data_3G1E
# 
_entry.id   3G1E 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3G1E         pdb_00003g1e 10.2210/pdb3g1e/pdb 
RCSB  RCSB051300   ?            ?                   
WWPDB D_1000051300 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1GK7 'HUMAN VIMENTIN COIL 1A FRAGMENT (1A)'                                unspecified 
PDB 1GK6 'HUMAN VIMENTIN COIL 2B FRAGMENT LINKED TO GCN4 LEUCINE ZIPPER (Z2B)' unspecified 
PDB 1GK4 'HUMAN VIMENTIN COIL 2B FRAGMENT (CYS2)'                              unspecified 
# 
_pdbx_database_status.entry_id                        3G1E 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2009-01-29 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Meier, M.'     1 
'Padilla, G.P.' 2 
'Herrmann, H.'  3 
'Wedig, T.'     4 
'Hergt, M.'     5 
'Patel, T.R.'   6 
'Stetefeld, J.' 7 
'Aebi, U.'      8 
'Burkhard, P.'  9 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Vimentin coil 1A-A molecular switch involved in the initiation of filament elongation.'                               
J.Mol.Biol. 390 245 261 2009 JMOBAK UK 0022-2836 0070 ? 19422834 10.1016/j.jmb.2009.04.067 
1       'Near-UV Circular Dichroism Reveals Structural Transitions of Vimentin Subunits during Intermediate Filament Assembly' 
J.Mol.Biol. 386 544 553 2009 JMOBAK UK 0022-2836 0070 ? 19136013 10.1016/j.jmb.2008.12.053 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Meier, M.'          1  ? 
primary 'Padilla, G.P.'      2  ? 
primary 'Herrmann, H.'       3  ? 
primary 'Wedig, T.'          4  ? 
primary 'Hergt, M.'          5  ? 
primary 'Patel, T.R.'        6  ? 
primary 'Stetefeld, J.'      7  ? 
primary 'Aebi, U.'           8  ? 
primary 'Burkhard, P.'       9  ? 
1       'Georgakopoulou, S.' 10 ? 
1       'Moeller, D.'        11 ? 
1       'Sachs, N.'          12 ? 
1       'Herrmann, H.'       13 ? 
1       'Aebi, U.'           14 ? 
# 
_cell.entry_id           3G1E 
_cell.length_a           35.496 
_cell.length_b           35.496 
_cell.length_c           108.022 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3G1E 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn Vimentin 4484.115 2  ? Y117L 'coil 1A' ? 
2 water   nat water    18.015   24 ? ?     ?         ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       '(ACE)NEKVELQELNDRFANLIDKVRFLEQQNKILLAELEQL(NH2)' 
_entity_poly.pdbx_seq_one_letter_code_can   XNEKVELQELNDRFANLIDKVRFLEQQNKILLAELEQLX 
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ACE n 
1 2  ASN n 
1 3  GLU n 
1 4  LYS n 
1 5  VAL n 
1 6  GLU n 
1 7  LEU n 
1 8  GLN n 
1 9  GLU n 
1 10 LEU n 
1 11 ASN n 
1 12 ASP n 
1 13 ARG n 
1 14 PHE n 
1 15 ALA n 
1 16 ASN n 
1 17 LEU n 
1 18 ILE n 
1 19 ASP n 
1 20 LYS n 
1 21 VAL n 
1 22 ARG n 
1 23 PHE n 
1 24 LEU n 
1 25 GLU n 
1 26 GLN n 
1 27 GLN n 
1 28 ASN n 
1 29 LYS n 
1 30 ILE n 
1 31 LEU n 
1 32 LEU n 
1 33 ALA n 
1 34 GLU n 
1 35 LEU n 
1 36 GLU n 
1 37 GLN n 
1 38 LEU n 
1 39 NH2 n 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                
'residue 102 to 138 from human vimentin chemically synthesized with an N-terminal acetyl and a C-terminal amidyl tag' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    VIME_HUMAN 
_struct_ref.pdbx_db_accession          P08670 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   NEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQL 
_struct_ref.pdbx_align_begin           102 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3G1E A 2 ? 38 ? P08670 102 ? 138 ? 102 138 
2 1 3G1E B 2 ? 38 ? P08670 102 ? 138 ? 102 138 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3G1E ACE A 1  ? UNP P08670 ?   ?   insertion             101 1 
1 3G1E LEU A 17 ? UNP P08670 TYR 117 'engineered mutation' 117 2 
1 3G1E NH2 A 39 ? UNP P08670 ?   ?   insertion             139 3 
2 3G1E ACE B 1  ? UNP P08670 ?   ?   insertion             101 4 
2 3G1E LEU B 17 ? UNP P08670 TYR 117 'engineered mutation' 117 5 
2 3G1E NH2 B 39 ? UNP P08670 ?   ?   insertion             139 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACE non-polymer         . 'ACETYL GROUP'  ? 'C2 H4 O'        44.053  
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
NH2 non-polymer         . 'AMINO GROUP'   ? 'H2 N'           16.023  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3G1E 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.90 
_exptl_crystal.density_percent_sol   36.10 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'20 % PEG, 33 % isopropanol, 0.1 M trisodium citrate, pH 5.6, vapour diffusion, temperature 298K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'OXFORD ONYX CCD' 
_diffrn_detector.pdbx_collection_date   2006-01-10 
_diffrn_detector.details                'MULTI-LAYER OPTICS' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'ASK OXFORD DIFFRACTION' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'SEALED TUBE' 
_diffrn_source.type                        'OXFORD DIFFRACTION ENHANCE ULTRA' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3G1E 
_reflns.observed_criterion_sigma_I   6.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             11.650 
_reflns.d_resolution_high            1.770 
_reflns.number_obs                   6364 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         87.5 
_reflns.pdbx_Rmerge_I_obs            0.09900 
_reflns.pdbx_Rsym_value              0.09900 
_reflns.pdbx_netI_over_sigmaI        7.000 
_reflns.B_iso_Wilson_estimate        13.60 
_reflns.pdbx_redundancy              9.300 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.77 
_reflns_shell.d_res_low              1.86 
_reflns_shell.percent_possible_all   43.8 
_reflns_shell.Rmerge_I_obs           0.41400 
_reflns_shell.pdbx_Rsym_value        0.41400 
_reflns_shell.meanI_over_sigI_obs    1.600 
_reflns_shell.pdbx_redundancy        2.50 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3G1E 
_refine.ls_number_reflns_obs                     6136 
_refine.ls_number_reflns_all                     6136 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             11.65 
_refine.ls_d_res_high                            1.83 
_refine.ls_percent_reflns_obs                    93 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.253 
_refine.ls_R_factor_R_free                       0.295 
_refine.ls_R_factor_R_free_error                 0.014 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 7.100 
_refine.ls_number_reflns_R_free                  437 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            0.30 
_refine.occupancy_max                            1.00 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               33.19 
_refine.aniso_B[1][1]                            3.37000 
_refine.aniso_B[2][2]                            3.37000 
_refine.aniso_B[3][3]                            -6.75000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'CNS bulk solvent model used' 
_refine.solvent_model_param_ksol                 0.4 
_refine.solvent_model_param_bsol                 74.0181 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'MAXIMUM LIKELIHOOD TARGET USING AMPLITUDES' 
_refine.pdbx_starting_model                      'DIMERIC MODEL BUILT FROM PDB ENTRIES 1GK7 AND 1D7M' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             'restrained individual B-factor refinement' 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        3G1E 
_refine_analyze.Luzzati_coordinate_error_obs    0.25 
_refine_analyze.Luzzati_sigma_a_obs             0.23 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.30 
_refine_analyze.Luzzati_sigma_a_free            0.22 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        663 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             24 
_refine_hist.number_atoms_total               687 
_refine_hist.d_res_high                       1.83 
_refine_hist.d_res_low                        11.65 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.005 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             3.46  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            4.67  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             5.95  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            7.71  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       1.83 
_refine_ls_shell.d_res_low                        1.91 
_refine_ls_shell.number_reflns_R_work             493 
_refine_ls_shell.R_factor_R_work                  0.3220 
_refine_ls_shell.percent_reflns_obs               66.80 
_refine_ls_shell.R_factor_R_free                  0.3360 
_refine_ls_shell.R_factor_R_free_error            0.057 
_refine_ls_shell.percent_reflns_R_free            6.6 
_refine_ls_shell.number_reflns_R_free             35 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                  3G1E 
_struct.title                     'X-ray crystal structure of coil 1A of human vimentin' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3G1E 
_struct_keywords.text            
;dimeric parallel coiled coil, Acetylation, Coiled coil, Host-virus interaction, Intermediate filament, Phosphoprotein, STRUCTURAL PROTEIN
;
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 3 ? LEU A 38 ? GLU A 103 LEU A 138 1 ? 36 
HELX_P HELX_P2 2 VAL B 5 ? LEU B 38 ? VAL B 105 LEU B 138 1 ? 34 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? A ACE 1  C ? ? ? 1_555 A ASN 2  N ? ? A ACE 101 A ASN 102 1_555 ? ? ? ? ? ? ? 1.340 ? ? 
