data_3G0H
# 
_entry.id   3G0H 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3G0H         
NDB   PR0365       
RCSB  RCSB051267   
WWPDB D_1000051267 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3EWS 
_pdbx_database_related.details        'The same protein in complex with ADP' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3G0H 
_pdbx_database_status.recvd_initial_deposition_date   2009-01-28 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Karlberg, T.'                         1  
'Lehtio, L.'                           2  
'Collins, R.'                          3  
'Arrowsmith, C.H.'                     4  
'Berglund, H.'                         5  
'Bountra, C.'                          6  
'Dahlgren, L.G.'                       7  
'Edwards, A.M.'                        8  
'Flodin, S.'                           9  
'Flores, A.'                           10 
'Graslund, S.'                         11 
'Hammarstrom, M.'                      12 
'Johansson, A.'                        13 
'Johansson, I.'                        14 
'Kotenyova, T.'                        15 
'Moche, M.'                            16 
'Nilsson, M.E.'                        17 
'Nordlund, P.'                         18 
'Nyman, T.'                            19 
'Persson, C.'                          20 
'Sagemark, J.'                         21 
'Schutz, P.'                           22 
'Siponen, M.I.'                        23 
'Thorsell, A.G.'                       24 
'Tresaugues, L.'                       25 
'Van Den Berg, S.'                     26 
'Weigelt, J.'                          27 
'Welin, M.'                            28 
'Wisniewska, M.'                       29 
'Schuler, H.'                          30 
'Structural Genomics Consortium (SGC)' 31 
# 
_citation.id                        primary 
_citation.title                     'The DEXD/H-box RNA Helicase DDX19 Is Regulated by an {alpha}-Helical Switch.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            284 
_citation.page_first                10296 
_citation.page_last                 10300 
_citation.year                      2009 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19244245 
_citation.pdbx_database_id_DOI      10.1074/jbc.C900018200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Collins, R.'      1 
primary 'Karlberg, T.'     2 
primary 'Lehtio, L.'       3 
primary 'Schutz, P.'       4 
primary 'van den Berg, S.' 5 
primary 'Dahlgren, L.G.'   6 
primary 'Hammarstrom, M.'  7 
primary 'Weigelt, J.'      8 
primary 'Schuler, H.'      9 
# 
_cell.entry_id           3G0H 
_cell.length_a           41.570 
_cell.length_b           81.080 
_cell.length_c           124.740 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3G0H 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ATP-dependent RNA helicase DDX19B'           48025.246 1 3.6.1.- ? 'UNP residues 54-275' ? 
2 polymer     syn "5'-R(P*UP*UP*UP*UP*UP*UP*U)-3'"              2098.203  1 ?       ? ?                     ? 
3 non-polymer syn 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' 506.196   1 ?       ? ?                     ? 
4 non-polymer syn 'MAGNESIUM ION'                               24.305    1 ?       ? ?                     ? 
5 non-polymer syn GLYCEROL                                      92.094    1 ?       ? ?                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'DEAD box protein 19B, DEAD box RNA helicase DEAD5' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'   no no 
;SMEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPP
QNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISE
QIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPD
PNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQ
RAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNI
LNRIQEHFNKKIERLDTDDLDEIE
;
;SMEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPP
QNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISE
QIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPD
PNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQ
RAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNI
LNRIQEHFNKKIERLDTDDLDEIE
;
A ? 
2 polyribonucleotide no no UUUUUUU UUUUUUU E ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   GLU n 
1 4   ASP n 
1 5   ARG n 
1 6   ALA n 
1 7   ALA n 
1 8   GLN n 
1 9   SER n 
1 10  LEU n 
1 11  LEU n 
1 12  ASN n 
1 13  LYS n 
1 14  LEU n 
1 15  ILE n 
1 16  ARG n 
1 17  SER n 
1 18  ASN n 
1 19  LEU n 
1 20  VAL n 
1 21  ASP n 
1 22  ASN n 
1 23  THR n 
1 24  ASN n 
1 25  GLN n 
1 26  VAL n 
1 27  GLU n 
1 28  VAL n 
1 29  LEU n 
1 30  GLN n 
1 31  ARG n 
1 32  ASP n 
1 33  PRO n 
1 34  ASN n 
1 35  SER n 
1 36  PRO n 
1 37  LEU n 
1 38  TYR n 
1 39  SER n 
1 40  VAL n 
1 41  LYS n 
1 42  SER n 
1 43  PHE n 
1 44  GLU n 
1 45  GLU n 
1 46  LEU n 
1 47  ARG n 
1 48  LEU n 
1 49  LYS n 
1 50  PRO n 
1 51  GLN n 
1 52  LEU n 
1 53  LEU n 
1 54  GLN n 
1 55  GLY n 
1 56  VAL n 
1 57  TYR n 
1 58  ALA n 
1 59  MET n 
1 60  GLY n 
1 61  PHE n 
1 62  ASN n 
1 63  ARG n 
1 64  PRO n 
1 65  SER n 
1 66  LYS n 
1 67  ILE n 
1 68  GLN n 
1 69  GLU n 
1 70  ASN n 
1 71  ALA n 
1 72  LEU n 
1 73  PRO n 
1 74  LEU n 
1 75  MET n 
1 76  LEU n 
1 77  ALA n 
1 78  GLU n 
1 79  PRO n 
1 80  PRO n 
1 81  GLN n 
1 82  ASN n 
1 83  LEU n 
1 84  ILE n 
1 85  ALA n 
1 86  GLN n 
1 87  SER n 
1 88  GLN n 
1 89  SER n 
1 90  GLY n 
1 91  THR n 
1 92  GLY n 
1 93  LYS n 
1 94  THR n 
1 95  ALA n 
1 96  ALA n 
1 97  PHE n 
1 98  VAL n 
1 99  LEU n 
1 100 ALA n 
1 101 MET n 
1 102 LEU n 
1 103 SER n 
1 104 GLN n 
1 105 VAL n 
1 106 GLU n 
1 107 PRO n 
1 108 ALA n 
1 109 ASN n 
1 110 LYS n 
1 111 TYR n 
1 112 PRO n 
1 113 GLN n 
1 114 CYS n 
1 115 LEU n 
1 116 CYS n 
1 117 LEU n 
1 118 SER n 
1 119 PRO n 
1 120 THR n 
1 121 TYR n 
1 122 GLU n 
1 123 LEU n 
1 124 ALA n 
1 125 LEU n 
1 126 GLN n 
1 127 THR n 
1 128 GLY n 
1 129 LYS n 
1 130 VAL n 
1 131 ILE n 
1 132 GLU n 
1 133 GLN n 
1 134 MET n 
1 135 GLY n 
1 136 LYS n 
1 137 PHE n 
1 138 TYR n 
1 139 PRO n 
1 140 GLU n 
1 141 LEU n 
1 142 LYS n 
1 143 LEU n 
1 144 ALA n 
1 145 TYR n 
1 146 ALA n 
1 147 VAL n 
1 148 ARG n 
1 149 GLY n 
1 150 ASN n 
1 151 LYS n 
1 152 LEU n 
1 153 GLU n 
1 154 ARG n 
1 155 GLY n 
1 156 GLN n 
1 157 LYS n 
1 158 ILE n 
1 159 SER n 
1 160 GLU n 
1 161 GLN n 
1 162 ILE n 
1 163 VAL n 
1 164 ILE n 
1 165 GLY n 
1 166 THR n 
1 167 PRO n 
1 168 GLY n 
1 169 THR n 
1 170 VAL n 
1 171 LEU n 
1 172 ASP n 
1 173 TRP n 
1 174 CYS n 
1 175 SER n 
1 176 LYS n 
1 177 LEU n 
1 178 LYS n 
1 179 PHE n 
1 180 ILE n 
1 181 ASP n 
1 182 PRO n 
1 183 LYS n 
1 184 LYS n 
1 185 ILE n 
1 186 LYS n 
1 187 VAL n 
1 188 PHE n 
1 189 VAL n 
1 190 LEU n 
1 191 ASP n 
1 192 GLU n 
1 193 ALA n 
1 194 ASP n 
1 195 VAL n 
1 196 MET n 
1 197 ILE n 
1 198 ALA n 
1 199 THR n 
1 200 GLN n 
1 201 GLY n 
1 202 HIS n 
1 203 GLN n 
1 204 ASP n 
1 205 GLN n 
1 206 SER n 
1 207 ILE n 
1 208 ARG n 
1 209 ILE n 
1 210 GLN n 
1 211 ARG n 
1 212 MET n 
1 213 LEU n 
1 214 PRO n 
1 215 ARG n 
1 216 ASN n 
1 217 CYS n 
1 218 GLN n 
1 219 MET n 
1 220 LEU n 
1 221 LEU n 
1 222 PHE n 
1 223 SER n 
1 224 ALA n 
1 225 THR n 
1 226 PHE n 
1 227 GLU n 
1 228 ASP n 
1 229 SER n 
1 230 VAL n 
1 231 TRP n 
1 232 LYS n 
1 233 PHE n 
1 234 ALA n 
1 235 GLN n 
1 236 LYS n 
1 237 VAL n 
1 238 VAL n 
1 239 PRO n 
1 240 ASP n 
1 241 PRO n 
1 242 ASN n 
1 243 VAL n 
1 244 ILE n 
1 245 LYS n 
1 246 LEU n 
1 247 LYS n 
1 248 ARG n 
1 249 GLU n 
1 250 GLU n 
1 251 GLU n 
1 252 THR n 
1 253 LEU n 
1 254 ASP n 
1 255 THR n 
1 256 ILE n 
1 257 LYS n 
1 258 GLN n 
1 259 TYR n 
1 260 TYR n 
1 261 VAL n 
1 262 LEU n 
1 263 CYS n 
1 264 SER n 
1 265 SER n 
1 266 ARG n 
1 267 ASP n 
1 268 GLU n 
1 269 LYS n 
1 270 PHE n 
1 271 GLN n 
1 272 ALA n 
1 273 LEU n 
1 274 CYS n 
1 275 ASN n 
1 276 LEU n 
1 277 TYR n 
1 278 GLY n 
1 279 ALA n 
1 280 ILE n 
1 281 THR n 
1 282 ILE n 
1 283 ALA n 
1 284 GLN n 
1 285 ALA n 
1 286 MET n 
1 287 ILE n 
1 288 PHE n 
1 289 CYS n 
1 290 HIS n 
1 291 THR n 
1 292 ARG n 
1 293 LYS n 
1 294 THR n 
1 295 ALA n 
1 296 SER n 
1 297 TRP n 
1 298 LEU n 
1 299 ALA n 
1 300 ALA n 
1 301 GLU n 
1 302 LEU n 
1 303 SER n 
1 304 LYS n 
1 305 GLU n 
1 306 GLY n 
1 307 HIS n 
1 308 GLN n 
1 309 VAL n 
1 310 ALA n 
1 311 LEU n 
1 312 LEU n 
1 313 SER n 
1 314 GLY n 
1 315 GLU n 
1 316 MET n 
1 317 MET n 
1 318 VAL n 
1 319 GLU n 
1 320 GLN n 
1 321 ARG n 
1 322 ALA n 
1 323 ALA n 
1 324 VAL n 
1 325 ILE n 
1 326 GLU n 
1 327 ARG n 
1 328 PHE n 
1 329 ARG n 
1 330 GLU n 
1 331 GLY n 
1 332 LYS n 
1 333 GLU n 
1 334 LYS n 
1 335 VAL n 
1 336 LEU n 
1 337 VAL n 
1 338 THR n 
1 339 THR n 
1 340 ASN n 
1 341 VAL n 
1 342 CYS n 
1 343 ALA n 
1 344 ARG n 
1 345 GLY n 
1 346 ILE n 
1 347 ASP n 
1 348 VAL n 
1 349 GLU n 
1 350 GLN n 
1 351 VAL n 
1 352 SER n 
1 353 VAL n 
1 354 VAL n 
1 355 ILE n 
1 356 ASN n 
1 357 PHE n 
1 358 ASP n 
1 359 LEU n 
1 360 PRO n 
1 361 VAL n 
1 362 ASP n 
1 363 LYS n 
1 364 ASP n 
1 365 GLY n 
1 366 ASN n 
1 367 PRO n 
1 368 ASP n 
1 369 ASN n 
1 370 GLU n 
1 371 THR n 
1 372 TYR n 
1 373 LEU n 
1 374 HIS n 
1 375 ARG n 
1 376 ILE n 
1 377 GLY n 
1 378 ARG n 
1 379 THR n 
1 380 GLY n 
1 381 ARG n 
1 382 PHE n 
1 383 GLY n 
1 384 LYS n 
1 385 ARG n 
1 386 GLY n 
1 387 LEU n 
1 388 ALA n 
1 389 VAL n 
1 390 ASN n 
1 391 MET n 
1 392 VAL n 
1 393 ASP n 
1 394 SER n 
1 395 LYS n 
1 396 HIS n 
1 397 SER n 
1 398 MET n 
1 399 ASN n 
1 400 ILE n 
1 401 LEU n 
1 402 ASN n 
1 403 ARG n 
1 404 ILE n 
1 405 GLN n 
1 406 GLU n 
1 407 HIS n 
1 408 PHE n 
1 409 ASN n 
1 410 LYS n 
1 411 LYS n 
1 412 ILE n 
1 413 GLU n 
1 414 ARG n 
1 415 LEU n 
1 416 ASP n 
1 417 THR n 
1 418 ASP n 
1 419 ASP n 
1 420 LEU n 
1 421 ASP n 
1 422 GLU n 
1 423 ILE n 
1 424 GLU n 
2 1   U   n 
2 2   U   n 
2 3   U   n 
2 4   U   n 
2 5   U   n 
2 6   U   n 
2 7   U   n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'DBP5, DDX19, DDX19B' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3) gold pRARE2' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNIC28-Bsa4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DD19B_HUMAN Q9UMR2 1 
;EDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQN
LIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQI
VIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPN
VIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRA
AVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILN
RIQEHFNKKIERLDTDDLDEIE
;
54 ? 
2 PDB 3G0H        3G0H   2 UUUUUUU 1  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3G0H A 3 ? 424 ? Q9UMR2 54 ? 475 ? 54 475 
2 2 3G0H E 1 ? 7   ? 3G0H   1  ? 7   ? 1  7   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3G0H SER A 1 ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 52 1 
1 3G0H MET A 2 ? UNP Q9UMR2 ? ? 'EXPRESSION TAG' 53 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                       ?                               'C3 H7 N O2'        89.093 
ANP non-polymer         . 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ?                               'C10 H17 N6 O12 P3' 
506.196 
ARG 'L-peptide linking' y ARGININE                                      ?                               'C6 H15 N4 O2 1'    
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                    ?                               'C4 H8 N2 O3'       
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ?                               'C4 H7 N O4'        
133.103 
CYS 'L-peptide linking' y CYSTEINE                                      ?                               'C3 H7 N O2 S'      
121.158 
GLN 'L-peptide linking' y GLUTAMINE                                     ?                               'C5 H10 N2 O3'      
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ?                               'C5 H9 N O4'        
147.129 
GLY 'peptide linking'   y GLYCINE                                       ?                               'C2 H5 N O2'        75.067 
GOL non-polymer         . GLYCEROL                                      'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094 
HIS 'L-peptide linking' y HISTIDINE                                     ?                               'C6 H10 N3 O2 1'    
156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                    ?                               'C6 H13 N O2'       
131.173 
LEU 'L-peptide linking' y LEUCINE                                       ?                               'C6 H13 N O2'       
131.173 
LYS 'L-peptide linking' y LYSINE                                        ?                               'C6 H15 N2 O2 1'    
147.195 
MET 'L-peptide linking' y METHIONINE                                    ?                               'C5 H11 N O2 S'     
149.211 
MG  non-polymer         . 'MAGNESIUM ION'                               ?                               'Mg 2'              24.305 
PHE 'L-peptide linking' y PHENYLALANINE                                 ?                               'C9 H11 N O2'       
165.189 
PRO 'L-peptide linking' y PROLINE                                       ?                               'C5 H9 N O2'        
115.130 
SER 'L-peptide linking' y SERINE                                        ?                               'C3 H7 N O3'        
105.093 
THR 'L-peptide linking' y THREONINE                                     ?                               'C4 H9 N O3'        
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                    ?                               'C11 H12 N2 O2'     
204.225 
TYR 'L-peptide linking' y TYROSINE                                      ?                               'C9 H11 N O3'       
181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"                    ?                               'C9 H13 N2 O9 P'    
324.181 
VAL 'L-peptide linking' y VALINE                                        ?                               'C5 H11 N O2'       
117.146 
# 
_exptl.entry_id          3G0H 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.10 
_exptl_crystal.density_percent_sol   41.36 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8 
_exptl_crystal_grow.pdbx_details    
'14% PEGMME 2000, 0.25M trimethylamine n-oxide, 0.1 M Tris, pH 8, VAPOR DIFFUSION, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'PEGMME 2000'            ? ? ? 
1 2 1 'trimethylamine n-oxide' ? ? ? 
1 3 1 Tris                     ? ? ? 
1 4 2 'PEGMME 2000'            ? ? ? 
1 5 2 'trimethylamine n-oxide' ? ? ? 
1 6 2 Tris                     ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM Q315r' 
_diffrn_detector.pdbx_collection_date   2008-11-20 
_diffrn_detector.details                'monochromator crystals, Si(311) cut and Si(111)' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Liquid nitrogen cooled channel-cut silicon monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97931 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97931 
# 
_reflns.entry_id                     3G0H 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            2.7 
_reflns.number_obs                   12073 
_reflns.number_all                   12073 
_reflns.percent_possible_obs         99.3 
_reflns.pdbx_Rmerge_I_obs            0.145 
_reflns.pdbx_Rsym_value              0.189 
_reflns.pdbx_netI_over_sigmaI        9.1 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.7 
_reflns_shell.d_res_low              2.77 
_reflns_shell.percent_possible_all   99.7 
_reflns_shell.Rmerge_I_obs           0.55 
_reflns_shell.pdbx_Rsym_value        0.65 
_reflns_shell.meanI_over_sigI_obs    2.5 
_reflns_shell.pdbx_redundancy        3.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      880 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3G0H 
_refine.ls_number_reflns_obs                     11474 
_refine.ls_number_reflns_all                     11474 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.62 
_refine.ls_d_res_high                            2.70 
_refine.ls_percent_reflns_obs                    99.39 
_refine.ls_R_factor_obs                          0.22014 
_refine.ls_R_factor_all                          0.22014 
_refine.ls_R_factor_R_work                       0.21722 
_refine.ls_R_factor_R_free                       0.27520 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  600 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.905 
_refine.correlation_coeff_Fo_to_Fc_free          0.862 
_refine.B_iso_mean                               12.175 
_refine.aniso_B[1][1]                            -.10 
_refine.aniso_B[2][2]                            .02 
_refine.aniso_B[3][3]                            .07 
_refine.aniso_B[1][2]                            .00 
_refine.aniso_B[1][3]                            .00 
_refine.aniso_B[2][3]                            .00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             .80 
_refine.pdbx_solvent_shrinkage_radii             .80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 3EWS' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  .412 
_refine.overall_SU_ML                            .291 
_refine.overall_SU_B                             28.618 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3225 
_refine_hist.pdbx_number_atoms_nucleic_acid   125 
_refine_hist.pdbx_number_atoms_ligand         38 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               3388 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        29.62 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       0.007  0.022  ? 3453 'X-RAY DIFFRACTION' ? 
r_bond_other_d         0.001  0.020  ? 2350 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    1.129  2.030  ? 4693 'X-RAY DIFFRACTION' ? 
r_angle_other_deg      0.811  3.000  ? 5761 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 6.018  5.000  ? 407  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 36.560 24.765 ? 149  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 17.833 15.000 ? 619  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 15.903 15.000 ? 22   'X-RAY DIFFRACTION' ? 
r_chiral_restr         0.060  0.200  ? 538  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   0.004  0.021  ? 3670 'X-RAY DIFFRACTION' ? 
r_gen_planes_other     0.001  0.020  ? 644  'X-RAY DIFFRACTION' ? 
r_mcbond_it            0.238  1.500  ? 2036 'X-RAY DIFFRACTION' ? 
r_mcbond_other         0.036  1.500  ? 818  'X-RAY DIFFRACTION' ? 
r_mcangle_it           0.456  2.000  ? 3295 'X-RAY DIFFRACTION' ? 
r_scbond_it            0.776  3.000  ? 1417 'X-RAY DIFFRACTION' ? 
r_scangle_it           1.410  4.500  ? 1398 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.700 
_refine_ls_shell.d_res_low                        2.770 
_refine_ls_shell.number_reflns_R_work             828 
_refine_ls_shell.R_factor_R_work                  0.269 
_refine_ls_shell.percent_reflns_obs               99.77 
_refine_ls_shell.R_factor_R_free                  0.332 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             43 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3G0H 
_struct.title                     'Human dead-box RNA helicase DDX19, in complex with an ATP-analogue and RNA' 
_struct.pdbx_descriptor           'ATP-dependent RNA helicase DDX19B (E.C.3.6.1.-)/RNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3G0H 
_struct_keywords.pdbx_keywords   HYDROLASE/RNA 
_struct_keywords.text            
;PROTEIN-RNA COMPLEX, DBP5, Structural Genomics, Structural Genomics Consortium, SGC, ATP-binding, Helicase, Hydrolase, Membrane, mRNA transport, Nuclear pore complex, Nucleotide-binding, Nucleus, Phosphoprotein, Protein transport, RNA-binding, Translocation, Transport, polyURACIL, HYDROLASE-RNA COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 10  ? LEU A 14  ? LEU A 61  LEU A 65  5 ? 5  
HELX_P HELX_P2  2  ILE A 15  ? VAL A 20  ? ILE A 66  VAL A 71  1 ? 6  
HELX_P HELX_P3  3  ASN A 24  ? GLN A 30  ? ASN A 75  GLN A 81  1 ? 7  
HELX_P HELX_P4  4  PHE A 43  ? ARG A 47  ? PHE A 94  ARG A 98  5 ? 5  
HELX_P HELX_P5  5  LYS A 49  ? MET A 59  ? LYS A 100 MET A 110 1 ? 11 
HELX_P HELX_P6  6  SER A 65  ? ALA A 77  ? SER A 116 ALA A 128 1 ? 13 
HELX_P HELX_P7  7  GLY A 92  ? SER A 103 ? GLY A 143 SER A 154 1 ? 12 
HELX_P HELX_P8  8  THR A 120 ? GLY A 135 ? THR A 171 GLY A 186 1 ? 16 
HELX_P HELX_P9  9  THR A 166 ? CYS A 174 ? THR A 217 CYS A 225 1 ? 9  
HELX_P HELX_P10 10 ASP A 181 ? ILE A 185 ? ASP A 232 ILE A 236 5 ? 5  
HELX_P HELX_P11 11 GLU A 192 ? ALA A 198 ? GLU A 243 ALA A 249 1 ? 7  
HELX_P HELX_P12 12 HIS A 202 ? MET A 212 ? HIS A 253 MET A 263 1 ? 11 
HELX_P HELX_P13 13 GLU A 227 ? VAL A 238 ? GLU A 278 VAL A 289 1 ? 12 
HELX_P HELX_P14 14 LYS A 247 ? THR A 252 ? LYS A 298 THR A 303 5 ? 6  
HELX_P HELX_P15 15 SER A 265 ? THR A 281 ? SER A 316 THR A 332 1 ? 17 
HELX_P HELX_P16 16 THR A 291 ? GLU A 305 ? THR A 342 GLU A 356 1 ? 15 
HELX_P HELX_P17 17 MET A 317 ? GLU A 330 ? MET A 368 GLU A 381 1 ? 14 
HELX_P HELX_P18 18 ASN A 340 ? ALA A 343 ? ASN A 391 ALA A 394 5 ? 4  
HELX_P HELX_P19 19 ASP A 368 ? GLY A 377 ? ASP A 419 GLY A 428 1 ? 10 
HELX_P HELX_P20 20 SER A 394 ? PHE A 408 ? SER A 445 PHE A 459 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? C ANP . O1G ? ? ? 1_555 D MG . MG ? ? A ANP 1 A MG 476 1_555 ? ? ? ? ? ? ? 1.940 ? 
metalc2 metalc ? ? C ANP . O2B ? ? ? 1_555 D MG . MG ? ? A ANP 1 A MG 476 1_555 ? ? ? ? ? ? ? 2.347 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLU 
_struct_mon_prot_cis.label_seq_id           78 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLU 
_struct_mon_prot_cis.auth_seq_id            129 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    79 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     130 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       1.80 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
A 2 3 ? parallel 
A 3 4 ? parallel 
A 4 5 ? parallel 
A 5 6 ? parallel 
A 6 7 ? parallel 
B 1 2 ? parallel 
B 2 3 ? parallel 
B 3 4 ? parallel 
B 4 5 ? parallel 
B 5 6 ? parallel 
B 6 7 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 143 ? ALA A 146 ? LEU A 194 ALA A 197 
A 2 ILE A 162 ? GLY A 165 ? ILE A 213 GLY A 216 
A 3 CYS A 114 ? LEU A 117 ? CYS A 165 LEU A 168 
A 4 VAL A 187 ? ASP A 191 ? VAL A 238 ASP A 242 
A 5 GLN A 218 ? SER A 223 ? GLN A 269 SER A 274 
A 6 ASN A 82  ? GLN A 86  ? ASN A 133 GLN A 137 
A 7 PRO A 241 ? ILE A 244 ? PRO A 292 ILE A 295 
B 1 ALA A 310 ? LEU A 312 ? ALA A 361 LEU A 363 
B 2 VAL A 335 ? THR A 338 ? VAL A 386 THR A 389 
B 3 GLN A 284 ? PHE A 288 ? GLN A 335 PHE A 339 
B 4 VAL A 351 ? ASN A 356 ? VAL A 402 ASN A 407 
B 5 GLY A 386 ? VAL A 392 ? GLY A 437 VAL A 443 
B 6 ILE A 256 ? LEU A 262 ? ILE A 307 LEU A 313 
B 7 GLU A 413 ? ARG A 414 ? GLU A 464 ARG A 465 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ALA A 146 ? N ALA A 197 O ILE A 164 ? O ILE A 215 
A 2 3 O VAL A 163 ? O VAL A 214 N CYS A 114 ? N CYS A 165 
A 3 4 N LEU A 117 ? N LEU A 168 O VAL A 189 ? O VAL A 240 
A 4 5 N LEU A 190 ? N LEU A 241 O LEU A 220 ? O LEU A 271 
A 5 6 O LEU A 221 ? O LEU A 272 N LEU A 83  ? N LEU A 134 
A 6 7 N ILE A 84  ? N ILE A 135 O ASN A 242 ? O ASN A 293 
B 1 2 N ALA A 310 ? N ALA A 361 O VAL A 337 ? O VAL A 388 
B 2 3 O THR A 338 ? O THR A 389 N ILE A 287 ? N ILE A 338 
B 3 4 N MET A 286 ? N MET A 337 O ILE A 355 ? O ILE A 406 
B 4 5 N VAL A 354 ? N VAL A 405 O LEU A 387 ? O LEU A 438 
B 5 6 O ALA A 388 ? O ALA A 439 N TYR A 259 ? N TYR A 310 
B 6 7 N GLN A 258 ? N GLN A 309 O GLU A 413 ? O GLU A 464 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE ANP A 1'   
AC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG A 476'  
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL A 477' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 PHE A 61  ? PHE A 112 . ? 1_555 ? 
2  AC1 15 ARG A 63  ? ARG A 114 . ? 1_555 ? 
3  AC1 15 GLN A 68  ? GLN A 119 . ? 1_555 ? 
4  AC1 15 GLY A 90  ? GLY A 141 . ? 1_555 ? 
5  AC1 15 THR A 91  ? THR A 142 . ? 1_555 ? 
6  AC1 15 GLY A 92  ? GLY A 143 . ? 1_555 ? 
7  AC1 15 LYS A 93  ? LYS A 144 . ? 1_555 ? 
8  AC1 15 THR A 94  ? THR A 145 . ? 1_555 ? 
9  AC1 15 GLU A 192 ? GLU A 243 . ? 1_555 ? 
10 AC1 15 GLY A 345 ? GLY A 396 . ? 1_555 ? 
11 AC1 15 ASP A 347 ? ASP A 398 . ? 1_555 ? 
12 AC1 15 ARG A 378 ? ARG A 429 . ? 1_555 ? 
13 AC1 15 ARG A 381 ? ARG A 432 . ? 1_555 ? 
14 AC1 15 PHE A 382 ? PHE A 433 . ? 1_555 ? 
15 AC1 15 MG  D .   ? MG  A 476 . ? 1_555 ? 
16 AC2 2  ANP C .   ? ANP A 1   . ? 1_555 ? 
17 AC2 2  THR A 94  ? THR A 145 . ? 1_555 ? 
18 AC3 6  PHE A 226 ? PHE A 277 . ? 1_555 ? 
19 AC3 6  GLU A 227 ? GLU A 278 . ? 1_555 ? 
20 AC3 6  GLU A 251 ? GLU A 302 . ? 1_555 ? 
21 AC3 6  GLU A 370 ? GLU A 421 . ? 1_555 ? 
22 AC3 6  HIS A 407 ? HIS A 458 . ? 1_555 ? 
23 AC3 6  PHE A 408 ? PHE A 459 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3G0H 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3G0H 
_atom_sites.fract_transf_matrix[1][1]   .024056 
_atom_sites.fract_transf_matrix[1][2]   .000000 
_atom_sites.fract_transf_matrix[1][3]   .000000 
_atom_sites.fract_transf_matrix[2][1]   .000000 
_atom_sites.fract_transf_matrix[2][2]   .012333 
_atom_sites.fract_transf_matrix[2][3]   .000000 
_atom_sites.fract_transf_matrix[3][1]   .000000 
_atom_sites.fract_transf_matrix[3][2]   .000000 
_atom_sites.fract_transf_matrix[3][3]   .008017 
_atom_sites.fract_transf_vector[1]      .00000 
_atom_sites.fract_transf_vector[2]      .00000 
_atom_sites.fract_transf_vector[3]      .00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . SER A 1 9   ? -6.131  -12.107 -53.593 1.00 10.63 ? 60  SER A N     1 
ATOM   2    C  CA    . SER A 1 9   ? -6.406  -13.556 -53.811 1.00 10.77 ? 60  SER A CA    1 
ATOM   3    C  C     . SER A 1 9   ? -5.102  -14.354 -53.862 1.00 10.88 ? 60  SER A C     1 
ATOM   4    O  O     . SER A 1 9   ? -4.655  -14.735 -54.941 1.00 11.05 ? 60  SER A O     1 
ATOM   5    C  CB    . SER A 1 9   ? -7.202  -13.750 -55.105 1.00 10.68 ? 60  SER A CB    1 
ATOM   6    N  N     . LEU A 1 10  ? -4.496  -14.597 -52.698 1.00 10.99 ? 61  LEU A N     1 
ATOM   7    C  CA    . LEU A 1 10  ? -3.230  -15.358 -52.600 1.00 11.03 ? 61  LEU A CA    1 
ATOM   8    C  C     . LEU A 1 10  ? -3.141  -16.164 -51.289 1.00 11.07 ? 61  LEU A C     1 
ATOM   9    O  O     . LEU A 1 10  ? -4.016  -16.052 -50.435 1.00 11.24 ? 61  LEU A O     1 
ATOM   10   C  CB    . LEU A 1 10  ? -2.015  -14.422 -52.753 1.00 10.96 ? 61  LEU A CB    1 
ATOM   11   C  CG    . LEU A 1 10  ? -1.438  -13.685 -51.536 1.00 10.78 ? 61  LEU A CG    1 
ATOM   12   C  CD1   . LEU A 1 10  ? -0.156  -12.956 -51.918 1.00 10.38 ? 61  LEU A CD1   1 
ATOM   13   C  CD2   . LEU A 1 10  ? -2.452  -12.721 -50.936 1.00 10.88 ? 61  LEU A CD2   1 
ATOM   14   N  N     . LEU A 1 11  ? -2.088  -16.969 -51.137 1.00 10.99 ? 62  LEU A N     1 
ATOM   15   C  CA    . LEU A 1 11  ? -1.914  -17.820 -49.947 1.00 10.99 ? 62  LEU A CA    1 
ATOM   16   C  C     . LEU A 1 11  ? -1.983  -17.038 -48.638 1.00 11.09 ? 62  LEU A C     1 
ATOM   17   O  O     . LEU A 1 11  ? -2.636  -17.465 -47.682 1.00 11.03 ? 62  LEU A O     1 
ATOM   18   C  CB    . LEU A 1 11  ? -0.575  -18.563 -50.004 1.00 10.98 ? 62  LEU A CB    1 
ATOM   19   C  CG    . LEU A 1 11  ? -0.171  -19.345 -48.746 1.00 10.59 ? 62  LEU A CG    1 
ATOM   20   C  CD1   . LEU A 1 11  ? -1.166  -20.461 -48.461 1.00 10.24 ? 62  LEU A CD1   1 
ATOM   21   C  CD2   . LEU A 1 11  ? 1.234   -19.892 -48.898 1.00 10.12 ? 62  LEU A CD2   1 
ATOM   22   N  N     . ASN A 1 12  ? -1.286  -15.908 -48.598 1.00 11.18 ? 63  ASN A N     1 
ATOM   23   C  CA    . ASN A 1 12  ? -1.258  -15.064 -47.413 1.00 11.31 ? 63  ASN A CA    1 
ATOM   24   C  C     . ASN A 1 12  ? -2.530  -14.230 -47.221 1.00 11.54 ? 63  ASN A C     1 
ATOM   25   O  O     . ASN A 1 12  ? -2.649  -13.513 -46.230 1.00 11.64 ? 63  ASN A O     1 
ATOM   26   C  CB    . ASN A 1 12  ? -0.032  -14.150 -47.444 1.00 11.30 ? 63  ASN A CB    1 
ATOM   27   C  CG    . ASN A 1 12  ? 0.406   -13.721 -46.061 1.00 11.18 ? 63  ASN A CG    1 
ATOM   28   O  OD1   . ASN A 1 12  ? 0.507   -14.539 -45.146 1.00 10.76 ? 63  ASN A OD1   1 
ATOM   29   N  ND2   . ASN A 1 12  ? 0.668   -12.431 -45.900 1.00 10.86 ? 63  ASN A ND2   1 
ATOM   30   N  N     . LYS A 1 13  ? -3.465  -14.306 -48.170 1.00 11.73 ? 64  LYS A N     1 
ATOM   31   C  CA    . LYS A 1 13  ? -4.836  -13.842 -47.942 1.00 11.77 ? 64  LYS A CA    1 
ATOM   32   C  C     . LYS A 1 13  ? -5.592  -14.838 -47.040 1.00 11.84 ? 64  LYS A C     1 
ATOM   33   O  O     . LYS A 1 13  ? -6.689  -14.541 -46.580 1.00 11.91 ? 64  LYS A O     1 
ATOM   34   C  CB    . LYS A 1 13  ? -5.574  -13.644 -49.270 1.00 11.82 ? 64  LYS A CB    1 
ATOM   35   C  CG    . LYS A 1 13  ? -6.832  -12.787 -49.190 1.00 11.69 ? 64  LYS A CG    1 
ATOM   36   C  CD    . LYS A 1 13  ? -7.762  -13.030 -50.395 1.00 11.66 ? 64  LYS A CD    1 
ATOM   37   C  CE    . LYS A 1 13  ? -8.569  -14.337 -50.300 1.00 10.94 ? 64  LYS A CE    1 
ATOM   38   N  NZ    . LYS A 1 13  ? -7.939  -15.452 -51.057 1.00 10.40 ? 64  LYS A NZ    1 
ATOM   39   N  N     . LEU A 1 14  ? -5.000  -16.010 -46.781 1.00 11.94 ? 65  LEU A N     1 
ATOM   40   C  CA    . LEU A 1 14  ? -5.475  -16.921 -45.725 1.00 11.84 ? 65  LEU A CA    1 
ATOM   41   C  C     . LEU A 1 14  ? -5.155  -16.419 -44.302 1.00 11.88 ? 65  LEU A C     1 
ATOM   42   O  O     . LEU A 1 14  ? -5.112  -17.207 -43.356 1.00 11.91 ? 65  LEU A O     1 
ATOM   43   C  CB    . LEU A 1 14  ? -4.888  -18.317 -45.920 1.00 11.84 ? 65  LEU A CB    1 
ATOM   44   N  N     . ILE A 1 15  ? -4.877  -15.119 -44.171 1.00 11.90 ? 66  ILE A N     1 
ATOM   45   C  CA    . ILE A 1 15  ? -5.093  -14.375 -42.922 1.00 11.78 ? 66  ILE A CA    1 
ATOM   46   C  C     . ILE A 1 15  ? -6.586  -14.415 -42.597 1.00 11.70 ? 66  ILE A C     1 
ATOM   47   O  O     . ILE A 1 15  ? -6.979  -14.634 -41.447 1.00 11.72 ? 66  ILE A O     1 
ATOM   48   C  CB    . ILE A 1 15  ? -4.677  -12.884 -43.059 1.00 11.69 ? 66  ILE A CB    1 
ATOM   49   C  CG1   . ILE A 1 15  ? -3.156  -12.743 -43.060 1.00 11.74 ? 66  ILE A CG1   1 
ATOM   50   C  CG2   . ILE A 1 15  ? -5.273  -12.039 -41.934 1.00 11.55 ? 66  ILE A CG2   1 
ATOM   51   C  CD1   . ILE A 1 15  ? -2.682  -11.436 -43.657 1.00 11.48 ? 66  ILE A CD1   1 
ATOM   52   N  N     . ARG A 1 16  ? -7.401  -14.185 -43.632 1.00 11.47 ? 67  ARG A N     1 
ATOM   53   C  CA    . ARG A 1 16  ? -8.871  -14.211 -43.546 1.00 11.18 ? 67  ARG A CA    1 
ATOM   54   C  C     . ARG A 1 16  ? -9.425  -15.525 -42.964 1.00 10.73 ? 67  ARG A C     1 
ATOM   55   O  O     . ARG A 1 16  ? -10.492 -15.525 -42.348 1.00 10.70 ? 67  ARG A O     1 
ATOM   56   C  CB    . ARG A 1 16  ? -9.482  -13.881 -44.926 1.00 11.17 ? 67  ARG A CB    1 
ATOM   57   C  CG    . ARG A 1 16  ? -10.890 -14.404 -45.185 1.00 11.65 ? 67  ARG A CG    1 
ATOM   58   C  CD    . ARG A 1 16  ? -11.568 -13.767 -46.405 1.00 12.28 ? 67  ARG A CD    1 
ATOM   59   N  NE    . ARG A 1 16  ? -10.655 -13.052 -47.303 1.00 12.73 ? 67  ARG A NE    1 
ATOM   60   C  CZ    . ARG A 1 16  ? -10.448 -11.733 -47.296 1.00 13.17 ? 67  ARG A CZ    1 
ATOM   61   N  NH1   . ARG A 1 16  ? -9.600  -11.197 -48.160 1.00 13.25 ? 67  ARG A NH1   1 
ATOM   62   N  NH2   . ARG A 1 16  ? -11.076 -10.939 -46.431 1.00 13.43 ? 67  ARG A NH2   1 
ATOM   63   N  N     . SER A 1 17  ? -8.693  -16.626 -43.145 1.00 10.27 ? 68  SER A N     1 
ATOM   64   C  CA    . SER A 1 17  ? -8.987  -17.897 -42.463 1.00 9.87  ? 68  SER A CA    1 
ATOM   65   C  C     . SER A 1 17  ? -8.987  -17.748 -40.929 1.00 9.47  ? 68  SER A C     1 
ATOM   66   O  O     . SER A 1 17  ? -9.797  -18.359 -40.239 1.00 9.26  ? 68  SER A O     1 
ATOM   67   C  CB    . SER A 1 17  ? -7.972  -18.966 -42.885 1.00 9.82  ? 68  SER A CB    1 
ATOM   68   O  OG    . SER A 1 17  ? -8.342  -20.245 -42.407 1.00 9.79  ? 68  SER A OG    1 
ATOM   69   N  N     . ASN A 1 18  ? -8.075  -16.931 -40.410 1.00 9.19  ? 69  ASN A N     1 
ATOM   70   C  CA    . ASN A 1 18  ? -8.025  -16.608 -38.981 1.00 8.90  ? 69  ASN A CA    1 
ATOM   71   C  C     . ASN A 1 18  ? -8.877  -15.397 -38.583 1.00 8.86  ? 69  ASN A C     1 
ATOM   72   O  O     . ASN A 1 18  ? -9.057  -15.141 -37.395 1.00 8.81  ? 69  ASN A O     1 
ATOM   73   C  CB    . ASN A 1 18  ? -6.580  -16.354 -38.548 1.00 8.77  ? 69  ASN A CB    1 
ATOM   74   C  CG    . ASN A 1 18  ? -5.682  -17.538 -38.793 1.00 8.05  ? 69  ASN A CG    1 
ATOM   75   O  OD1   . ASN A 1 18  ? -6.148  -18.636 -39.090 1.00 7.61  ? 69  ASN A OD1   1 
ATOM   76   N  ND2   . ASN A 1 18  ? -4.382  -17.323 -38.669 1.00 7.01  ? 69  ASN A ND2   1 
ATOM   77   N  N     . LEU A 1 19  ? -9.382  -14.650 -39.565 1.00 8.85  ? 70  LEU A N     1 
ATOM   78   C  CA    . LEU A 1 19  ? -10.223 -13.478 -39.307 1.00 8.83  ? 70  LEU A CA    1 
ATOM   79   C  C     . LEU A 1 19  ? -11.433 -13.807 -38.424 1.00 8.78  ? 70  LEU A C     1 
ATOM   80   O  O     . LEU A 1 19  ? -11.761 -13.033 -37.522 1.00 9.00  ? 70  LEU A O     1 
ATOM   81   C  CB    . LEU A 1 19  ? -10.697 -12.847 -40.623 1.00 8.84  ? 70  LEU A CB    1 
ATOM   82   N  N     . VAL A 1 20  ? -12.081 -14.948 -38.678 1.00 8.52  ? 71  VAL A N     1 
ATOM   83   C  CA    . VAL A 1 20  ? -13.232 -15.404 -37.877 1.00 8.24  ? 71  VAL A CA    1 
ATOM   84   C  C     . VAL A 1 20  ? -13.032 -16.863 -37.419 1.00 8.07  ? 71  VAL A C     1 
ATOM   85   O  O     . VAL A 1 20  ? -13.613 -17.803 -37.981 1.00 8.07  ? 71  VAL A O     1 
ATOM   86   C  CB    . VAL A 1 20  ? -14.576 -15.220 -38.654 1.00 8.22  ? 71  VAL A CB    1 
ATOM   87   C  CG1   . VAL A 1 20  ? -14.541 -15.958 -39.991 1.00 8.09  ? 71  VAL A CG1   1 
ATOM   88   C  CG2   . VAL A 1 20  ? -15.772 -15.655 -37.805 1.00 7.63  ? 71  VAL A CG2   1 
ATOM   89   N  N     . ASP A 1 21  ? -12.212 -17.033 -36.380 1.00 7.66  ? 72  ASP A N     1 
ATOM   90   C  CA    . ASP A 1 21  ? -11.782 -18.363 -35.925 1.00 7.37  ? 72  ASP A CA    1 
ATOM   91   C  C     . ASP A 1 21  ? -12.834 -19.063 -35.052 1.00 7.02  ? 72  ASP A C     1 
ATOM   92   O  O     . ASP A 1 21  ? -13.871 -18.485 -34.735 1.00 7.03  ? 72  ASP A O     1 
ATOM   93   C  CB    . ASP A 1 21  ? -10.421 -18.274 -35.204 1.00 7.44  ? 72  ASP A CB    1 
ATOM   94   C  CG    . ASP A 1 21  ? -9.234  -18.673 -36.100 1.00 7.46  ? 72  ASP A CG    1 
ATOM   95   O  OD1   . ASP A 1 21  ? -9.437  -19.368 -37.125 1.00 7.00  ? 72  ASP A OD1   1 
ATOM   96   O  OD2   . ASP A 1 21  ? -8.086  -18.295 -35.761 1.00 6.95  ? 72  ASP A OD2   1 
ATOM   97   N  N     . ASN A 1 22  ? -12.546 -20.306 -34.662 1.00 6.54  ? 73  ASN A N     1 
ATOM   98   C  CA    . ASN A 1 22  ? -13.569 -21.247 -34.185 1.00 6.13  ? 73  ASN A CA    1 
ATOM   99   C  C     . ASN A 1 22  ? -14.294 -20.907 -32.872 1.00 5.59  ? 73  ASN A C     1 
ATOM   100  O  O     . ASN A 1 22  ? -13.722 -20.309 -31.958 1.00 5.44  ? 73  ASN A O     1 
ATOM   101  C  CB    . ASN A 1 22  ? -12.973 -22.658 -34.096 1.00 6.18  ? 73  ASN A CB    1 
ATOM   102  C  CG    . ASN A 1 22  ? -14.027 -23.724 -33.845 1.00 6.44  ? 73  ASN A CG    1 
ATOM   103  O  OD1   . ASN A 1 22  ? -14.468 -23.926 -32.710 1.00 6.92  ? 73  ASN A OD1   1 
ATOM   104  N  ND2   . ASN A 1 22  ? -14.438 -24.412 -34.906 1.00 6.62  ? 73  ASN A ND2   1 
ATOM   105  N  N     . THR A 1 23  ? -15.559 -21.340 -32.818 1.00 4.96  ? 74  THR A N     1 
ATOM   106  C  CA    . THR A 1 23  ? -16.507 -21.112 -31.711 1.00 4.52  ? 74  THR A CA    1 
ATOM   107  C  C     . THR A 1 23  ? -15.966 -21.289 -30.281 1.00 3.98  ? 74  THR A C     1 
ATOM   108  O  O     . THR A 1 23  ? -16.125 -20.401 -29.442 1.00 3.88  ? 74  THR A O     1 
ATOM   109  C  CB    . THR A 1 23  ? -17.755 -22.040 -31.883 1.00 4.57  ? 74  THR A CB    1 
ATOM   110  O  OG1   . THR A 1 23  ? -18.560 -21.572 -32.977 1.00 4.62  ? 74  THR A OG1   1 
ATOM   111  C  CG2   . THR A 1 23  ? -18.606 -22.092 -30.608 1.00 4.37  ? 74  THR A CG2   1 
ATOM   112  N  N     . ASN A 1 24  ? -15.360 -22.438 -30.000 1.00 3.25  ? 75  ASN A N     1 
ATOM   113  C  CA    . ASN A 1 24  ? -14.837 -22.719 -28.664 1.00 2.73  ? 75  ASN A CA    1 
ATOM   114  C  C     . ASN A 1 24  ? -13.318 -22.905 -28.672 1.00 2.22  ? 75  ASN A C     1 
ATOM   115  O  O     . ASN A 1 24  ? -12.778 -23.725 -27.929 1.00 2.24  ? 75  ASN A O     1 
ATOM   116  C  CB    . ASN A 1 24  ? -15.533 -23.958 -28.087 1.00 2.68  ? 75  ASN A CB    1 
ATOM   117  C  CG    . ASN A 1 24  ? -16.963 -23.681 -27.660 1.00 2.62  ? 75  ASN A CG    1 
ATOM   118  O  OD1   . ASN A 1 24  ? -17.908 -24.247 -28.209 1.00 2.73  ? 75  ASN A OD1   1 
ATOM   119  N  ND2   . ASN A 1 24  ? -17.129 -22.809 -26.673 1.00 2.30  ? 75  ASN A ND2   1 
ATOM   120  N  N     . GLN A 1 25  ? -12.632 -22.126 -29.503 1.00 2.00  ? 76  GLN A N     1 
ATOM   121  C  CA    . GLN A 1 25  ? -11.194 -22.298 -29.721 1.00 2.00  ? 76  GLN A CA    1 
ATOM   122  C  C     . GLN A 1 25  ? -10.382 -22.216 -28.432 1.00 2.00  ? 76  GLN A C     1 
ATOM   123  O  O     . GLN A 1 25  ? -9.624  -23.124 -28.110 1.00 2.00  ? 76  GLN A O     1 
ATOM   124  C  CB    . GLN A 1 25  ? -10.699 -21.247 -30.712 1.00 2.00  ? 76  GLN A CB    1 
ATOM   125  C  CG    . GLN A 1 25  ? -9.193  -21.232 -30.928 1.00 2.00  ? 76  GLN A CG    1 
ATOM   126  C  CD    . GLN A 1 25  ? -8.802  -20.356 -32.086 1.00 2.00  ? 76  GLN A CD    1 
ATOM   127  O  OE1   . GLN A 1 25  ? -9.577  -20.178 -33.018 1.00 2.00  ? 76  GLN A OE1   1 
ATOM   128  N  NE2   . GLN A 1 25  ? -7.600  -19.804 -32.039 1.00 2.00  ? 76  GLN A NE2   1 
ATOM   129  N  N     . VAL A 1 26  ? -10.550 -21.118 -27.707 1.00 2.00  ? 77  VAL A N     1 
ATOM   130  C  CA    . VAL A 1 26  ? -9.800  -20.878 -26.487 1.00 2.00  ? 77  VAL A CA    1 
ATOM   131  C  C     . VAL A 1 26  ? -10.186 -21.882 -25.416 1.00 2.00  ? 77  VAL A C     1 
ATOM   132  O  O     . VAL A 1 26  ? -9.335  -22.351 -24.677 1.00 2.00  ? 77  VAL A O     1 
ATOM   133  C  CB    . VAL A 1 26  ? -10.027 -19.448 -25.958 1.00 2.00  ? 77  VAL A CB    1 
ATOM   134  C  CG1   . VAL A 1 26  ? -9.361  -19.261 -24.608 1.00 2.00  ? 77  VAL A CG1   1 
ATOM   135  C  CG2   . VAL A 1 26  ? -9.501  -18.429 -26.953 1.00 2.00  ? 77  VAL A CG2   1 
ATOM   136  N  N     . GLU A 1 27  ? -11.465 -22.221 -25.341 1.00 2.00  ? 78  GLU A N     1 
ATOM   137  C  CA    . GLU A 1 27  ? -11.927 -23.187 -24.353 1.00 2.00  ? 78  GLU A CA    1 
ATOM   138  C  C     . GLU A 1 27  ? -11.264 -24.551 -24.544 1.00 2.00  ? 78  GLU A C     1 
ATOM   139  O  O     . GLU A 1 27  ? -10.854 -25.182 -23.573 1.00 2.00  ? 78  GLU A O     1 
ATOM   140  C  CB    . GLU A 1 27  ? -13.444 -23.331 -24.408 1.00 2.00  ? 78  GLU A CB    1 
ATOM   141  C  CG    . GLU A 1 27  ? -14.023 -24.037 -23.199 1.00 2.00  ? 78  GLU A CG    1 
ATOM   142  C  CD    . GLU A 1 27  ? -15.514 -24.270 -23.304 1.00 2.00  ? 78  GLU A CD    1 
ATOM   143  O  OE1   . GLU A 1 27  ? -16.047 -25.003 -22.445 1.00 2.00  ? 78  GLU A OE1   1 
ATOM   144  O  OE2   . GLU A 1 27  ? -16.151 -23.730 -24.233 1.00 2.00  ? 78  GLU A OE2   1 
ATOM   145  N  N     . VAL A 1 28  ? -11.161 -24.995 -25.796 1.00 2.00  ? 79  VAL A N     1 
ATOM   146  C  CA    . VAL A 1 28  ? -10.509 -26.269 -26.132 1.00 2.00  ? 79  VAL A CA    1 
ATOM   147  C  C     . VAL A 1 28  ? -9.024  -26.264 -25.759 1.00 2.18  ? 79  VAL A C     1 
ATOM   148  O  O     . VAL A 1 28  ? -8.491  -27.279 -25.292 1.00 2.09  ? 79  VAL A O     1 
ATOM   149  C  CB    . VAL A 1 28  ? -10.650 -26.612 -27.641 1.00 2.00  ? 79  VAL A CB    1 
ATOM   150  C  CG1   . VAL A 1 28  ? -9.801  -27.837 -28.008 1.00 2.00  ? 79  VAL A CG1   1 
ATOM   151  C  CG2   . VAL A 1 28  ? -12.115 -26.843 -28.002 1.00 2.00  ? 79  VAL A CG2   1 
ATOM   152  N  N     . LEU A 1 29  ? -8.363  -25.130 -25.980 1.00 2.71  ? 80  LEU A N     1 
ATOM   153  C  CA    . LEU A 1 29  ? -6.962  -24.970 -25.592 1.00 3.25  ? 80  LEU A CA    1 
ATOM   154  C  C     . LEU A 1 29  ? -6.804  -25.095 -24.071 1.00 3.90  ? 80  LEU A C     1 
ATOM   155  O  O     . LEU A 1 29  ? -5.951  -25.836 -23.585 1.00 3.83  ? 80  LEU A O     1 
ATOM   156  C  CB    . LEU A 1 29  ? -6.408  -23.628 -26.089 1.00 3.10  ? 80  LEU A CB    1 
ATOM   157  C  CG    . LEU A 1 29  ? -6.116  -23.535 -27.590 1.00 2.97  ? 80  LEU A CG    1 
ATOM   158  C  CD1   . LEU A 1 29  ? -5.934  -22.088 -28.029 1.00 2.04  ? 80  LEU A CD1   1 
ATOM   159  C  CD2   . LEU A 1 29  ? -4.890  -24.375 -27.968 1.00 2.50  ? 80  LEU A CD2   1 
ATOM   160  N  N     . GLN A 1 30  ? -7.659  -24.398 -23.328 1.00 4.75  ? 81  GLN A N     1 
ATOM   161  C  CA    . GLN A 1 30  ? -7.645  -24.461 -21.867 1.00 5.39  ? 81  GLN A CA    1 
ATOM   162  C  C     . GLN A 1 30  ? -8.073  -25.834 -21.306 1.00 6.17  ? 81  GLN A C     1 
ATOM   163  O  O     . GLN A 1 30  ? -8.247  -25.976 -20.095 1.00 6.31  ? 81  GLN A O     1 
ATOM   164  C  CB    . GLN A 1 30  ? -8.526  -23.353 -21.275 1.00 5.10  ? 81  GLN A CB    1 
ATOM   165  C  CG    . GLN A 1 30  ? -8.093  -21.947 -21.664 1.00 5.04  ? 81  GLN A CG    1 
ATOM   166  C  CD    . GLN A 1 30  ? -8.396  -20.907 -20.597 1.00 4.42  ? 81  GLN A CD    1 
ATOM   167  O  OE1   . GLN A 1 30  ? -9.407  -20.223 -20.667 1.00 5.35  ? 81  GLN A OE1   1 
ATOM   168  N  NE2   . GLN A 1 30  ? -7.524  -20.794 -19.600 1.00 3.23  ? 81  GLN A NE2   1 
ATOM   169  N  N     . ARG A 1 31  ? -8.249  -26.826 -22.179 1.00 6.95  ? 82  ARG A N     1 
ATOM   170  C  CA    . ARG A 1 31  ? -8.496  -28.212 -21.765 1.00 7.76  ? 82  ARG A CA    1 
ATOM   171  C  C     . ARG A 1 31  ? -7.428  -29.203 -22.272 1.00 8.30  ? 82  ARG A C     1 
ATOM   172  O  O     . ARG A 1 31  ? -7.524  -30.410 -22.018 1.00 8.18  ? 82  ARG A O     1 
ATOM   173  C  CB    . ARG A 1 31  ? -9.905  -28.638 -22.201 1.00 7.67  ? 82  ARG A CB    1 
ATOM   174  C  CG    . ARG A 1 31  ? -10.978 -27.987 -21.337 1.00 8.66  ? 82  ARG A CG    1 
ATOM   175  C  CD    . ARG A 1 31  ? -12.350 -28.628 -21.440 1.00 9.41  ? 82  ARG A CD    1 
ATOM   176  N  NE    . ARG A 1 31  ? -13.087 -28.133 -22.603 1.00 10.54 ? 82  ARG A NE    1 
ATOM   177  C  CZ    . ARG A 1 31  ? -13.232 -28.788 -23.754 1.00 11.78 ? 82  ARG A CZ    1 
ATOM   178  N  NH1   . ARG A 1 31  ? -12.699 -29.998 -23.935 1.00 12.13 ? 82  ARG A NH1   1 
ATOM   179  N  NH2   . ARG A 1 31  ? -13.923 -28.226 -24.738 1.00 12.20 ? 82  ARG A NH2   1 
ATOM   180  N  N     . ASP A 1 32  ? -6.401  -28.668 -22.939 1.00 8.99  ? 83  ASP A N     1 
ATOM   181  C  CA    . ASP A 1 32  ? -5.311  -29.439 -23.525 1.00 9.65  ? 83  ASP A CA    1 
ATOM   182  C  C     . ASP A 1 32  ? -4.062  -29.268 -22.669 1.00 10.18 ? 83  ASP A C     1 
ATOM   183  O  O     . ASP A 1 32  ? -3.572  -28.149 -22.524 1.00 10.26 ? 83  ASP A O     1 
ATOM   184  C  CB    . ASP A 1 32  ? -5.029  -28.929 -24.941 1.00 9.89  ? 83  ASP A CB    1 
ATOM   185  C  CG    . ASP A 1 32  ? -3.805  -29.574 -25.579 1.00 10.47 ? 83  ASP A CG    1 
ATOM   186  O  OD1   . ASP A 1 32  ? -3.121  -28.874 -26.353 1.00 11.38 ? 83  ASP A OD1   1 
ATOM   187  O  OD2   . ASP A 1 32  ? -3.533  -30.773 -25.332 1.00 11.35 ? 83  ASP A OD2   1 
ATOM   188  N  N     . PRO A 1 33  ? -3.544  -30.371 -22.091 1.00 10.92 ? 84  PRO A N     1 
ATOM   189  C  CA    . PRO A 1 33  ? -2.331  -30.340 -21.257 1.00 11.22 ? 84  PRO A CA    1 
ATOM   190  C  C     . PRO A 1 33  ? -1.120  -29.717 -21.946 1.00 11.57 ? 84  PRO A C     1 
ATOM   191  O  O     . PRO A 1 33  ? -0.332  -29.019 -21.300 1.00 12.00 ? 84  PRO A O     1 
ATOM   192  C  CB    . PRO A 1 33  ? -2.058  -31.816 -20.979 1.00 11.31 ? 84  PRO A CB    1 
ATOM   193  C  CG    . PRO A 1 33  ? -3.387  -32.473 -21.086 1.00 11.33 ? 84  PRO A CG    1 
ATOM   194  C  CD    . PRO A 1 33  ? -4.154  -31.715 -22.119 1.00 10.93 ? 84  PRO A CD    1 
ATOM   195  N  N     . ASN A 1 34  ? -0.990  -29.950 -23.249 1.00 11.70 ? 85  ASN A N     1 
ATOM   196  C  CA    . ASN A 1 34  ? 0.104   -29.374 -24.038 1.00 11.72 ? 85  ASN A CA    1 
ATOM   197  C  C     . ASN A 1 34  ? -0.035  -27.867 -24.292 1.00 11.19 ? 85  ASN A C     1 
ATOM   198  O  O     . ASN A 1 34  ? 0.866   -27.255 -24.862 1.00 11.21 ? 85  ASN A O     1 
ATOM   199  C  CB    . ASN A 1 34  ? 0.229   -30.118 -25.380 1.00 12.01 ? 85  ASN A CB    1 
ATOM   200  C  CG    . ASN A 1 34  ? 1.573   -29.880 -26.074 1.00 12.81 ? 85  ASN A CG    1 
ATOM   201  O  OD1   . ASN A 1 34  ? 2.496   -29.302 -25.494 1.00 13.47 ? 85  ASN A OD1   1 
ATOM   202  N  ND2   . ASN A 1 34  ? 1.683   -30.336 -27.327 1.00 13.96 ? 85  ASN A ND2   1 
ATOM   203  N  N     . SER A 1 35  ? -1.155  -27.268 -23.890 1.00 10.71 ? 86  SER A N     1 
ATOM   204  C  CA    . SER A 1 35  ? -1.352  -25.831 -24.076 1.00 10.34 ? 86  SER A CA    1 
ATOM   205  C  C     . SER A 1 35  ? -0.817  -25.066 -22.876 1.00 10.06 ? 86  SER A C     1 
ATOM   206  O  O     . SER A 1 35  ? -0.995  -25.489 -21.735 1.00 10.14 ? 86  SER A O     1 
ATOM   207  C  CB    . SER A 1 35  ? -2.828  -25.486 -24.271 1.00 10.17 ? 86  SER A CB    1 
ATOM   208  O  OG    . SER A 1 35  ? -2.977  -24.118 -24.616 1.00 9.95  ? 86  SER A OG    1 
ATOM   209  N  N     . PRO A 1 36  ? -0.162  -23.933 -23.127 1.00 9.65  ? 87  PRO A N     1 
ATOM   210  C  CA    . PRO A 1 36  ? 0.237   -23.059 -22.029 1.00 9.77  ? 87  PRO A CA    1 
ATOM   211  C  C     . PRO A 1 36  ? -0.937  -22.268 -21.426 1.00 10.03 ? 87  PRO A C     1 
ATOM   212  O  O     . PRO A 1 36  ? -0.750  -21.531 -20.453 1.00 9.74  ? 87  PRO A O     1 
ATOM   213  C  CB    . PRO A 1 36  ? 1.250   -22.119 -22.682 1.00 9.74  ? 87  PRO A CB    1 
ATOM   214  C  CG    . PRO A 1 36  ? 0.923   -22.136 -24.125 1.00 9.70  ? 87  PRO A CG    1 
