data_3G2S
# 
_entry.id   3G2S 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3G2S         
RCSB  RCSB051350   
WWPDB D_1000051350 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3G2T . unspecified 
PDB 3G2U . unspecified 
PDB 3G2V . unspecified 
PDB 3G2W . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3G2S 
_pdbx_database_status.recvd_initial_deposition_date   2009-02-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Cramer, J.F.'     1 
'Behrens, M.A.'    2 
'Gustafsen, C.'    3 
'Oliveira, C.L.P.' 4 
'Pedersen, J.S.'   5 
'Madsen, P.'       6 
'Petersen, C.M.'   7 
'Thirup, S.S.'     8 
# 
_citation.id                        primary 
_citation.title                     'GGA autoinhibition revisited' 
_citation.journal_abbrev            Traffic 
_citation.journal_volume            11 
_citation.page_first                259 
_citation.page_last                 273 
_citation.year                      2010 
_citation.journal_id_ASTM           ? 
_citation.country                   DK 
_citation.journal_id_ISSN           1398-9219 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20015111 
_citation.pdbx_database_id_DOI      10.1111/j.1600-0854.2009.01017.x 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Cramer, J.F.'     1 
primary 'Gustafsen, C.'    2 
primary 'Behrens, M.A.'    3 
primary 'Oliveira, C.L.P.' 4 
primary 'Pedersen, J.S.'   5 
primary 'Madsen, P.'       6 
primary 'Petersen, C.M.'   7 
primary 'Thirup, S.S.'     8 
# 
_cell.entry_id           3G2S 
_cell.length_a           42.430 
_cell.length_b           52.890 
_cell.length_c           136.350 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3G2S 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ADP-ribosylation factor-binding protein GGA1'     16958.564 2   ? ? 'VHS Domain (N-terminal domain)' ? 
2 polymer     syn 'C-terminal fragment of Sortilin-related receptor' 1364.564  2   ? ? ?                                ? 
3 non-polymer syn HEXANE-1,6-DIOL                                    118.174   1   ? ? ?                                ? 
4 water       nat water                                              18.015    275 ? ? ?                                ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Golgi-localized, gamma ear-containing, ARF-binding protein 1, Gamma-adaptin-related protein 1' 
2 
;Sorting protein-related receptor containing LDLR class A repeats, SorLA, SorLA-1, Low-density lipoprotein receptor relative with 11 ligand-binding repeats, LDLR relative with 11 ligand-binding repeats, LR11
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSMEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQEWEAIQALTVLETCMKSCG
KRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLYSWTVGLPEEVKIAEAYQMLKKQGIVKS
;
;GSMEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQEWEAIQALTVLETCMKSCG
KRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLYSWTVGLPEEVKIAEAYQMLKKQGIVKS
;
A,B ? 
2 'polypeptide(L)' no no ITGFSDDVPMVIA ITGFSDDVPMVIA C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   MET n 
1 4   GLU n 
1 5   PRO n 
1 6   ALA n 
1 7   MET n 
1 8   GLU n 
1 9   PRO n 
1 10  GLU n 
1 11  THR n 
1 12  LEU n 
1 13  GLU n 
1 14  ALA n 
1 15  ARG n 
1 16  ILE n 
1 17  ASN n 
1 18  ARG n 
1 19  ALA n 
1 20  THR n 
1 21  ASN n 
1 22  PRO n 
1 23  LEU n 
1 24  ASN n 
1 25  LYS n 
1 26  GLU n 
1 27  LEU n 
1 28  ASP n 
1 29  TRP n 
1 30  ALA n 
1 31  SER n 
1 32  ILE n 
1 33  ASN n 
1 34  GLY n 
1 35  PHE n 
1 36  CYS n 
1 37  GLU n 
1 38  GLN n 
1 39  LEU n 
1 40  ASN n 
1 41  GLU n 
1 42  ASP n 
1 43  PHE n 
1 44  GLU n 
1 45  GLY n 
1 46  PRO n 
1 47  PRO n 
1 48  LEU n 
1 49  ALA n 
1 50  THR n 
1 51  ARG n 
1 52  LEU n 
1 53  LEU n 
1 54  ALA n 
1 55  HIS n 
1 56  LYS n 
1 57  ILE n 
1 58  GLN n 
1 59  SER n 
1 60  PRO n 
1 61  GLN n 
1 62  GLU n 
1 63  TRP n 
1 64  GLU n 
1 65  ALA n 
1 66  ILE n 
1 67  GLN n 
1 68  ALA n 
1 69  LEU n 
1 70  THR n 
1 71  VAL n 
1 72  LEU n 
1 73  GLU n 
1 74  THR n 
1 75  CYS n 
1 76  MET n 
1 77  LYS n 
1 78  SER n 
1 79  CYS n 
1 80  GLY n 
1 81  LYS n 
1 82  ARG n 
1 83  PHE n 
1 84  HIS n 
1 85  ASP n 
1 86  GLU n 
1 87  VAL n 
1 88  GLY n 
1 89  LYS n 
1 90  PHE n 
1 91  ARG n 
1 92  PHE n 
1 93  LEU n 
1 94  ASN n 
1 95  GLU n 
1 96  LEU n 
1 97  ILE n 
1 98  LYS n 
1 99  VAL n 
1 100 VAL n 
1 101 SER n 
1 102 PRO n 
1 103 LYS n 
1 104 TYR n 
1 105 LEU n 
1 106 GLY n 
1 107 SER n 
1 108 ARG n 
1 109 THR n 
1 110 SER n 
1 111 GLU n 
1 112 LYS n 
1 113 VAL n 
1 114 LYS n 
1 115 ASN n 
1 116 LYS n 
1 117 ILE n 
1 118 LEU n 
1 119 GLU n 
1 120 LEU n 
1 121 LEU n 
1 122 TYR n 
1 123 SER n 
1 124 TRP n 
1 125 THR n 
1 126 VAL n 
1 127 GLY n 
1 128 LEU n 
1 129 PRO n 
1 130 GLU n 
1 131 GLU n 
1 132 VAL n 
1 133 LYS n 
1 134 ILE n 
1 135 ALA n 
1 136 GLU n 
1 137 ALA n 
1 138 TYR n 
1 139 GLN n 
1 140 MET n 
1 141 LEU n 
1 142 LYS n 
1 143 LYS n 
1 144 GLN n 
1 145 GLY n 
1 146 ILE n 
1 147 VAL n 
1 148 LYS n 
1 149 SER n 
2 1   ILE n 
2 2   THR n 
2 3   GLY n 
2 4   PHE n 
2 5   SER n 
2 6   ASP n 
2 7   ASP n 
2 8   VAL n 
2 9   PRO n 
2 10  MET n 
2 11  VAL n 
2 12  ILE n 
2 13  ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3) CodonPlus-RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX4T-1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'The peptide was chemically synthesized' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP GGA1_HUMAN Q9UJY5 1 
;MEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQEWEAIQALTVLETCMKSCGKR
FHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLYSWTVGLPEEVKIAEAYQMLKKQGIVKS
;
1    ? 
2 UNP SORL_HUMAN Q92673 2 ITGFSDDVPMVIA 2202 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3G2S A 3 ? 149 ? Q9UJY5 1    ? 147  ? 1 147 
2 1 3G2S B 3 ? 149 ? Q9UJY5 1    ? 147  ? 1 147 
3 2 3G2S C 1 ? 13  ? Q92673 2202 ? 2214 ? 1 13  
4 2 3G2S D 1 ? 13  ? Q92673 2202 ? 2214 ? 1 13  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3G2S GLY A 1 ? UNP Q9UJY5 ? ? 'EXPRESSION TAG' -1 1 
1 3G2S SER A 2 ? UNP Q9UJY5 ? ? 'EXPRESSION TAG' 0  2 
2 3G2S GLY B 1 ? UNP Q9UJY5 ? ? 'EXPRESSION TAG' -1 3 
2 3G2S SER B 2 ? UNP Q9UJY5 ? ? 'EXPRESSION TAG' 0  4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HEZ non-polymer         . HEXANE-1,6-DIOL ? 'C6 H14 O2'      118.174 
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3G2S 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.09 
_exptl_crystal.density_percent_sol   41.08 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    
'15%(w/v) PEG 5000 mmE, 0.2M NH4I, 0.3M 1,6-hexanediol, 0.1M MES-NaOH, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 292K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2007-03-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'high resolution Si(311) cut and a lower resolution Si(111) cut' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.8726 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.8726 
# 
_reflns.entry_id                     3G2S 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   -3.0 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            1.7 
_reflns.number_obs                   34575 
_reflns.number_all                   34624 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.094 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.7 
_reflns.B_iso_Wilson_estimate        15.590 
_reflns.pdbx_redundancy              8.21 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.7 
_reflns_shell.d_res_low              1.8 
_reflns_shell.percent_possible_all   99.7 
_reflns_shell.Rmerge_I_obs           0.322 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.81 
_reflns_shell.pdbx_redundancy        8.26 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      5312 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3G2S 
_refine.ls_number_reflns_obs                     34566 
_refine.ls_number_reflns_all                     34624 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.40 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             49.33 
_refine.ls_d_res_high                            1.70 
_refine.ls_percent_reflns_obs                    99.840 
_refine.ls_R_factor_obs                          0.197 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.196 
_refine.ls_R_factor_R_free                       0.226 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1728 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            0.50 
_refine.occupancy_max                            1.00 
_refine.correlation_coeff_Fo_to_Fc               0.947 
_refine.correlation_coeff_Fo_to_Fc_free          0.925 
_refine.B_iso_mean                               19.960 
_refine.aniso_B[1][1]                            0.467 
_refine.aniso_B[2][2]                            -0.551 
_refine.aniso_B[3][3]                            0.084 
_refine.aniso_B[1][2]                            -0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.339 
_refine.solvent_model_param_bsol                 43.098 
_refine.pdbx_solvent_vdw_probe_radii             1.110 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.900 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1JWF 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.119 
_refine.pdbx_overall_ESU_R_Free                  0.113 
_refine.overall_SU_ML                            0.200 
_refine.overall_SU_B                             4.283 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                5.56 
_refine.B_iso_max                                101.70 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   0.869 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 20.120 
_refine.ls_number_reflns_R_work                  32838 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2466 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         8 
_refine_hist.number_atoms_solvent             275 
_refine_hist.number_atoms_total               2749 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        49.33 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           2565 0.009  ? ? 'X-RAY DIFFRACTION' ? 
f_angle_d          3469 1.224  ? ? 'X-RAY DIFFRACTION' ? 
f_chiral_restr     391  0.095  ? ? 'X-RAY DIFFRACTION' ? 
f_plane_restr      443  0.018  ? ? 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 994  18.866 ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.redundancy_reflns_obs 
1.700 1.750  12 100.000 2662 . 0.235 0.266 . 140 . 2802 . 'X-RAY DIFFRACTION' . 
1.750 1.806  12 100.000 2665 . 0.222 0.271 . 140 . 2805 . 'X-RAY DIFFRACTION' . 
1.806 1.871  12 100.000 2710 . 0.210 0.231 . 143 . 2853 . 'X-RAY DIFFRACTION' . 
1.871 1.946  12 100.000 2719 . 0.211 0.232 . 143 . 2862 . 'X-RAY DIFFRACTION' . 
1.946 2.035  12 100.000 2723 . 0.193 0.245 . 143 . 2866 . 'X-RAY DIFFRACTION' . 
2.035 2.142  12 100.000 2689 . 0.186 0.246 . 142 . 2831 . 'X-RAY DIFFRACTION' . 
2.142 2.276  12 100.000 2729 . 0.193 0.214 . 143 . 2872 . 'X-RAY DIFFRACTION' . 
2.276 2.452  12 100.000 2715 . 0.183 0.238 . 143 . 2858 . 'X-RAY DIFFRACTION' . 
2.452 2.698  12 100.000 2752 . 0.197 0.221 . 145 . 2897 . 'X-RAY DIFFRACTION' . 
2.698 3.089  12 100.000 2763 . 0.204 0.240 . 146 . 2909 . 'X-RAY DIFFRACTION' . 
3.089 3.891  12 100.000 2787 . 0.182 0.202 . 146 . 2933 . 'X-RAY DIFFRACTION' . 
3.891 49.331 12 99.000  2924 . 0.180 0.186 . 154 . 3078 . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  3G2S 
_struct.title                     'VHS Domain of human GGA1 complexed with SorLA C-terminal Peptide' 
_struct.pdbx_descriptor           'ADP-ribosylation factor-binding protein GGA1, C-terminal fragment of Sortilin-related receptor' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3G2S 
_struct_keywords.pdbx_keywords   'PROTEIN TRANSPORT' 
_struct_keywords.text            
'ADP-ribosylation factor binding protein GGA1, VHS, acidic-cluster dileucine signal, SorLA, PROTEIN TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 11  ? THR A 20  ? THR A 9   THR A 18  1 ? 10 
HELX_P HELX_P2  2  ASP A 28  ? LEU A 39  ? ASP A 26  LEU A 37  1 ? 12 
HELX_P HELX_P3  3  ASN A 40  ? ASP A 42  ? ASN A 38  ASP A 40  5 ? 3  
HELX_P HELX_P4  4  GLU A 44  ? GLN A 58  ? GLU A 42  GLN A 56  1 ? 15 
HELX_P HELX_P5  5  GLN A 61  ? CYS A 79  ? GLN A 59  CYS A 77  1 ? 19 
HELX_P HELX_P6  6  GLY A 80  ? GLY A 88  ? GLY A 78  GLY A 86  1 ? 9  
HELX_P HELX_P7  7  LYS A 89  ? SER A 101 ? LYS A 87  SER A 99  1 ? 13 
HELX_P HELX_P8  8  LEU A 105 ? THR A 109 ? LEU A 103 THR A 107 5 ? 5  
HELX_P HELX_P9  9  SER A 110 ? LEU A 128 ? SER A 108 LEU A 126 1 ? 19 
HELX_P HELX_P10 10 GLU A 131 ? GLN A 144 ? GLU A 129 GLN A 142 1 ? 14 
HELX_P HELX_P11 11 THR B 11  ? THR B 20  ? THR B 9   THR B 18  1 ? 10 
HELX_P HELX_P12 12 ASP B 28  ? ASN B 40  ? ASP B 26  ASN B 38  1 ? 13 
HELX_P HELX_P13 13 GLU B 44  ? GLN B 58  ? GLU B 42  GLN B 56  1 ? 15 
HELX_P HELX_P14 14 GLN B 61  ? CYS B 79  ? GLN B 59  CYS B 77  1 ? 19 
HELX_P HELX_P15 15 GLY B 80  ? GLY B 88  ? GLY B 78  GLY B 86  1 ? 9  
HELX_P HELX_P16 16 LYS B 89  ? SER B 101 ? LYS B 87  SER B 99  1 ? 13 
HELX_P HELX_P17 17 LEU B 105 ? THR B 109 ? LEU B 103 THR B 107 5 ? 5  
HELX_P HELX_P18 18 SER B 110 ? LEU B 128 ? SER B 108 LEU B 126 1 ? 19 
HELX_P HELX_P19 19 GLU B 131 ? GLN B 144 ? GLU B 129 GLN B 142 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 36 SG ? ? ? 1_555 A CYS 75 SG ? ? A CYS 34 A CYS 73 1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf2 disulf ? ? B CYS 36 SG ? ? ? 1_555 B CYS 75 SG ? ? B CYS 34 B CYS 73 1_555 ? ? ? ? ? ? ? 2.068 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'BINDING SITE FOR RESIDUE HEZ B 148' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 PRO A 22 ? PRO A 20  . ? 1_555 ? 