covale2 covale both ? A LEU 38 C ? ? ? 1_555 A NH2 39 N ? ? A LEU 138 A NH2 139 1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale3 covale both ? B ACE 1  C ? ? ? 1_555 B ASN 2  N ? ? B ACE 101 B ASN 102 1_555 ? ? ? ? ? ? ? 1.334 ? ? 
covale4 covale both ? B LEU 38 C ? ? ? 1_555 B NH2 39 N ? ? B LEU 138 B NH2 139 1_555 ? ? ? ? ? ? ? 1.325 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_atom_sites.entry_id                    3G1E 
_atom_sites.fract_transf_matrix[1][1]   0.028172 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.028172 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009257 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
HETATM 1   C C   . ACE A 1 1  ? 4.165   34.784 -12.528 1.00 80.58 ? 101 ACE A C   1 
HETATM 2   O O   . ACE A 1 1  ? 5.155   35.036 -13.219 1.00 83.86 ? 101 ACE A O   1 
HETATM 3   C CH3 . ACE A 1 1  ? 3.493   33.461 -12.713 1.00 81.80 ? 101 ACE A CH3 1 
ATOM   4   N N   . ASN A 1 2  ? 3.712   35.660 -11.621 1.00 76.41 ? 102 ASN A N   1 
ATOM   5   C CA  . ASN A 1 2  ? 2.546   35.552 -10.718 1.00 74.34 ? 102 ASN A CA  1 
ATOM   6   C C   . ASN A 1 2  ? 1.933   34.245 -10.219 1.00 72.29 ? 102 ASN A C   1 
ATOM   7   O O   . ASN A 1 2  ? 1.780   34.070 -9.001  1.00 74.39 ? 102 ASN A O   1 
ATOM   8   C CB  . ASN A 1 2  ? 1.419   36.437 -11.250 1.00 74.97 ? 102 ASN A CB  1 
ATOM   9   C CG  . ASN A 1 2  ? 1.389   37.796 -10.582 1.00 78.35 ? 102 ASN A CG  1 
ATOM   10  O OD1 . ASN A 1 2  ? 2.430   38.416 -10.367 1.00 78.89 ? 102 ASN A OD1 1 
ATOM   11  N ND2 . ASN A 1 2  ? 0.192   38.272 -10.257 1.00 81.43 ? 102 ASN A ND2 1 
ATOM   12  N N   . GLU A 1 3  ? 1.528   33.352 -11.120 1.00 68.01 ? 103 GLU A N   1 
ATOM   13  C CA  . GLU A 1 3  ? 0.978   32.086 -10.655 1.00 62.26 ? 103 GLU A CA  1 
ATOM   14  C C   . GLU A 1 3  ? 2.107   31.573 -9.784  1.00 61.18 ? 103 GLU A C   1 
ATOM   15  O O   . GLU A 1 3  ? 1.888   30.943 -8.752  1.00 60.04 ? 103 GLU A O   1 
ATOM   16  C CB  . GLU A 1 3  ? 0.720   31.091 -11.793 1.00 61.31 ? 103 GLU A CB  1 
ATOM   17  C CG  . GLU A 1 3  ? -0.003  29.832 -11.287 1.00 67.18 ? 103 GLU A CG  1 
ATOM   18  C CD  . GLU A 1 3  ? -0.186  28.742 -12.332 1.00 73.16 ? 103 GLU A CD  1 
ATOM   19  O OE1 . GLU A 1 3  ? -0.741  29.035 -13.411 1.00 67.64 ? 103 GLU A OE1 1 
ATOM   20  O OE2 . GLU A 1 3  ? 0.211   27.585 -12.062 1.00 77.36 ? 103 GLU A OE2 1 
ATOM   21  N N   . LYS A 1 4  ? 3.322   31.892 -10.219 1.00 57.48 ? 104 LYS A N   1 
ATOM   22  C CA  . LYS A 1 4  ? 4.540   31.521 -9.519  1.00 56.33 ? 104 LYS A CA  1 
ATOM   23  C C   . LYS A 1 4  ? 4.725   32.446 -8.316  1.00 57.05 ? 104 LYS A C   1 
ATOM   24  O O   . LYS A 1 4  ? 5.469   32.130 -7.387  1.00 57.57 ? 104 LYS A O   1 
ATOM   25  C CB  . LYS A 1 4  ? 5.733   31.636 -10.463 1.00 57.41 ? 104 LYS A CB  1 
ATOM   26  N N   . VAL A 1 5  ? 4.045   33.590 -8.346  1.00 52.67 ? 105 VAL A N   1 
ATOM   27  C CA  . VAL A 1 5  ? 4.109   34.567 -7.263  1.00 52.42 ? 105 VAL A CA  1 
ATOM   28  C C   . VAL A 1 5  ? 2.773   34.589 -6.518  1.00 53.66 ? 105 VAL A C   1 
ATOM   29  O O   . VAL A 1 5  ? 2.253   35.644 -6.152  1.00 55.70 ? 105 VAL A O   1 
ATOM   30  C CB  . VAL A 1 5  ? 4.430   35.988 -7.795  1.00 51.74 ? 105 VAL A CB  1 
ATOM   31  C CG1 . VAL A 1 5  ? 4.573   36.964 -6.633  1.00 50.65 ? 105 VAL A CG1 1 
ATOM   32  C CG2 . VAL A 1 5  ? 5.716   35.961 -8.607  1.00 50.90 ? 105 VAL A CG2 1 
ATOM   33  N N   . GLU A 1 6  ? 2.223   33.398 -6.318  1.00 51.27 ? 106 GLU A N   1 
ATOM   34  C CA  . GLU A 1 6  ? 0.971   33.208 -5.601  1.00 47.12 ? 106 GLU A CA  1 
ATOM   35  C C   . GLU A 1 6  ? 1.094   31.809 -5.007  1.00 43.95 ? 106 GLU A C   1 
ATOM   36  O O   . GLU A 1 6  ? 0.419   31.461 -4.038  1.00 50.82 ? 106 GLU A O   1 
ATOM   37  C CB  . GLU A 1 6  ? -0.231  33.302 -6.552  1.00 48.21 ? 106 GLU A CB  1 
ATOM   38  C CG  . GLU A 1 6  ? -0.642  32.002 -7.230  1.00 51.73 ? 106 GLU A CG  1 
ATOM   39  C CD  . GLU A 1 6  ? -1.826  32.182 -8.172  1.00 63.70 ? 106 GLU A CD  1 
ATOM   40  O OE1 . GLU A 1 6  ? -2.795  32.878 -7.793  1.00 69.60 ? 106 GLU A OE1 1 
ATOM   41  O OE2 . GLU A 1 6  ? -1.792  31.620 -9.288  1.00 65.65 ? 106 GLU A OE2 1 
ATOM   42  N N   . LEU A 1 7  ? 1.980   31.017 -5.607  1.00 34.10 ? 107 LEU A N   1 
ATOM   43  C CA  . LEU A 1 7  ? 2.257   29.662 -5.152  1.00 34.89 ? 107 LEU A CA  1 
ATOM   44  C C   . LEU A 1 7  ? 3.314   29.779 -4.059  1.00 29.37 ? 107 LEU A C   1 
ATOM   45  O O   . LEU A 1 7  ? 3.279   29.057 -3.064  1.00 30.02 ? 107 LEU A O   1 
ATOM   46  C CB  . LEU A 1 7  ? 2.783   28.801 -6.306  1.00 26.52 ? 107 LEU A CB  1 
ATOM   47  C CG  . LEU A 1 7  ? 1.810   28.487 -7.447  1.00 29.61 ? 107 LEU A CG  1 
ATOM   48  C CD1 . LEU A 1 7  ? 2.525   27.698 -8.533  1.00 32.27 ? 107 LEU A CD1 1 
ATOM   49  C CD2 . LEU A 1 7  ? 0.622   27.704 -6.913  1.00 40.02 ? 107 LEU A CD2 1 
ATOM   50  N N   . GLN A 1 8  ? 4.255   30.698 -4.253  1.00 27.96 ? 108 GLN A N   1 
ATOM   51  C CA  . GLN A 1 8  ? 5.300   30.925 -3.266  1.00 32.88 ? 108 GLN A CA  1 
ATOM   52  C C   . GLN A 1 8  ? 4.630   31.384 -1.975  1.00 35.48 ? 108 GLN A C   1 
ATOM   53  O O   . GLN A 1 8  ? 4.964   30.907 -0.890  1.00 41.46 ? 108 GLN A O   1 
ATOM   54  C CB  . GLN A 1 8  ? 6.281   31.995 -3.755  1.00 32.71 ? 108 GLN A CB  1 
ATOM   55  C CG  . GLN A 1 8  ? 7.309   32.421 -2.712  1.00 41.68 ? 108 GLN A CG  1 
ATOM   56  C CD  . GLN A 1 8  ? 8.732   32.033 -3.079  1.00 47.69 ? 108 GLN A CD  1 
ATOM   57  O OE1 . GLN A 1 8  ? 9.042   30.855 -3.261  1.00 59.01 ? 108 GLN A OE1 1 
ATOM   58  N NE2 . GLN A 1 8  ? 9.607   33.028 -3.182  1.00 50.04 ? 108 GLN A NE2 1 
ATOM   59  N N   . GLU A 1 9  ? 3.677   32.306 -2.096  1.00 33.09 ? 109 GLU A N   1 
ATOM   60  C CA  . GLU A 1 9  ? 2.958   32.806 -0.926  1.00 35.39 ? 109 GLU A CA  1 
ATOM   61  C C   . GLU A 1 9  ? 2.280   31.642 -0.224  1.00 32.54 ? 109 GLU A C   1 
ATOM   62  O O   . GLU A 1 9  ? 2.280   31.556 1.003   1.00 33.78 ? 109 GLU A O   1 
ATOM   63  C CB  . GLU A 1 9  ? 1.879   33.817 -1.322  1.00 33.29 ? 109 GLU A CB  1 
ATOM   64  C CG  . GLU A 1 9  ? 2.380   35.116 -1.919  1.00 47.25 ? 109 GLU A CG  1 
ATOM   65  C CD  . GLU A 1 9  ? 1.292   36.180 -1.965  1.00 44.48 ? 109 GLU A CD  1 
ATOM   66  O OE1 . GLU A 1 9  ? 0.195   35.897 -2.492  1.00 45.49 ? 109 GLU A OE1 1 
ATOM   67  O OE2 . GLU A 1 9  ? 1.536   37.301 -1.472  1.00 48.21 ? 109 GLU A OE2 1 
ATOM   68  N N   . LEU A 1 10 ? 1.689   30.759 -1.024  1.00 27.50 ? 110 LEU A N   1 
ATOM   69  C CA  . LEU A 1 10 ? 0.989   29.587 -0.519  1.00 29.29 ? 110 LEU A CA  1 
ATOM   70  C C   . LEU A 1 10 ? 1.931   28.720 0.322   1.00 23.83 ? 110 LEU A C   1 
ATOM   71  O O   . LEU A 1 10 ? 1.562   28.276 1.410   1.00 19.96 ? 110 LEU A O   1 
ATOM   72  C CB  . LEU A 1 10 ? 0.417   28.784 -1.693  1.00 25.05 ? 110 LEU A CB  1 
ATOM   73  C CG  . LEU A 1 10 ? -0.601  27.684 -1.383  1.00 41.38 ? 110 LEU A CG  1 
ATOM   74  C CD1 . LEU A 1 10 ? -1.739  28.254 -0.553  1.00 33.14 ? 110 LEU A CD1 1 
ATOM   75  C CD2 . LEU A 1 10 ? -1.134  27.099 -2.683  1.00 44.60 ? 110 LEU A CD2 1 
ATOM   76  N N   . ASN A 1 11 ? 3.144   28.488 -0.179  1.00 20.95 ? 111 ASN A N   1 
ATOM   77  C CA  . ASN A 1 11 ? 4.124   27.686 0.554   1.00 24.40 ? 111 ASN A CA  1 
ATOM   78  C C   . ASN A 1 11 ? 4.624   28.407 1.801   1.00 19.24 ? 111 ASN A C   1 
ATOM   79  O O   . ASN A 1 11 ? 4.967   27.773 2.798   1.00 21.16 ? 111 ASN A O   1 
ATOM   80  C CB  . ASN A 1 11 ? 5.335   27.342 -0.322  1.00 22.26 ? 111 ASN A CB  1 
ATOM   81  C CG  . ASN A 1 11 ? 5.078   26.169 -1.243  1.00 18.74 ? 111 ASN A CG  1 
ATOM   82  O OD1 . ASN A 1 11 ? 4.396   25.212 -0.873  1.00 22.33 ? 111 ASN A OD1 1 
ATOM   83  N ND2 . ASN A 1 11 ? 5.640   26.227 -2.443  1.00 21.54 ? 111 ASN A ND2 1 
ATOM   84  N N   . ASP A 1 12 ? 4.683   29.731 1.746   1.00 22.23 ? 112 ASP A N   1 
ATOM   85  C CA  . ASP A 1 12 ? 5.154   30.477 2.902   1.00 22.62 ? 112 ASP A CA  1 
ATOM   86  C C   . ASP A 1 12 ? 4.154   30.480 4.049   1.00 19.96 ? 112 ASP A C   1 
ATOM   87  O O   . ASP A 1 12 ? 4.553   30.397 5.209   1.00 26.07 ? 112 ASP A O   1 
ATOM   88  C CB  . ASP A 1 12 ? 5.520   31.915 2.519   1.00 35.89 ? 112 ASP A CB  1 
ATOM   89  C CG  . ASP A 1 12 ? 6.747   31.985 1.629   1.00 34.71 ? 112 ASP A CG  1 
ATOM   90  O OD1 . ASP A 1 12 ? 7.647   31.132 1.792   1.00 44.17 ? 112 ASP A OD1 1 
ATOM   91  O OD2 . ASP A 1 12 ? 6.818   32.896 0.777   1.00 46.48 ? 112 ASP A OD2 1 
ATOM   92  N N   . ARG A 1 13 ? 2.860   30.565 3.747   1.00 22.76 ? 113 ARG A N   1 
ATOM   93  C CA  . ARG A 1 13 ? 1.870   30.569 4.820   1.00 23.95 ? 113 ARG A CA  1 
ATOM   94  C C   . ARG A 1 13 ? 1.732   29.171 5.412   1.00 26.63 ? 113 ARG A C   1 
ATOM   95  O O   . ARG A 1 13 ? 1.436   29.010 6.596   1.00 22.76 ? 113 ARG A O   1 
ATOM   96  C CB  . ARG A 1 13 ? 0.510   31.074 4.325   1.00 32.84 ? 113 ARG A CB  1 
ATOM   97  C CG  . ARG A 1 13 ? -0.187  30.208 3.294   1.00 48.44 ? 113 ARG A CG  1 
ATOM   98  C CD  . ARG A 1 13 ? -1.674  30.547 3.259   1.00 54.71 ? 113 ARG A CD  1 
ATOM   99  N NE  . ARG A 1 13 ? -1.922  31.951 2.936   1.00 62.33 ? 113 ARG A NE  1 
ATOM   100 C CZ  . ARG A 1 13 ? -1.863  32.459 1.708   1.00 66.51 ? 113 ARG A CZ  1 
ATOM   101 N NH1 . ARG A 1 13 ? -1.568  31.675 0.679   1.00 67.53 ? 113 ARG A NH1 1 