ATOM   215  C  CD    . PRO A 1 36  ? 0.322   -23.461 -24.432 1.00 9.55  ? 87  PRO A CD    1 
ATOM   216  N  N     . LEU A 1 37  ? -2.131  -22.414 -22.005 1.00 10.42 ? 88  LEU A N     1 
ATOM   217  C  CA    . LEU A 1 37  ? -3.353  -21.826 -21.440 1.00 10.65 ? 88  LEU A CA    1 
ATOM   218  C  C     . LEU A 1 37  ? -4.101  -22.832 -20.546 1.00 10.83 ? 88  LEU A C     1 
ATOM   219  O  O     . LEU A 1 37  ? -5.221  -22.570 -20.106 1.00 10.37 ? 88  LEU A O     1 
ATOM   220  C  CB    . LEU A 1 37  ? -4.284  -21.354 -22.568 1.00 10.64 ? 88  LEU A CB    1 
ATOM   221  C  CG    . LEU A 1 37  ? -3.684  -20.578 -23.744 1.00 10.28 ? 88  LEU A CG    1 
ATOM   222  C  CD1   . LEU A 1 37  ? -4.796  -20.125 -24.679 1.00 9.47  ? 88  LEU A CD1   1 
ATOM   223  C  CD2   . LEU A 1 37  ? -2.870  -19.387 -23.273 1.00 10.27 ? 88  LEU A CD2   1 
ATOM   224  N  N     . TYR A 1 38  ? -3.468  -23.968 -20.264 1.00 11.34 ? 89  TYR A N     1 
ATOM   225  C  CA    . TYR A 1 38  ? -4.148  -25.095 -19.635 1.00 11.94 ? 89  TYR A CA    1 
ATOM   226  C  C     . TYR A 1 38  ? -4.602  -24.797 -18.218 1.00 12.24 ? 89  TYR A C     1 
ATOM   227  O  O     . TYR A 1 38  ? -3.880  -24.187 -17.432 1.00 12.22 ? 89  TYR A O     1 
ATOM   228  C  CB    . TYR A 1 38  ? -3.245  -26.322 -19.634 1.00 12.06 ? 89  TYR A CB    1 
ATOM   229  C  CG    . TYR A 1 38  ? -3.915  -27.590 -19.184 1.00 12.24 ? 89  TYR A CG    1 
ATOM   230  C  CD1   . TYR A 1 38  ? -3.353  -28.371 -18.183 1.00 12.45 ? 89  TYR A CD1   1 
ATOM   231  C  CD2   . TYR A 1 38  ? -5.107  -28.016 -19.761 1.00 13.07 ? 89  TYR A CD2   1 
ATOM   232  C  CE1   . TYR A 1 38  ? -3.946  -29.539 -17.773 1.00 12.69 ? 89  TYR A CE1   1 
ATOM   233  C  CE2   . TYR A 1 38  ? -5.711  -29.193 -19.352 1.00 13.16 ? 89  TYR A CE2   1 
ATOM   234  C  CZ    . TYR A 1 38  ? -5.121  -29.947 -18.359 1.00 13.12 ? 89  TYR A CZ    1 
ATOM   235  O  OH    . TYR A 1 38  ? -5.708  -31.109 -17.944 1.00 13.55 ? 89  TYR A OH    1 
ATOM   236  N  N     . SER A 1 39  ? -5.809  -25.250 -17.909 1.00 12.82 ? 90  SER A N     1 
ATOM   237  C  CA    . SER A 1 39  ? -6.466  -24.913 -16.663 1.00 13.33 ? 90  SER A CA    1 
ATOM   238  C  C     . SER A 1 39  ? -7.028  -26.172 -16.017 1.00 13.60 ? 90  SER A C     1 
ATOM   239  O  O     . SER A 1 39  ? -8.008  -26.738 -16.520 1.00 13.55 ? 90  SER A O     1 
ATOM   240  C  CB    . SER A 1 39  ? -7.602  -23.923 -16.934 1.00 13.56 ? 90  SER A CB    1 
ATOM   241  O  OG    . SER A 1 39  ? -8.128  -23.393 -15.728 1.00 13.75 ? 90  SER A OG    1 
ATOM   242  N  N     . VAL A 1 40  ? -6.409  -26.605 -14.916 1.00 13.82 ? 91  VAL A N     1 
ATOM   243  C  CA    . VAL A 1 40  ? -6.917  -27.741 -14.121 1.00 13.93 ? 91  VAL A CA    1 
ATOM   244  C  C     . VAL A 1 40  ? -7.766  -27.309 -12.926 1.00 13.94 ? 91  VAL A C     1 
ATOM   245  O  O     . VAL A 1 40  ? -8.425  -28.138 -12.310 1.00 14.06 ? 91  VAL A O     1 
ATOM   246  C  CB    . VAL A 1 40  ? -5.777  -28.643 -13.594 1.00 14.00 ? 91  VAL A CB    1 
ATOM   247  C  CG1   . VAL A 1 40  ? -5.275  -29.576 -14.708 1.00 14.01 ? 91  VAL A CG1   1 
ATOM   248  C  CG2   . VAL A 1 40  ? -4.650  -27.795 -12.980 1.00 13.51 ? 91  VAL A CG2   1 
ATOM   249  N  N     . LYS A 1 41  ? -7.742  -26.022 -12.593 1.00 13.91 ? 92  LYS A N     1 
ATOM   250  C  CA    . LYS A 1 41  ? -8.533  -25.512 -11.478 1.00 13.97 ? 92  LYS A CA    1 
ATOM   251  C  C     . LYS A 1 41  ? -9.150  -24.163 -11.816 1.00 13.54 ? 92  LYS A C     1 
ATOM   252  O  O     . LYS A 1 41  ? -8.587  -23.386 -12.579 1.00 13.62 ? 92  LYS A O     1 
ATOM   253  C  CB    . LYS A 1 41  ? -7.674  -25.404 -10.217 1.00 14.26 ? 92  LYS A CB    1 
ATOM   254  C  CG    . LYS A 1 41  ? -6.609  -24.328 -10.270 1.00 14.94 ? 92  LYS A CG    1 
ATOM   255  C  CD    . LYS A 1 41  ? -5.336  -24.751 -9.534  1.00 16.36 ? 92  LYS A CD    1 
ATOM   256  C  CE    . LYS A 1 41  ? -5.566  -24.987 -8.044  1.00 17.11 ? 92  LYS A CE    1 
ATOM   257  N  NZ    . LYS A 1 41  ? -4.291  -24.837 -7.267  1.00 17.73 ? 92  LYS A NZ    1 
ATOM   258  N  N     . SER A 1 42  ? -10.313 -23.897 -11.233 1.00 13.02 ? 93  SER A N     1 
ATOM   259  C  CA    . SER A 1 42  ? -11.048 -22.671 -11.497 1.00 12.47 ? 93  SER A CA    1 
ATOM   260  C  C     . SER A 1 42  ? -10.382 -21.495 -10.807 1.00 12.01 ? 93  SER A C     1 
ATOM   261  O  O     . SER A 1 42  ? -9.444  -21.672 -10.032 1.00 11.92 ? 93  SER A O     1 
ATOM   262  C  CB    . SER A 1 42  ? -12.484 -22.805 -10.989 1.00 12.47 ? 93  SER A CB    1 
ATOM   263  O  OG    . SER A 1 42  ? -12.503 -22.900 -9.575  1.00 11.95 ? 93  SER A OG    1 
ATOM   264  N  N     . PHE A 1 43  ? -10.886 -20.296 -11.084 1.00 11.68 ? 94  PHE A N     1 
ATOM   265  C  CA    . PHE A 1 43  ? -10.414 -19.085 -10.405 1.00 11.30 ? 94  PHE A CA    1 
ATOM   266  C  C     . PHE A 1 43  ? -10.744 -19.098 -8.908  1.00 11.53 ? 94  PHE A C     1 
ATOM   267  O  O     . PHE A 1 43  ? -9.948  -18.617 -8.106  1.00 11.65 ? 94  PHE A O     1 
ATOM   268  C  CB    . PHE A 1 43  ? -10.976 -17.816 -11.063 1.00 10.91 ? 94  PHE A CB    1 
ATOM   269  C  CG    . PHE A 1 43  ? -10.102 -17.245 -12.149 1.00 9.21  ? 94  PHE A CG    1 
ATOM   270  C  CD1   . PHE A 1 43  ? -10.469 -17.336 -13.478 1.00 7.79  ? 94  PHE A CD1   1 
ATOM   271  C  CD2   . PHE A 1 43  ? -8.918  -16.593 -11.836 1.00 8.33  ? 94  PHE A CD2   1 
ATOM   272  C  CE1   . PHE A 1 43  ? -9.671  -16.795 -14.472 1.00 6.99  ? 94  PHE A CE1   1 
ATOM   273  C  CE2   . PHE A 1 43  ? -8.115  -16.051 -12.833 1.00 7.00  ? 94  PHE A CE2   1 
ATOM   274  C  CZ    . PHE A 1 43  ? -8.491  -16.151 -14.143 1.00 6.33  ? 94  PHE A CZ    1 
ATOM   275  N  N     . GLU A 1 44  ? -11.898 -19.655 -8.528  1.00 11.90 ? 95  GLU A N     1 
ATOM   276  C  CA    . GLU A 1 44  ? -12.260 -19.736 -7.097  1.00 12.13 ? 95  GLU A CA    1 
ATOM   277  C  C     . GLU A 1 44  ? -11.397 -20.725 -6.317  1.00 12.32 ? 95  GLU A C     1 
ATOM   278  O  O     . GLU A 1 44  ? -11.228 -20.563 -5.114  1.00 12.34 ? 95  GLU A O     1 
ATOM   279  C  CB    . GLU A 1 44  ? -13.756 -19.996 -6.832  1.00 12.23 ? 95  GLU A CB    1 
ATOM   280  C  CG    . GLU A 1 44  ? -14.564 -20.665 -7.924  1.00 12.64 ? 95  GLU A CG    1 
ATOM   281  C  CD    . GLU A 1 44  ? -15.111 -19.677 -8.939  1.00 13.17 ? 95  GLU A CD    1 
ATOM   282  O  OE1   . GLU A 1 44  ? -15.839 -18.742 -8.528  1.00 12.59 ? 95  GLU A OE1   1 
ATOM   283  O  OE2   . GLU A 1 44  ? -14.812 -19.846 -10.146 1.00 12.95 ? 95  GLU A OE2   1 
ATOM   284  N  N     . GLU A 1 45  ? -10.841 -21.726 -6.998  1.00 12.58 ? 96  GLU A N     1 
ATOM   285  C  CA    . GLU A 1 45  ? -9.852  -22.619 -6.384  1.00 12.80 ? 96  GLU A CA    1 
ATOM   286  C  C     . GLU A 1 45  ? -8.491  -21.938 -6.153  1.00 13.10 ? 96  GLU A C     1 
ATOM   287  O  O     . GLU A 1 45  ? -7.621  -22.498 -5.473  1.00 13.26 ? 96  GLU A O     1 
ATOM   288  C  CB    . GLU A 1 45  ? -9.663  -23.877 -7.227  1.00 12.70 ? 96  GLU A CB    1 
ATOM   289  C  CG    . GLU A 1 45  ? -10.868 -24.773 -7.238  1.00 12.96 ? 96  GLU A CG    1 
ATOM   290  C  CD    . GLU A 1 45  ? -10.647 -26.037 -8.047  1.00 13.40 ? 96  GLU A CD    1 
ATOM   291  O  OE1   . GLU A 1 45  ? -11.001 -26.051 -9.243  1.00 14.29 ? 96  GLU A OE1   1 
ATOM   292  O  OE2   . GLU A 1 45  ? -10.113 -27.017 -7.490  1.00 13.61 ? 96  GLU A OE2   1 
ATOM   293  N  N     . LEU A 1 46  ? -8.296  -20.748 -6.719  1.00 13.29 ? 97  LEU A N     1 
ATOM   294  C  CA    . LEU A 1 46  ? -7.115  -19.939 -6.403  1.00 13.48 ? 97  LEU A CA    1 
ATOM   295  C  C     . LEU A 1 46  ? -7.349  -19.061 -5.179  1.00 13.63 ? 97  LEU A C     1 
ATOM   296  O  O     . LEU A 1 46  ? -6.438  -18.370 -4.737  1.00 13.49 ? 97  LEU A O     1 
ATOM   297  C  CB    . LEU A 1 46  ? -6.701  -19.069 -7.593  1.00 13.58 ? 97  LEU A CB    1 
ATOM   298  C  CG    . LEU A 1 46  ? -6.326  -19.804 -8.885  1.00 13.84 ? 97  LEU A CG    1 
ATOM   299  C  CD1   . LEU A 1 46  ? -5.778  -18.813 -9.905  1.00 13.79 ? 97  LEU A CD1   1 
ATOM   300  C  CD2   . LEU A 1 46  ? -5.315  -20.924 -8.620  1.00 13.93 ? 97  LEU A CD2   1 
ATOM   301  N  N     . ARG A 1 47  ? -8.572  -19.081 -4.647  1.00 13.98 ? 98  ARG A N     1 
ATOM   302  C  CA    . ARG A 1 47  ? -8.906  -18.400 -3.390  1.00 14.23 ? 98  ARG A CA    1 
ATOM   303  C  C     . ARG A 1 47  ? -8.520  -16.916 -3.370  1.00 14.08 ? 98  ARG A C     1 
ATOM   304  O  O     . ARG A 1 47  ? -8.045  -16.408 -2.352  1.00 14.42 ? 98  ARG A O     1 
ATOM   305  C  CB    . ARG A 1 47  ? -8.277  -19.133 -2.192  1.00 14.45 ? 98  ARG A CB    1 
ATOM   306  C  CG    . ARG A 1 47  ? -9.072  -20.345 -1.692  1.00 15.65 ? 98  ARG A CG    1 
ATOM   307  C  CD    . ARG A 1 47  ? -9.182  -21.411 -2.766  1.00 17.66 ? 98  ARG A CD    1 
ATOM   308  N  NE    . ARG A 1 47  ? -9.189  -22.776 -2.238  1.00 19.59 ? 98  ARG A NE    1 
ATOM   309  C  CZ    . ARG A 1 47  ? -10.273 -23.460 -1.871  1.00 20.53 ? 98  ARG A CZ    1 
ATOM   310  N  NH1   . ARG A 1 47  ? -11.490 -22.920 -1.955  1.00 21.08 ? 98  ARG A NH1   1 
ATOM   311  N  NH2   . ARG A 1 47  ? -10.135 -24.700 -1.411  1.00 20.60 ? 98  ARG A NH2   1 
ATOM   312  N  N     . LEU A 1 48  ? -8.730  -16.222 -4.489  1.00 13.77 ? 99  LEU A N     1 
ATOM   313  C  CA    . LEU A 1 48  ? -8.562  -14.772 -4.525  1.00 13.50 ? 99  LEU A CA    1 
ATOM   314  C  C     . LEU A 1 48  ? -9.664  -14.111 -3.707  1.00 13.12 ? 99  LEU A C     1 
ATOM   315  O  O     . LEU A 1 48  ? -10.716 -14.705 -3.465  1.00 13.04 ? 99  LEU A O     1 
ATOM   316  C  CB    . LEU A 1 48  ? -8.621  -14.235 -5.956  1.00 13.57 ? 99  LEU A CB    1 
ATOM   317  C  CG    . LEU A 1 48  ? -7.639  -14.803 -6.975  1.00 13.79 ? 99  LEU A CG    1 
ATOM   318  C  CD1   . LEU A 1 48  ? -7.749  -14.023 -8.269  1.00 14.40 ? 99  LEU A CD1   1 
ATOM   319  C  CD2   . LEU A 1 48  ? -6.225  -14.763 -6.449  1.00 14.15 ? 99  LEU A CD2   1 
ATOM   320  N  N     . LYS A 1 49  ? -9.418  -12.876 -3.290  1.00 12.78 ? 100 LYS A N     1 
ATOM   321  C  CA    . LYS A 1 49  ? -10.416 -12.104 -2.557  1.00 12.51 ? 100 LYS A CA    1 
ATOM   322  C  C     . LYS A 1 49  ? -11.630 -11.905 -3.459  1.00 12.27 ? 100 LYS A C     1 
ATOM   323  O  O     . LYS A 1 49  ? -11.497 -11.947 -4.678  1.00 12.30 ? 100 LYS A O     1 
ATOM   324  C  CB    . LYS A 1 49  ? -9.845  -10.751 -2.117  1.00 12.38 ? 100 LYS A CB    1 
ATOM   325  C  CG    . LYS A 1 49  ? -8.714  -10.862 -1.097  1.00 12.41 ? 100 LYS A CG    1 
ATOM   326  C  CD    . LYS A 1 49  ? -7.934  -9.563  -0.952  1.00 12.69 ? 100 LYS A CD    1 
ATOM   327  C  CE    . LYS A 1 49  ? -7.010  -9.603  0.262   1.00 12.65 ? 100 LYS A CE    1 
ATOM   328  N  NZ    . LYS A 1 49  ? -6.493  -8.255  0.621   1.00 12.52 ? 100 LYS A NZ    1 
ATOM   329  N  N     . PRO A 1 50  ? -12.819 -11.704 -2.866  1.00 12.01 ? 101 PRO A N     1 
ATOM   330  C  CA    . PRO A 1 50  ? -14.047 -11.557 -3.644  1.00 11.72 ? 101 PRO A CA    1 
ATOM   331  C  C     . PRO A 1 50  ? -14.016 -10.423 -4.664  1.00 11.42 ? 101 PRO A C     1 
ATOM   332  O  O     . PRO A 1 50  ? -14.502 -10.596 -5.778  1.00 11.38 ? 101 PRO A O     1 
ATOM   333  C  CB    . PRO A 1 50  ? -15.105 -11.273 -2.569  1.00 11.85 ? 101 PRO A CB    1 
ATOM   334  C  CG    . PRO A 1 50  ? -14.569 -11.881 -1.335  1.00 11.70 ? 101 PRO A CG    1 
ATOM   335  C  CD    . PRO A 1 50  ? -13.092 -11.675 -1.415  1.00 12.10 ? 101 PRO A CD    1 
ATOM   336  N  N     . GLN A 1 51  ? -13.442 -9.282  -4.287  1.00 11.15 ? 102 GLN A N     1 
ATOM   337  C  CA    . GLN A 1 51  ? -13.380 -8.115  -5.175  1.00 10.97 ? 102 GLN A CA    1 
ATOM   338  C  C     . GLN A 1 51  ? -12.444 -8.361  -6.349  1.00 10.67 ? 102 GLN A C     1 
ATOM   339  O  O     . GLN A 1 51  ? -12.589 -7.764  -7.417  1.00 10.68 ? 102 GLN A O     1 
ATOM   340  C  CB    . GLN A 1 51  ? -12.920 -6.870  -4.414  1.00 11.03 ? 102 GLN A CB    1 
ATOM   341  C  CG    . GLN A 1 51  ? -13.905 -6.372  -3.364  1.00 11.47 ? 102 GLN A CG    1 
ATOM   342  C  CD    . GLN A 1 51  ? -13.814 -7.120  -2.043  1.00 12.73 ? 102 GLN A CD    1 
ATOM   343  O  OE1   . GLN A 1 51  ? -13.030 -8.064  -1.891  1.00 13.55 ? 102 GLN A OE1   1 
ATOM   344  N  NE2   . GLN A 1 51  ? -14.624 -6.701  -1.078  1.00 13.49 ? 102 GLN A NE2   1 
ATOM   345  N  N     . LEU A 1 52  ? -11.478 -9.243  -6.137  1.00 10.48 ? 103 LEU A N     1 
ATOM   346  C  CA    . LEU A 1 52  ? -10.497 -9.564  -7.154  1.00 10.35 ? 103 LEU A CA    1 
ATOM   347  C  C     . LEU A 1 52  ? -10.981 -10.684 -8.058  1.00 9.98  ? 103 LEU A C     1 
ATOM   348  O  O     . LEU A 1 52  ? -10.435 -10.886 -9.132  1.00 10.55 ? 103 LEU A O     1 
ATOM   349  C  CB    . LEU A 1 52  ? -9.159  -9.918  -6.493  1.00 10.39 ? 103 LEU A CB    1 
ATOM   350  C  CG    . LEU A 1 52  ? -8.525  -8.695  -5.822  1.00 10.35 ? 103 LEU A CG    1 
ATOM   351  C  CD1   . LEU A 1 52  ? -7.299  -9.064  -5.011  1.00 10.04 ? 103 LEU A CD1   1 
ATOM   352  C  CD2   . LEU A 1 52  ? -8.186  -7.648  -6.874  1.00 10.20 ? 103 LEU A CD2   1 
ATOM   353  N  N     . LEU A 1 53  ? -12.003 -11.404 -7.621  1.00 9.40  ? 104 LEU A N     1 
ATOM   354  C  CA    . LEU A 1 53  ? -12.616 -12.462 -8.413  1.00 9.12  ? 104 LEU A CA    1 
ATOM   355  C  C     . LEU A 1 53  ? -13.699 -11.832 -9.309  1.00 9.01  ? 104 LEU A C     1 
ATOM   356  O  O     . LEU A 1 53  ? -13.903 -12.231 -10.458 1.00 8.91  ? 104 LEU A O     1 
ATOM   357  C  CB    . LEU A 1 53  ? -13.210 -13.509 -7.467  1.00 8.85  ? 104 LEU A CB    1 
ATOM   358  C  CG    . LEU A 1 53  ? -13.378 -14.945 -7.941  1.00 9.33  ? 104 LEU A CG    1 
ATOM   359  C  CD1   . LEU A 1 53  ? -12.079 -15.503 -8.531  1.00 9.30  ? 104 LEU A CD1   1 
ATOM   360  C  CD2   . LEU A 1 53  ? -13.865 -15.806 -6.771  1.00 8.92  ? 104 LEU A CD2   1 
ATOM   361  N  N     . GLN A 1 54  ? -14.388 -10.837 -8.761  1.00 8.68  ? 105 GLN A N     1 
ATOM   362  C  CA    . GLN A 1 54  ? -15.333 -10.019 -9.516  1.00 8.40  ? 105 GLN A CA    1 
ATOM   363  C  C     . GLN A 1 54  ? -14.620 -9.242  -10.628 1.00 8.39  ? 105 GLN A C     1 
ATOM   364  O  O     . GLN A 1 54  ? -15.092 -9.189  -11.766 1.00 8.10  ? 105 GLN A O     1 
ATOM   365  C  CB    . GLN A 1 54  ? -16.034 -9.041  -8.565  1.00 8.32  ? 105 GLN A CB    1 
ATOM   366  C  CG    . GLN A 1 54  ? -17.019 -9.711  -7.607  1.00 7.44  ? 105 GLN A CG    1 
ATOM   367  C  CD    . GLN A 1 54  ? -17.361 -8.865  -6.395  1.00 5.67  ? 105 GLN A CD    1 
ATOM   368  O  OE1   . GLN A 1 54  ? -16.788 -7.802  -6.177  1.00 5.92  ? 105 GLN A OE1   1 
ATOM   369  N  NE2   . GLN A 1 54  ? -18.302 -9.340  -5.601  1.00 4.14  ? 105 GLN A NE2   1 
ATOM   370  N  N     . GLY A 1 55  ? -13.484 -8.638  -10.280 1.00 8.36  ? 106 GLY A N     1 
ATOM   371  C  CA    . GLY A 1 55  ? -12.625 -7.958  -11.250 1.00 8.16  ? 106 GLY A CA    1 
ATOM   372  C  C     . GLY A 1 55  ? -12.199 -8.871  -12.375 1.00 7.94  ? 106 GLY A C     1 
ATOM   373  O  O     . GLY A 1 55  ? -12.166 -8.454  -13.533 1.00 8.01  ? 106 GLY A O     1 
ATOM   374  N  N     . VAL A 1 56  ? -11.890 -10.121 -12.027 1.00 7.72  ? 107 VAL A N     1 
ATOM   375  C  CA    . VAL A 1 56  ? -11.443 -11.117 -13.002 1.00 7.56  ? 107 VAL A CA    1 
ATOM   376  C  C     . VAL A 1 56  ? -12.550 -11.455 -13.988 1.00 7.59  ? 107 VAL A C     1 
ATOM   377  O  O     . VAL A 1 56  ? -12.387 -11.284 -15.197 1.00 7.70  ? 107 VAL A O     1 
ATOM   378  C  CB    . VAL A 1 56  ? -10.937 -12.409 -12.316 1.00 7.41  ? 107 VAL A CB    1 
ATOM   379  C  CG1   . VAL A 1 56  ? -10.969 -13.594 -13.282 1.00 7.12  ? 107 VAL A CG1   1 
ATOM   380  C  CG2   . VAL A 1 56  ? -9.530  -12.201 -11.774 1.00 6.94  ? 107 VAL A CG2   1 
ATOM   381  N  N     . TYR A 1 57  ? -13.671 -11.933 -13.459 1.00 7.76  ? 108 TYR A N     1 
ATOM   382  C  CA    . TYR A 1 57  ? -14.823 -12.284 -14.276 1.00 7.95  ? 108 TYR A CA    1 
ATOM   383  C  C     . TYR A 1 57  ? -15.376 -11.092 -15.060 1.00 8.10  ? 108 TYR A C     1 
ATOM   384  O  O     . TYR A 1 57  ? -15.808 -11.253 -16.205 1.00 7.83  ? 108 TYR A O     1 
ATOM   385  C  CB    . TYR A 1 57  ? -15.918 -12.898 -13.412 1.00 7.95  ? 108 TYR A CB    1 
ATOM   386  C  CG    . TYR A 1 57  ? -15.587 -14.280 -12.898 1.00 8.61  ? 108 TYR A CG    1 
ATOM   387  C  CD1   . TYR A 1 57  ? -15.157 -15.284 -13.770 1.00 9.52  ? 108 TYR A CD1   1 
ATOM   388  C  CD2   . TYR A 1 57  ? -15.731 -14.600 -11.548 1.00 8.45  ? 108 TYR A CD2   1 
ATOM   389  C  CE1   . TYR A 1 57  ? -14.860 -16.557 -13.312 1.00 9.32  ? 108 TYR A CE1   1 
ATOM   390  C  CE2   . TYR A 1 57  ? -15.439 -15.869 -11.080 1.00 8.95  ? 108 TYR A CE2   1 
ATOM   391  C  CZ    . TYR A 1 57  ? -15.003 -16.841 -11.972 1.00 9.63  ? 108 TYR A CZ    1 
ATOM   392  O  OH    . TYR A 1 57  ? -14.716 -18.104 -11.531 1.00 10.52 ? 108 TYR A OH    1 
ATOM   393  N  N     . ALA A 1 58  ? -15.338 -9.902  -14.454 1.00 8.41  ? 109 ALA A N     1 
ATOM   394  C  CA    . ALA A 1 58  ? -15.757 -8.661  -15.125 1.00 8.58  ? 109 ALA A CA    1 
ATOM   395  C  C     . ALA A 1 58  ? -15.009 -8.415  -16.431 1.00 8.88  ? 109 ALA A C     1 
ATOM   396  O  O     . ALA A 1 58  ? -15.549 -7.799  -17.339 1.00 8.92  ? 109 ALA A O     1 
ATOM   397  C  CB    . ALA A 1 58  ? -15.589 -7.476  -14.208 1.00 8.32  ? 109 ALA A CB    1 
ATOM   398  N  N     . MET A 1 59  ? -13.776 -8.907  -16.528 1.00 9.35  ? 110 MET A N     1 
ATOM   399  C  CA    . MET A 1 59  ? -13.005 -8.818  -17.770 1.00 9.88  ? 110 MET A CA    1 
ATOM   400  C  C     . MET A 1 59  ? -13.339 -9.926  -18.768 1.00 9.87  ? 110 MET A C     1 
ATOM   401  O  O     . MET A 1 59  ? -12.748 -9.987  -19.850 1.00 9.67  ? 110 MET A O     1 
ATOM   402  C  CB    . MET A 1 59  ? -11.506 -8.872  -17.473 1.00 10.04 ? 110 MET A CB    1 
ATOM   403  C  CG    . MET A 1 59  ? -11.047 -7.789  -16.564 1.00 11.19 ? 110 MET A CG    1 
ATOM   404  S  SD    . MET A 1 59  ? -9.396  -7.232  -16.960 1.00 14.02 ? 110 MET A SD    1 
ATOM   405  C  CE    . MET A 1 59  ? -9.225  -5.975  -15.717 1.00 14.29 ? 110 MET A CE    1 
ATOM   406  N  N     . GLY A 1 60  ? -14.264 -10.807 -18.411 1.00 10.03 ? 111 GLY A N     1 
ATOM   407  C  CA    . GLY A 1 60  ? -14.632 -11.918 -19.287 1.00 10.29 ? 111 GLY A CA    1 
ATOM   408  C  C     . GLY A 1 60  ? -13.687 -13.107 -19.222 1.00 10.46 ? 111 GLY A C     1 
ATOM   409  O  O     . GLY A 1 60  ? -13.808 -14.029 -20.025 1.00 10.32 ? 111 GLY A O     1 
ATOM   410  N  N     . PHE A 1 61  ? -12.751 -13.095 -18.267 1.00 10.76 ? 112 PHE A N     1 
ATOM   411  C  CA    . PHE A 1 61  ? -11.864 -14.238 -18.031 1.00 10.78 ? 112 PHE A CA    1 
ATOM   412  C  C     . PHE A 1 61  ? -12.705 -15.398 -17.507 1.00 10.86 ? 112 PHE A C     1 
ATOM   413  O  O     . PHE A 1 61  ? -13.500 -15.212 -16.589 1.00 10.93 ? 112 PHE A O     1 
ATOM   414  C  CB    . PHE A 1 61  ? -10.800 -13.881 -16.987 1.00 10.89 ? 112 PHE A CB    1 
ATOM   415  C  CG    . PHE A 1 61  ? -9.772  -12.862 -17.451 1.00 11.04 ? 112 PHE A CG    1 
ATOM   416  C  CD1   . PHE A 1 61  ? -9.944  -12.113 -18.622 1.00 11.43 ? 112 PHE A CD1   1 
ATOM   417  C  CD2   . PHE A 1 61  ? -8.643  -12.632 -16.687 1.00 10.05 ? 112 PHE A CD2   1 
ATOM   418  C  CE1   . PHE A 1 61  ? -8.996  -11.182 -19.023 1.00 10.83 ? 112 PHE A CE1   1 
ATOM   419  C  CE2   . PHE A 1 61  ? -7.699  -11.696 -17.084 1.00 10.89 ? 112 PHE A CE2   1 
ATOM   420  C  CZ    . PHE A 1 61  ? -7.878  -10.971 -18.255 1.00 10.90 ? 112 PHE A CZ    1 
ATOM   421  N  N     . ASN A 1 62  ? -12.542 -16.585 -18.082 1.00 10.88 ? 113 ASN A N     1 
ATOM   422  C  CA    . ASN A 1 62  ? -13.308 -17.761 -17.647 1.00 10.95 ? 113 ASN A CA    1 
ATOM   423  C  C     . ASN A 1 62  ? -12.512 -18.724 -16.765 1.00 11.00 ? 113 ASN A C     1 
ATOM   424  O  O     . ASN A 1 62  ? -13.045 -19.278 -15.795 1.00 10.86 ? 113 ASN A O     1 
ATOM   425  C  CB    . ASN A 1 62  ? -13.854 -18.518 -18.865 1.00 10.97 ? 113 ASN A CB    1 
ATOM   426  C  CG    . ASN A 1 62  ? -15.111 -17.885 -19.434 1.00 11.21 ? 113 ASN A CG    1 
ATOM   427  O  OD1   . ASN A 1 62  ? -16.200 -18.034 -18.876 1.00 12.22 ? 113 ASN A OD1   1 
ATOM   428  N  ND2   . ASN A 1 62  ? -14.970 -17.185 -20.550 1.00 11.08 ? 113 ASN A ND2   1 
ATOM   429  N  N     . ARG A 1 63  ? -11.244 -18.927 -17.116 1.00 11.13 ? 114 ARG A N     1 
ATOM   430  C  CA    . ARG A 1 63  ? -10.409 -19.957 -16.501 1.00 11.43 ? 114 ARG A CA    1 
ATOM   431  C  C     . ARG A 1 63  ? -8.958  -19.500 -16.478 1.00 11.27 ? 114 ARG A C     1 
ATOM   432  O  O     . ARG A 1 63  ? -8.484  -18.912 -17.445 1.00 11.45 ? 114 ARG A O     1 
ATOM   433  C  CB    . ARG A 1 63  ? -10.492 -21.242 -17.321 1.00 11.72 ? 114 ARG A CB    1 
ATOM   434  C  CG    . ARG A 1 63  ? -11.821 -21.998 -17.230 1.00 13.21 ? 114 ARG A CG    1 
ATOM   435  C  CD    . ARG A 1 63  ? -11.965 -22.785 -15.922 1.00 15.07 ? 114 ARG A CD    1 
ATOM   436  N  NE    . ARG A 1 63  ? -10.935 -23.822 -15.790 1.00 16.71 ? 114 ARG A NE    1 
ATOM   437  C  CZ    . ARG A 1 63  ? -10.988 -24.853 -14.945 1.00 17.94 ? 114 ARG A CZ    1 
ATOM   438  N  NH1   . ARG A 1 63  ? -12.033 -25.044 -14.138 1.00 18.66 ? 114 ARG A NH1   1 
ATOM   439  N  NH2   . ARG A 1 63  ? -9.983  -25.716 -14.919 1.00 18.11 ? 114 ARG A NH2   1 
ATOM   440  N  N     . PRO A 1 64  ? -8.231  -19.780 -15.390 1.00 11.24 ? 115 PRO A N     1 
ATOM   441  C  CA    . PRO A 1 64  ? -6.839  -19.334 -15.369 1.00 11.11 ? 115 PRO A CA    1 
ATOM   442  C  C     . PRO A 1 64  ? -5.935  -20.090 -16.346 1.00 11.10 ? 115 PRO A C     1 
ATOM   443  O  O     . PRO A 1 64  ? -6.123  -21.283 -16.591 1.00 10.79 ? 115 PRO A O     1 
ATOM   444  C  CB    . PRO A 1 64  ? -6.409  -19.599 -13.925 1.00 11.12 ? 115 PRO A CB    1 
ATOM   445  C  CG    . PRO A 1 64  ? -7.308  -20.693 -13.456 1.00 11.10 ? 115 PRO A CG    1 
ATOM   446  C  CD    . PRO A 1 64  ? -8.619  -20.438 -14.131 1.00 11.34 ? 115 PRO A CD    1 
ATOM   447  N  N     . SER A 1 65  ? -4.970  -19.374 -16.907 1.00 11.21 ? 116 SER A N     1 
ATOM   448  C  CA    . SER A 1 65  ? -3.939  -19.978 -17.723 1.00 11.38 ? 116 SER A CA    1 
ATOM   449  C  C     . SER A 1 65  ? -2.937  -20.713 -16.830 1.00 11.35 ? 116 SER A C     1 
ATOM   450  O  O     . SER A 1 65  ? -2.952  -20.561 -15.612 1.00 11.39 ? 116 SER A O     1 
ATOM   451  C  CB    . SER A 1 65  ? -3.225  -18.904 -18.560 1.00 11.65 ? 116 SER A CB    1 
ATOM   452  O  OG    . SER A 1 65  ? -2.627  -17.902 -17.744 1.00 11.89 ? 116 SER A OG    1 
ATOM   453  N  N     . LYS A 1 66  ? -2.073  -21.509 -17.445 1.00 11.34 ? 117 LYS A N     1 
ATOM   454  C  CA    . LYS A 1 66  ? -1.043  -22.232 -16.711 1.00 11.51 ? 117 LYS A CA    1 
ATOM   455  C  C     . LYS A 1 66  ? -0.335  -21.288 -15.727 1.00 11.38 ? 117 LYS A C     1 
ATOM   456  O  O     . LYS A 1 66  ? -0.312  -21.548 -14.526 1.00 11.84 ? 117 LYS A O     1 
ATOM   457  C  CB    . LYS A 1 66  ? -0.024  -22.847 -17.684 1.00 11.62 ? 117 LYS A CB    1 
ATOM   458  C  CG    . LYS A 1 66  ? 0.722   -24.107 -17.196 1.00 12.00 ? 117 LYS A CG    1 
ATOM   459  C  CD    . LYS A 1 66  ? 0.313   -25.365 -18.011 1.00 12.73 ? 117 LYS A CD    1 
ATOM   460  C  CE    . LYS A 1 66  ? 1.515   -26.193 -18.478 1.00 12.77 ? 117 LYS A CE    1 
ATOM   461  N  NZ    . LYS A 1 66  ? 1.231   -26.922 -19.765 1.00 12.27 ? 117 LYS A NZ    1 
ATOM   462  N  N     . ILE A 1 67  ? 0.211   -20.181 -16.223 1.00 11.03 ? 118 ILE A N     1 
ATOM   463  C  CA    . ILE A 1 67  ? 1.082   -19.337 -15.395 1.00 10.87 ? 118 ILE A CA    1 
ATOM   464  C  C     . ILE A 1 67  ? 0.328   -18.712 -14.231 1.00 10.81 ? 118 ILE A C     1 
ATOM   465  O  O     . ILE A 1 67  ? 0.873   -18.565 -13.135 1.00 10.59 ? 118 ILE A O     1 
ATOM   466  C  CB    . ILE A 1 67  ? 1.800   -18.233 -16.224 1.00 10.77 ? 118 ILE A CB    1 
ATOM   467  C  CG1   . ILE A 1 67  ? 2.901   -17.546 -15.390 1.00 11.01 ? 118 ILE A CG1   1 
ATOM   468  C  CG2   . ILE A 1 67  ? 0.807   -17.203 -16.730 1.00 10.29 ? 118 ILE A CG2   1 
ATOM   469  C  CD1   . ILE A 1 67  ? 3.909   -18.491 -14.735 1.00 10.46 ? 118 ILE A CD1   1 
ATOM   470  N  N     . GLN A 1 68  ? -0.932  -18.368 -14.484 1.00 11.00 ? 119 GLN A N     1 
ATOM   471  C  CA    . GLN A 1 68  ? -1.819  -17.788 -13.478 1.00 10.88 ? 119 GLN A CA    1 
ATOM   472  C  C     . GLN A 1 68  ? -2.138  -18.799 -12.383 1.00 11.06 ? 119 GLN A C     1 
ATOM   473  O  O     . GLN A 1 68  ? -2.080  -18.468 -11.196 1.00 10.98 ? 119 GLN A O     1 
ATOM   474  C  CB    . GLN A 1 68  ? -3.107  -17.286 -14.146 1.00 10.90 ? 119 GLN A CB    1 
ATOM   475  C  CG    . GLN A 1 68  ? -2.883  -16.104 -15.103 1.00 10.55 ? 119 GLN A CG    1 
ATOM   476  C  CD    . GLN A 1 68  ? -4.080  -15.804 -15.980 1.00 10.36 ? 119 GLN A CD    1 
ATOM   477  O  OE1   . GLN A 1 68  ? -5.045  -16.573 -16.023 1.00 9.10  ? 119 GLN A OE1   1 
ATOM   478  N  NE2   . GLN A 1 68  ? -4.020  -14.679 -16.697 1.00 9.45  ? 119 GLN A NE2   1 
ATOM   479  N  N     . GLU A 1 69  ? -2.457  -20.028 -12.785 1.00 11.33 ? 120 GLU A N     1 
ATOM   480  C  CA    . GLU A 1 69  ? -2.716  -21.123 -11.835 1.00 11.92 ? 120 GLU A CA    1 
ATOM   481  C  C     . GLU A 1 69  ? -1.546  -21.416 -10.912 1.00 11.75 ? 120 GLU A C     1 
ATOM   482  O  O     . GLU A 1 69  ? -1.735  -21.661 -9.724  1.00 11.37 ? 120 GLU A O     1 
ATOM   483  C  CB    . GLU A 1 69  ? -3.063  -22.424 -12.574 1.00 12.27 ? 120 GLU A CB    1 
ATOM   484  C  CG    . GLU A 1 69  ? -4.503  -22.503 -13.005 1.00 13.47 ? 120 GLU A CG    1 
ATOM   485  C  CD    . GLU A 1 69  ? -4.876  -23.826 -13.613 1.00 14.70 ? 120 GLU A CD    1 
ATOM   486  O  OE1   . GLU A 1 69  ? -3.980  -24.624 -13.963 1.00 15.95 ? 120 GLU A OE1   1 
ATOM   487  O  OE2   . GLU A 1 69  ? -6.092  -24.067 -13.737 1.00 16.09 ? 120 GLU A OE2   1 
ATOM   488  N  N     . ASN A 1 70  ? -0.345  -21.415 -11.477 1.00 11.75 ? 121 ASN A N     1 
ATOM   489  C  CA    . ASN A 1 70  ? 0.849   -21.806 -10.737 1.00 11.95 ? 121 ASN A CA    1 
ATOM   490  C  C     . ASN A 1 70  ? 1.487   -20.652 -9.966  1.00 11.92 ? 121 ASN A C     1 
ATOM   491  O  O     . ASN A 1 70  ? 1.997   -20.856 -8.866  1.00 12.28 ? 121 ASN A O     1 
ATOM   492  C  CB    . ASN A 1 70  ? 1.875   -22.446 -11.682 1.00 12.06 ? 121 ASN A CB    1 
ATOM   493  C  CG    . ASN A 1 70  ? 1.447   -23.826 -12.167 1.00 12.07 ? 121 ASN A CG    1 
ATOM   494  O  OD1   . ASN A 1 70  ? 1.704   -24.828 -11.510 1.00 13.21 ? 121 ASN A OD1   1 
ATOM   495  N  ND2   . ASN A 1 70  ? 0.807   -23.880 -13.326 1.00 12.15 ? 121 ASN A ND2   1 
ATOM   496  N  N     . ALA A 1 71  ? 1.448   -19.446 -10.530 1.00 11.93 ? 122 ALA A N     1 
ATOM   497  C  CA    . ALA A 1 71  ? 2.123   -18.284 -9.931  1.00 11.70 ? 122 ALA A CA    1 
ATOM   498  C  C     . ALA A 1 71  ? 1.371   -17.686 -8.736  1.00 11.72 ? 122 ALA A C     1 
ATOM   499  O  O     . ALA A 1 71  ? 1.988   -17.319 -7.732  1.00 11.86 ? 122 ALA A O     1 
ATOM   500  C  CB    . ALA A 1 71  ? 2.358   -17.214 -10.981 1.00 11.67 ? 122 ALA A CB    1 
ATOM   501  N  N     . LEU A 1 72  ? 0.045   -17.588 -8.835  1.00 11.26 ? 123 LEU A N     1 
ATOM   502  C  CA    . LEU A 1 72  ? -0.733  -16.900 -7.795  1.00 10.76 ? 123 LEU A CA    1 
ATOM   503  C  C     . LEU A 1 72  ? -0.636  -17.559 -6.403  1.00 10.48 ? 123 LEU A C     1 
ATOM   504  O  O     . LEU A 1 72  ? -0.435  -16.866 -5.404  1.00 10.38 ? 123 LEU A O     1 
ATOM   505  C  CB    . LEU A 1 72  ? -2.192  -16.691 -8.245  1.00 10.56 ? 123 LEU A CB    1 
ATOM   506  C  CG    . LEU A 1 72  ? -2.362  -15.495 -9.192  1.00 9.68  ? 123 LEU A CG    1 
ATOM   507  C  CD1   . LEU A 1 72  ? -3.596  -15.616 -10.072 1.00 7.67  ? 123 LEU A CD1   1 
ATOM   508  C  CD2   . LEU A 1 72  ? -2.380  -14.207 -8.392  1.00 8.77  ? 123 LEU A CD2   1 
ATOM   509  N  N     . PRO A 1 73  ? -0.747  -18.894 -6.329  1.00 10.09 ? 124 PRO A N     1 
ATOM   510  C  CA    . PRO A 1 73  ? -0.502  -19.506 -5.023  1.00 9.86  ? 124 PRO A CA    1 
ATOM   511  C  C     . PRO A 1 73  ? 0.878   -19.141 -4.475  1.00 9.59  ? 124 PRO A C     1 
ATOM   512  O  O     . PRO A 1 73  ? 0.985   -18.765 -3.315  1.00 9.93  ? 124 PRO A O     1 
ATOM   513  C  CB    . PRO A 1 73  ? -0.605  -21.013 -5.304  1.00 9.70  ? 124 PRO A CB    1 
ATOM   514  C  CG    . PRO A 1 73  ? -1.426  -21.123 -6.521  1.00 9.96  ? 124 PRO A CG    1 
ATOM   515  C  CD    . PRO A 1 73  ? -1.096  -19.897 -7.346  1.00 10.18 ? 124 PRO A CD    1 
ATOM   516  N  N     . LEU A 1 74  ? 1.909   -19.222 -5.317  1.00 9.30  ? 125 LEU A N     1 
ATOM   517  C  CA    . LEU A 1 74  ? 3.286   -18.895 -4.917  1.00 8.93  ? 125 LEU A CA    1 
ATOM   518  C  C     . LEU A 1 74  ? 3.450   -17.433 -4.508  1.00 8.77  ? 125 LEU A C     1 
ATOM   519  O  O     . LEU A 1 74  ? 4.247   -17.124 -3.624  1.00 8.98  ? 125 LEU A O     1 
ATOM   520  C  CB    . LEU A 1 74  ? 4.277   -19.217 -6.044  1.00 8.71  ? 125 LEU A CB    1 
ATOM   521  C  CG    . LEU A 1 74  ? 4.432   -20.693 -6.423  1.00 8.59  ? 125 LEU A CG    1 
ATOM   522  C  CD1   . LEU A 1 74  ? 5.245   -20.840 -7.711  1.00 7.32  ? 125 LEU A CD1   1 
ATOM   523  C  CD2   . LEU A 1 74  ? 5.058   -21.487 -5.280  1.00 7.66  ? 125 LEU A CD2   1 
ATOM   524  N  N     . MET A 1 75  ? 2.699   -16.545 -5.156  1.00 8.50  ? 126 MET A N     1 
ATOM   525  C  CA    . MET A 1 75  ? 2.782   -15.113 -4.885  1.00 8.32  ? 126 MET A CA    1 
ATOM   526  C  C     . MET A 1 75  ? 1.908   -14.692 -3.701  1.00 8.40  ? 126 MET A C     1 
ATOM   527  O  O     . MET A 1 75  ? 2.271   -13.783 -2.961  1.00 8.55  ? 126 MET A O     1 
ATOM   528  C  CB    . MET A 1 75  ? 2.404   -14.310 -6.133  1.00 8.27  ? 126 MET A CB    1 
ATOM   529  C  CG    . MET A 1 75  ? 3.428   -14.406 -7.258  1.00 7.77  ? 126 MET A CG    1 
ATOM   530  S  SD    . MET A 1 75  ? 3.089   -13.373 -8.700  1.00 7.00  ? 126 MET A SD    1 
ATOM   531  C  CE    . MET A 1 75  ? 1.342   -13.695 -8.976  1.00 6.88  ? 126 MET A CE    1 
ATOM   532  N  N     . LEU A 1 76  ? 0.765   -15.349 -3.523  1.00 8.48  ? 127 LEU A N     1 
ATOM   533  C  CA    . LEU A 1 76  ? -0.130  -15.058 -2.401  1.00 8.43  ? 127 LEU A CA    1 
ATOM   534  C  C     . LEU A 1 76  ? 0.241   -15.817 -1.116  1.00 8.63  ? 127 LEU A C     1 
ATOM   535  O  O     . LEU A 1 76  ? -0.222  -15.453 -0.034  1.00 8.53  ? 127 LEU A O     1 
ATOM   536  C  CB    . LEU A 1 76  ? -1.575  -15.376 -2.782  1.00 8.36  ? 127 LEU A CB    1 
ATOM   537  C  CG    . LEU A 1 76  ? -2.139  -14.605 -3.977  1.00 8.33  ? 127 LEU A CG    1 
ATOM   538  C  CD1   . LEU A 1 76  ? -3.510  -15.149 -4.353  1.00 7.38  ? 127 LEU A CD1   1 
ATOM   539  C  CD2   . LEU A 1 76  ? -2.191  -13.111 -3.688  1.00 7.96  ? 127 LEU A CD2   1 
ATOM   540  N  N     . ALA A 1 77  ? 1.070   -16.856 -1.230  1.00 8.81  ? 128 ALA A N     1 
ATOM   541  C  CA    . ALA A 1 77  ? 1.547   -17.603 -0.058  1.00 9.07  ? 128 ALA A CA    1 
ATOM   542  C  C     . ALA A 1 77  ? 2.115   -16.671 1.024   1.00 9.40  ? 128 ALA A C     1 
ATOM   543  O  O     . ALA A 1 77  ? 2.706   -15.626 0.723   1.00 9.38  ? 128 ALA A O     1 
ATOM   544  C  CB    . ALA A 1 77  ? 2.589   -18.649 -0.466  1.00 8.91  ? 128 ALA A CB    1 
ATOM   545  N  N     . GLU A 1 78  ? 1.922   -17.070 2.280   1.00 9.73  ? 129 GLU A N     1 
ATOM   546  C  CA    . GLU A 1 78  ? 2.269   -16.255 3.433   1.00 10.14 ? 129 GLU A CA    1 
ATOM   547  C  C     . GLU A 1 78  ? 3.248   -17.029 4.309   1.00 10.12 ? 129 GLU A C     1 
ATOM   548  O  O     . GLU A 1 78  ? 3.016   -18.205 4.590   1.00 10.30 ? 129 GLU A O     1 
ATOM   549  C  CB    . GLU A 1 78  ? 1.006   -15.952 4.229   1.00 10.46 ? 129 GLU A CB    1 
ATOM   550  C  CG    . GLU A 1 78  ? 1.156   -14.857 5.272   1.00 11.59 ? 129 GLU A CG    1 
ATOM   551  C  CD    . GLU A 1 78  ? 1.088   -13.465 4.673   1.00 12.92 ? 129 GLU A CD    1 
ATOM   552  O  OE1   . GLU A 1 78  ? 0.175   -13.221 3.841   1.00 11.30 ? 129 GLU A OE1   1 
ATOM   553  O  OE2   . GLU A 1 78  ? 1.947   -12.624 5.052   1.00 13.72 ? 129 GLU A OE2   1 
ATOM   554  N  N     . PRO A 1 79  ? 4.342   -16.383 4.753   1.00 10.13 ? 130 PRO A N     1 
ATOM   555  C  CA    . PRO A 1 79  ? 4.714   -14.987 4.532   1.00 10.14 ? 130 PRO A CA    1 
ATOM   556  C  C     . PRO A 1 79  ? 5.270   -14.820 3.130   1.00 9.79  ? 130 PRO A C     1 
ATOM   557  O  O     . PRO A 1 79  ? 5.662   -15.815 2.532   1.00 9.84  ? 130 PRO A O     1 
ATOM   558  C  CB    . PRO A 1 79  ? 5.808   -14.758 5.569   1.00 10.35 ? 130 PRO A CB    1 
ATOM   559  C  CG    . PRO A 1 79  ? 6.491   -16.091 5.669   1.00 10.47 ? 130 PRO A CG    1 
ATOM   560  C  CD    . PRO A 1 79  ? 5.424   -17.133 5.419   1.00 10.17 ? 130 PRO A CD    1 
ATOM   561  N  N     . PRO A 1 80  ? 5.309   -13.580 2.606   1.00 9.54  ? 131 PRO A N     1 
ATOM   562  C  CA    . PRO A 1 80  ? 5.685   -13.368 1.198   1.00 9.44  ? 131 PRO A CA    1 
ATOM   563  C  C     . PRO A 1 80  ? 7.024   -13.988 0.784   1.00 9.53  ? 131 PRO A C     1 
ATOM   564  O  O     . PRO A 1 80  ? 7.971   -14.029 1.573   1.00 9.61  ? 131 PRO A O     1 
ATOM   565  C  CB    . PRO A 1 80  ? 5.738   -11.840 1.071   1.00 9.26  ? 131 PRO A CB    1 
ATOM   566  C  CG    . PRO A 1 80  ? 4.830   -11.344 2.121   1.00 9.23  ? 131 PRO A CG    1 
ATOM   567  C  CD    . PRO A 1 80  ? 4.928   -12.317 3.263   1.00 9.45  ? 131 PRO A CD    1 
ATOM   568  N  N     . GLN A 1 81  ? 7.072   -14.484 -0.447  1.00 9.63  ? 132 GLN A N     1 
ATOM   569  C  CA    . GLN A 1 81  ? 8.305   -14.951 -1.070  1.00 9.47  ? 132 GLN A CA    1 
ATOM   570  C  C     . GLN A 1 81  ? 8.449   -14.323 -2.462  1.00 9.15  ? 132 GLN A C     1 
ATOM   571  O  O     . GLN A 1 81  ? 7.463   -14.161 -3.183  1.00 9.25  ? 132 GLN A O     1 
ATOM   572  C  CB    . GLN A 1 81  ? 8.312   -16.481 -1.171  1.00 9.49  ? 132 GLN A CB    1 
ATOM   573  C  CG    . GLN A 1 81  ? 9.551   -17.029 -1.903  1.00 10.96 ? 132 GLN A CG    1 
ATOM   574  C  CD    . GLN A 1 81  ? 10.118  -18.308 -1.296  1.00 12.44 ? 132 GLN A CD    1 
ATOM   575  O  OE1   . GLN A 1 81  ? 9.375   -19.228 -0.937  1.00 13.02 ? 132 GLN A OE1   1 
ATOM   576  N  NE2   . GLN A 1 81  ? 11.451  -18.374 -1.196  1.00 12.64 ? 132 GLN A NE2   1 
ATOM   577  N  N     . ASN A 1 82  ? 9.675   -13.968 -2.836  1.00 8.73  ? 133 ASN A N     1 
ATOM   578  C  CA    . ASN A 1 82  ? 9.945   -13.430 -4.169  1.00 8.17  ? 133 ASN A CA    1 
ATOM   579  C  C     . ASN A 1 82  ? 9.754   -14.500 -5.235  1.00 7.71  ? 133 ASN A C     1 
ATOM   580  O  O     . ASN A 1 82  ? 9.822   -15.683 -4.938  1.00 7.68  ? 133 ASN A O     1 
ATOM   581  C  CB    . ASN A 1 82  ? 11.373  -12.887 -4.254  1.00 8.16  ? 133 ASN A CB    1 
ATOM   582  C  CG    . ASN A 1 82  ? 11.631  -11.763 -3.281  1.00 7.60  ? 133 ASN A CG    1 
ATOM   583  O  OD1   . ASN A 1 82  ? 10.713  -11.252 -2.653  1.00 6.40  ? 133 ASN A OD1   1 
ATOM   584  N  ND2   . ASN A 1 82  ? 12.893  -11.367 -3.154  1.00 8.26  ? 133 ASN A ND2   1 
ATOM   585  N  N     . LEU A 1 83  ? 9.529   -14.072 -6.474  1.00 7.37  ? 134 LEU A N     1 
ATOM   586  C  CA    . LEU A 1 83  ? 9.292   -14.989 -7.592  1.00 6.98  ? 134 LEU A CA    1 
ATOM   587  C  C     . LEU A 1 83  ? 9.882   -14.472 -8.914  1.00 6.97  ? 134 LEU A C     1 
ATOM   588  O  O     . LEU A 1 83  ? 9.670   -13.322 -9.308  1.00 6.93  ? 134 LEU A O     1 
ATOM   589  C  CB    . LEU A 1 83  ? 7.796   -15.230 -7.766  1.00 6.69  ? 134 LEU A CB    1 
ATOM   590  C  CG    . LEU A 1 83  ? 7.411   -16.184 -8.900  1.00 7.02  ? 134 LEU A CG    1 
ATOM   591  C  CD1   . LEU A 1 83  ? 7.743   -17.626 -8.517  1.00 6.36  ? 134 LEU A CD1   1 
ATOM   592  C  CD2   . LEU A 1 83  ? 5.938   -16.034 -9.265  1.00 5.80  ? 134 LEU A CD2   1 
ATOM   593  N  N     . ILE A 1 84  ? 10.627  -15.341 -9.588  1.00 6.99  ? 135 ILE A N     1 
ATOM   594  C  CA    . ILE A 1 84  ? 11.109  -15.097 -10.943 1.00 6.90  ? 135 ILE A CA    1 
ATOM   595  C  C     . ILE A 1 84  ? 10.430  -16.135 -11.833 1.00 6.82  ? 135 ILE A C     1 
ATOM   596  O  O     . ILE A 1 84  ? 10.671  -17.337 -11.685 1.00 7.05  ? 135 ILE A O     1 
ATOM   597  C  CB    . ILE A 1 84  ? 12.631  -15.243 -11.023 1.00 6.84  ? 135 ILE A CB    1 
ATOM   598  C  CG1   . ILE A 1 84  ? 13.300  -14.409 -9.915  1.00 7.02  ? 135 ILE A CG1   1 
ATOM   599  C  CG2   . ILE A 1 84  ? 13.125  -14.818 -12.403 1.00 6.60  ? 135 ILE A CG2   1 
ATOM   600  C  CD1   . ILE A 1 84  ? 14.729  -14.831 -9.585  1.00 7.04  ? 135 ILE A CD1   1 
ATOM   601  N  N     . ALA A 1 85  ? 9.564   -15.673 -12.733 1.00 6.61  ? 136 ALA A N     1 
ATOM   602  C  CA    . ALA A 1 85  ? 8.661   -16.567 -13.457 1.00 6.55  ? 136 ALA A CA    1 
ATOM   603  C  C     . ALA A 1 85  ? 8.670   -16.304 -14.954 1.00 6.64  ? 136 ALA A C     1 
ATOM   604  O  O     . ALA A 1 85  ? 8.685   -15.154 -15.396 1.00 7.07  ? 136 ALA A O     1 
ATOM   605  C  CB    . ALA A 1 85  ? 7.255   -16.427 -12.916 1.00 6.39  ? 136 ALA A CB    1 
ATOM   606  N  N     . GLN A 1 86  ? 8.631   -17.383 -15.727 1.00 6.64  ? 137 GLN A N     1 
ATOM   607  C  CA    . GLN A 1 86  ? 8.610   -17.305 -17.180 1.00 6.54  ? 137 GLN A CA    1 
ATOM   608  C  C     . GLN A 1 86  ? 7.374   -17.991 -17.760 1.00 6.58  ? 137 GLN A C     1 
ATOM   609  O  O     . GLN A 1 86  ? 7.095   -19.145 -17.429 1.00 6.78  ? 137 GLN A O     1 
ATOM   610  C  CB    . GLN A 1 86  ? 9.845   -18.002 -17.749 1.00 6.43  ? 137 GLN A CB    1 
ATOM   611  C  CG    . GLN A 1 86  ? 9.827   -18.111 -19.265 1.00 5.92  ? 137 GLN A CG    1 
ATOM   612  C  CD    . GLN A 1 86  ? 11.064  -18.746 -19.827 1.00 4.29  ? 137 GLN A CD    1 
ATOM   613  O  OE1   . GLN A 1 86  ? 11.730  -19.531 -19.159 1.00 4.48  ? 137 GLN A OE1   1 
ATOM   614  N  NE2   . GLN A 1 86  ? 11.380  -18.415 -21.070 1.00 3.15  ? 137 GLN A NE2   1 
ATOM   615  N  N     . SER A 1 87  ? 6.661   -17.287 -18.638 1.00 6.31  ? 138 SER A N     1 
ATOM   616  C  CA    . SER A 1 87  ? 5.628   -17.897 -19.481 1.00 6.26  ? 138 SER A CA    1 
ATOM   617  C  C     . SER A 1 87  ? 5.548   -17.220 -20.852 1.00 6.17  ? 138 SER A C     1 
ATOM   618  O  O     . SER A 1 87  ? 5.872   -16.037 -20.995 1.00 5.52  ? 138 SER A O     1 
ATOM   619  C  CB    . SER A 1 87  ? 4.257   -17.851 -18.809 1.00 6.28  ? 138 SER A CB    1 
ATOM   620  O  OG    . SER A 1 87  ? 3.251   -18.290 -19.710 1.00 6.38  ? 138 SER A OG    1 
ATOM   621  N  N     . GLN A 1 88  ? 5.060   -17.982 -21.834 1.00 6.07  ? 139 GLN A N     1 
ATOM   622  C  CA    . GLN A 1 88  ? 5.115   -17.611 -23.257 1.00 5.90  ? 139 GLN A CA    1 
ATOM   623  C  C     . GLN A 1 88  ? 4.351   -16.316 -23.596 1.00 6.12  ? 139 GLN A C     1 
ATOM   624  O  O     . GLN A 1 88  ? 3.626   -15.754 -22.759 1.00 6.39  ? 139 GLN A O     1 
ATOM   625  C  CB    . GLN A 1 88  ? 4.575   -18.769 -24.136 1.00 5.83  ? 139 GLN A CB    1 
ATOM   626  C  CG    . GLN A 1 88  ? 5.325   -20.123 -24.054 1.00 4.63  ? 139 GLN A CG    1 
ATOM   627  C  CD    . GLN A 1 88  ? 4.776   -21.065 -22.984 1.00 4.12  ? 139 GLN A CD    1 
ATOM   628  O  OE1   . GLN A 1 88  ? 4.030   -20.656 -22.104 1.00 5.21  ? 139 GLN A OE1   1 
ATOM   629  N  NE2   . GLN A 1 88  ? 5.157   -22.325 -23.054 1.00 3.50  ? 139 GLN A NE2   1 
ATOM   630  N  N     . SER A 1 89  ? 4.499   -15.855 -24.835 1.00 6.13  ? 140 SER A N     1 
ATOM   631  C  CA    . SER A 1 89  ? 3.714   -14.717 -25.322 1.00 6.39  ? 140 SER A CA    1 
ATOM   632  C  C     . SER A 1 89  ? 2.200   -14.948 -25.139 1.00 6.51  ? 140 SER A C     1 
ATOM   633  O  O     . SER A 1 89  ? 1.709   -16.076 -25.277 1.00 6.53  ? 140 SER A O     1 
ATOM   634  C  CB    . SER A 1 89  ? 4.009   -14.431 -26.802 1.00 6.31  ? 140 SER A CB    1 
ATOM   635  O  OG    . SER A 1 89  ? 5.378   -14.632 -27.127 1.00 6.67  ? 140 SER A OG    1 
ATOM   636  N  N     . GLY A 1 90  ? 1.483   -13.859 -24.852 1.00 6.66  ? 141 GLY A N     1 
ATOM   637  C  CA    . GLY A 1 90  ? 0.027   -13.840 -24.662 1.00 6.74  ? 141 GLY A CA    1 
ATOM   638  C  C     . GLY A 1 90  ? -0.598  -14.923 -23.794 1.00 6.93  ? 141 GLY A C     1 
ATOM   639  O  O     . GLY A 1 90  ? -1.637  -15.467 -24.161 1.00 6.95  ? 141 GLY A O     1 
ATOM   640  N  N     . THR A 1 91  ? 0.024   -15.226 -22.650 1.00 6.93  ? 142 THR A N     1 
ATOM   641  C  CA    . THR A 1 91  ? -0.451  -16.282 -21.741 1.00 6.78  ? 142 THR A CA    1 
ATOM   642  C  C     . THR A 1 91  ? -1.008  -15.725 -20.425 1.00 7.04  ? 142 THR A C     1 
ATOM   643  O  O     . THR A 1 91  ? -1.348  -16.486 -19.515 1.00 7.25  ? 142 THR A O     1 
ATOM   644  C  CB    . THR A 1 91  ? 0.668   -17.309 -21.428 1.00 6.63  ? 142 THR A CB    1 
ATOM   645  O  OG1   . THR A 1 91  ? 1.801   -16.637 -20.869 1.00 6.45  ? 142 THR A OG1   1 
ATOM   646  C  CG2   . THR A 1 91  ? 1.099   -18.036 -22.686 1.00 6.67  ? 142 THR A CG2   1 
ATOM   647  N  N     . GLY A 1 92  ? -1.104  -14.403 -20.321 1.00 7.24  ? 143 GLY A N     1 
ATOM   648  C  CA    . GLY A 1 92  ? -1.787  -13.765 -19.196 1.00 7.47  ? 143 GLY A CA    1 
ATOM   649  C  C     . GLY A 1 92  ? -0.950  -13.462 -17.969 1.00 7.60  ? 143 GLY A C     1 
ATOM   650  O  O     . GLY A 1 92  ? -1.451  -13.548 -16.849 1.00 7.70  ? 143 GLY A O     1 
ATOM   651  N  N     . LYS A 1 93  ? 0.315   -13.100 -18.170 1.00 8.08  ? 144 LYS A N     1 
ATOM   652  C  CA    . LYS A 1 93  ? 1.219   -12.775 -17.055 1.00 8.28  ? 144 LYS A CA    1 
ATOM   653  C  C     . LYS A 1 93  ? 0.839   -11.467 -16.360 1.00 8.45  ? 144 LYS A C     1 
ATOM   654  O  O     . LYS A 1 93  ? 1.039   -11.338 -15.157 1.00 8.43  ? 144 LYS A O     1 
ATOM   655  C  CB    . LYS A 1 93  ? 2.681   -12.722 -17.517 1.00 8.12  ? 144 LYS A CB    1 
ATOM   656  C  CG    . LYS A 1 93  ? 3.195   -14.041 -18.105 1.00 8.13  ? 144 LYS A CG    1 
ATOM   657  C  CD    . LYS A 1 93  ? 4.684   -13.971 -18.520 1.00 7.62  ? 144 LYS A CD    1 
ATOM   658  C  CE    . LYS A 1 93  ? 4.930   -13.112 -19.763 1.00 6.96  ? 144 LYS A CE    1 
ATOM   659  N  NZ    . LYS A 1 93  ? 4.260   -13.625 -20.999 1.00 6.24  ? 144 LYS A NZ    1 
ATOM   660  N  N     . THR A 1 94  ? 0.289   -10.509 -17.108 1.00 8.86  ? 145 THR A N     1 
ATOM   661  C  CA    . THR A 1 94  ? -0.160  -9.238  -16.525 1.00 9.18  ? 145 THR A CA    1 
ATOM   662  C  C     . THR A 1 94  ? -1.210  -9.458  -15.442 1.00 9.65  ? 145 THR A C     1 
ATOM   663  O  O     . THR A 1 94  ? -1.046  -9.007  -14.308 1.00 9.86  ? 145 THR A O     1 
ATOM   664  C  CB    . THR A 1 94  ? -0.758  -8.296  -17.569 1.00 9.02  ? 145 THR A CB    1 
ATOM   665  O  OG1   . THR A 1 94  ? -0.034  -8.410  -18.795 1.00 9.24  ? 145 THR A OG1   1 
ATOM   666  C  CG2   . THR A 1 94  ? -0.707  -6.858  -17.064 1.00 8.96  ? 145 THR A CG2   1 
ATOM   667  N  N     . ALA A 1 95  ? -2.282  -10.165 -15.796 1.00 10.16 ? 146 ALA A N     1 
ATOM   668  C  CA    . ALA A 1 95  ? -3.330  -10.508 -14.837 1.00 10.46 ? 146 ALA A CA    1 
ATOM   669  C  C     . ALA A 1 95  ? -2.719  -11.235 -13.647 1.00 10.82 ? 146 ALA A C     1 
ATOM   670  O  O     . ALA A 1 95  ? -3.125  -11.003 -12.506 1.00 10.80 ? 146 ALA A O     1 
ATOM   671  C  CB    . ALA A 1 95  ? -4.417  -11.351 -15.488 1.00 10.17 ? 146 ALA A CB    1 
ATOM   672  N  N     . ALA A 1 96  ? -1.718  -12.077 -13.917 1.00 11.21 ? 147 ALA A N     1 
ATOM   673  C  CA    . ALA A 1 96  ? -1.015  -12.815 -12.864 1.00 11.46 ? 147 ALA A CA    1 
ATOM   674  C  C     . ALA A 1 96  ? -0.378  -11.891 -11.831 1.00 11.74 ? 147 ALA A C     1 
ATOM   675  O  O     . ALA A 1 96  ? -0.659  -12.032 -10.648 1.00 12.31 ? 147 ALA A O     1 
ATOM   676  C  CB    . ALA A 1 96  ? 0.027   -13.734 -13.451 1.00 11.39 ? 147 ALA A CB    1 
ATOM   677  N  N     . PHE A 1 97  ? 0.459   -10.945 -12.249 1.00 11.82 ? 148 PHE A N     1 
ATOM   678  C  CA    . PHE A 1 97  ? 1.094   -10.045 -11.258 1.00 12.03 ? 148 PHE A CA    1 
ATOM   679  C  C     . PHE A 1 97  ? 0.198   -8.884  -10.777 1.00 11.75 ? 148 PHE A C     1 
ATOM   680  O  O     . PHE A 1 97  ? 0.335   -8.448  -9.643  1.00 11.68 ? 148 PHE A O     1 
ATOM   681  C  CB    . PHE A 1 97  ? 2.511   -9.569  -11.681 1.00 11.97 ? 148 PHE A CB    1 
ATOM   682  C  CG    . PHE A 1 97  ? 2.558   -8.691  -12.917 1.00 12.45 ? 148 PHE A CG    1 
ATOM   683  C  CD1   . PHE A 1 97  ? 2.283   -7.330  -12.838 1.00 13.22 ? 148 PHE A CD1   1 
ATOM   684  C  CD2   . PHE A 1 97  ? 2.950   -9.215  -14.140 1.00 12.65 ? 148 PHE A CD2   1 
ATOM   685  C  CE1   . PHE A 1 97  ? 2.355   -6.522  -13.964 1.00 12.42 ? 148 PHE A CE1   1 
ATOM   686  C  CE2   . PHE A 1 97  ? 3.027   -8.415  -15.265 1.00 12.53 ? 148 PHE A CE2   1 
ATOM   687  C  CZ    . PHE A 1 97  ? 2.727   -7.066  -15.175 1.00 12.92 ? 148 PHE A CZ    1 
ATOM   688  N  N     . VAL A 1 98  ? -0.724  -8.403  -11.612 1.00 11.67 ? 149 VAL A N     1 
ATOM   689  C  CA    . VAL A 1 98  ? -1.678  -7.371  -11.180 1.00 11.43 ? 149 VAL A CA    1 
ATOM   690  C  C     . VAL A 1 98  ? -2.531  -7.905  -10.031 1.00 11.39 ? 149 VAL A C     1 
ATOM   691  O  O     . VAL A 1 98  ? -2.673  -7.253  -8.995  1.00 11.52 ? 149 VAL A O     1 
ATOM   692  C  CB    . VAL A 1 98  ? -2.588  -6.883  -12.332 1.00 11.38 ? 149 VAL A CB    1 
ATOM   693  C  CG1   . VAL A 1 98  ? -3.761  -6.102  -11.783 1.00 11.67 ? 149 VAL A CG1   1 
ATOM   694  C  CG2   . VAL A 1 98  ? -1.811  -6.018  -13.298 1.00 10.75 ? 149 VAL A CG2   1 
ATOM   695  N  N     . LEU A 1 99  ? -3.083  -9.101  -10.203 1.00 11.34 ? 150 LEU A N     1 
ATOM   696  C  CA    . LEU A 1 99  ? -3.771  -9.764  -9.097  1.00 11.35 ? 150 LEU A CA    1 
ATOM   697  C  C     . LEU A 1 99  ? -2.854  -9.886  -7.871  1.00 11.37 ? 150 LEU A C     1 
ATOM   698  O  O     . LEU A 1 99  ? -3.310  -9.727  -6.751  1.00 12.04 ? 150 LEU A O     1 
ATOM   699  C  CB    . LEU A 1 99  ? -4.324  -11.145 -9.504  1.00 11.31 ? 150 LEU A CB    1 
ATOM   700  C  CG    . LEU A 1 99  ? -5.698  -11.216 -10.191 1.00 11.30 ? 150 LEU A CG    1 
ATOM   701  C  CD1   . LEU A 1 99  ? -6.792  -10.659 -9.311  1.00 12.08 ? 150 LEU A CD1   1 
ATOM   702  C  CD2   . LEU A 1 99  ? -5.709  -10.482 -11.509 1.00 12.07 ? 150 LEU A CD2   1 
ATOM   703  N  N     . ALA A 1 100 ? -1.570  -10.157 -8.075  1.00 11.27 ? 151 ALA A N     1 