2 AC1 6 HOH F .  ? HOH A 223 . ? 1_555 ? 
3 AC1 6 THR B 11 ? THR B 9   . ? 1_555 ? 
4 AC1 6 GLU B 13 ? GLU B 11  . ? 1_555 ? 
5 AC1 6 HOH G .  ? HOH B 159 . ? 1_555 ? 
6 AC1 6 HOH G .  ? HOH B 200 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3G2S 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3G2S 
_atom_sites.fract_transf_matrix[1][1]   0.023568 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018907 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007334 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 4   ? -18.035 -25.082 -20.370 1.00 62.70  ? 2   GLU A N   1 
ATOM   2    C CA  . GLU A 1 4   ? -18.018 -23.634 -20.020 1.00 59.34  ? 2   GLU A CA  1 
ATOM   3    C C   . GLU A 1 4   ? -16.613 -23.049 -20.198 1.00 55.11  ? 2   GLU A C   1 
ATOM   4    O O   . GLU A 1 4   ? -16.376 -21.891 -19.856 1.00 53.45  ? 2   GLU A O   1 
ATOM   5    C CB  . GLU A 1 4   ? -18.483 -23.442 -18.578 1.00 56.67  ? 2   GLU A CB  1 
ATOM   6    C CG  . GLU A 1 4   ? -17.961 -24.516 -17.641 1.00 61.49  ? 2   GLU A CG  1 
ATOM   7    C CD  . GLU A 1 4   ? -17.570 -23.987 -16.271 1.00 69.20  ? 2   GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 4   ? -17.121 -22.815 -16.153 1.00 63.87  ? 2   GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 4   ? -17.666 -24.781 -15.310 1.00 64.35  ? 2   GLU A OE2 1 
ATOM   10   N N   . PRO A 1 5   ? -15.693 -23.842 -20.766 1.00 41.42  ? 3   PRO A N   1 
ATOM   11   C CA  . PRO A 1 5   ? -14.395 -23.346 -21.228 1.00 37.07  ? 3   PRO A CA  1 
ATOM   12   C C   . PRO A 1 5   ? -14.573 -22.212 -22.235 1.00 33.65  ? 3   PRO A C   1 
ATOM   13   O O   . PRO A 1 5   ? -15.465 -22.277 -23.082 1.00 36.47  ? 3   PRO A O   1 
ATOM   14   C CB  . PRO A 1 5   ? -13.775 -24.567 -21.914 1.00 40.70  ? 3   PRO A CB  1 
ATOM   15   C CG  . PRO A 1 5   ? -14.467 -25.741 -21.307 1.00 43.33  ? 3   PRO A CG  1 
ATOM   16   C CD  . PRO A 1 5   ? -15.865 -25.282 -21.026 1.00 44.74  ? 3   PRO A CD  1 
ATOM   17   N N   . ALA A 1 6   ? -13.843 -21.122 -22.028 1.00 31.26  ? 4   ALA A N   1 
ATOM   18   C CA  . ALA A 1 6   ? -14.029 -19.894 -22.800 1.00 26.55  ? 4   ALA A CA  1 
ATOM   19   C C   . ALA A 1 6   ? -13.556 -20.075 -24.239 1.00 25.42  ? 4   ALA A C   1 
ATOM   20   O O   . ALA A 1 6   ? -12.424 -20.501 -24.477 1.00 24.52  ? 4   ALA A O   1 
ATOM   21   C CB  . ALA A 1 6   ? -13.275 -18.747 -22.145 1.00 23.05  ? 4   ALA A CB  1 
ATOM   22   N N   . MET A 1 7   ? -14.401 -19.689 -25.193 1.00 26.34  ? 5   MET A N   1 
ATOM   23   C CA  . MET A 1 7   ? -14.032 -19.725 -26.606 1.00 26.81  ? 5   MET A CA  1 
ATOM   24   C C   . MET A 1 7   ? -13.153 -18.552 -27.062 1.00 25.18  ? 5   MET A C   1 
ATOM   25   O O   . MET A 1 7   ? -12.272 -18.717 -27.903 1.00 24.76  ? 5   MET A O   1 
ATOM   26   C CB  . MET A 1 7   ? -15.289 -19.832 -27.476 1.00 28.98  ? 5   MET A CB  1 
ATOM   27   C CG  . MET A 1 7   ? -16.138 -21.059 -27.189 1.00 30.82  ? 5   MET A CG  1 
ATOM   28   S SD  . MET A 1 7   ? -17.605 -21.080 -28.239 1.00 44.15  ? 5   MET A SD  1 
ATOM   29   C CE  . MET A 1 7   ? -18.884 -20.476 -27.133 1.00 43.20  ? 5   MET A CE  1 
ATOM   30   N N   . GLU A 1 8   ? -13.379 -17.369 -26.503 1.00 27.21  ? 6   GLU A N   1 
ATOM   31   C CA  . GLU A 1 8   ? -12.630 -16.188 -26.913 1.00 25.47  ? 6   GLU A CA  1 
ATOM   32   C C   . GLU A 1 8   ? -11.153 -16.375 -26.532 1.00 23.63  ? 6   GLU A C   1 
ATOM   33   O O   . GLU A 1 8   ? -10.851 -16.816 -25.426 1.00 23.04  ? 6   GLU A O   1 
ATOM   34   C CB  . GLU A 1 8   ? -13.201 -14.928 -26.243 1.00 24.68  ? 6   GLU A CB  1 
ATOM   35   C CG  . GLU A 1 8   ? -12.626 -13.633 -26.809 1.00 24.12  ? 6   GLU A CG  1 
ATOM   36   C CD  . GLU A 1 8   ? -13.057 -12.390 -26.034 1.00 22.78  ? 6   GLU A CD  1 
ATOM   37   O OE1 . GLU A 1 8   ? -13.346 -11.357 -26.681 1.00 23.97  ? 6   GLU A OE1 1 
ATOM   38   O OE2 . GLU A 1 8   ? -12.881 -12.372 -24.795 1.00 22.66  ? 6   GLU A OE2 1 
ATOM   39   N N   . PRO A 1 9   ? -10.231 -16.117 -27.469 1.00 21.19  ? 7   PRO A N   1 
ATOM   40   C CA  . PRO A 1 9   ? -8.819  -16.393 -27.200 1.00 19.58  ? 7   PRO A CA  1 
ATOM   41   C C   . PRO A 1 9   ? -8.289  -15.592 -26.001 1.00 17.95  ? 7   PRO A C   1 
ATOM   42   O O   . PRO A 1 9   ? -8.626  -14.423 -25.835 1.00 17.85  ? 7   PRO A O   1 
ATOM   43   C CB  . PRO A 1 9   ? -8.121  -15.928 -28.483 1.00 19.47  ? 7   PRO A CB  1 
ATOM   44   C CG  . PRO A 1 9   ? -9.161  -16.103 -29.547 1.00 21.36  ? 7   PRO A CG  1 
ATOM   45   C CD  . PRO A 1 9   ? -10.497 -15.887 -28.902 1.00 22.34  ? 7   PRO A CD  1 
ATOM   46   N N   . GLU A 1 10  ? -7.522  -16.232 -25.130 1.00 20.23  ? 8   GLU A N   1 
ATOM   47   C CA  . GLU A 1 10  ? -6.812  -15.477 -24.099 1.00 19.07  ? 8   GLU A CA  1 
ATOM   48   C C   . GLU A 1 10  ? -5.957  -14.363 -24.717 1.00 17.25  ? 8   GLU A C   1 
ATOM   49   O O   . GLU A 1 10  ? -5.268  -14.573 -25.716 1.00 17.37  ? 8   GLU A O   1 
ATOM   50   C CB  . GLU A 1 10  ? -5.970  -16.443 -23.260 1.00 18.55  ? 8   GLU A CB  1 
ATOM   51   C CG  . GLU A 1 10  ? -5.283  -15.835 -22.033 1.00 18.73  ? 8   GLU A CG  1 
ATOM   52   C CD  . GLU A 1 10  ? -4.712  -16.896 -21.091 1.00 18.51  ? 8   GLU A CD  1 
ATOM   53   O OE1 . GLU A 1 10  ? -4.653  -16.628 -19.868 1.00 20.88  ? 8   GLU A OE1 1 
ATOM   54   O OE2 . GLU A 1 10  ? -4.359  -18.005 -21.567 1.00 23.05  ? 8   GLU A OE2 1 
ATOM   55   N N   . THR A 1 11  ? -5.885  -13.209 -24.055 1.00 14.31  ? 9   THR A N   1 
ATOM   56   C CA  . THR A 1 11  ? -5.069  -12.113 -24.590 1.00 13.30  ? 9   THR A CA  1 
ATOM   57   C C   . THR A 1 11  ? -3.568  -12.368 -24.451 1.00 12.57  ? 9   THR A C   1 
ATOM   58   O O   . THR A 1 11  ? -3.124  -13.013 -23.504 1.00 12.09  ? 9   THR A O   1 
ATOM   59   C CB  . THR A 1 11  ? -5.388  -10.782 -23.905 1.00 13.27  ? 9   THR A CB  1 
ATOM   60   O OG1 . THR A 1 11  ? -5.070  -10.897 -22.514 1.00 12.49  ? 9   THR A OG1 1 
ATOM   61   C CG2 . THR A 1 11  ? -6.882  -10.414 -24.078 1.00 14.86  ? 9   THR A CG2 1 
ATOM   62   N N   . LEU A 1 12  ? -2.779  -11.724 -25.307 1.00 14.29  ? 10  LEU A N   1 
ATOM   63   C CA  . LEU A 1 12  ? -1.328  -11.759 -25.161 1.00 13.20  ? 10  LEU A CA  1 
ATOM   64   C C   . LEU A 1 12  ? -0.873  -11.161 -23.826 1.00 12.19  ? 10  LEU A C   1 
ATOM   65   O O   . LEU A 1 12  ? 0.112   -11.615 -23.238 1.00 11.64  ? 10  LEU A O   1 
ATOM   66   C CB  . LEU A 1 12  ? -0.641  -11.048 -26.331 1.00 12.88  ? 10  LEU A CB  1 
ATOM   67   C CG  . LEU A 1 12  ? -0.776  -11.743 -27.696 1.00 13.89  ? 10  LEU A CG  1 
ATOM   68   C CD1 . LEU A 1 12  ? 0.036   -11.011 -28.768 1.00 13.59  ? 10  LEU A CD1 1 
ATOM   69   C CD2 . LEU A 1 12  ? -0.358  -13.198 -27.613 1.00 14.34  ? 10  LEU A CD2 1 
ATOM   70   N N   . GLU A 1 13  ? -1.571  -10.138 -23.346 1.00 12.77  ? 11  GLU A N   1 
ATOM   71   C CA  . GLU A 1 13  ? -1.242  -9.552  -22.042 1.00 12.01  ? 11  GLU A CA  1 
ATOM   72   C C   . GLU A 1 13  ? -1.476  -10.564 -20.914 1.00 12.40  ? 11  GLU A C   1 
ATOM   73   O O   . GLU A 1 13  ? -0.578  -10.836 -20.122 1.00 12.00  ? 11  GLU A O   1 
ATOM   74   C CB  . GLU A 1 13  ? -2.108  -8.312  -21.786 1.00 12.27  ? 11  GLU A CB  1 
ATOM   75   C CG  . GLU A 1 13  ? -1.719  -7.082  -22.596 1.00 11.83  ? 11  GLU A CG  1 
ATOM   76   C CD  . GLU A 1 13  ? -2.376  -6.990  -23.975 1.00 12.65  ? 11  GLU A CD  1 
ATOM   77   O OE1 . GLU A 1 13  ? -1.979  -6.092  -24.752 1.00 12.46  ? 11  GLU A OE1 1 
ATOM   78   O OE2 . GLU A 1 13  ? -3.297  -7.781  -24.289 1.00 13.82  ? 11  GLU A OE2 1 
ATOM   79   N N   . ALA A 1 14  ? -2.617  -11.254 -20.939 1.00 10.52  ? 12  ALA A N   1 
ATOM   80   C CA  . ALA A 1 14  ? -2.891  -12.238 -19.890 1.00 10.78  ? 12  ALA A CA  1 
ATOM   81   C C   . ALA A 1 14  ? -1.856  -13.355 -19.939 1.00 10.68  ? 12  ALA A C   1 
ATOM   82   O O   . ALA A 1 14  ? -1.372  -13.821 -18.907 1.00 10.95  ? 12  ALA A O   1 
ATOM   83   C CB  . ALA A 1 14  ? -4.308  -12.832 -20.042 1.00 12.19  ? 12  ALA A CB  1 
ATOM   84   N N   . ARG A 1 15  ? -1.521  -13.778 -21.151 1.00 11.85  ? 13  ARG A N   1 
ATOM   85   C CA  . ARG A 1 15  ? -0.554  -14.869 -21.325 1.00 12.09  ? 13  ARG A CA  1 
ATOM   86   C C   . ARG A 1 15  ? 0.857   -14.511 -20.841 1.00 10.89  ? 13  ARG A C   1 
ATOM   87   O O   . ARG A 1 15  ? 1.503   -15.301 -20.149 1.00 11.04  ? 13  ARG A O   1 
ATOM   88   C CB  . ARG A 1 15  ? -0.527  -15.337 -22.790 1.00 12.63  ? 13  ARG A CB  1 
ATOM   89   C CG  . ARG A 1 15  ? -1.781  -16.088 -23.261 1.00 14.27  ? 13  ARG A CG  1 
ATOM   90   C CD  . ARG A 1 15  ? -1.584  -16.526 -24.712 1.00 15.02  ? 13  ARG A CD  1 
ATOM   91   N NE  . ARG A 1 15  ? -2.750  -17.193 -25.266 1.00 17.05  ? 13  ARG A NE  1 
ATOM   92   C CZ  . ARG A 1 15  ? -2.934  -18.507 -25.215 1.00 18.38  ? 13  ARG A CZ  1 
ATOM   93   N NH1 . ARG A 1 15  ? -3.980  -19.051 -25.832 1.00 20.22  ? 13  ARG A NH1 1 
ATOM   94   N NH2 . ARG A 1 15  ? -2.148  -19.254 -24.446 1.00 18.49  ? 13  ARG A NH2 1 
ATOM   95   N N   . ILE A 1 16  ? 1.374   -13.365 -21.268 1.00 11.37  ? 14  ILE A N   1 
ATOM   96   C CA  A ILE A 1 16  ? 2.728   -12.968 -20.895 0.50 10.88  ? 14  ILE A CA  1 
ATOM   97   C CA  B ILE A 1 16  ? 2.726   -12.957 -20.895 0.50 10.56  ? 14  ILE A CA  1 
ATOM   98   C C   . ILE A 1 16  ? 2.862   -12.680 -19.394 1.00 10.20  ? 14  ILE A C   1 
ATOM   99   O O   . ILE A 1 16  ? 3.895   -13.001 -18.780 1.00 10.17  ? 14  ILE A O   1 
ATOM   100  C CB  A ILE A 1 16  ? 3.229   -11.787 -21.756 0.50 9.59   ? 14  ILE A CB  1 