ATOM   102 N NH2 . ARG A 1 13 ? -2.092  33.751 1.508   1.00 66.62 ? 113 ARG A NH2 1 
ATOM   103 N N   . PHE A 1 14 ? 1.960   28.164 4.576   1.00 26.77 ? 114 PHE A N   1 
ATOM   104 C CA  . PHE A 1 14 ? 1.897   26.769 4.997   1.00 22.83 ? 114 PHE A CA  1 
ATOM   105 C C   . PHE A 1 14 ? 3.036   26.541 5.999   1.00 19.09 ? 114 PHE A C   1 
ATOM   106 O O   . PHE A 1 14 ? 2.859   25.890 7.025   1.00 19.29 ? 114 PHE A O   1 
ATOM   107 C CB  . PHE A 1 14 ? 2.041   25.865 3.760   1.00 18.14 ? 114 PHE A CB  1 
ATOM   108 C CG  . PHE A 1 14 ? 1.948   24.388 4.053   1.00 32.73 ? 114 PHE A CG  1 
ATOM   109 C CD1 . PHE A 1 14 ? 1.091   23.905 5.036   1.00 26.95 ? 114 PHE A CD1 1 
ATOM   110 C CD2 . PHE A 1 14 ? 2.696   23.475 3.312   1.00 30.34 ? 114 PHE A CD2 1 
ATOM   111 C CE1 . PHE A 1 14 ? 0.978   22.534 5.279   1.00 35.76 ? 114 PHE A CE1 1 
ATOM   112 C CE2 . PHE A 1 14 ? 2.591   22.103 3.545   1.00 36.86 ? 114 PHE A CE2 1 
ATOM   113 C CZ  . PHE A 1 14 ? 1.729   21.632 4.532   1.00 27.90 ? 114 PHE A CZ  1 
ATOM   114 N N   . ALA A 1 15 ? 4.199   27.110 5.710   1.00 20.87 ? 115 ALA A N   1 
ATOM   115 C CA  . ALA A 1 15 ? 5.352   26.981 6.593   1.00 23.93 ? 115 ALA A CA  1 
ATOM   116 C C   . ALA A 1 15 ? 5.130   27.747 7.905   1.00 26.32 ? 115 ALA A C   1 
ATOM   117 O O   . ALA A 1 15 ? 5.448   27.256 8.989   1.00 17.53 ? 115 ALA A O   1 
ATOM   118 C CB  . ALA A 1 15 ? 6.598   27.500 5.884   1.00 19.64 ? 115 ALA A CB  1 
ATOM   119 N N   . ASN A 1 16 ? 4.582   28.954 7.807   1.00 24.68 ? 116 ASN A N   1 
ATOM   120 C CA  . ASN A 1 16 ? 4.334   29.756 9.000   1.00 24.57 ? 116 ASN A CA  1 
ATOM   121 C C   . ASN A 1 16 ? 3.328   29.079 9.920   1.00 15.02 ? 116 ASN A C   1 
ATOM   122 O O   . ASN A 1 16 ? 3.462   29.114 11.143  1.00 16.44 ? 116 ASN A O   1 
ATOM   123 C CB  . ASN A 1 16 ? 3.819   31.147 8.620   1.00 24.38 ? 116 ASN A CB  1 
ATOM   124 C CG  . ASN A 1 16 ? 4.871   31.989 7.925   1.00 34.47 ? 116 ASN A CG  1 
ATOM   125 O OD1 . ASN A 1 16 ? 6.070   31.839 8.173   1.00 33.51 ? 116 ASN A OD1 1 
ATOM   126 N ND2 . ASN A 1 16 ? 4.426   32.897 7.062   1.00 36.64 ? 116 ASN A ND2 1 
ATOM   127 N N   . LEU A 1 17 ? 2.318   28.465 9.318   1.00 17.36 ? 117 LEU A N   1 
ATOM   128 C CA  . LEU A 1 17 ? 1.278   27.783 10.071  1.00 19.55 ? 117 LEU A CA  1 
ATOM   129 C C   . LEU A 1 17 ? 1.857   26.556 10.765  1.00 21.41 ? 117 LEU A C   1 
ATOM   130 O O   . LEU A 1 17 ? 1.501   26.253 11.902  1.00 17.45 ? 117 LEU A O   1 
ATOM   131 C CB  . LEU A 1 17 ? 0.147   27.366 9.132   1.00 21.90 ? 117 LEU A CB  1 
ATOM   132 C CG  . LEU A 1 17 ? -1.227  27.163 9.770   1.00 38.23 ? 117 LEU A CG  1 
ATOM   133 C CD1 . LEU A 1 17 ? -1.701  28.475 10.382  1.00 34.96 ? 117 LEU A CD1 1 
ATOM   134 C CD2 . LEU A 1 17 ? -2.211  26.684 8.714   1.00 39.09 ? 117 LEU A CD2 1 
ATOM   135 N N   . ILE A 1 18 ? 2.745   25.847 10.074  1.00 20.67 ? 118 ILE A N   1 
ATOM   136 C CA  . ILE A 1 18 ? 3.372   24.665 10.651  1.00 14.84 ? 118 ILE A CA  1 
ATOM   137 C C   . ILE A 1 18 ? 4.235   25.095 11.837  1.00 20.58 ? 118 ILE A C   1 
ATOM   138 O O   . ILE A 1 18 ? 4.206   24.464 12.894  1.00 15.30 ? 118 ILE A O   1 
ATOM   139 C CB  . ILE A 1 18 ? 4.244   23.923 9.606   1.00 10.05 ? 118 ILE A CB  1 
ATOM   140 C CG1 . ILE A 1 18 ? 3.346   23.294 8.536   1.00 16.46 ? 118 ILE A CG1 1 
ATOM   141 C CG2 . ILE A 1 18 ? 5.090   22.853 10.289  1.00 12.00 ? 118 ILE A CG2 1 
ATOM   142 C CD1 . ILE A 1 18 ? 4.101   22.665 7.381   1.00 21.41 ? 118 ILE A CD1 1 
ATOM   143 N N   . ASP A 1 19 ? 4.991   26.177 11.662  1.00 19.06 ? 119 ASP A N   1 
ATOM   144 C CA  . ASP A 1 19 ? 5.847   26.687 12.729  1.00 18.45 ? 119 ASP A CA  1 
ATOM   145 C C   . ASP A 1 19 ? 5.035   27.098 13.950  1.00 19.59 ? 119 ASP A C   1 
ATOM   146 O O   . ASP A 1 19 ? 5.444   26.866 15.085  1.00 19.09 ? 119 ASP A O   1 
ATOM   147 C CB  . ASP A 1 19 ? 6.664   27.889 12.247  1.00 16.35 ? 119 ASP A CB  1 
ATOM   148 C CG  . ASP A 1 19 ? 7.691   27.515 11.205  1.00 23.69 ? 119 ASP A CG  1 
ATOM   149 O OD1 . ASP A 1 19 ? 8.169   26.360 11.230  1.00 24.13 ? 119 ASP A OD1 1 
ATOM   150 O OD2 . ASP A 1 19 ? 8.033   28.382 10.370  1.00 29.90 ? 119 ASP A OD2 1 
ATOM   151 N N   . LYS A 1 20 ? 3.883   27.715 13.719  1.00 14.95 ? 120 LYS A N   1 
ATOM   152 C CA  . LYS A 1 20 ? 3.039   28.142 14.824  1.00 21.20 ? 120 LYS A CA  1 
ATOM   153 C C   . LYS A 1 20 ? 2.586   26.932 15.639  1.00 15.27 ? 120 LYS A C   1 
ATOM   154 O O   . LYS A 1 20 ? 2.579   26.968 16.870  1.00 15.40 ? 120 LYS A O   1 
ATOM   155 C CB  . LYS A 1 20 ? 1.821   28.903 14.299  1.00 19.59 ? 120 LYS A CB  1 
ATOM   156 C CG  . LYS A 1 20 ? 1.072   29.655 15.386  1.00 30.26 ? 120 LYS A CG  1 
ATOM   157 C CD  . LYS A 1 20 ? -0.093  30.448 14.818  1.00 36.25 ? 120 LYS A CD  1 
ATOM   158 C CE  . LYS A 1 20 ? -0.678  31.381 15.868  1.00 39.47 ? 120 LYS A CE  1 
ATOM   159 N NZ  . LYS A 1 20 ? 0.306   32.425 16.273  1.00 50.51 ? 120 LYS A NZ  1 
ATOM   160 N N   . VAL A 1 21 ? 2.204   25.860 14.954  1.00 16.85 ? 121 VAL A N   1 
ATOM   161 C CA  . VAL A 1 21 ? 1.768   24.658 15.650  1.00 18.66 ? 121 VAL A CA  1 
ATOM   162 C C   . VAL A 1 21 ? 2.943   24.090 16.447  1.00 14.78 ? 121 VAL A C   1 
ATOM   163 O O   . VAL A 1 21 ? 2.797   23.746 17.614  1.00 17.83 ? 121 VAL A O   1 
ATOM   164 C CB  . VAL A 1 21 ? 1.244   23.589 14.664  1.00 20.84 ? 121 VAL A CB  1 
ATOM   165 C CG1 . VAL A 1 21 ? 0.893   22.313 15.418  1.00 18.46 ? 121 VAL A CG1 1 
ATOM   166 C CG2 . VAL A 1 21 ? 0.013   24.115 13.936  1.00 19.13 ? 121 VAL A CG2 1 
ATOM   167 N N   . ARG A 1 22 ? 4.109   24.009 15.814  1.00 16.05 ? 122 ARG A N   1 
ATOM   168 C CA  . ARG A 1 22 ? 5.309   23.491 16.470  1.00 23.38 ? 122 ARG A CA  1 
ATOM   169 C C   . ARG A 1 22 ? 5.636   24.256 17.762  1.00 20.69 ? 122 ARG A C   1 
ATOM   170 O O   . ARG A 1 22 ? 5.914   23.658 18.806  1.00 15.34 ? 122 ARG A O   1 
ATOM   171 C CB  . ARG A 1 22 ? 6.502   23.578 15.512  1.00 21.99 ? 122 ARG A CB  1 
ATOM   172 C CG  . ARG A 1 22 ? 6.451   22.630 14.316  1.00 23.52 ? 122 ARG A CG  1 
ATOM   173 C CD  . ARG A 1 22 ? 7.642   22.914 13.414  1.00 39.91 ? 122 ARG A CD  1 
ATOM   174 N NE  . ARG A 1 22 ? 8.821   23.138 14.239  1.00 37.58 ? 122 ARG A NE  1 
ATOM   175 C CZ  . ARG A 1 22 ? 9.648   24.170 14.123  1.00 34.81 ? 122 ARG A CZ  1 
ATOM   176 N NH1 . ARG A 1 22 ? 9.449   25.096 13.197  1.00 32.84 ? 122 ARG A NH1 1 
ATOM   177 N NH2 . ARG A 1 22 ? 10.665  24.286 14.963  1.00 45.46 ? 122 ARG A NH2 1 
ATOM   178 N N   . PHE A 1 23 ? 5.613   25.582 17.684  1.00 12.66 ? 123 PHE A N   1 
ATOM   179 C CA  . PHE A 1 23 ? 5.914   26.405 18.847  1.00 9.84  ? 123 PHE A CA  1 
ATOM   180 C C   . PHE A 1 23 ? 4.856   26.269 19.939  1.00 12.35 ? 123 PHE A C   1 
ATOM   181 O O   . PHE A 1 23 ? 5.182   26.186 21.122  1.00 14.53 ? 123 PHE A O   1 
ATOM   182 C CB  . PHE A 1 23 ? 6.071   27.873 18.427  1.00 11.01 ? 123 PHE A CB  1 
ATOM   183 C CG  . PHE A 1 23 ? 7.220   28.109 17.483  1.00 18.11 ? 123 PHE A CG  1 
ATOM   184 C CD1 . PHE A 1 23 ? 8.336   27.273 17.505  1.00 19.88 ? 123 PHE A CD1 1 
ATOM   185 C CD2 . PHE A 1 23 ? 7.204   29.178 16.592  1.00 22.74 ? 123 PHE A CD2 1 
ATOM   186 C CE1 . PHE A 1 23 ? 9.416   27.492 16.651  1.00 21.12 ? 123 PHE A CE1 1 
ATOM   187 C CE2 . PHE A 1 23 ? 8.283   29.406 15.733  1.00 22.26 ? 123 PHE A CE2 1 
ATOM   188 C CZ  . PHE A 1 23 ? 9.391   28.559 15.767  1.00 19.09 ? 123 PHE A CZ  1 
ATOM   189 N N   . LEU A 1 24 ? 3.588   26.238 19.547  1.00 15.10 ? 124 LEU A N   1 
ATOM   190 C CA  . LEU A 1 24 ? 2.522   26.097 20.527  1.00 13.39 ? 124 LEU A CA  1 
ATOM   191 C C   . LEU A 1 24 ? 2.632   24.764 21.260  1.00 12.62 ? 124 LEU A C   1 
ATOM   192 O O   . LEU A 1 24 ? 2.367   24.696 22.457  1.00 14.61 ? 124 LEU A O   1 
ATOM   193 C CB  . LEU A 1 24 ? 1.149   26.236 19.860  1.00 17.04 ? 124 LEU A CB  1 
ATOM   194 C CG  . LEU A 1 24 ? 0.764   27.662 19.443  1.00 16.60 ? 124 LEU A CG  1 
ATOM   195 C CD1 . LEU A 1 24 ? -0.556  27.650 18.661  1.00 17.94 ? 124 LEU A CD1 1 
ATOM   196 C CD2 . LEU A 1 24 ? 0.654   28.538 20.694  1.00 18.68 ? 124 LEU A CD2 1 
ATOM   197 N N   . GLU A 1 25 ? 3.033   23.707 20.558  1.00 14.47 ? 125 GLU A N   1 
ATOM   198 C CA  . GLU A 1 25 ? 3.175   22.407 21.207  1.00 17.62 ? 125 GLU A CA  1 
ATOM   199 C C   . GLU A 1 25 ? 4.369   22.400 22.153  1.00 14.75 ? 125 GLU A C   1 
ATOM   200 O O   . GLU A 1 25 ? 4.308   21.827 23.237  1.00 17.21 ? 125 GLU A O   1 
ATOM   201 C CB  . GLU A 1 25 ? 3.331   21.295 20.169  1.00 17.32 ? 125 GLU A CB  1 
ATOM   202 C CG  . GLU A 1 25 ? 2.124   21.150 19.259  1.00 17.80 ? 125 GLU A CG  1 
ATOM   203 C CD  . GLU A 1 25 ? 2.231   19.950 18.344  1.00 27.63 ? 125 GLU A CD  1 
ATOM   204 O OE1 . GLU A 1 25 ? 3.371   19.564 18.010  1.00 31.40 ? 125 GLU A OE1 1 
ATOM   205 O OE2 . GLU A 1 25 ? 1.179   19.403 17.947  1.00 31.20 ? 125 GLU A OE2 1 
ATOM   206 N N   . GLN A 1 26 ? 5.457   23.039 21.741  1.00 16.18 ? 126 GLN A N   1 
ATOM   207 C CA  . GLN A 1 26 ? 6.644   23.106 22.579  1.00 15.06 ? 126 GLN A CA  1 
ATOM   208 C C   . GLN A 1 26 ? 6.348   23.950 23.818  1.00 14.00 ? 126 GLN A C   1 
ATOM   209 O O   . GLN A 1 26 ? 6.733   23.597 24.933  1.00 12.79 ? 126 GLN A O   1 
ATOM   210 C CB  . GLN A 1 26 ? 7.804   23.704 21.784  1.00 18.56 ? 126 GLN A CB  1 
ATOM   211 C CG  . GLN A 1 26 ? 9.037   23.995 22.608  1.00 28.22 ? 126 GLN A CG  1 
ATOM   212 C CD  . GLN A 1 26 ? 10.200  24.443 21.750  1.00 35.77 ? 126 GLN A CD  1 
