 .   ? 11.407  -8.757  2.628   1.00 37.74  ? 999 AGS A N6    1 
HETATM 2126 N N1    . AGS B 2 .   ? 13.404  -9.253  1.442   1.00 44.67  ? 999 AGS A N1    1 
HETATM 2127 C C2    . AGS B 2 .   ? 14.655  -9.741  1.458   1.00 46.54  ? 999 AGS A C2    1 
HETATM 2128 N N3    . AGS B 2 .   ? 15.367  -10.275 2.454   1.00 46.46  ? 999 AGS A N3    1 
HETATM 2129 C C4    . AGS B 2 .   ? 14.638  -10.263 3.570   1.00 48.85  ? 999 AGS A C4    1 
HETATM 2130 S S     . SO4 C 3 .   ? 35.210  6.823   6.274   1.00 67.50  ? 2   SO4 A S     1 
HETATM 2131 O O1    . SO4 C 3 .   ? 34.386  7.271   5.152   1.00 69.59  ? 2   SO4 A O1    1 
HETATM 2132 O O2    . SO4 C 3 .   ? 35.870  5.547   5.938   1.00 71.65  ? 2   SO4 A O2    1 
HETATM 2133 O O3    . SO4 C 3 .   ? 36.169  7.866   6.701   1.00 66.67  ? 2   SO4 A O3    1 
HETATM 2134 O O4    . SO4 C 3 .   ? 34.310  6.536   7.381   1.00 70.56  ? 2   SO4 A O4    1 
HETATM 2135 S S     . SO4 D 3 .   ? 5.989   10.635  3.180   1.00 79.10  ? 3   SO4 A S     1 
HETATM 2136 O O1    . SO4 D 3 .   ? 5.430   11.983  3.397   1.00 80.97  ? 3   SO4 A O1    1 
HETATM 2137 O O2    . SO4 D 3 .   ? 4.869   9.682   3.169   1.00 81.10  ? 3   SO4 A O2    1 
HETATM 2138 O O3    . SO4 D 3 .   ? 6.712   10.604  1.910   1.00 75.93  ? 3   SO4 A O3    1 
HETATM 2139 O O4    . SO4 D 3 .   ? 6.873   10.309  4.286   1.00 78.74  ? 3   SO4 A O4    1 
HETATM 2140 O O     . HOH E 4 .   ? 21.480  -10.087 2.871   1.00 49.81  ? 1   HOH A O     1 
HETATM 2141 O O     . HOH E 4 .   ? 23.877  -5.467  6.175   1.00 37.30  ? 4   HOH A O     1 
HETATM 2142 O O     . HOH E 4 .   ? 6.748   -11.148 12.974  1.00 54.84  ? 5   HOH A O     1 
HETATM 2143 O O     . HOH E 4 .   ? 6.925   10.932  6.867   1.00 39.52  ? 6   HOH A O     1 
HETATM 2144 O O     . HOH E 4 .   ? 23.585  -2.495  10.910  1.00 36.17  ? 7   HOH A O     1 
HETATM 2145 O O     . HOH E 4 .   ? 6.405   13.075  13.028  1.00 44.88  ? 8   HOH A O     1 
HETATM 2146 O O     . HOH E 4 .   ? 11.360  13.028  18.773  1.00 58.68  ? 9   HOH A O     1 
HETATM 2147 O O     . HOH E 4 .   ? 5.004   -0.168  4.333   1.00 44.95  ? 10  HOH A O     1 
HETATM 2148 O O     . HOH E 4 .   ? 32.581  8.259   3.926   1.00 43.44  ? 11  HOH A O     1 
HETATM 2149 O O     . HOH E 4 .   ? 2.674   -19.001 -6.200  1.00 40.82  ? 12  HOH A O     1 
HETATM 2150 O O     . HOH E 4 .   ? 26.673  8.024   18.611  1.00 35.99  ? 13  HOH A O     1 
HETATM 2151 O O     . HOH E 4 .   ? 27.115  -1.178  10.579  1.00 49.05  ? 14  HOH A O     1 
HETATM 2152 O O     . HOH E 4 .   ? 10.142  -1.192  19.498  1.00 64.70  ? 15  HOH A O     1 
HETATM 2153 O O     . HOH E 4 .   ? 10.791  -15.782 10.797  1.00 48.29  ? 16  HOH A O     1 
HETATM 2154 O O     . HOH E 4 .   ? 6.430   -0.227  1.333   1.00 41.34  ? 17  HOH A O     1 
HETATM 2155 O O     . HOH E 4 .   ? 4.309   -2.624  6.158   1.00 62.05  ? 18  HOH A O     1 
HETATM 2156 O O     . HOH E 4 .   ? 25.834  4.352   21.805  1.00 53.31  ? 19  HOH A O     1 
HETATM 2157 O O     . HOH E 4 .   ? 26.408  12.835  -5.341  1.00 44.72  ? 20  HOH A O     1 
HETATM 2158 O O     . HOH E 4 .   ? 32.050  -0.934  -5.355  1.00 54.69  ? 21  HOH A O     1 
HETATM 2159 O O     . HOH E 4 .   ? -10.818 -12.418 -0.913  1.00 57.05  ? 22  HOH A O     1 
HETATM 2160 O O     . HOH E 4 .   ? 31.940  -4.828  26.463  1.00 60.91  ? 23  HOH A O     1 
HETATM 2161 O O     . HOH E 4 .   ? 7.639   12.282  20.212  1.00 55.21  ? 24  HOH A O     1 