ATOM   101  C CB  B ILE A 1 16  ? 3.212   -11.754 -21.736 0.50 10.24  ? 14  ILE A CB  1 
ATOM   102  C CG1 A ILE A 1 16  ? 4.757   -11.721 -21.750 0.50 9.14   ? 14  ILE A CG1 1 
ATOM   103  C CG1 B ILE A 1 16  ? 4.735   -11.645 -21.673 0.50 9.49   ? 14  ILE A CG1 1 
ATOM   104  C CG2 A ILE A 1 16  ? 2.648   -10.466 -21.259 0.50 9.33   ? 14  ILE A CG2 1 
ATOM   105  C CG2 B ILE A 1 16  ? 2.583   -10.456 -21.240 0.50 9.33   ? 14  ILE A CG2 1 
ATOM   106  C CD1 A ILE A 1 16  ? 5.312   -10.807 -22.822 0.50 9.08   ? 14  ILE A CD1 1 
ATOM   107  C CD1 B ILE A 1 16  ? 5.434   -12.885 -22.168 0.50 9.29   ? 14  ILE A CD1 1 
ATOM   108  N N   . ASN A 1 17  ? 1.792   -12.171 -18.780 1.00 10.42  ? 15  ASN A N   1 
ATOM   109  C CA  . ASN A 1 17  ? 1.792   -11.949 -17.332 1.00 10.21  ? 15  ASN A CA  1 
ATOM   110  C C   . ASN A 1 17  ? 1.911   -13.258 -16.542 1.00 11.59  ? 15  ASN A C   1 
ATOM   111  O O   . ASN A 1 17  ? 2.521   -13.293 -15.466 1.00 11.13  ? 15  ASN A O   1 
ATOM   112  C CB  . ASN A 1 17  ? 0.581   -11.129 -16.874 1.00 10.55  ? 15  ASN A CB  1 
ATOM   113  C CG  . ASN A 1 17  ? 0.585   -9.713  -17.430 1.00 10.37  ? 15  ASN A CG  1 
ATOM   114  O OD1 . ASN A 1 17  ? 1.614   -9.209  -17.890 1.00 9.49   ? 15  ASN A OD1 1 
ATOM   115  N ND2 . ASN A 1 17  ? -0.584  -9.065  -17.397 1.00 10.67  ? 15  ASN A ND2 1 
ATOM   116  N N   . ARG A 1 18  ? 1.368   -14.335 -17.100 1.00 12.93  ? 16  ARG A N   1 
ATOM   117  C CA  . ARG A 1 18  ? 1.463   -15.651 -16.478 1.00 14.05  ? 16  ARG A CA  1 
ATOM   118  C C   . ARG A 1 18  ? 2.812   -16.317 -16.757 1.00 13.00  ? 16  ARG A C   1 
ATOM   119  O O   . ARG A 1 18  ? 3.353   -17.020 -15.904 1.00 13.15  ? 16  ARG A O   1 
ATOM   120  C CB  . ARG A 1 18  ? 0.323   -16.553 -16.956 1.00 16.64  ? 16  ARG A CB  1 
ATOM   121  C CG  . ARG A 1 18  ? 0.129   -17.805 -16.116 1.00 16.25  ? 16  ARG A CG  1 
ATOM   122  C CD  . ARG A 1 18  ? -1.119  -18.564 -16.536 1.00 21.25  ? 16  ARG A CD  1 
ATOM   123  N NE  . ARG A 1 18  ? -1.118  -18.871 -17.964 1.00 33.43  ? 16  ARG A NE  1 
ATOM   124  C CZ  . ARG A 1 18  ? -1.906  -18.280 -18.856 1.00 24.70  ? 16  ARG A CZ  1 
ATOM   125  N NH1 . ARG A 1 18  ? -1.837  -18.623 -20.135 1.00 34.43  ? 16  ARG A NH1 1 
ATOM   126  N NH2 . ARG A 1 18  ? -2.765  -17.347 -18.469 1.00 39.10  ? 16  ARG A NH2 1 
ATOM   127  N N   . ALA A 1 19  ? 3.347   -16.093 -17.954 1.00 10.54  ? 17  ALA A N   1 
ATOM   128  C CA  . ALA A 1 19  ? 4.620   -16.688 -18.354 1.00 10.10  ? 17  ALA A CA  1 
ATOM   129  C C   . ALA A 1 19  ? 5.825   -16.013 -17.672 1.00 8.62   ? 17  ALA A C   1 
ATOM   130  O O   . ALA A 1 19  ? 6.933   -16.564 -17.671 1.00 8.94   ? 17  ALA A O   1 
ATOM   131  C CB  . ALA A 1 19  ? 4.768   -16.652 -19.877 1.00 11.09  ? 17  ALA A CB  1 
ATOM   132  N N   . THR A 1 20  ? 5.634   -14.788 -17.171 1.00 8.64   ? 18  THR A N   1 
ATOM   133  C CA  . THR A 1 20  ? 6.753   -13.995 -16.633 1.00 7.01   ? 18  THR A CA  1 
ATOM   134  C C   . THR A 1 20  ? 6.465   -13.564 -15.180 1.00 7.16   ? 18  THR A C   1 
ATOM   135  O O   . THR A 1 20  ? 7.163   -12.746 -14.577 1.00 7.20   ? 18  THR A O   1 
ATOM   136  C CB  . THR A 1 20  ? 7.052   -12.754 -17.515 1.00 6.62   ? 18  THR A CB  1 
ATOM   137  O OG1 . THR A 1 20  ? 5.949   -11.831 -17.467 1.00 6.72   ? 18  THR A OG1 1 
ATOM   138  C CG2 . THR A 1 20  ? 7.390   -13.154 -18.973 1.00 8.27   ? 18  THR A CG2 1 
ATOM   139  N N   . ASN A 1 21  ? 5.447   -14.171 -14.581 1.00 12.81  ? 19  ASN A N   1 
ATOM   140  C CA  . ASN A 1 21  ? 5.057   -13.830 -13.218 1.00 11.19  ? 19  ASN A CA  1 
ATOM   141  C C   . ASN A 1 21  ? 6.210   -14.101 -12.254 1.00 10.59  ? 19  ASN A C   1 
ATOM   142  O O   . ASN A 1 21  ? 6.737   -15.213 -12.213 1.00 11.08  ? 19  ASN A O   1 
ATOM   143  C CB  . ASN A 1 21  ? 3.856   -14.683 -12.795 1.00 13.09  ? 19  ASN A CB  1 
ATOM   144  C CG  . ASN A 1 21  ? 3.127   -14.097 -11.609 1.00 15.11  ? 19  ASN A CG  1 
ATOM   145  O OD1 . ASN A 1 21  ? 3.742   -13.642 -10.639 1.00 13.25  ? 19  ASN A OD1 1 
ATOM   146  N ND2 . ASN A 1 21  ? 1.806   -13.973 -11.744 1.00 12.56  ? 19  ASN A ND2 1 
ATOM   147  N N   . PRO A 1 22  ? 6.622   -13.077 -11.497 1.00 11.65  ? 20  PRO A N   1 
ATOM   148  C CA  . PRO A 1 22  ? 7.657   -13.207 -10.471 1.00 13.53  ? 20  PRO A CA  1 
ATOM   149  C C   . PRO A 1 22  ? 7.341   -14.232 -9.378  1.00 12.42  ? 20  PRO A C   1 
ATOM   150  O O   . PRO A 1 22  ? 8.268   -14.710 -8.719  1.00 14.40  ? 20  PRO A O   1 
ATOM   151  C CB  . PRO A 1 22  ? 7.755   -11.796 -9.879  1.00 14.83  ? 20  PRO A CB  1 
ATOM   152  C CG  . PRO A 1 22  ? 7.081   -10.901 -10.839 1.00 13.81  ? 20  PRO A CG  1 
ATOM   153  C CD  . PRO A 1 22  ? 6.061   -11.718 -11.554 1.00 12.47  ? 20  PRO A CD  1 
ATOM   154  N N   . LEU A 1 23  ? 6.074   -14.613 -9.229  1.00 11.46  ? 21  LEU A N   1 
ATOM   155  C CA  . LEU A 1 23  ? 5.697   -15.643 -8.251  1.00 13.43  ? 21  LEU A CA  1 
ATOM   156  C C   . LEU A 1 23  ? 6.026   -17.075 -8.700  1.00 14.21  ? 21  LEU A C   1 
ATOM   157  O O   . LEU A 1 23  ? 5.952   -18.019 -7.887  1.00 15.78  ? 21  LEU A O   1 
ATOM   158  C CB  . LEU A 1 23  ? 4.215   -15.536 -7.903  1.00 15.70  ? 21  LEU A CB  1 
ATOM   159  C CG  . LEU A 1 23  ? 3.831   -14.283 -7.119  1.00 16.27  ? 21  LEU A CG  1 
ATOM   160  C CD1 . LEU A 1 23  ? 2.311   -14.203 -7.040  1.00 16.45  ? 21  LEU A CD1 1 
ATOM   161  C CD2 . LEU A 1 23  ? 4.448   -14.305 -5.723  1.00 20.25  ? 21  LEU A CD2 1 
ATOM   162  N N   . ASN A 1 24  ? 6.191   -17.264 -10.011 1.00 12.00  ? 22  ASN A N   1 
ATOM   163  C CA  . ASN A 1 24  ? 6.436   -18.605 -10.551 1.00 12.45  ? 22  ASN A CA  1 
ATOM   164  C C   . ASN A 1 24  ? 7.608   -19.243 -9.817  1.00 13.56  ? 22  ASN A C   1 
ATOM   165  O O   . ASN A 1 24  ? 8.675   -18.628 -9.678  1.00 14.93  ? 22  ASN A O   1 
ATOM   166  C CB  . ASN A 1 24  ? 6.711   -18.595 -12.065 1.00 12.08  ? 22  ASN A CB  1 
ATOM   167  C CG  . ASN A 1 24  ? 5.472   -18.275 -12.890 1.00 12.11  ? 22  ASN A CG  1 
ATOM   168  O OD1 . ASN A 1 24  ? 4.343   -18.360 -12.398 1.00 12.65  ? 22  ASN A OD1 1 
ATOM   169  N ND2 . ASN A 1 24  ? 5.678   -17.871 -14.141 1.00 11.81  ? 22  ASN A ND2 1 
ATOM   170  N N   . LYS A 1 25  ? 7.415   -20.478 -9.366  1.00 16.11  ? 23  LYS A N   1 
ATOM   171  C CA  . LYS A 1 25  ? 8.481   -21.197 -8.674  1.00 16.18  ? 23  LYS A CA  1 
ATOM   172  C C   . LYS A 1 25  ? 9.485   -21.813 -9.654  1.00 19.10  ? 23  LYS A C   1 
ATOM   173  O O   . LYS A 1 25  ? 10.632  -22.074 -9.286  1.00 21.44  ? 23  LYS A O   1 
ATOM   174  C CB  . LYS A 1 25  ? 7.889   -22.229 -7.700  1.00 18.11  ? 23  LYS A CB  1 
ATOM   175  C CG  . LYS A 1 25  ? 7.123   -21.580 -6.547  1.00 19.08  ? 23  LYS A CG  1 
ATOM   176  C CD  . LYS A 1 25  ? 6.260   -22.581 -5.794  1.00 29.39  ? 23  LYS A CD  1 
ATOM   177  C CE  . LYS A 1 25  ? 5.184   -21.864 -4.983  1.00 42.07  ? 23  LYS A CE  1 
ATOM   178  N NZ  . LYS A 1 25  ? 5.004   -22.465 -3.632  1.00 56.50  ? 23  LYS A NZ  1 
ATOM   179  N N   . GLU A 1 26  ? 9.038   -22.080 -10.883 1.00 19.34  ? 24  GLU A N   1 
ATOM   180  C CA  . GLU A 1 26  ? 9.871   -22.611 -11.971 1.00 19.57  ? 24  GLU A CA  1 
ATOM   181  C C   . GLU A 1 26  ? 9.305   -22.072 -13.283 1.00 16.80  ? 24  GLU A C   1 
ATOM   182  O O   . GLU A 1 26  ? 8.194   -21.538 -13.299 1.00 15.82  ? 24  GLU A O   1 
ATOM   183  C CB  . GLU A 1 26  ? 9.827   -24.144 -12.022 1.00 20.17  ? 24  GLU A CB  1 
ATOM   184  C CG  . GLU A 1 26  ? 10.213  -24.833 -10.737 1.00 25.70  ? 24  GLU A CG  1 
ATOM   185  C CD  . GLU A 1 26  ? 11.664  -25.278 -10.710 1.00 40.41  ? 24  GLU A CD  1 
ATOM   186  O OE1 . GLU A 1 26  ? 11.957  -26.205 -9.923  1.00 37.01  ? 24  GLU A OE1 1 
ATOM   187  O OE2 . GLU A 1 26  ? 12.511  -24.674 -11.414 1.00 36.72  ? 24  GLU A OE2 1 
ATOM   188  N N   . LEU A 1 27  ? 10.076  -22.170 -14.363 1.00 14.92  ? 25  LEU A N   1 
ATOM   189  C CA  . LEU A 1 27  ? 9.591   -21.783 -15.692 1.00 13.39  ? 25  LEU A CA  1 
ATOM   190  C C   . LEU A 1 27  ? 8.238   -22.413 -16.014 1.00 15.67  ? 25  LEU A C   1 
ATOM   191  O O   . LEU A 1 27  ? 8.042   -23.623 -15.812 1.00 17.61  ? 25  LEU A O   1 
ATOM   192  C CB  . LEU A 1 27  ? 10.609  -22.175 -16.769 1.00 14.81  ? 25  LEU A CB  1 
ATOM   193  C CG  . LEU A 1 27  ? 11.943  -21.421 -16.704 1.00 12.98  ? 25  LEU A CG  1 
ATOM   194  C CD1 . LEU A 1 27  ? 12.955  -22.075 -17.681 1.00 15.35  ? 25  LEU A CD1 1 
ATOM   195  C CD2 . LEU A 1 27  ? 11.789  -19.925 -17.028 1.00 13.50  ? 25  LEU A CD2 1 
ATOM   196  N N   . ASP A 1 28  ? 7.290   -21.588 -16.458 1.00 12.94  ? 26  ASP A N   1 
ATOM   197  C CA  . ASP A 1 28  ? 5.929   -22.041 -16.776 1.00 14.39  ? 26  ASP A CA  1 
ATOM   198  C C   . ASP A 1 28  ? 5.824   -22.418 -18.251 1.00 15.74  ? 26  ASP A C   1 
ATOM   199  O O   . ASP A 1 28  ? 5.402   -21.599 -19.067 1.00 15.93  ? 26  ASP A O   1 
ATOM   200  C CB  . ASP A 1 28  ? 4.905   -20.930 -16.461 1.00 13.85  ? 26  ASP A CB  1 
ATOM   201  C CG  . ASP A 1 28  ? 3.447   -21.381 -16.646 1.00 16.79  ? 26  ASP A CG  1 
ATOM   202  O OD1 . ASP A 1 28  ? 3.226   -22.520 -17.115 1.00 17.05  ? 26  ASP A OD1 1 
ATOM   203  O OD2 . ASP A 1 28  ? 2.518   -20.576 -16.356 1.00 17.87  ? 26  ASP A OD2 1 
ATOM   204  N N   . TRP A 1 29  ? 6.339   -23.589 -18.623 1.00 17.95  ? 27  TRP A N   1 
ATOM   205  C CA  . TRP A 1 29  ? 6.501   -23.907 -20.042 1.00 18.50  ? 27  TRP A CA  1 
ATOM   206  C C   . TRP A 1 29  ? 5.166   -23.903 -20.791 1.00 18.27  ? 27  TRP A C   1 