ATOM   213 O OE1 . GLN A 1 26 ? 10.067  25.348 20.925  1.00 25.00 ? 126 GLN A OE1 1 
ATOM   214 N NE2 . GLN A 1 26 ? 11.354  23.811 21.942  1.00 32.59 ? 126 GLN A NE2 1 
ATOM   215 N N   . GLN A 1 27 ? 5.657   25.068 23.623  1.00 15.51 ? 127 GLN A N   1 
ATOM   216 C CA  . GLN A 1 27 ? 5.310   25.928 24.744  1.00 13.64 ? 127 GLN A CA  1 
ATOM   217 C C   . GLN A 1 27 ? 4.373   25.164 25.676  1.00 12.98 ? 127 GLN A C   1 
ATOM   218 O O   . GLN A 1 27 ? 4.509   25.225 26.894  1.00 13.06 ? 127 GLN A O   1 
ATOM   219 C CB  . GLN A 1 27 ? 4.638   27.210 24.241  1.00 14.43 ? 127 GLN A CB  1 
ATOM   220 C CG  . GLN A 1 27 ? 5.617   28.212 23.620  1.00 20.51 ? 127 GLN A CG  1 
ATOM   221 C CD  . GLN A 1 27 ? 4.922   29.321 22.850  1.00 19.64 ? 127 GLN A CD  1 
ATOM   222 O OE1 . GLN A 1 27 ? 3.915   29.870 23.299  1.00 27.21 ? 127 GLN A OE1 1 
ATOM   223 N NE2 . GLN A 1 27 ? 5.466   29.664 21.689  1.00 23.30 ? 127 GLN A NE2 1 
ATOM   224 N N   . ASN A 1 28 ? 3.432   24.434 25.087  1.00 15.74 ? 128 ASN A N   1 
ATOM   225 C CA  . ASN A 1 28 ? 2.463   23.647 25.843  1.00 17.59 ? 128 ASN A CA  1 
ATOM   226 C C   . ASN A 1 28 ? 3.150   22.586 26.705  1.00 19.32 ? 128 ASN A C   1 
ATOM   227 O O   . ASN A 1 28 ? 2.800   22.399 27.871  1.00 15.78 ? 128 ASN A O   1 
ATOM   228 C CB  . ASN A 1 28 ? 1.474   22.989 24.868  1.00 24.78 ? 128 ASN A CB  1 
ATOM   229 C CG  . ASN A 1 28 ? 0.498   22.059 25.557  1.00 32.45 ? 128 ASN A CG  1 
ATOM   230 O OD1 . ASN A 1 28 ? 0.696   20.844 25.594  1.00 25.58 ? 128 ASN A OD1 1 
ATOM   231 N ND2 . ASN A 1 28 ? -0.564  22.628 26.112  1.00 19.95 ? 128 ASN A ND2 1 
ATOM   232 N N   A LYS A 1 29 ? 4.128   21.881 26.143  0.60 17.58 ? 129 LYS A N   1 
ATOM   233 N N   B LYS A 1 29 ? 4.139   21.922 26.117  0.40 17.03 ? 129 LYS A N   1 
ATOM   234 C CA  A LYS A 1 29 ? 4.804   20.844 26.914  0.60 21.31 ? 129 LYS A CA  1 
ATOM   235 C CA  B LYS A 1 29 ? 4.905   20.881 26.790  0.40 20.07 ? 129 LYS A CA  1 
ATOM   236 C C   A LYS A 1 29 ? 5.576   21.425 28.098  0.60 18.68 ? 129 LYS A C   1 
ATOM   237 C C   B LYS A 1 29 ? 5.589   21.416 28.044  0.40 17.89 ? 129 LYS A C   1 
ATOM   238 O O   A LYS A 1 29 ? 5.653   20.800 29.154  0.60 16.09 ? 129 LYS A O   1 
ATOM   239 O O   B LYS A 1 29 ? 5.611   20.759 29.083  0.40 18.36 ? 129 LYS A O   1 
ATOM   240 C CB  A LYS A 1 29 ? 5.719   20.001 26.013  0.60 27.33 ? 129 LYS A CB  1 
ATOM   241 C CB  B LYS A 1 29 ? 5.965   20.325 25.833  0.40 20.28 ? 129 LYS A CB  1 
ATOM   242 C CG  A LYS A 1 29 ? 6.861   20.752 25.352  0.60 33.62 ? 129 LYS A CG  1 
ATOM   243 C CG  B LYS A 1 29 ? 6.838   19.222 26.413  0.40 19.88 ? 129 LYS A CG  1 
ATOM   244 C CD  A LYS A 1 29 ? 7.392   19.978 24.141  0.60 35.26 ? 129 LYS A CD  1 
ATOM   245 C CD  B LYS A 1 29 ? 7.965   18.839 25.455  0.40 21.13 ? 129 LYS A CD  1 
ATOM   246 C CE  A LYS A 1 29 ? 8.662   20.630 23.569  0.60 31.75 ? 129 LYS A CE  1 
ATOM   247 C CE  B LYS A 1 29 ? 9.075   19.889 25.418  0.40 21.25 ? 129 LYS A CE  1 
ATOM   248 N NZ  A LYS A 1 29 ? 9.081   19.904 22.320  0.60 31.93 ? 129 LYS A NZ  1 
ATOM   249 N NZ  B LYS A 1 29 ? 8.621   21.238 24.966  0.40 10.80 ? 129 LYS A NZ  1 
ATOM   250 N N   . ILE A 1 30 ? 6.143   22.617 27.938  1.00 14.67 ? 130 ILE A N   1 
ATOM   251 C CA  . ILE A 1 30 ? 6.852   23.236 29.048  1.00 15.27 ? 130 ILE A CA  1 
ATOM   252 C C   . ILE A 1 30 ? 5.872   23.704 30.123  1.00 13.48 ? 130 ILE A C   1 
ATOM   253 O O   . ILE A 1 30 ? 6.141   23.567 31.315  1.00 11.06 ? 130 ILE A O   1 
ATOM   254 C CB  . ILE A 1 30 ? 7.712   24.422 28.575  1.00 15.32 ? 130 ILE A CB  1 
ATOM   255 C CG1 . ILE A 1 30 ? 8.859   23.908 27.702  1.00 24.43 ? 130 ILE A CG1 1 
ATOM   256 C CG2 . ILE A 1 30 ? 8.282   25.163 29.771  1.00 28.15 ? 130 ILE A CG2 1 
ATOM   257 C CD1 . ILE A 1 30 ? 9.773   22.912 28.409  1.00 37.62 ? 130 ILE A CD1 1 
ATOM   258 N N   . LEU A 1 31 ? 4.735   24.250 29.704  1.00 11.80 ? 131 LEU A N   1 
ATOM   259 C CA  . LEU A 1 31 ? 3.730   24.709 30.655  1.00 11.44 ? 131 LEU A CA  1 
ATOM   260 C C   . LEU A 1 31 ? 3.193   23.526 31.479  1.00 12.50 ? 131 LEU A C   1 
ATOM   261 O O   . LEU A 1 31 ? 2.970   23.651 32.683  1.00 17.20 ? 131 LEU A O   1 
ATOM   262 C CB  . LEU A 1 31 ? 2.586   25.419 29.915  1.00 14.49 ? 131 LEU A CB  1 
ATOM   263 C CG  . LEU A 1 31 ? 2.931   26.768 29.265  1.00 15.53 ? 131 LEU A CG  1 
ATOM   264 C CD1 . LEU A 1 31 ? 1.769   27.268 28.416  1.00 14.38 ? 131 LEU A CD1 1 
ATOM   265 C CD2 . LEU A 1 31 ? 3.277   27.774 30.358  1.00 14.74 ? 131 LEU A CD2 1 
ATOM   266 N N   . LEU A 1 32 ? 2.995   22.384 30.826  1.00 15.51 ? 132 LEU A N   1 
ATOM   267 C CA  . LEU A 1 32 ? 2.504   21.186 31.503  1.00 14.37 ? 132 LEU A CA  1 
ATOM   268 C C   . LEU A 1 32 ? 3.520   20.721 32.544  1.00 22.85 ? 132 LEU A C   1 
ATOM   269 O O   . LEU A 1 32 ? 3.157   20.327 33.657  1.00 17.48 ? 132 LEU A O   1 
ATOM   270 C CB  . LEU A 1 32 ? 2.262   20.064 30.486  1.00 18.37 ? 132 LEU A CB  1 
ATOM   271 C CG  . LEU A 1 32 ? 1.100   20.245 29.505  1.00 23.31 ? 132 LEU A CG  1 
ATOM   272 C CD1 . LEU A 1 32 ? 1.082   19.095 28.498  1.00 25.77 ? 132 LEU A CD1 1 
ATOM   273 C CD2 . LEU A 1 32 ? -0.211  20.307 30.284  1.00 26.76 ? 132 LEU A CD2 1 
ATOM   274 N N   . ALA A 1 33 ? 4.797   20.771 32.169  1.00 17.23 ? 133 ALA A N   1 
ATOM   275 C CA  . ALA A 1 33 ? 5.882   20.354 33.053  1.00 17.09 ? 133 ALA A CA  1 
ATOM   276 C C   . ALA A 1 33 ? 5.960   21.254 34.280  1.00 21.11 ? 133 ALA A C   1 
ATOM   277 O O   . ALA A 1 33 ? 6.155   20.775 35.395  1.00 20.22 ? 133 ALA A O   1 
ATOM   278 C CB  . ALA A 1 33 ? 7.214   20.374 32.302  1.00 17.65 ? 133 ALA A CB  1 
ATOM   279 N N   . GLU A 1 34 ? 5.804   22.558 34.076  1.00 16.53 ? 134 GLU A N   1 
ATOM   280 C CA  . GLU A 1 34 ? 5.853   23.503 35.183  1.00 13.97 ? 134 GLU A CA  1 
ATOM   281 C C   . GLU A 1 34 ? 4.664   23.321 36.131  1.00 15.16 ? 134 GLU A C   1 
ATOM   282 O O   . GLU A 1 34 ? 4.831   23.335 37.347  1.00 14.89 ? 134 GLU A O   1 
ATOM   283 C CB  . GLU A 1 34 ? 5.897   24.942 34.647  1.00 21.77 ? 134 GLU A CB  1 
ATOM   284 C CG  . GLU A 1 34 ? 7.035   25.190 33.645  1.00 23.28 ? 134 GLU A CG  1 
ATOM   285 C CD  . GLU A 1 34 ? 7.100   26.631 33.146  1.00 23.06 ? 134 GLU A CD  1 
ATOM   286 O OE1 . GLU A 1 34 ? 6.036   27.270 33.019  1.00 18.38 ? 134 GLU A OE1 1 
ATOM   287 O OE2 . GLU A 1 34 ? 8.218   27.120 32.866  1.00 22.63 ? 134 GLU A OE2 1 
ATOM   288 N N   . LEU A 1 35 ? 3.465   23.146 35.583  1.00 15.91 ? 135 LEU A N   1 
ATOM   289 C CA  . LEU A 1 35 ? 2.286   22.968 36.425  1.00 14.21 ? 135 LEU A CA  1 
ATOM   290 C C   . LEU A 1 35 ? 2.454   21.677 37.208  1.00 19.53 ? 135 LEU A C   1 
ATOM   291 O O   . LEU A 1 35 ? 2.041   21.568 38.358  1.00 22.82 ? 135 LEU A O   1 
ATOM   292 C CB  . LEU A 1 35 ? 1.014   22.909 35.568  1.00 13.49 ? 135 LEU A CB  1 
ATOM   293 C CG  . LEU A 1 35 ? -0.317  22.963 36.326  1.00 24.93 ? 135 LEU A CG  1 
ATOM   294 C CD1 . LEU A 1 35 ? -0.398  24.257 37.129  1.00 19.60 ? 135 LEU A CD1 1 
ATOM   295 C CD2 . LEU A 1 35 ? -1.476  22.887 35.336  1.00 22.90 ? 135 LEU A CD2 1 
ATOM   296 N N   . GLU A 1 36 ? 3.086   20.707 36.563  1.00 22.57 ? 136 GLU A N   1 
ATOM   297 C CA  . GLU A 1 36 ? 3.345   19.398 37.150  1.00 25.66 ? 136 GLU A CA  1 
ATOM   298 C C   . GLU A 1 36 ? 4.196   19.529 38.421  1.00 35.82 ? 136 GLU A C   1 
ATOM   299 O O   . GLU A 1 36 ? 3.982   18.802 39.393  1.00 33.58 ? 136 GLU A O   1 
ATOM   300 C CB  . GLU A 1 36 ? 4.082   18.537 36.132  1.00 32.67 ? 136 GLU A CB  1 
ATOM   301 C CG  . GLU A 1 36 ? 3.788   17.045 36.182  1.00 48.62 ? 136 GLU A CG  1 
ATOM   302 C CD  . GLU A 1 36 ? 4.254   16.342 34.915  1.00 60.51 ? 136 GLU A CD  1 
ATOM   303 O OE1 . GLU A 1 36 ? 5.469   16.383 34.616  1.00 57.42 ? 136 GLU A OE1 1 
ATOM   304 O OE2 . GLU A 1 36 ? 3.403   15.759 34.210  1.00 67.57 ? 136 GLU A OE2 1 
ATOM   305 N N   . GLN A 1 37 ? 5.158   20.454 38.416  1.00 37.03 ? 137 GLN A N   1 
ATOM   306 C CA  . GLN A 1 37 ? 6.018   20.667 39.582  1.00 35.28 ? 137 GLN A CA  1 
ATOM   307 C C   . GLN A 1 37 ? 5.194   21.257 40.725  1.00 36.28 ? 137 GLN A C   1 
ATOM   308 O O   . GLN A 1 37 ? 5.431   20.972 41.885  1.00 34.02 ? 137 GLN A O   1 
ATOM   309 C CB  . GLN A 1 37 ? 7.161   21.624 39.244  1.00 38.27 ? 137 GLN A CB  1 
ATOM   310 C CG  . GLN A 1 37 ? 7.971   21.254 38.017  1.00 43.04 ? 137 GLN A CG  1 
ATOM   311 C CD  . GLN A 1 37 ? 9.099   22.229 37.736  1.00 47.24 ? 137 GLN A CD  1 
ATOM   312 O OE1 . GLN A 1 37 ? 9.761   22.163 36.689  1.00 46.66 ? 137 GLN A OE1 1 
ATOM   313 N NE2 . GLN A 1 37 ? 9.335   23.130 38.677  1.00 34.31 ? 137 GLN A NE2 1 
ATOM   314 N N   . LEU A 1 38 ? 4.203   22.067 40.384  1.00 37.02 ? 138 LEU A N   1 
ATOM   315 C CA  . LEU A 1 38 ? 3.360   22.675 41.397  1.00 37.20 ? 138 LEU A CA  1 
ATOM   316 C C   . LEU A 1 38 ? 2.277   21.724 41.878  1.00 40.34 ? 138 LEU A C   1 
ATOM   317 O O   . LEU A 1 38 ? 1.483   22.073 42.750  1.00 48.38 ? 138 LEU A O   1 
ATOM   318 C CB  . LEU A 1 38 ? 2.771   24.000 40.883  1.00 34.02 ? 138 LEU A CB  1 
ATOM   319 C CG  . LEU A 1 38 ? 3.569   25.304 41.116  1.00 38.18 ? 138 LEU A CG  1 
ATOM   320 C CD1 . LEU A 1 38 ? 5.032   25.133 40.714  1.00 41.60 ? 138 LEU A CD1 1 
ATOM   321 C CD2 . LEU A 1 38 ? 2.931   26.453 40.316  1.00 36.14 ? 138 LEU A CD2 1 
HETATM 322 N N   . NH2 A 1 39 ? 2.283   20.499 41.360  1.00 41.87 ? 139 NH2 A N   1 