HETATM 2162 O O     . HOH E 4 .   ? 25.616  -5.230  7.886   1.00 46.88  ? 25  HOH A O     1 
HETATM 2163 O O     . HOH E 4 .   ? 6.351   2.570   20.901  1.00 61.71  ? 26  HOH A O     1 
HETATM 2164 O O     . HOH E 4 .   ? 27.960  14.132  25.971  1.00 50.42  ? 27  HOH A O     1 
HETATM 2165 O O     . HOH E 4 .   ? 8.523   -25.450 -3.700  1.00 46.90  ? 28  HOH A O     1 
HETATM 2166 O O     . HOH E 4 .   ? -10.858 -10.010 0.872   1.00 63.11  ? 29  HOH A O     1 
HETATM 2167 O O     . HOH E 4 .   ? -4.595  -10.196 -3.906  1.00 73.16  ? 30  HOH A O     1 
HETATM 2168 O O     . HOH E 4 .   ? -4.085  -11.571 4.399   1.00 54.43  ? 31  HOH A O     1 
HETATM 2169 O O     . HOH E 4 .   ? 17.203  -12.215 -4.429  1.00 54.07  ? 32  HOH A O     1 
HETATM 2170 O O     . HOH E 4 .   ? 22.372  3.247   34.907  1.00 54.47  ? 33  HOH A O     1 
HETATM 2171 O O     . HOH E 4 .   ? 28.655  -5.291  27.161  1.00 64.20  ? 34  HOH A O     1 
HETATM 2172 O O     . HOH E 4 .   ? 28.857  -5.307  29.695  1.00 57.70  ? 35  HOH A O     1 
HETATM 2173 O O     . HOH E 4 .   ? 33.243  6.511   8.905   1.00 46.43  ? 36  HOH A O     1 
HETATM 2174 O O     . HOH E 4 .   ? 29.724  24.019  11.798  1.00 65.12  ? 37  HOH A O     1 
HETATM 2175 O O     . HOH E 4 .   ? 30.430  20.072  10.590  1.00 52.30  ? 38  HOH A O     1 
HETATM 2176 O O     . HOH E 4 .   ? 19.250  22.959  -0.091  1.00 52.19  ? 39  HOH A O     1 
HETATM 2177 O O     . HOH E 4 .   ? 21.471  -11.323 -3.097  1.00 61.40  ? 40  HOH A O     1 
HETATM 2178 O O     . HOH E 4 .   ? 8.382   -20.075 19.252  1.00 55.84  ? 41  HOH A O     1 
HETATM 2179 O O     . HOH E 4 .   ? 5.391   -20.365 11.623  1.00 56.45  ? 42  HOH A O     1 
HETATM 2180 O O     . HOH E 4 .   ? 25.016  6.667   -6.200  1.00 51.30  ? 43  HOH A O     1 
HETATM 2181 O O     . HOH E 4 .   ? 28.690  1.000   27.026  1.00 61.26  ? 44  HOH A O     1 
HETATM 2182 O O     . HOH E 4 .   ? 31.218  14.744  0.159   1.00 53.75  ? 45  HOH A O     1 
HETATM 2183 O O     . HOH E 4 .   ? 15.422  3.910   20.363  1.00 51.39  ? 46  HOH A O     1 
HETATM 2184 O O     . HOH E 4 .   ? -5.307  -5.401  12.407  1.00 56.83  ? 47  HOH A O     1 
HETATM 2185 O O     . HOH E 4 .   ? 0.269   -21.026 -5.931  1.00 61.23  ? 48  HOH A O     1 
HETATM 2186 O O     . HOH E 4 .   ? 4.287   2.222   -1.336  1.00 55.25  ? 49  HOH A O     1 
HETATM 2187 O O     . HOH E 4 .   ? 28.739  -7.576  7.451   1.00 58.43  ? 50  HOH A O     1 
HETATM 2188 O O     . HOH E 4 .   ? 20.733  11.334  27.895  1.00 45.69  ? 51  HOH A O     1 
HETATM 2189 O O     . HOH E 4 .   ? 13.659  6.942   -5.262  1.00 47.60  ? 52  HOH A O     1 
HETATM 2190 O O     . HOH E 4 .   ? 23.029  -3.668  13.365  1.00 46.19  ? 53  HOH A O     1 
HETATM 2191 O O     . HOH E 4 .   ? 22.125  -2.851  15.275  1.00 54.77  ? 54  HOH A O     1 
HETATM 2192 O O     . HOH E 4 .   ? 9.180   0.178   -3.852  1.00 49.84  ? 55  HOH A O     1 
HETATM 2193 O O     . HOH E 4 .   ? -11.606 -12.022 -6.844  1.00 60.86  ? 56  HOH A O     1 
HETATM 2194 O O     . HOH E 4 .   ? -13.537 -8.574  -0.349  1.00 52.05  ? 57  HOH A O     1 
HETATM 2195 O O     . HOH E 4 .   ? 35.777  9.214   9.918   1.00 50.09  ? 58  HOH A O     1 
HETATM 2196 O O     . HOH E 4 .   ? 13.957  14.336  19.364  1.00 46.80  ? 59  HOH A O     1 
HETATM 2197 O O     . HOH E 4 .   ? 15.871  -18.876 -6.365  1.00 60.41  ? 60  HOH A O     1 
HETATM 2198 O O     . HOH E 4 .   ? 15.998  9.954   30.015  1.00 64.72  ? 61  HOH A O     1 