ATOM   207  O O   . TRP A 1 29  ? 5.102   -23.503 -21.950 1.00 18.68  ? 27  TRP A O   1 
ATOM   208  C CB  . TRP A 1 29  ? 7.245   -25.238 -20.242 1.00 17.96  ? 27  TRP A CB  1 
ATOM   209  C CG  . TRP A 1 29  ? 8.720   -25.105 -20.021 1.00 16.23  ? 27  TRP A CG  1 
ATOM   210  C CD1 . TRP A 1 29  ? 9.454   -25.587 -18.966 1.00 18.31  ? 27  TRP A CD1 1 
ATOM   211  C CD2 . TRP A 1 29  ? 9.621   -24.336 -20.816 1.00 15.49  ? 27  TRP A CD2 1 
ATOM   212  N NE1 . TRP A 1 29  ? 10.759  -25.153 -19.062 1.00 17.74  ? 27  TRP A NE1 1 
ATOM   213  C CE2 . TRP A 1 29  ? 10.902  -24.460 -20.236 1.00 15.04  ? 27  TRP A CE2 1 
ATOM   214  C CE3 . TRP A 1 29  ? 9.493   -23.650 -22.028 1.00 17.47  ? 27  TRP A CE3 1 
ATOM   215  C CZ2 . TRP A 1 29  ? 12.033  -23.850 -20.785 1.00 16.19  ? 27  TRP A CZ2 1 
ATOM   216  C CZ3 . TRP A 1 29  ? 10.618  -23.044 -22.570 1.00 16.83  ? 27  TRP A CZ3 1 
ATOM   217  C CH2 . TRP A 1 29  ? 11.859  -23.102 -21.920 1.00 19.09  ? 27  TRP A CH2 1 
ATOM   218  N N   . ALA A 1 30  ? 4.077   -24.253 -20.108 1.00 20.73  ? 28  ALA A N   1 
ATOM   219  C CA  . ALA A 1 30  ? 2.780   -24.285 -20.781 1.00 20.94  ? 28  ALA A CA  1 
ATOM   220  C C   . ALA A 1 30  ? 2.371   -22.880 -21.227 1.00 20.83  ? 28  ALA A C   1 
ATOM   221  O O   . ALA A 1 30  ? 1.878   -22.687 -22.343 1.00 22.31  ? 28  ALA A O   1 
ATOM   222  C CB  . ALA A 1 30  ? 1.703   -24.897 -19.876 1.00 21.51  ? 28  ALA A CB  1 
ATOM   223  N N   . SER A 1 31  ? 2.549   -21.916 -20.331 1.00 15.81  ? 29  SER A N   1 
ATOM   224  C CA  . SER A 1 31  ? 2.266   -20.519 -20.636 1.00 16.46  ? 29  SER A CA  1 
ATOM   225  C C   . SER A 1 31  ? 3.260   -19.970 -21.661 1.00 15.65  ? 29  SER A C   1 
ATOM   226  O O   . SER A 1 31  ? 2.881   -19.231 -22.562 1.00 16.59  ? 29  SER A O   1 
ATOM   227  C CB  . SER A 1 31  ? 2.289   -19.672 -19.361 1.00 15.92  ? 29  SER A CB  1 
ATOM   228  O OG  . SER A 1 31  ? 1.206   -20.020 -18.516 1.00 17.99  ? 29  SER A OG  1 
ATOM   229  N N   . ILE A 1 32  ? 4.536   -20.316 -21.516 1.00 14.79  ? 30  ILE A N   1 
ATOM   230  C CA  . ILE A 1 32  ? 5.568   -19.860 -22.459 1.00 15.09  ? 30  ILE A CA  1 
ATOM   231  C C   . ILE A 1 32  ? 5.293   -20.355 -23.873 1.00 16.79  ? 30  ILE A C   1 
ATOM   232  O O   . ILE A 1 32  ? 5.144   -19.552 -24.795 1.00 15.78  ? 30  ILE A O   1 
ATOM   233  C CB  . ILE A 1 32  ? 6.969   -20.347 -22.038 1.00 12.90  ? 30  ILE A CB  1 
ATOM   234  C CG1 . ILE A 1 32  ? 7.378   -19.700 -20.710 1.00 11.77  ? 30  ILE A CG1 1 
ATOM   235  C CG2 . ILE A 1 32  ? 7.986   -20.128 -23.172 1.00 14.43  ? 30  ILE A CG2 1 
ATOM   236  C CD1 . ILE A 1 32  ? 8.667   -20.257 -20.102 1.00 11.70  ? 30  ILE A CD1 1 
ATOM   237  N N   . ASN A 1 33  ? 5.059   -21.659 -23.996 1.00 21.15  ? 31  ASN A N   1 
ATOM   238  C CA  . ASN A 1 33  ? 4.764   -22.279 -25.293 1.00 21.42  ? 31  ASN A CA  1 
ATOM   239  C C   . ASN A 1 33  ? 3.420   -21.737 -25.820 1.00 24.07  ? 31  ASN A C   1 
ATOM   240  O O   . ASN A 1 33  ? 3.305   -21.338 -26.985 1.00 23.29  ? 31  ASN A O   1 
ATOM   241  C CB  . ASN A 1 33  ? 4.712   -23.812 -25.160 1.00 22.11  ? 31  ASN A CB  1 
ATOM   242  C CG  . ASN A 1 33  ? 6.064   -24.446 -24.801 1.00 18.86  ? 31  ASN A CG  1 
ATOM   243  O OD1 . ASN A 1 33  ? 7.125   -23.946 -25.162 1.00 23.59  ? 31  ASN A OD1 1 
ATOM   244  N ND2 . ASN A 1 33  ? 6.008   -25.626 -24.191 1.00 26.46  ? 31  ASN A ND2 1 
ATOM   245  N N   . GLY A 1 34  ? 2.454   -21.540 -24.926 1.00 23.05  ? 32  GLY A N   1 
ATOM   246  C CA  . GLY A 1 34  ? 1.165   -20.981 -25.344 1.00 20.43  ? 32  GLY A CA  1 
ATOM   247  C C   . GLY A 1 34  ? 1.262   -19.585 -25.941 1.00 20.03  ? 32  GLY A C   1 
ATOM   248  O O   . GLY A 1 34  ? 0.513   -19.230 -26.850 1.00 20.83  ? 32  GLY A O   1 
ATOM   249  N N   . PHE A 1 35  ? 2.094   -18.742 -25.344 1.00 16.35  ? 33  PHE A N   1 
ATOM   250  C CA  . PHE A 1 35  ? 2.301   -17.373 -25.809 1.00 14.73  ? 33  PHE A CA  1 
ATOM   251  C C   . PHE A 1 35  ? 2.913   -17.366 -27.219 1.00 16.20  ? 33  PHE A C   1 
ATOM   252  O O   . PHE A 1 35  ? 2.395   -16.707 -28.124 1.00 17.33  ? 33  PHE A O   1 
ATOM   253  C CB  . PHE A 1 35  ? 3.213   -16.616 -24.823 1.00 13.24  ? 33  PHE A CB  1 
ATOM   254  C CG  . PHE A 1 35  ? 3.558   -15.218 -25.257 1.00 12.21  ? 33  PHE A CG  1 
ATOM   255  C CD1 . PHE A 1 35  ? 4.715   -14.957 -26.003 1.00 11.75  ? 33  PHE A CD1 1 
ATOM   256  C CD2 . PHE A 1 35  ? 2.719   -14.155 -24.953 1.00 11.93  ? 33  PHE A CD2 1 
ATOM   257  C CE1 . PHE A 1 35  ? 5.046   -13.647 -26.357 1.00 11.62  ? 33  PHE A CE1 1 
ATOM   258  C CE2 . PHE A 1 35  ? 3.039   -12.851 -25.320 1.00 11.51  ? 33  PHE A CE2 1 
ATOM   259  C CZ  . PHE A 1 35  ? 4.243   -12.586 -25.974 1.00 10.90  ? 33  PHE A CZ  1 
ATOM   260  N N   . CYS A 1 36  ? 3.904   -18.218 -27.452 1.00 17.17  ? 34  CYS A N   1 
ATOM   261  C CA  . CYS A 1 36  ? 4.538   -18.263 -28.774 1.00 21.94  ? 34  CYS A CA  1 
ATOM   262  C C   . CYS A 1 36  ? 3.542   -18.740 -29.826 1.00 24.22  ? 34  CYS A C   1 
ATOM   263  O O   . CYS A 1 36  ? 3.431   -18.156 -30.915 1.00 23.23  ? 34  CYS A O   1 
ATOM   264  C CB  . CYS A 1 36  ? 5.783   -19.154 -28.768 1.00 19.24  ? 34  CYS A CB  1 
ATOM   265  S SG  . CYS A 1 36  ? 7.092   -18.614 -27.667 1.00 22.04  ? 34  CYS A SG  1 
ATOM   266  N N   . GLU A 1 37  ? 2.753   -19.740 -29.436 1.00 22.63  ? 35  GLU A N   1 
ATOM   267  C CA  . GLU A 1 37  ? 1.774   -20.371 -30.313 1.00 31.44  ? 35  GLU A CA  1 
ATOM   268  C C   . GLU A 1 37  ? 0.641   -19.424 -30.713 1.00 31.21  ? 35  GLU A C   1 
ATOM   269  O O   . GLU A 1 37  ? 0.027   -19.615 -31.761 1.00 37.30  ? 35  GLU A O   1 
ATOM   270  C CB  . GLU A 1 37  ? 1.197   -21.630 -29.652 1.00 30.73  ? 35  GLU A CB  1 
ATOM   271  C CG  . GLU A 1 37  ? 2.119   -22.841 -29.708 1.00 33.09  ? 35  GLU A CG  1 
ATOM   272  C CD  . GLU A 1 37  ? 1.798   -23.907 -28.678 1.00 40.61  ? 35  GLU A CD  1 
ATOM   273  O OE1 . GLU A 1 37  ? 0.704   -23.861 -28.067 1.00 43.21  ? 35  GLU A OE1 1 
ATOM   274  O OE2 . GLU A 1 37  ? 2.673   -24.773 -28.450 1.00 40.41  ? 35  GLU A OE2 1 
ATOM   275  N N   . GLN A 1 38  ? 0.360   -18.422 -29.883 1.00 33.00  ? 36  GLN A N   1 
ATOM   276  C CA  . GLN A 1 38  ? -0.817  -17.568 -30.040 1.00 32.30  ? 36  GLN A CA  1 
ATOM   277  C C   . GLN A 1 38  ? -0.563  -16.211 -30.690 1.00 30.93  ? 36  GLN A C   1 
ATOM   278  O O   . GLN A 1 38  ? -1.509  -15.493 -31.021 1.00 31.39  ? 36  GLN A O   1 
ATOM   279  C CB  . GLN A 1 38  ? -1.526  -17.358 -28.697 1.00 36.20  ? 36  GLN A CB  1 
ATOM   280  C CG  . GLN A 1 38  ? -2.387  -16.093 -28.600 1.00 32.66  ? 36  GLN A CG  1 
ATOM   281  C CD  . GLN A 1 38  ? -3.772  -16.261 -29.214 1.00 46.96  ? 36  GLN A CD  1 
ATOM   282  O OE1 . GLN A 1 38  ? -4.404  -17.311 -29.084 1.00 48.59  ? 36  GLN A OE1 1 
ATOM   283  N NE2 . GLN A 1 38  ? -4.251  -15.218 -29.883 1.00 42.34  ? 36  GLN A NE2 1 
ATOM   284  N N   . LEU A 1 39  ? 0.691   -15.769 -30.697 1.00 26.10  ? 37  LEU A N   1 
ATOM   285  C CA  . LEU A 1 39  ? 1.006   -14.426 -31.184 1.00 24.15  ? 37  LEU A CA  1 
ATOM   286  C C   . LEU A 1 39  ? 0.916   -14.315 -32.707 1.00 27.90  ? 37  LEU A C   1 
ATOM   287  O O   . LEU A 1 39  ? 0.748   -13.214 -33.244 1.00 27.57  ? 37  LEU A O   1 
ATOM   288  C CB  . LEU A 1 39  ? 2.391   -13.976 -30.698 1.00 15.53  ? 37  LEU A CB  1 
ATOM   289  C CG  . LEU A 1 39  ? 3.621   -14.811 -31.087 1.00 17.90  ? 37  LEU A CG  1 
ATOM   290  C CD1 . LEU A 1 39  ? 4.134   -14.402 -32.461 1.00 19.93  ? 37  LEU A CD1 1 
ATOM   291  C CD2 . LEU A 1 39  ? 4.745   -14.585 -30.099 1.00 17.43  ? 37  LEU A CD2 1 
ATOM   292  N N   . ASN A 1 40  ? 0.863   -15.466 -33.375 1.00 33.07  ? 38  ASN A N   1 
ATOM   293  C CA  . ASN A 1 40  ? 0.696   -15.506 -34.831 1.00 39.40  ? 38  ASN A CA  1 
ATOM   294  C C   . ASN A 1 40  ? -0.749  -15.363 -35.329 1.00 40.58  ? 38  ASN A C   1 
ATOM   295  O O   . ASN A 1 40  ? -1.001  -15.353 -36.535 1.00 41.05  ? 38  ASN A O   1 
ATOM   296  C CB  . ASN A 1 40  ? 1.338   -16.762 -35.443 1.00 42.04  ? 38  ASN A CB  1 
ATOM   297  C CG  . ASN A 1 40  ? 2.647   -17.153 -34.773 1.00 47.08  ? 38  ASN A CG  1 
ATOM   298  O OD1 . ASN A 1 40  ? 2.649   -17.597 -33.624 1.00 48.59  ? 38  ASN A OD1 1 
ATOM   299  N ND2 . ASN A 1 40  ? 3.733   -17.169 -35.550 1.00 46.42  ? 38  ASN A ND2 1 
ATOM   300  N N   . GLU A 1 41  ? -1.694  -15.246 -34.404 1.00 37.62  ? 39  GLU A N   1 
ATOM   301  C CA  . GLU A 1 41  ? -3.104  -15.486 -34.703 1.00 40.18  ? 39  GLU A CA  1 
ATOM   302  C C   . GLU A 1 41  ? -3.767  -14.332 -35.452 1.00 42.61  ? 39  GLU A C   1 
ATOM   303  O O   . GLU A 1 41  ? -4.880  -14.481 -35.962 1.00 42.07  ? 39  GLU A O   1 
ATOM   304  C CB  . GLU A 1 41  ? -3.885  -15.789 -33.422 1.00 40.71  ? 39  GLU A CB  1 
ATOM   305  C CG  . GLU A 1 41  ? -3.658  -17.187 -32.863 1.00 41.55  ? 39  GLU A CG  1 
ATOM   306  C CD  . GLU A 1 41  ? -3.727  -18.259 -33.933 1.00 50.51  ? 39  GLU A CD  1 
ATOM   307  O OE1 . GLU A 1 41  ? -2.674  -18.844 -34.267 1.00 48.64  ? 39  GLU A OE1 1 
ATOM   308  O OE2 . GLU A 1 41  ? -4.847  -18.542 -34.407 1.00 53.90  ? 39  GLU A OE2 1 
ATOM   309  N N   . ASP A 1 42  ? -3.137  -13.160 -35.419 1.00 44.18  ? 40  ASP A N   1 
ATOM   310  C CA  . ASP A 1 42  ? -3.620  -12.005 -36.175 1.00 46.86  ? 40  ASP A CA  1 
ATOM   311  C C   . ASP A 1 42  ? -2.474  -11.134 -36.687 1.00 45.27  ? 40  ASP A C   1 
ATOM   312  O O   . ASP A 1 42  ? -1.303  -11.423 -36.445 1.00 40.08  ? 40  ASP A O   1 
ATOM   313  C CB  . ASP A 1 42  ? -4.565  -11.163 -35.315 1.00 46.81  ? 40  ASP A CB  1 