ATOM   704  C  CA    . ALA A 1 100 ? -0.624  -10.246 -6.964  1.00 11.13 ? 151 ALA A CA    1 
ATOM   705  C  C     . ALA A 1 100 ? -0.524  -8.910  -6.229  1.00 11.30 ? 151 ALA A C     1 
ATOM   706  O  O     . ALA A 1 100 ? -0.562  -8.874  -5.000  1.00 10.71 ? 151 ALA A O     1 
ATOM   707  C  CB    . ALA A 1 100 ? 0.752   -10.688 -7.463  1.00 11.09 ? 151 ALA A CB    1 
ATOM   708  N  N     . MET A 1 101 ? -0.414  -7.820  -6.991  1.00 11.71 ? 152 MET A N     1 
ATOM   709  C  CA    . MET A 1 101 ? -0.300  -6.471  -6.421  1.00 12.10 ? 152 MET A CA    1 
ATOM   710  C  C     . MET A 1 101 ? -1.562  -6.055  -5.685  1.00 12.30 ? 152 MET A C     1 
ATOM   711  O  O     . MET A 1 101 ? -1.516  -5.626  -4.529  1.00 12.08 ? 152 MET A O     1 
ATOM   712  C  CB    . MET A 1 101 ? -0.047  -5.442  -7.516  1.00 12.27 ? 152 MET A CB    1 
ATOM   713  C  CG    . MET A 1 101 ? 1.268   -5.589  -8.242  1.00 12.53 ? 152 MET A CG    1 
ATOM   714  S  SD    . MET A 1 101 ? 1.574   -4.127  -9.236  1.00 12.67 ? 152 MET A SD    1 
ATOM   715  C  CE    . MET A 1 101 ? 2.846   -3.334  -8.262  1.00 13.12 ? 152 MET A CE    1 
ATOM   716  N  N     . LEU A 1 102 ? -2.692  -6.175  -6.373  1.00 12.55 ? 153 LEU A N     1 
ATOM   717  C  CA    . LEU A 1 102 ? -3.971  -5.794  -5.799  1.00 12.71 ? 153 LEU A CA    1 
ATOM   718  C  C     . LEU A 1 102 ? -4.246  -6.583  -4.520  1.00 12.74 ? 153 LEU A C     1 
ATOM   719  O  O     . LEU A 1 102 ? -4.815  -6.053  -3.563  1.00 12.95 ? 153 LEU A O     1 
ATOM   720  C  CB    . LEU A 1 102 ? -5.098  -6.001  -6.815  1.00 12.72 ? 153 LEU A CB    1 
ATOM   721  C  CG    . LEU A 1 102 ? -5.062  -5.096  -8.053  1.00 12.92 ? 153 LEU A CG    1 
ATOM   722  C  CD1   . LEU A 1 102 ? -6.125  -5.503  -9.057  1.00 12.83 ? 153 LEU A CD1   1 
ATOM   723  C  CD2   . LEU A 1 102 ? -5.228  -3.631  -7.670  1.00 13.08 ? 153 LEU A CD2   1 
ATOM   724  N  N     . SER A 1 103 ? -3.808  -7.836  -4.492  1.00 12.60 ? 154 SER A N     1 
ATOM   725  C  CA    . SER A 1 103 ? -4.064  -8.699  -3.347  1.00 12.78 ? 154 SER A CA    1 
ATOM   726  C  C     . SER A 1 103 ? -3.310  -8.319  -2.057  1.00 12.64 ? 154 SER A C     1 
ATOM   727  O  O     . SER A 1 103 ? -3.680  -8.781  -0.986  1.00 12.38 ? 154 SER A O     1 
ATOM   728  C  CB    . SER A 1 103 ? -3.768  -10.151 -3.711  1.00 12.61 ? 154 SER A CB    1 
ATOM   729  O  OG    . SER A 1 103 ? -4.407  -11.017 -2.794  1.00 13.94 ? 154 SER A OG    1 
ATOM   730  N  N     . GLN A 1 104 ? -2.274  -7.489  -2.163  1.00 12.86 ? 155 GLN A N     1 
ATOM   731  C  CA    . GLN A 1 104 ? -1.481  -7.062  -1.011  1.00 13.31 ? 155 GLN A CA    1 
ATOM   732  C  C     . GLN A 1 104 ? -1.704  -5.591  -0.642  1.00 13.92 ? 155 GLN A C     1 
ATOM   733  O  O     . GLN A 1 104 ? -1.180  -5.124  0.369   1.00 14.11 ? 155 GLN A O     1 
ATOM   734  C  CB    . GLN A 1 104 ? 0.012   -7.267  -1.280  1.00 13.16 ? 155 GLN A CB    1 
ATOM   735  C  CG    . GLN A 1 104 ? 0.403   -8.659  -1.752  1.00 13.12 ? 155 GLN A CG    1 
ATOM   736  C  CD    . GLN A 1 104 ? 0.179   -9.732  -0.711  1.00 12.71 ? 155 GLN A CD    1 
ATOM   737  O  OE1   . GLN A 1 104 ? 0.096   -9.445  0.479   1.00 12.60 ? 155 GLN A OE1   1 
ATOM   738  N  NE2   . GLN A 1 104 ? 0.083   -10.982 -1.157  1.00 12.27 ? 155 GLN A NE2   1 
ATOM   739  N  N     . VAL A 1 105 ? -2.451  -4.855  -1.458  1.00 14.56 ? 156 VAL A N     1 
ATOM   740  C  CA    . VAL A 1 105 ? -2.715  -3.446  -1.184  1.00 15.12 ? 156 VAL A CA    1 
ATOM   741  C  C     . VAL A 1 105 ? -3.804  -3.316  -0.127  1.00 15.76 ? 156 VAL A C     1 
ATOM   742  O  O     . VAL A 1 105 ? -4.779  -4.068  -0.149  1.00 15.96 ? 156 VAL A O     1 
ATOM   743  C  CB    . VAL A 1 105 ? -3.156  -2.687  -2.463  1.00 15.26 ? 156 VAL A CB    1 
ATOM   744  C  CG1   . VAL A 1 105 ? -4.588  -3.072  -2.876  1.00 14.68 ? 156 VAL A CG1   1 
ATOM   745  C  CG2   . VAL A 1 105 ? -3.046  -1.189  -2.252  1.00 15.33 ? 156 VAL A CG2   1 
ATOM   746  N  N     . GLU A 1 106 ? -3.619  -2.375  0.802   1.00 16.51 ? 157 GLU A N     1 
ATOM   747  C  CA    . GLU A 1 106 ? -4.642  -1.999  1.789   1.00 17.01 ? 157 GLU A CA    1 
ATOM   748  C  C     . GLU A 1 106 ? -5.155  -0.607  1.400   1.00 17.07 ? 157 GLU A C     1 
ATOM   749  O  O     . GLU A 1 106 ? -4.499  0.395   1.706   1.00 17.10 ? 157 GLU A O     1 
ATOM   750  C  CB    . GLU A 1 106 ? -4.060  -1.952  3.203   1.00 17.17 ? 157 GLU A CB    1 
ATOM   751  C  CG    . GLU A 1 106 ? -3.174  -3.129  3.565   1.00 18.39 ? 157 GLU A CG    1 
ATOM   752  C  CD    . GLU A 1 106 ? -2.316  -2.847  4.798   1.00 19.96 ? 157 GLU A CD    1 
ATOM   753  O  OE1   . GLU A 1 106 ? -1.072  -2.717  4.657   1.00 20.22 ? 157 GLU A OE1   1 
ATOM   754  O  OE2   . GLU A 1 106 ? -2.893  -2.741  5.904   1.00 20.44 ? 157 GLU A OE2   1 
ATOM   755  N  N     . PRO A 1 107 ? -6.320  -0.537  0.719   1.00 17.03 ? 158 PRO A N     1 
ATOM   756  C  CA    . PRO A 1 107 ? -6.768  0.721   0.090   1.00 16.84 ? 158 PRO A CA    1 
ATOM   757  C  C     . PRO A 1 107 ? -6.909  1.910   1.043   1.00 16.51 ? 158 PRO A C     1 
ATOM   758  O  O     . PRO A 1 107 ? -6.840  3.057   0.596   1.00 16.60 ? 158 PRO A O     1 
ATOM   759  C  CB    . PRO A 1 107 ? -8.135  0.356   -0.507  1.00 17.00 ? 158 PRO A CB    1 
ATOM   760  C  CG    . PRO A 1 107 ? -8.119  -1.138  -0.641  1.00 17.12 ? 158 PRO A CG    1 
ATOM   761  C  CD    . PRO A 1 107 ? -7.284  -1.633  0.493   1.00 17.14 ? 158 PRO A CD    1 
ATOM   762  N  N     . ALA A 1 108 ? -7.108  1.634   2.332   1.00 15.97 ? 159 ALA A N     1 
ATOM   763  C  CA    . ALA A 1 108 ? -7.228  2.679   3.352   1.00 15.57 ? 159 ALA A CA    1 
ATOM   764  C  C     . ALA A 1 108 ? -6.000  3.594   3.405   1.00 15.26 ? 159 ALA A C     1 
ATOM   765  O  O     . ALA A 1 108 ? -6.122  4.806   3.578   1.00 15.08 ? 159 ALA A O     1 
ATOM   766  C  CB    . ALA A 1 108 ? -7.464  2.044   4.712   1.00 15.58 ? 159 ALA A CB    1 
ATOM   767  N  N     . ASN A 1 109 ? -4.822  2.994   3.247   1.00 14.86 ? 160 ASN A N     1 
ATOM   768  C  CA    . ASN A 1 109 ? -3.553  3.712   3.294   1.00 14.39 ? 160 ASN A CA    1 
ATOM   769  C  C     . ASN A 1 109 ? -3.263  4.426   1.977   1.00 14.08 ? 160 ASN A C     1 
ATOM   770  O  O     . ASN A 1 109 ? -2.991  3.786   0.961   1.00 14.12 ? 160 ASN A O     1 
ATOM   771  C  CB    . ASN A 1 109 ? -2.428  2.737   3.635   1.00 14.29 ? 160 ASN A CB    1 
ATOM   772  C  CG    . ASN A 1 109 ? -2.657  2.028   4.960   1.00 14.32 ? 160 ASN A CG    1 
ATOM   773  O  OD1   . ASN A 1 109 ? -2.672  0.801   5.021   1.00 14.89 ? 160 ASN A OD1   1 
ATOM   774  N  ND2   . ASN A 1 109 ? -2.857  2.798   6.023   1.00 13.83 ? 160 ASN A ND2   1 
ATOM   775  N  N     . LYS A 1 110 ? -3.318  5.756   2.010   1.00 13.77 ? 161 LYS A N     1 
ATOM   776  C  CA    . LYS A 1 110 ? -3.235  6.587   0.803   1.00 13.39 ? 161 LYS A CA    1 
ATOM   777  C  C     . LYS A 1 110 ? -1.794  6.920   0.442   1.00 12.84 ? 161 LYS A C     1 
ATOM   778  O  O     . LYS A 1 110 ? -1.422  8.086   0.374   1.00 12.72 ? 161 LYS A O     1 
ATOM   779  C  CB    . LYS A 1 110 ? -4.026  7.900   0.983   1.00 13.50 ? 161 LYS A CB    1 
ATOM   780  C  CG    . LYS A 1 110 ? -5.476  7.747   1.448   1.00 13.51 ? 161 LYS A CG    1 
ATOM   781  C  CD    . LYS A 1 110 ? -6.359  7.095   0.392   1.00 13.59 ? 161 LYS A CD    1 
ATOM   782  C  CE    . LYS A 1 110 ? -7.721  6.723   0.957   1.00 13.38 ? 161 LYS A CE    1 
ATOM   783  N  NZ    . LYS A 1 110 ? -8.402  5.684   0.139   1.00 13.33 ? 161 LYS A NZ    1 
ATOM   784  N  N     . TYR A 1 111 ? -0.985  5.890   0.226   1.00 12.43 ? 162 TYR A N     1 
ATOM   785  C  CA    . TYR A 1 111 ? 0.365   6.063   -0.324  1.00 12.25 ? 162 TYR A CA    1 
ATOM   786  C  C     . TYR A 1 111 ? 0.723   4.850   -1.172  1.00 11.89 ? 162 TYR A C     1 
ATOM   787  O  O     . TYR A 1 111 ? 0.124   3.790   -1.010  1.00 12.03 ? 162 TYR A O     1 
ATOM   788  C  CB    . TYR A 1 111 ? 1.407   6.268   0.783   1.00 12.14 ? 162 TYR A CB    1 
ATOM   789  C  CG    . TYR A 1 111 ? 1.328   5.250   1.886   1.00 12.23 ? 162 TYR A CG    1 
ATOM   790  C  CD1   . TYR A 1 111 ? 0.712   5.555   3.100   1.00 12.10 ? 162 TYR A CD1   1 
ATOM   791  C  CD2   . TYR A 1 111 ? 1.852   3.972   1.714   1.00 12.76 ? 162 TYR A CD2   1 
ATOM   792  C  CE1   . TYR A 1 111 ? 0.630   4.616   4.117   1.00 12.21 ? 162 TYR A CE1   1 
ATOM   793  C  CE2   . TYR A 1 111 ? 1.774   3.023   2.725   1.00 13.37 ? 162 TYR A CE2   1 
ATOM   794  C  CZ    . TYR A 1 111 ? 1.162   3.351   3.923   1.00 13.00 ? 162 TYR A CZ    1 
ATOM   795  O  OH    . TYR A 1 111 ? 1.087   2.402   4.916   1.00 13.67 ? 162 TYR A OH    1 
ATOM   796  N  N     . PRO A 1 112 ? 1.675   5.007   -2.102  1.00 11.62 ? 163 PRO A N     1 
ATOM   797  C  CA    . PRO A 1 112 ? 2.161   3.880   -2.900  1.00 11.56 ? 163 PRO A CA    1 
ATOM   798  C  C     . PRO A 1 112 ? 2.649   2.674   -2.088  1.00 11.49 ? 163 PRO A C     1 
ATOM   799  O  O     . PRO A 1 112 ? 3.635   2.761   -1.352  1.00 11.33 ? 163 PRO A O     1 
ATOM   800  C  CB    . PRO A 1 112 ? 3.309   4.503   -3.690  1.00 11.45 ? 163 PRO A CB    1 
ATOM   801  C  CG    . PRO A 1 112 ? 2.848   5.899   -3.922  1.00 11.42 ? 163 PRO A CG    1 
ATOM   802  C  CD    . PRO A 1 112 ? 2.090   6.294   -2.685  1.00 11.49 ? 163 PRO A CD    1 
ATOM   803  N  N     . GLN A 1 113 ? 1.928   1.565   -2.228  1.00 11.62 ? 164 GLN A N     1 
ATOM   804  C  CA    . GLN A 1 113 ? 2.303   0.283   -1.633  1.00 11.79 ? 164 GLN A CA    1 
ATOM   805  C  C     . GLN A 1 113 ? 2.834   -0.694  -2.675  1.00 11.72 ? 164 GLN A C     1 
ATOM   806  O  O     . GLN A 1 113 ? 3.519   -1.658  -2.326  1.00 11.91 ? 164 GLN A O     1 
ATOM   807  C  CB    . GLN A 1 113 ? 1.093   -0.348  -0.945  1.00 11.80 ? 164 GLN A CB    1 
ATOM   808  C  CG    . GLN A 1 113 ? 0.653   0.392   0.300   1.00 12.27 ? 164 GLN A CG    1 
ATOM   809  C  CD    . GLN A 1 113 ? -0.812  0.189   0.595   1.00 13.40 ? 164 GLN A CD    1 
ATOM   810  O  OE1   . GLN A 1 113 ? -1.278  -0.941  0.740   1.00 14.25 ? 164 GLN A OE1   1 
ATOM   811  N  NE2   . GLN A 1 113 ? -1.551  1.285   0.682   1.00 13.80 ? 164 GLN A NE2   1 
ATOM   812  N  N     . CYS A 1 114 ? 2.506   -0.453  -3.942  1.00 11.50 ? 165 CYS A N     1 
ATOM   813  C  CA    . CYS A 1 114 ? 2.788   -1.403  -5.011  1.00 11.51 ? 165 CYS A CA    1 
ATOM   814  C  C     . CYS A 1 114 ? 3.284   -0.675  -6.242  1.00 11.56 ? 165 CYS A C     1 
ATOM   815  O  O     . CYS A 1 114 ? 2.623   0.229   -6.746  1.00 11.51 ? 165 CYS A O     1 
ATOM   816  C  CB    . CYS A 1 114 ? 1.538   -2.210  -5.351  1.00 11.51 ? 165 CYS A CB    1 
ATOM   817  S  SG    . CYS A 1 114 ? 1.063   -3.338  -4.044  1.00 11.67 ? 165 CYS A SG    1 
ATOM   818  N  N     . LEU A 1 115 ? 4.453   -1.093  -6.718  1.00 11.72 ? 166 LEU A N     1 
ATOM   819  C  CA    . LEU A 1 115 ? 5.176   -0.399  -7.767  1.00 11.61 ? 166 LEU A CA    1 
ATOM   820  C  C     . LEU A 1 115 ? 5.456   -1.381  -8.884  1.00 11.78 ? 166 LEU A C     1 
ATOM   821  O  O     . LEU A 1 115 ? 5.881   -2.502  -8.627  1.00 12.30 ? 166 LEU A O     1 
ATOM   822  C  CB    . LEU A 1 115 ? 6.484   0.139   -7.193  1.00 11.45 ? 166 LEU A CB    1 
ATOM   823  C  CG    . LEU A 1 115 ? 7.322   1.101   -8.030  1.00 11.14 ? 166 LEU A CG    1 
ATOM   824  C  CD1   . LEU A 1 115 ? 6.481   2.229   -8.574  1.00 10.01 ? 166 LEU A CD1   1 
ATOM   825  C  CD2   . LEU A 1 115 ? 8.472   1.642   -7.186  1.00 10.85 ? 166 LEU A CD2   1 
ATOM   826  N  N     . CYS A 1 116 ? 5.211   -0.964  -10.120 1.00 11.93 ? 167 CYS A N     1 
ATOM   827  C  CA    . CYS A 1 116 ? 5.432   -1.815  -11.283 1.00 11.83 ? 167 CYS A CA    1 
ATOM   828  C  C     . CYS A 1 116 ? 6.255   -1.120  -12.371 1.00 11.79 ? 167 CYS A C     1 
ATOM   829  O  O     . CYS A 1 116 ? 5.950   0.001   -12.757 1.00 11.76 ? 167 CYS A O     1 
ATOM   830  C  CB    . CYS A 1 116 ? 4.099   -2.245  -11.867 1.00 11.72 ? 167 CYS A CB    1 
ATOM   831  S  SG    . CYS A 1 116 ? 4.315   -3.427  -13.189 1.00 12.42 ? 167 CYS A SG    1 
ATOM   832  N  N     . LEU A 1 117 ? 7.279   -1.806  -12.876 1.00 11.90 ? 168 LEU A N     1 
ATOM   833  C  CA    . LEU A 1 117 ? 8.152   -1.266  -13.915 1.00 11.86 ? 168 LEU A CA    1 
ATOM   834  C  C     . LEU A 1 117 ? 7.999   -1.964  -15.273 1.00 11.84 ? 168 LEU A C     1 
ATOM   835  O  O     . LEU A 1 117 ? 8.209   -3.181  -15.394 1.00 11.75 ? 168 LEU A O     1 
ATOM   836  C  CB    . LEU A 1 117 ? 9.612   -1.355  -13.471 1.00 12.09 ? 168 LEU A CB    1 
ATOM   837  C  CG    . LEU A 1 117 ? 10.019  -0.551  -12.235 1.00 12.32 ? 168 LEU A CG    1 
ATOM   838  C  CD1   . LEU A 1 117 ? 11.537  -0.491  -12.157 1.00 11.95 ? 168 LEU A CD1   1 
ATOM   839  C  CD2   . LEU A 1 117 ? 9.424   0.862   -12.257 1.00 12.58 ? 168 LEU A CD2   1 
ATOM   840  N  N     . SER A 1 118 ? 7.641   -1.164  -16.285 1.00 11.70 ? 169 SER A N     1 
ATOM   841  C  CA    . SER A 1 118 ? 7.619   -1.577  -17.686 1.00 11.45 ? 169 SER A CA    1 
ATOM   842  C  C     . SER A 1 118 ? 8.777   -0.898  -18.443 1.00 11.35 ? 169 SER A C     1 
ATOM   843  O  O     . SER A 1 118 ? 9.215   0.196   -18.070 1.00 11.36 ? 169 SER A O     1 
ATOM   844  C  CB    . SER A 1 118 ? 6.289   -1.182  -18.321 1.00 11.51 ? 169 SER A CB    1 
ATOM   845  O  OG    . SER A 1 118 ? 5.220   -1.953  -17.806 1.00 11.79 ? 169 SER A OG    1 
ATOM   846  N  N     . PRO A 1 119 ? 9.288   -1.547  -19.502 1.00 11.00 ? 170 PRO A N     1 
ATOM   847  C  CA    . PRO A 1 119 ? 10.416  -0.990  -20.248 1.00 10.89 ? 170 PRO A CA    1 
ATOM   848  C  C     . PRO A 1 119 ? 10.088  0.215   -21.130 1.00 10.85 ? 170 PRO A C     1 
ATOM   849  O  O     . PRO A 1 119 ? 11.007  0.930   -21.541 1.00 10.90 ? 170 PRO A O     1 
ATOM   850  C  CB    . PRO A 1 119 ? 10.860  -2.165  -21.129 1.00 10.77 ? 170 PRO A CB    1 
ATOM   851  C  CG    . PRO A 1 119 ? 9.655   -2.992  -21.280 1.00 10.75 ? 170 PRO A CG    1 
ATOM   852  C  CD    . PRO A 1 119 ? 8.975   -2.913  -19.952 1.00 11.06 ? 170 PRO A CD    1 
ATOM   853  N  N     . THR A 1 120 ? 8.812   0.428   -21.449 1.00 10.64 ? 171 THR A N     1 
ATOM   854  C  CA    . THR A 1 120 ? 8.443   1.492   -22.382 1.00 10.30 ? 171 THR A CA    1 
ATOM   855  C  C     . THR A 1 120 ? 7.123   2.176   -22.028 1.00 10.28 ? 171 THR A C     1 
ATOM   856  O  O     . THR A 1 120 ? 6.273   1.611   -21.329 1.00 10.35 ? 171 THR A O     1 
ATOM   857  C  CB    . THR A 1 120 ? 8.339   0.972   -23.842 1.00 10.41 ? 171 THR A CB    1 
ATOM   858  O  OG1   . THR A 1 120 ? 7.174   0.149   -23.991 1.00 9.72  ? 171 THR A OG1   1 
ATOM   859  C  CG2   . THR A 1 120 ? 9.595   0.193   -24.250 1.00 9.99  ? 171 THR A CG2   1 
ATOM   860  N  N     . TYR A 1 121 ? 6.974   3.392   -22.551 1.00 9.90  ? 172 TYR A N     1 
ATOM   861  C  CA    . TYR A 1 121 ? 5.802   4.241   -22.339 1.00 9.58  ? 172 TYR A CA    1 
ATOM   862  C  C     . TYR A 1 121 ? 4.476   3.535   -22.552 1.00 9.66  ? 172 TYR A C     1 
ATOM   863  O  O     . TYR A 1 121 ? 3.584   3.615   -21.707 1.00 9.59  ? 172 TYR A O     1 
ATOM   864  C  CB    . TYR A 1 121 ? 5.863   5.416   -23.303 1.00 9.40  ? 172 TYR A CB    1 
ATOM   865  C  CG    . TYR A 1 121 ? 4.795   6.449   -23.083 1.00 9.00  ? 172 TYR A CG    1 
ATOM   866  C  CD1   . TYR A 1 121 ? 4.879   7.337   -22.016 1.00 8.11  ? 172 TYR A CD1   1 
ATOM   867  C  CD2   . TYR A 1 121 ? 3.715   6.563   -23.949 1.00 8.44  ? 172 TYR A CD2   1 
ATOM   868  C  CE1   . TYR A 1 121 ? 3.919   8.295   -21.812 1.00 7.77  ? 172 TYR A CE1   1 
ATOM   869  C  CE2   . TYR A 1 121 ? 2.746   7.529   -23.750 1.00 7.89  ? 172 TYR A CE2   1 
ATOM   870  C  CZ    . TYR A 1 121 ? 2.853   8.391   -22.678 1.00 7.70  ? 172 TYR A CZ    1 
ATOM   871  O  OH    . TYR A 1 121 ? 1.905   9.368   -22.464 1.00 7.75  ? 172 TYR A OH    1 
ATOM   872  N  N     . GLU A 1 122 ? 4.355   2.849   -23.686 1.00 9.66  ? 173 GLU A N     1 
ATOM   873  C  CA    . GLU A 1 122 ? 3.081   2.273   -24.102 1.00 9.72  ? 173 GLU A CA    1 
ATOM   874  C  C     . GLU A 1 122 ? 2.705   1.035   -23.294 1.00 9.85  ? 173 GLU A C     1 
ATOM   875  O  O     . GLU A 1 122 ? 1.524   0.772   -23.079 1.00 9.53  ? 173 GLU A O     1 
ATOM   876  C  CB    . GLU A 1 122 ? 3.104   1.924   -25.590 1.00 9.71  ? 173 GLU A CB    1 
ATOM   877  C  CG    . GLU A 1 122 ? 3.216   3.129   -26.513 1.00 9.95  ? 173 GLU A CG    1 
ATOM   878  C  CD    . GLU A 1 122 ? 4.651   3.585   -26.740 1.00 10.23 ? 173 GLU A CD    1 
ATOM   879  O  OE1   . GLU A 1 122 ? 4.871   4.448   -27.622 1.00 10.17 ? 173 GLU A OE1   1 
ATOM   880  O  OE2   . GLU A 1 122 ? 5.556   3.080   -26.042 1.00 10.20 ? 173 GLU A OE2   1 
ATOM   881  N  N     . LEU A 1 123 ? 3.709   0.274   -22.861 1.00 10.14 ? 174 LEU A N     1 
ATOM   882  C  CA    . LEU A 1 123 ? 3.465   -0.912  -22.045 1.00 10.48 ? 174 LEU A CA    1 
ATOM   883  C  C     . LEU A 1 123 ? 2.965   -0.503  -20.651 1.00 10.80 ? 174 LEU A C     1 
ATOM   884  O  O     . LEU A 1 123 ? 2.051   -1.141  -20.109 1.00 10.97 ? 174 LEU A O     1 
ATOM   885  C  CB    . LEU A 1 123 ? 4.719   -1.793  -21.953 1.00 10.36 ? 174 LEU A CB    1 
ATOM   886  C  CG    . LEU A 1 123 ? 4.545   -3.134  -21.228 1.00 10.57 ? 174 LEU A CG    1 
ATOM   887  C  CD1   . LEU A 1 123 ? 3.360   -3.903  -21.770 1.00 9.90  ? 174 LEU A CD1   1 
ATOM   888  C  CD2   . LEU A 1 123 ? 5.807   -3.978  -21.329 1.00 10.70 ? 174 LEU A CD2   1 
ATOM   889  N  N     . ALA A 1 124 ? 3.547   0.568   -20.093 1.00 10.78 ? 175 ALA A N     1 
ATOM   890  C  CA    . ALA A 1 124 ? 3.052   1.161   -18.852 1.00 10.55 ? 175 ALA A CA    1 
ATOM   891  C  C     . ALA A 1 124 ? 1.584   1.555   -19.005 1.00 10.64 ? 175 ALA A C     1 
ATOM   892  O  O     . ALA A 1 124 ? 0.756   1.168   -18.180 1.00 10.89 ? 175 ALA A O     1 
ATOM   893  C  CB    . ALA A 1 124 ? 3.888   2.360   -18.447 1.00 10.37 ? 175 ALA A CB    1 
ATOM   894  N  N     . LEU A 1 125 ? 1.256   2.294   -20.066 1.00 10.58 ? 176 LEU A N     1 
ATOM   895  C  CA    . LEU A 1 125 ? -0.127  2.709   -20.305 1.00 10.63 ? 176 LEU A CA    1 
ATOM   896  C  C     . LEU A 1 125 ? -1.039  1.491   -20.372 1.00 10.96 ? 176 LEU A C     1 
ATOM   897  O  O     . LEU A 1 125 ? -2.043  1.413   -19.662 1.00 11.34 ? 176 LEU A O     1 
ATOM   898  C  CB    . LEU A 1 125 ? -0.259  3.507   -21.602 1.00 10.46 ? 176 LEU A CB    1 
ATOM   899  C  CG    . LEU A 1 125 ? 0.339   4.914   -21.661 1.00 10.76 ? 176 LEU A CG    1 
ATOM   900  C  CD1   . LEU A 1 125 ? -0.025  5.577   -22.987 1.00 10.33 ? 176 LEU A CD1   1 
ATOM   901  C  CD2   . LEU A 1 125 ? -0.112  5.783   -20.492 1.00 10.50 ? 176 LEU A CD2   1 
ATOM   902  N  N     . GLN A 1 126 ? -0.668  0.534   -21.216 1.00 11.17 ? 177 GLN A N     1 
ATOM   903  C  CA    . GLN A 1 126 ? -1.454  -0.675  -21.405 1.00 11.32 ? 177 GLN A CA    1 
ATOM   904  C  C     . GLN A 1 126 ? -1.676  -1.381  -20.072 1.00 11.34 ? 177 GLN A C     1 
ATOM   905  O  O     . GLN A 1 126 ? -2.821  -1.608  -19.685 1.00 11.53 ? 177 GLN A O     1 
ATOM   906  C  CB    . GLN A 1 126 ? -0.773  -1.599  -22.422 1.00 11.43 ? 177 GLN A CB    1 
ATOM   907  C  CG    . GLN A 1 126 ? -1.472  -2.936  -22.674 1.00 11.62 ? 177 GLN A CG    1 
ATOM   908  C  CD    . GLN A 1 126 ? -0.680  -3.830  -23.623 1.00 11.73 ? 177 GLN A CD    1 
ATOM   909  O  OE1   . GLN A 1 126 ? -0.376  -3.438  -24.748 1.00 11.68 ? 177 GLN A OE1   1 
ATOM   910  N  NE2   . GLN A 1 126 ? -0.341  -5.027  -23.171 1.00 11.85 ? 177 GLN A NE2   1 
ATOM   911  N  N     . THR A 1 127 ? -0.591  -1.695  -19.367 1.00 11.51 ? 178 THR A N     1 
ATOM   912  C  CA    . THR A 1 127 ? -0.672  -2.355  -18.050 1.00 11.62 ? 178 THR A CA    1 
ATOM   913  C  C     . THR A 1 127 ? -1.475  -1.536  -17.007 1.00 11.99 ? 178 THR A C     1 
ATOM   914  O  O     . THR A 1 127 ? -2.237  -2.097  -16.217 1.00 11.97 ? 178 THR A O     1 
ATOM   915  C  CB    . THR A 1 127 ? 0.735   -2.664  -17.470 1.00 11.46 ? 178 THR A CB    1 
ATOM   916  O  OG1   . THR A 1 127 ? 1.510   -3.416  -18.410 1.00 10.41 ? 178 THR A OG1   1 
ATOM   917  C  CG2   . THR A 1 127 ? 0.620   -3.462  -16.175 1.00 11.45 ? 178 THR A CG2   1 
ATOM   918  N  N     . GLY A 1 128 ? -1.312  -0.217  -17.010 1.00 12.31 ? 179 GLY A N     1 
ATOM   919  C  CA    . GLY A 1 128 ? -2.080  0.643   -16.111 1.00 12.69 ? 179 GLY A CA    1 
ATOM   920  C  C     . GLY A 1 128 ? -3.578  0.445   -16.257 1.00 12.92 ? 179 GLY A C     1 
ATOM   921  O  O     . GLY A 1 128 ? -4.301  0.382   -15.270 1.00 13.00 ? 179 GLY A O     1 
ATOM   922  N  N     . LYS A 1 129 ? -4.038  0.343   -17.497 1.00 13.32 ? 180 LYS A N     1 
ATOM   923  C  CA    . LYS A 1 129 ? -5.436  0.034   -17.787 1.00 13.69 ? 180 LYS A CA    1 
ATOM   924  C  C     . LYS A 1 129 ? -5.903  -1.293  -17.176 1.00 13.68 ? 180 LYS A C     1 
ATOM   925  O  O     . LYS A 1 129 ? -6.998  -1.381  -16.624 1.00 13.69 ? 180 LYS A O     1 
ATOM   926  C  CB    . LYS A 1 129 ? -5.672  -0.003  -19.299 1.00 13.86 ? 180 LYS A CB    1 
ATOM   927  C  CG    . LYS A 1 129 ? -6.313  1.261   -19.868 1.00 15.03 ? 180 LYS A CG    1 
ATOM   928  C  CD    . LYS A 1 129 ? -7.134  0.938   -21.122 1.00 16.48 ? 180 LYS A CD    1 
ATOM   929  C  CE    . LYS A 1 129 ? -8.445  0.207   -20.777 1.00 17.17 ? 180 LYS A CE    1 
ATOM   930  N  NZ    . LYS A 1 129 ? -8.768  -0.899  -21.744 1.00 18.05 ? 180 LYS A NZ    1 
ATOM   931  N  N     . VAL A 1 130 ? -5.081  -2.328  -17.291 1.00 13.68 ? 181 VAL A N     1 
ATOM   932  C  CA    . VAL A 1 130 ? -5.439  -3.632  -16.746 1.00 13.66 ? 181 VAL A CA    1 
ATOM   933  C  C     . VAL A 1 130 ? -5.547  -3.537  -15.228 1.00 13.80 ? 181 VAL A C     1 
ATOM   934  O  O     . VAL A 1 130 ? -6.462  -4.121  -14.645 1.00 13.80 ? 181 VAL A O     1 
ATOM   935  C  CB    . VAL A 1 130 ? -4.436  -4.744  -17.160 1.00 13.81 ? 181 VAL A CB    1 
ATOM   936  C  CG1   . VAL A 1 130 ? -4.768  -6.050  -16.465 1.00 13.32 ? 181 VAL A CG1   1 
ATOM   937  C  CG2   . VAL A 1 130 ? -4.437  -4.932  -18.682 1.00 13.23 ? 181 VAL A CG2   1 
ATOM   938  N  N     . ILE A 1 131 ? -4.638  -2.777  -14.601 1.00 13.72 ? 182 ILE A N     1 
ATOM   939  C  CA    . ILE A 1 131 ? -4.664  -2.546  -13.142 1.00 13.50 ? 182 ILE A CA    1 
ATOM   940  C  C     . ILE A 1 131 ? -5.942  -1.839  -12.678 1.00 13.79 ? 182 ILE A C     1 
ATOM   941  O  O     . ILE A 1 131 ? -6.572  -2.243  -11.691 1.00 14.05 ? 182 ILE A O     1 
ATOM   942  C  CB    . ILE A 1 131 ? -3.432  -1.729  -12.671 1.00 13.36 ? 182 ILE A CB    1 
ATOM   943  C  CG1   . ILE A 1 131 ? -2.175  -2.609  -12.681 1.00 12.78 ? 182 ILE A CG1   1 
ATOM   944  C  CG2   . ILE A 1 131 ? -3.660  -1.160  -11.272 1.00 12.54 ? 182 ILE A CG2   1 
ATOM   945  C  CD1   . ILE A 1 131 ? -0.885  -1.828  -12.664 1.00 11.65 ? 182 ILE A CD1   1 
ATOM   946  N  N     . GLU A 1 132 ? -6.323  -0.786  -13.389 1.00 13.92 ? 183 GLU A N     1 
ATOM   947  C  CA    . GLU A 1 132 ? -7.524  -0.039  -13.042 1.00 14.05 ? 183 GLU A CA    1 
ATOM   948  C  C     . GLU A 1 132 ? -8.763  -0.913  -13.177 1.00 14.18 ? 183 GLU A C     1 
ATOM   949  O  O     . GLU A 1 132 ? -9.597  -0.954  -12.283 1.00 14.20 ? 183 GLU A O     1 
ATOM   950  C  CB    . GLU A 1 132 ? -7.658  1.185   -13.934 1.00 14.04 ? 183 GLU A CB    1 
ATOM   951  C  CG    . GLU A 1 132 ? -6.575  2.229   -13.722 1.00 14.21 ? 183 GLU A CG    1 
ATOM   952  C  CD    . GLU A 1 132 ? -6.463  3.197   -14.884 1.00 15.05 ? 183 GLU A CD    1 
ATOM   953  O  OE1   . GLU A 1 132 ? -5.970  4.329   -14.689 1.00 15.85 ? 183 GLU A OE1   1 
ATOM   954  O  OE2   . GLU A 1 132 ? -6.870  2.824   -16.003 1.00 16.53 ? 183 GLU A OE2   1 
ATOM   955  N  N     . GLN A 1 133 ? -8.864  -1.616  -14.297 1.00 14.62 ? 184 GLN A N     1 
ATOM   956  C  CA    . GLN A 1 133 ? -10.018 -2.467  -14.588 1.00 15.06 ? 184 GLN A CA    1 
ATOM   957  C  C     . GLN A 1 133 ? -10.086 -3.701  -13.691 1.00 15.08 ? 184 GLN A C     1 
ATOM   958  O  O     . GLN A 1 133 ? -11.167 -4.174  -13.364 1.00 15.08 ? 184 GLN A O     1 
ATOM   959  C  CB    . GLN A 1 133 ? -9.986  -2.917  -16.047 1.00 15.10 ? 184 GLN A CB    1 
ATOM   960  C  CG    . GLN A 1 133 ? -10.161 -1.797  -17.046 1.00 16.35 ? 184 GLN A CG    1 
ATOM   961  C  CD    . GLN A 1 133 ? -9.932  -2.256  -18.485 1.00 18.39 ? 184 GLN A CD    1 
ATOM   962  O  OE1   . GLN A 1 133 ? -9.100  -3.130  -18.756 1.00 19.56 ? 184 GLN A OE1   1 
ATOM   963  N  NE2   . GLN A 1 133 ? -10.673 -1.659  -19.419 1.00 19.62 ? 184 GLN A NE2   1 
ATOM   964  N  N     . MET A 1 134 ? -8.929  -4.228  -13.309 1.00 15.37 ? 185 MET A N     1 
ATOM   965  C  CA    . MET A 1 134 ? -8.871  -5.428  -12.477 1.00 15.60 ? 185 MET A CA    1 
ATOM   966  C  C     . MET A 1 134 ? -9.244  -5.134  -11.024 1.00 15.61 ? 185 MET A C     1 
ATOM   967  O  O     . MET A 1 134 ? -9.794  -6.002  -10.347 1.00 15.82 ? 185 MET A O     1 
ATOM   968  C  CB    . MET A 1 134 ? -7.475  -6.024  -12.515 1.00 15.75 ? 185 MET A CB    1 
ATOM   969  C  CG    . MET A 1 134 ? -7.417  -7.478  -12.145 1.00 17.24 ? 185 MET A CG    1 
ATOM   970  S  SD    . MET A 1 134 ? -7.091  -8.505  -13.585 1.00 20.15 ? 185 MET A SD    1 
ATOM   971  C  CE    . MET A 1 134 ? -5.474  -7.900  -14.058 1.00 20.17 ? 185 MET A CE    1 
ATOM   972  N  N     . GLY A 1 135 ? -8.933  -3.924  -10.547 1.00 15.44 ? 186 GLY A N     1 
ATOM   973  C  CA    . GLY A 1 135 ? -9.243  -3.519  -9.177  1.00 15.29 ? 186 GLY A CA    1 
ATOM   974  C  C     . GLY A 1 135 ? -10.478 -2.648  -9.034  1.00 15.32 ? 186 GLY A C     1 
ATOM   975  O  O     . GLY A 1 135 ? -10.789 -2.196  -7.932  1.00 15.25 ? 186 GLY A O     1 
ATOM   976  N  N     . LYS A 1 136 ? -11.196 -2.433  -10.138 1.00 15.39 ? 187 LYS A N     1 
ATOM   977  C  CA    . LYS A 1 136 ? -12.339 -1.521  -10.181 1.00 15.36 ? 187 LYS A CA    1 
ATOM   978  C  C     . LYS A 1 136 ? -13.359 -1.740  -9.060  1.00 15.51 ? 187 LYS A C     1 
ATOM   979  O  O     . LYS A 1 136 ? -14.073 -0.812  -8.676  1.00 15.62 ? 187 LYS A O     1 
ATOM   980  C  CB    . LYS A 1 136 ? -13.047 -1.610  -11.538 1.00 15.48 ? 187 LYS A CB    1 
ATOM   981  C  CG    . LYS A 1 136 ? -13.724 -2.955  -11.830 1.00 15.70 ? 187 LYS A CG    1 
ATOM   982  C  CD    . LYS A 1 136 ? -14.877 -2.825  -12.821 1.00 15.64 ? 187 LYS A CD    1 
ATOM   983  C  CE    . LYS A 1 136 ? -14.412 -2.534  -14.232 1.00 15.57 ? 187 LYS A CE    1 
ATOM   984  N  NZ    . LYS A 1 136 ? -15.576 -2.414  -15.160 1.00 15.26 ? 187 LYS A NZ    1 
ATOM   985  N  N     . PHE A 1 137 ? -13.427 -2.959  -8.536  1.00 15.64 ? 188 PHE A N     1 
ATOM   986  C  CA    . PHE A 1 137 ? -14.341 -3.259  -7.442  1.00 15.78 ? 188 PHE A CA    1 
ATOM   987  C  C     . PHE A 1 137 ? -13.730 -2.942  -6.079  1.00 16.07 ? 188 PHE A C     1 
ATOM   988  O  O     . PHE A 1 137 ? -14.204 -3.411  -5.048  1.00 16.19 ? 188 PHE A O     1 
ATOM   989  C  CB    . PHE A 1 137 ? -14.824 -4.707  -7.532  1.00 15.73 ? 188 PHE A CB    1 
ATOM   990  C  CG    . PHE A 1 137 ? -15.530 -5.013  -8.818  1.00 15.30 ? 188 PHE A CG    1 
ATOM   991  C  CD1   . PHE A 1 137 ? -16.854 -4.662  -8.992  1.00 15.16 ? 188 PHE A CD1   1 
ATOM   992  C  CD2   . PHE A 1 137 ? -14.861 -5.622  -9.870  1.00 15.02 ? 188 PHE A CD2   1 
ATOM   993  C  CE1   . PHE A 1 137 ? -17.510 -4.926  -10.186 1.00 14.68 ? 188 PHE A CE1   1 
ATOM   994  C  CE2   . PHE A 1 137 ? -15.511 -5.884  -11.064 1.00 14.55 ? 188 PHE A CE2   1 
ATOM   995  C  CZ    . PHE A 1 137 ? -16.840 -5.538  -11.218 1.00 14.29 ? 188 PHE A CZ    1 
ATOM   996  N  N     . TYR A 1 138 ? -12.665 -2.152  -6.086  1.00 16.40 ? 189 TYR A N     1 
ATOM   997  C  CA    . TYR A 1 138 ? -12.277 -1.371  -4.925  1.00 16.85 ? 189 TYR A CA    1 
ATOM   998  C  C     . TYR A 1 138 ? -12.527 0.083   -5.304  1.00 16.65 ? 189 TYR A C     1 
ATOM   999  O  O     . TYR A 1 138 ? -11.710 0.673   -6.020  1.00 16.96 ? 189 TYR A O     1 
ATOM   1000 C  CB    . TYR A 1 138 ? -10.802 -1.566  -4.604  1.00 17.07 ? 189 TYR A CB    1 
ATOM   1001 C  CG    . TYR A 1 138 ? -10.501 -2.852  -3.889  1.00 18.69 ? 189 TYR A CG    1 
ATOM   1002 C  CD1   . TYR A 1 138 ? -10.060 -3.974  -4.587  1.00 19.85 ? 189 TYR A CD1   1 
ATOM   1003 C  CD2   . TYR A 1 138 ? -10.652 -2.949  -2.508  1.00 20.06 ? 189 TYR A CD2   1 
ATOM   1004 C  CE1   . TYR A 1 138 ? -9.770  -5.159  -3.924  1.00 20.88 ? 189 TYR A CE1   1 
ATOM   1005 C  CE2   . TYR A 1 138 ? -10.366 -4.128  -1.836  1.00 20.88 ? 189 TYR A CE2   1 
ATOM   1006 C  CZ    . TYR A 1 138 ? -9.927  -5.228  -2.549  1.00 21.42 ? 189 TYR A CZ    1 
ATOM   1007 O  OH    . TYR A 1 138 ? -9.650  -6.397  -1.882  1.00 23.58 ? 189 TYR A OH    1 
ATOM   1008 N  N     . PRO A 1 139 ? -13.658 0.663   -4.850  1.00 16.27 ? 190 PRO A N     1 
ATOM   1009 C  CA    . PRO A 1 139 ? -14.013 2.038   -5.220  1.00 15.99 ? 190 PRO A CA    1 
ATOM   1010 C  C     . PRO A 1 139 ? -12.900 3.058   -4.975  1.00 15.83 ? 190 PRO A C     1 
ATOM   1011 O  O     . PRO A 1 139 ? -12.818 4.051   -5.698  1.00 15.55 ? 190 PRO A O     1 
ATOM   1012 C  CB    . PRO A 1 139 ? -15.209 2.352   -4.313  1.00 15.89 ? 190 PRO A CB    1 
ATOM   1013 C  CG    . PRO A 1 139 ? -15.791 1.044   -3.985  1.00 16.07 ? 190 PRO A CG    1 
ATOM   1014 C  CD    . PRO A 1 139 ? -14.646 0.078   -3.926  1.00 16.37 ? 190 PRO A CD    1 
ATOM   1015 N  N     . GLU A 1 140 ? -12.054 2.807   -3.974  1.00 15.76 ? 191 GLU A N     1 
ATOM   1016 C  CA    . GLU A 1 140 ? -11.043 3.774   -3.548  1.00 15.76 ? 191 GLU A CA    1 
ATOM   1017 C  C     . GLU A 1 140 ? -9.627  3.443   -4.020  1.00 15.49 ? 191 GLU A C     1 
ATOM   1018 O  O     . GLU A 1 140 ? -8.670  4.149   -3.700  1.00 15.44 ? 191 GLU A O     1 
ATOM   1019 C  CB    . GLU A 1 140 ? -11.095 3.928   -2.022  1.00 15.81 ? 191 GLU A CB    1 
ATOM   1020 C  CG    . GLU A 1 140 ? -12.406 4.562   -1.506  1.00 16.40 ? 191 GLU A CG    1 
ATOM   1021 C  CD    . GLU A 1 140 ? -12.556 6.060   -1.851  1.00 17.28 ? 191 GLU A CD    1 
ATOM   1022 O  OE1   . GLU A 1 140 ? -12.534 6.885   -0.911  1.00 17.89 ? 191 GLU A OE1   1 
ATOM   1023 O  OE2   . GLU A 1 140 ? -12.696 6.418   -3.048  1.00 17.12 ? 191 GLU A OE2   1 
ATOM   1024 N  N     . LEU A 1 141 ? -9.496  2.383   -4.802  1.00 15.31 ? 192 LEU A N     1 
ATOM   1025 C  CA    . LEU A 1 141 ? -8.209  2.015   -5.360  1.00 15.13 ? 192 LEU A CA    1 
ATOM   1026 C  C     . LEU A 1 141 ? -7.903  2.963   -6.518  1.00 15.02 ? 192 LEU A C     1 
ATOM   1027 O  O     . LEU A 1 141 ? -8.691  3.086   -7.450  1.00 14.98 ? 192 LEU A O     1 
ATOM   1028 C  CB    . LEU A 1 141 ? -8.254  0.575   -5.843  1.00 15.00 ? 192 LEU A CB    1 
ATOM   1029 C  CG    . LEU A 1 141 ? -6.927  -0.075  -6.204  1.00 15.26 ? 192 LEU A CG    1 
ATOM   1030 C  CD1   . LEU A 1 141 ? -6.371  -0.860  -5.017  1.00 14.98 ? 192 LEU A CD1   1 
ATOM   1031 C  CD2   . LEU A 1 141 ? -7.109  -0.979  -7.427  1.00 15.02 ? 192 LEU A CD2   1 
ATOM   1032 N  N     . LYS A 1 142 ? -6.765  3.645   -6.432  1.00 14.99 ? 193 LYS A N     1 
ATOM   1033 C  CA    . LYS A 1 142 ? -6.331  4.596   -7.449  1.00 14.99 ? 193 LYS A CA    1 
ATOM   1034 C  C     . LYS A 1 142 ? -4.939  4.236   -7.982  1.00 14.67 ? 193 LYS A C     1 
ATOM   1035 O  O     . LYS A 1 142 ? -4.115  3.662   -7.268  1.00 14.47 ? 193 LYS A O     1 
ATOM   1036 C  CB    . LYS A 1 142 ? -6.297  6.000   -6.857  1.00 15.10 ? 193 LYS A CB    1 
ATOM   1037 C  CG    . LYS A 1 142 ? -7.655  6.621   -6.608  1.00 16.19 ? 193 LYS A CG    1 
ATOM   1038 C  CD    . LYS A 1 142 ? -8.182  7.297   -7.870  1.00 18.06 ? 193 LYS A CD    1 
ATOM   1039 C  CE    . LYS A 1 142 ? -7.480  8.649   -8.156  1.00 18.74 ? 193 LYS A CE    1 
ATOM   1040 N  NZ    . LYS A 1 142 ? -7.431  8.973   -9.624  1.00 18.78 ? 193 LYS A NZ    1 
ATOM   1041 N  N     . LEU A 1 143 ? -4.684  4.599   -9.236  1.00 14.38 ? 194 LEU A N     1 
ATOM   1042 C  CA    . LEU A 1 143 ? -3.430  4.280   -9.919  1.00 14.14 ? 194 LEU A CA    1 
ATOM   1043 C  C     . LEU A 1 143 ? -2.758  5.577   -10.367 1.00 13.97 ? 194 LEU A C     1 
ATOM   1044 O  O     . LEU A 1 143 ? -3.415  6.484   -10.881 1.00 13.81 ? 194 LEU A O     1 
ATOM   1045 C  CB    . LEU A 1 143 ? -3.709  3.349   -11.117 1.00 14.19 ? 194 LEU A CB    1 
ATOM   1046 C  CG    . LEU A 1 143 ? -2.586  2.669   -11.919 1.00 14.00 ? 194 LEU A CG    1 
ATOM   1047 C  CD1   . LEU A 1 143 ? -1.883  3.655   -12.809 1.00 14.43 ? 194 LEU A CD1   1 
ATOM   1048 C  CD2   . LEU A 1 143 ? -1.579  1.978   -11.019 1.00 13.80 ? 194 LEU A CD2   1 
ATOM   1049 N  N     . ALA A 1 144 ? -1.450  5.664   -10.137 1.00 14.07 ? 195 ALA A N     1 
ATOM   1050 C  CA    . ALA A 1 144 ? -0.641  6.813   -10.536 1.00 13.95 ? 195 ALA A CA    1 
ATOM   1051 C  C     . ALA A 1 144 ? 0.306   6.374   -11.639 1.00 14.13 ? 195 ALA A C     1 
ATOM   1052 O  O     . ALA A 1 144 ? 0.891   5.291   -11.572 1.00 14.05 ? 195 ALA A O     1 
ATOM   1053 C  CB    . ALA A 1 144 ? 0.143   7.340   -9.355  1.00 13.65 ? 195 ALA A CB    1 
ATOM   1054 N  N     . TYR A 1 145 ? 0.456   7.214   -12.656 1.00 14.38 ? 196 TYR A N     1 
ATOM   1055 C  CA    . TYR A 1 145 ? 1.363   6.923   -13.758 1.00 14.43 ? 196 TYR A CA    1 
ATOM   1056 C  C     . TYR A 1 145 ? 2.684   7.682   -13.614 1.00 14.82 ? 196 TYR A C     1 
ATOM   1057 O  O     . TYR A 1 145 ? 2.752   8.896   -13.841 1.00 14.77 ? 196 TYR A O     1 
ATOM   1058 C  CB    . TYR A 1 145 ? 0.689   7.238   -15.096 1.00 14.41 ? 196 TYR A CB    1 
ATOM   1059 C  CG    . TYR A 1 145 ? -0.456  6.298   -15.425 1.00 13.87 ? 196 TYR A CG    1 
ATOM   1060 C  CD1   . TYR A 1 145 ? -1.723  6.517   -14.908 1.00 13.09 ? 196 TYR A CD1   1 
ATOM   1061 C  CD2   . TYR A 1 145 ? -0.265  5.192   -16.242 1.00 13.15 ? 196 TYR A CD2   1 
ATOM   1062 C  CE1   . TYR A 1 145 ? -2.777  5.674   -15.201 1.00 12.84 ? 196 TYR A CE1   1 
ATOM   1063 C  CE2   . TYR A 1 145 ? -1.312  4.340   -16.541 1.00 13.38 ? 196 TYR A CE2   1 
ATOM   1064 C  CZ    . TYR A 1 145 ? -2.571  4.586   -16.013 1.00 13.22 ? 196 TYR A CZ    1 
ATOM   1065 O  OH    . TYR A 1 145 ? -3.631  3.750   -16.288 1.00 12.55 ? 196 TYR A OH    1 
ATOM   1066 N  N     . ALA A 1 146 ? 3.731   6.953   -13.227 1.00 15.17 ? 197 ALA A N     1 
ATOM   1067 C  CA    . ALA A 1 146 ? 5.088   7.483   -13.199 1.00 15.40 ? 197 ALA A CA    1 
ATOM   1068 C  C     . ALA A 1 146 ? 5.713   7.314   -14.584 1.00 15.78 ? 197 ALA A C     1 
ATOM   1069 O  O     . ALA A 1 146 ? 6.682   6.570   -14.760 1.00 15.70 ? 197 ALA A O     1 
ATOM   1070 C  CB    . ALA A 1 146 ? 5.914   6.770   -12.136 1.00 15.29 ? 197 ALA A CB    1 
ATOM   1071 N  N     . VAL A 1 147 ? 5.140   8.018   -15.561 1.00 16.28 ? 198 VAL A N     1 
ATOM   1072 C  CA    . VAL A 1 147 ? 5.565   7.947   -16.966 1.00 16.63 ? 198 VAL A CA    1 
ATOM   1073 C  C     . VAL A 1 147 ? 5.925   9.335   -17.502 1.00 17.17 ? 198 VAL A C     1 
ATOM   1074 O  O     . VAL A 1 147 ? 5.567   10.359  -16.915 1.00 16.98 ? 198 VAL A O     1 
ATOM   1075 C  CB    . VAL A 1 147 ? 4.471   7.324   -17.886 1.00 16.49 ? 198 VAL A CB    1 
ATOM   1076 C  CG1   . VAL A 1 147 ? 4.260   5.854   -17.565 1.00 16.19 ? 198 VAL A CG1   1 
ATOM   1077 C  CG2   . VAL A 1 147 ? 3.172   8.102   -17.783 1.00 16.26 ? 198 VAL A CG2   1 
ATOM   1078 N  N     . ARG A 1 148 ? 6.607   9.353   -18.643 1.00 17.97 ? 199 ARG A N     1 
ATOM   1079 C  CA    . ARG A 1 148 ? 7.204   10.582  -19.163 1.00 18.78 ? 199 ARG A CA    1 
ATOM   1080 C  C     . ARG A 1 148 ? 6.184   11.697  -19.368 1.00 19.04 ? 199 ARG A C     1 
ATOM   1081 O  O     . ARG A 1 148 ? 6.459   12.851  -19.056 1.00 19.12 ? 199 ARG A O     1 
ATOM   1082 C  CB    . ARG A 1 148 ? 7.968   10.318  -20.468 1.00 19.04 ? 199 ARG A CB    1 
ATOM   1083 C  CG    . ARG A 1 148 ? 9.395   10.850  -20.451 1.00 19.73 ? 199 ARG A CG    1 
ATOM   1084 C  CD    . ARG A 1 148 ? 10.100  10.526  -21.748 1.00 21.32 ? 199 ARG A CD    1 
ATOM   1085 N  NE    . ARG A 1 148 ? 9.821   11.522  -22.779 1.00 22.97 ? 199 ARG A NE    1 
ATOM   1086 C  CZ    . ARG A 1 148 ? 10.132  11.392  -24.069 1.00 24.37 ? 199 ARG A CZ    1 
ATOM   1087 N  NH1   . ARG A 1 148 ? 10.724  10.288  -24.519 1.00 24.62 ? 199 ARG A NH1   1 
ATOM   1088 N  NH2   . ARG A 1 148 ? 9.832   12.372  -24.924 1.00 25.03 ? 199 ARG A NH2   1 
ATOM   1089 N  N     . GLY A 1 149 ? 5.000   11.353  -19.860 1.00 19.57 ? 200 GLY A N     1 
ATOM   1090 C  CA    . GLY A 1 149 ? 3.970   12.363  -20.134 1.00 20.11 ? 200 GLY A CA    1 
ATOM   1091 C  C     . GLY A 1 149 ? 3.544   13.220  -18.944 1.00 20.41 ? 200 GLY A C     1 
ATOM   1092 O  O     . GLY A 1 149 ? 2.993   14.304  -19.125 1.00 20.30 ? 200 GLY A O     1 
ATOM   1093 N  N     . ASN A 1 150 ? 3.832   12.746  -17.733 1.00 20.89 ? 201 ASN A N     1 
ATOM   1094 C  CA    . ASN A 1 150 ? 3.157   13.203  -16.525 1.00 21.21 ? 201 ASN A CA    1 
ATOM   1095 C  C     . ASN A 1 150 ? 3.987   14.197  -15.715 1.00 21.66 ? 201 ASN A C     1 
ATOM   1096 O  O     . ASN A 1 150 ? 5.204   14.060  -15.599 1.00 21.96 ? 201 ASN A O     1 
ATOM   1097 C  CB    . ASN A 1 150 ? 2.824   11.979  -15.664 1.00 21.18 ? 201 ASN A CB    1 
ATOM   1098 C  CG    . ASN A 1 150 ? 1.625   12.190  -14.774 1.00 20.99 ? 201 ASN A CG    1 
ATOM   1099 O  OD1   . ASN A 1 150 ? 1.157   13.309  -14.584 1.00 22.25 ? 201 ASN A OD1   1 
ATOM   1100 N  ND2   . ASN A 1 150 ? 1.123   11.106  -14.214 1.00 20.49 ? 201 ASN A ND2   1 
ATOM   1101 N  N     . LYS A 1 151 ? 3.320   15.199  -15.157 1.00 22.07 ? 202 LYS A N     1 
ATOM   1102 C  CA    . LYS A 1 151 ? 3.971   16.173  -14.291 1.00 22.47 ? 202 LYS A CA    1 
ATOM   1103 C  C     . LYS A 1 151 ? 2.998   16.643  -13.219 1.00 22.85 ? 202 LYS A C     1 
ATOM   1104 O  O     . LYS A 1 151 ? 1.851   16.994  -13.506 1.00 22.98 ? 202 LYS A O     1 
ATOM   1105 C  CB    . LYS A 1 151 ? 4.500   17.369  -15.093 1.00 22.46 ? 202 LYS A CB    1 
ATOM   1106 C  CG    . LYS A 1 151 ? 5.715   17.052  -15.954 1.00 22.11 ? 202 LYS A CG    1 
ATOM   1107 C  CD    . LYS A 1 151 ? 6.367   18.314  -16.490 1.00 22.10 ? 202 LYS A CD    1 
ATOM   1108 C  CE    . LYS A 1 151 ? 7.431   17.995  -17.534 1.00 22.03 ? 202 LYS A CE    1 
ATOM   1109 N  NZ    . LYS A 1 151 ? 8.483   17.082  -17.004 1.00 21.87 ? 202 LYS A NZ    1 
ATOM   1110 N  N     . LEU A 1 152 ? 3.478   16.644  -11.982 1.00 23.32 ? 203 LEU A N     1 
ATOM   1111 C  CA    . LEU A 1 152 ? 2.672   16.968  -10.818 1.00 23.71 ? 203 LEU A CA    1 
ATOM   1112 C  C     . LEU A 1 152 ? 3.243   18.226  -10.158 1.00 24.05 ? 203 LEU A C     1 
ATOM   1113 O  O     . LEU A 1 152 ? 4.418   18.551  -10.353 1.00 24.05 ? 203 LEU A O     1 
ATOM   1114 C  CB    . LEU A 1 152 ? 2.693   15.776  -9.856  1.00 23.78 ? 203 LEU A CB    1 
ATOM   1115 C  CG    . LEU A 1 152 ? 2.459   14.401  -10.515 1.00 23.63 ? 203 LEU A CG    1 
ATOM   1116 C  CD1   . LEU A 1 152 ? 2.901   13.262  -9.594  1.00 23.21 ? 203 LEU A CD1   1 
ATOM   1117 C  CD2   . LEU A 1 152 ? 1.000   14.223  -10.959 1.00 22.65 ? 203 LEU A CD2   1 
ATOM   1118 N  N     . GLU A 1 153 ? 2.417   18.945  -9.400  1.00 24.53 ? 204 GLU A N     1 
ATOM   1119 C  CA    . GLU A 1 153 ? 2.898   20.122  -8.653  1.00 24.89 ? 204 GLU A CA    1 
ATOM   1120 C  C     . GLU A 1 153 ? 3.968   19.683  -7.638  1.00 25.13 ? 204 GLU A C     1 
ATOM   1121 O  O     . GLU A 1 153 ? 3.703   18.839  -6.778  1.00 25.21 ? 204 GLU A O     1 
ATOM   1122 C  CB    . GLU A 1 153 ? 1.743   20.847  -7.945  1.00 24.77 ? 204 GLU A CB    1 
ATOM   1123 N  N     . ARG A 1 154 ? 5.170   20.254  -7.748  1.00 25.43 ? 205 ARG A N     1 
ATOM   1124 C  CA    . ARG A 1 154 ? 6.331   19.778  -6.975  1.00 25.75 ? 205 ARG A CA    1 
ATOM   1125 C  C     . ARG A 1 154 ? 6.157   19.979  -5.464  1.00 25.45 ? 205 ARG A C     1 
ATOM   1126 O  O     . ARG A 1 154 ? 5.482   20.913  -5.026  1.00 25.42 ? 205 ARG A O     1 
ATOM   1127 C  CB    . ARG A 1 154 ? 7.640   20.446  -7.450  1.00 25.97 ? 205 ARG A CB    1 
ATOM   1128 C  CG    . ARG A 1 154 ? 8.750   19.429  -7.773  1.00 27.17 ? 205 ARG A CG    1 
ATOM   1129 C  CD    . ARG A 1 154 ? 10.163  20.014  -7.666  1.00 28.64 ? 205 ARG A CD    1 
ATOM   1130 N  NE    . ARG A 1 154 ? 10.735  19.852  -6.323  1.00 29.64 ? 205 ARG A NE    1 
ATOM   1131 C  CZ    . ARG A 1 154 ? 12.033  19.953  -6.019  1.00 30.46 ? 205 ARG A CZ    1 
ATOM   1132 N  NH1   . ARG A 1 154 ? 12.943  20.219  -6.957  1.00 30.96 ? 205 ARG A NH1   1 
ATOM   1133 N  NH2   . ARG A 1 154 ? 12.432  19.784  -4.760  1.00 30.59 ? 205 ARG A NH2   1 
ATOM   1134 N  N     . GLY A 1 155 ? 6.762   19.086  -4.683  1.00 25.08 ? 206 GLY A N     1 
ATOM   1135 C  CA    . GLY A 1 155 ? 6.689   19.144  -3.222  1.00 24.82 ? 206 GLY A CA    1 
ATOM   1136 C  C     . GLY A 1 155 ? 5.625   18.250  -2.599  1.00 24.52 ? 206 GLY A C     1 
ATOM   1137 O  O     . GLY A 1 155 ? 5.554   18.138  -1.371  1.00 24.44 ? 206 GLY A O     1 
ATOM   1138 N  N     . GLN A 1 156 ? 4.800   17.611  -3.427  1.00 24.01 ? 207 GLN A N     1 
ATOM   1139 C  CA    . GLN A 1 156 ? 3.715   16.777  -2.916  1.00 23.60 ? 207 GLN A CA    1 
ATOM   1140 C  C     . GLN A 1 156 ? 4.124   15.310  -2.850  1.00 23.01 ? 207 GLN A C     1 
ATOM   1141 O  O     . GLN A 1 156 ? 5.183   14.928  -3.344  1.00 22.96 ? 207 GLN A O     1 
ATOM   1142 C  CB    . GLN A 1 156 ? 2.435   16.951  -3.756  1.00 23.69 ? 207 GLN A CB    1 
ATOM   1143 C  CG    . GLN A 1 156 ? 2.387   16.194  -5.095  1.00 23.84 ? 207 GLN A CG    1 
ATOM   1144 C  CD    . GLN A 1 156 ? 1.050   16.371  -5.819  1.00 24.07 ? 207 GLN A CD    1 
ATOM   1145 O  OE1   . GLN A 1 156 ? 1.004   16.615  -7.030  1.00 24.14 ? 207 GLN A OE1   1 
ATOM   1146 N  NE2   . GLN A 1 156 ? -0.043  16.253  -5.074  1.00 23.65 ? 207 GLN A NE2   1 
ATOM   1147 N  N     . LYS A 1 157 ? 3.278   14.517  -2.195  1.00 22.26 ? 208 LYS A N     1 
ATOM   1148 C  CA    . LYS A 1 157 ? 3.352   13.057  -2.210  1.00 21.61 ? 208 LYS A CA    1 
ATOM   1149 C  C     . LYS A 1 157 ? 2.087   12.544  -2.893  1.00 20.83 ? 208 LYS A C     1 
ATOM   1150 O  O     . LYS A 1 157 ? 0.994   13.071  -2.671  1.00 20.74 ? 208 LYS A O     1 
ATOM   1151 C  CB    . LYS A 1 157 ? 3.431   12.499  -0.784  1.00 21.70 ? 208 LYS A CB    1 
ATOM   1152 C  CG    . LYS A 1 157 ? 4.798   12.646  -0.098  1.00 21.98 ? 208 LYS A CG    1 
ATOM   1153 C  CD    . LYS A 1 157 ? 5.757   11.512  -0.479  1.00 22.01 ? 208 LYS A CD    1 
ATOM   1154 C  CE    . LYS A 1 157 ? 6.991   11.470  0.421   1.00 22.19 ? 208 LYS A CE    1 
ATOM   1155 N  NZ    . LYS A 1 157 ? 7.889   12.665  0.279   1.00 22.29 ? 208 LYS A NZ    1 
ATOM   1156 N  N     . ILE A 1 158 ? 2.223   11.521  -3.725  1.00 19.84 ? 209 ILE A N     1 
ATOM   1157 C  CA    . ILE A 1 158 ? 1.067   11.006  -4.434  1.00 19.03 ? 209 ILE A CA    1 
ATOM   1158 C  C     . ILE A 1 158 ? 0.284   10.104  -3.482  1.00 18.40 ? 209 ILE A C     1 
ATOM   1159 O  O     . ILE A 1 158 ? 0.867   9.368   -2.691  1.00 18.11 ? 209 ILE A O     1 
ATOM   1160 C  CB    . ILE A 1 158 ? 1.458   10.301  -5.747  1.00 19.06 ? 209 ILE A CB    1 
ATOM   1161 C  CG1   . ILE A 1 158 ? 1.974   8.884   -5.505  1.00 18.90 ? 209 ILE A CG1   1 
ATOM   1162 C  CG2   . ILE A 1 158 ? 2.500   11.134  -6.504  1.00 19.17 ? 209 ILE A CG2   1 
ATOM   1163 C  CD1   . ILE A 1 158 ? 2.396   8.195   -6.768  1.00 18.79 ? 209 ILE A CD1   1 
ATOM   1164 N  N     . SER A 1 159 ? -1.039  10.193  -3.550  1.00 17.79 ? 210 SER A N     1 
ATOM   1165 C  CA    . SER A 1 159 ? -1.917  9.492   -2.621  1.00 17.42 ? 210 SER A CA    1 
ATOM   1166 C  C     . SER A 1 159 ? -2.517  8.226   -3.221  1.00 17.16 ? 210 SER A C     1 
ATOM   1167 O  O     . SER A 1 159 ? -3.352  7.576   -2.586  1.00 17.39 ? 210 SER A O     1 
ATOM   1168 C  CB    . SER A 1 159 ? -3.041  10.425  -2.190  1.00 17.36 ? 210 SER A CB    1 
ATOM   1169 O  OG    . SER A 1 159 ? -3.697  10.949  -3.328  1.00 17.60 ? 210 SER A OG    1 
ATOM   1170 N  N     . GLU A 1 160 ? -2.103  7.886   -4.442  1.00 16.64 ? 211 GLU A N     1 
ATOM   1171 C  CA    . GLU A 1 160 ? -2.572  6.679   -5.114  1.00 16.17 ? 211 GLU A CA    1 
ATOM   1172 C  C     . GLU A 1 160 ? -1.843  5.463   -4.543  1.00 15.74 ? 211 GLU A C     1 
ATOM   1173 O  O     . GLU A 1 160 ? -0.652  5.531   -4.239  1.00 15.74 ? 211 GLU A O     1 
ATOM   1174 C  CB    . GLU A 1 160 ? -2.364  6.776   -6.635  1.00 16.26 ? 211 GLU A CB    1 
ATOM   1175 C  CG    . GLU A 1 160 ? -3.330  7.744   -7.372  1.00 16.33 ? 211 GLU A CG    1 
ATOM   1176 C  CD    . GLU A 1 160 ? -2.893  9.212   -7.374  1.00 16.32 ? 211 GLU A CD    1 
ATOM   1177 O  OE1   . GLU A 1 160 ? -1.724  9.508   -7.059  1.00 16.55 ? 211 GLU A OE1   1 
ATOM   1178 O  OE2   . GLU A 1 160 ? -3.736  10.077  -7.695  1.00 16.05 ? 211 GLU A OE2   1 
ATOM   1179 N  N     . GLN A 1 161 ? -2.564  4.355   -4.401  1.00 15.10 ? 212 GLN A N     1 
ATOM   1180 C  CA    . GLN A 1 161 ? -2.026  3.155   -3.761  1.00 14.66 ? 212 GLN A CA    1 
ATOM   1181 C  C     . GLN A 1 161 ? -1.118  2.320   -4.667  1.00 13.92 ? 212 GLN A C     1 
ATOM   1182 O  O     . GLN A 1 161 ? -0.252  1.594   -4.185  1.00 13.60 ? 212 GLN A O     1 
ATOM   1183 C  CB    . GLN A 1 161 ? -3.167  2.274   -3.238  1.00 14.85 ? 212 GLN A CB    1 
ATOM   1184 C  CG    . GLN A 1 161 ? -4.073  2.939   -2.190  1.00 15.40 ? 212 GLN A CG    1 
ATOM   1185 C  CD    . GLN A 1 161 ? -5.386  3.447   -2.767  1.00 16.07 ? 212 GLN A CD    1 
ATOM   1186 O  OE1   . GLN A 1 161 ? -5.423  3.990   -3.871  1.00 16.75 ? 212 GLN A OE1   1 
ATOM   1187 N  NE2   . GLN A 1 161 ? -6.471  3.276   -2.014  1.00 16.31 ? 212 GLN A NE2   1 
ATOM   1188 N  N     . ILE A 1 162 ? -1.333  2.399   -5.973  1.00 13.34 ? 213 ILE A N     1 
ATOM   1189 C  CA    . ILE A 1 162 ? -0.523  1.642   -6.925  1.00 13.00 ? 213 ILE A CA    1 
ATOM   1190 C  C     . ILE A 1 162 ? 0.132   2.593   -7.917  1.00 12.77 ? 213 ILE A C     1 
ATOM   1191 O  O     . ILE A 1 162 ? -0.544  3.434   -8.506  1.00 13.02 ? 213 ILE A O     1 