HETATM 2199 O O     . HOH E 4 .   ? 26.928  15.502  19.224  1.00 51.58  ? 62  HOH A O     1 
HETATM 2200 O O     . HOH E 4 .   ? 23.340  -6.561  -1.803  1.00 47.72  ? 63  HOH A O     1 
HETATM 2201 O O     . HOH E 4 .   ? 11.993  -5.705  30.086  1.00 64.19  ? 64  HOH A O     1 
HETATM 2202 O O     . HOH E 4 .   ? 10.477  11.997  22.701  1.00 50.81  ? 65  HOH A O     1 
HETATM 2203 O O     . HOH E 4 .   ? 12.576  15.421  -1.348  1.00 56.15  ? 66  HOH A O     1 
HETATM 2204 O O     . HOH E 4 .   ? 29.140  15.629  -6.947  1.00 58.23  ? 67  HOH A O     1 
HETATM 2205 O O     . HOH E 4 .   ? 5.916   -24.318 -1.404  1.00 56.98  ? 68  HOH A O     1 
HETATM 2206 O O     . HOH E 4 .   ? 20.457  8.826   -6.004  1.00 55.92  ? 69  HOH A O     1 
HETATM 2207 O O     . HOH E 4 .   ? 11.476  5.240   -3.928  1.00 63.24  ? 70  HOH A O     1 
HETATM 2208 O O     . HOH E 4 .   ? 25.618  2.292   32.059  1.00 69.97  ? 71  HOH A O     1 
HETATM 2209 O O     . HOH E 4 .   ? 17.414  -23.049 -8.753  1.00 63.16  ? 72  HOH A O     1 
HETATM 2210 O O     . HOH E 4 .   ? 29.905  -0.207  30.956  1.00 57.74  ? 73  HOH A O     1 
HETATM 2211 O O     . HOH E 4 .   ? 4.221   -12.366 -13.458 1.00 68.05  ? 74  HOH A O     1 
HETATM 2212 O O     . HOH E 4 .   ? 34.909  14.594  12.918  1.00 51.57  ? 75  HOH A O     1 
HETATM 2213 O O     . HOH E 4 .   ? 26.822  -2.589  20.299  1.00 43.34  ? 76  HOH A O     1 
HETATM 2214 O O     . HOH E 4 .   ? 16.341  -20.864 -8.767  1.00 54.49  ? 77  HOH A O     1 
HETATM 2215 O O     . HOH E 4 .   ? 13.617  16.001  21.492  1.00 48.63  ? 78  HOH A O     1 
HETATM 2216 O O     . HOH E 4 .   ? 5.734   13.922  10.437  1.00 54.68  ? 79  HOH A O     1 
HETATM 2217 O O     . HOH E 4 .   ? 6.973   16.925  15.256  1.00 65.59  ? 80  HOH A O     1 
HETATM 2218 O O     . HOH E 4 .   ? 16.539  23.335  -0.220  1.00 54.35  ? 81  HOH A O     1 
HETATM 2219 O O     . HOH E 4 .   ? 35.673  13.130  7.506   1.00 49.39  ? 82  HOH A O     1 
HETATM 2220 O O     . HOH E 4 .   ? 8.466   8.813   1.013   1.00 57.85  ? 83  HOH A O     1 
HETATM 2221 O O     . HOH E 4 .   ? 8.248   -8.464  -5.027  1.00 64.31  ? 84  HOH A O     1 
HETATM 2222 O O     . HOH E 4 .   ? 5.825   -21.739 16.204  1.00 61.79  ? 85  HOH A O     1 
HETATM 2223 O O     . HOH E 4 .   ? 34.769  17.186  3.782   1.00 65.44  ? 86  HOH A O     1 
HETATM 2224 O O     . HOH E 4 .   ? 34.204  21.355  7.733   1.00 55.44  ? 87  HOH A O     1 
HETATM 2225 O O     . HOH E 4 .   ? 30.078  16.046  22.031  1.00 56.05  ? 88  HOH A O     1 
HETATM 2226 O O     . HOH E 4 .   ? 30.545  -4.783  19.680  1.00 56.72  ? 89  HOH A O     1 
HETATM 2227 O O     . HOH E 4 .   ? 21.374  9.631   30.153  1.00 58.59  ? 90  HOH A O     1 
HETATM 2228 O O     . HOH E 4 .   ? 8.201   8.698   22.815  1.00 67.23  ? 91  HOH A O     1 
HETATM 2229 O O     . HOH E 4 .   ? 33.157  18.236  1.539   1.00 58.23  ? 92  HOH A O     1 
HETATM 2230 O O     . HOH E 4 .   ? 10.007  16.187  1.771   1.00 73.37  ? 93  HOH A O     1 
HETATM 2231 O O     . HOH E 4 .   ? 27.235  -8.933  -4.517  1.00 67.66  ? 94  HOH A O     1 
HETATM 2232 O O     . HOH E 4 .   ? 9.987   18.836  -0.282  1.00 59.19  ? 95  HOH A O     1 
HETATM 2233 O O     . HOH E 4 .   ? 11.488  -25.224 16.574  1.00 65.18  ? 96  HOH A O     1 
HETATM 2234 O O     . HOH E 4 .   ? 20.657  2.766   36.710  1.00 60.28  ? 97  HOH A O     1 