ATOM   314  C CG  . ASP A 1 42  ? -3.824  -10.318 -34.304 1.00 50.99  ? 40  ASP A CG  1 
ATOM   315  O OD1 . ASP A 1 42  ? -2.707  -10.717 -33.907 1.00 49.89  ? 40  ASP A OD1 1 
ATOM   316  O OD2 . ASP A 1 42  ? -4.334  -9.237  -33.939 1.00 59.64  ? 40  ASP A OD2 1 
ATOM   317  N N   . PHE A 1 43  ? -2.818  -10.058 -37.389 1.00 58.75  ? 41  PHE A N   1 
ATOM   318  C CA  . PHE A 1 43  ? -1.810  -9.118  -37.867 1.00 60.12  ? 41  PHE A CA  1 
ATOM   319  C C   . PHE A 1 43  ? -1.163  -8.326  -36.734 1.00 55.58  ? 41  PHE A C   1 
ATOM   320  O O   . PHE A 1 43  ? 0.032   -8.017  -36.776 1.00 54.95  ? 41  PHE A O   1 
ATOM   321  C CB  . PHE A 1 43  ? -2.397  -8.163  -38.911 1.00 64.77  ? 41  PHE A CB  1 
ATOM   322  C CG  . PHE A 1 43  ? -1.360  -7.343  -39.622 1.00 67.34  ? 41  PHE A CG  1 
ATOM   323  C CD1 . PHE A 1 43  ? -1.232  -5.988  -39.358 1.00 72.24  ? 41  PHE A CD1 1 
ATOM   324  C CD2 . PHE A 1 43  ? -0.397  -7.962  -40.405 1.00 73.75  ? 41  PHE A CD2 1 
ATOM   325  C CE1 . PHE A 1 43  ? -0.224  -5.245  -39.949 1.00 76.73  ? 41  PHE A CE1 1 
ATOM   326  C CE2 . PHE A 1 43  ? 0.614   -7.229  -41.001 1.00 76.27  ? 41  PHE A CE2 1 
ATOM   327  C CZ  . PHE A 1 43  ? 0.710   -5.868  -40.762 1.00 74.22  ? 41  PHE A CZ  1 
ATOM   328  N N   . GLU A 1 44  ? -1.968  -7.927  -35.755 1.00 39.64  ? 42  GLU A N   1 
ATOM   329  C CA  . GLU A 1 44  ? -1.455  -7.116  -34.655 1.00 34.14  ? 42  GLU A CA  1 
ATOM   330  C C   . GLU A 1 44  ? -0.605  -7.940  -33.691 1.00 29.28  ? 42  GLU A C   1 
ATOM   331  O O   . GLU A 1 44  ? 0.047   -7.386  -32.798 1.00 22.71  ? 42  GLU A O   1 
ATOM   332  C CB  . GLU A 1 44  ? -2.608  -6.433  -33.907 1.00 34.28  ? 42  GLU A CB  1 
ATOM   333  C CG  . GLU A 1 44  ? -3.787  -6.008  -34.775 1.00 48.76  ? 42  GLU A CG  1 
ATOM   334  C CD  . GLU A 1 44  ? -3.393  -5.183  -35.992 1.00 58.04  ? 42  GLU A CD  1 
ATOM   335  O OE1 . GLU A 1 44  ? -4.308  -4.749  -36.726 1.00 67.02  ? 42  GLU A OE1 1 
ATOM   336  O OE2 . GLU A 1 44  ? -2.183  -5.011  -36.252 1.00 58.59  ? 42  GLU A OE2 1 
ATOM   337  N N   . GLY A 1 45  ? -0.622  -9.263  -33.857 1.00 25.32  ? 43  GLY A N   1 
ATOM   338  C CA  . GLY A 1 45  ? -0.011  -10.161 -32.876 1.00 22.06  ? 43  GLY A CA  1 
ATOM   339  C C   . GLY A 1 45  ? 1.480   -9.945  -32.630 1.00 20.06  ? 43  GLY A C   1 
ATOM   340  O O   . GLY A 1 45  ? 1.917   -9.699  -31.491 1.00 17.20  ? 43  GLY A O   1 
ATOM   341  N N   . PRO A 1 46  ? 2.301   -10.205 -33.657 1.00 18.47  ? 44  PRO A N   1 
ATOM   342  C CA  . PRO A 1 46  ? 3.754   -10.220 -33.454 1.00 18.04  ? 44  PRO A CA  1 
ATOM   343  C C   . PRO A 1 46  ? 4.393   -8.897  -32.997 1.00 17.59  ? 44  PRO A C   1 
ATOM   344  O O   . PRO A 1 46  ? 5.163   -8.899  -32.039 1.00 14.11  ? 44  PRO A O   1 
ATOM   345  C CB  . PRO A 1 46  ? 4.293   -10.622 -34.829 1.00 20.29  ? 44  PRO A CB  1 
ATOM   346  C CG  . PRO A 1 46  ? 3.195   -11.436 -35.441 1.00 20.29  ? 44  PRO A CG  1 
ATOM   347  C CD  . PRO A 1 46  ? 1.907   -10.826 -34.939 1.00 21.91  ? 44  PRO A CD  1 
ATOM   348  N N   . PRO A 1 47  ? 3.930   -7.757  -33.533 1.00 18.00  ? 45  PRO A N   1 
ATOM   349  C CA  . PRO A 1 47  ? 4.376   -6.471  -32.980 1.00 16.85  ? 45  PRO A CA  1 
ATOM   350  C C   . PRO A 1 47  ? 3.923   -6.236  -31.534 1.00 15.11  ? 45  PRO A C   1 
ATOM   351  O O   . PRO A 1 47  ? 4.690   -5.698  -30.738 1.00 13.62  ? 45  PRO A O   1 
ATOM   352  C CB  . PRO A 1 47  ? 3.741   -5.432  -33.918 1.00 18.36  ? 45  PRO A CB  1 
ATOM   353  C CG  . PRO A 1 47  ? 3.238   -6.187  -35.085 1.00 22.93  ? 45  PRO A CG  1 
ATOM   354  C CD  . PRO A 1 47  ? 2.991   -7.593  -34.656 1.00 19.92  ? 45  PRO A CD  1 
ATOM   355  N N   . LEU A 1 48  ? 2.684   -6.586  -31.191 1.00 12.67  ? 46  LEU A N   1 
ATOM   356  C CA  . LEU A 1 48  ? 2.255   -6.529  -29.781 1.00 12.06  ? 46  LEU A CA  1 
ATOM   357  C C   . LEU A 1 48  ? 3.116   -7.400  -28.866 1.00 11.12  ? 46  LEU A C   1 
ATOM   358  O O   . LEU A 1 48  ? 3.572   -6.953  -27.802 1.00 10.48  ? 46  LEU A O   1 
ATOM   359  C CB  . LEU A 1 48  ? 0.773   -6.927  -29.652 1.00 13.00  ? 46  LEU A CB  1 
ATOM   360  C CG  . LEU A 1 48  ? 0.213   -6.938  -28.221 1.00 12.49  ? 46  LEU A CG  1 
ATOM   361  C CD1 . LEU A 1 48  ? 0.412   -5.598  -27.534 1.00 11.94  ? 46  LEU A CD1 1 
ATOM   362  C CD2 . LEU A 1 48  ? -1.256  -7.364  -28.160 1.00 13.59  ? 46  LEU A CD2 1 
ATOM   363  N N   . ALA A 1 49  ? 3.373   -8.633  -29.292 1.00 11.14  ? 47  ALA A N   1 
ATOM   364  C CA  . ALA A 1 49  ? 4.208   -9.552  -28.527 1.00 9.79   ? 47  ALA A CA  1 
ATOM   365  C C   . ALA A 1 49  ? 5.601   -8.963  -28.240 1.00 9.35   ? 47  ALA A C   1 
ATOM   366  O O   . ALA A 1 49  ? 6.122   -9.064  -27.107 1.00 8.53   ? 47  ALA A O   1 
ATOM   367  C CB  . ALA A 1 49  ? 4.328   -10.894 -29.229 1.00 10.67  ? 47  ALA A CB  1 
ATOM   368  N N   . THR A 1 50  ? 6.204   -8.340  -29.251 1.00 10.90  ? 48  THR A N   1 
ATOM   369  C CA  . THR A 1 50  ? 7.542   -7.798  -29.045 1.00 11.38  ? 48  THR A CA  1 
ATOM   370  C C   . THR A 1 50  ? 7.538   -6.580  -28.128 1.00 10.21  ? 48  THR A C   1 
ATOM   371  O O   . THR A 1 50  ? 8.433   -6.423  -27.293 1.00 9.76   ? 48  THR A O   1 
ATOM   372  C CB  . THR A 1 50  ? 8.332   -7.526  -30.380 1.00 10.49  ? 48  THR A CB  1 
ATOM   373  O OG1 . THR A 1 50  ? 7.595   -6.621  -31.208 1.00 11.54  ? 48  THR A OG1 1 
ATOM   374  C CG2 . THR A 1 50  ? 8.551   -8.832  -31.146 1.00 11.86  ? 48  THR A CG2 1 
ATOM   375  N N   . ARG A 1 51  ? 6.491   -5.768  -28.220 1.00 10.21  ? 49  ARG A N   1 
ATOM   376  C CA  . ARG A 1 51  ? 6.334   -4.649  -27.303 1.00 9.90   ? 49  ARG A CA  1 
ATOM   377  C C   . ARG A 1 51  ? 6.145   -5.111  -25.867 1.00 9.45   ? 49  ARG A C   1 
ATOM   378  O O   . ARG A 1 51  ? 6.766   -4.589  -24.947 1.00 9.09   ? 49  ARG A O   1 
ATOM   379  C CB  . ARG A 1 51  ? 5.215   -3.712  -27.761 1.00 10.53  ? 49  ARG A CB  1 
ATOM   380  C CG  . ARG A 1 51  ? 5.543   -3.106  -29.116 1.00 15.71  ? 49  ARG A CG  1 
ATOM   381  C CD  . ARG A 1 51  ? 4.592   -1.997  -29.541 1.00 24.42  ? 49  ARG A CD  1 
ATOM   382  N NE  . ARG A 1 51  ? 3.511   -2.492  -30.393 1.00 35.70  ? 49  ARG A NE  1 
ATOM   383  C CZ  . ARG A 1 51  ? 2.262   -2.632  -29.972 1.00 35.49  ? 49  ARG A CZ  1 
ATOM   384  N NH1 . ARG A 1 51  ? 1.329   -3.096  -30.791 1.00 25.59  ? 49  ARG A NH1 1 
ATOM   385  N NH2 . ARG A 1 51  ? 1.935   -2.252  -28.742 1.00 45.63  ? 49  ARG A NH2 1 
ATOM   386  N N   . LEU A 1 52  ? 5.325   -6.139  -25.680 1.00 8.85   ? 50  LEU A N   1 
ATOM   387  C CA  . LEU A 1 52  ? 5.144   -6.693  -24.350 1.00 8.54   ? 50  LEU A CA  1 
ATOM   388  C C   . LEU A 1 52  ? 6.446   -7.313  -23.826 1.00 6.87   ? 50  LEU A C   1 
ATOM   389  O O   . LEU A 1 52  ? 6.813   -7.157  -22.651 1.00 8.02   ? 50  LEU A O   1 
ATOM   390  C CB  . LEU A 1 52  ? 4.014   -7.736  -24.371 1.00 8.89   ? 50  LEU A CB  1 
ATOM   391  C CG  . LEU A 1 52  ? 2.614   -7.139  -24.582 1.00 9.34   ? 50  LEU A CG  1 
ATOM   392  C CD1 . LEU A 1 52  ? 1.630   -8.305  -24.741 1.00 9.23   ? 50  LEU A CD1 1 
ATOM   393  C CD2 . LEU A 1 52  ? 2.228   -6.255  -23.404 1.00 9.42   ? 50  LEU A CD2 1 
ATOM   394  N N   . LEU A 1 53  ? 7.137   -8.069  -24.669 1.00 7.34   ? 51  LEU A N   1 
ATOM   395  C CA  . LEU A 1 53  ? 8.389   -8.680  -24.206 1.00 6.87   ? 51  LEU A CA  1 
ATOM   396  C C   . LEU A 1 53  ? 9.430   -7.628  -23.843 1.00 5.56   ? 51  LEU A C   1 
ATOM   397  O O   . LEU A 1 53  ? 10.142  -7.773  -22.851 1.00 6.79   ? 51  LEU A O   1 
ATOM   398  C CB  . LEU A 1 53  ? 8.982   -9.620  -25.263 1.00 6.95   ? 51  LEU A CB  1 
ATOM   399  C CG  . LEU A 1 53  ? 8.294   -10.973 -25.427 1.00 8.74   ? 51  LEU A CG  1 
ATOM   400  C CD1 . LEU A 1 53  ? 8.708   -11.614 -26.772 1.00 7.10   ? 51  LEU A CD1 1 
ATOM   401  C CD2 . LEU A 1 53  ? 8.726   -11.854 -24.236 1.00 6.66   ? 51  LEU A CD2 1 
ATOM   402  N N   . ALA A 1 54  ? 9.541   -6.585  -24.655 1.00 8.17   ? 52  ALA A N   1 
ATOM   403  C CA  . ALA A 1 54  ? 10.525  -5.525  -24.380 1.00 8.27   ? 52  ALA A CA  1 
ATOM   404  C C   . ALA A 1 54  ? 10.313  -4.888  -23.013 1.00 8.25   ? 52  ALA A C   1 
ATOM   405  O O   . ALA A 1 54  ? 11.260  -4.754  -22.237 1.00 8.21   ? 52  ALA A O   1 
ATOM   406  C CB  . ALA A 1 54  ? 10.496  -4.440  -25.470 1.00 8.49   ? 52  ALA A CB  1 
ATOM   407  N N   . HIS A 1 55  ? 9.055   -4.633  -22.660 1.00 9.19   ? 53  HIS A N   1 
ATOM   408  C CA  . HIS A 1 55  ? 8.767   -4.099  -21.335 1.00 9.27   ? 53  HIS A CA  1 
ATOM   409  C C   . HIS A 1 55  ? 9.196   -5.076  -20.239 1.00 9.31   ? 53  HIS A C   1 
ATOM   410  O O   . HIS A 1 55  ? 9.836   -4.677  -19.265 1.00 9.05   ? 53  HIS A O   1 
ATOM   411  C CB  . HIS A 1 55  ? 7.289   -3.740  -21.202 1.00 9.79   ? 53  HIS A CB  1 
ATOM   412  C CG  . HIS A 1 55  ? 6.933   -3.199  -19.849 1.00 9.64   ? 53  HIS A CG  1 
ATOM   413  N ND1 . HIS A 1 55  ? 6.139   -3.886  -18.961 1.00 10.64  ? 53  HIS A ND1 1 
ATOM   414  C CD2 . HIS A 1 55  ? 7.392   -2.115  -19.180 1.00 9.75   ? 53  HIS A CD2 1 
ATOM   415  C CE1 . HIS A 1 55  ? 6.076   -3.220  -17.819 1.00 9.78   ? 53  HIS A CE1 1 
ATOM   416  N NE2 . HIS A 1 55  ? 6.817   -2.133  -17.931 1.00 9.78   ? 53  HIS A NE2 1 
ATOM   417  N N   . LYS A 1 56  ? 8.838   -6.350  -20.385 1.00 7.58   ? 54  LYS A N   1 
ATOM   418  C CA  . LYS A 1 56  ? 9.127   -7.321  -19.331 1.00 6.49   ? 54  LYS A CA  1 
ATOM   419  C C   . LYS A 1 56  ? 10.636  -7.478  -19.130 1.00 7.68   ? 54  LYS A C   1 