ATOM   1192 C  CB    . ILE A 1 162 ? -1.369  0.597   -7.706  1.00 12.85 ? 213 ILE A CB    1 
ATOM   1193 C  CG1   . ILE A 1 162 ? -1.986  -0.420  -6.748  1.00 12.36 ? 213 ILE A CG1   1 
ATOM   1194 C  CG2   . ILE A 1 162 ? -0.509  -0.134  -8.734  1.00 12.73 ? 213 ILE A CG2   1 
ATOM   1195 C  CD1   . ILE A 1 162 ? -2.354  -1.731  -7.406  1.00 12.09 ? 213 ILE A CD1   1 
ATOM   1196 N  N     . VAL A 1 163 ? 1.444   2.466   -8.094  1.00 12.28 ? 214 VAL A N     1 
ATOM   1197 C  CA    . VAL A 1 163 ? 2.156   3.233   -9.110  1.00 11.84 ? 214 VAL A CA    1 
ATOM   1198 C  C     . VAL A 1 163 ? 2.604   2.291   -10.213 1.00 11.92 ? 214 VAL A C     1 
ATOM   1199 O  O     . VAL A 1 163 ? 3.078   1.195   -9.931  1.00 12.07 ? 214 VAL A O     1 
ATOM   1200 C  CB    . VAL A 1 163 ? 3.386   3.939   -8.527  1.00 11.77 ? 214 VAL A CB    1 
ATOM   1201 C  CG1   . VAL A 1 163 ? 4.277   4.483   -9.644  1.00 11.10 ? 214 VAL A CG1   1 
ATOM   1202 C  CG2   . VAL A 1 163 ? 2.957   5.051   -7.568  1.00 11.41 ? 214 VAL A CG2   1 
ATOM   1203 N  N     . ILE A 1 164 ? 2.419   2.707   -11.466 1.00 11.81 ? 215 ILE A N     1 
ATOM   1204 C  CA    . ILE A 1 164 ? 3.036   2.038   -12.611 1.00 11.52 ? 215 ILE A CA    1 
ATOM   1205 C  C     . ILE A 1 164 ? 3.855   3.083   -13.346 1.00 11.46 ? 215 ILE A C     1 
ATOM   1206 O  O     . ILE A 1 164 ? 3.429   4.227   -13.475 1.00 11.57 ? 215 ILE A O     1 
ATOM   1207 C  CB    . ILE A 1 164 ? 2.005   1.368   -13.572 1.00 11.62 ? 215 ILE A CB    1 
ATOM   1208 C  CG1   . ILE A 1 164 ? 2.726   0.770   -14.790 1.00 11.43 ? 215 ILE A CG1   1 
ATOM   1209 C  CG2   . ILE A 1 164 ? 0.923   2.357   -14.026 1.00 11.24 ? 215 ILE A CG2   1 
ATOM   1210 C  CD1   . ILE A 1 164 ? 1.994   -0.349  -15.452 1.00 11.89 ? 215 ILE A CD1   1 
ATOM   1211 N  N     . GLY A 1 165 ? 5.033   2.697   -13.820 1.00 11.38 ? 216 GLY A N     1 
ATOM   1212 C  CA    . GLY A 1 165 ? 5.914   3.648   -14.468 1.00 11.53 ? 216 GLY A CA    1 
ATOM   1213 C  C     . GLY A 1 165 ? 7.080   3.034   -15.202 1.00 11.56 ? 216 GLY A C     1 
ATOM   1214 O  O     . GLY A 1 165 ? 7.294   1.826   -15.158 1.00 11.75 ? 216 GLY A O     1 
ATOM   1215 N  N     . THR A 1 166 ? 7.821   3.899   -15.885 1.00 11.50 ? 217 THR A N     1 
ATOM   1216 C  CA    . THR A 1 166 ? 9.020   3.533   -16.613 1.00 11.33 ? 217 THR A CA    1 
ATOM   1217 C  C     . THR A 1 166 ? 10.236  3.878   -15.727 1.00 11.60 ? 217 THR A C     1 
ATOM   1218 O  O     . THR A 1 166 ? 10.140  4.756   -14.868 1.00 11.89 ? 217 THR A O     1 
ATOM   1219 C  CB    . THR A 1 166 ? 9.058   4.276   -17.980 1.00 11.36 ? 217 THR A CB    1 
ATOM   1220 O  OG1   . THR A 1 166 ? 8.540   5.603   -17.826 1.00 10.40 ? 217 THR A OG1   1 
ATOM   1221 C  CG2   . THR A 1 166 ? 8.208   3.544   -19.013 1.00 10.55 ? 217 THR A CG2   1 
ATOM   1222 N  N     . PRO A 1 167 ? 11.379  3.187   -15.916 1.00 11.73 ? 218 PRO A N     1 
ATOM   1223 C  CA    . PRO A 1 167 ? 12.500  3.284   -14.963 1.00 11.74 ? 218 PRO A CA    1 
ATOM   1224 C  C     . PRO A 1 167 ? 12.973  4.691   -14.600 1.00 11.83 ? 218 PRO A C     1 
ATOM   1225 O  O     . PRO A 1 167 ? 13.214  4.973   -13.422 1.00 12.20 ? 218 PRO A O     1 
ATOM   1226 C  CB    . PRO A 1 167 ? 13.615  2.521   -15.671 1.00 11.89 ? 218 PRO A CB    1 
ATOM   1227 C  CG    . PRO A 1 167 ? 12.895  1.492   -16.467 1.00 11.86 ? 218 PRO A CG    1 
ATOM   1228 C  CD    . PRO A 1 167 ? 11.639  2.163   -16.947 1.00 11.62 ? 218 PRO A CD    1 
ATOM   1229 N  N     . GLY A 1 168 ? 13.107  5.566   -15.589 1.00 11.65 ? 219 GLY A N     1 
ATOM   1230 C  CA    . GLY A 1 168 ? 13.614  6.910   -15.344 1.00 11.48 ? 219 GLY A CA    1 
ATOM   1231 C  C     . GLY A 1 168 ? 12.709  7.754   -14.463 1.00 11.51 ? 219 GLY A C     1 
ATOM   1232 O  O     . GLY A 1 168 ? 13.138  8.285   -13.432 1.00 11.30 ? 219 GLY A O     1 
ATOM   1233 N  N     . THR A 1 169 ? 11.450  7.878   -14.874 1.00 11.62 ? 220 THR A N     1 
ATOM   1234 C  CA    . THR A 1 169 ? 10.479  8.712   -14.163 1.00 11.43 ? 220 THR A CA    1 
ATOM   1235 C  C     . THR A 1 169 ? 10.248  8.207   -12.745 1.00 11.50 ? 220 THR A C     1 
ATOM   1236 O  O     . THR A 1 169 ? 10.240  9.002   -11.802 1.00 11.33 ? 220 THR A O     1 
ATOM   1237 C  CB    . THR A 1 169 ? 9.142   8.776   -14.911 1.00 11.50 ? 220 THR A CB    1 
ATOM   1238 O  OG1   . THR A 1 169 ? 9.364   9.322   -16.217 1.00 11.03 ? 220 THR A OG1   1 
ATOM   1239 C  CG2   . THR A 1 169 ? 8.129   9.633   -14.148 1.00 10.75 ? 220 THR A CG2   1 
ATOM   1240 N  N     . VAL A 1 170 ? 10.078  6.894   -12.589 1.00 11.45 ? 221 VAL A N     1 
ATOM   1241 C  CA    . VAL A 1 170 ? 9.948   6.318   -11.252 1.00 11.69 ? 221 VAL A CA    1 
ATOM   1242 C  C     . VAL A 1 170 ? 11.158  6.690   -10.391 1.00 12.12 ? 221 VAL A C     1 
ATOM   1243 O  O     . VAL A 1 170 ? 11.002  7.063   -9.226  1.00 12.47 ? 221 VAL A O     1 
ATOM   1244 C  CB    . VAL A 1 170 ? 9.779   4.787   -11.275 1.00 11.60 ? 221 VAL A CB    1 
ATOM   1245 C  CG1   . VAL A 1 170 ? 9.955   4.220   -9.885  1.00 11.49 ? 221 VAL A CG1   1 
ATOM   1246 C  CG2   . VAL A 1 170 ? 8.404   4.401   -11.819 1.00 11.36 ? 221 VAL A CG2   1 
ATOM   1247 N  N     . LEU A 1 171 ? 12.355  6.620   -10.969 1.00 12.39 ? 222 LEU A N     1 
ATOM   1248 C  CA    . LEU A 1 171 ? 13.580  6.935   -10.235 1.00 12.48 ? 222 LEU A CA    1 
ATOM   1249 C  C     . LEU A 1 171 ? 13.585  8.375   -9.735  1.00 12.86 ? 222 LEU A C     1 
ATOM   1250 O  O     . LEU A 1 171 ? 14.006  8.638   -8.615  1.00 13.04 ? 222 LEU A O     1 
ATOM   1251 C  CB    . LEU A 1 171 ? 14.811  6.675   -11.108 1.00 12.49 ? 222 LEU A CB    1 
ATOM   1252 C  CG    . LEU A 1 171 ? 16.178  6.635   -10.424 1.00 12.04 ? 222 LEU A CG    1 
ATOM   1253 C  CD1   . LEU A 1 171 ? 16.203  5.616   -9.294  1.00 10.75 ? 222 LEU A CD1   1 
ATOM   1254 C  CD2   . LEU A 1 171 ? 17.262  6.323   -11.447 1.00 11.22 ? 222 LEU A CD2   1 
ATOM   1255 N  N     . ASP A 1 172 ? 13.120  9.304   -10.569 1.00 13.37 ? 223 ASP A N     1 
ATOM   1256 C  CA    . ASP A 1 172 ? 12.992  10.715  -10.171 1.00 13.56 ? 223 ASP A CA    1 
ATOM   1257 C  C     . ASP A 1 172 ? 11.901  10.923  -9.108  1.00 13.67 ? 223 ASP A C     1 
ATOM   1258 O  O     . ASP A 1 172 ? 12.071  11.727  -8.187  1.00 13.77 ? 223 ASP A O     1 
ATOM   1259 C  CB    . ASP A 1 172 ? 12.697  11.606  -11.389 1.00 13.59 ? 223 ASP A CB    1 
ATOM   1260 C  CG    . ASP A 1 172 ? 13.956  12.118  -12.068 1.00 14.27 ? 223 ASP A CG    1 
ATOM   1261 O  OD1   . ASP A 1 172 ? 15.070  11.820  -11.586 1.00 14.29 ? 223 ASP A OD1   1 
ATOM   1262 O  OD2   . ASP A 1 172 ? 13.828  12.838  -13.085 1.00 14.87 ? 223 ASP A OD2   1 
ATOM   1263 N  N     . TRP A 1 173 ? 10.782  10.213  -9.253  1.00 13.64 ? 224 TRP A N     1 
ATOM   1264 C  CA    . TRP A 1 173 ? 9.689   10.265  -8.274  1.00 13.45 ? 224 TRP A CA    1 
ATOM   1265 C  C     . TRP A 1 173 ? 10.142  9.777   -6.914  1.00 13.41 ? 224 TRP A C     1 
ATOM   1266 O  O     . TRP A 1 173 ? 9.751   10.334  -5.891  1.00 13.12 ? 224 TRP A O     1 
ATOM   1267 C  CB    . TRP A 1 173 ? 8.507   9.414   -8.746  1.00 13.44 ? 224 TRP A CB    1 
ATOM   1268 C  CG    . TRP A 1 173 ? 7.659   10.102  -9.743  1.00 12.68 ? 224 TRP A CG    1 
ATOM   1269 C  CD1   . TRP A 1 173 ? 8.053   11.052  -10.634 1.00 12.28 ? 224 TRP A CD1   1 
ATOM   1270 C  CD2   . TRP A 1 173 ? 6.268   9.888   -9.970  1.00 12.44 ? 224 TRP A CD2   1 
ATOM   1271 N  NE1   . TRP A 1 173 ? 6.988   11.456  -11.394 1.00 12.57 ? 224 TRP A NE1   1 
ATOM   1272 C  CE2   . TRP A 1 173 ? 5.877   10.753  -11.010 1.00 12.63 ? 224 TRP A CE2   1 
ATOM   1273 C  CE3   . TRP A 1 173 ? 5.308   9.055   -9.389  1.00 12.69 ? 224 TRP A CE3   1 
ATOM   1274 C  CZ2   . TRP A 1 173 ? 4.564   10.814  -11.481 1.00 12.65 ? 224 TRP A CZ2   1 
ATOM   1275 C  CZ3   . TRP A 1 173 ? 4.003   9.112   -9.859  1.00 13.04 ? 224 TRP A CZ3   1 
ATOM   1276 C  CH2   . TRP A 1 173 ? 3.644   9.984   -10.898 1.00 13.01 ? 224 TRP A CH2   1 
ATOM   1277 N  N     . CYS A 1 174 ? 10.969  8.733   -6.930  1.00 13.55 ? 225 CYS A N     1 
ATOM   1278 C  CA    . CYS A 1 174 ? 11.511  8.116   -5.722  1.00 13.76 ? 225 CYS A CA    1 
ATOM   1279 C  C     . CYS A 1 174 ? 12.742  8.822   -5.151  1.00 14.01 ? 225 CYS A C     1 
ATOM   1280 O  O     . CYS A 1 174 ? 13.195  8.480   -4.058  1.00 14.11 ? 225 CYS A O     1 
ATOM   1281 C  CB    . CYS A 1 174 ? 11.877  6.661   -6.013  1.00 13.85 ? 225 CYS A CB    1 
ATOM   1282 S  SG    . CYS A 1 174 ? 10.452  5.602   -6.336  1.00 13.69 ? 225 CYS A SG    1 
ATOM   1283 N  N     . SER A 1 175 ? 13.283  9.795   -5.881  1.00 14.23 ? 226 SER A N     1 
ATOM   1284 C  CA    . SER A 1 175 ? 14.491  10.497  -5.457  1.00 14.39 ? 226 SER A CA    1 
ATOM   1285 C  C     . SER A 1 175 ? 14.231  12.001  -5.375  1.00 14.43 ? 226 SER A C     1 
ATOM   1286 O  O     . SER A 1 175 ? 13.494  12.444  -4.496  1.00 14.58 ? 226 SER A O     1 
ATOM   1287 C  CB    . SER A 1 175 ? 15.648  10.166  -6.407  1.00 14.45 ? 226 SER A CB    1 
ATOM   1288 O  OG    . SER A 1 175 ? 15.832  8.764   -6.498  1.00 14.94 ? 226 SER A OG    1 
ATOM   1289 N  N     . LYS A 1 176 ? 14.805  12.774  -6.298  1.00 14.38 ? 227 LYS A N     1 
ATOM   1290 C  CA    . LYS A 1 176 ? 14.769  14.237  -6.234  1.00 14.33 ? 227 LYS A CA    1 
ATOM   1291 C  C     . LYS A 1 176 ? 13.365  14.851  -6.121  1.00 14.16 ? 227 LYS A C     1 
ATOM   1292 O  O     . LYS A 1 176 ? 13.197  15.886  -5.477  1.00 14.12 ? 227 LYS A O     1 
ATOM   1293 C  CB    . LYS A 1 176 ? 15.527  14.851  -7.422  1.00 14.37 ? 227 LYS A CB    1 
ATOM   1294 C  CG    . LYS A 1 176 ? 15.127  14.319  -8.797  1.00 14.76 ? 227 LYS A CG    1 
ATOM   1295 C  CD    . LYS A 1 176 ? 15.917  15.003  -9.910  1.00 14.97 ? 227 LYS A CD    1 
ATOM   1296 C  CE    . LYS A 1 176 ? 15.391  16.401  -10.204 1.00 15.01 ? 227 LYS A CE    1 
ATOM   1297 N  NZ    . LYS A 1 176 ? 16.078  17.032  -11.366 1.00 15.22 ? 227 LYS A NZ    1 
ATOM   1298 N  N     . LEU A 1 177 ? 12.361  14.225  -6.729  1.00 14.02 ? 228 LEU A N     1 
ATOM   1299 C  CA    . LEU A 1 177 ? 10.998  14.769  -6.678  1.00 13.84 ? 228 LEU A CA    1 
ATOM   1300 C  C     . LEU A 1 177 ? 10.270  14.436  -5.373  1.00 13.58 ? 228 LEU A C     1 
ATOM   1301 O  O     . LEU A 1 177 ? 9.352   15.152  -4.982  1.00 13.68 ? 228 LEU A O     1 
ATOM   1302 C  CB    . LEU A 1 177 ? 10.167  14.288  -7.874  1.00 13.86 ? 228 LEU A CB    1 
ATOM   1303 C  CG    . LEU A 1 177 ? 10.728  14.576  -9.268  1.00 13.56 ? 228 LEU A CG    1 
ATOM   1304 C  CD1   . LEU A 1 177 ? 9.725   14.157  -10.343 1.00 13.09 ? 228 LEU A CD1   1 
ATOM   1305 C  CD2   . LEU A 1 177 ? 11.096  16.042  -9.410  1.00 12.76 ? 228 LEU A CD2   1 
ATOM   1306 N  N     . LYS A 1 178 ? 10.676  13.359  -4.707  1.00 13.34 ? 229 LYS A N     1 
ATOM   1307 C  CA    . LYS A 1 178 ? 10.049  12.930  -3.455  1.00 13.37 ? 229 LYS A CA    1 
ATOM   1308 C  C     . LYS A 1 178 ? 8.531   12.785  -3.581  1.00 13.17 ? 229 LYS A C     1 
ATOM   1309 O  O     . LYS A 1 178 ? 7.784   13.193  -2.696  1.00 13.23 ? 229 LYS A O     1 
ATOM   1310 C  CB    . LYS A 1 178 ? 10.385  13.900  -2.316  1.00 13.34 ? 229 LYS A CB    1 
ATOM   1311 C  CG    . LYS A 1 178 ? 11.858  13.956  -1.935  1.00 14.22 ? 229 LYS A CG    1 
ATOM   1312 C  CD    . LYS A 1 178 ? 12.344  12.653  -1.288  1.00 14.88 ? 229 LYS A CD    1 
ATOM   1313 C  CE    . LYS A 1 178 ? 13.220  12.922  -0.059  1.00 15.14 ? 229 LYS A CE    1 
ATOM   1314 N  NZ    . LYS A 1 178 ? 12.423  13.465  1.085   1.00 14.87 ? 229 LYS A NZ    1 
ATOM   1315 N  N     . PHE A 1 179 ? 8.074   12.213  -4.684  1.00 12.97 ? 230 PHE A N     1 
ATOM   1316 C  CA    . PHE A 1 179 ? 6.654   11.948  -4.848  1.00 13.05 ? 230 PHE A CA    1 
ATOM   1317 C  C     . PHE A 1 179 ? 6.282   10.611  -4.196  1.00 12.73 ? 230 PHE A C     1 
ATOM   1318 O  O     . PHE A 1 179 ? 5.187   10.460  -3.654  1.00 12.61 ? 230 PHE A O     1 
ATOM   1319 C  CB    . PHE A 1 179 ? 6.251   11.965  -6.337  1.00 13.24 ? 230 PHE A CB    1 
ATOM   1320 C  CG    . PHE A 1 179 ? 6.392   13.323  -7.021  1.00 13.82 ? 230 PHE A CG    1 
ATOM   1321 C  CD1   . PHE A 1 179 ? 6.535   14.506  -6.298  1.00 13.94 ? 230 PHE A CD1   1 
ATOM   1322 C  CD2   . PHE A 1 179 ? 6.335   13.410  -8.408  1.00 14.69 ? 230 PHE A CD2   1 
ATOM   1323 C  CE1   . PHE A 1 179 ? 6.647   15.732  -6.946  1.00 13.98 ? 230 PHE A CE1   1 
ATOM   1324 C  CE2   . PHE A 1 179 ? 6.443   14.639  -9.059  1.00 14.55 ? 230 PHE A CE2   1 
ATOM   1325 C  CZ    . PHE A 1 179 ? 6.600   15.796  -8.326  1.00 14.15 ? 230 PHE A CZ    1 
ATOM   1326 N  N     . ILE A 1 180 ? 7.195   9.650   -4.246  1.00 12.53 ? 231 ILE A N     1 
ATOM   1327 C  CA    . ILE A 1 180 ? 6.957   8.322   -3.684  1.00 12.55 ? 231 ILE A CA    1 
ATOM   1328 C  C     . ILE A 1 180 ? 8.010   7.991   -2.639  1.00 12.36 ? 231 ILE A C     1 
ATOM   1329 O  O     . ILE A 1 180 ? 9.198   7.974   -2.949  1.00 12.34 ? 231 ILE A O     1 
ATOM   1330 C  CB    . ILE A 1 180 ? 7.028   7.214   -4.775  1.00 12.61 ? 231 ILE A CB    1 
ATOM   1331 C  CG1   . ILE A 1 180 ? 6.044   7.497   -5.913  1.00 12.97 ? 231 ILE A CG1   1 
ATOM   1332 C  CG2   . ILE A 1 180 ? 6.762   5.831   -4.168  1.00 12.07 ? 231 ILE A CG2   1 
ATOM   1333 C  CD1   . ILE A 1 180 ? 6.115   6.474   -7.049  1.00 13.18 ? 231 ILE A CD1   1 
ATOM   1334 N  N     . ASP A 1 181 ? 7.582   7.712   -1.412  1.00 12.25 ? 232 ASP A N     1 
ATOM   1335 C  CA    . ASP A 1 181 ? 8.484   7.133   -0.415  1.00 12.29 ? 232 ASP A CA    1 
ATOM   1336 C  C     . ASP A 1 181 ? 8.735   5.668   -0.801  1.00 12.19 ? 232 ASP A C     1 
ATOM   1337 O  O     . ASP A 1 181 ? 7.869   4.818   -0.596  1.00 12.40 ? 232 ASP A O     1 
ATOM   1338 C  CB    . ASP A 1 181 ? 7.876   7.228   0.989   1.00 12.14 ? 232 ASP A CB    1 
ATOM   1339 C  CG    . ASP A 1 181 ? 8.872   6.917   2.093   1.00 12.19 ? 232 ASP A CG    1 
ATOM   1340 O  OD1   . ASP A 1 181 ? 10.002  6.486   1.805   1.00 12.66 ? 232 ASP A OD1   1 
ATOM   1341 O  OD2   . ASP A 1 181 ? 8.523   7.109   3.274   1.00 13.43 ? 232 ASP A OD2   1 
ATOM   1342 N  N     . PRO A 1 182 ? 9.923   5.365   -1.357  1.00 12.11 ? 233 PRO A N     1 
ATOM   1343 C  CA    . PRO A 1 182 ? 10.135  3.999   -1.847  1.00 12.05 ? 233 PRO A CA    1 
ATOM   1344 C  C     . PRO A 1 182 ? 10.236  2.962   -0.725  1.00 12.02 ? 233 PRO A C     1 
ATOM   1345 O  O     . PRO A 1 182 ? 10.074  1.768   -0.978  1.00 12.17 ? 233 PRO A O     1 
ATOM   1346 C  CB    . PRO A 1 182 ? 11.458  4.100   -2.616  1.00 11.96 ? 233 PRO A CB    1 
ATOM   1347 C  CG    . PRO A 1 182 ? 12.185  5.239   -2.000  1.00 12.00 ? 233 PRO A CG    1 
ATOM   1348 C  CD    . PRO A 1 182 ? 11.179  6.142   -1.325  1.00 11.96 ? 233 PRO A CD    1 
ATOM   1349 N  N     . LYS A 1 183 ? 10.488  3.419   0.501   1.00 11.92 ? 234 LYS A N     1 
ATOM   1350 C  CA    . LYS A 1 183 ? 10.641  2.526   1.646   1.00 11.84 ? 234 LYS A CA    1 
ATOM   1351 C  C     . LYS A 1 183 ? 9.327   1.904   2.118   1.00 11.63 ? 234 LYS A C     1 
ATOM   1352 O  O     . LYS A 1 183 ? 9.346   0.962   2.914   1.00 11.27 ? 234 LYS A O     1 
ATOM   1353 C  CB    . LYS A 1 183 ? 11.309  3.264   2.806   1.00 11.93 ? 234 LYS A CB    1 
ATOM   1354 C  CG    . LYS A 1 183 ? 12.728  3.756   2.508   1.00 12.46 ? 234 LYS A CG    1 
ATOM   1355 C  CD    . LYS A 1 183 ? 13.705  2.621   2.178   1.00 13.01 ? 234 LYS A CD    1 
ATOM   1356 C  CE    . LYS A 1 183 ? 14.184  1.889   3.415   1.00 12.79 ? 234 LYS A CE    1 
ATOM   1357 N  NZ    . LYS A 1 183 ? 15.254  2.646   4.093   1.00 12.83 ? 234 LYS A NZ    1 
ATOM   1358 N  N     . LYS A 1 184 ? 8.199   2.423   1.628   1.00 11.58 ? 235 LYS A N     1 
ATOM   1359 C  CA    . LYS A 1 184 ? 6.876   1.873   1.949   1.00 11.49 ? 235 LYS A CA    1 
ATOM   1360 C  C     . LYS A 1 184 ? 6.339   0.932   0.864   1.00 11.61 ? 235 LYS A C     1 
ATOM   1361 O  O     . LYS A 1 184 ? 5.158   0.589   0.877   1.00 11.56 ? 235 LYS A O     1 
ATOM   1362 C  CB    . LYS A 1 184 ? 5.869   3.007   2.192   1.00 11.41 ? 235 LYS A CB    1 
ATOM   1363 C  CG    . LYS A 1 184 ? 6.130   3.794   3.458   1.00 11.22 ? 235 LYS A CG    1 
ATOM   1364 C  CD    . LYS A 1 184 ? 5.180   4.964   3.599   1.00 10.64 ? 235 LYS A CD    1 
ATOM   1365 C  CE    . LYS A 1 184 ? 5.565   5.817   4.786   1.00 10.15 ? 235 LYS A CE    1 
ATOM   1366 N  NZ    . LYS A 1 184 ? 4.507   6.800   5.100   1.00 10.06 ? 235 LYS A NZ    1 
ATOM   1367 N  N     . ILE A 1 185 ? 7.188   0.503   -0.068  1.00 11.77 ? 236 ILE A N     1 
ATOM   1368 C  CA    . ILE A 1 185 ? 6.743   -0.428  -1.112  1.00 11.87 ? 236 ILE A CA    1 
ATOM   1369 C  C     . ILE A 1 185 ? 6.751   -1.873  -0.581  1.00 12.33 ? 236 ILE A C     1 
ATOM   1370 O  O     . ILE A 1 185 ? 7.745   -2.340  -0.018  1.00 12.14 ? 236 ILE A O     1 
ATOM   1371 C  CB    . ILE A 1 185 ? 7.581   -0.287  -2.410  1.00 11.64 ? 236 ILE A CB    1 
ATOM   1372 C  CG1   . ILE A 1 185 ? 7.526   1.159   -2.926  1.00 11.24 ? 236 ILE A CG1   1 
ATOM   1373 C  CG2   . ILE A 1 185 ? 7.067   -1.234  -3.489  1.00 11.27 ? 236 ILE A CG2   1 
ATOM   1374 C  CD1   . ILE A 1 185 ? 6.139   1.644   -3.294  1.00 9.88  ? 236 ILE A CD1   1 
ATOM   1375 N  N     . LYS A 1 186 ? 5.614   -2.550  -0.750  1.00 13.00 ? 237 LYS A N     1 
ATOM   1376 C  CA    . LYS A 1 186 ? 5.404   -3.927  -0.286  1.00 13.42 ? 237 LYS A CA    1 
ATOM   1377 C  C     . LYS A 1 186 ? 5.668   -4.931  -1.405  1.00 13.68 ? 237 LYS A C     1 
ATOM   1378 O  O     . LYS A 1 186 ? 6.308   -5.962  -1.175  1.00 14.07 ? 237 LYS A O     1 
ATOM   1379 C  CB    . LYS A 1 186 ? 3.960   -4.120  0.185   1.00 13.55 ? 237 LYS A CB    1 
ATOM   1380 C  CG    . LYS A 1 186 ? 3.736   -3.953  1.670   1.00 14.14 ? 237 LYS A CG    1 
ATOM   1381 C  CD    . LYS A 1 186 ? 2.272   -4.220  2.043   1.00 14.79 ? 237 LYS A CD    1 
ATOM   1382 C  CE    . LYS A 1 186 ? 1.333   -3.198  1.402   1.00 15.63 ? 237 LYS A CE    1 
ATOM   1383 N  NZ    . LYS A 1 186 ? 0.228   -2.759  2.318   1.00 16.76 ? 237 LYS A NZ    1 
ATOM   1384 N  N     . VAL A 1 187 ? 5.127   -4.637  -2.594  1.00 13.62 ? 238 VAL A N     1 
ATOM   1385 C  CA    . VAL A 1 187 ? 5.278   -5.474  -3.789  1.00 13.39 ? 238 VAL A CA    1 
ATOM   1386 C  C     . VAL A 1 187 ? 5.944   -4.677  -4.909  1.00 13.65 ? 238 VAL A C     1 
ATOM   1387 O  O     . VAL A 1 187 ? 5.501   -3.578  -5.265  1.00 13.72 ? 238 VAL A O     1 
ATOM   1388 C  CB    . VAL A 1 187 ? 3.918   -5.987  -4.311  1.00 13.29 ? 238 VAL A CB    1 
ATOM   1389 C  CG1   . VAL A 1 187 ? 4.126   -6.927  -5.485  1.00 13.11 ? 238 VAL A CG1   1 
ATOM   1390 C  CG2   . VAL A 1 187 ? 3.138   -6.692  -3.202  1.00 12.84 ? 238 VAL A CG2   1 
ATOM   1391 N  N     . PHE A 1 188 ? 7.001   -5.253  -5.471  1.00 13.73 ? 239 PHE A N     1 
ATOM   1392 C  CA    . PHE A 1 188 ? 7.768   -4.632  -6.532  1.00 13.77 ? 239 PHE A CA    1 
ATOM   1393 C  C     . PHE A 1 188 ? 7.761   -5.584  -7.726  1.00 13.87 ? 239 PHE A C     1 
ATOM   1394 O  O     . PHE A 1 188 ? 8.282   -6.689  -7.625  1.00 14.08 ? 239 PHE A O     1 
ATOM   1395 C  CB    . PHE A 1 188 ? 9.187   -4.395  -6.017  1.00 13.90 ? 239 PHE A CB    1 
ATOM   1396 C  CG    . PHE A 1 188 ? 10.106  -3.734  -7.008  1.00 14.09 ? 239 PHE A CG    1 
ATOM   1397 C  CD1   . PHE A 1 188 ? 11.334  -4.300  -7.315  1.00 14.00 ? 239 PHE A CD1   1 
ATOM   1398 C  CD2   . PHE A 1 188 ? 9.756   -2.536  -7.614  1.00 14.77 ? 239 PHE A CD2   1 
ATOM   1399 C  CE1   . PHE A 1 188 ? 12.195  -3.688  -8.219  1.00 14.58 ? 239 PHE A CE1   1 
ATOM   1400 C  CE2   . PHE A 1 188 ? 10.617  -1.916  -8.523  1.00 14.94 ? 239 PHE A CE2   1 
ATOM   1401 C  CZ    . PHE A 1 188 ? 11.832  -2.500  -8.830  1.00 14.40 ? 239 PHE A CZ    1 
ATOM   1402 N  N     . VAL A 1 189 ? 7.155   -5.168  -8.840  1.00 13.76 ? 240 VAL A N     1 
ATOM   1403 C  CA    . VAL A 1 189 ? 7.018   -6.023  -10.025 1.00 13.63 ? 240 VAL A CA    1 
ATOM   1404 C  C     . VAL A 1 189 ? 7.843   -5.484  -11.173 1.00 13.77 ? 240 VAL A C     1 
ATOM   1405 O  O     . VAL A 1 189 ? 7.681   -4.324  -11.545 1.00 13.78 ? 240 VAL A O     1 
ATOM   1406 C  CB    . VAL A 1 189 ? 5.561   -6.094  -10.531 1.00 13.61 ? 240 VAL A CB    1 
ATOM   1407 C  CG1   . VAL A 1 189 ? 5.485   -6.950  -11.784 1.00 12.76 ? 240 VAL A CG1   1 
ATOM   1408 C  CG2   . VAL A 1 189 ? 4.629   -6.640  -9.449  1.00 13.67 ? 240 VAL A CG2   1 
ATOM   1409 N  N     . LEU A 1 190 ? 8.713   -6.326  -11.739 1.00 13.73 ? 241 LEU A N     1 
ATOM   1410 C  CA    . LEU A 1 190 ? 9.454   -5.988  -12.957 1.00 13.62 ? 241 LEU A CA    1 
ATOM   1411 C  C     . LEU A 1 190 ? 8.843   -6.768  -14.113 1.00 13.83 ? 241 LEU A C     1 
ATOM   1412 O  O     . LEU A 1 190 ? 9.134   -7.954  -14.285 1.00 14.15 ? 241 LEU A O     1 
ATOM   1413 C  CB    . LEU A 1 190 ? 10.939  -6.358  -12.837 1.00 13.53 ? 241 LEU A CB    1 
ATOM   1414 C  CG    . LEU A 1 190 ? 11.907  -5.434  -12.097 1.00 13.08 ? 241 LEU A CG    1 
ATOM   1415 C  CD1   . LEU A 1 190 ? 11.376  -5.076  -10.749 1.00 13.56 ? 241 LEU A CD1   1 
ATOM   1416 C  CD2   . LEU A 1 190 ? 13.255  -6.114  -11.943 1.00 12.32 ? 241 LEU A CD2   1 
ATOM   1417 N  N     . ASP A 1 191 ? 7.992   -6.120  -14.904 1.00 13.80 ? 242 ASP A N     1 
ATOM   1418 C  CA    . ASP A 1 191 ? 7.455   -6.772  -16.096 1.00 13.90 ? 242 ASP A CA    1 
ATOM   1419 C  C     . ASP A 1 191 ? 8.578   -6.803  -17.136 1.00 13.76 ? 242 ASP A C     1 
ATOM   1420 O  O     . ASP A 1 191 ? 9.474   -5.961  -17.113 1.00 13.80 ? 242 ASP A O     1 
ATOM   1421 C  CB    . ASP A 1 191 ? 6.209   -6.049  -16.632 1.00 13.92 ? 242 ASP A CB    1 
ATOM   1422 C  CG    . ASP A 1 191 ? 5.516   -6.814  -17.762 1.00 13.97 ? 242 ASP A CG    1 
ATOM   1423 O  OD1   . ASP A 1 191 ? 5.792   -8.022  -17.934 1.00 13.53 ? 242 ASP A OD1   1 
ATOM   1424 O  OD2   . ASP A 1 191 ? 4.693   -6.204  -18.480 1.00 13.72 ? 242 ASP A OD2   1 
ATOM   1425 N  N     . GLU A 1 192 ? 8.545   -7.801  -18.014 1.00 13.46 ? 243 GLU A N     1 
ATOM   1426 C  CA    . GLU A 1 192 ? 9.584   -7.981  -19.009 1.00 13.28 ? 243 GLU A CA    1 
ATOM   1427 C  C     . GLU A 1 192 ? 10.930  -7.930  -18.283 1.00 13.48 ? 243 GLU A C     1 
ATOM   1428 O  O     . GLU A 1 192 ? 11.877  -7.253  -18.711 1.00 13.67 ? 243 GLU A O     1 
ATOM   1429 C  CB    . GLU A 1 192 ? 9.473   -6.905  -20.107 1.00 13.11 ? 243 GLU A CB    1 
ATOM   1430 C  CG    . GLU A 1 192 ? 8.184   -6.962  -20.933 1.00 12.23 ? 243 GLU A CG    1 
ATOM   1431 C  CD    . GLU A 1 192 ? 8.110   -8.163  -21.863 1.00 11.80 ? 243 GLU A CD    1 
ATOM   1432 O  OE1   . GLU A 1 192 ? 7.042   -8.411  -22.465 1.00 11.30 ? 243 GLU A OE1   1 
ATOM   1433 O  OE2   . GLU A 1 192 ? 9.128   -8.862  -22.004 1.00 13.59 ? 243 GLU A OE2   1 
ATOM   1434 N  N     . ALA A 1 193 ? 10.992  -8.680  -17.184 1.00 13.41 ? 244 ALA A N     1 
ATOM   1435 C  CA    . ALA A 1 193 ? 12.081  -8.603  -16.209 1.00 13.29 ? 244 ALA A CA    1 
ATOM   1436 C  C     . ALA A 1 193 ? 13.477  -8.724  -16.808 1.00 13.06 ? 244 ALA A C     1 
ATOM   1437 O  O     . ALA A 1 193 ? 14.381  -7.985  -16.421 1.00 13.18 ? 244 ALA A O     1 
ATOM   1438 C  CB    . ALA A 1 193 ? 11.889  -9.664  -15.131 1.00 13.01 ? 244 ALA A CB    1 
ATOM   1439 N  N     . ASP A 1 194 ? 13.647  -9.657  -17.741 1.00 13.00 ? 245 ASP A N     1 
ATOM   1440 C  CA    . ASP A 1 194 ? 14.969  -9.984  -18.297 1.00 12.80 ? 245 ASP A CA    1 
ATOM   1441 C  C     . ASP A 1 194 ? 15.666  -8.791  -18.960 1.00 12.82 ? 245 ASP A C     1 
ATOM   1442 O  O     . ASP A 1 194 ? 16.888  -8.651  -18.853 1.00 12.66 ? 245 ASP A O     1 
ATOM   1443 C  CB    . ASP A 1 194 ? 14.876  -11.157 -19.277 1.00 12.68 ? 245 ASP A CB    1 
ATOM   1444 C  CG    . ASP A 1 194 ? 13.980  -10.864 -20.458 1.00 12.45 ? 245 ASP A CG    1 
ATOM   1445 O  OD1   . ASP A 1 194 ? 12.936  -10.218 -20.277 1.00 12.89 ? 245 ASP A OD1   1 
ATOM   1446 O  OD2   . ASP A 1 194 ? 14.301  -11.287 -21.581 1.00 13.43 ? 245 ASP A OD2   1 
ATOM   1447 N  N     . VAL A 1 195 ? 14.895  -7.936  -19.631 1.00 12.80 ? 246 VAL A N     1 
ATOM   1448 C  CA    . VAL A 1 195 ? 15.447  -6.721  -20.225 1.00 12.90 ? 246 VAL A CA    1 
ATOM   1449 C  C     . VAL A 1 195 ? 15.521  -5.591  -19.191 1.00 12.94 ? 246 VAL A C     1 
ATOM   1450 O  O     . VAL A 1 195 ? 16.315  -4.656  -19.337 1.00 13.26 ? 246 VAL A O     1 
ATOM   1451 C  CB    . VAL A 1 195 ? 14.646  -6.264  -21.462 1.00 12.86 ? 246 VAL A CB    1 
ATOM   1452 C  CG1   . VAL A 1 195 ? 13.292  -5.675  -21.059 1.00 13.19 ? 246 VAL A CG1   1 
ATOM   1453 C  CG2   . VAL A 1 195 ? 15.454  -5.265  -22.261 1.00 12.74 ? 246 VAL A CG2   1 
ATOM   1454 N  N     . MET A 1 196 ? 14.700  -5.679  -18.148 1.00 12.60 ? 247 MET A N     1 
ATOM   1455 C  CA    . MET A 1 196 ? 14.752  -4.709  -17.061 1.00 12.52 ? 247 MET A CA    1 
ATOM   1456 C  C     . MET A 1 196 ? 16.030  -4.830  -16.218 1.00 12.38 ? 247 MET A C     1 
ATOM   1457 O  O     . MET A 1 196 ? 16.425  -3.858  -15.579 1.00 12.57 ? 247 MET A O     1 
ATOM   1458 C  CB    . MET A 1 196 ? 13.516  -4.828  -16.157 1.00 12.49 ? 247 MET A CB    1 
ATOM   1459 C  CG    . MET A 1 196 ? 12.202  -4.485  -16.843 1.00 12.48 ? 247 MET A CG    1 
ATOM   1460 S  SD    . MET A 1 196 ? 12.130  -2.795  -17.483 1.00 12.80 ? 247 MET A SD    1 
ATOM   1461 C  CE    . MET A 1 196 ? 12.041  -1.877  -15.951 1.00 13.04 ? 247 MET A CE    1 
ATOM   1462 N  N     . ILE A 1 197 ? 16.669  -6.005  -16.215 1.00 12.05 ? 248 ILE A N     1 
ATOM   1463 C  CA    . ILE A 1 197 ? 17.885  -6.231  -15.410 1.00 11.69 ? 248 ILE A CA    1 
ATOM   1464 C  C     . ILE A 1 197 ? 19.157  -6.488  -16.236 1.00 11.67 ? 248 ILE A C     1 
ATOM   1465 O  O     . ILE A 1 197 ? 20.232  -6.604  -15.665 1.00 11.87 ? 248 ILE A O     1 
ATOM   1466 C  CB    . ILE A 1 197 ? 17.698  -7.400  -14.394 1.00 11.64 ? 248 ILE A CB    1 
ATOM   1467 C  CG1   . ILE A 1 197 ? 17.659  -8.756  -15.095 1.00 11.26 ? 248 ILE A CG1   1 
ATOM   1468 C  CG2   . ILE A 1 197 ? 16.416  -7.215  -13.572 1.00 11.52 ? 248 ILE A CG2   1 
ATOM   1469 C  CD1   . ILE A 1 197 ? 17.708  -9.915  -14.147 1.00 11.31 ? 248 ILE A CD1   1 
ATOM   1470 N  N     . ALA A 1 198 ? 19.034  -6.582  -17.562 1.00 11.58 ? 249 ALA A N     1 
ATOM   1471 C  CA    . ALA A 1 198 ? 20.182  -6.801  -18.453 1.00 11.43 ? 249 ALA A CA    1 
ATOM   1472 C  C     . ALA A 1 198 ? 20.937  -5.494  -18.690 1.00 11.44 ? 249 ALA A C     1 
ATOM   1473 O  O     . ALA A 1 198 ? 20.312  -4.453  -18.840 1.00 11.27 ? 249 ALA A O     1 
ATOM   1474 C  CB    . ALA A 1 198 ? 19.715  -7.382  -19.779 1.00 11.31 ? 249 ALA A CB    1 
ATOM   1475 N  N     . THR A 1 199 ? 22.271  -5.558  -18.739 1.00 11.55 ? 250 THR A N     1 
ATOM   1476 C  CA    . THR A 1 199 ? 23.122  -4.361  -18.825 1.00 11.67 ? 250 THR A CA    1 
ATOM   1477 C  C     . THR A 1 199 ? 22.772  -3.480  -20.000 1.00 11.72 ? 250 THR A C     1 
ATOM   1478 O  O     . THR A 1 199 ? 22.785  -2.254  -19.888 1.00 11.56 ? 250 THR A O     1 
ATOM   1479 C  CB    . THR A 1 199 ? 24.605  -4.723  -18.994 1.00 11.75 ? 250 THR A CB    1 
ATOM   1480 O  OG1   . THR A 1 199 ? 25.002  -5.605  -17.943 1.00 12.94 ? 250 THR A OG1   1 
ATOM   1481 C  CG2   . THR A 1 199 ? 25.476  -3.466  -18.965 1.00 11.14 ? 250 THR A CG2   1 
ATOM   1482 N  N     . GLN A 1 200 ? 22.493  -4.118  -21.131 1.00 11.97 ? 251 GLN A N     1 
ATOM   1483 C  CA    . GLN A 1 200 ? 22.089  -3.414  -22.341 1.00 12.39 ? 251 GLN A CA    1 
ATOM   1484 C  C     . GLN A 1 200 ? 20.607  -2.985  -22.307 1.00 12.27 ? 251 GLN A C     1 
ATOM   1485 O  O     . GLN A 1 200 ? 20.163  -2.224  -23.170 1.00 12.35 ? 251 GLN A O     1 
ATOM   1486 C  CB    . GLN A 1 200 ? 22.414  -4.253  -23.587 1.00 12.56 ? 251 GLN A CB    1 
ATOM   1487 C  CG    . GLN A 1 200 ? 23.563  -3.702  -24.451 1.00 13.85 ? 251 GLN A CG    1 
ATOM   1488 C  CD    . GLN A 1 200 ? 24.818  -3.313  -23.661 1.00 15.76 ? 251 GLN A CD    1 
ATOM   1489 O  OE1   . GLN A 1 200 ? 25.443  -2.287  -23.945 1.00 17.18 ? 251 GLN A OE1   1 
ATOM   1490 N  NE2   . GLN A 1 200 ? 25.191  -4.131  -22.677 1.00 16.63 ? 251 GLN A NE2   1 
ATOM   1491 N  N     . GLY A 1 201 ? 19.864  -3.464  -21.307 1.00 12.12 ? 252 GLY A N     1 
ATOM   1492 C  CA    . GLY A 1 201 ? 18.513  -2.974  -21.007 1.00 12.08 ? 252 GLY A CA    1 
ATOM   1493 C  C     . GLY A 1 201 ? 18.517  -1.909  -19.918 1.00 11.95 ? 252 GLY A C     1 
ATOM   1494 O  O     . GLY A 1 201 ? 19.345  -1.013  -19.944 1.00 11.97 ? 252 GLY A O     1 
ATOM   1495 N  N     . HIS A 1 202 ? 17.609  -2.018  -18.950 1.00 12.16 ? 253 HIS A N     1 
ATOM   1496 C  CA    . HIS A 1 202 ? 17.442  -0.992  -17.906 1.00 12.25 ? 253 HIS A CA    1 
ATOM   1497 C  C     . HIS A 1 202 ? 18.081  -1.324  -16.547 1.00 12.32 ? 253 HIS A C     1 
ATOM   1498 O  O     . HIS A 1 202 ? 17.643  -0.812  -15.517 1.00 12.14 ? 253 HIS A O     1 
ATOM   1499 C  CB    . HIS A 1 202 ? 15.953  -0.718  -17.702 1.00 12.27 ? 253 HIS A CB    1 
ATOM   1500 C  CG    . HIS A 1 202 ? 15.255  -0.269  -18.944 1.00 12.53 ? 253 HIS A CG    1 
ATOM   1501 N  ND1   . HIS A 1 202 ? 14.776  -1.153  -19.887 1.00 12.68 ? 253 HIS A ND1   1 
ATOM   1502 C  CD2   . HIS A 1 202 ? 14.974  0.970   -19.410 1.00 12.57 ? 253 HIS A CD2   1 
ATOM   1503 C  CE1   . HIS A 1 202 ? 14.220  -0.477  -20.876 1.00 12.62 ? 253 HIS A CE1   1 
ATOM   1504 N  NE2   . HIS A 1 202 ? 14.330  0.813   -20.612 1.00 12.64 ? 253 HIS A NE2   1 
ATOM   1505 N  N     . GLN A 1 203 ? 19.131  -2.142  -16.550 1.00 12.42 ? 254 GLN A N     1 
ATOM   1506 C  CA    . GLN A 1 203 ? 19.745  -2.623  -15.315 1.00 12.76 ? 254 GLN A CA    1 
ATOM   1507 C  C     . GLN A 1 203 ? 20.084  -1.515  -14.324 1.00 13.08 ? 254 GLN A C     1 
ATOM   1508 O  O     . GLN A 1 203 ? 19.712  -1.596  -13.155 1.00 13.31 ? 254 GLN A O     1 
ATOM   1509 C  CB    . GLN A 1 203 ? 21.016  -3.404  -15.633 1.00 12.93 ? 254 GLN A CB    1 
ATOM   1510 C  CG    . GLN A 1 203 ? 21.714  -4.011  -14.417 1.00 13.06 ? 254 GLN A CG    1 
ATOM   1511 C  CD    . GLN A 1 203 ? 22.993  -4.721  -14.794 1.00 13.17 ? 254 GLN A CD    1 
ATOM   1512 O  OE1   . GLN A 1 203 ? 24.066  -4.401  -14.282 1.00 13.24 ? 254 GLN A OE1   1 
ATOM   1513 N  NE2   . GLN A 1 203 ? 22.893  -5.678  -15.709 1.00 12.70 ? 254 GLN A NE2   1 
ATOM   1514 N  N     . ASP A 1 204 ? 20.804  -0.498  -14.791 1.00 13.47 ? 255 ASP A N     1 
ATOM   1515 C  CA    . ASP A 1 204 ? 21.273  0.595   -13.928 1.00 13.81 ? 255 ASP A CA    1 
ATOM   1516 C  C     . ASP A 1 204 ? 20.156  1.258   -13.118 1.00 13.86 ? 255 ASP A C     1 
ATOM   1517 O  O     . ASP A 1 204 ? 20.226  1.308   -11.889 1.00 13.83 ? 255 ASP A O     1 
ATOM   1518 C  CB    . ASP A 1 204 ? 22.003  1.659   -14.756 1.00 13.89 ? 255 ASP A CB    1 
ATOM   1519 C  CG    . ASP A 1 204 ? 23.385  1.199   -15.233 1.00 14.92 ? 255 ASP A CG    1 
ATOM   1520 O  OD1   . ASP A 1 204 ? 23.967  1.889   -16.106 1.00 15.40 ? 255 ASP A OD1   1 
ATOM   1521 O  OD2   . ASP A 1 204 ? 23.896  0.163   -14.738 1.00 16.14 ? 255 ASP A OD2   1 
ATOM   1522 N  N     . GLN A 1 205 ? 19.136  1.767   -13.807 1.00 13.89 ? 256 GLN A N     1 
ATOM   1523 C  CA    . GLN A 1 205 ? 18.021  2.443   -13.140 1.00 13.91 ? 256 GLN A CA    1 
ATOM   1524 C  C     . GLN A 1 205 ? 17.174  1.461   -12.336 1.00 13.78 ? 256 GLN A C     1 
ATOM   1525 O  O     . GLN A 1 205 ? 16.725  1.790   -11.234 1.00 13.49 ? 256 GLN A O     1 
ATOM   1526 C  CB    . GLN A 1 205 ? 17.131  3.171   -14.153 1.00 14.00 ? 256 GLN A CB    1 
ATOM   1527 C  CG    . GLN A 1 205 ? 17.759  4.406   -14.797 1.00 14.59 ? 256 GLN A CG    1 
ATOM   1528 C  CD    . GLN A 1 205 ? 16.920  4.956   -15.948 1.00 15.52 ? 256 GLN A CD    1 
ATOM   1529 O  OE1   . GLN A 1 205 ? 16.114  4.237   -16.534 1.00 16.90 ? 256 GLN A OE1   1 
ATOM   1530 N  NE2   . GLN A 1 205 ? 17.107  6.231   -16.275 1.00 15.82 ? 256 GLN A NE2   1 
ATOM   1531 N  N     . SER A 1 206 ? 16.950  0.271   -12.903 1.00 13.70 ? 257 SER A N     1 
ATOM   1532 C  CA    . SER A 1 206 ? 16.161  -0.782  -12.258 1.00 13.74 ? 257 SER A CA    1 
ATOM   1533 C  C     . SER A 1 206 ? 16.747  -1.170  -10.909 1.00 13.91 ? 257 SER A C     1 
ATOM   1534 O  O     . SER A 1 206 ? 16.034  -1.243  -9.912  1.00 13.96 ? 257 SER A O     1 
ATOM   1535 C  CB    . SER A 1 206 ? 16.092  -2.035  -13.136 1.00 13.65 ? 257 SER A CB    1 
ATOM   1536 O  OG    . SER A 1 206 ? 15.334  -1.818  -14.312 1.00 13.72 ? 257 SER A OG    1 
ATOM   1537 N  N     . ILE A 1 207 ? 18.046  -1.433  -10.882 1.00 14.21 ? 258 ILE A N     1 
ATOM   1538 C  CA    . ILE A 1 207 ? 18.707  -1.805  -9.640  1.00 14.43 ? 258 ILE A CA    1 
ATOM   1539 C  C     . ILE A 1 207 ? 18.769  -0.620  -8.682  1.00 14.73 ? 258 ILE A C     1 
ATOM   1540 O  O     . ILE A 1 207 ? 18.611  -0.793  -7.470  1.00 14.95 ? 258 ILE A O     1 
ATOM   1541 C  CB    . ILE A 1 207 ? 20.119  -2.371  -9.888  1.00 14.30 ? 258 ILE A CB    1 
ATOM   1542 C  CG1   . ILE A 1 207 ? 20.032  -3.649  -10.730 1.00 14.31 ? 258 ILE A CG1   1 
ATOM   1543 C  CG2   . ILE A 1 207 ? 20.825  -2.651  -8.567  1.00 14.00 ? 258 ILE A CG2   1 
ATOM   1544 C  CD1   . ILE A 1 207 ? 18.950  -4.617  -10.285 1.00 13.64 ? 258 ILE A CD1   1 
ATOM   1545 N  N     . ARG A 1 208 ? 18.972  0.582   -9.211  1.00 14.86 ? 259 ARG A N     1 
ATOM   1546 C  CA    . ARG A 1 208 ? 19.060  1.745   -8.344  1.00 15.31 ? 259 ARG A CA    1 
ATOM   1547 C  C     . ARG A 1 208 ? 17.725  2.033   -7.647  1.00 15.34 ? 259 ARG A C     1 
ATOM   1548 O  O     . ARG A 1 208 ? 17.717  2.500   -6.510  1.00 15.43 ? 259 ARG A O     1 
ATOM   1549 C  CB    . ARG A 1 208 ? 19.576  2.974   -9.096  1.00 15.49 ? 259 ARG A CB    1 
ATOM   1550 C  CG    . ARG A 1 208 ? 19.982  4.102   -8.148  1.00 16.56 ? 259 ARG A CG    1 
ATOM   1551 C  CD    . ARG A 1 208 ? 21.258  4.819   -8.566  1.00 18.49 ? 259 ARG A CD    1 
ATOM   1552 N  NE    . ARG A 1 208 ? 20.997  5.905   -9.513  1.00 20.22 ? 259 ARG A NE    1 
ATOM   1553 C  CZ    . ARG A 1 208 ? 21.085  5.812   -10.841 1.00 21.77 ? 259 ARG A CZ    1 
ATOM   1554 N  NH1   . ARG A 1 208 ? 21.436  4.671   -11.438 1.00 22.60 ? 259 ARG A NH1   1 
ATOM   1555 N  NH2   . ARG A 1 208 ? 20.820  6.880   -11.588 1.00 22.35 ? 259 ARG A NH2   1 
ATOM   1556 N  N     . ILE A 1 209 ? 16.612  1.743   -8.324  1.00 15.38 ? 260 ILE A N     1 
ATOM   1557 C  CA    . ILE A 1 209 ? 15.279  1.793   -7.709  1.00 15.42 ? 260 ILE A CA    1 
ATOM   1558 C  C     . ILE A 1 209 ? 15.114  0.674   -6.670  1.00 15.63 ? 260 ILE A C     1 
ATOM   1559 O  O     . ILE A 1 209 ? 14.665  0.915   -5.553  1.00 15.77 ? 260 ILE A O     1 
ATOM   1560 C  CB    . ILE A 1 209 ? 14.136  1.682   -8.766  1.00 15.29 ? 260 ILE A CB    1 
ATOM   1561 C  CG1   . ILE A 1 209 ? 14.047  2.961   -9.603  1.00 15.13 ? 260 ILE A CG1   1 
ATOM   1562 C  CG2   . ILE A 1 209 ? 12.795  1.426   -8.091  1.00 14.83 ? 260 ILE A CG2   1 
ATOM   1563 C  CD1   . ILE A 1 209 ? 13.228  2.817   -10.858 1.00 14.28 ? 260 ILE A CD1   1 
ATOM   1564 N  N     . GLN A 1 210 ? 15.485  -0.545  -7.043  1.00 15.87 ? 261 GLN A N     1 
ATOM   1565 C  CA    . GLN A 1 210 ? 15.377  -1.701  -6.149  1.00 16.01 ? 261 GLN A CA    1 
ATOM   1566 C  C     . GLN A 1 210 ? 16.085  -1.457  -4.815  1.00 15.83 ? 261 GLN A C     1 
ATOM   1567 O  O     . GLN A 1 210 ? 15.537  -1.759  -3.756  1.00 15.73 ? 261 GLN A O     1 
ATOM   1568 C  CB    . GLN A 1 210 ? 15.966  -2.935  -6.827  1.00 16.12 ? 261 GLN A CB    1 
ATOM   1569 C  CG    . GLN A 1 210 ? 15.848  -4.216  -6.018  1.00 16.73 ? 261 GLN A CG    1 
ATOM   1570 C  CD    . GLN A 1 210 ? 17.012  -5.151  -6.256  1.00 18.06 ? 261 GLN A CD    1 
ATOM   1571 O  OE1   . GLN A 1 210 ? 17.745  -5.016  -7.240  1.00 18.77 ? 261 GLN A OE1   1 
ATOM   1572 N  NE2   . GLN A 1 210 ? 17.201  -6.104  -5.345  1.00 19.81 ? 261 GLN A NE2   1 
ATOM   1573 N  N     . ARG A 1 211 ? 17.299  -0.911  -4.886  1.00 15.61 ? 262 ARG A N     1 
ATOM   1574 C  CA    . ARG A 1 211 ? 18.079  -0.565  -3.703  1.00 15.58 ? 262 ARG A CA    1 
ATOM   1575 C  C     . ARG A 1 211 ? 17.323  0.330   -2.728  1.00 15.28 ? 262 ARG A C     1 
ATOM   1576 O  O     . ARG A 1 211 ? 17.511  0.231   -1.523  1.00 15.24 ? 262 ARG A O     1 
ATOM   1577 C  CB    . ARG A 1 211 ? 19.382  0.137   -4.102  1.00 15.88 ? 262 ARG A CB    1 
ATOM   1578 C  CG    . ARG A 1 211 ? 20.463  -0.786  -4.657  1.00 16.71 ? 262 ARG A CG    1 
ATOM   1579 C  CD    . ARG A 1 211 ? 21.854  -0.291  -4.270  1.00 17.88 ? 262 ARG A CD    1 
ATOM   1580 N  NE    . ARG A 1 211 ? 22.905  -1.000  -4.995  1.00 19.21 ? 262 ARG A NE    1 
ATOM   1581 C  CZ    . ARG A 1 211 ? 23.284  -0.737  -6.248  1.00 20.24 ? 262 ARG A CZ    1 
ATOM   1582 N  NH1   . ARG A 1 211 ? 22.704  0.231   -6.959  1.00 20.43 ? 262 ARG A NH1   1 
ATOM   1583 N  NH2   . ARG A 1 211 ? 24.255  -1.456  -6.800  1.00 20.78 ? 262 ARG A NH2   1 
ATOM   1584 N  N     . MET A 1 212 ? 16.464  1.200   -3.249  1.00 15.14 ? 263 MET A N     1 
ATOM   1585 C  CA    . MET A 1 212 ? 15.706  2.127   -2.408  1.00 14.83 ? 263 MET A CA    1 
ATOM   1586 C  C     . MET A 1 212 ? 14.539  1.463   -1.664  1.00 14.64 ? 263 MET A C     1 
ATOM   1587 O  O     . MET A 1 212 ? 13.938  2.084   -0.783  1.00 14.61 ? 263 MET A O     1 
ATOM   1588 C  CB    . MET A 1 212 ? 15.176  3.290   -3.246  1.00 14.69 ? 263 MET A CB    1 
ATOM   1589 C  CG    . MET A 1 212 ? 16.230  3.994   -4.069  1.00 14.55 ? 263 MET A CG    1 
ATOM   1590 S  SD    . MET A 1 212 ? 15.574  5.436   -4.925  1.00 14.89 ? 263 MET A SD    1 
ATOM   1591 C  CE    . MET A 1 212 ? 15.692  6.678   -3.636  1.00 15.45 ? 263 MET A CE    1 
ATOM   1592 N  N     . LEU A 1 213 ? 14.222  0.215   -2.009  1.00 14.36 ? 264 LEU A N     1 
ATOM   1593 C  CA    . LEU A 1 213 ? 13.089  -0.491  -1.394  1.00 14.50 ? 264 LEU A CA    1 
ATOM   1594 C  C     . LEU A 1 213 ? 13.416  -0.980  0.027   1.00 14.70 ? 264 LEU A C     1 
ATOM   1595 O  O     . LEU A 1 213 ? 14.585  -1.021  0.412   1.00 14.55 ? 264 LEU A O     1 
ATOM   1596 C  CB    . LEU A 1 213 ? 12.655  -1.666  -2.283  1.00 14.32 ? 264 LEU A CB    1 
ATOM   1597 C  CG    . LEU A 1 213 ? 12.233  -1.312  -3.718  1.00 13.83 ? 264 LEU A CG    1 
ATOM   1598 C  CD1   . LEU A 1 213 ? 12.003  -2.578  -4.521  1.00 13.63 ? 264 LEU A CD1   1 
ATOM   1599 C  CD2   . LEU A 1 213 ? 10.993  -0.412  -3.761  1.00 12.43 ? 264 LEU A CD2   1 
ATOM   1600 N  N     . PRO A 1 214 ? 12.381  -1.327  0.822   1.00 15.09 ? 265 PRO A N     1 
ATOM   1601 C  CA    . PRO A 1 214 ? 12.638  -1.913  2.136   1.00 15.37 ? 265 PRO A CA    1 
ATOM   1602 C  C     . PRO A 1 214 ? 13.064  -3.382  2.057   1.00 16.02 ? 265 PRO A C     1 
ATOM   1603 O  O     . PRO A 1 214 ? 12.800  -4.060  1.057   1.00 15.96 ? 265 PRO A O     1 
ATOM   1604 C  CB    . PRO A 1 214 ? 11.282  -1.790  2.843   1.00 15.24 ? 265 PRO A CB    1 
ATOM   1605 C  CG    . PRO A 1 214 ? 10.298  -1.828  1.766   1.00 15.10 ? 265 PRO A CG    1 
ATOM   1606 C  CD    . PRO A 1 214 ? 10.938  -1.110  0.605   1.00 15.13 ? 265 PRO A CD    1 
ATOM   1607 N  N     . ARG A 1 215 ? 13.708  -3.854  3.122   1.00 16.72 ? 266 ARG A N     1 
ATOM   1608 C  CA    . ARG A 1 215 ? 14.162  -5.245  3.243   1.00 17.34 ? 266 ARG A CA    1 
ATOM   1609 C  C     . ARG A 1 215 ? 12.996  -6.239  3.063   1.00 17.54 ? 266 ARG A C     1 
ATOM   1610 O  O     . ARG A 1 215 ? 13.144  -7.259  2.387   1.00 17.63 ? 266 ARG A O     1 
ATOM   1611 C  CB    . ARG A 1 215 ? 14.848  -5.429  4.604   1.00 17.55 ? 266 ARG A CB    1 
ATOM   1612 C  CG    . ARG A 1 215 ? 15.714  -6.679  4.770   1.00 18.75 ? 266 ARG A CG    1 
ATOM   1613 C  CD    . ARG A 1 215 ? 14.931  -7.884  5.293   1.00 20.37 ? 266 ARG A CD    1 
ATOM   1614 N  NE    . ARG A 1 215 ? 14.057  -7.547  6.421   1.00 21.76 ? 266 ARG A NE    1 
ATOM   1615 C  CZ    . ARG A 1 215 ? 13.031  -8.290  6.852   1.00 22.57 ? 266 ARG A CZ    1 
ATOM   1616 N  NH1   . ARG A 1 215 ? 12.721  -9.453  6.279   1.00 22.60 ? 266 ARG A NH1   1 
ATOM   1617 N  NH2   . ARG A 1 215 ? 12.303  -7.863  7.878   1.00 23.19 ? 266 ARG A NH2   1 
ATOM   1618 N  N     . ASN A 1 216 ? 11.838  -5.925  3.647   1.00 17.62 ? 267 ASN A N     1 
ATOM   1619 C  CA    . ASN A 1 216 ? 10.646  -6.775  3.536   1.00 17.72 ? 267 ASN A CA    1 
ATOM   1620 C  C     . ASN A 1 216 ? 9.774   -6.368  2.353   1.00 17.60 ? 267 ASN A C     1 
ATOM   1621 O  O     . ASN A 1 216 ? 8.634   -5.923  2.515   1.00 17.71 ? 267 ASN A O     1 
ATOM   1622 C  CB    . ASN A 1 216 ? 9.816   -6.711  4.825   1.00 17.88 ? 267 ASN A CB    1 
ATOM   1623 C  CG    . ASN A 1 216 ? 9.052   -5.398  4.964   1.00 18.70 ? 267 ASN A CG    1 
ATOM   1624 O  OD1   . ASN A 1 216 ? 9.594   -4.314  4.692   1.00 19.49 ? 267 ASN A OD1   1 
ATOM   1625 N  ND2   . ASN A 1 216 ? 7.780   -5.490  5.361   1.00 19.20 ? 267 ASN A ND2   1 
ATOM   1626 N  N     . CYS A 1 217 ? 10.314  -6.512  1.154   1.00 17.37 ? 268 CYS A N     1 
ATOM   1627 C  CA    . CYS A 1 217 ? 9.572   -6.183  -0.051  1.00 16.90 ? 268 CYS A CA    1 
ATOM   1628 C  C     . CYS A 1 217 ? 9.527   -7.419  -0.909  1.00 16.30 ? 268 CYS A C     1 
ATOM   1629 O  O     . CYS A 1 217 ? 10.573  -7.967  -1.245  1.00 16.34 ? 268 CYS A O     1 
ATOM   1630 C  CB    . CYS A 1 217 ? 10.259  -5.048  -0.802  1.00 16.99 ? 268 CYS A CB    1 
ATOM   1631 S  SG    . CYS A 1 217 ? 9.356   -4.488  -2.251  1.00 17.52 ? 268 CYS A SG    1 
ATOM   1632 N  N     . GLN A 1 218 ? 8.319   -7.871  -1.237  1.00 15.81 ? 269 GLN A N     1 
ATOM   1633 C  CA    . GLN A 1 218 ? 8.140   -8.992  -2.152  1.00 15.32 ? 269 GLN A CA    1 
ATOM   1634 C  C     . GLN A 1 218 ? 8.522   -8.518  -3.540  1.00 15.24 ? 269 GLN A C     1 
ATOM   1635 O  O     . GLN A 1 218 ? 8.163   -7.413  -3.937  1.00 15.39 ? 269 GLN A O     1 
ATOM   1636 C  CB    . GLN A 1 218 ? 6.692   -9.490  -2.147  1.00 15.17 ? 269 GLN A CB    1 
ATOM   1637 C  CG    . GLN A 1 218 ? 6.487   -10.777 -2.941  1.00 14.52 ? 269 GLN A CG    1 
ATOM   1638 C  CD    . GLN A 1 218 ? 5.049   -11.247 -2.955  1.00 13.91 ? 269 GLN A CD    1 
ATOM   1639 O  OE1   . GLN A 1 218 ? 4.123   -10.447 -2.856  1.00 14.70 ? 269 GLN A OE1   1 
ATOM   1640 N  NE2   . GLN A 1 218 ? 4.853   -12.553 -3.090  1.00 12.69 ? 269 GLN A NE2   1 
ATOM   1641 N  N     . MET A 1 219 ? 9.259   -9.348  -4.272  1.00 15.11 ? 270 MET A N     1 
ATOM   1642 C  CA    . MET A 1 219 ? 9.729   -8.983  -5.600  1.00 14.87 ? 270 MET A CA    1 
ATOM   1643 C  C     . MET A 1 219 ? 9.314   -10.027 -6.602  1.00 14.35 ? 270 MET A C     1 
ATOM   1644 O  O     . MET A 1 219 ? 9.467   -11.222 -6.361  1.00 14.36 ? 270 MET A O     1 
ATOM   1645 C  CB    . MET A 1 219 ? 11.234  -8.817  -5.596  1.00 15.09 ? 270 MET A CB    1 
ATOM   1646 C  CG    . MET A 1 219 ? 11.672  -7.744  -4.632  1.00 16.34 ? 270 MET A CG    1 
ATOM   1647 S  SD    . MET A 1 219 ? 13.422  -7.401  -4.727  1.00 19.85 ? 270 MET A SD    1 
ATOM   1648 C  CE    . MET A 1 219 ? 13.800  -7.026  -3.000  1.00 18.56 ? 270 MET A CE    1 
ATOM   1649 N  N     . LEU A 1 220 ? 8.788   -9.557  -7.729  1.00 13.77 ? 271 LEU A N     1 
ATOM   1650 C  CA    . LEU A 1 220 ? 8.179   -10.412 -8.734  1.00 13.09 ? 271 LEU A CA    1 
ATOM   1651 C  C     . LEU A 1 220 ? 8.716   -10.034 -10.100 1.00 12.90 ? 271 LEU A C     1 
ATOM   1652 O  O     . LEU A 1 220 ? 8.610   -8.886  -10.520 1.00 13.01 ? 271 LEU A O     1 
ATOM   1653 C  CB    . LEU A 1 220 ? 6.664   -10.238 -8.710  1.00 12.81 ? 271 LEU A CB    1 
ATOM   1654 C  CG    . LEU A 1 220 ? 5.992   -10.511 -7.362  1.00 11.93 ? 271 LEU A CG    1 
ATOM   1655 C  CD1   . LEU A 1 220 ? 4.531   -10.091 -7.401  1.00 10.95 ? 271 LEU A CD1   1 
ATOM   1656 C  CD2   . LEU A 1 220 ? 6.119   -11.977 -6.979  1.00 10.78 ? 271 LEU A CD2   1 
ATOM   1657 N  N     . LEU A 1 221 ? 9.299   -11.008 -10.787 1.00 12.71 ? 272 LEU A N     1 
ATOM   1658 C  CA    . LEU A 1 221 ? 9.885   -10.798 -12.101 1.00 12.42 ? 272 LEU A CA    1 
ATOM   1659 C  C     . LEU A 1 221 ? 9.146   -11.675 -13.125 1.00 12.66 ? 272 LEU A C     1 
ATOM   1660 O  O     . LEU A 1 221 ? 8.992   -12.885 -12.915 1.00 12.98 ? 272 LEU A O     1 
ATOM   1661 C  CB    . LEU A 1 221 ? 11.382  -11.125 -12.051 1.00 12.24 ? 272 LEU A CB    1 
ATOM   1662 C  CG    . LEU A 1 221 ? 12.292  -9.986  -11.549 1.00 11.76 ? 272 LEU A CG    1 
ATOM   1663 C  CD1   . LEU A 1 221 ? 11.915  -9.519  -10.158 1.00 11.22 ? 272 LEU A CD1   1 
ATOM   1664 C  CD2   . LEU A 1 221 ? 13.760  -10.393 -11.573 1.00 11.57 ? 272 LEU A CD2   1 
ATOM   1665 N  N     . PHE A 1 222 ? 8.665   -11.059 -14.211 1.00 12.44 ? 273 PHE A N     1 
ATOM   1666 C  CA    . PHE A 1 222 ? 7.947   -11.781 -15.267 1.00 12.17 ? 273 PHE A CA    1 
ATOM   1667 C  C     . PHE A 1 222 ? 8.488   -11.446 -16.649 1.00 12.10 ? 273 PHE A C     1 
ATOM   1668 O  O     . PHE A 1 222 ? 8.790   -10.290 -16.944 1.00 12.33 ? 273 PHE A O     1 
ATOM   1669 C  CB    . PHE A 1 222 ? 6.453   -11.458 -15.223 1.00 11.98 ? 273 PHE A CB    1 
ATOM   1670 C  CG    . PHE A 1 222 ? 5.698   -12.254 -14.208 1.00 12.21 ? 273 PHE A CG    1 
ATOM   1671 C  CD1   . PHE A 1 222 ? 5.660   -11.855 -12.883 1.00 12.52 ? 273 PHE A CD1   1 
ATOM   1672 C  CD2   . PHE A 1 222 ? 5.027   -13.410 -14.572 1.00 11.68 ? 273 PHE A CD2   1 
ATOM   1673 C  CE1   . PHE A 1 222 ? 4.963   -12.598 -11.942 1.00 12.16 ? 273 PHE A CE1   1 
ATOM   1674 C  CE2   . PHE A 1 222 ? 4.335   -14.150 -13.641 1.00 11.16 ? 273 PHE A CE2   1 
ATOM   1675 C  CZ    . PHE A 1 222 ? 4.301   -13.749 -12.327 1.00 11.73 ? 273 PHE A CZ    1 
ATOM   1676 N  N     . SER A 1 223 ? 8.595   -12.473 -17.489 1.00 11.92 ? 274 SER A N     1 
ATOM   1677 C  CA    . SER A 1 223 ? 8.988   -12.322 -18.890 1.00 11.66 ? 274 SER A CA    1 
ATOM   1678 C  C     . SER A 1 223 ? 8.723   -13.611 -19.648 1.00 11.41 ? 274 SER A C     1 
ATOM   1679 O  O     . SER A 1 223 ? 8.608   -14.678 -19.052 1.00 11.60 ? 274 SER A O     1 