HETATM 2235 O O     . HOH E 4 .   ? 20.481  -1.446  32.466  1.00 62.72  ? 98  HOH A O     1 
HETATM 2236 O O     . HOH E 4 .   ? 15.240  13.533  -7.321  1.00 59.89  ? 99  HOH A O     1 
HETATM 2237 O O     . HOH E 4 .   ? 6.625   -22.716 27.497  1.00 71.27  ? 100 HOH A O     1 
HETATM 2238 O O     . HOH E 4 .   ? 33.368  20.865  2.169   1.00 50.22  ? 101 HOH A O     1 
HETATM 2239 O O     . HOH E 4 .   ? 13.121  -10.326 -6.771  1.00 68.86  ? 102 HOH A O     1 
HETATM 2240 O O     . HOH E 4 .   ? 33.039  15.398  1.541   1.00 60.75  ? 103 HOH A O     1 
HETATM 2241 O O     . HOH E 4 .   ? 11.547  3.462   27.554  1.00 58.65  ? 104 HOH A O     1 
HETATM 2242 O O     . HOH E 4 .   ? -5.603  -15.372 23.499  1.00 60.15  ? 105 HOH A O     1 
HETATM 2243 O O     . HOH E 4 .   ? 11.683  8.994   -2.319  1.00 42.23  ? 693 HOH A O     1 
HETATM 2244 O O     . HOH E 4 .   ? 28.216  9.717   18.248  1.00 33.38  ? 694 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PRO 1   416 ?   ?   ?   A . n 
A 1 2   GLN 2   417 ?   ?   ?   A . n 
A 1 3   TYR 3   418 ?   ?   ?   A . n 
A 1 4   GLY 4   419 419 GLY GLY A . n 
A 1 5   ILE 5   420 420 ILE ILE A . n 
A 1 6   ALA 6   421 421 ALA ALA A . n 
A 1 7   ARG 7   422 422 ARG ARG A . n 
A 1 8   GLU 8   423 423 GLU GLU A . n 
A 1 9   ASP 9   424 424 ASP ASP A . n 
A 1 10  VAL 10  425 425 VAL VAL A . n 
A 1 11  VAL 11  426 426 VAL VAL A . n 
A 1 12  LEU 12  427 427 LEU LEU A . n 
A 1 13  ASN 13  428 428 ASN ASN A . n 
A 1 14  ARG 14  429 429 ARG ARG A . n 
A 1 15  ILE 15  430 430 ILE ILE A . n 
A 1 16  LEU 16  431 431 LEU LEU A . n 
A 1 17  GLY 17  432 432 GLY GLY A . n 
A 1 18  GLU 18  433 433 GLU GLU A . n 
A 1 19  GLY 19  434 434 GLY GLY A . n 
A 1 20  PHE 20  435 435 PHE PHE A . n 
A 1 21  PHE 21  436 436 PHE PHE A . n 
A 1 22  GLY 22  437 437 GLY GLY A . n 
A 1 23  GLU 23  438 438 GLU GLU A . n 
A 1 24  VAL 24  439 439 VAL VAL A . n 
A 1 25  TYR 25  440 440 TYR TYR A . n 
A 1 26  GLU 26  441 441 GLU GLU A . n 
A 1 27  GLY 27  442 442 GLY GLY A . n 
A 1 28  VAL 28  443 443 VAL VAL A . n 
A 1 29  TYR 29  444 444 TYR TYR A . n 
A 1 30  THR 30  445 445 THR THR A . n 
A 1 31  ASN 31  446 446 ASN ASN A . n 
A 1 32  HIS 32  447 447 HIS HIS A . n 
A 1 33  LYS 33  448 448 LYS LYS A . n 
A 1 34  GLY 34  449 449 GLY GLY A . n 
A 1 35  GLU 35  450 450 GLU GLU A . n 
A 1 36  LYS 36  451 451 LYS LYS A . n 
A 1 37  ILE 37  452 452 ILE ILE A . n 
A 1 38  ASN 38  453 453 ASN ASN A . n 
A 1 39  VAL 39  454 454 VAL VAL A . n 
A 1 40  ALA 40  455 455 ALA ALA A . n 
A 1 41  VAL 41  456 456 VAL VAL A . n 
A 1 42  LYS 42  457 457 LYS LYS A . n 
A 1 43  THR 43  458 458 THR THR A . n 
A 1 44  CYS 44  459 459 CYS CYS A . n 
A 1 45  LYS 45  460 460 LYS LYS A . n 
A 1 46  LYS 46  461 461 LYS LYS A . n 
A 1 47  ASP 47  462 462 ASP ASP A . n 
A 1 48  CYS 48  463 463 CYS CYS A . n 
A 1 49  THR 49  464 464 THR THR A . n 
A 1 50  LEU 50  465 465 LEU LEU A . n 
A 1 51  ASP 51  466 466 ASP ASP A . n 
A 1 52  ASN 52  467 467 ASN ASN A . n 
A 1 53  LYS 53  468 468 LYS LYS A . n 
A 1 54  GLU 54  469 469 GLU GLU A . n 
A 1 55  LYS 55  470 470 LYS LYS A . n 
A 1 56  PHE 56  471 471 PHE PHE A . n 
A 1 57  MET 57  472 472 MET MET A . n 
A 1 58  SER 58  473 473 SER SER A . n 
A 1 59  GLU 59  474 474 GLU GLU A . n 
A 1 60  ALA 60  475 475 ALA ALA A . n 
A 1 61  VAL 61  476 476 VAL VAL A . n 
A 1 62  ILE 62  477 477 ILE ILE A . n 
A 1 63  MET 63  478 478 MET MET A . n 