ATOM   420  O O   . LYS A 1 56  ? 11.135  -7.610  -18.000 1.00 7.69   ? 54  LYS A O   1 
ATOM   421  C CB  . LYS A 1 56  ? 8.434   -8.667  -19.588 1.00 7.35   ? 54  LYS A CB  1 
ATOM   422  C CG  . LYS A 1 56  ? 6.892   -8.621  -19.543 1.00 8.29   ? 54  LYS A CG  1 
ATOM   423  C CD  . LYS A 1 56  ? 6.328   -8.192  -18.176 1.00 5.84   ? 54  LYS A CD  1 
ATOM   424  C CE  . LYS A 1 56  ? 4.789   -8.459  -18.139 1.00 6.79   ? 54  LYS A CE  1 
ATOM   425  N NZ  . LYS A 1 56  ? 4.088   -7.958  -16.905 1.00 8.65   ? 54  LYS A NZ  1 
ATOM   426  N N   . ILE A 1 57  ? 11.362  -7.396  -20.238 1.00 7.36   ? 55  ILE A N   1 
ATOM   427  C CA  . ILE A 1 57  ? 12.808  -7.609  -20.193 1.00 7.21   ? 55  ILE A CA  1 
ATOM   428  C C   . ILE A 1 57  ? 13.509  -6.472  -19.435 1.00 8.78   ? 55  ILE A C   1 
ATOM   429  O O   . ILE A 1 57  ? 14.608  -6.639  -18.899 1.00 8.27   ? 55  ILE A O   1 
ATOM   430  C CB  . ILE A 1 57  ? 13.348  -7.782  -21.635 1.00 8.55   ? 55  ILE A CB  1 
ATOM   431  C CG1 . ILE A 1 57  ? 12.927  -9.147  -22.200 1.00 7.81   ? 55  ILE A CG1 1 
ATOM   432  C CG2 . ILE A 1 57  ? 14.875  -7.641  -21.658 1.00 7.07   ? 55  ILE A CG2 1 
ATOM   433  C CD1 . ILE A 1 57  ? 13.027  -9.262  -23.746 1.00 8.92   ? 55  ILE A CD1 1 
ATOM   434  N N   . GLN A 1 58  ? 12.883  -5.294  -19.436 1.00 8.76   ? 56  GLN A N   1 
ATOM   435  C CA  . GLN A 1 58  ? 13.383  -4.135  -18.704 1.00 9.02   ? 56  GLN A CA  1 
ATOM   436  C C   . GLN A 1 58  ? 13.021  -4.123  -17.203 1.00 9.46   ? 56  GLN A C   1 
ATOM   437  O O   . GLN A 1 58  ? 13.415  -3.209  -16.459 1.00 9.69   ? 56  GLN A O   1 
ATOM   438  C CB  . GLN A 1 58  ? 12.928  -2.858  -19.433 1.00 9.04   ? 56  GLN A CB  1 
ATOM   439  C CG  . GLN A 1 58  ? 13.520  -2.762  -20.837 1.00 9.51   ? 56  GLN A CG  1 
ATOM   440  C CD  . GLN A 1 58  ? 13.268  -1.437  -21.554 1.00 14.98  ? 56  GLN A CD  1 
ATOM   441  O OE1 . GLN A 1 58  ? 13.963  -1.111  -22.537 1.00 14.40  ? 56  GLN A OE1 1 
ATOM   442  N NE2 . GLN A 1 58  ? 12.393  -0.608  -20.986 1.00 11.71  ? 56  GLN A NE2 1 
ATOM   443  N N   . SER A 1 59  ? 12.414  -5.203  -16.712 1.00 7.76   ? 57  SER A N   1 
ATOM   444  C CA  . SER A 1 59  ? 12.010  -5.232  -15.300 1.00 8.15   ? 57  SER A CA  1 
ATOM   445  C C   . SER A 1 59  ? 13.214  -5.168  -14.359 1.00 8.58   ? 57  SER A C   1 
ATOM   446  O O   . SER A 1 59  ? 14.198  -5.879  -14.561 1.00 8.62   ? 57  SER A O   1 
ATOM   447  C CB  . SER A 1 59  ? 11.200  -6.493  -14.958 1.00 8.27   ? 57  SER A CB  1 
ATOM   448  O OG  . SER A 1 59  ? 10.817  -6.465  -13.590 1.00 8.02   ? 57  SER A OG  1 
ATOM   449  N N   . PRO A 1 60  ? 13.084  -4.415  -13.256 1.00 9.23   ? 58  PRO A N   1 
ATOM   450  C CA  . PRO A 1 60  ? 14.138  -4.444  -12.232 1.00 9.81   ? 58  PRO A CA  1 
ATOM   451  C C   . PRO A 1 60  ? 14.096  -5.725  -11.394 1.00 10.94  ? 58  PRO A C   1 
ATOM   452  O O   . PRO A 1 60  ? 14.997  -5.997  -10.588 1.00 11.46  ? 58  PRO A O   1 
ATOM   453  C CB  . PRO A 1 60  ? 13.823  -3.214  -11.372 1.00 13.19  ? 58  PRO A CB  1 
ATOM   454  C CG  . PRO A 1 60  ? 12.359  -2.967  -11.560 1.00 12.60  ? 58  PRO A CG  1 
ATOM   455  C CD  . PRO A 1 60  ? 12.025  -3.428  -12.960 1.00 9.87   ? 58  PRO A CD  1 
ATOM   456  N N   . GLN A 1 61  ? 12.997  -6.457  -11.522 1.00 10.22  ? 59  GLN A N   1 
ATOM   457  C CA  . GLN A 1 61  ? 12.835  -7.747  -10.843 1.00 11.43  ? 59  GLN A CA  1 
ATOM   458  C C   . GLN A 1 61  ? 13.438  -8.859  -11.707 1.00 9.67   ? 59  GLN A C   1 
ATOM   459  O O   . GLN A 1 61  ? 12.917  -9.196  -12.766 1.00 10.31  ? 59  GLN A O   1 
ATOM   460  C CB  . GLN A 1 61  ? 11.344  -8.009  -10.615 1.00 10.49  ? 59  GLN A CB  1 
ATOM   461  C CG  . GLN A 1 61  ? 10.710  -6.965  -9.700  1.00 11.95  ? 59  GLN A CG  1 
ATOM   462  C CD  . GLN A 1 61  ? 9.271   -7.285  -9.361  1.00 12.78  ? 59  GLN A CD  1 
ATOM   463  O OE1 . GLN A 1 61  ? 8.964   -8.362  -8.854  1.00 13.50  ? 59  GLN A OE1 1 
ATOM   464  N NE2 . GLN A 1 61  ? 8.391   -6.298  -9.530  1.00 16.68  ? 59  GLN A NE2 1 
ATOM   465  N N   . GLU A 1 62  ? 14.602  -9.329  -11.285 1.00 9.02   ? 60  GLU A N   1 
ATOM   466  C CA  . GLU A 1 62  ? 15.443  -10.181 -12.120 1.00 8.93   ? 60  GLU A CA  1 
ATOM   467  C C   . GLU A 1 62  ? 14.677  -11.377 -12.697 1.00 9.48   ? 60  GLU A C   1 
ATOM   468  O O   . GLU A 1 62  ? 14.809  -11.688 -13.879 1.00 8.08   ? 60  GLU A O   1 
ATOM   469  C CB  . GLU A 1 62  ? 16.684  -10.618 -11.342 1.00 10.05  ? 60  GLU A CB  1 
ATOM   470  C CG  . GLU A 1 62  ? 17.605  -11.495 -12.164 1.00 11.27  ? 60  GLU A CG  1 
ATOM   471  C CD  . GLU A 1 62  ? 18.702  -12.104 -11.331 1.00 15.63  ? 60  GLU A CD  1 
ATOM   472  O OE1 . GLU A 1 62  ? 18.431  -13.109 -10.645 1.00 16.49  ? 60  GLU A OE1 1 
ATOM   473  O OE2 . GLU A 1 62  ? 19.843  -11.582 -11.354 1.00 17.55  ? 60  GLU A OE2 1 
ATOM   474  N N   . TRP A 1 63  ? 13.918  -12.076 -11.853 1.00 10.70  ? 61  TRP A N   1 
ATOM   475  C CA  . TRP A 1 63  ? 13.243  -13.292 -12.300 1.00 10.98  ? 61  TRP A CA  1 
ATOM   476  C C   . TRP A 1 63  ? 12.173  -12.999 -13.360 1.00 9.64   ? 61  TRP A C   1 
ATOM   477  O O   . TRP A 1 63  ? 11.889  -13.833 -14.216 1.00 9.83   ? 61  TRP A O   1 
ATOM   478  C CB  . TRP A 1 63  ? 12.657  -14.022 -11.080 1.00 10.54  ? 61  TRP A CB  1 
ATOM   479  C CG  . TRP A 1 63  ? 11.877  -15.293 -11.369 1.00 12.32  ? 61  TRP A CG  1 
ATOM   480  C CD1 . TRP A 1 63  ? 10.689  -15.650 -10.792 1.00 11.06  ? 61  TRP A CD1 1 
ATOM   481  C CD2 . TRP A 1 63  ? 12.300  -16.432 -12.140 1.00 12.90  ? 61  TRP A CD2 1 
ATOM   482  N NE1 . TRP A 1 63  ? 10.305  -16.900 -11.222 1.00 12.73  ? 61  TRP A NE1 1 
ATOM   483  C CE2 . TRP A 1 63  ? 11.296  -17.419 -12.013 1.00 12.66  ? 61  TRP A CE2 1 
ATOM   484  C CE3 . TRP A 1 63  ? 13.414  -16.706 -12.942 1.00 12.11  ? 61  TRP A CE3 1 
ATOM   485  C CZ2 . TRP A 1 63  ? 11.371  -18.656 -12.660 1.00 11.62  ? 61  TRP A CZ2 1 
ATOM   486  C CZ3 . TRP A 1 63  ? 13.520  -17.964 -13.525 1.00 13.12  ? 61  TRP A CZ3 1 
ATOM   487  C CH2 . TRP A 1 63  ? 12.488  -18.915 -13.403 1.00 13.22  ? 61  TRP A CH2 1 
ATOM   488  N N   . GLU A 1 64  ? 11.547  -11.826 -13.275 1.00 10.12  ? 62  GLU A N   1 
ATOM   489  C CA  . GLU A 1 64  ? 10.610  -11.398 -14.309 1.00 10.24  ? 62  GLU A CA  1 
ATOM   490  C C   . GLU A 1 64  ? 11.324  -11.227 -15.650 1.00 10.52  ? 62  GLU A C   1 
ATOM   491  O O   . GLU A 1 64  ? 10.857  -11.717 -16.673 1.00 9.92   ? 62  GLU A O   1 
ATOM   492  C CB  . GLU A 1 64  ? 9.899   -10.103 -13.883 1.00 10.57  ? 62  GLU A CB  1 
ATOM   493  C CG  . GLU A 1 64  ? 8.842   -9.599  -14.852 1.00 10.48  ? 62  GLU A CG  1 
ATOM   494  C CD  . GLU A 1 64  ? 7.995   -8.454  -14.285 1.00 9.79   ? 62  GLU A CD  1 
ATOM   495  O OE1 . GLU A 1 64  ? 6.765   -8.546  -14.426 1.00 10.66  ? 62  GLU A OE1 1 
ATOM   496  O OE2 . GLU A 1 64  ? 8.527   -7.553  -13.602 1.00 9.80   ? 62  GLU A OE2 1 
ATOM   497  N N   . ALA A 1 65  ? 12.453  -10.519 -15.647 1.00 6.20   ? 63  ALA A N   1 
ATOM   498  C CA  . ALA A 1 65  ? 13.215  -10.301 -16.871 1.00 5.87   ? 63  ALA A CA  1 
ATOM   499  C C   . ALA A 1 65  ? 13.805  -11.589 -17.454 1.00 6.24   ? 63  ALA A C   1 
ATOM   500  O O   . ALA A 1 65  ? 13.844  -11.777 -18.675 1.00 6.04   ? 63  ALA A O   1 
ATOM   501  C CB  . ALA A 1 65  ? 14.335  -9.275  -16.604 1.00 6.63   ? 63  ALA A CB  1 
ATOM   502  N N   . ILE A 1 66  ? 14.321  -12.455 -16.583 1.00 6.90   ? 64  ILE A N   1 
ATOM   503  C CA  . ILE A 1 66  ? 14.887  -13.728 -17.028 1.00 7.73   ? 64  ILE A CA  1 
ATOM   504  C C   . ILE A 1 66  ? 13.804  -14.627 -17.646 1.00 6.86   ? 64  ILE A C   1 
ATOM   505  O O   . ILE A 1 66  ? 14.023  -15.247 -18.687 1.00 7.98   ? 64  ILE A O   1 
ATOM   506  C CB  . ILE A 1 66  ? 15.626  -14.440 -15.869 1.00 8.23   ? 64  ILE A CB  1 
ATOM   507  C CG1 . ILE A 1 66  ? 16.922  -13.694 -15.516 1.00 7.89   ? 64  ILE A CG1 1 
ATOM   508  C CG2 . ILE A 1 66  ? 15.879  -15.931 -16.157 1.00 7.77   ? 64  ILE A CG2 1 
ATOM   509  C CD1 . ILE A 1 66  ? 17.976  -13.762 -16.618 1.00 8.86   ? 64  ILE A CD1 1 
ATOM   510  N N   . GLN A 1 67  ? 12.620  -14.676 -17.036 1.00 9.61   ? 65  GLN A N   1 
ATOM   511  C CA  . GLN A 1 67  ? 11.515  -15.414 -17.654 1.00 9.87   ? 65  GLN A CA  1 
ATOM   512  C C   . GLN A 1 67  ? 11.169  -14.826 -19.022 1.00 9.75   ? 65  GLN A C   1 
ATOM   513  O O   . GLN A 1 67  ? 11.000  -15.554 -20.010 1.00 10.11  ? 65  GLN A O   1 
ATOM   514  C CB  . GLN A 1 67  ? 10.281  -15.469 -16.730 1.00 9.69   ? 65  GLN A CB  1 
ATOM   515  C CG  . GLN A 1 67  ? 10.507  -16.395 -15.533 1.00 10.11  ? 65  GLN A CG  1 
ATOM   516  C CD  . GLN A 1 67  ? 9.331   -16.434 -14.564 1.00 10.35  ? 65  GLN A CD  1 
ATOM   517  O OE1 . GLN A 1 67  ? 8.516   -17.362 -14.618 1.00 10.84  ? 65  GLN A OE1 1 
ATOM   518  N NE2 . GLN A 1 67  ? 9.169   -15.373 -13.764 1.00 10.33  ? 65  GLN A NE2 1 
ATOM   519  N N   . ALA A 1 68  ? 11.089  -13.502 -19.083 1.00 8.04   ? 66  ALA A N   1 
ATOM   520  C CA  . ALA A 1 68  ? 10.783  -12.819 -20.343 1.00 7.77   ? 66  ALA A CA  1 
ATOM   521  C C   . ALA A 1 68  ? 11.804  -13.163 -21.441 1.00 8.30   ? 66  ALA A C   1 
ATOM   522  O O   . ALA A 1 68  ? 11.437  -13.406 -22.600 1.00 8.36   ? 66  ALA A O   1 
ATOM   523  C CB  . ALA A 1 68  ? 10.683  -11.309 -20.135 1.00 7.87   ? 66  ALA A CB  1 
ATOM   524  N N   . LEU A 1 69  ? 13.081  -13.226 -21.073 1.00 6.12   ? 67  LEU A N   1 
ATOM   525  C CA  . LEU A 1 69  ? 14.124  -13.576 -22.041 1.00 7.27   ? 67  LEU A CA  1 