HETATM 323 C C   . ACE B 1 1  ? -2.688  17.085 -10.484 1.00 74.63 ? 101 ACE B C   1 
HETATM 324 O O   . ACE B 1 1  ? -1.798  16.284 -10.200 1.00 76.74 ? 101 ACE B O   1 
HETATM 325 C CH3 . ACE B 1 1  ? -2.351  18.521 -10.778 1.00 76.58 ? 101 ACE B CH3 1 
ATOM   326 N N   . ASN B 1 2  ? -3.970  16.722 -10.557 1.00 75.81 ? 102 ASN B N   1 
ATOM   327 C CA  . ASN B 1 2  ? -5.065  17.640 -10.879 1.00 73.44 ? 102 ASN B CA  1 
ATOM   328 C C   . ASN B 1 2  ? -5.179  18.734 -9.826  1.00 76.04 ? 102 ASN B C   1 
ATOM   329 O O   . ASN B 1 2  ? -5.394  18.460 -8.645  1.00 76.49 ? 102 ASN B O   1 
ATOM   330 C CB  . ASN B 1 2  ? -6.386  16.864 -10.980 1.00 71.90 ? 102 ASN B CB  1 
ATOM   331 C CG  . ASN B 1 2  ? -7.582  17.655 -10.476 1.00 68.13 ? 102 ASN B CG  1 
ATOM   332 O OD1 . ASN B 1 2  ? -7.864  18.756 -10.949 1.00 66.93 ? 102 ASN B OD1 1 
ATOM   333 N ND2 . ASN B 1 2  ? -8.298  17.084 -9.513  1.00 57.25 ? 102 ASN B ND2 1 
ATOM   334 N N   . GLU B 1 3  ? -5.037  19.976 -10.272 1.00 76.10 ? 103 GLU B N   1 
ATOM   335 C CA  . GLU B 1 3  ? -5.095  21.123 -9.384  1.00 76.87 ? 103 GLU B CA  1 
ATOM   336 C C   . GLU B 1 3  ? -6.514  21.621 -9.139  1.00 77.17 ? 103 GLU B C   1 
ATOM   337 O O   . GLU B 1 3  ? -6.906  22.701 -9.576  1.00 77.55 ? 103 GLU B O   1 
ATOM   338 C CB  . GLU B 1 3  ? -4.204  22.234 -9.940  1.00 76.25 ? 103 GLU B CB  1 
ATOM   339 C CG  . GLU B 1 3  ? -2.751  21.787 -10.067 1.00 81.20 ? 103 GLU B CG  1 
ATOM   340 C CD  . GLU B 1 3  ? -1.876  22.789 -10.790 1.00 82.20 ? 103 GLU B CD  1 
ATOM   341 O OE1 . GLU B 1 3  ? -2.224  23.166 -11.927 1.00 83.83 ? 103 GLU B OE1 1 
ATOM   342 O OE2 . GLU B 1 3  ? -0.836  23.192 -10.226 1.00 81.71 ? 103 GLU B OE2 1 
ATOM   343 N N   . LYS B 1 4  ? -7.271  20.791 -8.433  1.00 76.71 ? 104 LYS B N   1 
ATOM   344 C CA  . LYS B 1 4  ? -8.648  21.061 -8.047  1.00 74.31 ? 104 LYS B CA  1 
ATOM   345 C C   . LYS B 1 4  ? -8.800  20.194 -6.808  1.00 71.84 ? 104 LYS B C   1 
ATOM   346 O O   . LYS B 1 4  ? -9.381  20.602 -5.800  1.00 71.27 ? 104 LYS B O   1 
ATOM   347 C CB  . LYS B 1 4  ? -9.609  20.611 -9.136  1.00 74.28 ? 104 LYS B CB  1 
ATOM   348 N N   . VAL B 1 5  ? -8.246  18.990 -6.907  1.00 68.24 ? 105 VAL B N   1 
ATOM   349 C CA  . VAL B 1 5  ? -8.249  18.029 -5.817  1.00 62.15 ? 105 VAL B CA  1 
ATOM   350 C C   . VAL B 1 5  ? -7.034  18.338 -4.950  1.00 62.73 ? 105 VAL B C   1 
ATOM   351 O O   . VAL B 1 5  ? -7.068  18.148 -3.737  1.00 58.20 ? 105 VAL B O   1 
ATOM   352 C CB  . VAL B 1 5  ? -8.146  16.577 -6.347  1.00 59.65 ? 105 VAL B CB  1 
ATOM   353 C CG1 . VAL B 1 5  ? -7.758  15.624 -5.221  1.00 58.17 ? 105 VAL B CG1 1 
ATOM   354 C CG2 . VAL B 1 5  ? -9.477  16.153 -6.945  1.00 65.43 ? 105 VAL B CG2 1 
ATOM   355 N N   . GLU B 1 6  ? -5.967  18.825 -5.581  1.00 59.06 ? 106 GLU B N   1 
ATOM   356 C CA  . GLU B 1 6  ? -4.738  19.164 -4.868  1.00 57.89 ? 106 GLU B CA  1 
ATOM   357 C C   . GLU B 1 6  ? -4.877  20.475 -4.106  1.00 55.10 ? 106 GLU B C   1 
ATOM   358 O O   . GLU B 1 6  ? -4.290  20.645 -3.037  1.00 51.58 ? 106 GLU B O   1 
ATOM   359 C CB  . GLU B 1 6  ? -3.555  19.267 -5.839  1.00 58.98 ? 106 GLU B CB  1 
ATOM   360 C CG  . GLU B 1 6  ? -3.192  17.959 -6.528  1.00 69.21 ? 106 GLU B CG  1 
ATOM   361 C CD  . GLU B 1 6  ? -1.809  17.996 -7.157  1.00 71.35 ? 106 GLU B CD  1 
ATOM   362 O OE1 . GLU B 1 6  ? -1.532  18.934 -7.935  1.00 74.07 ? 106 GLU B OE1 1 
ATOM   363 O OE2 . GLU B 1 6  ? -1.001  17.085 -6.873  1.00 67.28 ? 106 GLU B OE2 1 
ATOM   364 N N   . LEU B 1 7  ? -5.653  21.400 -4.660  1.00 54.45 ? 107 LEU B N   1 
ATOM   365 C CA  . LEU B 1 7  ? -5.863  22.693 -4.023  1.00 54.49 ? 107 LEU B CA  1 
ATOM   366 C C   . LEU B 1 7  ? -7.054  22.681 -3.070  1.00 55.93 ? 107 LEU B C   1 
ATOM   367 O O   . LEU B 1 7  ? -7.431  23.711 -2.509  1.00 58.99 ? 107 LEU B O   1 
ATOM   368 C CB  . LEU B 1 7  ? -6.015  23.782 -5.087  1.00 54.53 ? 107 LEU B CB  1 
ATOM   369 C CG  . LEU B 1 7  ? -4.679  24.383 -5.550  1.00 60.82 ? 107 LEU B CG  1 
ATOM   370 C CD1 . LEU B 1 7  ? -3.675  23.281 -5.871  1.00 68.79 ? 107 LEU B CD1 1 
ATOM   371 C CD2 . LEU B 1 7  ? -4.914  25.269 -6.760  1.00 66.00 ? 107 LEU B CD2 1 
ATOM   372 N N   . GLN B 1 8  ? -7.641  21.501 -2.899  1.00 51.95 ? 108 GLN B N   1 
ATOM   373 C CA  . GLN B 1 8  ? -8.755  21.299 -1.981  1.00 48.69 ? 108 GLN B CA  1 
ATOM   374 C C   . GLN B 1 8  ? -8.137  20.478 -0.856  1.00 47.91 ? 108 GLN B C   1 
ATOM   375 O O   . GLN B 1 8  ? -8.665  20.414 0.255   1.00 39.81 ? 108 GLN B O   1 
ATOM   376 C CB  . GLN B 1 8  ? -9.884  20.514 -2.652  1.00 51.73 ? 108 GLN B CB  1 
ATOM   377 C CG  . GLN B 1 8  ? -11.029 20.096 -1.722  1.00 45.36 ? 108 GLN B CG  1 
ATOM   378 C CD  . GLN B 1 8  ? -11.728 21.272 -1.057  1.00 51.29 ? 108 GLN B CD  1 
ATOM   379 O OE1 . GLN B 1 8  ? -11.185 21.903 -0.148  1.00 60.16 ? 108 GLN B OE1 1 
ATOM   380 N NE2 . GLN B 1 8  ? -12.941 21.572 -1.512  1.00 61.12 ? 108 GLN B NE2 1 
ATOM   381 N N   . GLU B 1 9  ? -7.003  19.854 -1.169  1.00 42.77 ? 109 GLU B N   1 
ATOM   382 C CA  . GLU B 1 9  ? -6.266  19.048 -0.203  1.00 42.22 ? 109 GLU B CA  1 
ATOM   383 C C   . GLU B 1 9  ? -5.481  19.975 0.714   1.00 33.89 ? 109 GLU B C   1 
ATOM   384 O O   . GLU B 1 9  ? -5.565  19.857 1.935   1.00 33.27 ? 109 GLU B O   1 
ATOM   385 C CB  . GLU B 1 9  ? -5.306  18.087 -0.910  1.00 48.42 ? 109 GLU B CB  1 
ATOM   386 C CG  . GLU B 1 9  ? -5.992  16.928 -1.621  1.00 59.54 ? 109 GLU B CG  1 
ATOM   387 C CD  . GLU B 1 9  ? -5.021  16.080 -2.421  1.00 61.17 ? 109 GLU B CD  1 
ATOM   388 O OE1 . GLU B 1 9  ? -4.563  15.036 -1.906  1.00 66.83 ? 109 GLU B OE1 1 
ATOM   389 O OE2 . GLU B 1 9  ? -4.704  16.469 -3.565  1.00 66.28 ? 109 GLU B OE2 1 
ATOM   390 N N   . LEU B 1 10 ? -4.716  20.893 0.126   1.00 36.97 ? 110 LEU B N   1 
ATOM   391 C CA  . LEU B 1 10 ? -3.945  21.843 0.921   1.00 39.48 ? 110 LEU B CA  1 
ATOM   392 C C   . LEU B 1 10 ? -4.907  22.622 1.807   1.00 41.55 ? 110 LEU B C   1 
ATOM   393 O O   . LEU B 1 10 ? -4.579  22.970 2.941   1.00 38.53 ? 110 LEU B O   1 
ATOM   394 C CB  . LEU B 1 10 ? -3.170  22.813 0.023   1.00 42.36 ? 110 LEU B CB  1 
ATOM   395 C CG  . LEU B 1 10 ? -1.723  22.445 -0.321  1.00 47.34 ? 110 LEU B CG  1 
ATOM   396 C CD1 . LEU B 1 10 ? -1.127  23.504 -1.237  1.00 46.47 ? 110 LEU B CD1 1 
ATOM   397 C CD2 . LEU B 1 10 ? -0.904  22.337 0.960   1.00 42.31 ? 110 LEU B CD2 1 
ATOM   398 N N   . ASN B 1 11 ? -6.099  22.887 1.282   1.00 35.06 ? 111 ASN B N   1 
ATOM   399 C CA  . ASN B 1 11 ? -7.123  23.610 2.024   1.00 33.65 ? 111 ASN B CA  1 
ATOM   400 C C   . ASN B 1 11 ? -7.470  22.839 3.297   1.00 32.92 ? 111 ASN B C   1 
ATOM   401 O O   . ASN B 1 11 ? -7.510  23.411 4.387   1.00 30.06 ? 111 ASN B O   1 
ATOM   402 C CB  . ASN B 1 11 ? -8.376  23.778 1.164   1.00 33.17 ? 111 ASN B CB  1 
ATOM   403 C CG  . ASN B 1 11 ? -9.461  24.569 1.865   1.00 47.20 ? 111 ASN B CG  1 
ATOM   404 O OD1 . ASN B 1 11 ? -9.316  25.768 2.100   1.00 42.36 ? 111 ASN B OD1 1 
ATOM   405 N ND2 . ASN B 1 11 ? -10.555 23.898 2.209   1.00 48.82 ? 111 ASN B ND2 1 
ATOM   406 N N   . ASP B 1 12 ? -7.721  21.538 3.148   1.00 35.66 ? 112 ASP B N   1 
ATOM   407 C CA  . ASP B 1 12 ? -8.052  20.679 4.281   1.00 31.05 ? 112 ASP B CA  1 
ATOM   408 C C   . ASP B 1 12 ? -6.889  20.643 5.273   1.00 33.64 ? 112 ASP B C   1 
ATOM   409 O O   . ASP B 1 12 ? -7.100  20.610 6.484   1.00 28.96 ? 112 ASP B O   1 
ATOM   410 C CB  . ASP B 1 12 ? -8.378  19.255 3.807   1.00 33.43 ? 112 ASP B CB  1 
ATOM   411 C CG  . ASP B 1 12 ? -9.752  19.150 3.156   1.00 46.63 ? 112 ASP B CG  1 
ATOM   412 O OD1 . ASP B 1 12 ? -10.498 20.153 3.152   1.00 45.43 ? 112 ASP B OD1 1 
ATOM   413 O OD2 . ASP B 1 12 ? -10.089 18.056 2.652   1.00 41.97 ? 112 ASP B OD2 1 
ATOM   414 N N   A ARG B 1 13 ? -5.659  20.635 4.770   0.60 28.66 ? 113 ARG B N   1 
ATOM   415 N N   B ARG B 1 13 ? -5.670  20.652 4.741   0.40 29.34 ? 113 ARG B N   1 
ATOM   416 C CA  A ARG B 1 13 ? -4.512  20.619 5.667   0.60 29.34 ? 113 ARG B CA  1 
ATOM   417 C CA  B ARG B 1 13 ? -4.456  20.642 5.552   0.40 29.70 ? 113 ARG B CA  1 
ATOM   418 C C   A ARG B 1 13 ? -4.437  21.949 6.411   0.60 22.16 ? 113 ARG B C   1 
ATOM   419 C C   B ARG B 1 13 ? -4.390  21.933 6.365   0.40 25.27 ? 113 ARG B C   1 
ATOM   420 O O   A ARG B 1 13 ? -4.183  21.979 7.616   0.60 20.64 ? 113 ARG B O   1 
ATOM   421 O O   B ARG B 1 13 ? -4.102  21.917 7.562   0.40 25.17 ? 113 ARG B O   1 
ATOM   422 C CB  A ARG B 1 13 ? -3.217  20.355 4.892   0.60 25.75 ? 113 ARG B CB  1 
ATOM   423 C CB  B ARG B 1 13 ? -3.229  20.538 4.639   0.40 27.56 ? 113 ARG B CB  1 
ATOM   424 C CG  A ARG B 1 13 ? -3.089  18.917 4.393   0.60 24.01 ? 113 ARG B CG  1 
ATOM   425 C CG  B ARG B 1 13 ? -1.881  20.659 5.339   0.40 30.60 ? 113 ARG B CG  1 
ATOM   426 C CD  A ARG B 1 13 ? -1.742  18.667 3.732   0.60 26.95 ? 113 ARG B CD  1 
ATOM   427 C CD  B ARG B 1 13 ? -1.568  19.464 6.229   0.40 30.38 ? 113 ARG B CD  1 
ATOM   428 N NE  A ARG B 1 13 ? -1.639  17.318 3.175   0.60 19.50 ? 113 ARG B NE  1 
ATOM   429 N NE  B ARG B 1 13 ? -0.236  19.585 6.819   0.40 26.05 ? 113 ARG B NE  1 
ATOM   430 C CZ  A ARG B 1 13 ? -1.578  16.204 3.898   0.60 14.14 ? 113 ARG B CZ  1 
ATOM   431 C CZ  B ARG B 1 13 ? 0.295   18.717 7.675   0.40 27.86 ? 113 ARG B CZ  1 
ATOM   432 N NH1 A ARG B 1 13 ? -1.605  16.258 5.223   0.60 22.30 ? 113 ARG B NH1 1 