A 1 64  LYS 64  479 479 LYS LYS A . n 
A 1 65  ASN 65  480 480 ASN ASN A . n 
A 1 66  LEU 66  481 481 LEU LEU A . n 
A 1 67  ASP 67  482 482 ASP ASP A . n 
A 1 68  HIS 68  483 483 HIS HIS A . n 
A 1 69  PRO 69  484 484 PRO PRO A . n 
A 1 70  HIS 70  485 485 HIS HIS A . n 
A 1 71  ILE 71  486 486 ILE ILE A . n 
A 1 72  VAL 72  487 487 VAL VAL A . n 
A 1 73  LYS 73  488 488 LYS LYS A . n 
A 1 74  LEU 74  489 489 LEU LEU A . n 
A 1 75  ILE 75  490 490 ILE ILE A . n 
A 1 76  GLY 76  491 491 GLY GLY A . n 
A 1 77  ILE 77  492 492 ILE ILE A . n 
A 1 78  ILE 78  493 493 ILE ILE A . n 
A 1 79  GLU 79  494 494 GLU GLU A . n 
A 1 80  GLU 80  495 495 GLU GLU A . n 
A 1 81  GLU 81  496 496 GLU GLU A . n 
A 1 82  PRO 82  497 497 PRO PRO A . n 
A 1 83  THR 83  498 498 THR THR A . n 
A 1 84  TRP 84  499 499 TRP TRP A . n 
A 1 85  ILE 85  500 500 ILE ILE A . n 
A 1 86  ILE 86  501 501 ILE ILE A . n 
A 1 87  MET 87  502 502 MET MET A . n 
A 1 88  GLU 88  503 503 GLU GLU A . n 
A 1 89  LEU 89  504 504 LEU LEU A . n 
A 1 90  TYR 90  505 505 TYR TYR A . n 
A 1 91  PRO 91  506 506 PRO PRO A . n 
A 1 92  TYR 92  507 507 TYR TYR A . n 
A 1 93  GLY 93  508 508 GLY GLY A . n 
A 1 94  GLU 94  509 509 GLU GLU A . n 
A 1 95  LEU 95  510 510 LEU LEU A . n 
A 1 96  GLY 96  511 511 GLY GLY A . n 
A 1 97  HIS 97  512 512 HIS HIS A . n 
A 1 98  TYR 98  513 513 TYR TYR A . n 
A 1 99  LEU 99  514 514 LEU LEU A . n 
A 1 100 GLU 100 515 515 GLU GLU A . n 
A 1 101 ARG 101 516 516 ARG ARG A . n 
A 1 102 ASN 102 517 517 ASN ASN A . n 
A 1 103 LYS 103 518 518 LYS LYS A . n 
A 1 104 ASN 104 519 519 ASN ASN A . n 
A 1 105 SER 105 520 520 SER SER A . n 
A 1 106 LEU 106 521 521 LEU LEU A . n 
A 1 107 LYS 107 522 522 LYS LYS A . n 
A 1 108 VAL 108 523 523 VAL VAL A . n 
A 1 109 LEU 109 524 524 LEU LEU A . n 
A 1 110 THR 110 525 525 THR THR A . n 
A 1 111 LEU 111 526 526 LEU LEU A . n 
A 1 112 VAL 112 527 527 VAL VAL A . n 
A 1 113 LEU 113 528 528 LEU LEU A . n 
A 1 114 TYR 114 529 529 TYR TYR A . n 
A 1 115 SER 115 530 530 SER SER A . n 
A 1 116 LEU 116 531 531 LEU LEU A . n 
A 1 117 GLN 117 532 532 GLN GLN A . n 
A 1 118 ILE 118 533 533 ILE ILE A . n 
A 1 119 CYS 119 534 534 CYS CYS A . n 
A 1 120 LYS 120 535 535 LYS LYS A . n 
A 1 121 ALA 121 536 536 ALA ALA A . n 
A 1 122 MET 122 537 537 MET MET A . n 
A 1 123 ALA 123 538 538 ALA ALA A . n 
A 1 124 TYR 124 539 539 TYR TYR A . n 
A 1 125 LEU 125 540 540 LEU LEU A . n 
A 1 126 GLU 126 541 541 GLU GLU A . n 
A 1 127 SER 127 542 542 SER SER A . n 
A 1 128 ILE 128 543 543 ILE ILE A . n 
A 1 129 ASN 129 544 544 ASN ASN A . n 
A 1 130 CYS 130 545 545 CYS CYS A . n 
A 1 131 VAL 131 546 546 VAL VAL A . n 
A 1 132 HIS 132 547 547 HIS HIS A . n 
A 1 133 ARG 133 548 548 ARG ARG A . n 
A 1 134 ASP 134 549 549 ASP ASP A . n 
A 1 135 ILE 135 550 550 ILE ILE A . n 
A 1 136 ALA 136 551 551 ALA ALA A . n 
A 1 137 VAL 137 552 552 VAL VAL A . n 
A 1 138 ARG 138 553 553 ARG ARG A . n 
A 1 139 ASN 139 554 554 ASN ASN A . n 
A 1 140 ILE 140 555 555 ILE ILE A . n 
A 1 141 LEU 141 556 556 LEU LEU A . n 
A 1 142 VAL 142 557 557 VAL VAL A . n 
A 1 143 ALA 143 558 558 ALA ALA A . n 
A 1 144 SER 144 559 559 SER SER A . n 
A 1 145 PRO 145 560 560 PRO PRO A . n 
A 1 146 GLU 146 561 561 GLU GLU A . n 
A 1 147 CYS 147 562 562 CYS CYS A . n 
A 1 148 VAL 148 563 563 VAL VAL A . n 
A 1 149 LYS 149 564 564 LYS LYS A . n 
A 1 150 LEU 150 565 565 LEU LEU A . n 