ATOM   526  C C   . LEU A 1 69  ? 13.996  -15.027 -22.509 1.00 7.89   ? 67  LEU A C   1 
ATOM   527  O O   . LEU A 1 69  ? 14.255  -15.351 -23.674 1.00 8.22   ? 67  LEU A O   1 
ATOM   528  C CB  . LEU A 1 69  ? 15.512  -13.315 -21.439 1.00 6.73   ? 67  LEU A CB  1 
ATOM   529  C CG  . LEU A 1 69  ? 15.900  -11.833 -21.361 1.00 6.75   ? 67  LEU A CG  1 
ATOM   530  C CD1 . LEU A 1 69  ? 17.168  -11.716 -20.492 1.00 6.21   ? 67  LEU A CD1 1 
ATOM   531  C CD2 . LEU A 1 69  ? 16.133  -11.283 -22.779 1.00 5.95   ? 67  LEU A CD2 1 
ATOM   532  N N   . THR A 1 70  ? 13.559  -15.897 -21.600 1.00 9.48   ? 68  THR A N   1 
ATOM   533  C CA  . THR A 1 70  ? 13.269  -17.282 -21.938 1.00 10.13  ? 68  THR A CA  1 
ATOM   534  C C   . THR A 1 70  ? 12.070  -17.412 -22.885 1.00 10.69  ? 68  THR A C   1 
ATOM   535  O O   . THR A 1 70  ? 12.143  -18.149 -23.867 1.00 11.25  ? 68  THR A O   1 
ATOM   536  C CB  . THR A 1 70  ? 13.036  -18.119 -20.665 1.00 10.36  ? 68  THR A CB  1 
ATOM   537  O OG1 . THR A 1 70  ? 14.222  -18.043 -19.857 1.00 10.24  ? 68  THR A OG1 1 
ATOM   538  C CG2 . THR A 1 70  ? 12.763  -19.574 -21.035 1.00 11.14  ? 68  THR A CG2 1 
ATOM   539  N N   . VAL A 1 71  ? 11.083  -16.530 -22.737 1.00 8.37   ? 69  VAL A N   1 
ATOM   540  C CA  . VAL A 1 71  ? 10.010  -16.484 -23.721 1.00 9.74   ? 69  VAL A CA  1 
ATOM   541  C C   . VAL A 1 71  ? 10.540  -16.062 -25.104 1.00 8.89   ? 69  VAL A C   1 
ATOM   542  O O   . VAL A 1 71  ? 10.236  -16.676 -26.130 1.00 9.99   ? 69  VAL A O   1 
ATOM   543  C CB  . VAL A 1 71  ? 8.838   -15.577 -23.265 1.00 8.73   ? 69  VAL A CB  1 
ATOM   544  C CG1 . VAL A 1 71  ? 7.752   -15.528 -24.356 1.00 9.08   ? 69  VAL A CG1 1 
ATOM   545  C CG2 . VAL A 1 71  ? 8.257   -16.080 -21.935 1.00 9.12   ? 69  VAL A CG2 1 
ATOM   546  N N   . LEU A 1 72  ? 11.324  -14.989 -25.130 1.00 9.80   ? 70  LEU A N   1 
ATOM   547  C CA  . LEU A 1 72  ? 11.905  -14.486 -26.369 1.00 8.87   ? 70  LEU A CA  1 
ATOM   548  C C   . LEU A 1 72  ? 12.712  -15.561 -27.082 1.00 9.85   ? 70  LEU A C   1 
ATOM   549  O O   . LEU A 1 72  ? 12.528  -15.787 -28.283 1.00 10.16  ? 70  LEU A O   1 
ATOM   550  C CB  . LEU A 1 72  ? 12.819  -13.303 -26.064 1.00 7.11   ? 70  LEU A CB  1 
ATOM   551  C CG  . LEU A 1 72  ? 13.562  -12.679 -27.253 1.00 7.83   ? 70  LEU A CG  1 
ATOM   552  C CD1 . LEU A 1 72  ? 12.640  -12.155 -28.345 1.00 7.48   ? 70  LEU A CD1 1 
ATOM   553  C CD2 . LEU A 1 72  ? 14.450  -11.573 -26.691 1.00 7.13   ? 70  LEU A CD2 1 
ATOM   554  N N   . GLU A 1 73  ? 13.566  -16.242 -26.329 1.00 10.33  ? 71  GLU A N   1 
ATOM   555  C CA  . GLU A 1 73  ? 14.419  -17.325 -26.843 1.00 10.72  ? 71  GLU A CA  1 
ATOM   556  C C   . GLU A 1 73  ? 13.539  -18.405 -27.484 1.00 11.69  ? 71  GLU A C   1 
ATOM   557  O O   . GLU A 1 73  ? 13.819  -18.901 -28.577 1.00 13.09  ? 71  GLU A O   1 
ATOM   558  C CB  . GLU A 1 73  ? 15.216  -17.918 -25.678 1.00 10.94  ? 71  GLU A CB  1 
ATOM   559  C CG  . GLU A 1 73  ? 16.167  -19.070 -26.076 1.00 12.35  ? 71  GLU A CG  1 
ATOM   560  C CD  . GLU A 1 73  ? 16.950  -19.652 -24.909 1.00 13.13  ? 71  GLU A CD  1 
ATOM   561  O OE1 . GLU A 1 73  ? 17.745  -20.599 -25.131 1.00 16.77  ? 71  GLU A OE1 1 
ATOM   562  O OE2 . GLU A 1 73  ? 16.733  -19.246 -23.753 1.00 14.29  ? 71  GLU A OE2 1 
ATOM   563  N N   . THR A 1 74  ? 12.486  -18.786 -26.769 1.00 10.91  ? 72  THR A N   1 
ATOM   564  C CA  . THR A 1 74  ? 11.625  -19.901 -27.165 1.00 12.05  ? 72  THR A CA  1 
ATOM   565  C C   . THR A 1 74  ? 10.833  -19.536 -28.422 1.00 13.09  ? 72  THR A C   1 
ATOM   566  O O   . THR A 1 74  ? 10.683  -20.341 -29.344 1.00 14.20  ? 72  THR A O   1 
ATOM   567  C CB  . THR A 1 74  ? 10.673  -20.273 -26.000 1.00 12.08  ? 72  THR A CB  1 
ATOM   568  O OG1 . THR A 1 74  ? 11.433  -20.675 -24.848 1.00 11.30  ? 72  THR A OG1 1 
ATOM   569  C CG2 . THR A 1 74  ? 9.741   -21.399 -26.403 1.00 13.49  ? 72  THR A CG2 1 
ATOM   570  N N   . CYS A 1 75  ? 10.306  -18.314 -28.450 1.00 13.78  ? 73  CYS A N   1 
ATOM   571  C CA  . CYS A 1 75  ? 9.500   -17.875 -29.574 1.00 13.88  ? 73  CYS A CA  1 
ATOM   572  C C   . CYS A 1 75  ? 10.361  -17.733 -30.826 1.00 14.82  ? 73  CYS A C   1 
ATOM   573  O O   . CYS A 1 75  ? 9.893   -17.936 -31.942 1.00 14.41  ? 73  CYS A O   1 
ATOM   574  C CB  . CYS A 1 75  ? 8.828   -16.548 -29.257 1.00 14.96  ? 73  CYS A CB  1 
ATOM   575  S SG  . CYS A 1 75  ? 7.424   -16.654 -28.110 1.00 14.07  ? 73  CYS A SG  1 
ATOM   576  N N   . MET A 1 76  ? 11.625  -17.365 -30.645 1.00 14.10  ? 74  MET A N   1 
ATOM   577  C CA  . MET A 1 76  ? 12.509  -17.298 -31.816 1.00 14.11  ? 74  MET A CA  1 
ATOM   578  C C   . MET A 1 76  ? 12.703  -18.678 -32.451 1.00 16.96  ? 74  MET A C   1 
ATOM   579  O O   . MET A 1 76  ? 12.954  -18.791 -33.658 1.00 18.05  ? 74  MET A O   1 
ATOM   580  C CB  . MET A 1 76  ? 13.854  -16.637 -31.496 1.00 13.68  ? 74  MET A CB  1 
ATOM   581  C CG  . MET A 1 76  ? 13.793  -15.116 -31.318 1.00 11.00  ? 74  MET A CG  1 
ATOM   582  S SD  . MET A 1 76  ? 13.475  -14.253 -32.864 1.00 12.67  ? 74  MET A SD  1 
ATOM   583  C CE  . MET A 1 76  ? 15.114  -14.214 -33.592 1.00 14.37  ? 74  MET A CE  1 
ATOM   584  N N   . LYS A 1 77  ? 12.703  -19.719 -31.639 1.00 17.70  ? 75  LYS A N   1 
ATOM   585  C CA  . LYS A 1 77  ? 12.702  -21.113 -32.110 1.00 19.95  ? 75  LYS A CA  1 
ATOM   586  C C   . LYS A 1 77  ? 11.407  -21.642 -32.710 1.00 21.35  ? 75  LYS A C   1 
ATOM   587  O O   . LYS A 1 77  ? 11.428  -22.323 -33.687 1.00 25.08  ? 75  LYS A O   1 
ATOM   588  C CB  . LYS A 1 77  ? 13.254  -22.050 -31.076 1.00 19.47  ? 75  LYS A CB  1 
ATOM   589  C CG  . LYS A 1 77  ? 14.658  -21.941 -30.957 1.00 20.65  ? 75  LYS A CG  1 
ATOM   590  C CD  . LYS A 1 77  ? 15.232  -22.636 -29.775 1.00 34.06  ? 75  LYS A CD  1 
ATOM   591  C CE  . LYS A 1 77  ? 14.336  -22.589 -28.581 1.00 35.58  ? 75  LYS A CE  1 
ATOM   592  N NZ  . LYS A 1 77  ? 14.974  -23.146 -27.425 1.00 34.48  ? 75  LYS A NZ  1 
ATOM   593  N N   . SER A 1 78  ? 10.279  -21.327 -32.102 1.00 18.77  ? 76  SER A N   1 
ATOM   594  C CA  A SER A 1 78  ? 9.017   -21.959 -32.461 0.50 21.75  ? 76  SER A CA  1 
ATOM   595  C CA  B SER A 1 78  ? 8.989   -21.935 -32.417 0.50 21.66  ? 76  SER A CA  1 
ATOM   596  C C   . SER A 1 78  ? 8.245   -21.140 -33.490 1.00 20.35  ? 76  SER A C   1 
ATOM   597  O O   . SER A 1 78  ? 7.395   -21.675 -34.197 1.00 28.67  ? 76  SER A O   1 
ATOM   598  C CB  A SER A 1 78  ? 8.152   -22.170 -31.221 0.50 20.57  ? 76  SER A CB  1 
ATOM   599  C CB  B SER A 1 78  ? 8.119   -22.031 -31.158 0.50 20.15  ? 76  SER A CB  1 
ATOM   600  O OG  A SER A 1 78  ? 7.757   -20.917 -30.703 0.50 19.37  ? 76  SER A OG  1 
ATOM   601  O OG  B SER A 1 78  ? 8.600   -23.015 -30.257 0.50 20.19  ? 76  SER A OG  1 
ATOM   602  N N   . CYS A 1 79  ? 8.488   -19.835 -33.536 1.00 22.96  ? 77  CYS A N   1 
ATOM   603  C CA  . CYS A 1 79  ? 7.691   -18.961 -34.388 1.00 21.41  ? 77  CYS A CA  1 
ATOM   604  C C   . CYS A 1 79  ? 8.385   -18.827 -35.743 1.00 23.42  ? 77  CYS A C   1 
ATOM   605  O O   . CYS A 1 79  ? 9.518   -19.278 -35.907 1.00 26.57  ? 77  CYS A O   1 
ATOM   606  C CB  . CYS A 1 79  ? 7.497   -17.592 -33.724 1.00 18.65  ? 77  CYS A CB  1 
ATOM   607  S SG  . CYS A 1 79  ? 6.610   -17.659 -32.120 1.00 24.16  ? 77  CYS A SG  1 
ATOM   608  N N   . GLY A 1 80  ? 7.713   -18.214 -36.710 1.00 26.36  ? 78  GLY A N   1 
ATOM   609  C CA  . GLY A 1 80  ? 8.329   -17.969 -38.010 1.00 29.63  ? 78  GLY A CA  1 
ATOM   610  C C   . GLY A 1 80  ? 8.472   -16.491 -38.334 1.00 30.52  ? 78  GLY A C   1 
ATOM   611  O O   . GLY A 1 80  ? 8.809   -15.677 -37.460 1.00 24.56  ? 78  GLY A O   1 
ATOM   612  N N   . LYS A 1 81  ? 8.182   -16.138 -39.584 1.00 31.25  ? 79  LYS A N   1 
ATOM   613  C CA  . LYS A 1 81  ? 8.802   -14.961 -40.183 1.00 27.81  ? 79  LYS A CA  1 
ATOM   614  C C   . LYS A 1 81  ? 8.342   -13.643 -39.576 1.00 24.68  ? 79  LYS A C   1 
ATOM   615  O O   . LYS A 1 81  ? 9.157   -12.732 -39.435 1.00 23.25  ? 79  LYS A O   1 
ATOM   616  C CB  . LYS A 1 81  ? 8.642   -14.932 -41.706 1.00 29.97  ? 79  LYS A CB  1 
ATOM   617  C CG  . LYS A 1 81  ? 9.390   -13.760 -42.358 1.00 28.38  ? 79  LYS A CG  1 
ATOM   618  C CD  . LYS A 1 81  ? 9.513   -13.913 -43.866 1.00 36.79  ? 79  LYS A CD  1 
ATOM   619  C CE  . LYS A 1 81  ? 10.104  -12.655 -44.502 1.00 38.07  ? 79  LYS A CE  1 
ATOM   620  N NZ  . LYS A 1 81  ? 9.343   -11.422 -44.131 1.00 36.81  ? 79  LYS A NZ  1 
ATOM   621  N N   . ARG A 1 82  ? 7.033   -13.478 -39.383 1.00 25.16  ? 80  ARG A N   1 
ATOM   622  C CA  . ARG A 1 82  ? 6.496   -12.223 -38.851 1.00 23.25  ? 80  ARG A CA  1 
ATOM   623  C C   . ARG A 1 82  ? 7.121   -11.879 -37.500 1.00 21.36  ? 80  ARG A C   1 
ATOM   624  O O   . ARG A 1 82  ? 7.507   -10.736 -37.277 1.00 19.89  ? 80  ARG A O   1 
ATOM   625  C CB  . ARG A 1 82  ? 4.968   -12.264 -38.728 1.00 23.85  ? 80  ARG A CB  1 
ATOM   626  C CG  . ARG A 1 82  ? 4.233   -12.119 -40.061 1.00 34.48  ? 80  ARG A CG  1 
ATOM   627  C CD  . ARG A 1 82  ? 2.819   -11.590 -39.853 1.00 44.72  ? 80  ARG A CD  1 
ATOM   628  N NE  . ARG A 1 82  ? 1.977   -12.525 -39.107 1.00 50.35  ? 80  ARG A NE  1 
ATOM   629  C CZ  . ARG A 1 82  ? 1.230   -12.188 -38.057 1.00 44.49  ? 80  ARG A CZ  1 
ATOM   630  N NH1 . ARG A 1 82  ? 1.159   -10.922 -37.671 1.00 40.02  ? 80  ARG A NH1 1 
ATOM   631  N NH2 . ARG A 1 82  ? 0.497   -13.102 -37.436 1.00 45.67  ? 80  ARG A NH2 1 