ATOM   433 N NH1 B ARG B 1 13 ? -0.388  17.647 8.056   0.40 31.40 ? 113 ARG B NH1 1 
ATOM   434 N NH2 A ARG B 1 13 ? -1.487  15.028 3.291   0.60 26.11 ? 113 ARG B NH2 1 
ATOM   435 N NH2 B ARG B 1 13 ? 1.516   18.922 8.150   0.40 32.75 ? 113 ARG B NH2 1 
ATOM   436 N N   . PHE B 1 14 ? -4.666  23.047 5.693   1.00 21.59 ? 114 PHE B N   1 
ATOM   437 C CA  . PHE B 1 14 ? -4.648  24.369 6.311   1.00 26.35 ? 114 PHE B CA  1 
ATOM   438 C C   . PHE B 1 14 ? -5.727  24.446 7.385   1.00 26.37 ? 114 PHE B C   1 
ATOM   439 O O   . PHE B 1 14 ? -5.503  24.997 8.463   1.00 28.18 ? 114 PHE B O   1 
ATOM   440 C CB  . PHE B 1 14 ? -4.899  25.456 5.258   1.00 28.25 ? 114 PHE B CB  1 
ATOM   441 C CG  . PHE B 1 14 ? -3.700  25.773 4.400   1.00 42.60 ? 114 PHE B CG  1 
ATOM   442 C CD1 . PHE B 1 14 ? -2.600  24.919 4.356   1.00 37.89 ? 114 PHE B CD1 1 
ATOM   443 C CD2 . PHE B 1 14 ? -3.678  26.929 3.626   1.00 43.19 ? 114 PHE B CD2 1 
ATOM   444 C CE1 . PHE B 1 14 ? -1.501  25.215 3.554   1.00 40.08 ? 114 PHE B CE1 1 
ATOM   445 C CE2 . PHE B 1 14 ? -2.582  27.231 2.821   1.00 46.71 ? 114 PHE B CE2 1 
ATOM   446 C CZ  . PHE B 1 14 ? -1.492  26.372 2.787   1.00 41.21 ? 114 PHE B CZ  1 
ATOM   447 N N   . ALA B 1 15 ? -6.898  23.892 7.084   1.00 29.86 ? 115 ALA B N   1 
ATOM   448 C CA  . ALA B 1 15 ? -8.014  23.890 8.025   1.00 29.92 ? 115 ALA B CA  1 
ATOM   449 C C   . ALA B 1 15 ? -7.668  23.107 9.286   1.00 30.21 ? 115 ALA B C   1 
ATOM   450 O O   . ALA B 1 15 ? -7.897  23.579 10.399  1.00 26.76 ? 115 ALA B O   1 
ATOM   451 C CB  . ALA B 1 15 ? -9.248  23.295 7.372   1.00 30.65 ? 115 ALA B CB  1 
ATOM   452 N N   . ASN B 1 16 ? -7.122  21.908 9.116   1.00 31.24 ? 116 ASN B N   1 
ATOM   453 C CA  . ASN B 1 16 ? -6.754  21.089 10.266  1.00 31.10 ? 116 ASN B CA  1 
ATOM   454 C C   . ASN B 1 16 ? -5.684  21.762 11.125  1.00 26.08 ? 116 ASN B C   1 
ATOM   455 O O   . ASN B 1 16 ? -5.701  21.646 12.350  1.00 25.67 ? 116 ASN B O   1 
ATOM   456 C CB  . ASN B 1 16 ? -6.262  19.713 9.812   1.00 34.32 ? 116 ASN B CB  1 
ATOM   457 C CG  . ASN B 1 16 ? -7.359  18.888 9.169   1.00 44.95 ? 116 ASN B CG  1 
ATOM   458 O OD1 . ASN B 1 16 ? -8.526  18.981 9.555   1.00 45.41 ? 116 ASN B OD1 1 
ATOM   459 N ND2 . ASN B 1 16 ? -6.990  18.061 8.194   1.00 43.65 ? 116 ASN B ND2 1 
ATOM   460 N N   . LEU B 1 17 ? -4.753  22.460 10.481  1.00 26.46 ? 117 LEU B N   1 
ATOM   461 C CA  . LEU B 1 17 ? -3.687  23.150 11.205  1.00 28.61 ? 117 LEU B CA  1 
ATOM   462 C C   . LEU B 1 17 ? -4.253  24.295 12.042  1.00 28.03 ? 117 LEU B C   1 
ATOM   463 O O   . LEU B 1 17 ? -3.786  24.555 13.151  1.00 23.03 ? 117 LEU B O   1 
ATOM   464 C CB  . LEU B 1 17 ? -2.640  23.696 10.229  1.00 28.92 ? 117 LEU B CB  1 
ATOM   465 C CG  . LEU B 1 17 ? -1.710  22.688 9.543   1.00 31.36 ? 117 LEU B CG  1 
ATOM   466 C CD1 . LEU B 1 17 ? -0.834  23.405 8.527   1.00 25.23 ? 117 LEU B CD1 1 
ATOM   467 C CD2 . LEU B 1 17 ? -0.849  21.991 10.583  1.00 26.92 ? 117 LEU B CD2 1 
ATOM   468 N N   . ILE B 1 18 ? -5.262  24.975 11.509  1.00 27.60 ? 118 ILE B N   1 
ATOM   469 C CA  . ILE B 1 18 ? -5.881  26.086 12.221  1.00 25.49 ? 118 ILE B CA  1 
ATOM   470 C C   . ILE B 1 18 ? -6.682  25.585 13.422  1.00 26.23 ? 118 ILE B C   1 
ATOM   471 O O   . ILE B 1 18 ? -6.696  26.226 14.470  1.00 23.83 ? 118 ILE B O   1 
ATOM   472 C CB  . ILE B 1 18 ? -6.788  26.909 11.284  1.00 31.62 ? 118 ILE B CB  1 
ATOM   473 C CG1 . ILE B 1 18 ? -5.930  27.561 10.195  1.00 34.79 ? 118 ILE B CG1 1 
ATOM   474 C CG2 . ILE B 1 18 ? -7.541  27.971 12.078  1.00 25.39 ? 118 ILE B CG2 1 
ATOM   475 C CD1 . ILE B 1 18 ? -6.720  28.345 9.163   1.00 34.16 ? 118 ILE B CD1 1 
ATOM   476 N N   . ASP B 1 19 ? -7.347  24.442 13.277  1.00 29.54 ? 119 ASP B N   1 
ATOM   477 C CA  . ASP B 1 19 ? -8.106  23.881 14.391  1.00 28.59 ? 119 ASP B CA  1 
ATOM   478 C C   . ASP B 1 19 ? -7.125  23.553 15.504  1.00 32.88 ? 119 ASP B C   1 
ATOM   479 O O   . ASP B 1 19 ? -7.403  23.765 16.686  1.00 29.56 ? 119 ASP B O   1 
ATOM   480 C CB  . ASP B 1 19 ? -8.835  22.600 13.976  1.00 35.44 ? 119 ASP B CB  1 
ATOM   481 C CG  . ASP B 1 19 ? -10.116 22.876 13.220  1.00 44.65 ? 119 ASP B CG  1 
ATOM   482 O OD1 . ASP B 1 19 ? -10.577 24.037 13.240  1.00 39.69 ? 119 ASP B OD1 1 
ATOM   483 O OD2 . ASP B 1 19 ? -10.670 21.929 12.618  1.00 47.09 ? 119 ASP B OD2 1 
ATOM   484 N N   . LYS B 1 20 ? -5.975  23.027 15.100  1.00 30.58 ? 120 LYS B N   1 
ATOM   485 C CA  . LYS B 1 20 ? -4.904  22.648 16.012  1.00 27.44 ? 120 LYS B CA  1 
ATOM   486 C C   . LYS B 1 20 ? -4.405  23.890 16.747  1.00 22.21 ? 120 LYS B C   1 
ATOM   487 O O   . LYS B 1 20 ? -4.179  23.863 17.958  1.00 29.01 ? 120 LYS B O   1 
ATOM   488 C CB  . LYS B 1 20 ? -3.763  22.026 15.207  1.00 33.48 ? 120 LYS B CB  1 
ATOM   489 C CG  . LYS B 1 20 ? -2.849  21.103 15.987  1.00 50.01 ? 120 LYS B CG  1 
ATOM   490 C CD  . LYS B 1 20 ? -2.895  19.693 15.406  1.00 49.90 ? 120 LYS B CD  1 
ATOM   491 C CE  . LYS B 1 20 ? -2.502  19.674 13.932  1.00 44.22 ? 120 LYS B CE  1 
ATOM   492 N NZ  . LYS B 1 20 ? -2.583  18.302 13.351  1.00 50.01 ? 120 LYS B NZ  1 
ATOM   493 N N   . VAL B 1 21 ? -4.239  24.978 16.002  1.00 19.21 ? 121 VAL B N   1 
ATOM   494 C CA  . VAL B 1 21 ? -3.774  26.246 16.560  1.00 17.78 ? 121 VAL B CA  1 
ATOM   495 C C   . VAL B 1 21 ? -4.742  26.786 17.609  1.00 23.23 ? 121 VAL B C   1 
ATOM   496 O O   . VAL B 1 21 ? -4.325  27.260 18.663  1.00 20.73 ? 121 VAL B O   1 
ATOM   497 C CB  . VAL B 1 21 ? -3.595  27.307 15.451  1.00 20.57 ? 121 VAL B CB  1 
ATOM   498 C CG1 . VAL B 1 21 ? -3.451  28.692 16.066  1.00 22.47 ? 121 VAL B CG1 1 
ATOM   499 C CG2 . VAL B 1 21 ? -2.364  26.971 14.609  1.00 21.89 ? 121 VAL B CG2 1 
ATOM   500 N N   . ARG B 1 22 ? -6.034  26.717 17.312  1.00 25.30 ? 122 ARG B N   1 
ATOM   501 C CA  . ARG B 1 22 ? -7.058  27.189 18.239  1.00 28.23 ? 122 ARG B CA  1 
ATOM   502 C C   . ARG B 1 22 ? -7.021  26.386 19.534  1.00 23.70 ? 122 ARG B C   1 
ATOM   503 O O   . ARG B 1 22 ? -6.969  26.948 20.625  1.00 22.30 ? 122 ARG B O   1 
ATOM   504 C CB  . ARG B 1 22 ? -8.444  27.052 17.608  1.00 27.47 ? 122 ARG B CB  1 
ATOM   505 C CG  . ARG B 1 22 ? -8.603  27.787 16.300  1.00 37.21 ? 122 ARG B CG  1 
ATOM   506 C CD  . ARG B 1 22 ? -8.315  29.270 16.455  1.00 45.37 ? 122 ARG B CD  1 
ATOM   507 N NE  . ARG B 1 22 ? -8.456  29.972 15.184  1.00 54.96 ? 122 ARG B NE  1 
ATOM   508 C CZ  . ARG B 1 22 ? -8.142  31.249 14.993  1.00 57.23 ? 122 ARG B CZ  1 
ATOM   509 N NH1 . ARG B 1 22 ? -7.663  31.975 15.995  1.00 59.19 ? 122 ARG B NH1 1 
ATOM   510 N NH2 . ARG B 1 22 ? -8.304  31.799 13.798  1.00 60.25 ? 122 ARG B NH2 1 
ATOM   511 N N   . PHE B 1 23 ? -7.066  25.065 19.400  1.00 21.78 ? 123 PHE B N   1 
ATOM   512 C CA  . PHE B 1 23 ? -7.038  24.165 20.549  1.00 20.80 ? 123 PHE B CA  1 
ATOM   513 C C   . PHE B 1 23 ? -5.850  24.443 21.465  1.00 21.33 ? 123 PHE B C   1 
ATOM   514 O O   . PHE B 1 23 ? -6.000  24.570 22.684  1.00 17.86 ? 123 PHE B O   1 
ATOM   515 C CB  . PHE B 1 23 ? -6.965  22.711 20.069  1.00 16.09 ? 123 PHE B CB  1 
ATOM   516 C CG  . PHE B 1 23 ? -6.766  21.706 21.177  1.00 20.23 ? 123 PHE B CG  1 
ATOM   517 C CD1 . PHE B 1 23 ? -7.743  21.518 22.149  1.00 19.82 ? 123 PHE B CD1 1 
ATOM   518 C CD2 . PHE B 1 23 ? -5.604  20.940 21.241  1.00 24.15 ? 123 PHE B CD2 1 
ATOM   519 C CE1 . PHE B 1 23 ? -7.572  20.576 23.168  1.00 25.34 ? 123 PHE B CE1 1 
ATOM   520 C CE2 . PHE B 1 23 ? -5.421  19.993 22.258  1.00 24.28 ? 123 PHE B CE2 1 
ATOM   521 C CZ  . PHE B 1 23 ? -6.409  19.813 23.223  1.00 23.10 ? 123 PHE B CZ  1 
ATOM   522 N N   . LEU B 1 24 ? -4.669  24.522 20.863  1.00 15.40 ? 124 LEU B N   1 
ATOM   523 C CA  . LEU B 1 24 ? -3.438  24.754 21.607  1.00 19.72 ? 124 LEU B CA  1 
ATOM   524 C C   . LEU B 1 24 ? -3.367  26.135 22.236  1.00 15.28 ? 124 LEU B C   1 
ATOM   525 O O   . LEU B 1 24 ? -2.846  26.285 23.336  1.00 20.85 ? 124 LEU B O   1 
ATOM   526 C CB  . LEU B 1 24 ? -2.228  24.528 20.699  1.00 16.94 ? 124 LEU B CB  1 
ATOM   527 C CG  . LEU B 1 24 ? -2.037  23.083 20.231  1.00 20.77 ? 124 LEU B CG  1 
ATOM   528 C CD1 . LEU B 1 24 ? -0.947  23.015 19.173  1.00 28.02 ? 124 LEU B CD1 1 
ATOM   529 C CD2 . LEU B 1 24 ? -1.684  22.210 21.421  1.00 20.49 ? 124 LEU B CD2 1 
ATOM   530 N N   . GLU B 1 25 ? -3.880  27.146 21.547  1.00 16.29 ? 125 GLU B N   1 
ATOM   531 C CA  . GLU B 1 25 ? -3.867  28.492 22.107  1.00 20.34 ? 125 GLU B CA  1 
ATOM   532 C C   . GLU B 1 25 ? -4.748  28.539 23.353  1.00 19.04 ? 125 GLU B C   1 
ATOM   533 O O   . GLU B 1 25 ? -4.374  29.133 24.368  1.00 21.52 ? 125 GLU B O   1 
ATOM   534 C CB  . GLU B 1 25 ? -4.361  29.508 21.077  1.00 22.36 ? 125 GLU B CB  1 
ATOM   535 C CG  . GLU B 1 25 ? -3.423  29.692 19.892  1.00 33.78 ? 125 GLU B CG  1 
ATOM   536 C CD  . GLU B 1 25 ? -3.799  30.894 19.046  1.00 35.65 ? 125 GLU B CD  1 
ATOM   537 O OE1 . GLU B 1 25 ? -4.993  31.020 18.704  1.00 32.59 ? 125 GLU B OE1 1 
ATOM   538 O OE2 . GLU B 1 25 ? -2.907  31.714 18.726  1.00 33.25 ? 125 GLU B OE2 1 
ATOM   539 N N   . GLN B 1 26 ? -5.916  27.905 23.272  1.00 23.46 ? 126 GLN B N   1 
ATOM   540 C CA  . GLN B 1 26 ? -6.840  27.867 24.403  1.00 22.70 ? 126 GLN B CA  1 
ATOM   541 C C   . GLN B 1 26 ? -6.238  27.088 25.562  1.00 18.25 ? 126 GLN B C   1 
ATOM   542 O O   . GLN B 1 26 ? -6.348  27.498 26.714  1.00 21.01 ? 126 GLN B O   1 
ATOM   543 C CB  . GLN B 1 26 ? -8.183  27.228 24.013  1.00 23.46 ? 126 GLN B CB  1 