A 1 151 GLY 151 566 566 GLY GLY A . n 
A 1 152 ASP 152 567 567 ASP ASP A . n 
A 1 153 PHE 153 568 568 PHE PHE A . n 
A 1 154 GLY 154 569 569 GLY GLY A . n 
A 1 155 LEU 155 570 ?   ?   ?   A . n 
A 1 156 SER 156 571 ?   ?   ?   A . n 
A 1 157 ARG 157 572 ?   ?   ?   A . n 
A 1 158 TYR 158 573 ?   ?   ?   A . n 
A 1 159 ILE 159 574 ?   ?   ?   A . n 
A 1 160 GLU 160 575 ?   ?   ?   A . n 
A 1 161 ASP 161 576 ?   ?   ?   A . n 
A 1 162 GLU 162 577 ?   ?   ?   A . n 
A 1 163 ASP 163 578 ?   ?   ?   A . n 
A 1 164 TYR 164 579 ?   ?   ?   A . n 
A 1 165 TYR 165 580 ?   ?   ?   A . n 
A 1 166 LYS 166 581 ?   ?   ?   A . n 
A 1 167 ALA 167 582 ?   ?   ?   A . n 
A 1 168 SER 168 583 ?   ?   ?   A . n 
A 1 169 VAL 169 584 ?   ?   ?   A . n 
A 1 170 THR 170 585 585 THR THR A . n 
A 1 171 ARG 171 586 586 ARG ARG A . n 
A 1 172 LEU 172 587 587 LEU LEU A . n 
A 1 173 PRO 173 588 588 PRO PRO A . n 
A 1 174 ILE 174 589 589 ILE ILE A . n 
A 1 175 LYS 175 590 590 LYS LYS A . n 
A 1 176 TRP 176 591 591 TRP TRP A . n 
A 1 177 MET 177 592 592 MET MET A . n 
A 1 178 SER 178 593 593 SER SER A . n 
A 1 179 PRO 179 594 594 PRO PRO A . n 
A 1 180 GLU 180 595 595 GLU GLU A . n 
A 1 181 SER 181 596 596 SER SER A . n 
A 1 182 ILE 182 597 597 ILE ILE A . n 
A 1 183 ASN 183 598 598 ASN ASN A . n 
A 1 184 PHE 184 599 599 PHE PHE A . n 
A 1 185 ARG 185 600 600 ARG ARG A . n 
A 1 186 ARG 186 601 601 ARG ARG A . n 
A 1 187 PHE 187 602 602 PHE PHE A . n 
A 1 188 THR 188 603 603 THR THR A . n 
A 1 189 THR 189 604 604 THR THR A . n 
A 1 190 ALA 190 605 605 ALA ALA A . n 
A 1 191 SER 191 606 606 SER SER A . n 
A 1 192 ASP 192 607 607 ASP ASP A . n 
A 1 193 VAL 193 608 608 VAL VAL A . n 
A 1 194 TRP 194 609 609 TRP TRP A . n 
A 1 195 MET 195 610 610 MET MET A . n 
A 1 196 PHE 196 611 611 PHE PHE A . n 
A 1 197 ALA 197 612 612 ALA ALA A . n 
A 1 198 VAL 198 613 613 VAL VAL A . n 
A 1 199 CYS 199 614 614 CYS CYS A . n 
A 1 200 MET 200 615 615 MET MET A . n 
A 1 201 TRP 201 616 616 TRP TRP A . n 
A 1 202 GLU 202 617 617 GLU GLU A . n 
A 1 203 ILE 203 618 618 ILE ILE A . n 
A 1 204 LEU 204 619 619 LEU LEU A . n 
A 1 205 SER 205 620 620 SER SER A . n 
A 1 206 PHE 206 621 621 PHE PHE A . n 
A 1 207 GLY 207 622 622 GLY GLY A . n 
A 1 208 LYS 208 623 623 LYS LYS A . n 
A 1 209 GLN 209 624 624 GLN GLN A . n 
A 1 210 PRO 210 625 625 PRO PRO A . n 
A 1 211 PHE 211 626 626 PHE PHE A . n 
A 1 212 PHE 212 627 627 PHE PHE A . n 
A 1 213 TRP 213 628 628 TRP TRP A . n 
A 1 214 LEU 214 629 629 LEU LEU A . n 
A 1 215 GLU 215 630 630 GLU GLU A . n 
A 1 216 ASN 216 631 631 ASN ASN A . n 
A 1 217 LYS 217 632 632 LYS LYS A . n 
A 1 218 ASP 218 633 633 ASP ASP A . n 
A 1 219 VAL 219 634 634 VAL VAL A . n 
A 1 220 ILE 220 635 635 ILE ILE A . n 
A 1 221 GLY 221 636 636 GLY GLY A . n 
A 1 222 VAL 222 637 637 VAL VAL A . n 
A 1 223 LEU 223 638 638 LEU LEU A . n 
A 1 224 GLU 224 639 639 GLU GLU A . n 
A 1 225 LYS 225 640 640 LYS LYS A . n 
A 1 226 GLY 226 641 641 GLY GLY A . n 
A 1 227 ASP 227 642 642 ASP ASP A . n 
A 1 228 ARG 228 643 643 ARG ARG A . n 
A 1 229 LEU 229 644 644 LEU LEU A . n 
A 1 230 PRO 230 645 645 PRO PRO A . n 
A 1 231 LYS 231 646 646 LYS LYS A . n 
A 1 232 PRO 232 647 647 PRO PRO A . n 
A 1 233 ASP 233 648 648 ASP ASP A . n 
A 1 234 LEU 234 649 649 LEU LEU A . n 
A 1 235 CYS 235 650 650 CYS CYS A . n 
A 1 236 PRO 236 651 651 PRO PRO A . n 
A 1 237 PRO 237 652 652 PRO PRO A . n 