ATOM   1680 C  CB    . SER A 1 223 ? 10.476  -11.968 -19.008 1.00 11.61 ? 274 SER A CB    1 
ATOM   1681 O  OG    . SER A 1 223 ? 10.904  -11.990 -20.363 1.00 11.13 ? 274 SER A OG    1 
ATOM   1682 N  N     . ALA A 1 224 ? 8.648   -13.515 -20.966 1.00 11.29 ? 275 ALA A N     1 
ATOM   1683 C  CA    . ALA A 1 224 ? 8.574   -14.711 -21.805 1.00 11.34 ? 275 ALA A CA    1 
ATOM   1684 C  C     . ALA A 1 224 ? 9.951   -15.331 -22.034 1.00 11.31 ? 275 ALA A C     1 
ATOM   1685 O  O     . ALA A 1 224 ? 10.045  -16.487 -22.447 1.00 11.56 ? 275 ALA A O     1 
ATOM   1686 C  CB    . ALA A 1 224 ? 7.904   -14.393 -23.136 1.00 11.30 ? 275 ALA A CB    1 
ATOM   1687 N  N     . THR A 1 225 ? 11.004  -14.561 -21.760 1.00 11.22 ? 276 THR A N     1 
ATOM   1688 C  CA    . THR A 1 225 ? 12.379  -14.974 -22.025 1.00 11.18 ? 276 THR A CA    1 
ATOM   1689 C  C     . THR A 1 225 ? 13.299  -14.621 -20.860 1.00 11.13 ? 276 THR A C     1 
ATOM   1690 O  O     . THR A 1 225 ? 13.099  -13.613 -20.188 1.00 11.08 ? 276 THR A O     1 
ATOM   1691 C  CB    . THR A 1 225 ? 12.940  -14.282 -23.295 1.00 11.32 ? 276 THR A CB    1 
ATOM   1692 O  OG1   . THR A 1 225 ? 12.931  -12.854 -23.121 1.00 11.06 ? 276 THR A OG1   1 
ATOM   1693 C  CG2   . THR A 1 225 ? 12.116  -14.654 -24.520 1.00 10.93 ? 276 THR A CG2   1 
ATOM   1694 N  N     . PHE A 1 226 ? 14.286  -15.481 -20.618 1.00 11.14 ? 277 PHE A N     1 
ATOM   1695 C  CA    . PHE A 1 226 ? 15.367  -15.217 -19.673 1.00 10.96 ? 277 PHE A CA    1 
ATOM   1696 C  C     . PHE A 1 226 ? 16.644  -15.794 -20.251 1.00 11.01 ? 277 PHE A C     1 
ATOM   1697 O  O     . PHE A 1 226 ? 16.922  -16.985 -20.099 1.00 11.01 ? 277 PHE A O     1 
ATOM   1698 C  CB    . PHE A 1 226 ? 15.093  -15.862 -18.313 1.00 10.98 ? 277 PHE A CB    1 
ATOM   1699 C  CG    . PHE A 1 226 ? 14.053  -15.151 -17.495 1.00 10.63 ? 277 PHE A CG    1 
ATOM   1700 C  CD1   . PHE A 1 226 ? 12.733  -15.562 -17.524 1.00 9.63  ? 277 PHE A CD1   1 
ATOM   1701 C  CD2   . PHE A 1 226 ? 14.401  -14.076 -16.684 1.00 10.43 ? 277 PHE A CD2   1 
ATOM   1702 C  CE1   . PHE A 1 226 ? 11.776  -14.916 -16.764 1.00 9.64  ? 277 PHE A CE1   1 
ATOM   1703 C  CE2   . PHE A 1 226 ? 13.448  -13.422 -15.926 1.00 9.48  ? 277 PHE A CE2   1 
ATOM   1704 C  CZ    . PHE A 1 226 ? 12.136  -13.845 -15.962 1.00 9.56  ? 277 PHE A CZ    1 
ATOM   1705 N  N     . GLU A 1 227 ? 17.415  -14.948 -20.926 1.00 11.06 ? 278 GLU A N     1 
ATOM   1706 C  CA    . GLU A 1 227 ? 18.683  -15.363 -21.473 1.00 10.97 ? 278 GLU A CA    1 
ATOM   1707 C  C     . GLU A 1 227 ? 19.500  -16.013 -20.370 1.00 11.11 ? 278 GLU A C     1 
ATOM   1708 O  O     . GLU A 1 227 ? 19.397  -15.648 -19.194 1.00 10.99 ? 278 GLU A O     1 
ATOM   1709 C  CB    . GLU A 1 227 ? 19.427  -14.172 -22.082 1.00 11.11 ? 278 GLU A CB    1 
ATOM   1710 C  CG    . GLU A 1 227 ? 20.706  -14.542 -22.838 1.00 10.77 ? 278 GLU A CG    1 
ATOM   1711 C  CD    . GLU A 1 227 ? 21.963  -14.411 -21.994 1.00 11.48 ? 278 GLU A CD    1 
ATOM   1712 O  OE1   . GLU A 1 227 ? 22.796  -15.354 -21.995 1.00 10.98 ? 278 GLU A OE1   1 
ATOM   1713 O  OE2   . GLU A 1 227 ? 22.123  -13.359 -21.331 1.00 11.85 ? 278 GLU A OE2   1 
ATOM   1714 N  N     . ASP A 1 228 ? 20.299  -16.991 -20.773 1.00 11.27 ? 279 ASP A N     1 
ATOM   1715 C  CA    . ASP A 1 228 ? 21.074  -17.834 -19.861 1.00 11.35 ? 279 ASP A CA    1 
ATOM   1716 C  C     . ASP A 1 228 ? 21.749  -17.067 -18.707 1.00 10.95 ? 279 ASP A C     1 
ATOM   1717 O  O     . ASP A 1 228 ? 21.554  -17.403 -17.538 1.00 11.10 ? 279 ASP A O     1 
ATOM   1718 C  CB    . ASP A 1 228 ? 22.119  -18.604 -20.671 1.00 11.60 ? 279 ASP A CB    1 
ATOM   1719 C  CG    . ASP A 1 228 ? 22.239  -20.034 -20.249 1.00 12.73 ? 279 ASP A CG    1 
ATOM   1720 O  OD1   . ASP A 1 228 ? 22.416  -20.273 -19.036 1.00 14.33 ? 279 ASP A OD1   1 
ATOM   1721 O  OD2   . ASP A 1 228 ? 22.177  -20.915 -21.138 1.00 15.03 ? 279 ASP A OD2   1 
ATOM   1722 N  N     . SER A 1 229 ? 22.531  -16.042 -19.035 1.00 10.57 ? 280 SER A N     1 
ATOM   1723 C  CA    . SER A 1 229 ? 23.241  -15.244 -18.023 1.00 10.21 ? 280 SER A CA    1 
ATOM   1724 C  C     . SER A 1 229 ? 22.307  -14.368 -17.198 1.00 10.09 ? 280 SER A C     1 
ATOM   1725 O  O     . SER A 1 229 ? 22.555  -14.146 -16.017 1.00 9.82  ? 280 SER A O     1 
ATOM   1726 C  CB    . SER A 1 229 ? 24.295  -14.349 -18.683 1.00 10.28 ? 280 SER A CB    1 
ATOM   1727 O  OG    . SER A 1 229 ? 23.693  -13.294 -19.410 1.00 9.34  ? 280 SER A OG    1 
ATOM   1728 N  N     . VAL A 1 230 ? 21.252  -13.859 -17.835 1.00 10.03 ? 281 VAL A N     1 
ATOM   1729 C  CA    . VAL A 1 230 ? 20.249  -13.026 -17.160 1.00 9.90  ? 281 VAL A CA    1 
ATOM   1730 C  C     . VAL A 1 230 ? 19.511  -13.832 -16.097 1.00 10.07 ? 281 VAL A C     1 
ATOM   1731 O  O     . VAL A 1 230 ? 19.240  -13.324 -15.005 1.00 10.32 ? 281 VAL A O     1 
ATOM   1732 C  CB    . VAL A 1 230 ? 19.204  -12.417 -18.155 1.00 9.90  ? 281 VAL A CB    1 
ATOM   1733 C  CG1   . VAL A 1 230 ? 18.151  -11.613 -17.402 1.00 9.16  ? 281 VAL A CG1   1 
ATOM   1734 C  CG2   . VAL A 1 230 ? 19.889  -11.538 -19.206 1.00 9.16  ? 281 VAL A CG2   1 
ATOM   1735 N  N     . TRP A 1 231 ? 19.188  -15.084 -16.419 1.00 10.14 ? 282 TRP A N     1 
ATOM   1736 C  CA    . TRP A 1 231 ? 18.560  -15.995 -15.455 1.00 10.14 ? 282 TRP A CA    1 
ATOM   1737 C  C     . TRP A 1 231 ? 19.452  -16.162 -14.227 1.00 10.43 ? 282 TRP A C     1 
ATOM   1738 O  O     . TRP A 1 231 ? 18.970  -16.137 -13.095 1.00 10.56 ? 282 TRP A O     1 
ATOM   1739 C  CB    . TRP A 1 231 ? 18.291  -17.355 -16.108 1.00 10.00 ? 282 TRP A CB    1 
ATOM   1740 C  CG    . TRP A 1 231 ? 17.612  -18.332 -15.218 1.00 9.24  ? 282 TRP A CG    1 
ATOM   1741 C  CD1   . TRP A 1 231 ? 18.155  -19.457 -14.669 1.00 8.01  ? 282 TRP A CD1   1 
ATOM   1742 C  CD2   . TRP A 1 231 ? 16.253  -18.281 -14.769 1.00 8.59  ? 282 TRP A CD2   1 
ATOM   1743 N  NE1   . TRP A 1 231 ? 17.219  -20.111 -13.906 1.00 7.18  ? 282 TRP A NE1   1 
ATOM   1744 C  CE2   . TRP A 1 231 ? 16.043  -19.409 -13.949 1.00 7.89  ? 282 TRP A CE2   1 
ATOM   1745 C  CE3   . TRP A 1 231 ? 15.191  -17.396 -14.986 1.00 8.96  ? 282 TRP A CE3   1 
ATOM   1746 C  CZ2   . TRP A 1 231 ? 14.813  -19.674 -13.335 1.00 8.27  ? 282 TRP A CZ2   1 
ATOM   1747 C  CZ3   . TRP A 1 231 ? 13.963  -17.659 -14.380 1.00 9.00  ? 282 TRP A CZ3   1 
ATOM   1748 C  CH2   . TRP A 1 231 ? 13.788  -18.787 -13.556 1.00 8.56  ? 282 TRP A CH2   1 
ATOM   1749 N  N     . LYS A 1 232 ? 20.757  -16.313 -14.462 1.00 10.71 ? 283 LYS A N     1 
ATOM   1750 C  CA    . LYS A 1 232 ? 21.734  -16.453 -13.374 1.00 10.83 ? 283 LYS A CA    1 
ATOM   1751 C  C     . LYS A 1 232 ? 21.929  -15.155 -12.593 1.00 10.66 ? 283 LYS A C     1 
ATOM   1752 O  O     . LYS A 1 232 ? 22.206  -15.185 -11.403 1.00 10.75 ? 283 LYS A O     1 
ATOM   1753 C  CB    . LYS A 1 232 ? 23.082  -16.983 -13.901 1.00 10.83 ? 283 LYS A CB    1 
ATOM   1754 C  CG    . LYS A 1 232 ? 23.196  -18.509 -13.847 1.00 11.50 ? 283 LYS A CG    1 
ATOM   1755 C  CD    . LYS A 1 232 ? 23.455  -18.990 -12.397 1.00 12.58 ? 283 LYS A CD    1 
ATOM   1756 C  CE    . LYS A 1 232 ? 22.866  -20.367 -12.082 1.00 12.40 ? 283 LYS A CE    1 
ATOM   1757 N  NZ    . LYS A 1 232 ? 22.516  -20.466 -10.635 1.00 11.62 ? 283 LYS A NZ    1 
ATOM   1758 N  N     . PHE A 1 233 ? 21.782  -14.020 -13.264 1.00 10.67 ? 284 PHE A N     1 
ATOM   1759 C  CA    . PHE A 1 233 ? 21.909  -12.722 -12.608 1.00 10.58 ? 284 PHE A CA    1 
ATOM   1760 C  C     . PHE A 1 233 ? 20.684  -12.420 -11.763 1.00 10.89 ? 284 PHE A C     1 
ATOM   1761 O  O     . PHE A 1 233 ? 20.803  -11.938 -10.636 1.00 10.97 ? 284 PHE A O     1 
ATOM   1762 C  CB    . PHE A 1 233 ? 22.094  -11.608 -13.638 1.00 10.42 ? 284 PHE A CB    1 
ATOM   1763 C  CG    . PHE A 1 233 ? 22.105  -10.247 -13.037 1.00 9.32  ? 284 PHE A CG    1 
ATOM   1764 C  CD1   . PHE A 1 233 ? 23.091  -9.894  -12.136 1.00 8.83  ? 284 PHE A CD1   1 
ATOM   1765 C  CD2   . PHE A 1 233 ? 21.123  -9.327  -13.347 1.00 8.36  ? 284 PHE A CD2   1 
ATOM   1766 C  CE1   . PHE A 1 233 ? 23.107  -8.640  -11.565 1.00 8.43  ? 284 PHE A CE1   1 
ATOM   1767 C  CE2   . PHE A 1 233 ? 21.135  -8.074  -12.778 1.00 8.35  ? 284 PHE A CE2   1 
ATOM   1768 C  CZ    . PHE A 1 233 ? 22.127  -7.730  -11.886 1.00 8.31  ? 284 PHE A CZ    1 
ATOM   1769 N  N     . ALA A 1 234 ? 19.506  -12.691 -12.321 1.00 11.27 ? 285 ALA A N     1 
ATOM   1770 C  CA    . ALA A 1 234 ? 18.244  -12.508 -11.603 1.00 11.47 ? 285 ALA A CA    1 
ATOM   1771 C  C     . ALA A 1 234 ? 18.226  -13.281 -10.275 1.00 11.64 ? 285 ALA A C     1 
ATOM   1772 O  O     . ALA A 1 234 ? 17.664  -12.804 -9.285  1.00 11.87 ? 285 ALA A O     1 
ATOM   1773 C  CB    . ALA A 1 234 ? 17.078  -12.931 -12.481 1.00 11.45 ? 285 ALA A CB    1 
ATOM   1774 N  N     . GLN A 1 235 ? 18.849  -14.458 -10.265 1.00 11.67 ? 286 GLN A N     1 
ATOM   1775 C  CA    . GLN A 1 235 ? 18.981  -15.286 -9.056  1.00 11.88 ? 286 GLN A CA    1 
ATOM   1776 C  C     . GLN A 1 235 ? 19.798  -14.640 -7.927  1.00 12.00 ? 286 GLN A C     1 
ATOM   1777 O  O     . GLN A 1 235 ? 19.621  -14.978 -6.758  1.00 11.97 ? 286 GLN A O     1 
ATOM   1778 C  CB    . GLN A 1 235 ? 19.635  -16.621 -9.416  1.00 11.92 ? 286 GLN A CB    1 
ATOM   1779 C  CG    . GLN A 1 235 ? 18.713  -17.582 -10.106 1.00 12.12 ? 286 GLN A CG    1 
ATOM   1780 C  CD    . GLN A 1 235 ? 17.916  -18.353 -9.113  1.00 12.81 ? 286 GLN A CD    1 
ATOM   1781 O  OE1   . GLN A 1 235 ? 16.769  -18.008 -8.827  1.00 14.19 ? 286 GLN A OE1   1 
ATOM   1782 N  NE2   . GLN A 1 235 ? 18.530  -19.384 -8.531  1.00 12.44 ? 286 GLN A NE2   1 
ATOM   1783 N  N     . LYS A 1 236 ? 20.702  -13.733 -8.280  1.00 12.06 ? 287 LYS A N     1 
ATOM   1784 C  CA    . LYS A 1 236 ? 21.587  -13.106 -7.305  1.00 12.13 ? 287 LYS A CA    1 
ATOM   1785 C  C     . LYS A 1 236 ? 21.079  -11.738 -6.838  1.00 12.45 ? 287 LYS A C     1 
ATOM   1786 O  O     . LYS A 1 236 ? 21.487  -11.251 -5.788  1.00 12.63 ? 287 LYS A O     1 
ATOM   1787 C  CB    . LYS A 1 236 ? 22.997  -12.975 -7.894  1.00 12.08 ? 287 LYS A CB    1 
ATOM   1788 C  CG    . LYS A 1 236 ? 23.580  -14.287 -8.430  1.00 11.63 ? 287 LYS A CG    1 
ATOM   1789 C  CD    . LYS A 1 236 ? 23.804  -15.328 -7.326  1.00 11.31 ? 287 LYS A CD    1 
ATOM   1790 C  CE    . LYS A 1 236 ? 23.420  -16.720 -7.794  1.00 11.05 ? 287 LYS A CE    1 
ATOM   1791 N  NZ    . LYS A 1 236 ? 23.435  -17.706 -6.686  1.00 10.72 ? 287 LYS A NZ    1 
ATOM   1792 N  N     . VAL A 1 237 ? 20.192  -11.124 -7.610  1.00 12.75 ? 288 VAL A N     1 
ATOM   1793 C  CA    . VAL A 1 237 ? 19.658  -9.810  -7.269  1.00 13.01 ? 288 VAL A CA    1 
ATOM   1794 C  C     . VAL A 1 237 ? 18.298  -9.890  -6.578  1.00 13.25 ? 288 VAL A C     1 
ATOM   1795 O  O     . VAL A 1 237 ? 17.895  -8.950  -5.895  1.00 13.30 ? 288 VAL A O     1 
ATOM   1796 C  CB    . VAL A 1 237 ? 19.525  -8.941  -8.518  1.00 13.00 ? 288 VAL A CB    1 
ATOM   1797 C  CG1   . VAL A 1 237 ? 19.190  -7.522  -8.126  1.00 13.21 ? 288 VAL A CG1   1 
ATOM   1798 C  CG2   . VAL A 1 237 ? 20.814  -8.975  -9.302  1.00 12.74 ? 288 VAL A CG2   1 
ATOM   1799 N  N     . VAL A 1 238 ? 17.598  -11.007 -6.768  1.00 13.57 ? 289 VAL A N     1 
ATOM   1800 C  CA    . VAL A 1 238 ? 16.319  -11.268 -6.116  1.00 13.67 ? 289 VAL A CA    1 
ATOM   1801 C  C     . VAL A 1 238 ? 16.519  -12.265 -4.973  1.00 14.06 ? 289 VAL A C     1 
ATOM   1802 O  O     . VAL A 1 238 ? 16.828  -13.435 -5.223  1.00 14.52 ? 289 VAL A O     1 
ATOM   1803 C  CB    . VAL A 1 238 ? 15.313  -11.881 -7.103  1.00 13.58 ? 289 VAL A CB    1 
ATOM   1804 C  CG1   . VAL A 1 238 ? 14.054  -12.318 -6.375  1.00 13.60 ? 289 VAL A CG1   1 
ATOM   1805 C  CG2   . VAL A 1 238 ? 14.989  -10.905 -8.220  1.00 13.40 ? 289 VAL A CG2   1 
ATOM   1806 N  N     . PRO A 1 239 ? 16.350  -11.817 -3.714  1.00 14.20 ? 290 PRO A N     1 
ATOM   1807 C  CA    . PRO A 1 239 ? 16.414  -12.710 -2.546  1.00 14.26 ? 290 PRO A CA    1 
ATOM   1808 C  C     . PRO A 1 239 ? 15.474  -13.921 -2.607  1.00 14.47 ? 290 PRO A C     1 
ATOM   1809 O  O     . PRO A 1 239 ? 14.350  -13.789 -3.095  1.00 14.52 ? 290 PRO A O     1 
ATOM   1810 C  CB    . PRO A 1 239 ? 15.981  -11.797 -1.397  1.00 14.24 ? 290 PRO A CB    1 
ATOM   1811 C  CG    . PRO A 1 239 ? 16.375  -10.440 -1.823  1.00 14.25 ? 290 PRO A CG    1 
ATOM   1812 C  CD    . PRO A 1 239 ? 16.307  -10.398 -3.318  1.00 14.12 ? 290 PRO A CD    1 
ATOM   1813 N  N     . ASP A 1 240 ? 15.944  -15.076 -2.113  1.00 14.63 ? 291 ASP A N     1 
ATOM   1814 C  CA    . ASP A 1 240 ? 15.116  -16.273 -1.889  1.00 14.61 ? 291 ASP A CA    1 
ATOM   1815 C  C     . ASP A 1 240 ? 13.946  -16.376 -2.870  1.00 14.65 ? 291 ASP A C     1 
ATOM   1816 O  O     . ASP A 1 240 ? 12.802  -16.077 -2.514  1.00 15.07 ? 291 ASP A O     1 
ATOM   1817 C  CB    . ASP A 1 240 ? 14.572  -16.261 -0.450  1.00 14.80 ? 291 ASP A CB    1 
ATOM   1818 C  CG    . ASP A 1 240 ? 15.309  -17.209 0.488   1.00 15.50 ? 291 ASP A CG    1 
ATOM   1819 O  OD1   . ASP A 1 240 ? 16.444  -17.650 0.189   1.00 16.06 ? 291 ASP A OD1   1 
ATOM   1820 O  OD2   . ASP A 1 240 ? 14.723  -17.513 1.549   1.00 15.66 ? 291 ASP A OD2   1 
ATOM   1821 N  N     . PRO A 1 241 ? 14.219  -16.789 -4.114  1.00 14.34 ? 292 PRO A N     1 
ATOM   1822 C  CA    . PRO A 1 241 ? 13.132  -16.774 -5.065  1.00 14.12 ? 292 PRO A CA    1 
ATOM   1823 C  C     . PRO A 1 241 ? 12.564  -18.155 -5.339  1.00 13.93 ? 292 PRO A C     1 
ATOM   1824 O  O     . PRO A 1 241 ? 13.298  -19.131 -5.380  1.00 13.72 ? 292 PRO A O     1 
ATOM   1825 C  CB    . PRO A 1 241 ? 13.802  -16.209 -6.325  1.00 14.21 ? 292 PRO A CB    1 
ATOM   1826 C  CG    . PRO A 1 241 ? 15.260  -16.596 -6.205  1.00 14.25 ? 292 PRO A CG    1 
ATOM   1827 C  CD    . PRO A 1 241 ? 15.500  -17.070 -4.781  1.00 14.44 ? 292 PRO A CD    1 
ATOM   1828 N  N     . ASN A 1 242 ? 11.249  -18.223 -5.492  1.00 14.09 ? 293 ASN A N     1 
ATOM   1829 C  CA    . ASN A 1 242 ? 10.617  -19.328 -6.193  1.00 14.19 ? 293 ASN A CA    1 
ATOM   1830 C  C     . ASN A 1 242 ? 10.827  -19.045 -7.671  1.00 14.09 ? 293 ASN A C     1 
ATOM   1831 O  O     . ASN A 1 242 ? 10.897  -17.886 -8.085  1.00 14.34 ? 293 ASN A O     1 
ATOM   1832 C  CB    . ASN A 1 242 ? 9.119   -19.425 -5.870  1.00 14.35 ? 293 ASN A CB    1 
ATOM   1833 C  CG    . ASN A 1 242 ? 8.856   -19.858 -4.437  1.00 14.36 ? 293 ASN A CG    1 
ATOM   1834 O  OD1   . ASN A 1 242 ? 9.558   -20.709 -3.896  1.00 15.02 ? 293 ASN A OD1   1 
ATOM   1835 N  ND2   . ASN A 1 242 ? 7.836   -19.274 -3.819  1.00 15.26 ? 293 ASN A ND2   1 
ATOM   1836 N  N     . VAL A 1 243 ? 10.939  -20.102 -8.461  1.00 13.69 ? 294 VAL A N     1 
ATOM   1837 C  CA    . VAL A 1 243 ? 11.362  -19.982 -9.842  1.00 13.34 ? 294 VAL A CA    1 
ATOM   1838 C  C     . VAL A 1 243 ? 10.397  -20.769 -10.721 1.00 13.17 ? 294 VAL A C     1 
ATOM   1839 O  O     . VAL A 1 243 ? 10.035  -21.901 -10.396 1.00 13.15 ? 294 VAL A O     1 
ATOM   1840 C  CB    . VAL A 1 243 ? 12.832  -20.490 -9.982  1.00 13.38 ? 294 VAL A CB    1 
ATOM   1841 C  CG1   . VAL A 1 243 ? 13.012  -21.363 -11.200 1.00 13.53 ? 294 VAL A CG1   1 
ATOM   1842 C  CG2   . VAL A 1 243 ? 13.808  -19.320 -9.996  1.00 13.07 ? 294 VAL A CG2   1 
ATOM   1843 N  N     . ILE A 1 244 ? 9.936   -20.146 -11.803 1.00 13.10 ? 295 ILE A N     1 
ATOM   1844 C  CA    . ILE A 1 244 ? 9.244   -20.871 -12.872 1.00 13.02 ? 295 ILE A CA    1 
ATOM   1845 C  C     . ILE A 1 244 ? 10.021  -20.632 -14.161 1.00 12.98 ? 295 ILE A C     1 
ATOM   1846 O  O     . ILE A 1 244 ? 9.980   -19.541 -14.727 1.00 12.84 ? 295 ILE A O     1 
ATOM   1847 C  CB    . ILE A 1 244 ? 7.771   -20.440 -13.058 1.00 13.09 ? 295 ILE A CB    1 
ATOM   1848 C  CG1   . ILE A 1 244 ? 6.987   -20.562 -11.745 1.00 13.05 ? 295 ILE A CG1   1 
ATOM   1849 C  CG2   . ILE A 1 244 ? 7.104   -21.296 -14.135 1.00 12.53 ? 295 ILE A CG2   1 
ATOM   1850 C  CD1   . ILE A 1 244 ? 5.476   -20.366 -11.902 1.00 12.23 ? 295 ILE A CD1   1 
ATOM   1851 N  N     . LYS A 1 245 ? 10.761  -21.654 -14.590 1.00 12.88 ? 296 LYS A N     1 
ATOM   1852 C  CA    . LYS A 1 245 ? 11.552  -21.596 -15.811 1.00 12.72 ? 296 LYS A CA    1 
ATOM   1853 C  C     . LYS A 1 245 ? 10.941  -22.562 -16.813 1.00 12.91 ? 296 LYS A C     1 
ATOM   1854 O  O     . LYS A 1 245 ? 10.467  -23.635 -16.436 1.00 12.87 ? 296 LYS A O     1 
ATOM   1855 C  CB    . LYS A 1 245 ? 13.008  -21.982 -15.523 1.00 12.60 ? 296 LYS A CB    1 
ATOM   1856 C  CG    . LYS A 1 245 ? 14.032  -21.312 -16.437 1.00 12.07 ? 296 LYS A CG    1 
ATOM   1857 C  CD    . LYS A 1 245 ? 15.314  -22.133 -16.567 1.00 11.73 ? 296 LYS A CD    1 
ATOM   1858 C  CE    . LYS A 1 245 ? 16.395  -21.404 -17.370 1.00 11.09 ? 296 LYS A CE    1 
ATOM   1859 N  NZ    . LYS A 1 245 ? 15.885  -20.818 -18.640 1.00 10.42 ? 296 LYS A NZ    1 
ATOM   1860 N  N     . LEU A 1 246 ? 10.931  -22.168 -18.084 1.00 13.24 ? 297 LEU A N     1 
ATOM   1861 C  CA    . LEU A 1 246 ? 10.456  -23.042 -19.161 1.00 13.50 ? 297 LEU A CA    1 
ATOM   1862 C  C     . LEU A 1 246 ? 11.607  -23.856 -19.752 1.00 13.93 ? 297 LEU A C     1 
ATOM   1863 O  O     . LEU A 1 246 ? 12.772  -23.450 -19.685 1.00 13.98 ? 297 LEU A O     1 
ATOM   1864 C  CB    . LEU A 1 246 ? 9.791   -22.221 -20.273 1.00 13.32 ? 297 LEU A CB    1 
ATOM   1865 C  CG    . LEU A 1 246 ? 8.498   -21.492 -19.910 1.00 12.80 ? 297 LEU A CG    1 
ATOM   1866 C  CD1   . LEU A 1 246 ? 8.005   -20.658 -21.087 1.00 11.04 ? 297 LEU A CD1   1 
ATOM   1867 C  CD2   . LEU A 1 246 ? 7.446   -22.493 -19.472 1.00 11.88 ? 297 LEU A CD2   1 
ATOM   1868 N  N     . LYS A 1 247 ? 11.277  -25.019 -20.308 1.00 14.47 ? 298 LYS A N     1 
ATOM   1869 C  CA    . LYS A 1 247 ? 12.183  -25.714 -21.227 1.00 14.89 ? 298 LYS A CA    1 
ATOM   1870 C  C     . LYS A 1 247 ? 12.121  -24.964 -22.551 1.00 15.07 ? 298 LYS A C     1 
ATOM   1871 O  O     . LYS A 1 247 ? 11.096  -24.348 -22.863 1.00 15.09 ? 298 LYS A O     1 
ATOM   1872 C  CB    . LYS A 1 247 ? 11.745  -27.162 -21.444 1.00 14.98 ? 298 LYS A CB    1 
ATOM   1873 C  CG    . LYS A 1 247 ? 11.820  -28.066 -20.213 1.00 15.41 ? 298 LYS A CG    1 
ATOM   1874 C  CD    . LYS A 1 247 ? 10.702  -29.121 -20.241 1.00 15.99 ? 298 LYS A CD    1 
ATOM   1875 C  CE    . LYS A 1 247 ? 11.109  -30.418 -19.561 1.00 16.23 ? 298 LYS A CE    1 
ATOM   1876 N  NZ    . LYS A 1 247 ? 11.923  -31.271 -20.479 1.00 16.41 ? 298 LYS A NZ    1 
ATOM   1877 N  N     . ARG A 1 248 ? 13.193  -25.012 -23.338 1.00 15.27 ? 299 ARG A N     1 
ATOM   1878 C  CA    . ARG A 1 248 ? 13.225  -24.233 -24.574 1.00 15.45 ? 299 ARG A CA    1 
ATOM   1879 C  C     . ARG A 1 248 ? 12.247  -24.734 -25.637 1.00 15.43 ? 299 ARG A C     1 
ATOM   1880 O  O     . ARG A 1 248 ? 11.738  -23.941 -26.425 1.00 15.76 ? 299 ARG A O     1 
ATOM   1881 C  CB    . ARG A 1 248 ? 14.630  -24.131 -25.161 1.00 15.61 ? 299 ARG A CB    1 
ATOM   1882 C  CG    . ARG A 1 248 ? 14.750  -22.911 -26.074 1.00 16.29 ? 299 ARG A CG    1 
ATOM   1883 C  CD    . ARG A 1 248 ? 16.121  -22.754 -26.627 1.00 17.29 ? 299 ARG A CD    1 
ATOM   1884 N  NE    . ARG A 1 248 ? 17.082  -22.357 -25.609 1.00 17.74 ? 299 ARG A NE    1 
ATOM   1885 C  CZ    . ARG A 1 248 ? 18.386  -22.235 -25.827 1.00 18.97 ? 299 ARG A CZ    1 
ATOM   1886 N  NH1   . ARG A 1 248 ? 18.893  -22.479 -27.034 1.00 20.14 ? 299 ARG A NH1   1 
ATOM   1887 N  NH2   . ARG A 1 248 ? 19.191  -21.866 -24.837 1.00 19.46 ? 299 ARG A NH2   1 
ATOM   1888 N  N     . GLU A 1 249 ? 11.988  -26.036 -25.667 1.00 15.44 ? 300 GLU A N     1 
ATOM   1889 C  CA    . GLU A 1 249 ? 10.898  -26.570 -26.493 1.00 15.53 ? 300 GLU A CA    1 
ATOM   1890 C  C     . GLU A 1 249 ? 9.552   -25.869 -26.219 1.00 15.60 ? 300 GLU A C     1 
ATOM   1891 O  O     . GLU A 1 249 ? 8.759   -25.695 -27.136 1.00 15.76 ? 300 GLU A O     1 
ATOM   1892 C  CB    . GLU A 1 249 ? 10.758  -28.101 -26.346 1.00 15.57 ? 300 GLU A CB    1 
ATOM   1893 C  CG    . GLU A 1 249 ? 11.086  -28.671 -24.962 1.00 15.94 ? 300 GLU A CG    1 
ATOM   1894 C  CD    . GLU A 1 249 ? 10.299  -29.934 -24.622 1.00 16.74 ? 300 GLU A CD    1 
ATOM   1895 O  OE1   . GLU A 1 249 ? 10.920  -30.948 -24.235 1.00 15.87 ? 300 GLU A OE1   1 
ATOM   1896 O  OE2   . GLU A 1 249 ? 9.052   -29.907 -24.730 1.00 17.84 ? 300 GLU A OE2   1 
ATOM   1897 N  N     . GLU A 1 250 ? 9.311   -25.448 -24.976 1.00 15.65 ? 301 GLU A N     1 
ATOM   1898 C  CA    . GLU A 1 250 ? 8.043   -24.801 -24.594 1.00 15.78 ? 301 GLU A CA    1 
ATOM   1899 C  C     . GLU A 1 250 ? 7.923   -23.319 -24.979 1.00 15.54 ? 301 GLU A C     1 
ATOM   1900 O  O     . GLU A 1 250 ? 6.847   -22.734 -24.862 1.00 15.30 ? 301 GLU A O     1 
ATOM   1901 C  CB    . GLU A 1 250 ? 7.827   -24.908 -23.077 1.00 15.92 ? 301 GLU A CB    1 
ATOM   1902 C  CG    . GLU A 1 250 ? 7.777   -26.324 -22.535 1.00 16.67 ? 301 GLU A CG    1 
ATOM   1903 C  CD    . GLU A 1 250 ? 7.679   -26.357 -21.017 1.00 17.82 ? 301 GLU A CD    1 
ATOM   1904 O  OE1   . GLU A 1 250 ? 8.657   -25.962 -20.344 1.00 18.16 ? 301 GLU A OE1   1 
ATOM   1905 O  OE2   . GLU A 1 250 ? 6.624   -26.784 -20.496 1.00 19.11 ? 301 GLU A OE2   1 
ATOM   1906 N  N     . GLU A 1 251 ? 9.014   -22.712 -25.432 1.00 15.41 ? 302 GLU A N     1 
ATOM   1907 C  CA    . GLU A 1 251 ? 9.068   -21.254 -25.582 1.00 15.36 ? 302 GLU A CA    1 
ATOM   1908 C  C     . GLU A 1 251 ? 8.342   -20.676 -26.804 1.00 15.25 ? 302 GLU A C     1 
ATOM   1909 O  O     . GLU A 1 251 ? 7.985   -19.502 -26.789 1.00 15.59 ? 302 GLU A O     1 
ATOM   1910 C  CB    . GLU A 1 251 ? 10.528  -20.768 -25.549 1.00 15.35 ? 302 GLU A CB    1 
ATOM   1911 C  CG    . GLU A 1 251 ? 11.139  -20.802 -24.149 1.00 15.35 ? 302 GLU A CG    1 
ATOM   1912 C  CD    . GLU A 1 251 ? 12.506  -20.147 -24.049 1.00 15.32 ? 302 GLU A CD    1 
ATOM   1913 O  OE1   . GLU A 1 251 ? 13.144  -19.884 -25.094 1.00 16.20 ? 302 GLU A OE1   1 
ATOM   1914 O  OE2   . GLU A 1 251 ? 12.953  -19.903 -22.909 1.00 14.61 ? 302 GLU A OE2   1 
ATOM   1915 N  N     . THR A 1 252 ? 8.128   -21.476 -27.848 1.00 15.26 ? 303 THR A N     1 
ATOM   1916 C  CA    . THR A 1 252 ? 7.464   -20.998 -29.070 1.00 15.19 ? 303 THR A CA    1 
ATOM   1917 C  C     . THR A 1 252 ? 6.056   -21.561 -29.144 1.00 15.32 ? 303 THR A C     1 
ATOM   1918 O  O     . THR A 1 252 ? 5.834   -22.731 -28.842 1.00 15.51 ? 303 THR A O     1 
ATOM   1919 C  CB    . THR A 1 252 ? 8.201   -21.423 -30.365 1.00 15.15 ? 303 THR A CB    1 
ATOM   1920 O  OG1   . THR A 1 252 ? 7.796   -22.749 -30.733 1.00 15.44 ? 303 THR A OG1   1 
ATOM   1921 C  CG2   . THR A 1 252 ? 9.718   -21.367 -30.198 1.00 14.46 ? 303 THR A CG2   1 
ATOM   1922 N  N     . LEU A 1 253 ? 5.112   -20.725 -29.559 1.00 15.38 ? 304 LEU A N     1 
ATOM   1923 C  CA    . LEU A 1 253 ? 3.720   -21.131 -29.681 1.00 15.39 ? 304 LEU A CA    1 
ATOM   1924 C  C     . LEU A 1 253 ? 3.494   -21.954 -30.948 1.00 15.48 ? 304 LEU A C     1 
ATOM   1925 O  O     . LEU A 1 253 ? 4.027   -21.634 -32.006 1.00 15.38 ? 304 LEU A O     1 
ATOM   1926 C  CB    . LEU A 1 253 ? 2.807   -19.897 -29.700 1.00 15.39 ? 304 LEU A CB    1 
ATOM   1927 C  CG    . LEU A 1 253 ? 2.206   -19.410 -28.376 1.00 15.41 ? 304 LEU A CG    1 
ATOM   1928 C  CD1   . LEU A 1 253 ? 3.247   -19.311 -27.280 1.00 15.25 ? 304 LEU A CD1   1 
ATOM   1929 C  CD2   . LEU A 1 253 ? 1.509   -18.067 -28.584 1.00 14.61 ? 304 LEU A CD2   1 
ATOM   1930 N  N     . ASP A 1 254 ? 2.688   -23.009 -30.830 1.00 15.77 ? 305 ASP A N     1 
ATOM   1931 C  CA    . ASP A 1 254 ? 2.184   -23.741 -31.998 1.00 16.11 ? 305 ASP A CA    1 
ATOM   1932 C  C     . ASP A 1 254 ? 1.176   -22.895 -32.748 1.00 16.25 ? 305 ASP A C     1 
ATOM   1933 O  O     . ASP A 1 254 ? 0.850   -23.177 -33.898 1.00 16.25 ? 305 ASP A O     1 
ATOM   1934 C  CB    . ASP A 1 254 ? 1.457   -25.023 -31.577 1.00 16.20 ? 305 ASP A CB    1 
ATOM   1935 C  CG    . ASP A 1 254 ? 2.380   -26.069 -30.984 1.00 16.79 ? 305 ASP A CG    1 
ATOM   1936 O  OD1   . ASP A 1 254 ? 3.590   -26.088 -31.319 1.00 17.61 ? 305 ASP A OD1   1 
ATOM   1937 O  OD2   . ASP A 1 254 ? 1.877   -26.887 -30.181 1.00 16.94 ? 305 ASP A OD2   1 
ATOM   1938 N  N     . THR A 1 255 ? 0.664   -21.878 -32.064 1.00 16.55 ? 306 THR A N     1 
ATOM   1939 C  CA    . THR A 1 255 ? -0.449  -21.083 -32.535 1.00 16.68 ? 306 THR A CA    1 
ATOM   1940 C  C     . THR A 1 255 ? 0.020   -19.943 -33.462 1.00 16.63 ? 306 THR A C     1 
ATOM   1941 O  O     . THR A 1 255 ? -0.783  -19.412 -34.237 1.00 16.64 ? 306 THR A O     1 
ATOM   1942 C  CB    . THR A 1 255 ? -1.282  -20.572 -31.311 1.00 16.74 ? 306 THR A CB    1 
ATOM   1943 O  OG1   . THR A 1 255 ? -2.679  -20.605 -31.626 1.00 17.89 ? 306 THR A OG1   1 
ATOM   1944 C  CG2   . THR A 1 255 ? -0.875  -19.172 -30.876 1.00 16.63 ? 306 THR A CG2   1 
ATOM   1945 N  N     . ILE A 1 256 ? 1.310   -19.584 -33.387 1.00 16.54 ? 307 ILE A N     1 
ATOM   1946 C  CA    . ILE A 1 256 ? 1.926   -18.587 -34.296 1.00 16.37 ? 307 ILE A CA    1 
ATOM   1947 C  C     . ILE A 1 256 ? 2.801   -19.297 -35.321 1.00 16.39 ? 307 ILE A C     1 
ATOM   1948 O  O     . ILE A 1 256 ? 3.835   -19.871 -34.963 1.00 16.43 ? 307 ILE A O     1 
ATOM   1949 C  CB    . ILE A 1 256 ? 2.840   -17.578 -33.549 1.00 16.13 ? 307 ILE A CB    1 
ATOM   1950 C  CG1   . ILE A 1 256 ? 2.038   -16.714 -32.581 1.00 15.79 ? 307 ILE A CG1   1 
ATOM   1951 C  CG2   . ILE A 1 256 ? 3.573   -16.666 -34.549 1.00 16.38 ? 307 ILE A CG2   1 
ATOM   1952 C  CD1   . ILE A 1 256 ? 2.908   -15.930 -31.624 1.00 14.96 ? 307 ILE A CD1   1 
ATOM   1953 N  N     . LYS A 1 257 ? 2.415   -19.245 -36.593 1.00 16.28 ? 308 LYS A N     1 
ATOM   1954 C  CA    . LYS A 1 257 ? 3.167   -19.963 -37.613 1.00 16.28 ? 308 LYS A CA    1 
ATOM   1955 C  C     . LYS A 1 257 ? 4.167   -19.018 -38.301 1.00 16.17 ? 308 LYS A C     1 
ATOM   1956 O  O     . LYS A 1 257 ? 3.836   -17.880 -38.633 1.00 16.02 ? 308 LYS A O     1 
ATOM   1957 C  CB    . LYS A 1 257 ? 2.216   -20.702 -38.574 1.00 16.35 ? 308 LYS A CB    1 
ATOM   1958 C  CG    . LYS A 1 257 ? 2.242   -20.305 -40.037 1.00 16.78 ? 308 LYS A CG    1 
ATOM   1959 C  CD    . LYS A 1 257 ? 2.381   -21.535 -40.924 1.00 17.18 ? 308 LYS A CD    1 
ATOM   1960 C  CE    . LYS A 1 257 ? 3.805   -22.092 -40.882 1.00 17.41 ? 308 LYS A CE    1 
ATOM   1961 N  NZ    . LYS A 1 257 ? 3.969   -23.277 -41.768 1.00 17.34 ? 308 LYS A NZ    1 
ATOM   1962 N  N     . GLN A 1 258 ? 5.393   -19.511 -38.489 1.00 16.10 ? 309 GLN A N     1 
ATOM   1963 C  CA    . GLN A 1 258 ? 6.541   -18.685 -38.867 1.00 15.94 ? 309 GLN A CA    1 
ATOM   1964 C  C     . GLN A 1 258 ? 6.965   -18.891 -40.317 1.00 15.98 ? 309 GLN A C     1 
ATOM   1965 O  O     . GLN A 1 258 ? 7.264   -20.005 -40.725 1.00 15.97 ? 309 GLN A O     1 
ATOM   1966 C  CB    . GLN A 1 258 ? 7.732   -19.012 -37.959 1.00 15.87 ? 309 GLN A CB    1 
ATOM   1967 C  CG    . GLN A 1 258 ? 7.537   -18.627 -36.505 1.00 15.58 ? 309 GLN A CG    1 
ATOM   1968 C  CD    . GLN A 1 258 ? 8.723   -18.992 -35.626 1.00 15.02 ? 309 GLN A CD    1 
ATOM   1969 O  OE1   . GLN A 1 258 ? 9.866   -18.638 -35.917 1.00 14.13 ? 309 GLN A OE1   1 
ATOM   1970 N  NE2   . GLN A 1 258 ? 8.448   -19.698 -34.535 1.00 15.11 ? 309 GLN A NE2   1 
ATOM   1971 N  N     . TYR A 1 259 ? 7.018   -17.803 -41.080 1.00 16.24 ? 310 TYR A N     1 
ATOM   1972 C  CA    . TYR A 1 259 ? 7.445   -17.843 -42.480 1.00 16.40 ? 310 TYR A CA    1 
ATOM   1973 C  C     . TYR A 1 259 ? 8.702   -16.990 -42.712 1.00 16.45 ? 310 TYR A C     1 
ATOM   1974 O  O     . TYR A 1 259 ? 9.185   -16.310 -41.800 1.00 16.58 ? 310 TYR A O     1 
ATOM   1975 C  CB    . TYR A 1 259 ? 6.315   -17.339 -43.381 1.00 16.41 ? 310 TYR A CB    1 
ATOM   1976 C  CG    . TYR A 1 259 ? 5.268   -18.375 -43.730 1.00 16.94 ? 310 TYR A CG    1 
ATOM   1977 C  CD1   . TYR A 1 259 ? 5.558   -19.407 -44.614 1.00 17.82 ? 310 TYR A CD1   1 
ATOM   1978 C  CD2   . TYR A 1 259 ? 3.977   -18.307 -43.204 1.00 17.37 ? 310 TYR A CD2   1 
ATOM   1979 C  CE1   . TYR A 1 259 ? 4.603   -20.355 -44.950 1.00 17.94 ? 310 TYR A CE1   1 
ATOM   1980 C  CE2   . TYR A 1 259 ? 3.008   -19.251 -43.541 1.00 17.51 ? 310 TYR A CE2   1 
ATOM   1981 C  CZ    . TYR A 1 259 ? 3.329   -20.272 -44.413 1.00 17.86 ? 310 TYR A CZ    1 
ATOM   1982 O  OH    . TYR A 1 259 ? 2.389   -21.216 -44.764 1.00 18.26 ? 310 TYR A OH    1 
ATOM   1983 N  N     . TYR A 1 260 ? 9.238   -17.056 -43.931 1.00 16.38 ? 311 TYR A N     1 
ATOM   1984 C  CA    . TYR A 1 260 ? 10.227  -16.081 -44.401 1.00 16.23 ? 311 TYR A CA    1 
ATOM   1985 C  C     . TYR A 1 260 ? 10.190  -15.912 -45.924 1.00 16.08 ? 311 TYR A C     1 
ATOM   1986 O  O     . TYR A 1 260 ? 9.850   -16.844 -46.651 1.00 16.20 ? 311 TYR A O     1 
ATOM   1987 C  CB    . TYR A 1 260 ? 11.638  -16.451 -43.925 1.00 16.33 ? 311 TYR A CB    1 
ATOM   1988 C  CG    . TYR A 1 260 ? 12.323  -17.529 -44.729 1.00 16.18 ? 311 TYR A CG    1 
ATOM   1989 C  CD1   . TYR A 1 260 ? 13.129  -17.206 -45.812 1.00 16.08 ? 311 TYR A CD1   1 
ATOM   1990 C  CD2   . TYR A 1 260 ? 12.179  -18.867 -44.397 1.00 16.33 ? 311 TYR A CD2   1 
ATOM   1991 C  CE1   . TYR A 1 260 ? 13.764  -18.195 -46.554 1.00 16.54 ? 311 TYR A CE1   1 
ATOM   1992 C  CE2   . TYR A 1 260 ? 12.812  -19.864 -45.136 1.00 16.35 ? 311 TYR A CE2   1 
ATOM   1993 C  CZ    . TYR A 1 260 ? 13.601  -19.521 -46.208 1.00 15.89 ? 311 TYR A CZ    1 
ATOM   1994 O  OH    . TYR A 1 260 ? 14.221  -20.503 -46.933 1.00 15.03 ? 311 TYR A OH    1 
ATOM   1995 N  N     . VAL A 1 261 ? 10.525  -14.714 -46.397 1.00 16.04 ? 312 VAL A N     1 
ATOM   1996 C  CA    . VAL A 1 261 ? 10.637  -14.452 -47.836 1.00 15.93 ? 312 VAL A CA    1 
ATOM   1997 C  C     . VAL A 1 261 ? 12.061  -14.032 -48.172 1.00 15.96 ? 312 VAL A C     1 
ATOM   1998 O  O     . VAL A 1 261 ? 12.659  -13.211 -47.473 1.00 15.84 ? 312 VAL A O     1 
ATOM   1999 C  CB    . VAL A 1 261 ? 9.679   -13.351 -48.322 1.00 15.77 ? 312 VAL A CB    1 
ATOM   2000 C  CG1   . VAL A 1 261 ? 9.550   -13.419 -49.835 1.00 15.73 ? 312 VAL A CG1   1 
ATOM   2001 C  CG2   . VAL A 1 261 ? 8.316   -13.493 -47.673 1.00 15.88 ? 312 VAL A CG2   1 
ATOM   2002 N  N     . LEU A 1 262 ? 12.592  -14.599 -49.251 1.00 15.94 ? 313 LEU A N     1 
ATOM   2003 C  CA    . LEU A 1 262 ? 13.973  -14.376 -49.641 1.00 16.03 ? 313 LEU A CA    1 
ATOM   2004 C  C     . LEU A 1 262 ? 14.035  -13.181 -50.605 1.00 16.15 ? 313 LEU A C     1 
ATOM   2005 O  O     . LEU A 1 262 ? 13.265  -13.117 -51.558 1.00 15.83 ? 313 LEU A O     1 
ATOM   2006 C  CB    . LEU A 1 262 ? 14.532  -15.665 -50.277 1.00 16.10 ? 313 LEU A CB    1 
ATOM   2007 C  CG    . LEU A 1 262 ? 16.046  -15.945 -50.301 1.00 15.91 ? 313 LEU A CG    1 
ATOM   2008 C  CD1   . LEU A 1 262 ? 16.734  -15.499 -49.015 1.00 15.81 ? 313 LEU A CD1   1 
ATOM   2009 C  CD2   . LEU A 1 262 ? 16.313  -17.429 -50.562 1.00 15.13 ? 313 LEU A CD2   1 
ATOM   2010 N  N     . CYS A 1 263 ? 14.928  -12.229 -50.327 1.00 16.39 ? 314 CYS A N     1 
ATOM   2011 C  CA    . CYS A 1 263 ? 15.129  -11.052 -51.176 1.00 16.86 ? 314 CYS A CA    1 
ATOM   2012 C  C     . CYS A 1 263 ? 16.617  -10.769 -51.353 1.00 16.85 ? 314 CYS A C     1 
ATOM   2013 O  O     . CYS A 1 263 ? 17.459  -11.489 -50.816 1.00 17.11 ? 314 CYS A O     1 
ATOM   2014 C  CB    . CYS A 1 263 ? 14.447  -9.824  -50.566 1.00 17.09 ? 314 CYS A CB    1 
ATOM   2015 S  SG    . CYS A 1 263 ? 12.665  -9.997  -50.344 1.00 18.53 ? 314 CYS A SG    1 
ATOM   2016 N  N     . SER A 1 264 ? 16.942  -9.724  -52.107 1.00 16.71 ? 315 SER A N     1 
ATOM   2017 C  CA    . SER A 1 264 ? 18.338  -9.357  -52.340 1.00 16.65 ? 315 SER A CA    1 
ATOM   2018 C  C     . SER A 1 264 ? 18.699  -7.918  -51.932 1.00 16.60 ? 315 SER A C     1 
ATOM   2019 O  O     . SER A 1 264 ? 19.876  -7.561  -51.930 1.00 16.46 ? 315 SER A O     1 
ATOM   2020 C  CB    . SER A 1 264 ? 18.694  -9.605  -53.806 1.00 16.56 ? 315 SER A CB    1 
ATOM   2021 O  OG    . SER A 1 264 ? 17.596  -9.321  -54.649 1.00 16.55 ? 315 SER A OG    1 
ATOM   2022 N  N     . SER A 1 265 ? 17.708  -7.102  -51.570 1.00 16.67 ? 316 SER A N     1 
ATOM   2023 C  CA    . SER A 1 265 ? 17.970  -5.713  -51.158 1.00 16.60 ? 316 SER A CA    1 
ATOM   2024 C  C     . SER A 1 265 ? 16.812  -5.133  -50.358 1.00 16.56 ? 316 SER A C     1 
ATOM   2025 O  O     . SER A 1 265 ? 15.776  -5.768  -50.212 1.00 16.59 ? 316 SER A O     1 
ATOM   2026 C  CB    . SER A 1 265 ? 18.233  -4.825  -52.381 1.00 16.48 ? 316 SER A CB    1 
ATOM   2027 O  OG    . SER A 1 265 ? 17.021  -4.466  -53.023 1.00 16.27 ? 316 SER A OG    1 
ATOM   2028 N  N     . ARG A 1 266 ? 16.997  -3.918  -49.855 1.00 16.67 ? 317 ARG A N     1 
ATOM   2029 C  CA    . ARG A 1 266 ? 15.929  -3.202  -49.157 1.00 16.84 ? 317 ARG A CA    1 
ATOM   2030 C  C     . ARG A 1 266 ? 14.801  -2.795  -50.102 1.00 16.86 ? 317 ARG A C     1 
ATOM   2031 O  O     . ARG A 1 266 ? 13.636  -2.793  -49.709 1.00 16.75 ? 317 ARG A O     1 
ATOM   2032 C  CB    . ARG A 1 266 ? 16.473  -1.955  -48.461 1.00 16.86 ? 317 ARG A CB    1 
ATOM   2033 C  CG    . ARG A 1 266 ? 15.466  -1.312  -47.526 1.00 17.38 ? 317 ARG A CG    1 
ATOM   2034 C  CD    . ARG A 1 266 ? 16.069  -0.165  -46.745 1.00 17.73 ? 317 ARG A CD    1 
ATOM   2035 N  NE    . ARG A 1 266 ? 16.275  1.012   -47.585 1.00 17.57 ? 317 ARG A NE    1 
ATOM   2036 C  CZ    . ARG A 1 266 ? 16.721  2.185   -47.141 1.00 17.19 ? 317 ARG A CZ    1 
ATOM   2037 N  NH1   . ARG A 1 266 ? 17.019  2.362   -45.851 1.00 16.37 ? 317 ARG A NH1   1 
ATOM   2038 N  NH2   . ARG A 1 266 ? 16.868  3.189   -47.998 1.00 17.06 ? 317 ARG A NH2   1 
ATOM   2039 N  N     . ASP A 1 267 ? 15.151  -2.434  -51.337 1.00 17.05 ? 318 ASP A N     1 
ATOM   2040 C  CA    . ASP A 1 267 ? 14.143  -2.122  -52.356 1.00 17.15 ? 318 ASP A CA    1 
ATOM   2041 C  C     . ASP A 1 267 ? 13.276  -3.350  -52.644 1.00 17.06 ? 318 ASP A C     1 
ATOM   2042 O  O     . ASP A 1 267 ? 12.059  -3.232  -52.806 1.00 16.93 ? 318 ASP A O     1 
ATOM   2043 C  CB    . ASP A 1 267 ? 14.792  -1.622  -53.650 1.00 17.21 ? 318 ASP A CB    1 
ATOM   2044 C  CG    . ASP A 1 267 ? 15.538  -0.303  -53.468 1.00 17.55 ? 318 ASP A CG    1 
ATOM   2045 O  OD1   . ASP A 1 267 ? 16.700  -0.221  -53.924 1.00 18.12 ? 318 ASP A OD1   1 
ATOM   2046 O  OD2   . ASP A 1 267 ? 14.978  0.642   -52.869 1.00 17.14 ? 318 ASP A OD2   1 
ATOM   2047 N  N     . GLU A 1 268 ? 13.907  -4.524  -52.682 1.00 16.95 ? 319 GLU A N     1 
ATOM   2048 C  CA    . GLU A 1 268 ? 13.199  -5.778  -52.939 1.00 16.93 ? 319 GLU A CA    1 
ATOM   2049 C  C     . GLU A 1 268 ? 12.306  -6.194  -51.763 1.00 16.85 ? 319 GLU A C     1 
ATOM   2050 O  O     . GLU A 1 268 ? 11.274  -6.841  -51.960 1.00 16.79 ? 319 GLU A O     1 
ATOM   2051 C  CB    . GLU A 1 268 ? 14.192  -6.891  -53.283 1.00 16.95 ? 319 GLU A CB    1 
ATOM   2052 C  CG    . GLU A 1 268 ? 13.540  -8.155  -53.829 1.00 17.11 ? 319 GLU A CG    1 
ATOM   2053 C  CD    . GLU A 1 268 ? 14.491  -9.004  -54.656 1.00 17.60 ? 319 GLU A CD    1 
ATOM   2054 O  OE1   . GLU A 1 268 ? 15.228  -8.441  -55.494 1.00 16.70 ? 319 GLU A OE1   1 
ATOM   2055 O  OE2   . GLU A 1 268 ? 14.496  -10.240 -54.476 1.00 18.87 ? 319 GLU A OE2   1 
ATOM   2056 N  N     . LYS A 1 269 ? 12.698  -5.825  -50.546 1.00 16.79 ? 320 LYS A N     1 
ATOM   2057 C  CA    . LYS A 1 269 ? 11.855  -6.057  -49.369 1.00 16.66 ? 320 LYS A CA    1 
ATOM   2058 C  C     . LYS A 1 269 ? 10.646  -5.120  -49.377 1.00 16.84 ? 320 LYS A C     1 
ATOM   2059 O  O     . LYS A 1 269 ? 9.547   -5.498  -48.949 1.00 16.96 ? 320 LYS A O     1 
ATOM   2060 C  CB    . LYS A 1 269 ? 12.652  -5.873  -48.076 1.00 16.48 ? 320 LYS A CB    1 
ATOM   2061 C  CG    . LYS A 1 269 ? 13.626  -7.007  -47.787 1.00 15.83 ? 320 LYS A CG    1 
ATOM   2062 C  CD    . LYS A 1 269 ? 14.157  -6.954  -46.360 1.00 14.52 ? 320 LYS A CD    1 
ATOM   2063 C  CE    . LYS A 1 269 ? 15.062  -5.763  -46.113 1.00 13.74 ? 320 LYS A CE    1 
ATOM   2064 N  NZ    . LYS A 1 269 ? 15.920  -5.987  -44.918 1.00 12.86 ? 320 LYS A NZ    1 
ATOM   2065 N  N     . PHE A 1 270 ? 10.857  -3.897  -49.860 1.00 16.80 ? 321 PHE A N     1 
ATOM   2066 C  CA    . PHE A 1 270 ? 9.783   -2.915  -49.981 1.00 16.70 ? 321 PHE A CA    1 
ATOM   2067 C  C     . PHE A 1 270 ? 8.750   -3.377  -50.998 1.00 16.55 ? 321 PHE A C     1 
ATOM   2068 O  O     . PHE A 1 270 ? 7.556   -3.227  -50.781 1.00 16.43 ? 321 PHE A O     1 
ATOM   2069 C  CB    . PHE A 1 270 ? 10.355  -1.553  -50.378 1.00 16.82 ? 321 PHE A CB    1 
ATOM   2070 C  CG    . PHE A 1 270 ? 9.314   -0.507  -50.643 1.00 16.94 ? 321 PHE A CG    1 
ATOM   2071 C  CD1   . PHE A 1 270 ? 9.163   0.037   -51.912 1.00 17.19 ? 321 PHE A CD1   1 
ATOM   2072 C  CD2   . PHE A 1 270 ? 8.485   -0.063  -49.623 1.00 17.13 ? 321 PHE A CD2   1 
ATOM   2073 C  CE1   . PHE A 1 270 ? 8.204   1.010   -52.157 1.00 17.34 ? 321 PHE A CE1   1 
ATOM   2074 C  CE2   . PHE A 1 270 ? 7.519   0.904   -49.861 1.00 16.71 ? 321 PHE A CE2   1 
ATOM   2075 C  CZ    . PHE A 1 270 ? 7.378   1.442   -51.127 1.00 17.12 ? 321 PHE A CZ    1 
ATOM   2076 N  N     . GLN A 1 271 ? 9.216   -3.948  -52.104 1.00 16.66 ? 322 GLN A N     1 
ATOM   2077 C  CA    . GLN A 1 271 ? 8.314   -4.421  -53.146 1.00 16.56 ? 322 GLN A CA    1 
ATOM   2078 C  C     . GLN A 1 271 ? 7.487   -5.618  -52.706 1.00 16.71 ? 322 GLN A C     1 
ATOM   2079 O  O     . GLN A 1 271 ? 6.304   -5.692  -53.021 1.00 16.84 ? 322 GLN A O     1 
ATOM   2080 C  CB    . GLN A 1 271 ? 9.074   -4.754  -54.429 1.00 16.42 ? 322 GLN A CB    1 
ATOM   2081 C  CG    . GLN A 1 271 ? 9.255   -3.565  -55.345 1.00 16.53 ? 322 GLN A CG    1 
ATOM   2082 C  CD    . GLN A 1 271 ? 7.957   -2.812  -55.590 1.00 16.36 ? 322 GLN A CD    1 
ATOM   2083 O  OE1   . GLN A 1 271 ? 7.952   -1.587  -55.687 1.00 16.02 ? 322 GLN A OE1   1 
ATOM   2084 N  NE2   . GLN A 1 271 ? 6.845   -3.542  -55.669 1.00 15.92 ? 322 GLN A NE2   1 
ATOM   2085 N  N     . ALA A 1 272 ? 8.108   -6.552  -51.986 1.00 16.86 ? 323 ALA A N     1 
ATOM   2086 C  CA    . ALA A 1 272 ? 7.407   -7.733  -51.473 1.00 16.87 ? 323 ALA A CA    1 
ATOM   2087 C  C     . ALA A 1 272 ? 6.224   -7.284  -50.622 1.00 17.03 ? 323 ALA A C     1 
ATOM   2088 O  O     . ALA A 1 272 ? 5.066   -7.583  -50.914 1.00 16.98 ? 323 ALA A O     1 
ATOM   2089 C  CB    . ALA A 1 272 ? 8.358   -8.590  -50.647 1.00 16.55 ? 323 ALA A CB    1 
ATOM   2090 N  N     . LEU A 1 273 ? 6.550   -6.526  -49.587 1.00 17.35 ? 324 LEU A N     1 
ATOM   2091 C  CA    . LEU A 1 273 ? 5.587   -5.990  -48.634 1.00 17.53 ? 324 LEU A CA    1 
ATOM   2092 C  C     . LEU A 1 273 ? 4.491   -5.153  -49.324 1.00 17.57 ? 324 LEU A C     1 
ATOM   2093 O  O     . LEU A 1 273 ? 3.318   -5.227  -48.954 1.00 17.36 ? 324 LEU A O     1 
ATOM   2094 C  CB    . LEU A 1 273 ? 6.372   -5.189  -47.583 1.00 17.62 ? 324 LEU A CB    1 
ATOM   2095 C  CG    . LEU A 1 273 ? 5.698   -4.292  -46.551 1.00 17.84 ? 324 LEU A CG    1 
ATOM   2096 C  CD1   . LEU A 1 273 ? 4.868   -5.119  -45.584 1.00 17.57 ? 324 LEU A CD1   1 
ATOM   2097 C  CD2   . LEU A 1 273 ? 6.779   -3.485  -45.820 1.00 17.65 ? 324 LEU A CD2   1 
ATOM   2098 N  N     . CYS A 1 274 ? 4.877   -4.380  -50.336 1.00 17.85 ? 325 CYS A N     1 
ATOM   2099 C  CA    . CYS A 1 274 ? 3.912   -3.698  -51.209 1.00 18.14 ? 325 CYS A CA    1 
ATOM   2100 C  C     . CYS A 1 274 ? 2.872   -4.652  -51.784 1.00 18.34 ? 325 CYS A C     1 
ATOM   2101 O  O     . CYS A 1 274 ? 1.677   -4.343  -51.790 1.00 18.08 ? 325 CYS A O     1 
ATOM   2102 C  CB    . CYS A 1 274 ? 4.620   -3.024  -52.383 1.00 18.13 ? 325 CYS A CB    1 
ATOM   2103 S  SG    . CYS A 1 274 ? 5.155   -1.373  -52.054 1.00 18.76 ? 325 CYS A SG    1 
ATOM   2104 N  N     . ASN A 1 275 ? 3.346   -5.792  -52.291 1.00 18.70 ? 326 ASN A N     1 
ATOM   2105 C  CA    . ASN A 1 275 ? 2.478   -6.786  -52.925 1.00 19.00 ? 326 ASN A CA    1 
ATOM   2106 C  C     . ASN A 1 275 ? 1.608   -7.474  -51.884 1.00 19.16 ? 326 ASN A C     1 
ATOM   2107 O  O     . ASN A 1 275 ? 0.492   -7.890  -52.189 1.00 19.11 ? 326 ASN A O     1 
ATOM   2108 C  CB    . ASN A 1 275 ? 3.290   -7.846  -53.702 1.00 19.10 ? 326 ASN A CB    1 
ATOM   2109 C  CG    . ASN A 1 275 ? 4.176   -7.245  -54.804 1.00 19.41 ? 326 ASN A CG    1 
ATOM   2110 O  OD1   . ASN A 1 275 ? 3.884   -6.180  -55.360 1.00 20.56 ? 326 ASN A OD1   1 
ATOM   2111 N  ND2   . ASN A 1 275 ? 5.266   -7.938  -55.121 1.00 18.95 ? 326 ASN A ND2   1 
ATOM   2112 N  N     . LEU A 1 276 ? 2.123   -7.575  -50.656 1.00 19.41 ? 327 LEU A N     1 
ATOM   2113 C  CA    . LEU A 1 276 ? 1.422   -8.251  -49.561 1.00 19.62 ? 327 LEU A CA    1 
ATOM   2114 C  C     . LEU A 1 276 ? 0.502   -7.345  -48.744 1.00 19.71 ? 327 LEU A C     1 
ATOM   2115 O  O     . LEU A 1 276 ? -0.214  -7.828  -47.873 1.00 19.68 ? 327 LEU A O     1 
ATOM   2116 C  CB    . LEU A 1 276 ? 2.434   -8.901  -48.608 1.00 19.61 ? 327 LEU A CB    1 
ATOM   2117 C  CG    . LEU A 1 276 ? 3.428   -9.902  -49.206 1.00 19.74 ? 327 LEU A CG    1 
ATOM   2118 C  CD1   . LEU A 1 276 ? 4.062   -10.733 -48.098 1.00 19.22 ? 327 LEU A CD1   1 
ATOM   2119 C  CD2   . LEU A 1 276 ? 2.769   -10.805 -50.256 1.00 19.82 ? 327 LEU A CD2   1 
ATOM   2120 N  N     . TYR A 1 277 ? 0.515   -6.046  -49.024 1.00 19.92 ? 328 TYR A N     1 
ATOM   2121 C  CA    . TYR A 1 277 ? -0.213  -5.070  -48.197 1.00 20.12 ? 328 TYR A CA    1 
ATOM   2122 C  C     . TYR A 1 277 ? -1.734  -5.312  -48.160 1.00 20.11 ? 328 TYR A C     1 
ATOM   2123 O  O     . TYR A 1 277 ? -2.360  -5.167  -47.106 1.00 20.10 ? 328 TYR A O     1 
ATOM   2124 C  CB    . TYR A 1 277 ? 0.082   -3.644  -48.671 1.00 20.15 ? 328 TYR A CB    1 
ATOM   2125 C  CG    . TYR A 1 277 ? 0.117   -2.628  -47.559 1.00 20.43 ? 328 TYR A CG    1 
ATOM   2126 C  CD1   . TYR A 1 277 ? -0.949  -1.756  -47.349 1.00 20.50 ? 328 TYR A CD1   1 
ATOM   2127 C  CD2   . TYR A 1 277 ? 1.218   -2.535  -46.717 1.00 20.77 ? 328 TYR A CD2   1 
ATOM   2128 C  CE1   . TYR A 1 277 ? -0.921  -0.821  -46.329 1.00 20.62 ? 328 TYR A CE1   1 
ATOM   2129 C  CE2   . TYR A 1 277 ? 1.262   -1.594  -45.691 1.00 20.74 ? 328 TYR A CE2   1 
ATOM   2130 C  CZ    . TYR A 1 277 ? 0.190   -0.737  -45.501 1.00 20.90 ? 328 TYR A CZ    1 
ATOM   2131 O  OH    . TYR A 1 277 ? 0.225   0.202   -44.483 1.00 20.76 ? 328 TYR A OH    1 
ATOM   2132 N  N     . GLY A 1 278 ? -2.315  -5.690  -49.301 1.00 20.04 ? 329 GLY A N     1 
ATOM   2133 C  CA    . GLY A 1 278 ? -3.734  -6.064  -49.374 1.00 19.84 ? 329 GLY A CA    1 
ATOM   2134 C  C     . GLY A 1 278 ? -4.122  -7.155  -48.385 1.00 19.82 ? 329 GLY A C     1 
ATOM   2135 O  O     . GLY A 1 278 ? -5.227  -7.141  -47.829 1.00 19.80 ? 329 GLY A O     1 
ATOM   2136 N  N     . ALA A 1 279 ? -3.207  -8.096  -48.162 1.00 19.72 ? 330 ALA A N     1 
ATOM   2137 C  CA    . ALA A 1 279 ? -3.419  -9.194  -47.216 1.00 19.68 ? 330 ALA A CA    1 
ATOM   2138 C  C     . ALA A 1 279 ? -3.267  -8.722  -45.768 1.00 19.64 ? 330 ALA A C     1 
ATOM   2139 O  O     . ALA A 1 279 ? -4.063  -9.077  -44.895 1.00 19.56 ? 330 ALA A O     1 
ATOM   2140 C  CB    . ALA A 1 279 ? -2.441  -10.328 -47.508 1.00 19.60 ? 330 ALA A CB    1 
ATOM   2141 N  N     . ILE A 1 280 ? -2.229  -7.929  -45.533 1.00 19.61 ? 331 ILE A N     1 
ATOM   2142 C  CA    . ILE A 1 280 ? -1.915  -7.389  -44.215 1.00 19.66 ? 331 ILE A CA    1 
ATOM   2143 C  C     . ILE A 1 280 ? -3.015  -6.468  -43.665 1.00 19.46 ? 331 ILE A C     1 
ATOM   2144 O  O     . ILE A 1 280 ? -3.231  -6.420  -42.448 1.00 19.46 ? 331 ILE A O     1 
ATOM   2145 C  CB    . ILE A 1 280 ? -0.584  -6.595  -44.269 1.00 19.92 ? 331 ILE A CB    1 
ATOM   2146 C  CG1   . ILE A 1 280 ? 0.597   -7.550  -44.435 1.00 20.23 ? 331 ILE A CG1   1 
ATOM   2147 C  CG2   . ILE A 1 280 ? -0.387  -5.740  -43.021 1.00 19.89 ? 331 ILE A CG2   1 
ATOM   2148 C  CD1   . ILE A 1 280 ? 1.917   -6.821  -44.573 1.00 21.03 ? 331 ILE A CD1   1 
ATOM   2149 N  N     . THR A 1 281 ? -3.692  -5.732  -44.550 1.00 19.00 ? 332 THR A N     1 
ATOM   2150 C  CA    . THR A 1 281 ? -4.710  -4.770  -44.122 1.00 18.64 ? 332 THR A CA    1 
ATOM   2151 C  C     . THR A 1 281 ? -6.089  -5.401  -43.963 1.00 18.58 ? 332 THR A C     1 
ATOM   2152 O  O     . THR A 1 281 ? -7.022  -4.728  -43.517 1.00 18.72 ? 332 THR A O     1 
ATOM   2153 C  CB    . THR A 1 281 ? -4.803  -3.571  -45.076 1.00 18.48 ? 332 THR A CB    1 
ATOM   2154 O  OG1   . THR A 1 281 ? -5.019  -4.032  -46.413 1.00 18.14 ? 332 THR A OG1   1 
ATOM   2155 C  CG2   . THR A 1 281 ? -3.522  -2.757  -45.016 1.00 18.30 ? 332 THR A CG2   1 
ATOM   2156 N  N     . ILE A 1 282 ? -6.214  -6.681  -44.319 1.00 18.35 ? 333 ILE A N     1 
ATOM   2157 C  CA    . ILE A 1 282 ? -7.438  -7.448  -44.062 1.00 18.27 ? 333 ILE A CA    1 
ATOM   2158 C  C     . ILE A 1 282 ? -7.827  -7.309  -42.595 1.00 17.81 ? 333 ILE A C     1 
ATOM   2159 O  O     . ILE A 1 282 ? -8.960  -6.943  -42.274 1.00 17.88 ? 333 ILE A O     1 
ATOM   2160 C  CB    . ILE A 1 282 ? -7.265  -8.964  -44.375 1.00 18.43 ? 333 ILE A CB    1 
ATOM   2161 C  CG1   . ILE A 1 282 ? -7.157  -9.203  -45.883 1.00 18.61 ? 333 ILE A CG1   1 
ATOM   2162 C  CG2   . ILE A 1 282 ? -8.436  -9.773  -43.810 1.00 18.51 ? 333 ILE A CG2   1 
ATOM   2163 C  CD1   . ILE A 1 282 ? -7.022  -10.675 -46.257 1.00 19.26 ? 333 ILE A CD1   1 
ATOM   2164 N  N     . ALA A 1 283 ? -6.874  -7.618  -41.718 1.00 17.17 ? 334 ALA A N     1 
ATOM   2165 C  CA    . ALA A 1 283 ? -7.037  -7.416  -40.289 1.00 16.74 ? 334 ALA A CA    1 
ATOM   2166 C  C     . ALA A 1 283 ? -6.099  -6.296  -39.859 1.00 16.24 ? 334 ALA A C     1 
ATOM   2167 O  O     . ALA A 1 283 ? -6.297  -5.140  -40.237 1.00 16.42 ? 334 ALA A O     1 
ATOM   2168 C  CB    . ALA A 1 283 ? -6.759  -8.710  -39.520 1.00 16.67 ? 334 ALA A CB    1 