ATOM   544 C CG  . GLN B 1 26 ? -9.027  26.817 25.232  1.00 30.52 ? 126 GLN B CG  1 
ATOM   545 C CD  . GLN B 1 26 ? -10.384 26.225 24.875  1.00 28.99 ? 126 GLN B CD  1 
ATOM   546 O OE1 . GLN B 1 26 ? -10.505 25.431 23.944  1.00 42.40 ? 126 GLN B OE1 1 
ATOM   547 N NE2 . GLN B 1 26 ? -11.411 26.596 25.638  1.00 42.12 ? 126 GLN B NE2 1 
ATOM   548 N N   A GLN B 1 27 ? -5.604  25.953 25.280  0.60 17.28 ? 127 GLN B N   1 
ATOM   549 N N   B GLN B 1 27 ? -5.596  25.972 25.230  0.40 18.38 ? 127 GLN B N   1 
ATOM   550 C CA  A GLN B 1 27 ? -5.026  25.185 26.373  0.60 18.26 ? 127 GLN B CA  1 
ATOM   551 C CA  B GLN B 1 27 ? -4.955  25.101 26.207  0.40 18.98 ? 127 GLN B CA  1 
ATOM   552 C C   A GLN B 1 27 ? -3.847  25.911 27.012  0.60 16.71 ? 127 GLN B C   1 
ATOM   553 C C   B GLN B 1 27 ? -3.825  25.811 26.952  0.40 17.99 ? 127 GLN B C   1 
ATOM   554 O O   A GLN B 1 27 ? -3.743  25.955 28.237  0.60 19.00 ? 127 GLN B O   1 
ATOM   555 O O   B GLN B 1 27 ? -3.741  25.748 28.178  0.40 19.43 ? 127 GLN B O   1 
ATOM   556 C CB  A GLN B 1 27 ? -4.597  23.784 25.923  0.60 20.11 ? 127 GLN B CB  1 
ATOM   557 C CB  B GLN B 1 27 ? -4.411  23.861 25.491  0.40 19.70 ? 127 GLN B CB  1 
ATOM   558 C CG  A GLN B 1 27 ? -4.134  22.917 27.094  0.60 16.90 ? 127 GLN B CG  1 
ATOM   559 C CG  B GLN B 1 27 ? -3.559  22.942 26.343  0.40 21.12 ? 127 GLN B CG  1 
ATOM   560 C CD  A GLN B 1 27 ? -3.933  21.459 26.730  0.60 15.87 ? 127 GLN B CD  1 
ATOM   561 C CD  B GLN B 1 27 ? -3.017  21.766 25.550  0.40 18.92 ? 127 GLN B CD  1 
ATOM   562 O OE1 A GLN B 1 27 ? -2.859  20.897 26.948  0.60 15.67 ? 127 GLN B OE1 1 
ATOM   563 O OE1 B GLN B 1 27 ? -2.396  21.944 24.501  0.40 20.43 ? 127 GLN B OE1 1 
ATOM   564 N NE2 A GLN B 1 27 ? -4.969  20.836 26.184  0.60 14.48 ? 127 GLN B NE2 1 
ATOM   565 N NE2 B GLN B 1 27 ? -3.245  20.558 26.052  0.40 20.92 ? 127 GLN B NE2 1 
ATOM   566 N N   . ASN B 1 28 ? -2.961  26.489 26.205  1.00 18.12 ? 128 ASN B N   1 
ATOM   567 C CA  . ASN B 1 28 ? -1.832  27.206 26.792  1.00 17.22 ? 128 ASN B CA  1 
ATOM   568 C C   . ASN B 1 28 ? -2.329  28.391 27.630  1.00 20.10 ? 128 ASN B C   1 
ATOM   569 O O   . ASN B 1 28 ? -1.731  28.737 28.640  1.00 22.35 ? 128 ASN B O   1 
ATOM   570 C CB  . ASN B 1 28 ? -0.865  27.694 25.712  1.00 22.09 ? 128 ASN B CB  1 
ATOM   571 C CG  . ASN B 1 28 ? -0.125  26.553 25.024  1.00 27.06 ? 128 ASN B CG  1 
ATOM   572 O OD1 . ASN B 1 28 ? -0.130  25.410 25.493  1.00 16.62 ? 128 ASN B OD1 1 
ATOM   573 N ND2 . ASN B 1 28 ? 0.526   26.865 23.911  1.00 23.56 ? 128 ASN B ND2 1 
ATOM   574 N N   . LYS B 1 29 ? -3.426  29.014 27.221  1.00 15.66 ? 129 LYS B N   1 
ATOM   575 C CA  . LYS B 1 29 ? -3.956  30.132 27.998  1.00 21.19 ? 129 LYS B CA  1 
ATOM   576 C C   . LYS B 1 29 ? -4.498  29.628 29.339  1.00 17.94 ? 129 LYS B C   1 
ATOM   577 O O   . LYS B 1 29 ? -4.381  30.297 30.366  1.00 13.76 ? 129 LYS B O   1 
ATOM   578 C CB  . LYS B 1 29 ? -5.051  30.854 27.211  1.00 27.46 ? 129 LYS B CB  1 
ATOM   579 C CG  . LYS B 1 29 ? -4.521  31.680 26.051  1.00 32.26 ? 129 LYS B CG  1 
ATOM   580 C CD  . LYS B 1 29 ? -5.653  32.323 25.258  1.00 34.73 ? 129 LYS B CD  1 
ATOM   581 C CE  . LYS B 1 29 ? -5.120  33.255 24.174  1.00 39.40 ? 129 LYS B CE  1 
ATOM   582 N NZ  . LYS B 1 29 ? -4.403  34.431 24.749  1.00 50.42 ? 129 LYS B NZ  1 
ATOM   583 N N   . ILE B 1 30 ? -5.084  28.435 29.319  1.00 20.90 ? 130 ILE B N   1 
ATOM   584 C CA  . ILE B 1 30 ? -5.625  27.810 30.520  1.00 18.55 ? 130 ILE B CA  1 
ATOM   585 C C   . ILE B 1 30 ? -4.487  27.435 31.464  1.00 15.74 ? 130 ILE B C   1 
ATOM   586 O O   . ILE B 1 30 ? -4.576  27.647 32.672  1.00 14.22 ? 130 ILE B O   1 
ATOM   587 C CB  . ILE B 1 30 ? -6.427  26.532 30.163  1.00 22.48 ? 130 ILE B CB  1 
ATOM   588 C CG1 . ILE B 1 30 ? -7.806  26.918 29.621  1.00 15.12 ? 130 ILE B CG1 1 
ATOM   589 C CG2 . ILE B 1 30 ? -6.544  25.622 31.377  1.00 20.85 ? 130 ILE B CG2 1 
ATOM   590 C CD1 . ILE B 1 30 ? -8.603  25.741 29.101  1.00 21.47 ? 130 ILE B CD1 1 
ATOM   591 N N   . LEU B 1 31 ? -3.418  26.877 30.905  1.00 15.41 ? 131 LEU B N   1 
ATOM   592 C CA  . LEU B 1 31 ? -2.268  26.474 31.705  1.00 19.81 ? 131 LEU B CA  1 
ATOM   593 C C   . LEU B 1 31 ? -1.595  27.680 32.351  1.00 14.39 ? 131 LEU B C   1 
ATOM   594 O O   . LEU B 1 31 ? -1.223  27.636 33.522  1.00 13.19 ? 131 LEU B O   1 
ATOM   595 C CB  . LEU B 1 31 ? -1.263  25.708 30.840  1.00 19.60 ? 131 LEU B CB  1 
ATOM   596 C CG  . LEU B 1 31 ? -1.787  24.371 30.302  1.00 14.00 ? 131 LEU B CG  1 
ATOM   597 C CD1 . LEU B 1 31 ? -0.804  23.799 29.295  1.00 24.59 ? 131 LEU B CD1 1 
ATOM   598 C CD2 . LEU B 1 31 ? -2.001  23.402 31.455  1.00 18.96 ? 131 LEU B CD2 1 
ATOM   599 N N   A LEU B 1 32 ? -1.437  28.755 31.582  0.70 15.22 ? 132 LEU B N   1 
ATOM   600 N N   B LEU B 1 32 ? -1.442  28.756 31.585  0.30 15.59 ? 132 LEU B N   1 
ATOM   601 C CA  A LEU B 1 32 ? -0.823  29.974 32.096  0.70 16.55 ? 132 LEU B CA  1 
ATOM   602 C CA  B LEU B 1 32 ? -0.813  29.962 32.105  0.30 16.24 ? 132 LEU B CA  1 
ATOM   603 C C   A LEU B 1 32 ? -1.660  30.539 33.238  0.70 21.75 ? 132 LEU B C   1 
ATOM   604 C C   B LEU B 1 32 ? -1.658  30.543 33.236  0.30 19.75 ? 132 LEU B C   1 
ATOM   605 O O   A LEU B 1 32 ? -1.127  30.959 34.262  0.70 23.66 ? 132 LEU B O   1 
ATOM   606 O O   B LEU B 1 32 ? -1.124  30.984 34.252  0.30 21.37 ? 132 LEU B O   1 
ATOM   607 C CB  A LEU B 1 32 ? -0.699  31.021 30.984  0.70 18.17 ? 132 LEU B CB  1 
ATOM   608 C CB  B LEU B 1 32 ? -0.643  31.000 30.991  0.30 15.01 ? 132 LEU B CB  1 
ATOM   609 C CG  A LEU B 1 32 ? 0.361   30.757 29.913  0.70 15.85 ? 132 LEU B CG  1 
ATOM   610 C CG  B LEU B 1 32 ? 0.292   32.169 31.313  0.30 12.02 ? 132 LEU B CG  1 
ATOM   611 C CD1 A LEU B 1 32 ? 0.197   31.738 28.763  0.70 14.00 ? 132 LEU B CD1 1 
ATOM   612 C CD1 B LEU B 1 32 ? 1.688   31.636 31.612  0.30 7.28  ? 132 LEU B CD1 1 
ATOM   613 C CD2 A LEU B 1 32 ? 1.747   30.872 30.535  0.70 19.64 ? 132 LEU B CD2 1 
ATOM   614 C CD2 B LEU B 1 32 ? 0.335   33.137 30.142  0.30 12.77 ? 132 LEU B CD2 1 
ATOM   615 N N   . ALA B 1 33 ? -2.977  30.538 33.063  1.00 21.79 ? 133 ALA B N   1 
ATOM   616 C CA  . ALA B 1 33 ? -3.879  31.056 34.088  1.00 20.53 ? 133 ALA B CA  1 
ATOM   617 C C   . ALA B 1 33 ? -3.744  30.231 35.368  1.00 20.81 ? 133 ALA B C   1 
ATOM   618 O O   . ALA B 1 33 ? -3.747  30.775 36.473  1.00 18.39 ? 133 ALA B O   1 
ATOM   619 C CB  . ALA B 1 33 ? -5.325  31.029 33.587  1.00 21.52 ? 133 ALA B CB  1 
ATOM   620 N N   . GLU B 1 34 ? -3.621  28.916 35.218  1.00 13.62 ? 134 GLU B N   1 
ATOM   621 C CA  . GLU B 1 34 ? -3.469  28.042 36.376  1.00 15.99 ? 134 GLU B CA  1 
ATOM   622 C C   . GLU B 1 34 ? -2.160  28.350 37.102  1.00 18.89 ? 134 GLU B C   1 
ATOM   623 O O   . GLU B 1 34 ? -2.120  28.410 38.330  1.00 21.09 ? 134 GLU B O   1 
ATOM   624 C CB  . GLU B 1 34 ? -3.483  26.571 35.947  1.00 20.00 ? 134 GLU B CB  1 
ATOM   625 C CG  . GLU B 1 34 ? -4.824  26.065 35.416  1.00 21.23 ? 134 GLU B CG  1 
ATOM   626 C CD  . GLU B 1 34 ? -5.938  26.143 36.444  1.00 22.15 ? 134 GLU B CD  1 
ATOM   627 O OE1 . GLU B 1 34 ? -5.633  26.161 37.654  1.00 19.01 ? 134 GLU B OE1 1 
ATOM   628 O OE2 . GLU B 1 34 ? -7.121  26.170 36.045  1.00 25.23 ? 134 GLU B OE2 1 
ATOM   629 N N   . LEU B 1 35 ? -1.086  28.529 36.339  1.00 19.93 ? 135 LEU B N   1 
ATOM   630 C CA  . LEU B 1 35 ? 0.208   28.848 36.923  1.00 15.55 ? 135 LEU B CA  1 
ATOM   631 C C   . LEU B 1 35 ? 0.118   30.191 37.640  1.00 20.00 ? 135 LEU B C   1 
ATOM   632 O O   . LEU B 1 35 ? 0.680   30.366 38.718  1.00 25.21 ? 135 LEU B O   1 
ATOM   633 C CB  . LEU B 1 35 ? 1.286   28.906 35.833  1.00 20.39 ? 135 LEU B CB  1 
ATOM   634 C CG  . LEU B 1 35 ? 1.687   27.562 35.217  1.00 17.58 ? 135 LEU B CG  1 
ATOM   635 C CD1 . LEU B 1 35 ? 2.622   27.796 34.047  1.00 26.04 ? 135 LEU B CD1 1 
ATOM   636 C CD2 . LEU B 1 35 ? 2.358   26.696 36.270  1.00 19.56 ? 135 LEU B CD2 1 
ATOM   637 N N   . GLU B 1 36 ? -0.602  31.132 37.035  1.00 20.79 ? 136 GLU B N   1 
ATOM   638 C CA  . GLU B 1 36 ? -0.776  32.467 37.608  1.00 25.42 ? 136 GLU B CA  1 
ATOM   639 C C   . GLU B 1 36 ? -1.491  32.344 38.956  1.00 34.87 ? 136 GLU B C   1 
ATOM   640 O O   . GLU B 1 36 ? -1.129  33.008 39.935  1.00 37.89 ? 136 GLU B O   1 
ATOM   641 C CB  . GLU B 1 36 ? -1.603  33.334 36.658  1.00 35.11 ? 136 GLU B CB  1 
ATOM   642 C CG  . GLU B 1 36 ? -1.824  34.774 37.114  1.00 48.05 ? 136 GLU B CG  1 
ATOM   643 C CD  . GLU B 1 36 ? -0.564  35.620 37.041  1.00 54.32 ? 136 GLU B CD  1 
ATOM   644 O OE1 . GLU B 1 36 ? 0.120   35.575 35.997  1.00 61.43 ? 136 GLU B OE1 1 
ATOM   645 O OE2 . GLU B 1 36 ? -0.265  36.342 38.017  1.00 60.01 ? 136 GLU B OE2 1 
ATOM   646 N N   . GLN B 1 37 ? -2.495  31.470 39.001  1.00 29.24 ? 137 GLN B N   1 
ATOM   647 C CA  . GLN B 1 37 ? -3.277  31.225 40.212  1.00 34.05 ? 137 GLN B CA  1 
ATOM   648 C C   . GLN B 1 37 ? -2.490  30.503 41.294  1.00 33.76 ? 137 GLN B C   1 
ATOM   649 O O   . GLN B 1 37 ? -2.832  30.584 42.466  1.00 36.48 ? 137 GLN B O   1 
ATOM   650 C CB  . GLN B 1 37 ? -4.505  30.389 39.889  1.00 34.95 ? 137 GLN B CB  1 
ATOM   651 C CG  . GLN B 1 37 ? -5.690  31.171 39.386  1.00 48.79 ? 137 GLN B CG  1 
ATOM   652 C CD  . GLN B 1 37 ? -6.179  32.192 40.395  1.00 47.37 ? 137 GLN B CD  1 
ATOM   653 O OE1 . GLN B 1 37 ? -5.808  32.152 41.568  1.00 50.66 ? 137 GLN B OE1 1 