A 1 238 VAL 238 653 653 VAL VAL A . n 
A 1 239 LEU 239 654 654 LEU LEU A . n 
A 1 240 TYR 240 655 655 TYR TYR A . n 
A 1 241 THR 241 656 656 THR THR A . n 
A 1 242 LEU 242 657 657 LEU LEU A . n 
A 1 243 MET 243 658 658 MET MET A . n 
A 1 244 THR 244 659 659 THR THR A . n 
A 1 245 ARG 245 660 660 ARG ARG A . n 
A 1 246 CYS 246 661 661 CYS CYS A . n 
A 1 247 TRP 247 662 662 TRP TRP A . n 
A 1 248 ASP 248 663 663 ASP ASP A . n 
A 1 249 TYR 249 664 664 TYR TYR A . n 
A 1 250 ASP 250 665 665 ASP ASP A . n 
A 1 251 PRO 251 666 666 PRO PRO A . n 
A 1 252 SER 252 667 667 SER SER A . n 
A 1 253 ASP 253 668 668 ASP ASP A . n 
A 1 254 ARG 254 669 669 ARG ARG A . n 
A 1 255 PRO 255 670 670 PRO PRO A . n 
A 1 256 ARG 256 671 671 ARG ARG A . n 
A 1 257 PHE 257 672 672 PHE PHE A . n 
A 1 258 THR 258 673 673 THR THR A . n 
A 1 259 GLU 259 674 674 GLU GLU A . n 
A 1 260 LEU 260 675 675 LEU LEU A . n 
A 1 261 VAL 261 676 676 VAL VAL A . n 
A 1 262 CYS 262 677 677 CYS CYS A . n 
A 1 263 SER 263 678 678 SER SER A . n 
A 1 264 LEU 264 679 679 LEU LEU A . n 
A 1 265 SER 265 680 680 SER SER A . n 
A 1 266 ASP 266 681 681 ASP ASP A . n 
A 1 267 VAL 267 682 682 VAL VAL A . n 
A 1 268 TYR 268 683 683 TYR TYR A . n 
A 1 269 GLN 269 684 684 GLN GLN A . n 
A 1 270 MET 270 685 685 MET MET A . n 
A 1 271 GLU 271 686 686 GLU GLU A . n 
A 1 272 LYS 272 687 687 LYS LYS A . n 
A 1 273 ASP 273 688 688 ASP ASP A . n 
A 1 274 ILE 274 689 689 ILE ILE A . n 
A 1 275 ALA 275 690 690 ALA ALA A . n 
A 1 276 MET 276 691 691 MET MET A . n 
A 1 277 GLU 277 692 692 GLU GLU A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 AGS 1   999 999 AGS AGS A . 
C 3 SO4 1   2   2   SO4 SO4 A . 
D 3 SO4 1   3   3   SO4 SO4 A . 
E 4 HOH 1   1   1   HOH HOH A . 
E 4 HOH 2   4   4   HOH HOH A . 
E 4 HOH 3   5   5   HOH HOH A . 
E 4 HOH 4   6   6   HOH HOH A . 
E 4 HOH 5   7   7   HOH HOH A . 
E 4 HOH 6   8   8   HOH HOH A . 
E 4 HOH 7   9   9   HOH HOH A . 
E 4 HOH 8   10  10  HOH HOH A . 
E 4 HOH 9   11  11  HOH HOH A . 
E 4 HOH 10  12  12  HOH HOH A . 
E 4 HOH 11  13  13  HOH HOH A . 
E 4 HOH 12  14  14  HOH HOH A . 
E 4 HOH 13  15  15  HOH HOH A . 
E 4 HOH 14  16  16  HOH HOH A . 
E 4 HOH 15  17  17  HOH HOH A . 
E 4 HOH 16  18  18  HOH HOH A . 
E 4 HOH 17  19  19  HOH HOH A . 
E 4 HOH 18  20  20  HOH HOH A . 
E 4 HOH 19  21  21  HOH HOH A . 
E 4 HOH 20  22  22  HOH HOH A . 
E 4 HOH 21  23  23  HOH HOH A . 
E 4 HOH 22  24  24  HOH HOH A . 
E 4 HOH 23  25  25  HOH HOH A . 
E 4 HOH 24  26  26  HOH HOH A . 
E 4 HOH 25  27  27  HOH HOH A . 
E 4 HOH 26  28  28  HOH HOH A . 
E 4 HOH 27  29  29  HOH HOH A . 
E 4 HOH 28  30  30  HOH HOH A . 
E 4 HOH 29  31  31  HOH HOH A . 
E 4 HOH 30  32  32  HOH HOH A . 
E 4 HOH 31  33  33  HOH HOH A . 
E 4 HOH 32  34  34  HOH HOH A . 
E 4 HOH 33  35  35  HOH HOH A . 
E 4 HOH 34  36  36  HOH HOH A . 
E 4 HOH 35  37  37  HOH HOH A . 
E 4 HOH 36  38  38  HOH HOH A . 
E 4 HOH 37  39  39  HOH HOH A . 
E 4 HOH 38  40  40  HOH HOH A . 
E 4 HOH 39  41  41  HOH HOH A . 
E 4 HOH 40  42  42  HOH HOH A . 
E 4 HOH 41  43  43  HOH HOH A . 
E 4 HOH 42  44  44  HOH HOH A . 
E 4 HOH 43  45  45  HOH HOH A . 
E 4 HOH 44  46  46  HOH HOH A . 
E 4 HOH 45  47  47  HOH HOH A . 
E 4 HOH 46  48  48  HOH HOH A . 
E 4 HOH 47  49  49  HOH HOH A . 
E 4 HOH 48  50  50  HOH HOH A . 
E 4 HOH 49  51  51  HOH HOH A . 
E 4 HOH 50  52  52  HOH HOH A . 
E 4 HOH 51  53  53  HOH HOH A . 
E 4 HOH 52  54  54  HOH HOH A . 