ATOM   2169 N  N     . GLN A 1 284 ? -5.069  -6.640  -39.099 1.00 15.48 ? 335 GLN A N     1 
ATOM   2170 C  CA    . GLN A 1 284 ? -4.166  -5.650  -38.550 1.00 15.11 ? 335 GLN A CA    1 
ATOM   2171 C  C     . GLN A 1 284 ? -2.784  -6.278  -38.497 1.00 14.80 ? 335 GLN A C     1 
ATOM   2172 O  O     . GLN A 1 284 ? -2.672  -7.493  -38.430 1.00 14.97 ? 335 GLN A O     1 
ATOM   2173 C  CB    . GLN A 1 284 ? -4.663  -5.255  -37.160 1.00 15.16 ? 335 GLN A CB    1 
ATOM   2174 C  CG    . GLN A 1 284 ? -4.323  -3.844  -36.722 1.00 14.68 ? 335 GLN A CG    1 
ATOM   2175 C  CD    . GLN A 1 284 ? -5.369  -3.234  -35.809 1.00 13.86 ? 335 GLN A CD    1 
ATOM   2176 O  OE1   . GLN A 1 284 ? -6.514  -3.675  -35.762 1.00 14.47 ? 335 GLN A OE1   1 
ATOM   2177 N  NE2   . GLN A 1 284 ? -4.982  -2.195  -35.097 1.00 13.79 ? 335 GLN A NE2   1 
ATOM   2178 N  N     . ALA A 1 285 ? -1.734  -5.468  -38.550 1.00 14.64 ? 336 ALA A N     1 
ATOM   2179 C  CA    . ALA A 1 285 ? -0.366  -6.003  -38.604 1.00 14.54 ? 336 ALA A CA    1 
ATOM   2180 C  C     . ALA A 1 285 ? 0.696   -5.045  -38.060 1.00 14.50 ? 336 ALA A C     1 
ATOM   2181 O  O     . ALA A 1 285 ? 0.473   -3.835  -37.963 1.00 14.59 ? 336 ALA A O     1 
ATOM   2182 C  CB    . ALA A 1 285 ? -0.018  -6.399  -40.026 1.00 14.47 ? 336 ALA A CB    1 
ATOM   2183 N  N     . MET A 1 286 ? 1.852   -5.610  -37.716 1.00 14.33 ? 337 MET A N     1 
ATOM   2184 C  CA    . MET A 1 286 ? 2.991   -4.855  -37.199 1.00 14.33 ? 337 MET A CA    1 
ATOM   2185 C  C     . MET A 1 286 ? 4.254   -5.178  -37.978 1.00 14.06 ? 337 MET A C     1 
ATOM   2186 O  O     . MET A 1 286 ? 4.530   -6.338  -38.271 1.00 14.10 ? 337 MET A O     1 
ATOM   2187 C  CB    . MET A 1 286 ? 3.224   -5.183  -35.721 1.00 14.42 ? 337 MET A CB    1 
ATOM   2188 C  CG    . MET A 1 286 ? 2.552   -4.214  -34.774 1.00 15.05 ? 337 MET A CG    1 
ATOM   2189 S  SD    . MET A 1 286 ? 2.516   -4.801  -33.069 1.00 17.12 ? 337 MET A SD    1 
ATOM   2190 C  CE    . MET A 1 286 ? 4.031   -4.111  -32.398 1.00 15.06 ? 337 MET A CE    1 
ATOM   2191 N  N     . ILE A 1 287 ? 5.027   -4.142  -38.286 1.00 13.79 ? 338 ILE A N     1 
ATOM   2192 C  CA    . ILE A 1 287 ? 6.276   -4.286  -39.010 1.00 13.51 ? 338 ILE A CA    1 
ATOM   2193 C  C     . ILE A 1 287 ? 7.403   -3.735  -38.159 1.00 13.56 ? 338 ILE A C     1 
ATOM   2194 O  O     . ILE A 1 287 ? 7.383   -2.554  -37.815 1.00 13.47 ? 338 ILE A O     1 
ATOM   2195 C  CB    . ILE A 1 287 ? 6.258   -3.508  -40.336 1.00 13.47 ? 338 ILE A CB    1 
ATOM   2196 C  CG1   . ILE A 1 287 ? 5.030   -3.889  -41.174 1.00 13.21 ? 338 ILE A CG1   1 
ATOM   2197 C  CG2   . ILE A 1 287 ? 7.542   -3.766  -41.108 1.00 12.94 ? 338 ILE A CG2   1 
ATOM   2198 C  CD1   . ILE A 1 287 ? 4.836   -3.025  -42.400 1.00 12.74 ? 338 ILE A CD1   1 
ATOM   2199 N  N     . PHE A 1 288 ? 8.381   -4.586  -37.831 1.00 13.50 ? 339 PHE A N     1 
ATOM   2200 C  CA    . PHE A 1 288 ? 9.546   -4.174  -37.041 1.00 13.47 ? 339 PHE A CA    1 
ATOM   2201 C  C     . PHE A 1 288 ? 10.754  -3.829  -37.912 1.00 13.57 ? 339 PHE A C     1 
ATOM   2202 O  O     . PHE A 1 288 ? 10.959  -4.439  -38.965 1.00 13.70 ? 339 PHE A O     1 
ATOM   2203 C  CB    . PHE A 1 288 ? 9.933   -5.269  -36.053 1.00 13.53 ? 339 PHE A CB    1 
ATOM   2204 C  CG    . PHE A 1 288 ? 8.944   -5.455  -34.932 1.00 13.05 ? 339 PHE A CG    1 
ATOM   2205 C  CD1   . PHE A 1 288 ? 8.102   -6.555  -34.899 1.00 12.59 ? 339 PHE A CD1   1 
ATOM   2206 C  CD2   . PHE A 1 288 ? 8.862   -4.525  -33.912 1.00 12.50 ? 339 PHE A CD2   1 
ATOM   2207 C  CE1   . PHE A 1 288 ? 7.199   -6.724  -33.866 1.00 12.39 ? 339 PHE A CE1   1 
ATOM   2208 C  CE2   . PHE A 1 288 ? 7.964   -4.686  -32.880 1.00 12.72 ? 339 PHE A CE2   1 
ATOM   2209 C  CZ    . PHE A 1 288 ? 7.131   -5.788  -32.855 1.00 12.47 ? 339 PHE A CZ    1 
ATOM   2210 N  N     . CYS A 1 289 ? 11.542  -2.849  -37.459 1.00 13.39 ? 340 CYS A N     1 
ATOM   2211 C  CA    . CYS A 1 289 ? 12.775  -2.428  -38.133 1.00 13.53 ? 340 CYS A CA    1 
ATOM   2212 C  C     . CYS A 1 289 ? 13.937  -2.328  -37.147 1.00 13.25 ? 340 CYS A C     1 
ATOM   2213 O  O     . CYS A 1 289 ? 13.740  -2.136  -35.949 1.00 13.10 ? 340 CYS A O     1 
ATOM   2214 C  CB    . CYS A 1 289 ? 12.578  -1.074  -38.806 1.00 13.57 ? 340 CYS A CB    1 
ATOM   2215 S  SG    . CYS A 1 289 ? 11.289  -1.082  -40.077 1.00 15.43 ? 340 CYS A SG    1 
ATOM   2216 N  N     . HIS A 1 290 ? 15.157  -2.440  -37.655 1.00 13.10 ? 341 HIS A N     1 
ATOM   2217 C  CA    . HIS A 1 290 ? 16.324  -2.431  -36.783 1.00 12.83 ? 341 HIS A CA    1 
ATOM   2218 C  C     . HIS A 1 290 ? 16.585  -1.054  -36.181 1.00 12.49 ? 341 HIS A C     1 
ATOM   2219 O  O     . HIS A 1 290 ? 17.131  -0.952  -35.086 1.00 12.28 ? 341 HIS A O     1 
ATOM   2220 C  CB    . HIS A 1 290 ? 17.575  -2.926  -37.510 1.00 12.70 ? 341 HIS A CB    1 
ATOM   2221 C  CG    . HIS A 1 290 ? 18.758  -3.080  -36.606 1.00 13.10 ? 341 HIS A CG    1 
ATOM   2222 N  ND1   . HIS A 1 290 ? 19.917  -2.350  -36.758 1.00 13.46 ? 341 HIS A ND1   1 
ATOM   2223 C  CD2   . HIS A 1 290 ? 18.944  -3.853  -35.508 1.00 13.34 ? 341 HIS A CD2   1 
ATOM   2224 C  CE1   . HIS A 1 290 ? 20.772  -2.677  -35.805 1.00 13.12 ? 341 HIS A CE1   1 
ATOM   2225 N  NE2   . HIS A 1 290 ? 20.206  -3.586  -35.032 1.00 12.77 ? 341 HIS A NE2   1 
ATOM   2226 N  N     . THR A 1 291 ? 16.194  -0.002  -36.894 1.00 12.25 ? 342 THR A N     1 
ATOM   2227 C  CA    . THR A 1 291 ? 16.475  1.361   -36.463 1.00 12.24 ? 342 THR A CA    1 
ATOM   2228 C  C     . THR A 1 291 ? 15.309  2.314   -36.723 1.00 12.34 ? 342 THR A C     1 
ATOM   2229 O  O     . THR A 1 291 ? 14.387  2.004   -37.487 1.00 12.52 ? 342 THR A O     1 
ATOM   2230 C  CB    . THR A 1 291 ? 17.725  1.916   -37.176 1.00 12.30 ? 342 THR A CB    1 
ATOM   2231 O  OG1   . THR A 1 291 ? 17.469  2.028   -38.586 1.00 12.52 ? 342 THR A OG1   1 
ATOM   2232 C  CG2   . THR A 1 291 ? 18.929  1.001   -36.943 1.00 11.80 ? 342 THR A CG2   1 
ATOM   2233 N  N     . ARG A 1 292 ? 15.381  3.486   -36.091 1.00 12.26 ? 343 ARG A N     1 
ATOM   2234 C  CA    . ARG A 1 292 ? 14.360  4.529   -36.221 1.00 11.89 ? 343 ARG A CA    1 
ATOM   2235 C  C     . ARG A 1 292 ? 14.312  5.097   -37.631 1.00 11.71 ? 343 ARG A C     1 
ATOM   2236 O  O     . ARG A 1 292 ? 13.242  5.405   -38.137 1.00 11.80 ? 343 ARG A O     1 
ATOM   2237 C  CB    . ARG A 1 292 ? 14.639  5.677   -35.251 1.00 11.83 ? 343 ARG A CB    1 
ATOM   2238 C  CG    . ARG A 1 292 ? 14.680  5.290   -33.792 1.00 11.69 ? 343 ARG A CG    1 
ATOM   2239 C  CD    . ARG A 1 292 ? 15.111  6.471   -32.967 1.00 11.71 ? 343 ARG A CD    1 
ATOM   2240 N  NE    . ARG A 1 292 ? 15.080  6.194   -31.535 1.00 12.15 ? 343 ARG A NE    1 
ATOM   2241 C  CZ    . ARG A 1 292 ? 15.362  7.091   -30.591 1.00 12.56 ? 343 ARG A CZ    1 
ATOM   2242 N  NH1   . ARG A 1 292 ? 15.707  8.335   -30.916 1.00 12.33 ? 343 ARG A NH1   1 
ATOM   2243 N  NH2   . ARG A 1 292 ? 15.302  6.743   -29.310 1.00 13.08 ? 343 ARG A NH2   1 
ATOM   2244 N  N     . LYS A 1 293 ? 15.480  5.256   -38.247 1.00 11.63 ? 344 LYS A N     1 
ATOM   2245 C  CA    . LYS A 1 293 ? 15.575  5.817   -39.592 1.00 11.62 ? 344 LYS A CA    1 
ATOM   2246 C  C     . LYS A 1 293 ? 14.909  4.930   -40.643 1.00 11.50 ? 344 LYS A C     1 
ATOM   2247 O  O     . LYS A 1 293 ? 14.201  5.438   -41.520 1.00 11.27 ? 344 LYS A O     1 
ATOM   2248 C  CB    . LYS A 1 293 ? 17.036  6.087   -39.959 1.00 11.70 ? 344 LYS A CB    1 
ATOM   2249 C  CG    . LYS A 1 293 ? 17.568  7.356   -39.334 1.00 12.45 ? 344 LYS A CG    1 
ATOM   2250 C  CD    . LYS A 1 293 ? 19.055  7.528   -39.553 1.00 13.76 ? 344 LYS A CD    1 
ATOM   2251 C  CE    . LYS A 1 293 ? 19.607  8.668   -38.681 1.00 14.67 ? 344 LYS A CE    1 
ATOM   2252 N  NZ    . LYS A 1 293 ? 21.041  8.996   -38.984 1.00 14.85 ? 344 LYS A NZ    1 
ATOM   2253 N  N     . THR A 1 294 ? 15.131  3.615   -40.544 1.00 11.41 ? 345 THR A N     1 
ATOM   2254 C  CA    . THR A 1 294 ? 14.495  2.642   -41.442 1.00 11.21 ? 345 THR A CA    1 
ATOM   2255 C  C     . THR A 1 294 ? 12.992  2.593   -41.196 1.00 11.26 ? 345 THR A C     1 
ATOM   2256 O  O     . THR A 1 294 ? 12.218  2.431   -42.133 1.00 11.60 ? 345 THR A O     1 
ATOM   2257 C  CB    . THR A 1 294 ? 15.059  1.207   -41.274 1.00 11.07 ? 345 THR A CB    1 
ATOM   2258 O  OG1   . THR A 1 294 ? 16.489  1.228   -41.301 1.00 10.75 ? 345 THR A OG1   1 
ATOM   2259 C  CG2   . THR A 1 294 ? 14.551  0.295   -42.380 1.00 10.55 ? 345 THR A CG2   1 
ATOM   2260 N  N     . ALA A 1 295 ? 12.584  2.723   -39.937 1.00 11.20 ? 346 ALA A N     1 
ATOM   2261 C  CA    . ALA A 1 295 ? 11.166  2.806   -39.594 1.00 11.15 ? 346 ALA A CA    1 
ATOM   2262 C  C     . ALA A 1 295 ? 10.540  3.975   -40.338 1.00 10.96 ? 346 ALA A C     1 
ATOM   2263 O  O     . ALA A 1 295 ? 9.546   3.830   -41.039 1.00 11.06 ? 346 ALA A O     1 
ATOM   2264 C  CB    . ALA A 1 295 ? 10.989  2.972   -38.083 1.00 10.98 ? 346 ALA A CB    1 
ATOM   2265 N  N     . SER A 1 296 ? 11.156  5.134   -40.198 1.00 11.03 ? 347 SER A N     1 
ATOM   2266 C  CA    . SER A 1 296 ? 10.656  6.350   -40.819 1.00 11.13 ? 347 SER A CA    1 
ATOM   2267 C  C     . SER A 1 296 ? 10.727  6.310   -42.350 1.00 10.95 ? 347 SER A C     1 
ATOM   2268 O  O     . SER A 1 296 ? 9.849   6.841   -43.022 1.00 10.79 ? 347 SER A O     1 
ATOM   2269 C  CB    . SER A 1 296 ? 11.441  7.546   -40.285 1.00 11.06 ? 347 SER A CB    1 
ATOM   2270 O  OG    . SER A 1 296 ? 10.922  8.750   -40.795 1.00 11.42 ? 347 SER A OG    1 
ATOM   2271 N  N     . TRP A 1 297 ? 11.779  5.695   -42.888 1.00 11.14 ? 348 TRP A N     1 
ATOM   2272 C  CA    . TRP A 1 297 ? 11.940  5.549   -44.335 1.00 11.21 ? 348 TRP A CA    1 
ATOM   2273 C  C     . TRP A 1 297 ? 10.831  4.667   -44.882 1.00 11.39 ? 348 TRP A C     1 
ATOM   2274 O  O     . TRP A 1 297 ? 10.182  5.011   -45.871 1.00 11.29 ? 348 TRP A O     1 
ATOM   2275 C  CB    . TRP A 1 297 ? 13.299  4.926   -44.687 1.00 11.16 ? 348 TRP A CB    1 
ATOM   2276 C  CG    . TRP A 1 297 ? 13.475  4.640   -46.180 1.00 11.48 ? 348 TRP A CG    1 
ATOM   2277 C  CD1   . TRP A 1 297 ? 13.961  5.499   -47.122 1.00 11.59 ? 348 TRP A CD1   1 
ATOM   2278 C  CD2   . TRP A 1 297 ? 13.158  3.420   -46.880 1.00 11.43 ? 348 TRP A CD2   1 
ATOM   2279 N  NE1   . TRP A 1 297 ? 13.968  4.898   -48.356 1.00 11.65 ? 348 TRP A NE1   1 
ATOM   2280 C  CE2   . TRP A 1 297 ? 13.478  3.624   -48.238 1.00 11.35 ? 348 TRP A CE2   1 
ATOM   2281 C  CE3   . TRP A 1 297 ? 12.632  2.179   -46.489 1.00 11.83 ? 348 TRP A CE3   1 
ATOM   2282 C  CZ2   . TRP A 1 297 ? 13.296  2.633   -49.211 1.00 11.25 ? 348 TRP A CZ2   1 
ATOM   2283 C  CZ3   . TRP A 1 297 ? 12.449  1.191   -47.460 1.00 11.82 ? 348 TRP A CZ3   1 
ATOM   2284 C  CH2   . TRP A 1 297 ? 12.780  1.429   -48.804 1.00 11.70 ? 348 TRP A CH2   1 
ATOM   2285 N  N     . LEU A 1 298 ? 10.623  3.527   -44.231 1.00 11.62 ? 349 LEU A N     1 
ATOM   2286 C  CA    . LEU A 1 298 ? 9.607   2.574   -44.658 1.00 11.98 ? 349 LEU A CA    1 
ATOM   2287 C  C     . LEU A 1 298 ? 8.235   3.246   -44.676 1.00 12.36 ? 349 LEU A C     1 
ATOM   2288 O  O     . LEU A 1 298 ? 7.488   3.147   -45.664 1.00 12.65 ? 349 LEU A O     1 
ATOM   2289 C  CB    . LEU A 1 298 ? 9.607   1.346   -43.742 1.00 11.77 ? 349 LEU A CB    1 
ATOM   2290 C  CG    . LEU A 1 298 ? 8.692   0.173   -44.100 1.00 11.65 ? 349 LEU A CG    1 
ATOM   2291 C  CD1   . LEU A 1 298 ? 8.657   -0.082  -45.596 1.00 11.07 ? 349 LEU A CD1   1 
ATOM   2292 C  CD2   . LEU A 1 298 ? 9.119   -1.092  -43.343 1.00 11.06 ? 349 LEU A CD2   1 
ATOM   2293 N  N     . ALA A 1 299 ? 7.930   3.960   -43.596 1.00 12.52 ? 350 ALA A N     1 
ATOM   2294 C  CA    . ALA A 1 299 ? 6.670   4.686   -43.472 1.00 12.47 ? 350 ALA A CA    1 
ATOM   2295 C  C     . ALA A 1 299 ? 6.445   5.638   -44.648 1.00 12.49 ? 350 ALA A C     1 
ATOM   2296 O  O     . ALA A 1 299 ? 5.377   5.628   -45.252 1.00 12.51 ? 350 ALA A O     1 
ATOM   2297 C  CB    . ALA A 1 299 ? 6.636   5.445   -42.152 1.00 12.51 ? 350 ALA A CB    1 
ATOM   2298 N  N     . ALA A 1 300 ? 7.456   6.446   -44.970 1.00 12.50 ? 351 ALA A N     1 
ATOM   2299 C  CA    . ALA A 1 300 ? 7.355   7.428   -46.054 1.00 12.66 ? 351 ALA A CA    1 
ATOM   2300 C  C     . ALA A 1 300 ? 7.268   6.769   -47.423 1.00 12.78 ? 351 ALA A C     1 
ATOM   2301 O  O     . ALA A 1 300 ? 6.645   7.305   -48.342 1.00 12.81 ? 351 ALA A O     1 
ATOM   2302 C  CB    . ALA A 1 300 ? 8.536   8.399   -46.015 1.00 12.58 ? 351 ALA A CB    1 
ATOM   2303 N  N     . GLU A 1 301 ? 7.896   5.606   -47.555 1.00 12.92 ? 352 GLU A N     1 
ATOM   2304 C  CA    . GLU A 1 301 ? 7.891   4.882   -48.813 1.00 12.87 ? 352 GLU A CA    1 
ATOM   2305 C  C     . GLU A 1 301 ? 6.524   4.214   -49.032 1.00 13.09 ? 352 GLU A C     1 
ATOM   2306 O  O     . GLU A 1 301 ? 5.960   4.310   -50.119 1.00 13.01 ? 352 GLU A O     1 
ATOM   2307 C  CB    . GLU A 1 301 ? 9.038   3.866   -48.838 1.00 12.75 ? 352 GLU A CB    1 
ATOM   2308 C  CG    . GLU A 1 301 ? 9.684   3.684   -50.198 1.00 12.48 ? 352 GLU A CG    1 
ATOM   2309 C  CD    . GLU A 1 301 ? 10.323  4.952   -50.737 1.00 11.55 ? 352 GLU A CD    1 
ATOM   2310 O  OE1   . GLU A 1 301 ? 11.003  5.659   -49.969 1.00 11.26 ? 352 GLU A OE1   1 
ATOM   2311 O  OE2   . GLU A 1 301 ? 10.138  5.235   -51.938 1.00 10.51 ? 352 GLU A OE2   1 
ATOM   2312 N  N     . LEU A 1 302 ? 5.986   3.561   -48.000 1.00 13.32 ? 353 LEU A N     1 
ATOM   2313 C  CA    . LEU A 1 302 ? 4.623   3.008   -48.061 1.00 13.57 ? 353 LEU A CA    1 
ATOM   2314 C  C     . LEU A 1 302 ? 3.572   4.084   -48.321 1.00 14.02 ? 353 LEU A C     1 
ATOM   2315 O  O     . LEU A 1 302 ? 2.635   3.886   -49.094 1.00 13.88 ? 353 LEU A O     1 
ATOM   2316 C  CB    . LEU A 1 302 ? 4.264   2.304   -46.756 1.00 13.43 ? 353 LEU A CB    1 
ATOM   2317 C  CG    . LEU A 1 302 ? 4.927   0.964   -46.494 1.00 13.00 ? 353 LEU A CG    1 
ATOM   2318 C  CD1   . LEU A 1 302 ? 4.492   0.440   -45.138 1.00 12.92 ? 353 LEU A CD1   1 
ATOM   2319 C  CD2   . LEU A 1 302 ? 4.575   -0.016  -47.582 1.00 12.99 ? 353 LEU A CD2   1 
ATOM   2320 N  N     . SER A 1 303 ? 3.733   5.217   -47.648 1.00 14.73 ? 354 SER A N     1 
ATOM   2321 C  CA    . SER A 1 303 ? 2.801   6.338   -47.746 1.00 15.32 ? 354 SER A CA    1 
ATOM   2322 C  C     . SER A 1 303 ? 2.826   6.962   -49.140 1.00 15.73 ? 354 SER A C     1 
ATOM   2323 O  O     . SER A 1 303 ? 1.799   7.406   -49.664 1.00 15.62 ? 354 SER A O     1 
ATOM   2324 C  CB    . SER A 1 303 ? 3.157   7.388   -46.685 1.00 15.37 ? 354 SER A CB    1 
ATOM   2325 O  OG    . SER A 1 303 ? 2.304   8.515   -46.750 1.00 15.80 ? 354 SER A OG    1 
ATOM   2326 N  N     . LYS A 1 304 ? 4.010   6.987   -49.736 1.00 16.32 ? 355 LYS A N     1 
ATOM   2327 C  CA    . LYS A 1 304 ? 4.186   7.540   -51.068 1.00 16.83 ? 355 LYS A CA    1 
ATOM   2328 C  C     . LYS A 1 304 ? 3.748   6.528   -52.124 1.00 16.95 ? 355 LYS A C     1 
ATOM   2329 O  O     . LYS A 1 304 ? 3.538   6.881   -53.282 1.00 17.22 ? 355 LYS A O     1 
ATOM   2330 C  CB    . LYS A 1 304 ? 5.641   7.965   -51.252 1.00 16.93 ? 355 LYS A CB    1 
ATOM   2331 C  CG    . LYS A 1 304 ? 5.901   8.880   -52.437 1.00 17.56 ? 355 LYS A CG    1 
ATOM   2332 C  CD    . LYS A 1 304 ? 6.971   9.955   -52.143 1.00 18.16 ? 355 LYS A CD    1 
ATOM   2333 C  CE    . LYS A 1 304 ? 8.133   9.472   -51.240 1.00 18.30 ? 355 LYS A CE    1 
ATOM   2334 N  NZ    . LYS A 1 304 ? 8.668   8.117   -51.562 1.00 18.22 ? 355 LYS A NZ    1 
ATOM   2335 N  N     . GLU A 1 305 ? 3.597   5.274   -51.713 1.00 17.21 ? 356 GLU A N     1 
ATOM   2336 C  CA    . GLU A 1 305 ? 2.994   4.251   -52.559 1.00 17.57 ? 356 GLU A CA    1 
ATOM   2337 C  C     . GLU A 1 305 ? 1.466   4.235   -52.394 1.00 17.70 ? 356 GLU A C     1 
ATOM   2338 O  O     . GLU A 1 305 ? 0.780   3.449   -53.044 1.00 17.79 ? 356 GLU A O     1 
ATOM   2339 C  CB    . GLU A 1 305 ? 3.601   2.875   -52.246 1.00 17.59 ? 356 GLU A CB    1 
ATOM   2340 C  CG    . GLU A 1 305 ? 3.513   1.858   -53.378 1.00 18.10 ? 356 GLU A CG    1 
ATOM   2341 C  CD    . GLU A 1 305 ? 4.429   2.175   -54.554 1.00 18.95 ? 356 GLU A CD    1 
ATOM   2342 O  OE1   . GLU A 1 305 ? 4.780   1.237   -55.300 1.00 19.19 ? 356 GLU A OE1   1 
ATOM   2343 O  OE2   . GLU A 1 305 ? 4.794   3.356   -54.744 1.00 19.88 ? 356 GLU A OE2   1 
ATOM   2344 N  N     . GLY A 1 306 ? 0.944   5.107   -51.533 1.00 17.89 ? 357 GLY A N     1 
ATOM   2345 C  CA    . GLY A 1 306 ? -0.492  5.330   -51.417 1.00 18.16 ? 357 GLY A CA    1 
ATOM   2346 C  C     . GLY A 1 306 ? -1.183  4.502   -50.349 1.00 18.58 ? 357 GLY A C     1 
ATOM   2347 O  O     . GLY A 1 306 ? -2.412  4.493   -50.269 1.00 18.63 ? 357 GLY A O     1 
ATOM   2348 N  N     . HIS A 1 307 ? -0.403  3.811   -49.523 1.00 18.98 ? 358 HIS A N     1 
ATOM   2349 C  CA    . HIS A 1 307 ? -0.954  2.998   -48.440 1.00 19.16 ? 358 HIS A CA    1 
ATOM   2350 C  C     . HIS A 1 307 ? -1.016  3.832   -47.163 1.00 19.48 ? 358 HIS A C     1 
ATOM   2351 O  O     . HIS A 1 307 ? -0.039  4.498   -46.815 1.00 19.68 ? 358 HIS A O     1 
ATOM   2352 C  CB    . HIS A 1 307 ? -0.083  1.762   -48.209 1.00 19.12 ? 358 HIS A CB    1 
ATOM   2353 C  CG    . HIS A 1 307 ? 0.122   0.929   -49.434 1.00 18.91 ? 358 HIS A CG    1 
ATOM   2354 N  ND1   . HIS A 1 307 ? 1.361   0.752   -50.013 1.00 18.94 ? 358 HIS A ND1   1 
ATOM   2355 C  CD2   . HIS A 1 307 ? -0.755  0.243   -50.204 1.00 18.39 ? 358 HIS A CD2   1 
ATOM   2356 C  CE1   . HIS A 1 307 ? 1.238   -0.012  -51.084 1.00 18.81 ? 358 HIS A CE1   1 
ATOM   2357 N  NE2   . HIS A 1 307 ? -0.035  -0.337  -51.220 1.00 18.63 ? 358 HIS A NE2   1 
ATOM   2358 N  N     . GLN A 1 308 ? -2.155  3.815   -46.469 1.00 19.60 ? 359 GLN A N     1 
ATOM   2359 C  CA    . GLN A 1 308 ? -2.221  4.451   -45.158 1.00 19.65 ? 359 GLN A CA    1 
ATOM   2360 C  C     . GLN A 1 308 ? -1.361  3.614   -44.221 1.00 19.28 ? 359 GLN A C     1 
ATOM   2361 O  O     . GLN A 1 308 ? -1.407  2.387   -44.271 1.00 19.57 ? 359 GLN A O     1 
ATOM   2362 C  CB    . GLN A 1 308 ? -3.653  4.550   -44.633 1.00 19.92 ? 359 GLN A CB    1 
ATOM   2363 C  CG    . GLN A 1 308 ? -3.810  5.620   -43.537 1.00 21.05 ? 359 GLN A CG    1 
ATOM   2364 C  CD    . GLN A 1 308 ? -5.155  5.566   -42.818 1.00 22.52 ? 359 GLN A CD    1 
ATOM   2365 O  OE1   . GLN A 1 308 ? -5.573  4.511   -42.326 1.00 23.86 ? 359 GLN A OE1   1 
ATOM   2366 N  NE2   . GLN A 1 308 ? -5.831  6.713   -42.737 1.00 23.00 ? 359 GLN A NE2   1 
ATOM   2367 N  N     . VAL A 1 309 ? -0.563  4.282   -43.393 1.00 18.74 ? 360 VAL A N     1 
ATOM   2368 C  CA    . VAL A 1 309 ? 0.432   3.613   -42.553 1.00 18.33 ? 360 VAL A CA    1 
ATOM   2369 C  C     . VAL A 1 309 ? 0.654   4.428   -41.283 1.00 17.93 ? 360 VAL A C     1 
ATOM   2370 O  O     . VAL A 1 309 ? 0.507   5.658   -41.292 1.00 17.86 ? 360 VAL A O     1 
ATOM   2371 C  CB    . VAL A 1 309 ? 1.793   3.429   -43.313 1.00 18.50 ? 360 VAL A CB    1 
ATOM   2372 C  CG1   . VAL A 1 309 ? 2.311   4.765   -43.841 1.00 18.18 ? 360 VAL A CG1   1 
ATOM   2373 C  CG2   . VAL A 1 309 ? 2.851   2.756   -42.426 1.00 18.44 ? 360 VAL A CG2   1 
ATOM   2374 N  N     . ALA A 1 310 ? 0.997   3.735   -40.195 1.00 17.27 ? 361 ALA A N     1 
ATOM   2375 C  CA    . ALA A 1 310 ? 1.246   4.374   -38.904 1.00 16.71 ? 361 ALA A CA    1 
ATOM   2376 C  C     . ALA A 1 310 ? 2.704   4.186   -38.512 1.00 16.19 ? 361 ALA A C     1 
ATOM   2377 O  O     . ALA A 1 310 ? 3.261   3.104   -38.693 1.00 16.17 ? 361 ALA A O     1 
ATOM   2378 C  CB    . ALA A 1 310 ? 0.325   3.790   -37.840 1.00 16.62 ? 361 ALA A CB    1 
ATOM   2379 N  N     . LEU A 1 311 ? 3.320   5.245   -37.987 1.00 15.68 ? 362 LEU A N     1 
ATOM   2380 C  CA    . LEU A 1 311 ? 4.692   5.179   -37.481 1.00 15.07 ? 362 LEU A CA    1 
ATOM   2381 C  C     . LEU A 1 311 ? 4.721   5.366   -35.969 1.00 14.74 ? 362 LEU A C     1 
ATOM   2382 O  O     . LEU A 1 311 ? 3.969   6.174   -35.423 1.00 14.86 ? 362 LEU A O     1 
ATOM   2383 C  CB    . LEU A 1 311 ? 5.566   6.240   -38.151 1.00 14.99 ? 362 LEU A CB    1 
ATOM   2384 C  CG    . LEU A 1 311 ? 7.067   6.234   -37.822 1.00 14.30 ? 362 LEU A CG    1 
ATOM   2385 C  CD1   . LEU A 1 311 ? 7.738   4.882   -38.114 1.00 13.01 ? 362 LEU A CD1   1 
ATOM   2386 C  CD2   . LEU A 1 311 ? 7.741   7.370   -38.576 1.00 12.59 ? 362 LEU A CD2   1 
ATOM   2387 N  N     . LEU A 1 312 ? 5.593   4.608   -35.308 1.00 14.51 ? 363 LEU A N     1 
ATOM   2388 C  CA    . LEU A 1 312 ? 5.782   4.697   -33.863 1.00 14.38 ? 363 LEU A CA    1 
ATOM   2389 C  C     . LEU A 1 312 ? 7.231   4.366   -33.484 1.00 14.21 ? 363 LEU A C     1 
ATOM   2390 O  O     . LEU A 1 312 ? 7.693   3.238   -33.675 1.00 14.06 ? 363 LEU A O     1 
ATOM   2391 C  CB    . LEU A 1 312 ? 4.812   3.755   -33.144 1.00 14.48 ? 363 LEU A CB    1 
ATOM   2392 C  CG    . LEU A 1 312 ? 4.759   3.800   -31.609 1.00 14.69 ? 363 LEU A CG    1 
ATOM   2393 C  CD1   . LEU A 1 312 ? 4.425   5.189   -31.095 1.00 14.54 ? 363 LEU A CD1   1 
ATOM   2394 C  CD2   . LEU A 1 312 ? 3.742   2.783   -31.090 1.00 14.72 ? 363 LEU A CD2   1 
ATOM   2395 N  N     . SER A 1 313 ? 7.947   5.363   -32.969 1.00 13.99 ? 364 SER A N     1 
ATOM   2396 C  CA    . SER A 1 313 ? 9.295   5.156   -32.451 1.00 14.19 ? 364 SER A CA    1 
ATOM   2397 C  C     . SER A 1 313 ? 9.617   6.103   -31.301 1.00 13.97 ? 364 SER A C     1 
ATOM   2398 O  O     . SER A 1 313 ? 8.904   7.078   -31.056 1.00 13.82 ? 364 SER A O     1 
ATOM   2399 C  CB    . SER A 1 313 ? 10.338  5.320   -33.559 1.00 14.41 ? 364 SER A CB    1 
ATOM   2400 O  OG    . SER A 1 313 ? 10.641  6.684   -33.784 1.00 15.15 ? 364 SER A OG    1 
ATOM   2401 N  N     . GLY A 1 314 ? 10.716  5.805   -30.615 1.00 13.79 ? 365 GLY A N     1 
ATOM   2402 C  CA    . GLY A 1 314 ? 11.130  6.540   -29.432 1.00 13.59 ? 365 GLY A CA    1 
ATOM   2403 C  C     . GLY A 1 314 ? 11.537  7.984   -29.659 1.00 13.55 ? 365 GLY A C     1 
ATOM   2404 O  O     . GLY A 1 314 ? 11.559  8.759   -28.711 1.00 13.66 ? 365 GLY A O     1 
ATOM   2405 N  N     . GLU A 1 315 ? 11.860  8.366   -30.893 1.00 13.52 ? 366 GLU A N     1 
ATOM   2406 C  CA    . GLU A 1 315 ? 12.214  9.765   -31.164 1.00 13.58 ? 366 GLU A CA    1 
ATOM   2407 C  C     . GLU A 1 315 ? 10.988  10.674  -31.176 1.00 13.39 ? 366 GLU A C     1 
ATOM   2408 O  O     . GLU A 1 315 ? 11.120  11.889  -31.051 1.00 13.13 ? 366 GLU A O     1 
ATOM   2409 C  CB    . GLU A 1 315 ? 13.018  9.922   -32.466 1.00 13.69 ? 366 GLU A CB    1 
ATOM   2410 C  CG    . GLU A 1 315 ? 12.306  9.541   -33.749 1.00 14.04 ? 366 GLU A CG    1 
ATOM   2411 C  CD    . GLU A 1 315 ? 13.156  9.790   -34.992 1.00 15.24 ? 366 GLU A CD    1 
ATOM   2412 O  OE1   . GLU A 1 315 ? 14.070  10.648  -34.940 1.00 15.87 ? 366 GLU A OE1   1 
ATOM   2413 O  OE2   . GLU A 1 315 ? 12.904  9.128   -36.029 1.00 16.06 ? 366 GLU A OE2   1 
ATOM   2414 N  N     . MET A 1 316 ? 9.806   10.080  -31.327 1.00 13.32 ? 367 MET A N     1 
ATOM   2415 C  CA    . MET A 1 316 ? 8.549   10.826  -31.254 1.00 13.42 ? 367 MET A CA    1 
ATOM   2416 C  C     . MET A 1 316 ? 8.283   11.275  -29.819 1.00 13.57 ? 367 MET A C     1 
ATOM   2417 O  O     . MET A 1 316 ? 8.702   10.609  -28.866 1.00 13.64 ? 367 MET A O     1 
ATOM   2418 C  CB    . MET A 1 316 ? 7.375   9.962   -31.723 1.00 13.34 ? 367 MET A CB    1 
ATOM   2419 C  CG    . MET A 1 316 ? 7.465   9.493   -33.162 1.00 13.06 ? 367 MET A CG    1 
ATOM   2420 S  SD    . MET A 1 316 ? 6.094   8.400   -33.565 1.00 12.49 ? 367 MET A SD    1 
ATOM   2421 C  CE    . MET A 1 316 ? 6.364   8.159   -35.302 1.00 13.69 ? 367 MET A CE    1 
ATOM   2422 N  N     . MET A 1 317 ? 7.584   12.397  -29.664 1.00 13.61 ? 368 MET A N     1 
ATOM   2423 C  CA    . MET A 1 317 ? 7.203   12.865  -28.330 1.00 13.64 ? 368 MET A CA    1 
ATOM   2424 C  C     . MET A 1 317 ? 6.016   12.054  -27.823 1.00 13.18 ? 368 MET A C     1 
ATOM   2425 O  O     . MET A 1 317 ? 5.275   11.462  -28.608 1.00 13.40 ? 368 MET A O     1 
ATOM   2426 C  CB    . MET A 1 317 ? 6.942   14.382  -28.289 1.00 13.83 ? 368 MET A CB    1 
ATOM   2427 C  CG    . MET A 1 317 ? 5.938   14.956  -29.289 1.00 15.13 ? 368 MET A CG    1 
ATOM   2428 S  SD    . MET A 1 317 ? 6.275   16.719  -29.612 1.00 17.77 ? 368 MET A SD    1 
ATOM   2429 C  CE    . MET A 1 317 ? 4.639   17.365  -29.960 1.00 17.20 ? 368 MET A CE    1 
ATOM   2430 N  N     . VAL A 1 318 ? 5.873   11.988  -26.505 1.00 12.58 ? 369 VAL A N     1 
ATOM   2431 C  CA    . VAL A 1 318 ? 4.885   11.108  -25.887 1.00 12.03 ? 369 VAL A CA    1 
ATOM   2432 C  C     . VAL A 1 318 ? 3.446   11.388  -26.347 1.00 11.69 ? 369 VAL A C     1 
ATOM   2433 O  O     . VAL A 1 318 ? 2.645   10.456  -26.470 1.00 11.51 ? 369 VAL A O     1 
ATOM   2434 C  CB    . VAL A 1 318 ? 4.959   11.159  -24.340 1.00 11.94 ? 369 VAL A CB    1 
ATOM   2435 C  CG1   . VAL A 1 318 ? 6.242   10.498  -23.852 1.00 11.56 ? 369 VAL A CG1   1 
ATOM   2436 C  CG2   . VAL A 1 318 ? 4.847   12.587  -23.842 1.00 11.43 ? 369 VAL A CG2   1 
ATOM   2437 N  N     . GLU A 1 319 ? 3.129   12.658  -26.602 1.00 11.31 ? 370 GLU A N     1 
ATOM   2438 C  CA    . GLU A 1 319 ? 1.793   13.053  -27.080 1.00 11.08 ? 370 GLU A CA    1 
ATOM   2439 C  C     . GLU A 1 319 ? 1.478   12.351  -28.391 1.00 10.98 ? 370 GLU A C     1 
ATOM   2440 O  O     . GLU A 1 319 ? 0.401   11.768  -28.551 1.00 10.81 ? 370 GLU A O     1 
ATOM   2441 C  CB    . GLU A 1 319 ? 1.690   14.574  -27.276 1.00 11.04 ? 370 GLU A CB    1 
ATOM   2442 C  CG    . GLU A 1 319 ? 1.522   15.388  -25.977 1.00 11.15 ? 370 GLU A CG    1 
ATOM   2443 C  CD    . GLU A 1 319 ? 2.837   15.746  -25.287 1.00 11.29 ? 370 GLU A CD    1 
ATOM   2444 O  OE1   . GLU A 1 319 ? 3.851   15.047  -25.516 1.00 11.42 ? 370 GLU A OE1   1 
ATOM   2445 O  OE2   . GLU A 1 319 ? 2.853   16.725  -24.500 1.00 11.30 ? 370 GLU A OE2   1 
ATOM   2446 N  N     . GLN A 1 320 ? 2.438   12.404  -29.314 1.00 10.83 ? 371 GLN A N     1 
ATOM   2447 C  CA    . GLN A 1 320 ? 2.334   11.721  -30.602 1.00 10.79 ? 371 GLN A CA    1 
ATOM   2448 C  C     . GLN A 1 320 ? 2.322   10.189  -30.464 1.00 10.52 ? 371 GLN A C     1 
ATOM   2449 O  O     . GLN A 1 320 ? 1.525   9.519   -31.119 1.00 10.42 ? 371 GLN A O     1 
ATOM   2450 C  CB    . GLN A 1 320 ? 3.469   12.174  -31.533 1.00 11.06 ? 371 GLN A CB    1 
ATOM   2451 C  CG    . GLN A 1 320 ? 3.088   13.298  -32.496 1.00 11.59 ? 371 GLN A CG    1 
ATOM   2452 C  CD    . GLN A 1 320 ? 2.345   14.431  -31.820 1.00 12.89 ? 371 GLN A CD    1 
ATOM   2453 O  OE1   . GLN A 1 320 ? 2.771   14.941  -30.776 1.00 14.35 ? 371 GLN A OE1   1 
ATOM   2454 N  NE2   . GLN A 1 320 ? 1.220   14.831  -32.407 1.00 12.51 ? 371 GLN A NE2   1 
ATOM   2455 N  N     . ARG A 1 321 ? 3.197   9.649   -29.614 1.00 10.24 ? 372 ARG A N     1 
ATOM   2456 C  CA    . ARG A 1 321 ? 3.232   8.210   -29.324 1.00 9.90  ? 372 ARG A CA    1 
ATOM   2457 C  C     . ARG A 1 321 ? 1.911   7.719   -28.747 1.00 9.89  ? 372 ARG A C     1 
ATOM   2458 O  O     . ARG A 1 321 ? 1.386   6.710   -29.195 1.00 10.19 ? 372 ARG A O     1 
ATOM   2459 C  CB    . ARG A 1 321 ? 4.366   7.868   -28.352 1.00 9.78  ? 372 ARG A CB    1 
ATOM   2460 C  CG    . ARG A 1 321 ? 5.752   7.879   -28.970 1.00 9.38  ? 372 ARG A CG    1 
ATOM   2461 C  CD    . ARG A 1 321 ? 6.878   7.718   -27.929 1.00 8.50  ? 372 ARG A CD    1 
ATOM   2462 N  NE    . ARG A 1 321 ? 6.992   6.350   -27.414 1.00 7.92  ? 372 ARG A NE    1 
ATOM   2463 C  CZ    . ARG A 1 321 ? 7.952   5.916   -26.594 1.00 7.40  ? 372 ARG A CZ    1 
ATOM   2464 N  NH1   . ARG A 1 321 ? 7.954   4.652   -26.185 1.00 7.39  ? 372 ARG A NH1   1 
ATOM   2465 N  NH2   . ARG A 1 321 ? 8.911   6.733   -26.174 1.00 7.43  ? 372 ARG A NH2   1 
ATOM   2466 N  N     . ALA A 1 322 ? 1.382   8.425   -27.751 1.00 10.01 ? 373 ALA A N     1 
ATOM   2467 C  CA    . ALA A 1 322 ? 0.078   8.082   -27.151 1.00 10.06 ? 373 ALA A CA    1 
ATOM   2468 C  C     . ALA A 1 322 ? -1.046  8.146   -28.183 1.00 10.30 ? 373 ALA A C     1 
ATOM   2469 O  O     . ALA A 1 322 ? -1.973  7.339   -28.150 1.00 10.35 ? 373 ALA A O     1 
ATOM   2470 C  CB    . ALA A 1 322 ? -0.236  9.006   -25.997 1.00 9.67  ? 373 ALA A CB    1 
ATOM   2471 N  N     . ALA A 1 323 ? -0.949  9.116   -29.091 1.00 10.64 ? 374 ALA A N     1 
ATOM   2472 C  CA    . ALA A 1 323 ? -1.916  9.299   -30.169 1.00 10.80 ? 374 ALA A CA    1 
ATOM   2473 C  C     . ALA A 1 323 ? -1.944  8.090   -31.081 1.00 11.34 ? 374 ALA A C     1 
ATOM   2474 O  O     . ALA A 1 323 ? -2.998  7.520   -31.333 1.00 11.31 ? 374 ALA A O     1 
ATOM   2475 C  CB    . ALA A 1 323 ? -1.574  10.543  -30.979 1.00 10.46 ? 374 ALA A CB    1 
ATOM   2476 N  N     . VAL A 1 324 ? -0.775  7.693   -31.573 1.00 11.99 ? 375 VAL A N     1 
ATOM   2477 C  CA    . VAL A 1 324 ? -0.708  6.634   -32.568 1.00 12.34 ? 375 VAL A CA    1 
ATOM   2478 C  C     . VAL A 1 324 ? -1.158  5.315   -31.977 1.00 12.61 ? 375 VAL A C     1 
ATOM   2479 O  O     . VAL A 1 324 ? -1.996  4.623   -32.559 1.00 12.94 ? 375 VAL A O     1 
ATOM   2480 C  CB    . VAL A 1 324 ? 0.704   6.457   -33.151 1.00 12.53 ? 375 VAL A CB    1 
ATOM   2481 C  CG1   . VAL A 1 324 ? 0.734   5.220   -34.059 1.00 12.22 ? 375 VAL A CG1   1 
ATOM   2482 C  CG2   . VAL A 1 324 ? 1.136   7.721   -33.910 1.00 12.38 ? 375 VAL A CG2   1 
ATOM   2483 N  N     . ILE A 1 325 ? -0.607  4.970   -30.819 1.00 12.57 ? 376 ILE A N     1 
ATOM   2484 C  CA    . ILE A 1 325 ? -0.913  3.695   -30.209 1.00 12.64 ? 376 ILE A CA    1 
ATOM   2485 C  C     . ILE A 1 325 ? -2.414  3.531   -29.956 1.00 13.03 ? 376 ILE A C     1 
ATOM   2486 O  O     . ILE A 1 325 ? -2.946  2.433   -30.091 1.00 12.96 ? 376 ILE A O     1 
ATOM   2487 C  CB    . ILE A 1 325 ? -0.128  3.491   -28.907 1.00 12.62 ? 376 ILE A CB    1 
ATOM   2488 C  CG1   . ILE A 1 325 ? -0.294  2.053   -28.409 1.00 11.98 ? 376 ILE A CG1   1 
ATOM   2489 C  CG2   . ILE A 1 325 ? -0.568  4.503   -27.856 1.00 12.60 ? 376 ILE A CG2   1 
ATOM   2490 C  CD1   . ILE A 1 325 ? 0.137   0.998   -29.414 1.00 10.89 ? 376 ILE A CD1   1 
ATOM   2491 N  N     . GLU A 1 326 ? -3.100  4.615   -29.603 1.00 13.53 ? 377 GLU A N     1 
ATOM   2492 C  CA    . GLU A 1 326 ? -4.545  4.544   -29.409 1.00 14.05 ? 377 GLU A CA    1 
ATOM   2493 C  C     . GLU A 1 326 ? -5.267  4.348   -30.743 1.00 13.99 ? 377 GLU A C     1 
ATOM   2494 O  O     . GLU A 1 326 ? -6.172  3.519   -30.837 1.00 13.93 ? 377 GLU A O     1 
ATOM   2495 C  CB    . GLU A 1 326 ? -5.079  5.785   -28.695 1.00 14.36 ? 377 GLU A CB    1 
ATOM   2496 C  CG    . GLU A 1 326 ? -6.362  5.503   -27.920 1.00 15.78 ? 377 GLU A CG    1 
ATOM   2497 C  CD    . GLU A 1 326 ? -6.923  6.732   -27.230 1.00 17.97 ? 377 GLU A CD    1 
ATOM   2498 O  OE1   . GLU A 1 326 ? -7.033  7.791   -27.891 1.00 19.65 ? 377 GLU A OE1   1 
ATOM   2499 O  OE2   . GLU A 1 326 ? -7.268  6.638   -26.028 1.00 19.25 ? 377 GLU A OE2   1 
ATOM   2500 N  N     . ARG A 1 327 ? -4.857  5.104   -31.763 1.00 14.00 ? 378 ARG A N     1 
ATOM   2501 C  CA    . ARG A 1 327 ? -5.419  4.975   -33.115 1.00 14.08 ? 378 ARG A CA    1 
ATOM   2502 C  C     . ARG A 1 327 ? -5.273  3.560   -33.638 1.00 13.99 ? 378 ARG A C     1 
ATOM   2503 O  O     . ARG A 1 327 ? -6.204  3.000   -34.207 1.00 14.04 ? 378 ARG A O     1 
ATOM   2504 C  CB    . ARG A 1 327 ? -4.734  5.924   -34.103 1.00 14.08 ? 378 ARG A CB    1 
ATOM   2505 C  CG    . ARG A 1 327 ? -5.163  7.361   -33.989 1.00 14.58 ? 378 ARG A CG    1 
ATOM   2506 C  CD    . ARG A 1 327 ? -4.598  8.199   -35.141 1.00 15.35 ? 378 ARG A CD    1 
ATOM   2507 N  NE    . ARG A 1 327 ? -5.290  7.929   -36.401 1.00 15.88 ? 378 ARG A NE    1 
ATOM   2508 C  CZ    . ARG A 1 327 ? -6.532  8.322   -36.693 1.00 16.68 ? 378 ARG A CZ    1 
ATOM   2509 N  NH1   . ARG A 1 327 ? -7.260  9.024   -35.818 1.00 17.37 ? 378 ARG A NH1   1 
ATOM   2510 N  NH2   . ARG A 1 327 ? -7.060  8.007   -37.871 1.00 16.85 ? 378 ARG A NH2   1 
ATOM   2511 N  N     . PHE A 1 328 ? -4.088  2.997   -33.462 1.00 14.10 ? 379 PHE A N     1 
ATOM   2512 C  CA    . PHE A 1 328 ? -3.843  1.615   -33.846 1.00 14.29 ? 379 PHE A CA    1 
ATOM   2513 C  C     . PHE A 1 328 ? -4.704  0.664   -33.019 1.00 14.60 ? 379 PHE A C     1 
ATOM   2514 O  O     . PHE A 1 328 ? -5.261  -0.299  -33.538 1.00 14.38 ? 379 PHE A O     1 
ATOM   2515 C  CB    . PHE A 1 328 ? -2.375  1.281   -33.651 1.00 14.07 ? 379 PHE A CB    1 
ATOM   2516 C  CG    . PHE A 1 328 ? -2.002  -0.085  -34.125 1.00 14.10 ? 379 PHE A CG    1 
ATOM   2517 C  CD1   . PHE A 1 328 ? -2.153  -0.431  -35.458 1.00 13.53 ? 379 PHE A CD1   1 
ATOM   2518 C  CD2   . PHE A 1 328 ? -1.482  -1.024  -33.242 1.00 13.99 ? 379 PHE A CD2   1 
ATOM   2519 C  CE1   . PHE A 1 328 ? -1.795  -1.682  -35.900 1.00 13.84 ? 379 PHE A CE1   1 
ATOM   2520 C  CE2   . PHE A 1 328 ? -1.119  -2.282  -33.682 1.00 13.45 ? 379 PHE A CE2   1 
ATOM   2521 C  CZ    . PHE A 1 328 ? -1.276  -2.615  -35.003 1.00 13.77 ? 379 PHE A CZ    1 
ATOM   2522 N  N     . ARG A 1 329 ? -4.815  0.963   -31.730 1.00 15.07 ? 380 ARG A N     1 
ATOM   2523 C  CA    . ARG A 1 329 ? -5.613  0.169   -30.805 1.00 15.48 ? 380 ARG A CA    1 
ATOM   2524 C  C     . ARG A 1 329 ? -7.073  0.051   -31.237 1.00 15.62 ? 380 ARG A C     1 
ATOM   2525 O  O     . ARG A 1 329 ? -7.693  -0.987  -31.039 1.00 15.57 ? 380 ARG A O     1 
ATOM   2526 C  CB    . ARG A 1 329 ? -5.547  0.789   -29.409 1.00 15.75 ? 380 ARG A CB    1 
ATOM   2527 C  CG    . ARG A 1 329 ? -5.421  -0.210  -28.283 1.00 16.13 ? 380 ARG A CG    1 
ATOM   2528 C  CD    . ARG A 1 329 ? -4.311  0.168   -27.297 1.00 16.92 ? 380 ARG A CD    1 
ATOM   2529 N  NE    . ARG A 1 329 ? -3.835  -1.050  -26.657 1.00 18.33 ? 380 ARG A NE    1 
ATOM   2530 C  CZ    . ARG A 1 329 ? -2.599  -1.282  -26.232 1.00 19.10 ? 380 ARG A CZ    1 
ATOM   2531 N  NH1   . ARG A 1 329 ? -1.633  -0.374  -26.327 1.00 19.03 ? 380 ARG A NH1   1 
ATOM   2532 N  NH2   . ARG A 1 329 ? -2.329  -2.458  -25.700 1.00 20.36 ? 380 ARG A NH2   1 
ATOM   2533 N  N     . GLU A 1 330 ? -7.607  1.117   -31.827 1.00 15.96 ? 381 GLU A N     1 
ATOM   2534 C  CA    . GLU A 1 330 ? -9.005  1.165   -32.262 1.00 16.38 ? 381 GLU A CA    1 
ATOM   2535 C  C     . GLU A 1 330 ? -9.209  0.673   -33.703 1.00 16.66 ? 381 GLU A C     1 
ATOM   2536 O  O     . GLU A 1 330 ? -10.317 0.731   -34.233 1.00 16.51 ? 381 GLU A O     1 
ATOM   2537 C  CB    . GLU A 1 330 ? -9.529  2.598   -32.158 1.00 16.48 ? 381 GLU A CB    1 
ATOM   2538 C  CG    . GLU A 1 330 ? -9.448  3.214   -30.770 1.00 17.26 ? 381 GLU A CG    1 
ATOM   2539 C  CD    . GLU A 1 330 ? -9.632  4.723   -30.803 1.00 18.58 ? 381 GLU A CD    1 
ATOM   2540 O  OE1   . GLU A 1 330 ? -8.612  5.445   -30.750 1.00 19.56 ? 381 GLU A OE1   1 
ATOM   2541 O  OE2   . GLU A 1 330 ? -10.792 5.189   -30.905 1.00 18.36 ? 381 GLU A OE2   1 
ATOM   2542 N  N     . GLY A 1 331 ? -8.143  0.206   -34.345 1.00 17.04 ? 382 GLY A N     1 
ATOM   2543 C  CA    . GLY A 1 331 ? -8.217  -0.222  -35.737 1.00 17.32 ? 382 GLY A CA    1 
ATOM   2544 C  C     . GLY A 1 331 ? -8.419  0.909   -36.729 1.00 17.56 ? 382 GLY A C     1 
ATOM   2545 O  O     . GLY A 1 331 ? -8.850  0.667   -37.861 1.00 17.71 ? 382 GLY A O     1 
ATOM   2546 N  N     . LYS A 1 332 ? -8.120  2.141   -36.311 1.00 17.76 ? 383 LYS A N     1 
ATOM   2547 C  CA    . LYS A 1 332 ? -8.166  3.302   -37.209 1.00 17.90 ? 383 LYS A CA    1 
ATOM   2548 C  C     . LYS A 1 332 ? -6.913  3.329   -38.068 1.00 17.74 ? 383 LYS A C     1 
ATOM   2549 O  O     . LYS A 1 332 ? -6.899  3.918   -39.139 1.00 17.61 ? 383 LYS A O     1 
ATOM   2550 C  CB    . LYS A 1 332 ? -8.315  4.601   -36.414 1.00 18.02 ? 383 LYS A CB    1 
ATOM   2551 C  CG    . LYS A 1 332 ? -9.732  4.807   -35.895 1.00 18.69 ? 383 LYS A CG    1 
ATOM   2552 C  CD    . LYS A 1 332 ? -9.809  5.760   -34.701 1.00 19.44 ? 383 LYS A CD    1 
ATOM   2553 C  CE    . LYS A 1 332 ? -11.271 6.063   -34.370 1.00 19.84 ? 383 LYS A CE    1 
ATOM   2554 N  NZ    . LYS A 1 332 ? -11.454 6.734   -33.055 1.00 20.42 ? 383 LYS A NZ    1 
ATOM   2555 N  N     . GLU A 1 333 ? -5.861  2.692   -37.564 1.00 17.90 ? 384 GLU A N     1 
ATOM   2556 C  CA    . GLU A 1 333 ? -4.674  2.367   -38.340 1.00 17.98 ? 384 GLU A CA    1 
ATOM   2557 C  C     . GLU A 1 333 ? -4.576  0.859   -38.337 1.00 17.69 ? 384 GLU A C     1 
ATOM   2558 O  O     . GLU A 1 333 ? -4.821  0.229   -37.311 1.00 17.90 ? 384 GLU A O     1 
ATOM   2559 C  CB    . GLU A 1 333 ? -3.426  2.956   -37.688 1.00 18.15 ? 384 GLU A CB    1 
ATOM   2560 C  CG    . GLU A 1 333 ? -3.500  4.459   -37.416 1.00 19.18 ? 384 GLU A CG    1 
ATOM   2561 C  CD    . GLU A 1 333 ? -3.543  5.313   -38.679 1.00 20.32 ? 384 GLU A CD    1 
ATOM   2562 O  OE1   . GLU A 1 333 ? -3.335  4.782   -39.798 1.00 21.22 ? 384 GLU A OE1   1 
ATOM   2563 O  OE2   . GLU A 1 333 ? -3.785  6.530   -38.545 1.00 20.93 ? 384 GLU A OE2   1 
ATOM   2564 N  N     . LYS A 1 334 ? -4.231  0.276   -39.476 1.00 17.34 ? 385 LYS A N     1 
ATOM   2565 C  CA    . LYS A 1 334 ? -4.176  -1.178  -39.598 1.00 17.19 ? 385 LYS A CA    1 
ATOM   2566 C  C     . LYS A 1 334 ? -2.751  -1.727  -39.677 1.00 16.98 ? 385 LYS A C     1 
ATOM   2567 O  O     . LYS A 1 334 ? -2.532  -2.897  -39.384 1.00 17.28 ? 385 LYS A O     1 
ATOM   2568 C  CB    . LYS A 1 334 ? -5.042  -1.634  -40.775 1.00 17.47 ? 385 LYS A CB    1 
ATOM   2569 C  CG    . LYS A 1 334 ? -6.519  -1.766  -40.364 1.00 18.01 ? 385 LYS A CG    1 
ATOM   2570 C  CD    . LYS A 1 334 ? -7.500  -1.356  -41.435 1.00 18.29 ? 385 LYS A CD    1 
ATOM   2571 C  CE    . LYS A 1 334 ? -8.922  -1.366  -40.881 1.00 19.02 ? 385 LYS A CE    1 
ATOM   2572 N  NZ    . LYS A 1 334 ? -9.826  -0.396  -41.568 1.00 19.33 ? 385 LYS A NZ    1 
ATOM   2573 N  N     . VAL A 1 335 ? -1.785  -0.880  -40.030 1.00 16.53 ? 386 VAL A N     1 
ATOM   2574 C  CA    . VAL A 1 335 ? -0.378  -1.258  -40.024 1.00 16.13 ? 386 VAL A CA    1 
ATOM   2575 C  C     . VAL A 1 335 ? 0.436   -0.253  -39.220 1.00 16.05 ? 386 VAL A C     1 
ATOM   2576 O  O     . VAL A 1 335 ? 0.279   0.956   -39.392 1.00 16.10 ? 386 VAL A O     1 
ATOM   2577 C  CB    . VAL A 1 335 ? 0.196   -1.320  -41.446 1.00 16.08 ? 386 VAL A CB    1 
ATOM   2578 C  CG1   . VAL A 1 335 ? 1.687   -1.603  -41.412 1.00 15.61 ? 386 VAL A CG1   1 
ATOM   2579 C  CG2   . VAL A 1 335 ? -0.534  -2.370  -42.272 1.00 15.80 ? 386 VAL A CG2   1 
ATOM   2580 N  N     . LEU A 1 336 ? 1.308   -0.764  -38.349 1.00 15.82 ? 387 LEU A N     1 
ATOM   2581 C  CA    . LEU A 1 336 ? 2.214   0.072   -37.561 1.00 15.47 ? 387 LEU A CA    1 
ATOM   2582 C  C     . LEU A 1 336 ? 3.687   -0.266  -37.837 1.00 15.26 ? 387 LEU A C     1 
ATOM   2583 O  O     . LEU A 1 336 ? 4.211   -1.277  -37.348 1.00 15.30 ? 387 LEU A O     1 
ATOM   2584 C  CB    . LEU A 1 336 ? 1.928   -0.081  -36.065 1.00 15.55 ? 387 LEU A CB    1 
ATOM   2585 C  CG    . LEU A 1 336 ? 2.772   0.831   -35.175 1.00 14.82 ? 387 LEU A CG    1 
ATOM   2586 C  CD1   . LEU A 1 336 ? 2.237   2.239   -35.264 1.00 14.91 ? 387 LEU A CD1   1 
ATOM   2587 C  CD2   . LEU A 1 336 ? 2.768   0.343   -33.753 1.00 14.58 ? 387 LEU A CD2   1 
ATOM   2588 N  N     . VAL A 1 337 ? 4.347   0.589   -38.618 1.00 14.67 ? 388 VAL A N     1 
ATOM   2589 C  CA    . VAL A 1 337 ? 5.792   0.520   -38.780 1.00 14.01 ? 388 VAL A CA    1 
ATOM   2590 C  C     . VAL A 1 337 ? 6.406   0.988   -37.463 1.00 13.39 ? 388 VAL A C     1 
ATOM   2591 O  O     . VAL A 1 337 ? 6.140   2.095   -37.005 1.00 13.27 ? 388 VAL A O     1 
ATOM   2592 C  CB    . VAL A 1 337 ? 6.278   1.410   -39.937 1.00 14.10 ? 388 VAL A CB    1 
ATOM   2593 C  CG1   . VAL A 1 337 ? 7.797   1.334   -40.073 1.00 14.13 ? 388 VAL A CG1   1 
ATOM   2594 C  CG2   . VAL A 1 337 ? 5.597   1.004   -41.233 1.00 14.26 ? 388 VAL A CG2   1 
ATOM   2595 N  N     . THR A 1 338 ? 7.217   0.138   -36.848 1.00 12.73 ? 389 THR A N     1 
ATOM   2596 C  CA    . THR A 1 338 ? 7.723   0.418   -35.515 1.00 12.26 ? 389 THR A CA    1 
ATOM   2597 C  C     . THR A 1 338 ? 9.128   -0.155  -35.301 1.00 12.01 ? 389 THR A C     1 
ATOM   2598 O  O     . THR A 1 338 ? 9.656   -0.855  -36.165 1.00 12.02 ? 389 THR A O     1 
ATOM   2599 C  CB    . THR A 1 338 ? 6.732   -0.116  -34.454 1.00 12.03 ? 389 THR A CB    1 
ATOM   2600 O  OG1   . THR A 1 338 ? 7.055   0.424   -33.174 1.00 11.51 ? 389 THR A OG1   1 
ATOM   2601 C  CG2   . THR A 1 338 ? 6.748   -1.629  -34.401 1.00 11.94 ? 389 THR A CG2   1 
ATOM   2602 N  N     . THR A 1 339 ? 9.734   0.184   -34.164 1.00 11.55 ? 390 THR A N     1 
ATOM   2603 C  CA    . THR A 1 339 ? 11.038  -0.346  -33.769 1.00 11.20 ? 390 THR A CA    1 
ATOM   2604 C  C     . THR A 1 339 ? 10.823  -1.374  -32.660 1.00 10.99 ? 390 THR A C     1 
ATOM   2605 O  O     . THR A 1 339 ? 9.692   -1.808  -32.441 1.00 11.07 ? 390 THR A O     1 
ATOM   2606 C  CB    . THR A 1 339 ? 11.964  0.782   -33.278 1.00 11.18 ? 390 THR A CB    1 
ATOM   2607 O  OG1   . THR A 1 339 ? 11.348  1.453   -32.174 1.00 10.92 ? 390 THR A OG1   1 
ATOM   2608 C  CG2   . THR A 1 339 ? 12.230  1.776   -34.392 1.00 10.89 ? 390 THR A CG2   1 
ATOM   2609 N  N     . ASN A 1 340 ? 11.896  -1.770  -31.974 1.00 10.79 ? 391 ASN A N     1 
ATOM   2610 C  CA    . ASN A 1 340 ? 11.802  -2.689  -30.835 1.00 10.68 ? 391 ASN A CA    1 
ATOM   2611 C  C     . ASN A 1 340 ? 11.044  -2.068  -29.665 1.00 10.98 ? 391 ASN A C     1 
ATOM   2612 O  O     . ASN A 1 340 ? 10.747  -2.756  -28.690 1.00 11.27 ? 391 ASN A O     1 
ATOM   2613 C  CB    . ASN A 1 340 ? 13.192  -3.134  -30.348 1.00 10.61 ? 391 ASN A CB    1 
ATOM   2614 C  CG    . ASN A 1 340 ? 13.794  -4.286  -31.168 1.00 10.42 ? 391 ASN A CG    1 
ATOM   2615 O  OD1   . ASN A 1 340 ? 13.096  -5.069  -31.800 1.00 10.08 ? 391 ASN A OD1   1 
ATOM   2616 N  ND2   . ASN A 1 340 ? 15.113  -4.391  -31.129 1.00 10.59 ? 391 ASN A ND2   1 
ATOM   2617 N  N     . VAL A 1 341 ? 10.722  -0.777  -29.754 1.00 11.25 ? 392 VAL A N     1 
ATOM   2618 C  CA    . VAL A 1 341 ? 9.888   -0.116  -28.743 1.00 11.13 ? 392 VAL A CA    1 
ATOM   2619 C  C     . VAL A 1 341 ? 8.550   -0.829  -28.544 1.00 11.10 ? 392 VAL A C     1 
ATOM   2620 O  O     . VAL A 1 341 ? 7.933   -0.692  -27.487 1.00 11.56 ? 392 VAL A O     1 
ATOM   2621 C  CB    . VAL A 1 341 ? 9.594   1.354   -29.112 1.00 11.14 ? 392 VAL A CB    1 
ATOM   2622 C  CG1   . VAL A 1 341 ? 8.609   1.419   -30.279 1.00 10.74 ? 392 VAL A CG1   1 
ATOM   2623 C  CG2   . VAL A 1 341 ? 9.056   2.109   -27.904 1.00 10.86 ? 392 VAL A CG2   1 
ATOM   2624 N  N     . CYS A 1 342 ? 8.099   -1.558  -29.566 1.00 10.74 ? 393 CYS A N     1 
ATOM   2625 C  CA    . CYS A 1 342 ? 6.876   -2.358  -29.489 1.00 10.48 ? 393 CYS A CA    1 
ATOM   2626 C  C     . CYS A 1 342 ? 7.126   -3.869  -29.494 1.00 10.10 ? 393 CYS A C     1 
ATOM   2627 O  O     . CYS A 1 342 ? 6.188   -4.643  -29.593 1.00 9.58  ? 393 CYS A O     1 
ATOM   2628 C  CB    . CYS A 1 342 ? 5.965   -2.017  -30.666 1.00 10.46 ? 393 CYS A CB    1 
ATOM   2629 S  SG    . CYS A 1 342 ? 5.461   -0.314  -30.703 1.00 10.44 ? 393 CYS A SG    1 
ATOM   2630 N  N     . ALA A 1 343 ? 8.382   -4.285  -29.378 1.00 10.02 ? 394 ALA A N     1 
ATOM   2631 C  CA    . ALA A 1 343 ? 8.730   -5.709  -29.433 1.00 9.96  ? 394 ALA A CA    1 
ATOM   2632 C  C     . ALA A 1 343 ? 8.100   -6.509  -28.292 1.00 9.97  ? 394 ALA A C     1 
ATOM   2633 O  O     . ALA A 1 343 ? 7.825   -7.704  -28.447 1.00 10.42 ? 394 ALA A O     1 
ATOM   2634 C  CB    . ALA A 1 343 ? 10.242  -5.894  -29.420 1.00 9.46  ? 394 ALA A CB    1 
ATOM   2635 N  N     . ARG A 1 344 ? 7.855   -5.853  -27.165 1.00 9.68  ? 395 ARG A N     1 
ATOM   2636 C  CA    . ARG A 1 344 ? 7.524   -6.547  -25.942 1.00 9.79  ? 395 ARG A CA    1 
ATOM   2637 C  C     . ARG A 1 344 ? 6.221   -6.052  -25.334 1.00 9.92  ? 395 ARG A C     1 
ATOM   2638 O  O     . ARG A 1 344 ? 5.935   -4.859  -25.342 1.00 10.34 ? 395 ARG A O     1 
ATOM   2639 C  CB    . ARG A 1 344 ? 8.675   -6.370  -24.947 1.00 9.71  ? 395 ARG A CB    1 
ATOM   2640 C  CG    . ARG A 1 344 ? 9.990   -6.959  -25.441 1.00 9.67  ? 395 ARG A CG    1 
ATOM   2641 C  CD    . ARG A 1 344 ? 11.168  -6.500  -24.624 1.00 10.53 ? 395 ARG A CD    1 
ATOM   2642 N  NE    . ARG A 1 344 ? 11.545  -7.453  -23.582 1.00 11.72 ? 395 ARG A NE    1 
ATOM   2643 C  CZ    . ARG A 1 344 ? 12.507  -8.369  -23.682 1.00 12.30 ? 395 ARG A CZ    1 
ATOM   2644 N  NH1   . ARG A 1 344 ? 13.218  -8.511  -24.792 1.00 13.80 ? 395 ARG A NH1   1 
ATOM   2645 N  NH2   . ARG A 1 344 ? 12.763  -9.162  -22.658 1.00 12.52 ? 395 ARG A NH2   1 
ATOM   2646 N  N     . GLY A 1 345 ? 5.413   -6.982  -24.841 1.00 10.12 ? 396 GLY A N     1 
ATOM   2647 C  CA    . GLY A 1 345 ? 4.299   -6.654  -23.959 1.00 10.13 ? 396 GLY A CA    1 
ATOM   2648 C  C     . GLY A 1 345 ? 3.058   -6.072  -24.601 1.00 10.07 ? 396 GLY A C     1 
ATOM   2649 O  O     . GLY A 1 345 ? 1.972   -6.175  -24.034 1.00 10.19 ? 396 GLY A O     1 
ATOM   2650 N  N     . ILE A 1 346 ? 3.202   -5.446  -25.763 1.00 10.06 ? 397 ILE A N     1 
ATOM   2651 C  CA    . ILE A 1 346 ? 2.074   -4.792  -26.401 1.00 10.10 ? 397 ILE A CA    1 
ATOM   2652 C  C     . ILE A 1 346 ? 1.061   -5.861  -26.774 1.00 10.32 ? 397 ILE A C     1 
ATOM   2653 O  O     . ILE A 1 346 ? 1.432   -6.933  -27.248 1.00 10.15 ? 397 ILE A O     1 
ATOM   2654 C  CB    . ILE A 1 346 ? 2.491   -3.986  -27.653 1.00 10.16 ? 397 ILE A CB    1 
ATOM   2655 C  CG1   . ILE A 1 346 ? 3.428   -2.828  -27.274 1.00 9.54  ? 397 ILE A CG1   1 
ATOM   2656 C  CG2   . ILE A 1 346 ? 1.262   -3.464  -28.387 1.00 9.88  ? 397 ILE A CG2   1 