ATOM   654 N NE2 . GLN B 1 37 ? -7.026  33.108 39.943  1.00 55.85 ? 137 GLN B NE2 1 
ATOM   655 N N   . LEU B 1 38 ? -1.459  29.766 40.901  1.00 26.62 ? 138 LEU B N   1 
ATOM   656 C CA  . LEU B 1 38 ? -0.643  29.054 41.876  1.00 28.62 ? 138 LEU B CA  1 
ATOM   657 C C   . LEU B 1 38 ? 0.524   29.919 42.337  1.00 31.76 ? 138 LEU B C   1 
ATOM   658 O O   . LEU B 1 38 ? 0.817   29.988 43.536  1.00 43.83 ? 138 LEU B O   1 
ATOM   659 C CB  . LEU B 1 38 ? -0.174  27.711 41.301  1.00 27.12 ? 138 LEU B CB  1 
ATOM   660 C CG  . LEU B 1 38 ? -1.235  26.600 41.171  1.00 26.64 ? 138 LEU B CG  1 
ATOM   661 C CD1 . LEU B 1 38 ? -0.700  25.444 40.331  1.00 27.52 ? 138 LEU B CD1 1 
ATOM   662 C CD2 . LEU B 1 38 ? -1.643  26.109 42.564  1.00 32.93 ? 138 LEU B CD2 1 
HETATM 663 N N   . NH2 B 1 39 ? 1.143   30.631 41.406  1.00 30.44 ? 139 NH2 B N   1 
HETATM 664 O O   . HOH C 2 .  ? 5.431   18.156 29.469  1.00 23.44 ? 1   HOH A O   1 
HETATM 665 O O   . HOH C 2 .  ? 7.337   21.323 18.731  1.00 26.30 ? 2   HOH A O   1 
HETATM 666 O O   . HOH C 2 .  ? 3.763   33.692 -4.232  1.00 38.69 ? 3   HOH A O   1 
HETATM 667 O O   . HOH C 2 .  ? 9.799   22.220 17.032  1.00 29.50 ? 4   HOH A O   1 
HETATM 668 O O   . HOH C 2 .  ? 3.683   31.608 19.640  1.00 34.55 ? 5   HOH A O   1 
HETATM 669 O O   . HOH C 2 .  ? 1.421   39.955 -8.069  1.00 44.92 ? 6   HOH A O   1 
HETATM 670 O O   . HOH C 2 .  ? 2.730   43.145 -8.175  1.00 48.61 ? 7   HOH A O   1 
HETATM 671 O O   . HOH C 2 .  ? 7.730   35.891 -12.315 1.00 42.16 ? 8   HOH A O   1 
HETATM 672 O O   . HOH C 2 .  ? 10.247  29.534 1.641   1.00 52.66 ? 9   HOH A O   1 
HETATM 673 O O   . HOH C 2 .  ? 7.203   30.981 10.383  1.00 34.89 ? 10  HOH A O   1 
HETATM 674 O O   . HOH C 2 .  ? 1.554   25.331 -13.014 1.00 53.45 ? 11  HOH A O   1 
HETATM 675 O O   . HOH C 2 .  ? 1.874   17.844 40.468  1.00 40.72 ? 12  HOH A O   1 
HETATM 676 O O   . HOH D 2 .  ? -4.603  33.268 36.606  1.00 41.99 ? 13  HOH B O   1 
HETATM 677 O O   . HOH D 2 .  ? -8.498  29.450 20.686  1.00 39.19 ? 14  HOH B O   1 
HETATM 678 O O   . HOH D 2 .  ? -10.134 23.638 17.311  1.00 32.13 ? 15  HOH B O   1 
HETATM 679 O O   . HOH D 2 .  ? 0.932   32.598 34.318  1.00 35.51 ? 16  HOH B O   1 
HETATM 680 O O   . HOH D 2 .  ? -5.083  35.628 37.840  1.00 44.56 ? 17  HOH B O   1 
HETATM 681 O O   . HOH D 2 .  ? -12.078 20.619 5.114   1.00 59.11 ? 18  HOH B O   1 
HETATM 682 O O   . HOH D 2 .  ? -3.161  19.595 8.635   1.00 44.36 ? 19  HOH B O   1 
HETATM 683 O O   . HOH D 2 .  ? 3.498   30.958 38.744  1.00 34.68 ? 20  HOH B O   1 
HETATM 684 O O   . HOH D 2 .  ? -2.760  17.564 23.935  1.00 36.97 ? 21  HOH B O   1 
HETATM 685 O O   . HOH D 2 .  ? -3.811  35.005 21.975  1.00 48.56 ? 22  HOH B O   1 
HETATM 686 O O   . HOH D 2 .  ? -4.465  30.813 12.979  1.00 50.30 ? 23  HOH B O   1 
HETATM 687 O O   . HOH D 2 .  ? 3.943   30.177 41.770  1.00 42.93 ? 24  HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ACE 1  101 101 ACE ACE A . n 
A 1 2  ASN 2  102 102 ASN ASN A . n 
A 1 3  GLU 3  103 103 GLU GLU A . n 
A 1 4  LYS 4  104 104 LYS LYS A . n 
A 1 5  VAL 5  105 105 VAL VAL A . n 
A 1 6  GLU 6  106 106 GLU GLU A . n 
A 1 7  LEU 7  107 107 LEU LEU A . n 
A 1 8  GLN 8  108 108 GLN GLN A . n 
A 1 9  GLU 9  109 109 GLU GLU A . n 
A 1 10 LEU 10 110 110 LEU LEU A . n 
A 1 11 ASN 11 111 111 ASN ASN A . n 
A 1 12 ASP 12 112 112 ASP ASP A . n 
A 1 13 ARG 13 113 113 ARG ARG A . n 
A 1 14 PHE 14 114 114 PHE PHE A . n 
A 1 15 ALA 15 115 115 ALA ALA A . n 
A 1 16 ASN 16 116 116 ASN ASN A . n 
A 1 17 LEU 17 117 117 LEU LEU A . n 
A 1 18 ILE 18 118 118 ILE ILE A . n 
A 1 19 ASP 19 119 119 ASP ASP A . n 
A 1 20 LYS 20 120 120 LYS LYS A . n 
A 1 21 VAL 21 121 121 VAL VAL A . n 
A 1 22 ARG 22 122 122 ARG ARG A . n 
A 1 23 PHE 23 123 123 PHE PHE A . n 
A 1 24 LEU 24 124 124 LEU LEU A . n 
A 1 25 GLU 25 125 125 GLU GLU A . n 
A 1 26 GLN 26 126 126 GLN GLN A . n 
A 1 27 GLN 27 127 127 GLN GLN A . n 
A 1 28 ASN 28 128 128 ASN ASN A . n 
A 1 29 LYS 29 129 129 LYS LYS A . n 
A 1 30 ILE 30 130 130 ILE ILE A . n 
A 1 31 LEU 31 131 131 LEU LEU A . n 
A 1 32 LEU 32 132 132 LEU LEU A . n 
A 1 33 ALA 33 133 133 ALA ALA A . n 
A 1 34 GLU 34 134 134 GLU GLU A . n 
A 1 35 LEU 35 135 135 LEU LEU A . n 
A 1 36 GLU 36 136 136 GLU GLU A . n 
A 1 37 GLN 37 137 137 GLN GLN A . n 
A 1 38 LEU 38 138 138 LEU LEU A . n 
A 1 39 NH2 39 139 139 NH2 NH2 A . n 
B 1 1  ACE 1  101 101 ACE ACE B . n 
B 1 2  ASN 2  102 102 ASN ASN B . n 
B 1 3  GLU 3  103 103 GLU GLU B . n 
B 1 4  LYS 4  104 104 LYS LYS B . n 
B 1 5  VAL 5  105 105 VAL VAL B . n 
B 1 6  GLU 6  106 106 GLU GLU B . n 
B 1 7  LEU 7  107 107 LEU LEU B . n 
B 1 8  GLN 8  108 108 GLN GLN B . n 
B 1 9  GLU 9  109 109 GLU GLU B . n 
B 1 10 LEU 10 110 110 LEU LEU B . n 
B 1 11 ASN 11 111 111 ASN ASN B . n 
B 1 12 ASP 12 112 112 ASP ASP B . n 
B 1 13 ARG 13 113 113 ARG ARG B . n 
B 1 14 PHE 14 114 114 PHE PHE B . n 
B 1 15 ALA 15 115 115 ALA ALA B . n 
B 1 16 ASN 16 116 116 ASN ASN B . n 
B 1 17 LEU 17 117 117 LEU LEU B . n 
B 1 18 ILE 18 118 118 ILE ILE B . n 
B 1 19 ASP 19 119 119 ASP ASP B . n 
B 1 20 LYS 20 120 120 LYS LYS B . n 
B 1 21 VAL 21 121 121 VAL VAL B . n 
B 1 22 ARG 22 122 122 ARG ARG B . n 
B 1 23 PHE 23 123 123 PHE PHE B . n 
B 1 24 LEU 24 124 124 LEU LEU B . n 
B 1 25 GLU 25 125 125 GLU GLU B . n 
B 1 26 GLN 26 126 126 GLN GLN B . n 
B 1 27 GLN 27 127 127 GLN GLN B . n 
B 1 28 ASN 28 128 128 ASN ASN B . n 
B 1 29 LYS 29 129 129 LYS LYS B . n 
B 1 30 ILE 30 130 130 ILE ILE B . n 
B 1 31 LEU 31 131 131 LEU LEU B . n 
B 1 32 LEU 32 132 132 LEU LEU B . n 
B 1 33 ALA 33 133 133 ALA ALA B . n 
B 1 34 GLU 34 134 134 GLU GLU B . n 
B 1 35 LEU 35 135 135 LEU LEU B . n 
B 1 36 GLU 36 136 136 GLU GLU B . n 
B 1 37 GLN 37 137 137 GLN GLN B . n 
B 1 38 LEU 38 138 138 LEU LEU B . n 
B 1 39 NH2 39 139 139 NH2 NH2 B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  1  1  HOH HOH A . 
C 2 HOH 2  2  2  HOH HOH A . 
C 2 HOH 3  3  3  HOH HOH A . 
C 2 HOH 4  4  4  HOH HOH A . 
C 2 HOH 5  5  5  HOH HOH A . 
C 2 HOH 6  6  6  HOH HOH A . 
C 2 HOH 7  7  7  HOH HOH A . 
C 2 HOH 8  8  8  HOH HOH A . 
C 2 HOH 9  9  9  HOH HOH A . 
C 2 HOH 10 10 10 HOH HOH A . 
C 2 HOH 11 11 11 HOH HOH A . 
C 2 HOH 12 12 12 HOH HOH A . 
D 2 HOH 1  13 13 HOH HOH B . 
D 2 HOH 2  14 14 HOH HOH B . 
D 2 HOH 3  15 15 HOH HOH B . 
D 2 HOH 4  16 16 HOH HOH B . 
D 2 HOH 5  17 17 HOH HOH B . 
D 2 HOH 6  18 18 HOH HOH B . 
D 2 HOH 7  19 19 HOH HOH B . 
D 2 HOH 8  20 20 HOH HOH B . 
D 2 HOH 9  21 21 HOH HOH B . 
D 2 HOH 10 22 22 HOH HOH B . 
D 2 HOH 11 23 23 HOH HOH B . 
D 2 HOH 12 24 24 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2070 ? 
1 MORE         -21  ? 
1 'SSA (A^2)'  6180 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-05-05 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-11-01 
4 'Structure model' 1 3 2021-10-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' software           
2 4 'Structure model' database_2         
3 4 'Structure model' struct_conn        
4 4 'Structure model' struct_ref_seq_dif 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_software.name'                      
2 4 'Structure model' '_database_2.pdbx_DOI'                
3 4 'Structure model' '_database_2.pdbx_database_accession' 
4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
5 4 'Structure model' '_struct_ref_seq_dif.details'         
# 
_pdbx_phasing_MR.entry_id                     3G1E 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                'Phaser MODE: MR_AUTO' 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          2.500 
_pdbx_phasing_MR.d_res_low_rotation           11.630 
_pdbx_phasing_MR.d_res_high_translation       2.500 
_pdbx_phasing_MR.d_res_low_translation        11.630 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
SCALA       .                          ?                    other   'Phil Evans'      pre@mrc-lmb.cam.ac.uk       'data scaling' 
http://www.ccp4.ac.uk/dist/html/INDEX.html  Fortran_77 ? 1 
PHASER      .                          ?                    other   'R. J. Read'      cimr-phaser@lists.cam.ac.uk phasing 
http://www-structmed.cimr.cam.ac.uk/phaser/ ?          ? 2 
CNS         1.2                        1998                 package 'Axel T. Brunger' axel.brunger@yale.edu       refinement 
http://cns.csb.yale.edu/v1.1/               Fortran_77 ? 3 
PDB_EXTRACT 3.004                      'September 10, 2007' package PDB               sw-help@rcsb.rutgers.edu    
'data extraction' http://pdb.rutgers.edu/software/            C++        ? 4 
CrysalisPro 'PRO (OXFORD DIFFRACTION)' ?                    ?       ?                 ?                           'data reduction' 
?                                           ?          ? 5 
REFMAC      '5.2.0019/CNS 1.0'         ?                    ?       ?                 ?                           refinement ? ? ? 
6 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 VAL A 105 ? ? -109.76 40.76  
2 1 GLU A 106 ? ? -151.90 -21.11 
3 1 LYS B 104 ? ? -154.99 -41.50 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 104 ? CG ? A LYS 4 CG 
2 1 Y 1 A LYS 104 ? CD ? A LYS 4 CD 
3 1 Y 1 A LYS 104 ? CE ? A LYS 4 CE 
4 1 Y 1 A LYS 104 ? NZ ? A LYS 4 NZ 
5 1 Y 1 B LYS 104 ? CG ? B LYS 4 CG 
6 1 Y 1 B LYS 104 ? CD ? B LYS 4 CD 
7 1 Y 1 B LYS 104 ? CE ? B LYS 4 CE 
8 1 Y 1 B LYS 104 ? NZ ? B LYS 4 NZ 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#