E 4 HOH 53  55  55  HOH HOH A . 
E 4 HOH 54  56  56  HOH HOH A . 
E 4 HOH 55  57  57  HOH HOH A . 
E 4 HOH 56  58  58  HOH HOH A . 
E 4 HOH 57  59  59  HOH HOH A . 
E 4 HOH 58  60  60  HOH HOH A . 
E 4 HOH 59  61  61  HOH HOH A . 
E 4 HOH 60  62  62  HOH HOH A . 
E 4 HOH 61  63  63  HOH HOH A . 
E 4 HOH 62  64  64  HOH HOH A . 
E 4 HOH 63  65  65  HOH HOH A . 
E 4 HOH 64  66  66  HOH HOH A . 
E 4 HOH 65  67  67  HOH HOH A . 
E 4 HOH 66  68  68  HOH HOH A . 
E 4 HOH 67  69  69  HOH HOH A . 
E 4 HOH 68  70  70  HOH HOH A . 
E 4 HOH 69  71  71  HOH HOH A . 
E 4 HOH 70  72  72  HOH HOH A . 
E 4 HOH 71  73  73  HOH HOH A . 
E 4 HOH 72  74  74  HOH HOH A . 
E 4 HOH 73  75  75  HOH HOH A . 
E 4 HOH 74  76  76  HOH HOH A . 
E 4 HOH 75  77  77  HOH HOH A . 
E 4 HOH 76  78  78  HOH HOH A . 
E 4 HOH 77  79  79  HOH HOH A . 
E 4 HOH 78  80  80  HOH HOH A . 
E 4 HOH 79  81  81  HOH HOH A . 
E 4 HOH 80  82  82  HOH HOH A . 
E 4 HOH 81  83  83  HOH HOH A . 
E 4 HOH 82  84  84  HOH HOH A . 
E 4 HOH 83  85  85  HOH HOH A . 
E 4 HOH 84  86  86  HOH HOH A . 
E 4 HOH 85  87  87  HOH HOH A . 
E 4 HOH 86  88  88  HOH HOH A . 
E 4 HOH 87  89  89  HOH HOH A . 
E 4 HOH 88  90  90  HOH HOH A . 
E 4 HOH 89  91  91  HOH HOH A . 
E 4 HOH 90  92  92  HOH HOH A . 
E 4 HOH 91  93  93  HOH HOH A . 
E 4 HOH 92  94  94  HOH HOH A . 
E 4 HOH 93  95  95  HOH HOH A . 
E 4 HOH 94  96  96  HOH HOH A . 
E 4 HOH 95  97  97  HOH HOH A . 
E 4 HOH 96  98  98  HOH HOH A . 
E 4 HOH 97  99  99  HOH HOH A . 
E 4 HOH 98  100 100 HOH HOH A . 
E 4 HOH 99  101 101 HOH HOH A . 
E 4 HOH 100 102 102 HOH HOH A . 
E 4 HOH 101 103 103 HOH HOH A . 
E 4 HOH 102 104 104 HOH HOH A . 
E 4 HOH 103 105 105 HOH HOH A . 
E 4 HOH 104 693 2   HOH HOH A . 
E 4 HOH 105 694 3   HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-03-31 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
_software.name             REFMAC 
_software.classification   refinement 
_software.version          5.2.0019 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O4 A SO4 2   ? ? O   A HOH 36  ? ? 1.86 
2 1 O  A HIS 547 ? ? OD1 A ASP 607 ? ? 2.15 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    OE2 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    GLU 
_pdbx_validate_symm_contact.auth_seq_id_1     561 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    NE 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    ARG 
_pdbx_validate_symm_contact.auth_seq_id_2     601 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   1_554 
_pdbx_validate_symm_contact.dist              2.16 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             GLU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              595 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             GLU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              595 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             GLU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              595 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                126.90 
_pdbx_validate_rmsd_angle.angle_target_value         113.40 
_pdbx_validate_rmsd_angle.angle_deviation            13.50 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.20 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 446 ? ? -45.74  171.32  
2 1 LYS A 461 ? ? -52.61  67.50   
3 1 ASP A 462 ? ? -134.74 -107.90 
4 1 CYS A 463 ? ? -56.16  62.90   
5 1 THR A 464 ? ? 20.28   -132.98 
6 1 ASP A 567 ? ? -102.86 78.24   
7 1 ARG A 586 ? ? -45.50  93.87   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A PRO 416 ? A PRO 1   
2  1 Y 1 A GLN 417 ? A GLN 2   
3  1 Y 1 A TYR 418 ? A TYR 3   
4  1 Y 1 A LEU 570 ? A LEU 155 
5  1 Y 1 A SER 571 ? A SER 156 
6  1 Y 1 A ARG 572 ? A ARG 157 
7  1 Y 1 A TYR 573 ? A TYR 158 
8  1 Y 1 A ILE 574 ? A ILE 159 
9  1 Y 1 A GLU 575 ? A GLU 160 
10 1 Y 1 A ASP 576 ? A ASP 161 
11 1 Y 1 A GLU 577 ? A GLU 162 
12 1 Y 1 A ASP 578 ? A ASP 163 
13 1 Y 1 A TYR 579 ? A TYR 164 
14 1 Y 1 A TYR 580 ? A TYR 165 
15 1 Y 1 A LYS 581 ? A LYS 166 
16 1 Y 1 A ALA 582 ? A ALA 167 
17 1 Y 1 A SER 583 ? A SER 168 
18 1 Y 1 A VAL 584 ? A VAL 169 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER' AGS 
3 'SULFATE ION'                                SO4 
4 water                                        HOH 
#