ATOM   2657 C  CD1   . ILE A 1 346 ? 2.826   -1.796  -26.318 1.00 9.26  ? 397 ILE A CD1   1 
ATOM   2658 N  N     . ASP A 1 347 ? -0.213  -5.557  -26.543 1.00 10.63 ? 398 ASP A N     1 
ATOM   2659 C  CA    . ASP A 1 347 ? -1.294  -6.521  -26.689 1.00 10.95 ? 398 ASP A CA    1 
ATOM   2660 C  C     . ASP A 1 347 ? -2.454  -5.893  -27.461 1.00 11.34 ? 398 ASP A C     1 
ATOM   2661 O  O     . ASP A 1 347 ? -3.271  -5.180  -26.888 1.00 11.47 ? 398 ASP A O     1 
ATOM   2662 C  CB    . ASP A 1 347 ? -1.755  -6.958  -25.299 1.00 10.93 ? 398 ASP A CB    1 
ATOM   2663 C  CG    . ASP A 1 347 ? -2.872  -7.968  -25.343 1.00 10.70 ? 398 ASP A CG    1 
ATOM   2664 O  OD1   . ASP A 1 347 ? -2.629  -9.094  -25.805 1.00 10.99 ? 398 ASP A OD1   1 
ATOM   2665 O  OD2   . ASP A 1 347 ? -3.990  -7.647  -24.893 1.00 11.24 ? 398 ASP A OD2   1 
ATOM   2666 N  N     . VAL A 1 348 ? -2.509  -6.139  -28.767 1.00 11.83 ? 399 VAL A N     1 
ATOM   2667 C  CA    . VAL A 1 348 ? -3.623  -5.672  -29.593 1.00 12.19 ? 399 VAL A CA    1 
ATOM   2668 C  C     . VAL A 1 348 ? -4.272  -6.855  -30.311 1.00 12.45 ? 399 VAL A C     1 
ATOM   2669 O  O     . VAL A 1 348 ? -3.736  -7.370  -31.288 1.00 12.52 ? 399 VAL A O     1 
ATOM   2670 C  CB    . VAL A 1 348 ? -3.169  -4.614  -30.624 1.00 12.33 ? 399 VAL A CB    1 
ATOM   2671 C  CG1   . VAL A 1 348 ? -4.331  -4.246  -31.550 1.00 12.55 ? 399 VAL A CG1   1 
ATOM   2672 C  CG2   . VAL A 1 348 ? -2.619  -3.373  -29.916 1.00 11.77 ? 399 VAL A CG2   1 
ATOM   2673 N  N     . GLU A 1 349 ? -5.432  -7.266  -29.806 1.00 12.99 ? 400 GLU A N     1 
ATOM   2674 C  CA    . GLU A 1 349 ? -6.185  -8.434  -30.289 1.00 13.37 ? 400 GLU A CA    1 
ATOM   2675 C  C     . GLU A 1 349 ? -6.177  -8.699  -31.789 1.00 13.39 ? 400 GLU A C     1 
ATOM   2676 O  O     . GLU A 1 349 ? -6.067  -9.851  -32.216 1.00 13.28 ? 400 GLU A O     1 
ATOM   2677 C  CB    . GLU A 1 349 ? -7.648  -8.285  -29.893 1.00 13.78 ? 400 GLU A CB    1 
ATOM   2678 C  CG    . GLU A 1 349 ? -8.138  -9.247  -28.831 1.00 15.06 ? 400 GLU A CG    1 
ATOM   2679 C  CD    . GLU A 1 349 ? -9.628  -9.468  -28.940 1.00 16.66 ? 400 GLU A CD    1 
ATOM   2680 O  OE1   . GLU A 1 349 ? -10.106 -10.526 -28.480 1.00 18.38 ? 400 GLU A OE1   1 
ATOM   2681 O  OE2   . GLU A 1 349 ? -10.320 -8.592  -29.514 1.00 18.05 ? 400 GLU A OE2   1 
ATOM   2682 N  N     . GLN A 1 350 ? -6.339  -7.637  -32.575 1.00 13.41 ? 401 GLN A N     1 
ATOM   2683 C  CA    . GLN A 1 350 ? -6.517  -7.759  -34.025 1.00 13.45 ? 401 GLN A CA    1 
ATOM   2684 C  C     . GLN A 1 350 ? -5.234  -7.942  -34.846 1.00 13.25 ? 401 GLN A C     1 
ATOM   2685 O  O     . GLN A 1 350 ? -5.314  -8.196  -36.047 1.00 13.51 ? 401 GLN A O     1 
ATOM   2686 C  CB    . GLN A 1 350 ? -7.327  -6.563  -34.574 1.00 13.55 ? 401 GLN A CB    1 
ATOM   2687 C  CG    . GLN A 1 350 ? -8.833  -6.798  -34.610 1.00 14.01 ? 401 GLN A CG    1 
ATOM   2688 C  CD    . GLN A 1 350 ? -9.202  -8.188  -35.125 1.00 14.57 ? 401 GLN A CD    1 
ATOM   2689 O  OE1   . GLN A 1 350 ? -9.663  -9.038  -34.362 1.00 15.26 ? 401 GLN A OE1   1 
ATOM   2690 N  NE2   . GLN A 1 350 ? -8.964  -8.431  -36.411 1.00 14.47 ? 401 GLN A NE2   1 
ATOM   2691 N  N     . VAL A 1 351 ? -4.064  -7.816  -34.220 1.00 13.18 ? 402 VAL A N     1 
ATOM   2692 C  CA    . VAL A 1 351 ? -2.786  -7.946  -34.940 1.00 12.84 ? 402 VAL A CA    1 
ATOM   2693 C  C     . VAL A 1 351 ? -2.552  -9.394  -35.357 1.00 12.85 ? 402 VAL A C     1 
ATOM   2694 O  O     . VAL A 1 351 ? -2.056  -10.196 -34.574 1.00 12.86 ? 402 VAL A O     1 
ATOM   2695 C  CB    . VAL A 1 351 ? -1.600  -7.462  -34.082 1.00 12.77 ? 402 VAL A CB    1 
ATOM   2696 C  CG1   . VAL A 1 351 ? -0.266  -7.749  -34.789 1.00 12.24 ? 402 VAL A CG1   1 
ATOM   2697 C  CG2   . VAL A 1 351 ? -1.759  -5.984  -33.758 1.00 12.13 ? 402 VAL A CG2   1 
ATOM   2698 N  N     . SER A 1 352 ? -2.915  -9.720  -36.594 1.00 12.94 ? 403 SER A N     1 
ATOM   2699 C  CA    . SER A 1 352 ? -2.821  -11.093 -37.094 1.00 13.05 ? 403 SER A CA    1 
ATOM   2700 C  C     . SER A 1 352 ? -1.563  -11.363 -37.921 1.00 13.05 ? 403 SER A C     1 
ATOM   2701 O  O     . SER A 1 352 ? -1.329  -12.500 -38.321 1.00 13.27 ? 403 SER A O     1 
ATOM   2702 C  CB    . SER A 1 352 ? -4.060  -11.435 -37.918 1.00 13.02 ? 403 SER A CB    1 
ATOM   2703 O  OG    . SER A 1 352 ? -4.276  -10.462 -38.917 1.00 13.45 ? 403 SER A OG    1 
ATOM   2704 N  N     . VAL A 1 353 ? -0.764  -10.335 -38.192 1.00 13.02 ? 404 VAL A N     1 
ATOM   2705 C  CA    . VAL A 1 353 ? 0.505   -10.526 -38.893 1.00 13.12 ? 404 VAL A CA    1 
ATOM   2706 C  C     . VAL A 1 353 ? 1.583   -9.653  -38.288 1.00 13.10 ? 404 VAL A C     1 
ATOM   2707 O  O     . VAL A 1 353 ? 1.397   -8.450  -38.155 1.00 12.85 ? 404 VAL A O     1 
ATOM   2708 C  CB    . VAL A 1 353 ? 0.409   -10.184 -40.394 1.00 13.19 ? 404 VAL A CB    1 
ATOM   2709 C  CG1   . VAL A 1 353 ? 1.757   -10.402 -41.066 1.00 13.17 ? 404 VAL A CG1   1 
ATOM   2710 C  CG2   . VAL A 1 353 ? -0.658  -11.022 -41.070 1.00 13.27 ? 404 VAL A CG2   1 
ATOM   2711 N  N     . VAL A 1 354 ? 2.698   -10.274 -37.909 1.00 13.35 ? 405 VAL A N     1 
ATOM   2712 C  CA    . VAL A 1 354 ? 3.908   -9.553  -37.518 1.00 13.60 ? 405 VAL A CA    1 
ATOM   2713 C  C     . VAL A 1 354 ? 4.953   -9.728  -38.612 1.00 13.81 ? 405 VAL A C     1 
ATOM   2714 O  O     . VAL A 1 354 ? 5.198   -10.852 -39.057 1.00 13.65 ? 405 VAL A O     1 
ATOM   2715 C  CB    . VAL A 1 354 ? 4.481   -10.076 -36.198 1.00 13.57 ? 405 VAL A CB    1 
ATOM   2716 C  CG1   . VAL A 1 354 ? 5.927   -9.609  -36.010 1.00 13.52 ? 405 VAL A CG1   1 
ATOM   2717 C  CG2   . VAL A 1 354 ? 3.620   -9.619  -35.041 1.00 14.10 ? 405 VAL A CG2   1 
ATOM   2718 N  N     . ILE A 1 355 ? 5.554   -8.620  -39.050 1.00 14.03 ? 406 ILE A N     1 
ATOM   2719 C  CA    . ILE A 1 355 ? 6.601   -8.653  -40.081 1.00 14.21 ? 406 ILE A CA    1 
ATOM   2720 C  C     . ILE A 1 355 ? 7.919   -8.126  -39.514 1.00 14.33 ? 406 ILE A C     1 
ATOM   2721 O  O     . ILE A 1 355 ? 7.992   -7.001  -39.031 1.00 14.33 ? 406 ILE A O     1 
ATOM   2722 C  CB    . ILE A 1 355 ? 6.251   -7.788  -41.333 1.00 14.25 ? 406 ILE A CB    1 
ATOM   2723 C  CG1   . ILE A 1 355 ? 4.859   -8.122  -41.897 1.00 14.08 ? 406 ILE A CG1   1 
ATOM   2724 C  CG2   . ILE A 1 355 ? 7.323   -7.955  -42.404 1.00 14.04 ? 406 ILE A CG2   1 
ATOM   2725 C  CD1   . ILE A 1 355 ? 4.849   -9.150  -42.974 1.00 14.34 ? 406 ILE A CD1   1 
ATOM   2726 N  N     . ASN A 1 356 ? 8.953   -8.956  -39.561 1.00 14.60 ? 407 ASN A N     1 
ATOM   2727 C  CA    . ASN A 1 356 ? 10.315  -8.492  -39.345 1.00 14.64 ? 407 ASN A CA    1 
ATOM   2728 C  C     . ASN A 1 356 ? 10.891  -8.022  -40.673 1.00 14.75 ? 407 ASN A C     1 
ATOM   2729 O  O     . ASN A 1 356 ? 11.471  -8.810  -41.411 1.00 14.84 ? 407 ASN A O     1 
ATOM   2730 C  CB    . ASN A 1 356 ? 11.168  -9.615  -38.768 1.00 14.68 ? 407 ASN A CB    1 
ATOM   2731 C  CG    . ASN A 1 356 ? 10.647  -10.109 -37.453 1.00 14.33 ? 407 ASN A CG    1 
ATOM   2732 O  OD1   . ASN A 1 356 ? 10.212  -9.328  -36.614 1.00 14.88 ? 407 ASN A OD1   1 
ATOM   2733 N  ND2   . ASN A 1 356 ? 10.681  -11.412 -37.263 1.00 13.70 ? 407 ASN A ND2   1 
ATOM   2734 N  N     . PHE A 1 357 ? 10.699  -6.743  -40.988 1.00 15.00 ? 408 PHE A N     1 
ATOM   2735 C  CA    . PHE A 1 357 ? 11.265  -6.153  -42.201 1.00 15.09 ? 408 PHE A CA    1 
ATOM   2736 C  C     . PHE A 1 357 ? 12.784  -6.146  -42.089 1.00 15.35 ? 408 PHE A C     1 
ATOM   2737 O  O     . PHE A 1 357 ? 13.481  -6.285  -43.093 1.00 15.41 ? 408 PHE A O     1 
ATOM   2738 C  CB    . PHE A 1 357 ? 10.735  -4.736  -42.424 1.00 15.10 ? 408 PHE A CB    1 
ATOM   2739 C  CG    . PHE A 1 357 ? 11.231  -4.089  -43.690 1.00 15.05 ? 408 PHE A CG    1 
ATOM   2740 C  CD1   . PHE A 1 357 ? 12.350  -3.264  -43.676 1.00 14.66 ? 408 PHE A CD1   1 
ATOM   2741 C  CD2   . PHE A 1 357 ? 10.577  -4.304  -44.897 1.00 15.45 ? 408 PHE A CD2   1 
ATOM   2742 C  CE1   . PHE A 1 357 ? 12.812  -2.664  -44.845 1.00 14.97 ? 408 PHE A CE1   1 
ATOM   2743 C  CE2   . PHE A 1 357 ? 11.035  -3.708  -46.073 1.00 15.65 ? 408 PHE A CE2   1 
ATOM   2744 C  CZ    . PHE A 1 357 ? 12.156  -2.885  -46.043 1.00 15.18 ? 408 PHE A CZ    1 
ATOM   2745 N  N     . ASP A 1 358 ? 13.279  -5.960  -40.865 1.00 15.53 ? 409 ASP A N     1 
ATOM   2746 C  CA    . ASP A 1 358 ? 14.667  -6.251  -40.515 1.00 15.71 ? 409 ASP A CA    1 
ATOM   2747 C  C     . ASP A 1 358 ? 14.660  -7.342  -39.459 1.00 15.78 ? 409 ASP A C     1 
ATOM   2748 O  O     . ASP A 1 358 ? 13.825  -7.322  -38.555 1.00 16.10 ? 409 ASP A O     1 
ATOM   2749 C  CB    . ASP A 1 358 ? 15.351  -5.014  -39.944 1.00 15.75 ? 409 ASP A CB    1 
ATOM   2750 C  CG    . ASP A 1 358 ? 15.532  -3.926  -40.967 1.00 16.34 ? 409 ASP A CG    1 
ATOM   2751 O  OD1   . ASP A 1 358 ? 15.582  -4.256  -42.170 1.00 17.55 ? 409 ASP A OD1   1 
ATOM   2752 O  OD2   . ASP A 1 358 ? 15.635  -2.740  -40.570 1.00 17.45 ? 409 ASP A OD2   1 
ATOM   2753 N  N     . LEU A 1 359 ? 15.580  -8.296  -39.563 1.00 15.86 ? 410 LEU A N     1 
ATOM   2754 C  CA    . LEU A 1 359 ? 15.679  -9.353  -38.560 1.00 15.88 ? 410 LEU A CA    1 
ATOM   2755 C  C     . LEU A 1 359 ? 16.258  -8.761  -37.275 1.00 15.99 ? 410 LEU A C     1 
ATOM   2756 O  O     . LEU A 1 359 ? 17.065  -7.834  -37.339 1.00 16.00 ? 410 LEU A O     1 
ATOM   2757 C  CB    . LEU A 1 359 ? 16.545  -10.504 -39.065 1.00 15.70 ? 410 LEU A CB    1 
ATOM   2758 C  CG    . LEU A 1 359 ? 16.017  -11.200 -40.317 1.00 15.93 ? 410 LEU A CG    1 
ATOM   2759 C  CD1   . LEU A 1 359 ? 16.998  -12.262 -40.783 1.00 15.37 ? 410 LEU A CD1   1 
ATOM   2760 C  CD2   . LEU A 1 359 ? 14.635  -11.808 -40.062 1.00 16.54 ? 410 LEU A CD2   1 
ATOM   2761 N  N     . PRO A 1 360 ? 15.839  -9.285  -36.105 1.00 16.12 ? 411 PRO A N     1 
ATOM   2762 C  CA    . PRO A 1 360 ? 16.256  -8.704  -34.840 1.00 16.11 ? 411 PRO A CA    1 
ATOM   2763 C  C     . PRO A 1 360 ? 17.661  -9.136  -34.448 1.00 15.94 ? 411 PRO A C     1 
ATOM   2764 O  O     . PRO A 1 360 ? 17.861  -10.256 -33.977 1.00 15.85 ? 411 PRO A O     1 
ATOM   2765 C  CB    . PRO A 1 360 ? 15.224  -9.253  -33.848 1.00 16.13 ? 411 PRO A CB    1 
ATOM   2766 C  CG    . PRO A 1 360 ? 14.873  -10.571 -34.382 1.00 16.24 ? 411 PRO A CG    1 
ATOM   2767 C  CD    . PRO A 1 360 ? 15.000  -10.477 -35.892 1.00 16.25 ? 411 PRO A CD    1 
ATOM   2768 N  N     . VAL A 1 361 ? 18.619  -8.244  -34.659 1.00 15.81 ? 412 VAL A N     1 
ATOM   2769 C  CA    . VAL A 1 361 ? 19.984  -8.445  -34.198 1.00 15.77 ? 412 VAL A CA    1 
ATOM   2770 C  C     . VAL A 1 361 ? 20.207  -7.567  -32.980 1.00 15.93 ? 412 VAL A C     1 
ATOM   2771 O  O     . VAL A 1 361 ? 19.429  -6.651  -32.724 1.00 16.08 ? 412 VAL A O     1 
ATOM   2772 C  CB    . VAL A 1 361 ? 21.017  -8.122  -35.296 1.00 15.72 ? 412 VAL A CB    1 
ATOM   2773 C  CG1   . VAL A 1 361 ? 20.845  -9.080  -36.465 1.00 15.37 ? 412 VAL A CG1   1 
ATOM   2774 C  CG2   . VAL A 1 361 ? 20.895  -6.669  -35.756 1.00 15.12 ? 412 VAL A CG2   1 
ATOM   2775 N  N     . ASP A 1 362 ? 21.250  -7.866  -32.214 1.00 16.17 ? 413 ASP A N     1 
ATOM   2776 C  CA    . ASP A 1 362 ? 21.562  -7.088  -31.019 1.00 16.38 ? 413 ASP A CA    1 
ATOM   2777 C  C     . ASP A 1 362 ? 22.584  -5.994  -31.340 1.00 16.72 ? 413 ASP A C     1 
ATOM   2778 O  O     . ASP A 1 362 ? 22.974  -5.817  -32.499 1.00 16.75 ? 413 ASP A O     1 
ATOM   2779 C  CB    . ASP A 1 362 ? 22.034  -8.005  -29.874 1.00 16.23 ? 413 ASP A CB    1 
ATOM   2780 C  CG    . ASP A 1 362 ? 23.470  -8.493  -30.037 1.00 15.99 ? 413 ASP A CG    1 
ATOM   2781 O  OD1   . ASP A 1 362 ? 24.119  -8.207  -31.068 1.00 15.08 ? 413 ASP A OD1   1 
ATOM   2782 O  OD2   . ASP A 1 362 ? 23.946  -9.181  -29.110 1.00 15.50 ? 413 ASP A OD2   1 
ATOM   2783 N  N     . LYS A 1 363 ? 23.004  -5.265  -30.307 1.00 17.09 ? 414 LYS A N     1 
ATOM   2784 C  CA    . LYS A 1 363 ? 23.984  -4.186  -30.433 1.00 17.29 ? 414 LYS A CA    1 
ATOM   2785 C  C     . LYS A 1 363 ? 25.174  -4.598  -31.289 1.00 17.25 ? 414 LYS A C     1 
ATOM   2786 O  O     . LYS A 1 363 ? 25.554  -3.885  -32.218 1.00 17.22 ? 414 LYS A O     1 
ATOM   2787 C  CB    . LYS A 1 363 ? 24.471  -3.769  -29.045 1.00 17.41 ? 414 LYS A CB    1 
ATOM   2788 C  CG    . LYS A 1 363 ? 25.476  -2.631  -29.040 1.00 18.28 ? 414 LYS A CG    1 
ATOM   2789 C  CD    . LYS A 1 363 ? 26.032  -2.380  -27.640 1.00 19.45 ? 414 LYS A CD    1 
ATOM   2790 C  CE    . LYS A 1 363 ? 27.152  -3.359  -27.268 1.00 19.91 ? 414 LYS A CE    1 
ATOM   2791 N  NZ    . LYS A 1 363 ? 26.680  -4.752  -27.037 1.00 19.96 ? 414 LYS A NZ    1 
ATOM   2792 N  N     . ASP A 1 364 ? 25.753  -5.753  -30.975 1.00 17.27 ? 415 ASP A N     1 
ATOM   2793 C  CA    . ASP A 1 364 ? 26.953  -6.232  -31.678 1.00 17.38 ? 415 ASP A CA    1 
ATOM   2794 C  C     . ASP A 1 364 ? 26.680  -6.748  -33.096 1.00 17.23 ? 415 ASP A C     1 
ATOM   2795 O  O     . ASP A 1 364 ? 27.600  -6.868  -33.888 1.00 17.28 ? 415 ASP A O     1 
ATOM   2796 C  CB    . ASP A 1 364 ? 27.642  -7.340  -30.868 1.00 17.34 ? 415 ASP A CB    1 
ATOM   2797 C  CG    . ASP A 1 364 ? 28.277  -6.831  -29.579 1.00 17.57 ? 415 ASP A CG    1 
ATOM   2798 O  OD1   . ASP A 1 364 ? 28.387  -5.597  -29.391 1.00 17.51 ? 415 ASP A OD1   1 
ATOM   2799 O  OD2   . ASP A 1 364 ? 28.675  -7.681  -28.750 1.00 17.80 ? 415 ASP A OD2   1 
ATOM   2800 N  N     . GLY A 1 365 ? 25.425  -7.053  -33.411 1.00 17.27 ? 416 GLY A N     1 
ATOM   2801 C  CA    . GLY A 1 365 ? 25.070  -7.667  -34.692 1.00 17.18 ? 416 GLY A CA    1 
ATOM   2802 C  C     . GLY A 1 365 ? 24.793  -9.159  -34.589 1.00 17.15 ? 416 GLY A C     1 
ATOM   2803 O  O     . GLY A 1 365 ? 24.755  -9.856  -35.600 1.00 17.14 ? 416 GLY A O     1 
ATOM   2804 N  N     . ASN A 1 366 ? 24.589  -9.647  -33.368 1.00 17.11 ? 417 ASN A N     1 
ATOM   2805 C  CA    . ASN A 1 366 ? 24.271  -11.052 -33.137 1.00 17.11 ? 417 ASN A CA    1 
ATOM   2806 C  C     . ASN A 1 366 ? 22.766  -11.271 -33.220 1.00 17.00 ? 417 ASN A C     1 
ATOM   2807 O  O     . ASN A 1 366 ? 21.993  -10.392 -32.845 1.00 17.02 ? 417 ASN A O     1 
ATOM   2808 C  CB    . ASN A 1 366 ? 24.759  -11.494 -31.758 1.00 17.12 ? 417 ASN A CB    1 
ATOM   2809 C  CG    . ASN A 1 366 ? 26.227  -11.191 -31.533 1.00 17.38 ? 417 ASN A CG    1 
ATOM   2810 O  OD1   . ASN A 1 366 ? 27.089  -11.598 -32.314 1.00 16.86 ? 417 ASN A OD1   1 
ATOM   2811 N  ND2   . ASN A 1 366 ? 26.518  -10.471 -30.457 1.00 17.73 ? 417 ASN A ND2   1 
ATOM   2812 N  N     . PRO A 1 367 ? 22.338  -12.448 -33.700 1.00 16.78 ? 418 PRO A N     1 
ATOM   2813 C  CA    . PRO A 1 367 ? 20.901  -12.714 -33.692 1.00 16.66 ? 418 PRO A CA    1 
ATOM   2814 C  C     . PRO A 1 367 ? 20.315  -12.519 -32.290 1.00 16.47 ? 418 PRO A C     1 
ATOM   2815 O  O     . PRO A 1 367 ? 20.832  -13.086 -31.326 1.00 16.58 ? 418 PRO A O     1 
ATOM   2816 C  CB    . PRO A 1 367 ? 20.815  -14.183 -34.122 1.00 16.78 ? 418 PRO A CB    1 
ATOM   2817 C  CG    . PRO A 1 367 ? 22.088  -14.450 -34.859 1.00 16.65 ? 418 PRO A CG    1 
ATOM   2818 C  CD    . PRO A 1 367 ? 23.119  -13.579 -34.234 1.00 16.58 ? 418 PRO A CD    1 
ATOM   2819 N  N     . ASP A 1 368 ? 19.275  -11.697 -32.180 1.00 16.17 ? 419 ASP A N     1 
ATOM   2820 C  CA    . ASP A 1 368 ? 18.626  -11.429 -30.897 1.00 15.91 ? 419 ASP A CA    1 
ATOM   2821 C  C     . ASP A 1 368 ? 17.486  -12.428 -30.728 1.00 15.68 ? 419 ASP A C     1 
ATOM   2822 O  O     . ASP A 1 368 ? 16.352  -12.168 -31.118 1.00 15.75 ? 419 ASP A O     1 
ATOM   2823 C  CB    . ASP A 1 368 ? 18.120  -9.980  -30.842 1.00 15.80 ? 419 ASP A CB    1 
ATOM   2824 C  CG    . ASP A 1 368 ? 17.756  -9.520  -29.428 1.00 15.65 ? 419 ASP A CG    1 
ATOM   2825 O  OD1   . ASP A 1 368 ? 17.535  -10.363 -28.523 1.00 14.32 ? 419 ASP A OD1   1 
ATOM   2826 O  OD2   . ASP A 1 368 ? 17.675  -8.285  -29.230 1.00 15.68 ? 419 ASP A OD2   1 
ATOM   2827 N  N     . ASN A 1 369 ? 17.799  -13.584 -30.158 1.00 15.63 ? 420 ASN A N     1 
ATOM   2828 C  CA    . ASN A 1 369 ? 16.809  -14.654 -30.025 1.00 15.62 ? 420 ASN A CA    1 
ATOM   2829 C  C     . ASN A 1 369 ? 15.594  -14.239 -29.188 1.00 15.64 ? 420 ASN A C     1 
ATOM   2830 O  O     . ASN A 1 369 ? 14.448  -14.573 -29.519 1.00 15.87 ? 420 ASN A O     1 
ATOM   2831 C  CB    . ASN A 1 369 ? 17.463  -15.910 -29.434 1.00 15.48 ? 420 ASN A CB    1 
ATOM   2832 C  CG    . ASN A 1 369 ? 18.358  -16.622 -30.426 1.00 15.27 ? 420 ASN A CG    1 
ATOM   2833 O  OD1   . ASN A 1 369 ? 18.039  -16.717 -31.605 1.00 15.07 ? 420 ASN A OD1   1 
ATOM   2834 N  ND2   . ASN A 1 369 ? 19.481  -17.135 -29.950 1.00 15.39 ? 420 ASN A ND2   1 
ATOM   2835 N  N     . GLU A 1 370 ? 15.850  -13.490 -28.120 1.00 15.45 ? 421 GLU A N     1 
ATOM   2836 C  CA    . GLU A 1 370 ? 14.809  -13.113 -27.175 1.00 15.32 ? 421 GLU A CA    1 
ATOM   2837 C  C     . GLU A 1 370 ? 13.834  -12.159 -27.838 1.00 15.13 ? 421 GLU A C     1 
ATOM   2838 O  O     . GLU A 1 370 ? 12.620  -12.370 -27.780 1.00 15.49 ? 421 GLU A O     1 
ATOM   2839 C  CB    . GLU A 1 370 ? 15.410  -12.460 -25.929 1.00 15.31 ? 421 GLU A CB    1 
ATOM   2840 C  CG    . GLU A 1 370 ? 16.221  -13.407 -25.057 1.00 15.86 ? 421 GLU A CG    1 
ATOM   2841 C  CD    . GLU A 1 370 ? 17.521  -13.868 -25.710 1.00 16.30 ? 421 GLU A CD    1 
ATOM   2842 O  OE1   . GLU A 1 370 ? 18.041  -13.157 -26.598 1.00 16.55 ? 421 GLU A OE1   1 
ATOM   2843 O  OE2   . GLU A 1 370 ? 18.018  -14.949 -25.333 1.00 16.83 ? 421 GLU A OE2   1 
ATOM   2844 N  N     . THR A 1 371 ? 14.375  -11.124 -28.477 1.00 14.55 ? 422 THR A N     1 
ATOM   2845 C  CA    . THR A 1 371 ? 13.566  -10.117 -29.151 1.00 14.28 ? 422 THR A CA    1 
ATOM   2846 C  C     . THR A 1 371 ? 12.710  -10.743 -30.243 1.00 13.90 ? 422 THR A C     1 
ATOM   2847 O  O     . THR A 1 371 ? 11.539  -10.397 -30.392 1.00 14.04 ? 422 THR A O     1 
ATOM   2848 C  CB    . THR A 1 371 ? 14.456  -8.984  -29.734 1.00 14.36 ? 422 THR A CB    1 
ATOM   2849 O  OG1   . THR A 1 371 ? 15.169  -8.358  -28.660 1.00 14.89 ? 422 THR A OG1   1 
ATOM   2850 C  CG2   . THR A 1 371 ? 13.624  -7.923  -30.473 1.00 13.60 ? 422 THR A CG2   1 
ATOM   2851 N  N     . TYR A 1 372 ? 13.294  -11.675 -30.986 1.00 13.38 ? 423 TYR A N     1 
ATOM   2852 C  CA    . TYR A 1 372 ? 12.577  -12.371 -32.034 1.00 13.02 ? 423 TYR A CA    1 
ATOM   2853 C  C     . TYR A 1 372 ? 11.284  -13.002 -31.506 1.00 12.87 ? 423 TYR A C     1 
ATOM   2854 O  O     . TYR A 1 372 ? 10.221  -12.828 -32.098 1.00 12.72 ? 423 TYR A O     1 
ATOM   2855 C  CB    . TYR A 1 372 ? 13.469  -13.441 -32.656 1.00 12.82 ? 423 TYR A CB    1 
ATOM   2856 C  CG    . TYR A 1 372 ? 12.769  -14.242 -33.722 1.00 13.46 ? 423 TYR A CG    1 
ATOM   2857 C  CD1   . TYR A 1 372 ? 12.736  -13.799 -35.041 1.00 14.06 ? 423 TYR A CD1   1 
ATOM   2858 C  CD2   . TYR A 1 372 ? 12.116  -15.437 -33.412 1.00 13.16 ? 423 TYR A CD2   1 
ATOM   2859 C  CE1   . TYR A 1 372 ? 12.076  -14.531 -36.032 1.00 14.09 ? 423 TYR A CE1   1 
ATOM   2860 C  CE2   . TYR A 1 372 ? 11.454  -16.170 -34.388 1.00 13.44 ? 423 TYR A CE2   1 
ATOM   2861 C  CZ    . TYR A 1 372 ? 11.441  -15.715 -35.699 1.00 14.02 ? 423 TYR A CZ    1 
ATOM   2862 O  OH    . TYR A 1 372 ? 10.800  -16.442 -36.678 1.00 14.61 ? 423 TYR A OH    1 
ATOM   2863 N  N     . LEU A 1 373 ? 11.387  -13.734 -30.397 1.00 12.74 ? 424 LEU A N     1 
ATOM   2864 C  CA    . LEU A 1 373 ? 10.242  -14.428 -29.794 1.00 12.62 ? 424 LEU A CA    1 
ATOM   2865 C  C     . LEU A 1 373 ? 9.176   -13.450 -29.277 1.00 12.79 ? 424 LEU A C     1 
ATOM   2866 O  O     . LEU A 1 373 ? 7.971   -13.717 -29.388 1.00 12.75 ? 424 LEU A O     1 
ATOM   2867 C  CB    . LEU A 1 373 ? 10.723  -15.345 -28.654 1.00 12.52 ? 424 LEU A CB    1 
ATOM   2868 C  CG    . LEU A 1 373 ? 9.690   -16.172 -27.870 1.00 12.56 ? 424 LEU A CG    1 
ATOM   2869 C  CD1   . LEU A 1 373 ? 10.392  -17.125 -26.940 1.00 12.35 ? 424 LEU A CD1   1 
ATOM   2870 C  CD2   . LEU A 1 373 ? 8.708   -15.309 -27.059 1.00 13.19 ? 424 LEU A CD2   1 
ATOM   2871 N  N     . HIS A 1 374 ? 9.621   -12.338 -28.690 1.00 12.79 ? 425 HIS A N     1 
ATOM   2872 C  CA    . HIS A 1 374 ? 8.705   -11.285 -28.253 1.00 12.92 ? 425 HIS A CA    1 
ATOM   2873 C  C     . HIS A 1 374 ? 8.040   -10.621 -29.444 1.00 13.03 ? 425 HIS A C     1 
ATOM   2874 O  O     . HIS A 1 374 ? 6.832   -10.406 -29.428 1.00 13.62 ? 425 HIS A O     1 
ATOM   2875 C  CB    . HIS A 1 374 ? 9.424   -10.228 -27.412 1.00 12.90 ? 425 HIS A CB    1 
ATOM   2876 C  CG    . HIS A 1 374 ? 9.884   -10.734 -26.087 1.00 12.66 ? 425 HIS A CG    1 
ATOM   2877 N  ND1   . HIS A 1 374 ? 9.005   -11.110 -25.096 1.00 12.31 ? 425 HIS A ND1   1 
ATOM   2878 C  CD2   . HIS A 1 374 ? 11.127  -10.933 -25.588 1.00 12.45 ? 425 HIS A CD2   1 
ATOM   2879 C  CE1   . HIS A 1 374 ? 9.688   -11.523 -24.044 1.00 12.89 ? 425 HIS A CE1   1 
ATOM   2880 N  NE2   . HIS A 1 374 ? 10.977  -11.423 -24.315 1.00 13.18 ? 425 HIS A NE2   1 
ATOM   2881 N  N     . ARG A 1 375 ? 8.817   -10.302 -30.477 1.00 12.91 ? 426 ARG A N     1 
ATOM   2882 C  CA    . ARG A 1 375 ? 8.256   -9.712  -31.694 1.00 12.86 ? 426 ARG A CA    1 
ATOM   2883 C  C     . ARG A 1 375 ? 7.154   -10.578 -32.316 1.00 12.75 ? 426 ARG A C     1 
ATOM   2884 O  O     . ARG A 1 375 ? 6.037   -10.098 -32.529 1.00 12.67 ? 426 ARG A O     1 
ATOM   2885 C  CB    . ARG A 1 375 ? 9.336   -9.457  -32.733 1.00 12.86 ? 426 ARG A CB    1 
ATOM   2886 C  CG    . ARG A 1 375 ? 10.227  -8.247  -32.476 1.00 13.13 ? 426 ARG A CG    1 
ATOM   2887 C  CD    . ARG A 1 375 ? 11.171  -8.122  -33.662 1.00 13.87 ? 426 ARG A CD    1 
ATOM   2888 N  NE    . ARG A 1 375 ? 12.030  -6.946  -33.659 1.00 13.80 ? 426 ARG A NE    1 
ATOM   2889 C  CZ    . ARG A 1 375 ? 12.791  -6.581  -34.689 1.00 14.56 ? 426 ARG A CZ    1 
ATOM   2890 N  NH1   . ARG A 1 375 ? 12.791  -7.291  -35.820 1.00 15.00 ? 426 ARG A NH1   1 
ATOM   2891 N  NH2   . ARG A 1 375 ? 13.549  -5.494  -34.599 1.00 14.77 ? 426 ARG A NH2   1 
ATOM   2892 N  N     . ILE A 1 376 ? 7.448   -11.847 -32.597 1.00 12.61 ? 427 ILE A N     1 
ATOM   2893 C  CA    . ILE A 1 376 ? 6.424   -12.724 -33.182 1.00 12.68 ? 427 ILE A CA    1 
ATOM   2894 C  C     . ILE A 1 376 ? 5.276   -12.993 -32.194 1.00 13.06 ? 427 ILE A C     1 
ATOM   2895 O  O     . ILE A 1 376 ? 4.195   -13.430 -32.599 1.00 13.09 ? 427 ILE A O     1 
ATOM   2896 C  CB    . ILE A 1 376 ? 6.990   -14.061 -33.751 1.00 12.30 ? 427 ILE A CB    1 
ATOM   2897 C  CG1   . ILE A 1 376 ? 7.444   -15.008 -32.645 1.00 12.02 ? 427 ILE A CG1   1 
ATOM   2898 C  CG2   . ILE A 1 376 ? 8.117   -13.792 -34.709 1.00 11.65 ? 427 ILE A CG2   1 
ATOM   2899 C  CD1   . ILE A 1 376 ? 7.970   -16.327 -33.182 1.00 11.96 ? 427 ILE A CD1   1 
ATOM   2900 N  N     . GLY A 1 377 ? 5.515   -12.717 -30.910 1.00 13.41 ? 428 GLY A N     1 
ATOM   2901 C  CA    . GLY A 1 377 ? 4.498   -12.874 -29.861 1.00 13.62 ? 428 GLY A CA    1 
ATOM   2902 C  C     . GLY A 1 377 ? 3.407   -11.812 -29.806 1.00 13.74 ? 428 GLY A C     1 
ATOM   2903 O  O     . GLY A 1 377 ? 2.473   -11.936 -29.018 1.00 13.94 ? 428 GLY A O     1 
ATOM   2904 N  N     . ARG A 1 378 ? 3.513   -10.781 -30.648 1.00 13.88 ? 429 ARG A N     1 
ATOM   2905 C  CA    . ARG A 1 378 ? 2.510   -9.710  -30.717 1.00 13.86 ? 429 ARG A CA    1 
ATOM   2906 C  C     . ARG A 1 378 ? 1.315   -10.139 -31.579 1.00 14.03 ? 429 ARG A C     1 
ATOM   2907 O  O     . ARG A 1 378 ? 0.367   -9.378  -31.751 1.00 14.05 ? 429 ARG A O     1 
ATOM   2908 C  CB    . ARG A 1 378 ? 3.118   -8.417  -31.278 1.00 13.88 ? 429 ARG A CB    1 
ATOM   2909 C  CG    . ARG A 1 378 ? 4.533   -8.085  -30.766 1.00 13.98 ? 429 ARG A CG    1 
ATOM   2910 C  CD    . ARG A 1 378 ? 4.566   -7.161  -29.565 1.00 13.70 ? 429 ARG A CD    1 
ATOM   2911 N  NE    . ARG A 1 378 ? 3.828   -7.631  -28.395 1.00 13.74 ? 429 ARG A NE    1 
ATOM   2912 C  CZ    . ARG A 1 378 ? 4.226   -8.583  -27.553 1.00 12.95 ? 429 ARG A CZ    1 
ATOM   2913 N  NH1   . ARG A 1 378 ? 5.361   -9.239  -27.732 1.00 12.06 ? 429 ARG A NH1   1 
ATOM   2914 N  NH2   . ARG A 1 378 ? 3.458   -8.889  -26.519 1.00 13.73 ? 429 ARG A NH2   1 
ATOM   2915 N  N     . THR A 1 379 ? 1.385   -11.356 -32.124 1.00 14.18 ? 430 THR A N     1 
ATOM   2916 C  CA    . THR A 1 379 ? 0.286   -11.988 -32.852 1.00 14.04 ? 430 THR A CA    1 
ATOM   2917 C  C     . THR A 1 379 ? -0.066  -13.328 -32.184 1.00 14.02 ? 430 THR A C     1 
ATOM   2918 O  O     . THR A 1 379 ? 0.701   -13.847 -31.378 1.00 14.07 ? 430 THR A O     1 
ATOM   2919 C  CB    . THR A 1 379 ? 0.678   -12.223 -34.329 1.00 14.01 ? 430 THR A CB    1 
ATOM   2920 O  OG1   . THR A 1 379 ? -0.492  -12.507 -35.107 1.00 13.56 ? 430 THR A OG1   1 
ATOM   2921 C  CG2   . THR A 1 379 ? 1.668   -13.375 -34.444 1.00 13.65 ? 430 THR A CG2   1 
ATOM   2922 N  N     . GLY A 1 380 ? -1.229  -13.878 -32.513 1.00 14.13 ? 431 GLY A N     1 
ATOM   2923 C  CA    . GLY A 1 380 ? -1.662  -15.165 -31.957 1.00 14.19 ? 431 GLY A CA    1 
ATOM   2924 C  C     . GLY A 1 380 ? -1.724  -15.190 -30.431 1.00 14.15 ? 431 GLY A C     1 
ATOM   2925 O  O     . GLY A 1 380 ? -1.188  -16.095 -29.785 1.00 14.29 ? 431 GLY A O     1 
ATOM   2926 N  N     . ARG A 1 381 ? -2.405  -14.204 -29.859 1.00 13.93 ? 432 ARG A N     1 
ATOM   2927 C  CA    . ARG A 1 381 ? -2.362  -13.968 -28.423 1.00 13.78 ? 432 ARG A CA    1 
ATOM   2928 C  C     . ARG A 1 381 ? -3.548  -14.613 -27.710 1.00 13.85 ? 432 ARG A C     1 
ATOM   2929 O  O     . ARG A 1 381 ? -4.670  -14.626 -28.218 1.00 13.97 ? 432 ARG A O     1 
ATOM   2930 C  CB    . ARG A 1 381 ? -2.274  -12.460 -28.148 1.00 13.70 ? 432 ARG A CB    1 
ATOM   2931 C  CG    . ARG A 1 381 ? -0.983  -11.861 -28.721 1.00 13.39 ? 432 ARG A CG    1 
ATOM   2932 C  CD    . ARG A 1 381 ? -0.814  -10.392 -28.445 1.00 12.92 ? 432 ARG A CD    1 
ATOM   2933 N  NE    . ARG A 1 381 ? -0.714  -10.098 -27.017 1.00 12.77 ? 432 ARG A NE    1 
ATOM   2934 C  CZ    . ARG A 1 381 ? 0.340   -10.363 -26.244 1.00 12.50 ? 432 ARG A CZ    1 
ATOM   2935 N  NH1   . ARG A 1 381 ? 1.427   -10.971 -26.726 1.00 12.09 ? 432 ARG A NH1   1 
ATOM   2936 N  NH2   . ARG A 1 381 ? 0.297   -10.026 -24.958 1.00 12.22 ? 432 ARG A NH2   1 
ATOM   2937 N  N     . PHE A 1 382 ? -3.267  -15.154 -26.530 1.00 13.71 ? 433 PHE A N     1 
ATOM   2938 C  CA    . PHE A 1 382 ? -4.212  -15.955 -25.753 1.00 13.52 ? 433 PHE A CA    1 
ATOM   2939 C  C     . PHE A 1 382 ? -5.159  -16.804 -26.591 1.00 13.51 ? 433 PHE A C     1 
ATOM   2940 O  O     . PHE A 1 382 ? -6.379  -16.615 -26.585 1.00 13.46 ? 433 PHE A O     1 
ATOM   2941 C  CB    . PHE A 1 382 ? -4.980  -15.087 -24.755 1.00 13.48 ? 433 PHE A CB    1 
ATOM   2942 C  CG    . PHE A 1 382 ? -5.250  -15.786 -23.458 1.00 13.42 ? 433 PHE A CG    1 
ATOM   2943 C  CD1   . PHE A 1 382 ? -6.360  -16.601 -23.309 1.00 12.98 ? 433 PHE A CD1   1 
ATOM   2944 C  CD2   . PHE A 1 382 ? -4.365  -15.661 -22.394 1.00 13.49 ? 433 PHE A CD2   1 
ATOM   2945 C  CE1   . PHE A 1 382 ? -6.597  -17.252 -22.116 1.00 13.01 ? 433 PHE A CE1   1 
ATOM   2946 C  CE2   . PHE A 1 382 ? -4.595  -16.314 -21.200 1.00 13.18 ? 433 PHE A CE2   1 
ATOM   2947 C  CZ    . PHE A 1 382 ? -5.710  -17.110 -21.060 1.00 13.01 ? 433 PHE A CZ    1 
ATOM   2948 N  N     . GLY A 1 383 ? -4.571  -17.757 -27.302 1.00 13.60 ? 434 GLY A N     1 
ATOM   2949 C  CA    . GLY A 1 383 ? -5.332  -18.765 -28.020 1.00 13.84 ? 434 GLY A CA    1 
ATOM   2950 C  C     . GLY A 1 383 ? -5.656  -18.432 -29.461 1.00 14.08 ? 434 GLY A C     1 
ATOM   2951 O  O     . GLY A 1 383 ? -5.997  -19.332 -30.225 1.00 14.23 ? 434 GLY A O     1 
ATOM   2952 N  N     . LYS A 1 384 ? -5.568  -17.154 -29.840 1.00 14.29 ? 435 LYS A N     1 
ATOM   2953 C  CA    . LYS A 1 384 ? -5.753  -16.766 -31.238 1.00 14.42 ? 435 LYS A CA    1 
ATOM   2954 C  C     . LYS A 1 384 ? -4.594  -17.273 -32.078 1.00 14.45 ? 435 LYS A C     1 
ATOM   2955 O  O     . LYS A 1 384 ? -3.488  -17.478 -31.576 1.00 14.66 ? 435 LYS A O     1 
ATOM   2956 C  CB    . LYS A 1 384 ? -5.897  -15.252 -31.404 1.00 14.54 ? 435 LYS A CB    1 
ATOM   2957 C  CG    . LYS A 1 384 ? -7.303  -14.754 -31.146 1.00 15.10 ? 435 LYS A CG    1 
ATOM   2958 C  CD    . LYS A 1 384 ? -7.435  -13.271 -31.420 1.00 15.88 ? 435 LYS A CD    1 
ATOM   2959 C  CE    . LYS A 1 384 ? -8.858  -12.786 -31.143 1.00 16.80 ? 435 LYS A CE    1 
ATOM   2960 N  NZ    . LYS A 1 384 ? -9.000  -11.300 -31.318 1.00 17.83 ? 435 LYS A NZ    1 
ATOM   2961 N  N     . ARG A 1 385 ? -4.875  -17.482 -33.358 1.00 14.38 ? 436 ARG A N     1 
ATOM   2962 C  CA    . ARG A 1 385 ? -3.925  -18.045 -34.299 1.00 14.26 ? 436 ARG A CA    1 
ATOM   2963 C  C     . ARG A 1 385 ? -3.319  -16.909 -35.126 1.00 14.02 ? 436 ARG A C     1 
ATOM   2964 O  O     . ARG A 1 385 ? -4.049  -16.097 -35.680 1.00 13.92 ? 436 ARG A O     1 
ATOM   2965 C  CB    . ARG A 1 385 ? -4.651  -19.052 -35.189 1.00 14.30 ? 436 ARG A CB    1 
ATOM   2966 C  CG    . ARG A 1 385 ? -3.740  -19.887 -36.054 1.00 14.58 ? 436 ARG A CG    1 
ATOM   2967 C  CD    . ARG A 1 385 ? -4.281  -21.300 -36.225 1.00 14.84 ? 436 ARG A CD    1 
ATOM   2968 N  NE    . ARG A 1 385 ? -5.587  -21.326 -36.879 1.00 14.83 ? 436 ARG A NE    1 
ATOM   2969 C  CZ    . ARG A 1 385 ? -6.357  -22.409 -36.999 1.00 14.94 ? 436 ARG A CZ    1 
ATOM   2970 N  NH1   . ARG A 1 385 ? -5.972  -23.585 -36.513 1.00 14.87 ? 436 ARG A NH1   1 
ATOM   2971 N  NH2   . ARG A 1 385 ? -7.531  -22.317 -37.609 1.00 15.26 ? 436 ARG A NH2   1 
ATOM   2972 N  N     . GLY A 1 386 ? -1.990  -16.857 -35.197 1.00 13.71 ? 437 GLY A N     1 
ATOM   2973 C  CA    . GLY A 1 386 ? -1.279  -15.728 -35.795 1.00 13.43 ? 437 GLY A CA    1 
ATOM   2974 C  C     . GLY A 1 386 ? -0.258  -16.129 -36.842 1.00 13.23 ? 437 GLY A C     1 
ATOM   2975 O  O     . GLY A 1 386 ? -0.135  -17.305 -37.190 1.00 13.34 ? 437 GLY A O     1 
ATOM   2976 N  N     . LEU A 1 387 ? 0.495   -15.137 -37.314 1.00 13.05 ? 438 LEU A N     1 
ATOM   2977 C  CA    . LEU A 1 387 ? 1.349   -15.274 -38.498 1.00 12.99 ? 438 LEU A CA    1 
ATOM   2978 C  C     . LEU A 1 387 ? 2.549   -14.311 -38.413 1.00 12.79 ? 438 LEU A C     1 
ATOM   2979 O  O     . LEU A 1 387 ? 2.374   -13.108 -38.205 1.00 12.42 ? 438 LEU A O     1 
ATOM   2980 C  CB    . LEU A 1 387 ? 0.511   -14.965 -39.748 1.00 12.97 ? 438 LEU A CB    1 
ATOM   2981 C  CG    . LEU A 1 387 ? 0.748   -15.741 -41.037 1.00 13.44 ? 438 LEU A CG    1 
ATOM   2982 C  CD1   . LEU A 1 387 ? 0.603   -17.236 -40.838 1.00 13.91 ? 438 LEU A CD1   1 
ATOM   2983 C  CD2   . LEU A 1 387 ? -0.239  -15.265 -42.095 1.00 15.00 ? 438 LEU A CD2   1 
ATOM   2984 N  N     . ALA A 1 388 ? 3.759   -14.846 -38.559 1.00 12.66 ? 439 ALA A N     1 
ATOM   2985 C  CA    . ALA A 1 388 ? 4.977   -14.036 -38.522 1.00 12.72 ? 439 ALA A CA    1 
ATOM   2986 C  C     . ALA A 1 388 ? 5.766   -14.249 -39.807 1.00 12.92 ? 439 ALA A C     1 
ATOM   2987 O  O     . ALA A 1 388 ? 6.168   -15.377 -40.100 1.00 12.85 ? 439 ALA A O     1 
ATOM   2988 C  CB    . ALA A 1 388 ? 5.822   -14.397 -37.321 1.00 12.40 ? 439 ALA A CB    1 
ATOM   2989 N  N     . VAL A 1 389 ? 5.975   -13.172 -40.571 1.00 13.24 ? 440 VAL A N     1 
ATOM   2990 C  CA    . VAL A 1 389 ? 6.709   -13.240 -41.845 1.00 13.48 ? 440 VAL A CA    1 
ATOM   2991 C  C     . VAL A 1 389 ? 8.039   -12.492 -41.759 1.00 13.69 ? 440 VAL A C     1 
ATOM   2992 O  O     . VAL A 1 389 ? 8.081   -11.304 -41.451 1.00 13.30 ? 440 VAL A O     1 
ATOM   2993 C  CB    . VAL A 1 389 ? 5.880   -12.692 -43.039 1.00 13.51 ? 440 VAL A CB    1 
ATOM   2994 C  CG1   . VAL A 1 389 ? 6.687   -12.776 -44.330 1.00 13.20 ? 440 VAL A CG1   1 
ATOM   2995 C  CG2   . VAL A 1 389 ? 4.572   -13.462 -43.186 1.00 13.18 ? 440 VAL A CG2   1 
ATOM   2996 N  N     . ASN A 1 390 ? 9.120   -13.212 -42.046 1.00 14.24 ? 441 ASN A N     1 
ATOM   2997 C  CA    . ASN A 1 390 ? 10.478  -12.672 -41.970 1.00 14.62 ? 441 ASN A CA    1 
ATOM   2998 C  C     . ASN A 1 390 ? 11.002  -12.244 -43.337 1.00 14.85 ? 441 ASN A C     1 
ATOM   2999 O  O     . ASN A 1 390 ? 11.004  -13.041 -44.267 1.00 14.97 ? 441 ASN A O     1 
ATOM   3000 C  CB    . ASN A 1 390 ? 11.413  -13.735 -41.393 1.00 14.71 ? 441 ASN A CB    1 
ATOM   3001 C  CG    . ASN A 1 390 ? 11.100  -14.061 -39.949 1.00 14.50 ? 441 ASN A CG    1 
ATOM   3002 O  OD1   . ASN A 1 390 ? 11.202  -13.201 -39.076 1.00 14.28 ? 441 ASN A OD1   1 
ATOM   3003 N  ND2   . ASN A 1 390 ? 10.726  -15.309 -39.690 1.00 14.12 ? 441 ASN A ND2   1 
ATOM   3004 N  N     . MET A 1 391 ? 11.458  -10.999 -43.455 1.00 15.17 ? 442 MET A N     1 
ATOM   3005 C  CA    . MET A 1 391 ? 12.032  -10.503 -44.708 1.00 15.46 ? 442 MET A CA    1 
ATOM   3006 C  C     . MET A 1 391 ? 13.551  -10.688 -44.710 1.00 15.50 ? 442 MET A C     1 
ATOM   3007 O  O     . MET A 1 391 ? 14.257  -9.997  -43.984 1.00 15.66 ? 442 MET A O     1 
ATOM   3008 C  CB    . MET A 1 391 ? 11.693  -9.018  -44.903 1.00 15.65 ? 442 MET A CB    1 
ATOM   3009 C  CG    . MET A 1 391 ? 10.209  -8.674  -44.863 1.00 16.27 ? 442 MET A CG    1 
ATOM   3010 S  SD    . MET A 1 391 ? 9.259   -9.444  -46.190 1.00 18.05 ? 442 MET A SD    1 
ATOM   3011 C  CE    . MET A 1 391 ? 7.577   -9.058  -45.692 1.00 18.41 ? 442 MET A CE    1 
ATOM   3012 N  N     . VAL A 1 392 ? 14.052  -11.619 -45.520 1.00 15.63 ? 443 VAL A N     1 
ATOM   3013 C  CA    . VAL A 1 392 ? 15.496  -11.871 -45.619 1.00 15.65 ? 443 VAL A CA    1 
ATOM   3014 C  C     . VAL A 1 392 ? 16.072  -11.165 -46.843 1.00 15.86 ? 443 VAL A C     1 
ATOM   3015 O  O     . VAL A 1 392 ? 15.626  -11.393 -47.962 1.00 15.76 ? 443 VAL A O     1 
ATOM   3016 C  CB    . VAL A 1 392 ? 15.807  -13.380 -45.690 1.00 15.61 ? 443 VAL A CB    1 
ATOM   3017 C  CG1   . VAL A 1 392 ? 17.289  -13.610 -45.929 1.00 15.73 ? 443 VAL A CG1   1 
ATOM   3018 C  CG2   . VAL A 1 392 ? 15.366  -14.073 -44.409 1.00 15.09 ? 443 VAL A CG2   1 
ATOM   3019 N  N     . ASP A 1 393 ? 17.070  -10.312 -46.620 1.00 16.31 ? 444 ASP A N     1 
ATOM   3020 C  CA    . ASP A 1 393 ? 17.623  -9.460  -47.679 1.00 16.64 ? 444 ASP A CA    1 
ATOM   3021 C  C     . ASP A 1 393 ? 18.973  -9.923  -48.247 1.00 16.69 ? 444 ASP A C     1 
ATOM   3022 O  O     . ASP A 1 393 ? 19.384  -9.440  -49.300 1.00 16.80 ? 444 ASP A O     1 
ATOM   3023 C  CB    . ASP A 1 393 ? 17.739  -8.009  -47.188 1.00 16.87 ? 444 ASP A CB    1 
ATOM   3024 C  CG    . ASP A 1 393 ? 18.864  -7.800  -46.165 1.00 17.90 ? 444 ASP A CG    1 
ATOM   3025 O  OD1   . ASP A 1 393 ? 18.898  -6.715  -45.547 1.00 19.84 ? 444 ASP A OD1   1 
ATOM   3026 O  OD2   . ASP A 1 393 ? 19.717  -8.695  -45.975 1.00 19.26 ? 444 ASP A OD2   1 
ATOM   3027 N  N     . SER A 1 394 ? 19.657  -10.834 -47.554 1.00 16.68 ? 445 SER A N     1 
ATOM   3028 C  CA    . SER A 1 394 ? 20.996  -11.278 -47.959 1.00 16.76 ? 445 SER A CA    1 
ATOM   3029 C  C     . SER A 1 394 ? 21.296  -12.704 -47.492 1.00 16.80 ? 445 SER A C     1 
ATOM   3030 O  O     . SER A 1 394 ? 20.447  -13.370 -46.894 1.00 16.99 ? 445 SER A O     1 
ATOM   3031 C  CB    . SER A 1 394 ? 22.058  -10.335 -47.388 1.00 16.76 ? 445 SER A CB    1 
ATOM   3032 O  OG    . SER A 1 394 ? 22.358  -10.664 -46.039 1.00 16.88 ? 445 SER A OG    1 
ATOM   3033 N  N     . LYS A 1 395 ? 22.516  -13.156 -47.761 1.00 16.74 ? 446 LYS A N     1 
ATOM   3034 C  CA    . LYS A 1 395 ? 22.970  -14.466 -47.312 1.00 16.84 ? 446 LYS A CA    1 
ATOM   3035 C  C     . LYS A 1 395 ? 23.340  -14.407 -45.833 1.00 16.99 ? 446 LYS A C     1 
ATOM   3036 O  O     . LYS A 1 395 ? 23.086  -15.345 -45.081 1.00 16.80 ? 446 LYS A O     1 
ATOM   3037 C  CB    . LYS A 1 395 ? 24.173  -14.924 -48.133 1.00 16.73 ? 446 LYS A CB    1 
ATOM   3038 C  CG    . LYS A 1 395 ? 24.157  -16.403 -48.481 1.00 17.08 ? 446 LYS A CG    1 
ATOM   3039 C  CD    . LYS A 1 395 ? 25.078  -16.700 -49.653 1.00 17.53 ? 446 LYS A CD    1 
ATOM   3040 C  CE    . LYS A 1 395 ? 24.519  -16.164 -50.978 1.00 17.70 ? 446 LYS A CE    1 
ATOM   3041 N  NZ    . LYS A 1 395 ? 25.576  -15.499 -51.800 1.00 17.66 ? 446 LYS A NZ    1 
ATOM   3042 N  N     . HIS A 1 396 ? 23.953  -13.299 -45.428 1.00 17.25 ? 447 HIS A N     1 
ATOM   3043 C  CA    . HIS A 1 396 ? 24.283  -13.077 -44.033 1.00 17.41 ? 447 HIS A CA    1 
ATOM   3044 C  C     . HIS A 1 396 ? 22.998  -13.037 -43.233 1.00 17.57 ? 447 HIS A C     1 
ATOM   3045 O  O     . HIS A 1 396 ? 22.899  -13.663 -42.177 1.00 17.98 ? 447 HIS A O     1 
ATOM   3046 C  CB    . HIS A 1 396 ? 25.053  -11.768 -43.861 1.00 17.48 ? 447 HIS A CB    1 
ATOM   3047 C  CG    . HIS A 1 396 ? 25.376  -11.436 -42.437 1.00 17.82 ? 447 HIS A CG    1 
ATOM   3048 N  ND1   . HIS A 1 396 ? 24.705  -10.461 -41.730 1.00 18.02 ? 447 HIS A ND1   1 
ATOM   3049 C  CD2   . HIS A 1 396 ? 26.297  -11.950 -41.587 1.00 18.19 ? 447 HIS A CD2   1 
ATOM   3050 C  CE1   . HIS A 1 396 ? 25.198  -10.387 -40.507 1.00 18.10 ? 447 HIS A CE1   1 
ATOM   3051 N  NE2   . HIS A 1 396 ? 26.166  -11.279 -40.395 1.00 18.16 ? 447 HIS A NE2   1 
ATOM   3052 N  N     . SER A 1 397 ? 22.007  -12.308 -43.738 1.00 17.50 ? 448 SER A N     1 
ATOM   3053 C  CA    . SER A 1 397 ? 20.719  -12.229 -43.057 1.00 17.32 ? 448 SER A CA    1 
ATOM   3054 C  C     . SER A 1 397 ? 20.085  -13.605 -42.964 1.00 17.44 ? 448 SER A C     1 
ATOM   3055 O  O     . SER A 1 397 ? 19.516  -13.954 -41.937 1.00 17.54 ? 448 SER A O     1 
ATOM   3056 C  CB    . SER A 1 397 ? 19.774  -11.249 -43.755 1.00 17.26 ? 448 SER A CB    1 
ATOM   3057 O  OG    . SER A 1 397 ? 19.984  -9.933  -43.282 1.00 16.32 ? 448 SER A OG    1 
ATOM   3058 N  N     . MET A 1 398 ? 20.198  -14.391 -44.027 1.00 17.60 ? 449 MET A N     1 
ATOM   3059 C  CA    . MET A 1 398 ? 19.651  -15.738 -44.018 1.00 17.87 ? 449 MET A CA    1 
ATOM   3060 C  C     . MET A 1 398 ? 20.277  -16.574 -42.894 1.00 17.97 ? 449 MET A C     1 
ATOM   3061 O  O     . MET A 1 398 ? 19.589  -17.387 -42.274 1.00 18.03 ? 449 MET A O     1 
ATOM   3062 C  CB    . MET A 1 398 ? 19.854  -16.411 -45.375 1.00 17.95 ? 449 MET A CB    1 
ATOM   3063 C  CG    . MET A 1 398 ? 19.216  -17.797 -45.498 1.00 18.67 ? 449 MET A CG    1 
ATOM   3064 S  SD    . MET A 1 398 ? 17.412  -17.783 -45.453 1.00 20.19 ? 449 MET A SD    1 
ATOM   3065 C  CE    . MET A 1 398 ? 17.079  -19.440 -44.843 1.00 19.03 ? 449 MET A CE    1 
ATOM   3066 N  N     . ASN A 1 399 ? 21.568  -16.359 -42.629 1.00 18.01 ? 450 ASN A N     1 
ATOM   3067 C  CA    . ASN A 1 399 ? 22.270  -17.051 -41.539 1.00 18.02 ? 450 ASN A CA    1 
ATOM   3068 C  C     . ASN A 1 399 ? 21.727  -16.694 -40.176 1.00 18.00 ? 450 ASN A C     1 
ATOM   3069 O  O     . ASN A 1 399 ? 21.557  -17.566 -39.328 1.00 17.94 ? 450 ASN A O     1 
ATOM   3070 C  CB    . ASN A 1 399 ? 23.761  -16.725 -41.544 1.00 18.02 ? 450 ASN A CB    1 
ATOM   3071 C  CG    . ASN A 1 399 ? 24.467  -17.303 -42.722 1.00 18.26 ? 450 ASN A CG    1 
ATOM   3072 O  OD1   . ASN A 1 399 ? 25.149  -16.591 -43.459 1.00 19.11 ? 450 ASN A OD1   1 
ATOM   3073 N  ND2   . ASN A 1 399 ? 24.308  -18.606 -42.924 1.00 18.54 ? 450 ASN A ND2   1 
ATOM   3074 N  N     . ILE A 1 400 ? 21.479  -15.405 -39.969 1.00 17.95 ? 451 ILE A N     1 
ATOM   3075 C  CA    . ILE A 1 400 ? 20.907  -14.929 -38.719 1.00 18.06 ? 451 ILE A CA    1 
ATOM   3076 C  C     . ILE A 1 400 ? 19.647  -15.746 -38.433 1.00 18.03 ? 451 ILE A C     1 
ATOM   3077 O  O     . ILE A 1 400 ? 19.525  -16.365 -37.376 1.00 18.02 ? 451 ILE A O     1 
ATOM   3078 C  CB    . ILE A 1 400 ? 20.566  -13.415 -38.779 1.00 18.13 ? 451 ILE A CB    1 
ATOM   3079 C  CG1   . ILE A 1 400 ? 21.837  -12.580 -38.954 1.00 18.15 ? 451 ILE A CG1   1 
ATOM   3080 C  CG2   . ILE A 1 400 ? 19.833  -12.969 -37.517 1.00 17.86 ? 451 ILE A CG2   1 
ATOM   3081 C  CD1   . ILE A 1 400 ? 21.557  -11.137 -39.321 1.00 19.02 ? 451 ILE A CD1   1 
ATOM   3082 N  N     . LEU A 1 401 ? 18.740  -15.767 -39.406 1.00 18.04 ? 452 LEU A N     1 
ATOM   3083 C  CA    . LEU A 1 401 ? 17.471  -16.498 -39.289 1.00 18.22 ? 452 LEU A CA    1 
ATOM   3084 C  C     . LEU A 1 401 ? 17.656  -18.001 -39.021 1.00 18.32 ? 452 LEU A C     1 
ATOM   3085 O  O     . LEU A 1 401 ? 16.901  -18.588 -38.245 1.00 18.30 ? 452 LEU A O     1 
ATOM   3086 C  CB    . LEU A 1 401 ? 16.628  -16.303 -40.557 1.00 18.13 ? 452 LEU A CB    1 
ATOM   3087 C  CG    . LEU A 1 401 ? 15.164  -16.744 -40.512 1.00 17.89 ? 452 LEU A CG    1 
ATOM   3088 C  CD1   . LEU A 1 401 ? 14.352  -15.921 -39.503 1.00 17.29 ? 452 LEU A CD1   1 
ATOM   3089 C  CD2   . LEU A 1 401 ? 14.564  -16.640 -41.902 1.00 17.95 ? 452 LEU A CD2   1 
ATOM   3090 N  N     . ASN A 1 402 ? 18.646  -18.614 -39.667 1.00 18.43 ? 453 ASN A N     1 
ATOM   3091 C  CA    . ASN A 1 402 ? 18.918  -20.040 -39.487 1.00 18.51 ? 453 ASN A CA    1 
ATOM   3092 C  C     . ASN A 1 402 ? 19.456  -20.359 -38.089 1.00 18.64 ? 453 ASN A C     1 
ATOM   3093 O  O     . ASN A 1 402 ? 19.128  -21.398 -37.513 1.00 18.67 ? 453 ASN A O     1 
ATOM   3094 C  CB    . ASN A 1 402 ? 19.869  -20.543 -40.578 1.00 18.50 ? 453 ASN A CB    1 
ATOM   3095 C  CG    . ASN A 1 402 ? 19.218  -20.554 -41.955 1.00 18.63 ? 453 ASN A CG    1 
ATOM   3096 O  OD1   . ASN A 1 402 ? 18.126  -20.015 -42.147 1.00 19.89 ? 453 ASN A OD1   1 
ATOM   3097 N  ND2   . ASN A 1 402 ? 19.886  -21.165 -42.918 1.00 18.13 ? 453 ASN A ND2   1 
ATOM   3098 N  N     . ARG A 1 403 ? 20.251  -19.449 -37.534 1.00 18.84 ? 454 ARG A N     1 
ATOM   3099 C  CA    . ARG A 1 403 ? 20.757  -19.602 -36.170 1.00 18.98 ? 454 ARG A CA    1 
ATOM   3100 C  C     . ARG A 1 403 ? 19.652  -19.436 -35.145 1.00 18.68 ? 454 ARG A C     1 
ATOM   3101 O  O     . ARG A 1 403 ? 19.651  -20.103 -34.114 1.00 18.70 ? 454 ARG A O     1 
ATOM   3102 C  CB    . ARG A 1 403 ? 21.873  -18.598 -35.891 1.00 19.29 ? 454 ARG A CB    1 
ATOM   3103 C  CG    . ARG A 1 403 ? 23.027  -18.755 -36.842 1.00 19.97 ? 454 ARG A CG    1 
ATOM   3104 C  CD    . ARG A 1 403 ? 24.380  -18.560 -36.193 1.00 21.45 ? 454 ARG A CD    1 
ATOM   3105 N  NE    . ARG A 1 403 ? 25.381  -19.560 -36.597 1.00 23.07 ? 454 ARG A NE    1 
ATOM   3106 C  CZ    . ARG A 1 403 ? 25.613  -20.015 -37.837 1.00 23.91 ? 454 ARG A CZ    1 
ATOM   3107 N  NH1   . ARG A 1 403 ? 24.941  -19.575 -38.906 1.00 24.31 ? 454 ARG A NH1   1 
ATOM   3108 N  NH2   . ARG A 1 403 ? 26.564  -20.928 -38.014 1.00 24.38 ? 454 ARG A NH2   1 
ATOM   3109 N  N     . ILE A 1 404 ? 18.717  -18.539 -35.429 1.00 18.49 ? 455 ILE A N     1 
ATOM   3110 C  CA    . ILE A 1 404 ? 17.532  -18.384 -34.597 1.00 18.40 ? 455 ILE A CA    1 
ATOM   3111 C  C     . ILE A 1 404 ? 16.716  -19.662 -34.652 1.00 18.59 ? 455 ILE A C     1 
ATOM   3112 O  O     . ILE A 1 404 ? 16.245  -20.168 -33.635 1.00 18.85 ? 455 ILE A O     1 
ATOM   3113 C  CB    . ILE A 1 404 ? 16.648  -17.226 -35.084 1.00 18.31 ? 455 ILE A CB    1 
ATOM   3114 C  CG1   . ILE A 1 404 ? 17.365  -15.885 -34.898 1.00 17.88 ? 455 ILE A CG1   1 
ATOM   3115 C  CG2   . ILE A 1 404 ? 15.308  -17.233 -34.341 1.00 18.13 ? 455 ILE A CG2   1 
ATOM   3116 C  CD1   . ILE A 1 404 ? 16.695  -14.736 -35.604 1.00 17.46 ? 455 ILE A CD1   1 
ATOM   3117 N  N     . GLN A 1 405 ? 16.562  -20.176 -35.864 1.00 18.74 ? 456 GLN A N     1 
ATOM   3118 C  CA    . GLN A 1 405 ? 15.762  -21.363 -36.120 1.00 18.83 ? 456 GLN A CA    1 
ATOM   3119 C  C     . GLN A 1 405 ? 16.191  -22.540 -35.263 1.00 18.99 ? 456 GLN A C     1 
ATOM   3120 O  O     . GLN A 1 405 ? 15.348  -23.301 -34.805 1.00 19.05 ? 456 GLN A O     1 
ATOM   3121 C  CB    . GLN A 1 405 ? 15.879  -21.756 -37.587 1.00 18.84 ? 456 GLN A CB    1 
ATOM   3122 C  CG    . GLN A 1 405 ? 14.561  -21.899 -38.292 1.00 19.00 ? 456 GLN A CG    1 
ATOM   3123 C  CD    . GLN A 1 405 ? 14.743  -22.268 -39.745 1.00 19.40 ? 456 GLN A CD    1 
ATOM   3124 O  OE1   . GLN A 1 405 ? 14.015  -23.102 -40.280 1.00 19.66 ? 456 GLN A OE1   1 
ATOM   3125 N  NE2   . GLN A 1 405 ? 15.731  -21.654 -40.394 1.00 19.67 ? 456 GLN A NE2   1 
ATOM   3126 N  N     . GLU A 1 406 ? 17.497  -22.698 -35.066 1.00 19.27 ? 457 GLU A N     1 
ATOM   3127 C  CA    . GLU A 1 406 ? 18.026  -23.820 -34.292 1.00 19.60 ? 457 GLU A CA    1 
ATOM   3128 C  C     . GLU A 1 406 ? 18.383  -23.439 -32.850 1.00 19.43 ? 457 GLU A C     1 
ATOM   3129 O  O     . GLU A 1 406 ? 18.770  -24.296 -32.050 1.00 19.38 ? 457 GLU A O     1 
ATOM   3130 C  CB    . GLU A 1 406 ? 19.222  -24.459 -35.016 1.00 19.95 ? 457 GLU A CB    1 
ATOM   3131 C  CG    . GLU A 1 406 ? 18.856  -25.133 -36.363 1.00 20.83 ? 457 GLU A CG    1 
ATOM   3132 C  CD    . GLU A 1 406 ? 17.740  -26.187 -36.244 1.00 21.91 ? 457 GLU A CD    1 
ATOM   3133 O  OE1   . GLU A 1 406 ? 17.796  -27.024 -35.306 1.00 21.94 ? 457 GLU A OE1   1 
ATOM   3134 O  OE2   . GLU A 1 406 ? 16.811  -26.175 -37.093 1.00 22.12 ? 457 GLU A OE2   1 
ATOM   3135 N  N     . HIS A 1 407 ? 18.254  -22.157 -32.521 1.00 19.23 ? 458 HIS A N     1 
ATOM   3136 C  CA    . HIS A 1 407 ? 18.167  -21.750 -31.123 1.00 19.08 ? 458 HIS A CA    1 
ATOM   3137 C  C     . HIS A 1 407 ? 16.884  -22.336 -30.558 1.00 19.07 ? 458 HIS A C     1 
ATOM   3138 O  O     . HIS A 1 407 ? 16.916  -23.065 -29.575 1.00 18.99 ? 458 HIS A O     1 
ATOM   3139 C  CB    . HIS A 1 407 ? 18.136  -20.231 -30.974 1.00 18.87 ? 458 HIS A CB    1 
ATOM   3140 C  CG    . HIS A 1 407 ? 17.951  -19.776 -29.564 1.00 18.55 ? 458 HIS A CG    1 
ATOM   3141 N  ND1   . HIS A 1 407 ? 18.974  -19.781 -28.642 1.00 18.33 ? 458 HIS A ND1   1 
ATOM   3142 C  CD2   . HIS A 1 407 ? 16.861  -19.307 -28.914 1.00 18.70 ? 458 HIS A CD2   1 
ATOM   3143 C  CE1   . HIS A 1 407 ? 18.525  -19.328 -27.486 1.00 18.06 ? 458 HIS A CE1   1 
ATOM   3144 N  NE2   . HIS A 1 407 ? 17.244  -19.037 -27.623 1.00 18.32 ? 458 HIS A NE2   1 
ATOM   3145 N  N     . PHE A 1 408 ? 15.769  -22.016 -31.216 1.00 19.10 ? 459 PHE A N     1 
ATOM   3146 C  CA    . PHE A 1 408 ? 14.443  -22.472 -30.807 1.00 19.25 ? 459 PHE A CA    1 
ATOM   3147 C  C     . PHE A 1 408 ? 14.100  -23.852 -31.347 1.00 19.38 ? 459 PHE A C     1 
ATOM   3148 O  O     . PHE A 1 408 ? 13.129  -24.458 -30.904 1.00 19.31 ? 459 PHE A O     1 
ATOM   3149 C  CB    . PHE A 1 408 ? 13.368  -21.483 -31.277 1.00 19.29 ? 459 PHE A CB    1 
ATOM   3150 C  CG    . PHE A 1 408 ? 13.441  -20.141 -30.603 1.00 19.19 ? 459 PHE A CG    1 
ATOM   3151 C  CD1   . PHE A 1 408 ? 12.997  -19.988 -29.298 1.00 19.18 ? 459 PHE A CD1   1 
ATOM   3152 C  CD2   . PHE A 1 408 ? 13.952  -19.031 -31.271 1.00 18.81 ? 459 PHE A CD2   1 
ATOM   3153 C  CE1   . PHE A 1 408 ? 13.065  -18.753 -28.666 1.00 19.22 ? 459 PHE A CE1   1 
ATOM   3154 C  CE2   . PHE A 1 408 ? 14.019  -17.792 -30.646 1.00 18.31 ? 459 PHE A CE2   1 
ATOM   3155 C  CZ    . PHE A 1 408 ? 13.580  -17.653 -29.344 1.00 18.53 ? 459 PHE A CZ    1 
ATOM   3156 N  N     . ASN A 1 409 ? 14.877  -24.332 -32.315 1.00 19.62 ? 460 ASN A N     1 
ATOM   3157 C  CA    . ASN A 1 409 ? 14.634  -25.623 -32.946 1.00 19.81 ? 460 ASN A CA    1 
ATOM   3158 C  C     . ASN A 1 409 ? 13.252  -25.710 -33.619 1.00 20.16 ? 460 ASN A C     1 
ATOM   3159 O  O     . ASN A 1 409 ? 12.609  -26.762 -33.603 1.00 20.06 ? 460 ASN A O     1 
ATOM   3160 C  CB    . ASN A 1 409 ? 14.811  -26.743 -31.917 1.00 19.79 ? 460 ASN A CB    1 
ATOM   3161 C  CG    . ASN A 1 409 ? 14.997  -28.100 -32.555 1.00 19.91 ? 460 ASN A CG    1 
ATOM   3162 O  OD1   . ASN A 1 409 ? 15.191  -28.219 -33.769 1.00 20.18 ? 460 ASN A OD1   1 
ATOM   3163 N  ND2   . ASN A 1 409 ? 14.939  -29.137 -31.737 1.00 19.97 ? 460 ASN A ND2   1 
ATOM   3164 N  N     . LYS A 1 410 ? 12.822  -24.605 -34.230 1.00 20.64 ? 461 LYS A N     1 
ATOM   3165 C  CA    . LYS A 1 410 ? 11.493  -24.490 -34.838 1.00 21.09 ? 461 LYS A CA    1 
ATOM   3166 C  C     . LYS A 1 410 ? 11.627  -23.986 -36.271 1.00 21.36 ? 461 LYS A C     1 
ATOM   3167 O  O     . LYS A 1 410 ? 11.794  -22.788 -36.498 1.00 21.59 ? 461 LYS A O     1 
ATOM   3168 C  CB    . LYS A 1 410 ? 10.639  -23.519 -34.017 1.00 21.18 ? 461 LYS A CB    1 
ATOM   3169 C  CG    . LYS A 1 410 ? 9.223   -23.257 -34.557 1.00 21.92 ? 461 LYS A CG    1 
ATOM   3170 C  CD    . LYS A 1 410 ? 8.164   -24.134 -33.877 1.00 23.13 ? 461 LYS A CD    1 
ATOM   3171 C  CE    . LYS A 1 410 ? 6.747   -23.579 -34.065 1.00 23.18 ? 461 LYS A CE    1 
ATOM   3172 N  NZ    . LYS A 1 410 ? 6.290   -23.695 -35.480 1.00 23.30 ? 461 LYS A NZ    1 
ATOM   3173 N  N     . LYS A 1 411 ? 11.533  -24.899 -37.232 1.00 21.78 ? 462 LYS A N     1 
ATOM   3174 C  CA    . LYS A 1 411 ? 11.797  -24.586 -38.640 1.00 22.15 ? 462 LYS A CA    1 
ATOM   3175 C  C     . LYS A 1 411 ? 10.859  -23.494 -39.144 1.00 22.32 ? 462 LYS A C     1 
ATOM   3176 O  O     . LYS A 1 411 ? 9.733   -23.383 -38.661 1.00 22.49 ? 462 LYS A O     1 
ATOM   3177 C  CB    . LYS A 1 411 ? 11.652  -25.845 -39.504 1.00 22.33 ? 462 LYS A CB    1 
ATOM   3178 C  CG    . LYS A 1 411 ? 12.299  -25.743 -40.881 1.00 22.94 ? 462 LYS A CG    1 
ATOM   3179 C  CD    . LYS A 1 411 ? 12.143  -27.042 -41.668 1.00 23.67 ? 462 LYS A CD    1 
ATOM   3180 C  CE    . LYS A 1 411 ? 13.098  -27.108 -42.856 1.00 24.10 ? 462 LYS A CE    1 
ATOM   3181 N  NZ    . LYS A 1 411 ? 13.023  -25.886 -43.711 1.00 24.75 ? 462 LYS A NZ    1 
ATOM   3182 N  N     . ILE A 1 412 ? 11.325  -22.692 -40.105 1.00 22.44 ? 463 ILE A N     1 
ATOM   3183 C  CA    . ILE A 1 412 ? 10.556  -21.552 -40.630 1.00 22.45 ? 463 ILE A CA    1 
ATOM   3184 C  C     . ILE A 1 412 ? 10.321  -21.710 -42.129 1.00 22.71 ? 463 ILE A C     1 
ATOM   3185 O  O     . ILE A 1 412 ? 11.274  -21.744 -42.892 1.00 22.73 ? 463 ILE A O     1 
ATOM   3186 C  CB    . ILE A 1 412 ? 11.291  -20.223 -40.400 1.00 22.30 ? 463 ILE A CB    1 
ATOM   3187 C  CG1   . ILE A 1 412 ? 11.483  -19.956 -38.906 1.00 21.71 ? 463 ILE A CG1   1 
ATOM   3188 C  CG2   . ILE A 1 412 ? 10.520  -19.079 -41.037 1.00 22.43 ? 463 ILE A CG2   1 
ATOM   3189 C  CD1   . ILE A 1 412 ? 12.365  -18.764 -38.621 1.00 20.40 ? 463 ILE A CD1   1 
ATOM   3190 N  N     . GLU A 1 413 ? 9.057   -21.795 -42.544 1.00 23.11 ? 464 GLU A N     1 
ATOM   3191 C  CA    . GLU A 1 413 ? 8.715   -22.057 -43.948 1.00 23.44 ? 464 GLU A CA    1 
ATOM   3192 C  C     . GLU A 1 413 ? 9.117   -20.920 -44.887 1.00 23.92 ? 464 GLU A C     1 
ATOM   3193 O  O     . GLU A 1 413 ? 9.149   -19.760 -44.488 1.00 23.71 ? 464 GLU A O     1 
ATOM   3194 C  CB    . GLU A 1 413 ? 7.209   -22.292 -44.114 1.00 23.44 ? 464 GLU A CB    1 
ATOM   3195 C  CG    . GLU A 1 413 ? 6.732   -23.720 -43.914 1.00 23.30 ? 464 GLU A CG    1 
ATOM   3196 C  CD    . GLU A 1 413 ? 5.499   -24.029 -44.753 1.00 23.19 ? 464 GLU A CD    1 
ATOM   3197 O  OE1   . GLU A 1 413 ? 4.369   -23.965 -44.224 1.00 22.77 ? 464 GLU A OE1   1 
ATOM   3198 O  OE2   . GLU A 1 413 ? 5.659   -24.318 -45.957 1.00 23.97 ? 464 GLU A OE2   1 
ATOM   3199 N  N     . ARG A 1 414 ? 9.405   -21.273 -46.140 1.00 24.65 ? 465 ARG A N     1 
ATOM   3200 C  CA    . ARG A 1 414 ? 9.631   -20.293 -47.200 1.00 25.26 ? 465 ARG A CA    1 
ATOM   3201 C  C     . ARG A 1 414 ? 8.296   -19.962 -47.876 1.00 25.41 ? 465 ARG A C     1 
ATOM   3202 O  O     . ARG A 1 414 ? 7.450   -20.843 -48.060 1.00 25.17 ? 465 ARG A O     1 
ATOM   3203 C  CB    . ARG A 1 414 ? 10.628  -20.844 -48.223 1.00 25.59 ? 465 ARG A CB    1 
ATOM   3204 C  CG    . ARG A 1 414 ? 11.075  -19.846 -49.307 1.00 26.73 ? 465 ARG A CG    1 
ATOM   3205 C  CD    . ARG A 1 414 ? 11.661  -20.573 -50.527 1.00 28.53 ? 465 ARG A CD    1 
ATOM   3206 N  NE    . ARG A 1 414 ? 11.731  -19.722 -51.719 1.00 30.04 ? 465 ARG A NE    1 
ATOM   3207 C  CZ    . ARG A 1 414 ? 10.690  -19.381 -52.486 1.00 31.27 ? 465 ARG A CZ    1 
ATOM   3208 N  NH1   . ARG A 1 414 ? 9.457   -19.797 -52.200 1.00 31.56 ? 465 ARG A NH1   1 
ATOM   3209 N  NH2   . ARG A 1 414 ? 10.880  -18.602 -53.548 1.00 31.41 ? 465 ARG A NH2   1 
ATOM   3210 N  N     . LEU A 1 415 ? 8.118   -18.690 -48.240 1.00 25.71 ? 466 LEU A N     1 
ATOM   3211 C  CA    . LEU A 1 415 ? 6.877   -18.206 -48.852 1.00 25.97 ? 466 LEU A CA    1 
ATOM   3212 C  C     . LEU A 1 415 ? 7.124   -17.656 -50.267 1.00 26.32 ? 466 LEU A C     1 
ATOM   3213 O  O     . LEU A 1 415 ? 7.997   -16.800 -50.465 1.00 26.53 ? 466 LEU A O     1 
ATOM   3214 C  CB    . LEU A 1 415 ? 6.257   -17.123 -47.964 1.00 25.87 ? 466 LEU A CB    1 
ATOM   3215 C  CG    . LEU A 1 415 ? 4.792   -16.747 -48.207 1.00 25.69 ? 466 LEU A CG    1 
ATOM   3216 C  CD1   . LEU A 1 415 ? 3.875   -17.960 -48.135 1.00 25.36 ? 466 LEU A CD1   1 
ATOM   3217 C  CD2   . LEU A 1 415 ? 4.353   -15.697 -47.201 1.00 25.12 ? 466 LEU A CD2   1 
ATOM   3218 N  N     . ASP A 1 416 ? 6.353   -18.152 -51.239 1.00 26.64 ? 467 ASP A N     1 
ATOM   3219 C  CA    . ASP A 1 416 ? 6.479   -17.741 -52.653 1.00 26.81 ? 467 ASP A CA    1 
ATOM   3220 C  C     . ASP A 1 416 ? 6.112   -16.264 -52.852 1.00 26.82 ? 467 ASP A C     1 
ATOM   3221 O  O     . ASP A 1 416 ? 5.073   -15.929 -53.431 1.00 26.86 ? 467 ASP A O     1 
ATOM   3222 C  CB    . ASP A 1 416 ? 5.608   -18.628 -53.568 1.00 26.87 ? 467 ASP A CB    1 
ATOM   3223 C  CG    . ASP A 1 416 ? 6.275   -19.954 -53.931 1.00 27.19 ? 467 ASP A CG    1 
ATOM   3224 O  OD1   . ASP A 1 416 ? 7.392   -19.927 -54.500 1.00 27.57 ? 467 ASP A OD1   1 
ATOM   3225 O  OD2   . ASP A 1 416 ? 5.666   -21.021 -53.675 1.00 27.35 ? 467 ASP A OD2   1 
ATOM   3226 O  OP3   . U   B 2 1   ? 24.472  4.291   -34.905 1.00 49.82 ? 1   U   E OP3   1 
ATOM   3227 P  P     . U   B 2 1   ? 23.567  4.612   -33.766 1.00 49.63 ? 1   U   E P     1 
ATOM   3228 O  OP1   . U   B 2 1   ? 22.868  5.877   -34.118 1.00 48.89 ? 1   U   E OP1   1 
ATOM   3229 O  OP2   . U   B 2 1   ? 24.358  4.534   -32.508 1.00 49.18 ? 1   U   E OP2   1 
ATOM   3230 O  "O5'" . U   B 2 1   ? 22.477  3.441   -33.649 1.00 46.38 ? 1   U   E "O5'" 1 
ATOM   3231 C  "C5'" . U   B 2 1   ? 22.388  2.399   -34.621 1.00 43.24 ? 1   U   E "C5'" 1 
ATOM   3232 C  "C4'" . U   B 2 1   ? 21.557  1.226   -34.121 1.00 40.74 ? 1   U   E "C4'" 1 
ATOM   3233 O  "O4'" . U   B 2 1   ? 22.410  0.304   -33.394 1.00 40.77 ? 1   U   E "O4'" 1 
ATOM   3234 C  "C3'" . U   B 2 1   ? 20.436  1.527   -33.133 1.00 38.17 ? 1   U   E "C3'" 1 
ATOM   3235 O  "O3'" . U   B 2 1   ? 19.287  2.055   -33.797 1.00 33.31 ? 1   U   E "O3'" 1 
ATOM   3236 C  "C2'" . U   B 2 1   ? 20.230  0.126   -32.580 1.00 39.09 ? 1   U   E "C2'" 1 
ATOM   3237 O  "O2'" . U   B 2 1   ? 19.628  -0.754  -33.507 1.00 38.88 ? 1   U   E "O2'" 1 
ATOM   3238 C  "C1'" . U   B 2 1   ? 21.676  -0.283  -32.336 1.00 40.29 ? 1   U   E "C1'" 1 
ATOM   3239 N  N1    . U   B 2 1   ? 22.236  0.145   -31.006 1.00 41.33 ? 1   U   E N1    1 
ATOM   3240 C  C2    . U   B 2 1   ? 21.885  -0.581  -29.877 1.00 41.73 ? 1   U   E C2    1 
ATOM   3241 O  O2    . U   B 2 1   ? 21.141  -1.545  -29.909 1.00 41.66 ? 1   U   E O2    1 
ATOM   3242 N  N3    . U   B 2 1   ? 22.437  -0.135  -28.699 1.00 41.80 ? 1   U   E N3    1 
ATOM   3243 C  C4    . U   B 2 1   ? 23.291  0.944   -28.536 1.00 42.24 ? 1   U   E C4    1 
ATOM   3244 O  O4    . U   B 2 1   ? 23.712  1.228   -27.416 1.00 42.78 ? 1   U   E O4    1 
ATOM   3245 C  C5    . U   B 2 1   ? 23.616  1.658   -29.751 1.00 42.14 ? 1   U   E C5    1 
ATOM   3246 C  C6    . U   B 2 1   ? 23.089  1.238   -30.912 1.00 41.91 ? 1   U   E C6    1 
ATOM   3247 P  P     . U   B 2 2   ? 18.419  3.276   -33.221 1.00 28.82 ? 2   U   E P     1 
ATOM   3248 O  OP1   . U   B 2 2   ? 17.662  3.826   -34.358 1.00 29.96 ? 2   U   E OP1   1 
ATOM   3249 O  OP2   . U   B 2 2   ? 19.235  4.190   -32.403 1.00 28.65 ? 2   U   E OP2   1 
ATOM   3250 O  "O5'" . U   B 2 2   ? 17.406  2.546   -32.226 1.00 27.66 ? 2   U   E "O5'" 1 
ATOM   3251 C  "C5'" . U   B 2 2   ? 16.632  1.422   -32.630 1.00 25.13 ? 2   U   E "C5'" 1 
ATOM   3252 C  "C4'" . U   B 2 2   ? 16.024  0.710   -31.434 1.00 23.99 ? 2   U   E "C4'" 1 
ATOM   3253 O  "O4'" . U   B 2 2   ? 17.061  0.024   -30.686 1.00 23.36 ? 2   U   E "O4'" 1 
ATOM   3254 C  "C3'" . U   B 2 2   ? 15.350  1.576   -30.380 1.00 23.13 ? 2   U   E "C3'" 1 
ATOM   3255 O  "O3'" . U   B 2 2   ? 14.053  2.017   -30.786 1.00 21.66 ? 2   U   E "O3'" 1 
ATOM   3256 C  "C2'" . U   B 2 2   ? 15.310  0.608   -29.205 1.00 22.82 ? 2   U   E "C2'" 1 
ATOM   3257 O  "O2'" . U   B 2 2   ? 14.279  -0.348  -29.307 1.00 21.41 ? 2   U   E "O2'" 1 
ATOM   3258 C  "C1'" . U   B 2 2   ? 16.674  -0.060  -29.325 1.00 23.49 ? 2   U   E "C1'" 1 
ATOM   3259 N  N1    . U   B 2 2   ? 17.711  0.591   -28.480 1.00 24.27 ? 2   U   E N1    1 
ATOM   3260 C  C2    . U   B 2 2   ? 17.864  0.193   -27.166 1.00 24.64 ? 2   U   E C2    1 
ATOM   3261 O  O2    . U   B 2 2   ? 17.193  -0.676  -26.628 1.00 24.30 ? 2   U   E O2    1 
ATOM   3262 N  N3    . U   B 2 2   ? 18.854  0.863   -26.490 1.00 25.07 ? 2   U   E N3    1 
ATOM   3263 C  C4    . U   B 2 2   ? 19.682  1.857   -26.981 1.00 25.46 ? 2   U   E C4    1 
ATOM   3264 O  O4    . U   B 2 2   ? 20.526  2.371   -26.255 1.00 26.61 ? 2   U   E O4    1 
ATOM   3265 C  C5    . U   B 2 2   ? 19.459  2.216   -28.352 1.00 25.23 ? 2   U   E C5    1 
ATOM   3266 C  C6    . U   B 2 2   ? 18.504  1.582   -29.030 1.00 24.93 ? 2   U   E C6    1 
ATOM   3267 P  P     . U   B 2 3   ? 13.324  3.193   -29.980 1.00 20.72 ? 3   U   E P     1 
ATOM   3268 O  OP1   . U   B 2 3   ? 12.098  3.573   -30.721 1.00 22.46 ? 3   U   E OP1   1 
ATOM   3269 O  OP2   . U   B 2 3   ? 14.307  4.246   -29.664 1.00 21.14 ? 3   U   E OP2   1 
ATOM   3270 O  "O5'" . U   B 2 3   ? 12.906  2.467   -28.627 1.00 20.42 ? 3   U   E "O5'" 1 
ATOM   3271 C  "C5'" . U   B 2 3   ? 12.607  3.228   -27.458 1.00 19.83 ? 3   U   E "C5'" 1 
ATOM   3272 C  "C4'" . U   B 2 3   ? 12.933  2.396   -26.237 1.00 18.67 ? 3   U   E "C4'" 1 
ATOM   3273 O  "O4'" . U   B 2 3   ? 14.319  2.012   -26.307 1.00 17.94 ? 3   U   E "O4'" 1 
ATOM   3274 C  "C3'" . U   B 2 3   ? 12.844  3.090   -24.893 1.00 18.42 ? 3   U   E "C3'" 1 
ATOM   3275 O  "O3'" . U   B 2 3   ? 11.517  3.178   -24.447 1.00 17.64 ? 3   U   E "O3'" 1 
ATOM   3276 C  "C2'" . U   B 2 3   ? 13.679  2.158   -24.033 1.00 18.58 ? 3   U   E "C2'" 1 
ATOM   3277 O  "O2'" . U   B 2 3   ? 12.975  0.990   -23.657 1.00 18.54 ? 3   U   E "O2'" 1 
ATOM   3278 C  "C1'" . U   B 2 3   ? 14.832  1.850   -24.991 1.00 18.55 ? 3   U   E "C1'" 1 
ATOM   3279 N  N1    . U   B 2 3   ? 16.058  2.714   -24.814 1.00 18.44 ? 3   U   E N1    1 
ATOM   3280 C  C2    . U   B 2 3   ? 16.775  2.606   -23.644 1.00 19.00 ? 3   U   E C2    1 
ATOM   3281 O  O2    . U   B 2 3   ? 16.461  1.858   -22.738 1.00 20.32 ? 3   U   E O2    1 
ATOM   3282 N  N3    . U   B 2 3   ? 17.876  3.412   -23.557 1.00 19.04 ? 3   U   E N3    1 
ATOM   3283 C  C4    . U   B 2 3   ? 18.329  4.296   -24.517 1.00 19.44 ? 3   U   E C4    1 
ATOM   3284 O  O4    . U   B 2 3   ? 19.336  4.960   -24.301 1.00 20.85 ? 3   U   E O4    1 
ATOM   3285 C  C5    . U   B 2 3   ? 17.535  4.362   -25.716 1.00 18.80 ? 3   U   E C5    1 
ATOM   3286 C  C6    . U   B 2 3   ? 16.457  3.584   -25.815 1.00 18.42 ? 3   U   E C6    1 
ATOM   3287 P  P     . U   B 2 4   ? 10.964  4.603   -23.997 1.00 17.01 ? 4   U   E P     1 
ATOM   3288 O  OP1   . U   B 2 4   ? 9.529   4.441   -23.677 1.00 18.51 ? 4   U   E OP1   1 
ATOM   3289 O  OP2   . U   B 2 4   ? 11.367  5.601   -25.015 1.00 17.12 ? 4   U   E OP2   1 
ATOM   3290 O  "O5'" . U   B 2 4   ? 11.738  4.872   -22.637 1.00 16.70 ? 4   U   E "O5'" 1 
ATOM   3291 C  "C5'" . U   B 2 4   ? 11.519  3.990   -21.550 1.00 17.79 ? 4   U   E "C5'" 1 
ATOM   3292 C  "C4'" . U   B 2 4   ? 12.579  4.136   -20.476 1.00 18.02 ? 4   U   E "C4'" 1 
ATOM   3293 O  "O4'" . U   B 2 4   ? 13.859  3.672   -20.973 1.00 17.38 ? 4   U   E "O4'" 1 
ATOM   3294 C  "C3'" . U   B 2 4   ? 12.847  5.554   -19.995 1.00 18.56 ? 4   U   E "C3'" 1 
ATOM   3295 O  "O3'" . U   B 2 4   ? 11.899  5.944   -19.009 1.00 20.91 ? 4   U   E "O3'" 1 
ATOM   3296 C  "C2'" . U   B 2 4   ? 14.233  5.375   -19.415 1.00 17.79 ? 4   U   E "C2'" 1 
ATOM   3297 O  "O2'" . U   B 2 4   ? 14.191  4.723   -18.164 1.00 18.35 ? 4   U   E "O2'" 1 
ATOM   3298 C  "C1'" . U   B 2 4   ? 14.889  4.498   -20.475 1.00 17.02 ? 4   U   E "C1'" 1 
ATOM   3299 N  N1    . U   B 2 4   ? 15.512  5.316   -21.564 1.00 15.98 ? 4   U   E N1    1 
ATOM   3300 C  C2    . U   B 2 4   ? 16.822  5.719   -21.417 1.00 15.18 ? 4   U   E C2    1 
ATOM   3301 O  O2    . U   B 2 4   ? 17.492  5.418   -20.452 1.00 13.44 ? 4   U   E O2    1 
ATOM   3302 N  N3    . U   B 2 4   ? 17.318  6.483   -22.454 1.00 15.80 ? 4   U   E N3    1 
ATOM   3303 C  C4    . U   B 2 4   ? 16.635  6.885   -23.602 1.00 16.23 ? 4   U   E C4    1 
ATOM   3304 O  O4    . U   B 2 4   ? 17.196  7.566   -24.457 1.00 16.10 ? 4   U   E O4    1 
ATOM   3305 C  C5    . U   B 2 4   ? 15.269  6.429   -23.691 1.00 15.67 ? 4   U   E C5    1 
ATOM   3306 C  C6    . U   B 2 4   ? 14.782  5.685   -22.687 1.00 16.17 ? 4   U   E C6    1 
ATOM   3307 P  P     . U   B 2 5   ? 11.403  7.455   -18.948 1.00 22.82 ? 5   U   E P     1 
ATOM   3308 O  OP1   . U   B 2 5   ? 10.528  7.611   -17.764 1.00 22.76 ? 5   U   E OP1   1 
ATOM   3309 O  OP2   . U   B 2 5   ? 10.900  7.823   -20.292 1.00 21.29 ? 5   U   E OP2   1 
ATOM   3310 O  "O5'" . U   B 2 5   ? 12.784  8.214   -18.673 1.00 24.53 ? 5   U   E "O5'" 1 
ATOM   3311 C  "C5'" . U   B 2 5   ? 12.866  9.612   -18.876 1.00 27.56 ? 5   U   E "C5'" 1 
ATOM   3312 C  "C4'" . U   B 2 5   ? 12.756  10.369  -17.568 1.00 29.58 ? 5   U   E "C4'" 1 
ATOM   3313 O  "O4'" . U   B 2 5   ? 13.721  9.846   -16.624 1.00 30.79 ? 5   U   E "O4'" 1 
ATOM   3314 C  "C3'" . U   B 2 5   ? 13.099  11.842  -17.682 1.00 31.31 ? 5   U   E "C3'" 1 
ATOM   3315 O  "O3'" . U   B 2 5   ? 11.938  12.586  -18.030 1.00 33.43 ? 5   U   E "O3'" 1 
ATOM   3316 C  "C2'" . U   B 2 5   ? 13.610  12.189  -16.292 1.00 31.46 ? 5   U   E "C2'" 1 
ATOM   3317 O  "O2'" . U   B 2 5   ? 12.558  12.615  -15.452 1.00 31.95 ? 5   U   E "O2'" 1 
ATOM   3318 C  "C1'" . U   B 2 5   ? 14.194  10.873  -15.778 1.00 31.38 ? 5   U   E "C1'" 1 
ATOM   3319 N  N1    . U   B 2 5   ? 15.694  10.785  -15.747 1.00 32.43 ? 5   U   E N1    1 
ATOM   3320 C  C2    . U   B 2 5   ? 16.321  10.313  -14.605 1.00 33.26 ? 5   U   E C2    1 
ATOM   3321 O  O2    . U   B 2 5   ? 15.734  9.961   -13.602 1.00 34.18 ? 5   U   E O2    1 
ATOM   3322 N  N3    . U   B 2 5   ? 17.687  10.257  -14.659 1.00 33.35 ? 5   U   E N3    1 
ATOM   3323 C  C4    . U   B 2 5   ? 18.486  10.614  -15.722 1.00 33.25 ? 5   U   E C4    1 
ATOM   3324 O  O4    . U   B 2 5   ? 19.702  10.499  -15.604 1.00 33.83 ? 5   U   E O4    1 
ATOM   3325 C  C5    . U   B 2 5   ? 17.778  11.095  -16.884 1.00 32.58 ? 5   U   E C5    1 
ATOM   3326 C  C6    . U   B 2 5   ? 16.439  11.159  -16.852 1.00 32.58 ? 5   U   E C6    1 
ATOM   3327 P  P     . U   B 2 6   ? 12.065  13.975  -18.814 1.00 35.68 ? 6   U   E P     1 
ATOM   3328 O  OP1   . U   B 2 6   ? 10.767  14.247  -19.470 1.00 35.24 ? 6   U   E OP1   1 
ATOM   3329 O  OP2   . U   B 2 6   ? 13.305  13.948  -19.629 1.00 34.51 ? 6   U   E OP2   1 
ATOM   3330 O  "O5'" . U   B 2 6   ? 12.244  14.997  -17.591 1.00 39.61 ? 6   U   E "O5'" 1 
ATOM   3331 C  "C5'" . U   B 2 6   ? 12.694  16.338  -17.790 1.00 43.52 ? 6   U   E "C5'" 1 
ATOM   3332 C  "C4'" . U   B 2 6   ? 12.892  17.052  -16.461 1.00 46.26 ? 6   U   E "C4'" 1 
ATOM   3333 O  "O4'" . U   B 2 6   ? 11.606  17.266  -15.816 1.00 47.26 ? 6   U   E "O4'" 1 
ATOM   3334 C  "C3'" . U   B 2 6   ? 13.740  16.313  -15.422 1.00 48.23 ? 6   U   E "C3'" 1 
ATOM   3335 O  "O3'" . U   B 2 6   ? 14.801  17.153  -14.972 1.00 51.27 ? 6   U   E "O3'" 1 
ATOM   3336 C  "C2'" . U   B 2 6   ? 12.750  15.975  -14.301 1.00 47.89 ? 6   U   E "C2'" 1 
ATOM   3337 O  "O2'" . U   B 2 6   ? 13.302  15.903  -13.002 1.00 47.74 ? 6   U   E "O2'" 1 
ATOM   3338 C  "C1'" . U   B 2 6   ? 11.807  17.164  -14.421 1.00 47.84 ? 6   U   E "C1'" 1 
ATOM   3339 N  N1    . U   B 2 6   ? 10.487  17.044  -13.707 1.00 48.48 ? 6   U   E N1    1 
ATOM   3340 C  C2    . U   B 2 6   ? 9.638   15.995  -14.013 1.00 48.78 ? 6   U   E C2    1 
ATOM   3341 O  O2    . U   B 2 6   ? 9.887   15.137  -14.834 1.00 49.04 ? 6   U   E O2    1 
ATOM   3342 N  N3    . U   B 2 6   ? 8.458   15.971  -13.315 1.00 48.99 ? 6   U   E N3    1 
ATOM   3343 C  C4    . U   B 2 6   ? 8.040   16.876  -12.359 1.00 48.99 ? 6   U   E C4    1 
ATOM   3344 O  O4    . U   B 2 6   ? 6.944   16.706  -11.831 1.00 48.92 ? 6   U   E O4    1 
ATOM   3345 C  C5    . U   B 2 6   ? 8.969   17.954  -12.085 1.00 48.65 ? 6   U   E C5    1 
ATOM   3346 C  C6    . U   B 2 6   ? 10.130  17.994  -12.757 1.00 48.55 ? 6   U   E C6    1 
ATOM   3347 P  P     . U   B 2 7   ? 16.344  16.793  -15.243 1.00 54.76 ? 7   U   E P     1 
ATOM   3348 O  OP1   . U   B 2 7   ? 16.784  17.719  -16.316 1.00 54.99 ? 7   U   E OP1   1 
ATOM   3349 O  OP2   . U   B 2 7   ? 16.501  15.324  -15.419 1.00 54.39 ? 7   U   E OP2   1 
ATOM   3350 O  "O5'" . U   B 2 7   ? 17.056  17.216  -13.863 1.00 54.96 ? 7   U   E "O5'" 1 
HETATM 3351 P  PG    . ANP C 3 .   ? 3.844   -10.928 -23.288 1.00 10.76 ? 1   ANP A PG    1 
HETATM 3352 O  O1G   . ANP C 3 .   ? 3.752   -9.731  -22.375 1.00 10.88 ? 1   ANP A O1G   1 
HETATM 3353 O  O2G   . ANP C 3 .   ? 5.115   -11.744 -23.151 1.00 12.17 ? 1   ANP A O2G   1 
HETATM 3354 O  O3G   . ANP C 3 .   ? 3.415   -10.706 -24.706 1.00 11.84 ? 1   ANP A O3G   1 
HETATM 3355 P  PB    . ANP C 3 .   ? 1.527   -11.649 -21.473 1.00 10.73 ? 1   ANP A PB    1 
HETATM 3356 O  O1B   . ANP C 3 .   ? 0.665   -12.860 -21.286 1.00 11.91 ? 1   ANP A O1B   1 
HETATM 3357 O  O2B   . ANP C 3 .   ? 2.321   -11.154 -20.305 1.00 12.46 ? 1   ANP A O2B   1 
HETATM 3358 N  N3B   . ANP C 3 .   ? 2.666   -12.061 -22.707 1.00 11.98 ? 1   ANP A N3B   1 
HETATM 3359 P  PA    . ANP C 3 .   ? -0.947  -10.296 -21.551 1.00 10.83 ? 1   ANP A PA    1 
HETATM 3360 O  O1A   . ANP C 3 .   ? -1.129  -10.981 -20.220 1.00 9.59  ? 1   ANP A O1A   1 
HETATM 3361 O  O2A   . ANP C 3 .   ? -1.323  -8.847  -21.736 1.00 10.99 ? 1   ANP A O2A   1 
HETATM 3362 O  O3A   . ANP C 3 .   ? 0.602   -10.444 -21.983 1.00 11.81 ? 1   ANP A O3A   1 
HETATM 3363 O  "O5'" . ANP C 3 .   ? -1.719  -11.070 -22.722 1.00 10.05 ? 1   ANP A "O5'" 1 
HETATM 3364 C  "C5'" . ANP C 3 .   ? -2.856  -11.867 -22.441 1.00 9.78  ? 1   ANP A "C5'" 1 
HETATM 3365 C  "C4'" . ANP C 3 .   ? -4.081  -11.348 -23.165 1.00 8.85  ? 1   ANP A "C4'" 1 
HETATM 3366 O  "O4'" . ANP C 3 .   ? -5.108  -12.299 -22.921 1.00 9.07  ? 1   ANP A "O4'" 1 
HETATM 3367 C  "C3'" . ANP C 3 .   ? -4.590  -10.043 -22.582 1.00 8.42  ? 1   ANP A "C3'" 1 
HETATM 3368 O  "O3'" . ANP C 3 .   ? -5.313  -9.305  -23.573 1.00 7.34  ? 1   ANP A "O3'" 1 
HETATM 3369 C  "C2'" . ANP C 3 .   ? -5.506  -10.462 -21.452 1.00 8.40  ? 1   ANP A "C2'" 1 
HETATM 3370 O  "O2'" . ANP C 3 .   ? -6.609  -9.566  -21.258 1.00 9.26  ? 1   ANP A "O2'" 1 
HETATM 3371 C  "C1'" . ANP C 3 .   ? -6.004  -11.828 -21.894 1.00 8.27  ? 1   ANP A "C1'" 1 
HETATM 3372 N  N9    . ANP C 3 .   ? -6.132  -12.818 -20.782 1.00 7.45  ? 1   ANP A N9    1 
HETATM 3373 C  C8    . ANP C 3 .   ? -5.334  -12.997 -19.705 1.00 7.16  ? 1   ANP A C8    1 
HETATM 3374 N  N7    . ANP C 3 .   ? -5.796  -14.011 -18.917 1.00 6.38  ? 1   ANP A N7    1 
HETATM 3375 C  C5    . ANP C 3 .   ? -6.908  -14.486 -19.497 1.00 5.94  ? 1   ANP A C5    1 
HETATM 3376 C  C6    . ANP C 3 .   ? -7.890  -15.547 -19.210 1.00 6.14  ? 1   ANP A C6    1 
HETATM 3377 N  N6    . ANP C 3 .   ? -7.764  -16.321 -18.103 1.00 5.38  ? 1   ANP A N6    1 
HETATM 3378 N  N1    . ANP C 3 .   ? -8.912  -15.714 -20.092 1.00 6.00  ? 1   ANP A N1    1 
HETATM 3379 C  C2    . ANP C 3 .   ? -9.063  -14.950 -21.190 1.00 5.05  ? 1   ANP A C2    1 
HETATM 3380 N  N3    . ANP C 3 .   ? -8.204  -13.973 -21.509 1.00 5.69  ? 1   ANP A N3    1 
HETATM 3381 C  C4    . ANP C 3 .   ? -7.130  -13.702 -20.720 1.00 6.61  ? 1   ANP A C4    1 
HETATM 3382 MG MG    . MG  D 4 .   ? 2.850   -8.934  -20.854 1.00 13.81 ? 476 MG  A MG    1 
HETATM 3383 C  C1    . GOL E 5 .   ? 15.176  -17.523 -23.143 1.00 28.54 ? 477 GOL A C1    1 
HETATM 3384 O  O1    . GOL E 5 .   ? 15.403  -18.307 -21.998 1.00 28.49 ? 477 GOL A O1    1 
HETATM 3385 C  C2    . GOL E 5 .   ? 16.208  -17.846 -24.207 1.00 28.53 ? 477 GOL A C2    1 
HETATM 3386 O  O2    . GOL E 5 .   ? 17.414  -17.177 -23.917 1.00 27.74 ? 477 GOL A O2    1 
HETATM 3387 C  C3    . GOL E 5 .   ? 15.659  -17.393 -25.552 1.00 28.45 ? 477 GOL A C3    1 
HETATM 3388 O  O3    . GOL E 5 .   ? 15.025  -18.490 -26.166 1.00 28.60 ? 477 GOL A O3    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   52  ?   ?   ?   A . n 
A 1 2   MET 2   53  ?   ?   ?   A . n 
A 1 3   GLU 3   54  ?   ?   ?   A . n 
A 1 4   ASP 4   55  ?   ?   ?   A . n 
A 1 5   ARG 5   56  ?   ?   ?   A . n 
A 1 6   ALA 6   57  ?   ?   ?   A . n 
A 1 7   ALA 7   58  ?   ?   ?   A . n 
A 1 8   GLN 8   59  ?   ?   ?   A . n 
A 1 9   SER 9   60  60  SER SER A . n 
A 1 10  LEU 10  61  61  LEU LEU A . n 
A 1 11  LEU 11  62  62  LEU LEU A . n 
A 1 12  ASN 12  63  63  ASN ASN A . n 
A 1 13  LYS 13  64  64  LYS LYS A . n 
A 1 14  LEU 14  65  65  LEU LEU A . n 
A 1 15  ILE 15  66  66  ILE ILE A . n 
A 1 16  ARG 16  67  67  ARG ARG A . n 
A 1 17  SER 17  68  68  SER SER A . n 
A 1 18  ASN 18  69  69  ASN ASN A . n 
A 1 19  LEU 19  70  70  LEU LEU A . n 
A 1 20  VAL 20  71  71  VAL VAL A . n 
A 1 21  ASP 21  72  72  ASP ASP A . n 
A 1 22  ASN 22  73  73  ASN ASN A . n 
A 1 23  THR 23  74  74  THR THR A . n 
A 1 24  ASN 24  75  75  ASN ASN A . n 
A 1 25  GLN 25  76  76  GLN GLN A . n 
A 1 26  VAL 26  77  77  VAL VAL A . n 
A 1 27  GLU 27  78  78  GLU GLU A . n 
A 1 28  VAL 28  79  79  VAL VAL A . n 
A 1 29  LEU 29  80  80  LEU LEU A . n 
A 1 30  GLN 30  81  81  GLN GLN A . n 
A 1 31  ARG 31  82  82  ARG ARG A . n 
A 1 32  ASP 32  83  83  ASP ASP A . n 
A 1 33  PRO 33  84  84  PRO PRO A . n 
A 1 34  ASN 34  85  85  ASN ASN A . n 
A 1 35  SER 35  86  86  SER SER A . n 
A 1 36  PRO 36  87  87  PRO PRO A . n 
A 1 37  LEU 37  88  88  LEU LEU A . n 
A 1 38  TYR 38  89  89  TYR TYR A . n 
A 1 39  SER 39  90  90  SER SER A . n 
A 1 40  VAL 40  91  91  VAL VAL A . n 
A 1 41  LYS 41  92  92  LYS LYS A . n 
A 1 42  SER 42  93  93  SER SER A . n 
A 1 43  PHE 43  94  94  PHE PHE A . n 
A 1 44  GLU 44  95  95  GLU GLU A . n 
A 1 45  GLU 45  96  96  GLU GLU A . n 
A 1 46  LEU 46  97  97  LEU LEU A . n 
A 1 47  ARG 47  98  98  ARG ARG A . n 
A 1 48  LEU 48  99  99  LEU LEU A . n 
A 1 49  LYS 49  100 100 LYS LYS A . n 
A 1 50  PRO 50  101 101 PRO PRO A . n 
A 1 51  GLN 51  102 102 GLN GLN A . n 
A 1 52  LEU 52  103 103 LEU LEU A . n 
A 1 53  LEU 53  104 104 LEU LEU A . n 
A 1 54  GLN 54  105 105 GLN GLN A . n 
A 1 55  GLY 55  106 106 GLY GLY A . n 
A 1 56  VAL 56  107 107 VAL VAL A . n 
A 1 57  TYR 57  108 108 TYR TYR A . n 
A 1 58  ALA 58  109 109 ALA ALA A . n 
A 1 59  MET 59  110 110 MET MET A . n 
A 1 60  GLY 60  111 111 GLY GLY A . n 
A 1 61  PHE 61  112 112 PHE PHE A . n 
A 1 62  ASN 62  113 113 ASN ASN A . n 
A 1 63  ARG 63  114 114 ARG ARG A . n 
A 1 64  PRO 64  115 115 PRO PRO A . n 
A 1 65  SER 65  116 116 SER SER A . n 
A 1 66  LYS 66  117 117 LYS LYS A . n 
A 1 67  ILE 67  118 118 ILE ILE A . n 
A 1 68  GLN 68  119 119 GLN GLN A . n 
A 1 69  GLU 69  120 120 GLU GLU A . n 
A 1 70  ASN 70  121 121 ASN ASN A . n 
A 1 71  ALA 71  122 122 ALA ALA A . n 
A 1 72  LEU 72  123 123 LEU LEU A . n 
A 1 73  PRO 73  124 124 PRO PRO A . n 
A 1 74  LEU 74  125 125 LEU LEU A . n 
A 1 75  MET 75  126 126 MET MET A . n 
A 1 76  LEU 76  127 127 LEU LEU A . n 
A 1 77  ALA 77  128 128 ALA ALA A . n 
A 1 78  GLU 78  129 129 GLU GLU A . n 
A 1 79  PRO 79  130 130 PRO PRO A . n 
A 1 80  PRO 80  131 131 PRO PRO A . n 
A 1 81  GLN 81  132 132 GLN GLN A . n 
A 1 82  ASN 82  133 133 ASN ASN A . n 
A 1 83  LEU 83  134 134 LEU LEU A . n 
A 1 84  ILE 84  135 135 ILE ILE A . n 
A 1 85  ALA 85  136 136 ALA ALA A . n 
A 1 86  GLN 86  137 137 GLN GLN A . n 
A 1 87  SER 87  138 138 SER SER A . n 
A 1 88  GLN 88  139 139 GLN GLN A . n 
A 1 89  SER 89  140 140 SER SER A . n 
A 1 90  GLY 90  141 141 GLY GLY A . n 
A 1 91  THR 91  142 142 THR THR A . n 
A 1 92  GLY 92  143 143 GLY GLY A . n 
A 1 93  LYS 93  144 144 LYS LYS A . n 
A 1 94  THR 94  145 145 THR THR A . n 
A 1 95  ALA 95  146 146 ALA ALA A . n 
A 1 96  ALA 96  147 147 ALA ALA A . n 
A 1 97  PHE 97  148 148 PHE PHE A . n 
A 1 98  VAL 98  149 149 VAL VAL A . n 
A 1 99  LEU 99  150 150 LEU LEU A . n 
A 1 100 ALA 100 151 151 ALA ALA A . n 
A 1 101 MET 101 152 152 MET MET A . n 
A 1 102 LEU 102 153 153 LEU LEU A . n 
A 1 103 SER 103 154 154 SER SER A . n 
A 1 104 GLN 104 155 155 GLN GLN A . n 
A 1 105 VAL 105 156 156 VAL VAL A . n 
A 1 106 GLU 106 157 157 GLU GLU A . n 
A 1 107 PRO 107 158 158 PRO PRO A . n 
A 1 108 ALA 108 159 159 ALA ALA A . n 
A 1 109 ASN 109 160 160 ASN ASN A . n 
A 1 110 LYS 110 161 161 LYS LYS A . n 
A 1 111 TYR 111 162 162 TYR TYR A . n 
A 1 112 PRO 112 163 163 PRO PRO A . n 
A 1 113 GLN 113 164 164 GLN GLN A . n 
A 1 114 CYS 114 165 165 CYS CYS A . n 
A 1 115 LEU 115 166 166 LEU LEU A . n 
A 1 116 CYS 116 167 167 CYS CYS A . n 
A 1 117 LEU 117 168 168 LEU LEU A . n 
A 1 118 SER 118 169 169 SER SER A . n 
A 1 119 PRO 119 170 170 PRO PRO A . n 
A 1 120 THR 120 171 171 THR THR A . n 
A 1 121 TYR 121 172 172 TYR TYR A . n 
A 1 122 GLU 122 173 173 GLU GLU A . n 
A 1 123 LEU 123 174 174 LEU LEU A . n 
A 1 124 ALA 124 175 175 ALA ALA A . n 
A 1 125 LEU 125 176 176 LEU LEU A . n 
A 1 126 GLN 126 177 177 GLN GLN A . n 
A 1 127 THR 127 178 178 THR THR A . n 
A 1 128 GLY 128 179 179 GLY GLY A . n 
A 1 129 LYS 129 180 180 LYS LYS A . n 
A 1 130 VAL 130 181 181 VAL VAL A . n 
A 1 131 ILE 131 182 182 ILE ILE A . n 
A 1 132 GLU 132 183 183 GLU GLU A . n 
A 1 133 GLN 133 184 184 GLN GLN A . n 
A 1 134 MET 134 185 185 MET MET A . n 
A 1 135 GLY 135 186 186 GLY GLY A . n 
A 1 136 LYS 136 187 187 LYS LYS A . n 
A 1 137 PHE 137 188 188 PHE PHE A . n 
A 1 138 TYR 138 189 189 TYR TYR A . n 
A 1 139 PRO 139 190 190 PRO PRO A . n 
A 1 140 GLU 140 191 191 GLU GLU A . n 
A 1 141 LEU 141 192 192 LEU LEU A . n 
A 1 142 LYS 142 193 193 LYS LYS A . n 
A 1 143 LEU 143 194 194 LEU LEU A . n 
A 1 144 ALA 144 195 195 ALA ALA A . n 
A 1 145 TYR 145 196 196 TYR TYR A . n 
A 1 146 ALA 146 197 197 ALA ALA A . n 
A 1 147 VAL 147 198 198 VAL VAL A . n 
A 1 148 ARG 148 199 199 ARG ARG A . n 
A 1 149 GLY 149 200 200 GLY GLY A . n 
A 1 150 ASN 150 201 201 ASN ASN A . n 
A 1 151 LYS 151 202 202 LYS LYS A . n 
A 1 152 LEU 152 203 203 LEU LEU A . n 
A 1 153 GLU 153 204 204 GLU GLU A . n 
A 1 154 ARG 154 205 205 ARG ARG A . n 
A 1 155 GLY 155 206 206 GLY GLY A . n 
A 1 156 GLN 156 207 207 GLN GLN A . n 
A 1 157 LYS 157 208 208 LYS LYS A . n 
A 1 158 ILE 158 209 209 ILE ILE A . n 
A 1 159 SER 159 210 210 SER SER A . n 
A 1 160 GLU 160 211 211 GLU GLU A . n 
A 1 161 GLN 161 212 212 GLN GLN A . n 
A 1 162 ILE 162 213 213 ILE ILE A . n 
A 1 163 VAL 163 214 214 VAL VAL A . n 
A 1 164 ILE 164 215 215 ILE ILE A . n 
A 1 165 GLY 165 216 216 GLY GLY A . n 
A 1 166 THR 166 217 217 THR THR A . n 
A 1 167 PRO 167 218 218 PRO PRO A . n 
A 1 168 GLY 168 219 219 GLY GLY A . n 
A 1 169 THR 169 220 220 THR THR A . n 
A 1 170 VAL 170 221 221 VAL VAL A . n 
A 1 171 LEU 171 222 222 LEU LEU A . n 
A 1 172 ASP 172 223 223 ASP ASP A . n 
A 1 173 TRP 173 224 224 TRP TRP A . n 
A 1 174 CYS 174 225 225 CYS CYS A . n 
A 1 175 SER 175 226 226 SER SER A . n 
A 1 176 LYS 176 227 227 LYS LYS A . n 
A 1 177 LEU 177 228 228 LEU LEU A . n 
A 1 178 LYS 178 229 229 LYS LYS A . n 
A 1 179 PHE 179 230 230 PHE PHE A . n 
A 1 180 ILE 180 231 231 ILE ILE A . n 
A 1 181 ASP 181 232 232 ASP ASP A . n 
A 1 182 PRO 182 233 233 PRO PRO A . n 
A 1 183 LYS 183 234 234 LYS LYS A . n 
A 1 184 LYS 184 235 235 LYS LYS A . n 
A 1 185 ILE 185 236 236 ILE ILE A . n 
A 1 186 LYS 186 237 237 LYS LYS A . n 
A 1 187 VAL 187 238 238 VAL VAL A . n 
A 1 188 PHE 188 239 239 PHE PHE A . n 
A 1 189 VAL 189 240 240 VAL VAL A . n 
A 1 190 LEU 190 241 241 LEU LEU A . n 
A 1 191 ASP 191 242 242 ASP ASP A . n 
A 1 192 GLU 192 243 243 GLU GLU A . n 
A 1 193 ALA 193 244 244 ALA ALA A . n 
A 1 194 ASP 194 245 245 ASP ASP A . n 
A 1 195 VAL 195 246 246 VAL VAL A . n 
A 1 196 MET 196 247 247 MET MET A . n 
A 1 197 ILE 197 248 248 ILE ILE A . n 
A 1 198 ALA 198 249 249 ALA ALA A . n 
A 1 199 THR 199 250 250 THR THR A . n 
A 1 200 GLN 200 251 251 GLN GLN A . n 
A 1 201 GLY 201 252 252 GLY GLY A . n 
A 1 202 HIS 202 253 253 HIS HIS A . n 
A 1 203 GLN 203 254 254 GLN GLN A . n 
A 1 204 ASP 204 255 255 ASP ASP A . n 
A 1 205 GLN 205 256 256 GLN GLN A . n 
A 1 206 SER 206 257 257 SER SER A . n 
A 1 207 ILE 207 258 258 ILE ILE A . n 
A 1 208 ARG 208 259 259 ARG ARG A . n 
A 1 209 ILE 209 260 260 ILE ILE A . n 
A 1 210 GLN 210 261 261 GLN GLN A . n 
A 1 211 ARG 211 262 262 ARG ARG A . n 
A 1 212 MET 212 263 263 MET MET A . n 
A 1 213 LEU 213 264 264 LEU LEU A . n 
A 1 214 PRO 214 265 265 PRO PRO A . n 
A 1 215 ARG 215 266 266 ARG ARG A . n 
A 1 216 ASN 216 267 267 ASN ASN A . n 
A 1 217 CYS 217 268 268 CYS CYS A . n 
A 1 218 GLN 218 269 269 GLN GLN A . n 
A 1 219 MET 219 270 270 MET MET A . n 
A 1 220 LEU 220 271 271 LEU LEU A . n 
A 1 221 LEU 221 272 272 LEU LEU A . n 
A 1 222 PHE 222 273 273 PHE PHE A . n 
A 1 223 SER 223 274 274 SER SER A . n 
A 1 224 ALA 224 275 275 ALA ALA A . n 
A 1 225 THR 225 276 276 THR THR A . n 
A 1 226 PHE 226 277 277 PHE PHE A . n 
A 1 227 GLU 227 278 278 GLU GLU A . n 
A 1 228 ASP 228 279 279 ASP ASP A . n 
A 1 229 SER 229 280 280 SER SER A . n 
A 1 230 VAL 230 281 281 VAL VAL A . n 
A 1 231 TRP 231 282 282 TRP TRP A . n 
A 1 232 LYS 232 283 283 LYS LYS A . n 
A 1 233 PHE 233 284 284 PHE PHE A . n 
A 1 234 ALA 234 285 285 ALA ALA A . n 
A 1 235 GLN 235 286 286 GLN GLN A . n 
A 1 236 LYS 236 287 287 LYS LYS A . n 
A 1 237 VAL 237 288 288 VAL VAL A . n 
A 1 238 VAL 238 289 289 VAL VAL A . n 
A 1 239 PRO 239 290 290 PRO PRO A . n 
A 1 240 ASP 240 291 291 ASP ASP A . n 
A 1 241 PRO 241 292 292 PRO PRO A . n 
A 1 242 ASN 242 293 293 ASN ASN A . n 
A 1 243 VAL 243 294 294 VAL VAL A . n 
A 1 244 ILE 244 295 295 ILE ILE A . n 
A 1 245 LYS 245 296 296 LYS LYS A . n 
A 1 246 LEU 246 297 297 LEU LEU A . n 
A 1 247 LYS 247 298 298 LYS LYS A . n 
A 1 248 ARG 248 299 299 ARG ARG A . n 
A 1 249 GLU 249 300 300 GLU GLU A . n 
A 1 250 GLU 250 301 301 GLU GLU A . n 
A 1 251 GLU 251 302 302 GLU GLU A . n 
A 1 252 THR 252 303 303 THR THR A . n 
A 1 253 LEU 253 304 304 LEU LEU A . n 
A 1 254 ASP 254 305 305 ASP ASP A . n 
A 1 255 THR 255 306 306 THR THR A . n 
A 1 256 ILE 256 307 307 ILE ILE A . n 
A 1 257 LYS 257 308 308 LYS LYS A . n 
A 1 258 GLN 258 309 309 GLN GLN A . n 
A 1 259 TYR 259 310 310 TYR TYR A . n 
A 1 260 TYR 260 311 311 TYR TYR A . n 
A 1 261 VAL 261 312 312 VAL VAL A . n 
A 1 262 LEU 262 313 313 LEU LEU A . n 
A 1 263 CYS 263 314 314 CYS CYS A . n 
A 1 264 SER 264 315 315 SER SER A . n 
A 1 265 SER 265 316 316 SER SER A . n 
A 1 266 ARG 266 317 317 ARG ARG A . n 
A 1 267 ASP 267 318 318 ASP ASP A . n 
A 1 268 GLU 268 319 319 GLU GLU A . n 
A 1 269 LYS 269 320 320 LYS LYS A . n 
A 1 270 PHE 270 321 321 PHE PHE A . n 
A 1 271 GLN 271 322 322 GLN GLN A . n 
A 1 272 ALA 272 323 323 ALA ALA A . n 
A 1 273 LEU 273 324 324 LEU LEU A . n 
A 1 274 CYS 274 325 325 CYS CYS A . n 
A 1 275 ASN 275 326 326 ASN ASN A . n 
A 1 276 LEU 276 327 327 LEU LEU A . n 
A 1 277 TYR 277 328 328 TYR TYR A . n 
A 1 278 GLY 278 329 329 GLY GLY A . n 
A 1 279 ALA 279 330 330 ALA ALA A . n 
A 1 280 ILE 280 331 331 ILE ILE A . n 
A 1 281 THR 281 332 332 THR THR A . n 
A 1 282 ILE 282 333 333 ILE ILE A . n 
A 1 283 ALA 283 334 334 ALA ALA A . n 
A 1 284 GLN 284 335 335 GLN GLN A . n 
A 1 285 ALA 285 336 336 ALA ALA A . n 
A 1 286 MET 286 337 337 MET MET A . n 
A 1 287 ILE 287 338 338 ILE ILE A . n 
A 1 288 PHE 288 339 339 PHE PHE A . n 
A 1 289 CYS 289 340 340 CYS CYS A . n 
A 1 290 HIS 290 341 341 HIS HIS A . n 
A 1 291 THR 291 342 342 THR THR A . n 
A 1 292 ARG 292 343 343 ARG ARG A . n 
A 1 293 LYS 293 344 344 LYS LYS A . n 
A 1 294 THR 294 345 345 THR THR A . n 
A 1 295 ALA 295 346 346 ALA ALA A . n 
A 1 296 SER 296 347 347 SER SER A . n 
A 1 297 TRP 297 348 348 TRP TRP A . n 
A 1 298 LEU 298 349 349 LEU LEU A . n 
A 1 299 ALA 299 350 350 ALA ALA A . n 
A 1 300 ALA 300 351 351 ALA ALA A . n 
A 1 301 GLU 301 352 352 GLU GLU A . n 
A 1 302 LEU 302 353 353 LEU LEU A . n 
A 1 303 SER 303 354 354 SER SER A . n 
A 1 304 LYS 304 355 355 LYS LYS A . n 
A 1 305 GLU 305 356 356 GLU GLU A . n 
A 1 306 GLY 306 357 357 GLY GLY A . n 
A 1 307 HIS 307 358 358 HIS HIS A . n 
A 1 308 GLN 308 359 359 GLN GLN A . n 
A 1 309 VAL 309 360 360 VAL VAL A . n 
A 1 310 ALA 310 361 361 ALA ALA A . n 
A 1 311 LEU 311 362 362 LEU LEU A . n 
A 1 312 LEU 312 363 363 LEU LEU A . n 
A 1 313 SER 313 364 364 SER SER A . n 
A 1 314 GLY 314 365 365 GLY GLY A . n 
A 1 315 GLU 315 366 366 GLU GLU A . n 
A 1 316 MET 316 367 367 MET MET A . n 
A 1 317 MET 317 368 368 MET MET A . n 
A 1 318 VAL 318 369 369 VAL VAL A . n 
A 1 319 GLU 319 370 370 GLU GLU A . n 
A 1 320 GLN 320 371 371 GLN GLN A . n 
A 1 321 ARG 321 372 372 ARG ARG A . n 
A 1 322 ALA 322 373 373 ALA ALA A . n 
A 1 323 ALA 323 374 374 ALA ALA A . n 
A 1 324 VAL 324 375 375 VAL VAL A . n 
A 1 325 ILE 325 376 376 ILE ILE A . n 
A 1 326 GLU 326 377 377 GLU GLU A . n 
A 1 327 ARG 327 378 378 ARG ARG A . n 
A 1 328 PHE 328 379 379 PHE PHE A . n 
A 1 329 ARG 329 380 380 ARG ARG A . n 
A 1 330 GLU 330 381 381 GLU GLU A . n 
A 1 331 GLY 331 382 382 GLY GLY A . n 
A 1 332 LYS 332 383 383 LYS LYS A . n 
A 1 333 GLU 333 384 384 GLU GLU A . n 
A 1 334 LYS 334 385 385 LYS LYS A . n 
A 1 335 VAL 335 386 386 VAL VAL A . n 
A 1 336 LEU 336 387 387 LEU LEU A . n 
A 1 337 VAL 337 388 388 VAL VAL A . n 
A 1 338 THR 338 389 389 THR THR A . n 
A 1 339 THR 339 390 390 THR THR A . n 
A 1 340 ASN 340 391 391 ASN ASN A . n 
A 1 341 VAL 341 392 392 VAL VAL A . n 
A 1 342 CYS 342 393 393 CYS CYS A . n 
A 1 343 ALA 343 394 394 ALA ALA A . n 
A 1 344 ARG 344 395 395 ARG ARG A . n 
A 1 345 GLY 345 396 396 GLY GLY A . n 
A 1 346 ILE 346 397 397 ILE ILE A . n 
A 1 347 ASP 347 398 398 ASP ASP A . n 
A 1 348 VAL 348 399 399 VAL VAL A . n 
A 1 349 GLU 349 400 400 GLU GLU A . n 
A 1 350 GLN 350 401 401 GLN GLN A . n 
A 1 351 VAL 351 402 402 VAL VAL A . n 
A 1 352 SER 352 403 403 SER SER A . n 
A 1 353 VAL 353 404 404 VAL VAL A . n 
A 1 354 VAL 354 405 405 VAL VAL A . n 
A 1 355 ILE 355 406 406 ILE ILE A . n 
A 1 356 ASN 356 407 407 ASN ASN A . n 
A 1 357 PHE 357 408 408 PHE PHE A . n 
A 1 358 ASP 358 409 409 ASP ASP A . n 
A 1 359 LEU 359 410 410 LEU LEU A . n 
A 1 360 PRO 360 411 411 PRO PRO A . n 
A 1 361 VAL 361 412 412 VAL VAL A . n 
A 1 362 ASP 362 413 413 ASP ASP A . n 
A 1 363 LYS 363 414 414 LYS LYS A . n 
A 1 364 ASP 364 415 415 ASP ASP A . n 
A 1 365 GLY 365 416 416 GLY GLY A . n 
A 1 366 ASN 366 417 417 ASN ASN A . n 
A 1 367 PRO 367 418 418 PRO PRO A . n 
A 1 368 ASP 368 419 419 ASP ASP A . n 
A 1 369 ASN 369 420 420 ASN ASN A . n 
A 1 370 GLU 370 421 421 GLU GLU A . n 
A 1 371 THR 371 422 422 THR THR A . n 
A 1 372 TYR 372 423 423 TYR TYR A . n 
A 1 373 LEU 373 424 424 LEU LEU A . n 
A 1 374 HIS 374 425 425 HIS HIS A . n 
A 1 375 ARG 375 426 426 ARG ARG A . n 
A 1 376 ILE 376 427 427 ILE ILE A . n 
A 1 377 GLY 377 428 428 GLY GLY A . n 
A 1 378 ARG 378 429 429 ARG ARG A . n 
A 1 379 THR 379 430 430 THR THR A . n 
A 1 380 GLY 380 431 431 GLY GLY A . n 
A 1 381 ARG 381 432 432 ARG ARG A . n 
A 1 382 PHE 382 433 433 PHE PHE A . n 
A 1 383 GLY 383 434 434 GLY GLY A . n 
A 1 384 LYS 384 435 435 LYS LYS A . n 
A 1 385 ARG 385 436 436 ARG ARG A . n 
A 1 386 GLY 386 437 437 GLY GLY A . n 
A 1 387 LEU 387 438 438 LEU LEU A . n 
A 1 388 ALA 388 439 439 ALA ALA A . n 
A 1 389 VAL 389 440 440 VAL VAL A . n 
A 1 390 ASN 390 441 441 ASN ASN A . n 
A 1 391 MET 391 442 442 MET MET A . n 
A 1 392 VAL 392 443 443 VAL VAL A . n 
A 1 393 ASP 393 444 444 ASP ASP A . n 
A 1 394 SER 394 445 445 SER SER A . n 
A 1 395 LYS 395 446 446 LYS LYS A . n 
A 1 396 HIS 396 447 447 HIS HIS A . n 
A 1 397 SER 397 448 448 SER SER A . n 
A 1 398 MET 398 449 449 MET MET A . n 
A 1 399 ASN 399 450 450 ASN ASN A . n 
A 1 400 ILE 400 451 451 ILE ILE A . n 
A 1 401 LEU 401 452 452 LEU LEU A . n 
A 1 402 ASN 402 453 453 ASN ASN A . n 
A 1 403 ARG 403 454 454 ARG ARG A . n 
A 1 404 ILE 404 455 455 ILE ILE A . n 
A 1 405 GLN 405 456 456 GLN GLN A . n 
A 1 406 GLU 406 457 457 GLU GLU A . n 
A 1 407 HIS 407 458 458 HIS HIS A . n 
A 1 408 PHE 408 459 459 PHE PHE A . n 
A 1 409 ASN 409 460 460 ASN ASN A . n 
A 1 410 LYS 410 461 461 LYS LYS A . n 
A 1 411 LYS 411 462 462 LYS LYS A . n 
A 1 412 ILE 412 463 463 ILE ILE A . n 
A 1 413 GLU 413 464 464 GLU GLU A . n 
A 1 414 ARG 414 465 465 ARG ARG A . n 
A 1 415 LEU 415 466 466 LEU LEU A . n 
A 1 416 ASP 416 467 467 ASP ASP A . n 
A 1 417 THR 417 468 ?   ?   ?   A . n 
A 1 418 ASP 418 469 ?   ?   ?   A . n 
A 1 419 ASP 419 470 ?   ?   ?   A . n 
A 1 420 LEU 420 471 ?   ?   ?   A . n 
A 1 421 ASP 421 472 ?   ?   ?   A . n 
A 1 422 GLU 422 473 ?   ?   ?   A . n 
A 1 423 ILE 423 474 ?   ?   ?   A . n 
A 1 424 GLU 424 475 ?   ?   ?   A . n 
B 2 1   U   1   1   1   U   U   E . n 
B 2 2   U   2   2   2   U   U   E . n 
B 2 3   U   3   3   3   U   U   E . n 
B 2 4   U   4   4   4   U   U   E . n 
B 2 5   U   5   5   5   U   U   E . n 
B 2 6   U   6   6   6   U   U   E . n 
B 2 7   U   7   7   7   U   U   E . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3040  ? 
1 MORE         -32   ? 
1 'SSA (A^2)'  17910 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_conn_angle.id                    1 
_pdbx_struct_conn_angle.ptnr1_label_atom_id   O1G 
_pdbx_struct_conn_angle.ptnr1_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr1_label_asym_id   C 
_pdbx_struct_conn_angle.ptnr1_label_comp_id   ANP 
_pdbx_struct_conn_angle.ptnr1_label_seq_id    . 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id    ANP 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id     1 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr1_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr2_label_atom_id   MG 
_pdbx_struct_conn_angle.ptnr2_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr2_label_asym_id   D 
_pdbx_struct_conn_angle.ptnr2_label_comp_id   MG 
_pdbx_struct_conn_angle.ptnr2_label_seq_id    . 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id    MG 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id     476 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr2_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr3_label_atom_id   O2B 
_pdbx_struct_conn_angle.ptnr3_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr3_label_asym_id   C 
_pdbx_struct_conn_angle.ptnr3_label_comp_id   ANP 
_pdbx_struct_conn_angle.ptnr3_label_seq_id    . 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id    A 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id    ANP 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id     1 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr3_symmetry        1_555 
_pdbx_struct_conn_angle.value                 84.2 
_pdbx_struct_conn_angle.value_esd             ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-02-17 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined -8.7679 -17.4388 -39.8642 .6277 .4910 .7228 -.0975 -.1773 .1235  1.6715 .1950  2.5877 .4293  2.0780 .5415  .3355  
-.4694 -.1178 -.0607 -.1252 .1651  .4404  -.5910 -.2104 'X-RAY DIFFRACTION' 
2 ? refined 3.5915  -6.5332  -10.8194 .0096 .0567 .0139 .0091  -.0017 .0095  1.3439 1.3688 1.5377 .1942  -.2177 -.3995 -.0443 
-.2060 .0020  .0841  -.0665 -.0031 -.0608 .0252  .1108  'X-RAY DIFFRACTION' 
3 ? refined 7.8145  -7.6288  -37.4954 .0543 .0408 .0247 -.0137 .0220  -.0070 1.2336 2.8536 1.8580 -.3595 -.0888 -.4714 -.0710 
.1004  -.0494 -.3060 -.0359 -.0272 .0821  .0442  .1069  'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 60  ? ? A 78  ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 A 79  ? ? A 297 ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 A 298 ? ? A 469 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MxCuBE 'data collection' .        ? 1 
PHASER phasing           .        ? 2 
REFMAC refinement        5.5.0053 ? 3 
XDS    'data reduction'  .        ? 4 
XSCALE 'data scaling'    .        ? 5 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            P 
_pdbx_validate_rmsd_bond.auth_asym_id_1            E 
_pdbx_validate_rmsd_bond.auth_comp_id_1            U 
_pdbx_validate_rmsd_bond.auth_seq_id_1             1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OP3 
_pdbx_validate_rmsd_bond.auth_asym_id_2            E 
_pdbx_validate_rmsd_bond.auth_comp_id_2            U 
_pdbx_validate_rmsd_bond.auth_seq_id_2             1 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.490 
_pdbx_validate_rmsd_bond.bond_target_value         1.607 
_pdbx_validate_rmsd_bond.bond_deviation            -0.117 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.012 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLN A 81  ? ? -67.64  7.54    
2 1 SER A 226 ? ? -123.28 -109.20 
3 1 ASP A 291 ? ? 29.96   77.05   
4 1 ALA A 334 ? ? -111.15 -110.77 
5 1 THR A 390 ? ? -105.53 -166.49 
6 1 PHE A 433 ? ? 34.11   64.78   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A SER 60  ? OG    ? A SER 9   OG    
2  1 Y 1 A LEU 65  ? CG    ? A LEU 14  CG    
3  1 Y 1 A LEU 65  ? CD1   ? A LEU 14  CD1   
4  1 Y 1 A LEU 65  ? CD2   ? A LEU 14  CD2   
5  1 Y 1 A LEU 70  ? CG    ? A LEU 19  CG    
6  1 Y 1 A LEU 70  ? CD1   ? A LEU 19  CD1   
7  1 Y 1 A LEU 70  ? CD2   ? A LEU 19  CD2   
8  1 Y 1 A GLU 204 ? CG    ? A GLU 153 CG    
9  1 Y 1 A GLU 204 ? CD    ? A GLU 153 CD    
10 1 Y 1 A GLU 204 ? OE1   ? A GLU 153 OE1   
11 1 Y 1 A GLU 204 ? OE2   ? A GLU 153 OE2   
12 1 Y 1 E U   7   ? "C5'" ? B U   7   "C5'" 
13 1 Y 1 E U   7   ? "C4'" ? B U   7   "C4'" 
14 1 Y 1 E U   7   ? "O4'" ? B U   7   "O4'" 
15 1 Y 1 E U   7   ? "C3'" ? B U   7   "C3'" 
16 1 Y 1 E U   7   ? "O3'" ? B U   7   "O3'" 
17 1 Y 1 E U   7   ? "C2'" ? B U   7   "C2'" 
18 1 Y 1 E U   7   ? "O2'" ? B U   7   "O2'" 
19 1 Y 1 E U   7   ? "C1'" ? B U   7   "C1'" 
20 1 Y 1 E U   7   ? N1    ? B U   7   N1    
21 1 Y 1 E U   7   ? C2    ? B U   7   C2    
22 1 Y 1 E U   7   ? O2    ? B U   7   O2    
23 1 Y 1 E U   7   ? N3    ? B U   7   N3    
24 1 Y 1 E U   7   ? C4    ? B U   7   C4    
25 1 Y 1 E U   7   ? O4    ? B U   7   O4    
26 1 Y 1 E U   7   ? C5    ? B U   7   C5    
27 1 Y 1 E U   7   ? C6    ? B U   7   C6    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 52  ? A SER 1   
2  1 Y 1 A MET 53  ? A MET 2   
3  1 Y 1 A GLU 54  ? A GLU 3   
4  1 Y 1 A ASP 55  ? A ASP 4   
5  1 Y 1 A ARG 56  ? A ARG 5   
6  1 Y 1 A ALA 57  ? A ALA 6   
7  1 Y 1 A ALA 58  ? A ALA 7   
8  1 Y 1 A GLN 59  ? A GLN 8   
9  1 Y 1 A THR 468 ? A THR 417 
10 1 Y 1 A ASP 469 ? A ASP 418 
11 1 Y 1 A ASP 470 ? A ASP 419 
12 1 Y 1 A LEU 471 ? A LEU 420 
13 1 Y 1 A ASP 472 ? A ASP 421 
14 1 Y 1 A GLU 473 ? A GLU 422 
15 1 Y 1 A ILE 474 ? A ILE 423 
16 1 Y 1 A GLU 475 ? A GLU 424 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ANP 
4 'MAGNESIUM ION'                               MG  
5 GLYCEROL                                      GOL 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 ANP 1 1   1 ANP ANP A . 
D 4 MG  1 476 1 MG  MG  A . 
E 5 GOL 1 477 1 GOL GOL A . 
#