ATOM   632  N N   . PHE A 1 83  ? 7.208   -12.862 -36.603 1.00 18.90  ? 81  PHE A N   1 
ATOM   633  C CA  . PHE A 1 83  ? 7.887   -12.674 -35.317 1.00 16.41  ? 81  PHE A CA  1 
ATOM   634  C C   . PHE A 1 83  ? 9.390   -12.391 -35.479 1.00 15.97  ? 81  PHE A C   1 
ATOM   635  O O   . PHE A 1 83  ? 9.917   -11.425 -34.912 1.00 12.57  ? 81  PHE A O   1 
ATOM   636  C CB  . PHE A 1 83  ? 7.666   -13.875 -34.386 1.00 19.31  ? 81  PHE A CB  1 
ATOM   637  C CG  . PHE A 1 83  ? 8.217   -13.664 -32.996 1.00 15.53  ? 81  PHE A CG  1 
ATOM   638  C CD1 . PHE A 1 83  ? 7.553   -12.849 -32.086 1.00 15.36  ? 81  PHE A CD1 1 
ATOM   639  C CD2 . PHE A 1 83  ? 9.386   -14.303 -32.589 1.00 13.19  ? 81  PHE A CD2 1 
ATOM   640  C CE1 . PHE A 1 83  ? 8.141   -12.515 -30.851 1.00 12.24  ? 81  PHE A CE1 1 
ATOM   641  C CE2 . PHE A 1 83  ? 9.938   -14.052 -31.323 1.00 13.25  ? 81  PHE A CE2 1 
ATOM   642  C CZ  . PHE A 1 83  ? 9.332   -13.133 -30.469 1.00 11.15  ? 81  PHE A CZ  1 
ATOM   643  N N   . HIS A 1 84  ? 10.062  -13.172 -36.324 1.00 18.09  ? 82  HIS A N   1 
ATOM   644  C CA  . HIS A 1 84  ? 11.476  -12.931 -36.618 1.00 15.38  ? 82  HIS A CA  1 
ATOM   645  C C   . HIS A 1 84  ? 11.737  -11.527 -37.166 1.00 16.00  ? 82  HIS A C   1 
ATOM   646  O O   . HIS A 1 84  ? 12.658  -10.844 -36.704 1.00 13.56  ? 82  HIS A O   1 
ATOM   647  C CB  . HIS A 1 84  ? 12.023  -13.976 -37.592 1.00 15.95  ? 82  HIS A CB  1 
ATOM   648  C CG  . HIS A 1 84  ? 12.331  -15.291 -36.948 1.00 19.88  ? 82  HIS A CG  1 
ATOM   649  N ND1 . HIS A 1 84  ? 13.357  -16.103 -37.378 1.00 36.77  ? 82  HIS A ND1 1 
ATOM   650  C CD2 . HIS A 1 84  ? 11.640  -16.015 -36.036 1.00 30.13  ? 82  HIS A CD2 1 
ATOM   651  C CE1 . HIS A 1 84  ? 13.339  -17.235 -36.695 1.00 35.65  ? 82  HIS A CE1 1 
ATOM   652  N NE2 . HIS A 1 84  ? 12.297  -17.214 -35.885 1.00 29.91  ? 82  HIS A NE2 1 
ATOM   653  N N   . ASP A 1 85  ? 10.788  -11.029 -37.962 1.00 17.79  ? 83  ASP A N   1 
ATOM   654  C CA  . ASP A 1 85  ? 10.923  -9.716  -38.593 1.00 18.96  ? 83  ASP A CA  1 
ATOM   655  C C   . ASP A 1 85  ? 10.778  -8.596  -37.563 1.00 18.64  ? 83  ASP A C   1 
ATOM   656  O O   . ASP A 1 85  ? 11.537  -7.624  -37.585 1.00 18.01  ? 83  ASP A O   1 
ATOM   657  C CB  . ASP A 1 85  ? 9.899   -9.541  -39.724 1.00 20.63  ? 83  ASP A CB  1 
ATOM   658  C CG  . ASP A 1 85  ? 10.297  -10.268 -41.010 1.00 27.45  ? 83  ASP A CG  1 
ATOM   659  O OD1 . ASP A 1 85  ? 9.435   -10.369 -41.908 1.00 24.60  ? 83  ASP A OD1 1 
ATOM   660  O OD2 . ASP A 1 85  ? 11.490  -10.599 -41.211 1.00 21.98  ? 83  ASP A OD2 1 
ATOM   661  N N   . GLU A 1 86  ? 9.914   -8.815  -36.574 1.00 17.05  ? 84  GLU A N   1 
ATOM   662  C CA  . GLU A 1 86  ? 9.671   -7.839  -35.520 1.00 15.33  ? 84  GLU A CA  1 
ATOM   663  C C   . GLU A 1 86  ? 10.861  -7.810  -34.563 1.00 13.19  ? 84  GLU A C   1 
ATOM   664  O O   . GLU A 1 86  ? 11.349  -6.739  -34.206 1.00 12.20  ? 84  GLU A O   1 
ATOM   665  C CB  . GLU A 1 86  ? 8.369   -8.136  -34.764 1.00 16.18  ? 84  GLU A CB  1 
ATOM   666  C CG  . GLU A 1 86  ? 7.089   -7.746  -35.505 1.00 21.99  ? 84  GLU A CG  1 
ATOM   667  C CD  . GLU A 1 86  ? 7.117   -6.334  -36.076 1.00 21.24  ? 84  GLU A CD  1 
ATOM   668  O OE1 . GLU A 1 86  ? 7.495   -5.392  -35.352 1.00 17.64  ? 84  GLU A OE1 1 
ATOM   669  O OE2 . GLU A 1 86  ? 6.509   -6.129  -37.147 1.00 23.54  ? 84  GLU A OE2 1 
ATOM   670  N N   . VAL A 1 87  ? 11.426  -8.976  -34.266 1.00 11.29  ? 85  VAL A N   1 
ATOM   671  C CA  . VAL A 1 87  ? 12.564  -9.029  -33.348 1.00 10.76  ? 85  VAL A CA  1 
ATOM   672  C C   . VAL A 1 87  ? 13.805  -8.423  -34.027 1.00 10.57  ? 85  VAL A C   1 
ATOM   673  O O   . VAL A 1 87  ? 14.589  -7.710  -33.390 1.00 9.98   ? 85  VAL A O   1 
ATOM   674  C CB  . VAL A 1 87  ? 12.834  -10.484 -32.911 1.00 10.80  ? 85  VAL A CB  1 
ATOM   675  C CG1 . VAL A 1 87  ? 14.169  -10.587 -32.215 1.00 10.38  ? 85  VAL A CG1 1 
ATOM   676  C CG2 . VAL A 1 87  ? 11.705  -10.951 -31.980 1.00 10.80  ? 85  VAL A CG2 1 
ATOM   677  N N   . GLY A 1 88  ? 13.876  -8.569  -35.350 1.00 10.10  ? 86  GLY A N   1 
ATOM   678  C CA  . GLY A 1 88  ? 15.022  -8.086  -36.117 1.00 11.81  ? 86  GLY A CA  1 
ATOM   679  C C   . GLY A 1 88  ? 14.918  -6.637  -36.571 1.00 12.37  ? 86  GLY A C   1 
ATOM   680  O O   . GLY A 1 88  ? 15.696  -6.216  -37.436 1.00 10.59  ? 86  GLY A O   1 
ATOM   681  N N   . LYS A 1 89  ? 13.996  -5.873  -35.973 1.00 11.39  ? 87  LYS A N   1 
ATOM   682  C CA  . LYS A 1 89  ? 13.944  -4.411  -36.145 1.00 12.57  ? 87  LYS A CA  1 
ATOM   683  C C   . LYS A 1 89  ? 14.573  -3.674  -34.958 1.00 10.54  ? 87  LYS A C   1 
ATOM   684  O O   . LYS A 1 89  ? 14.460  -4.117  -33.804 1.00 9.93   ? 87  LYS A O   1 
ATOM   685  C CB  . LYS A 1 89  ? 12.481  -3.934  -36.293 1.00 12.94  ? 87  LYS A CB  1 
ATOM   686  C CG  . LYS A 1 89  ? 11.828  -4.267  -37.636 1.00 15.33  ? 87  LYS A CG  1 
ATOM   687  C CD  . LYS A 1 89  ? 10.347  -3.895  -37.613 1.00 13.20  ? 87  LYS A CD  1 
ATOM   688  C CE  . LYS A 1 89  ? 9.580   -4.537  -38.768 1.00 18.58  ? 87  LYS A CE  1 
ATOM   689  N NZ  . LYS A 1 89  ? 8.105   -4.299  -38.631 1.00 19.47  ? 87  LYS A NZ  1 
ATOM   690  N N   . PHE A 1 90  ? 15.127  -2.491  -35.215 1.00 9.12   ? 88  PHE A N   1 
ATOM   691  C CA  . PHE A 1 90  ? 15.666  -1.680  -34.120 1.00 8.40   ? 88  PHE A CA  1 
ATOM   692  C C   . PHE A 1 90  ? 14.548  -1.245  -33.176 1.00 8.51   ? 88  PHE A C   1 
ATOM   693  O O   . PHE A 1 90  ? 14.782  -1.029  -31.988 1.00 8.08   ? 88  PHE A O   1 
ATOM   694  C CB  . PHE A 1 90  ? 16.436  -0.459  -34.664 1.00 9.66   ? 88  PHE A CB  1 
ATOM   695  C CG  . PHE A 1 90  ? 17.693  -0.830  -35.401 1.00 10.02  ? 88  PHE A CG  1 
ATOM   696  C CD1 . PHE A 1 90  ? 18.644  -1.640  -34.798 1.00 9.12   ? 88  PHE A CD1 1 
ATOM   697  C CD2 . PHE A 1 90  ? 17.912  -0.394  -36.697 1.00 9.85   ? 88  PHE A CD2 1 
ATOM   698  C CE1 . PHE A 1 90  ? 19.806  -2.014  -35.466 1.00 9.55   ? 88  PHE A CE1 1 
ATOM   699  C CE2 . PHE A 1 90  ? 19.093  -0.720  -37.360 1.00 10.29  ? 88  PHE A CE2 1 
ATOM   700  C CZ  . PHE A 1 90  ? 20.009  -1.576  -36.765 1.00 10.36  ? 88  PHE A CZ  1 
ATOM   701  N N   . ARG A 1 91  ? 13.311  -1.195  -33.665 1.00 10.33  ? 89  ARG A N   1 
ATOM   702  C CA  . ARG A 1 91  ? 12.196  -0.897  -32.764 1.00 10.18  ? 89  ARG A CA  1 
ATOM   703  C C   . ARG A 1 91  ? 12.237  -1.814  -31.535 1.00 9.43   ? 89  ARG A C   1 
ATOM   704  O O   . ARG A 1 91  ? 11.927  -1.400  -30.410 1.00 9.09   ? 89  ARG A O   1 
ATOM   705  C CB  . ARG A 1 91  ? 10.847  -1.045  -33.468 1.00 10.48  ? 89  ARG A CB  1 
ATOM   706  C CG  . ARG A 1 91  ? 9.682   -0.512  -32.656 1.00 14.16  ? 89  ARG A CG  1 
ATOM   707  C CD  . ARG A 1 91  ? 8.400   -0.455  -33.492 1.00 14.89  ? 89  ARG A CD  1 
ATOM   708  N NE  . ARG A 1 91  ? 8.550   0.204   -34.790 1.00 22.50  ? 89  ARG A NE  1 
ATOM   709  C CZ  . ARG A 1 91  ? 8.366   1.506   -34.992 1.00 20.38  ? 89  ARG A CZ  1 
ATOM   710  N NH1 . ARG A 1 91  ? 8.253   2.325   -33.954 1.00 24.58  ? 89  ARG A NH1 1 
ATOM   711  N NH2 . ARG A 1 91  ? 8.486   2.012   -36.211 1.00 24.16  ? 89  ARG A NH2 1 
ATOM   712  N N   . PHE A 1 92  ? 12.546  -3.083  -31.772 1.00 7.41   ? 90  PHE A N   1 
ATOM   713  C CA  . PHE A 1 92  ? 12.739  -4.015  -30.667 1.00 7.84   ? 90  PHE A CA  1 
ATOM   714  C C   . PHE A 1 92  ? 14.174  -3.999  -30.120 1.00 6.63   ? 90  PHE A C   1 
ATOM   715  O O   . PHE A 1 92  ? 14.391  -3.953  -28.898 1.00 6.97   ? 90  PHE A O   1 
ATOM   716  C CB  . PHE A 1 92  ? 12.356  -5.439  -31.087 1.00 7.45   ? 90  PHE A CB  1 
ATOM   717  C CG  . PHE A 1 92  ? 12.479  -6.442  -29.965 1.00 6.60   ? 90  PHE A CG  1 
ATOM   718  C CD1 . PHE A 1 92  ? 11.614  -6.400  -28.876 1.00 6.29   ? 90  PHE A CD1 1 
ATOM   719  C CD2 . PHE A 1 92  ? 13.469  -7.414  -30.000 1.00 7.89   ? 90  PHE A CD2 1 
ATOM   720  C CE1 . PHE A 1 92  ? 11.762  -7.297  -27.808 1.00 6.78   ? 90  PHE A CE1 1 
ATOM   721  C CE2 . PHE A 1 92  ? 13.573  -8.376  -28.986 1.00 7.46   ? 90  PHE A CE2 1 
ATOM   722  C CZ  . PHE A 1 92  ? 12.697  -8.333  -27.907 1.00 6.74   ? 90  PHE A CZ  1 
ATOM   723  N N   . LEU A 1 93  ? 15.151  -4.095  -31.017 1.00 6.88   ? 91  LEU A N   1 
ATOM   724  C CA  A LEU A 1 93  ? 16.547  -4.255  -30.616 0.50 6.65   ? 91  LEU A CA  1 
ATOM   725  C CA  B LEU A 1 93  ? 16.532  -4.274  -30.579 0.50 6.93   ? 91  LEU A CA  1 
ATOM   726  C C   . LEU A 1 93  ? 16.989  -3.108  -29.701 1.00 6.93   ? 91  LEU A C   1 
ATOM   727  O O   . LEU A 1 93  ? 17.765  -3.293  -28.763 1.00 6.89   ? 91  LEU A O   1 
ATOM   728  C CB  A LEU A 1 93  ? 17.437  -4.308  -31.859 0.50 7.52   ? 91  LEU A CB  1 
ATOM   729  C CB  B LEU A 1 93  ? 17.472  -4.468  -31.770 0.50 7.04   ? 91  LEU A CB  1 
ATOM   730  C CG  A LEU A 1 93  ? 17.886  -5.664  -32.420 0.50 7.32   ? 91  LEU A CG  1 
ATOM   731  C CG  B LEU A 1 93  ? 17.265  -5.738  -32.604 0.50 7.32   ? 91  LEU A CG  1 
ATOM   732  C CD1 A LEU A 1 93  ? 17.172  -6.911  -31.878 0.50 7.39   ? 91  LEU A CD1 1 
ATOM   733  C CD1 B LEU A 1 93  ? 17.780  -7.009  -31.874 0.50 7.06   ? 91  LEU A CD1 1 
ATOM   734  C CD2 A LEU A 1 93  ? 18.020  -5.675  -33.941 0.50 7.74   ? 91  LEU A CD2 1 
ATOM   735  C CD2 B LEU A 1 93  ? 15.828  -5.878  -33.003 0.50 7.45   ? 91  LEU A CD2 1 
ATOM   736  N N   . ASN A 1 94  ? 16.491  -1.905  -29.977 1.00 7.07   ? 92  ASN A N   1 
ATOM   737  C CA  . ASN A 1 94  ? 16.861  -0.754  -29.152 1.00 6.91   ? 92  ASN A CA  1 
ATOM   738  C C   . ASN A 1 94  ? 16.499  -0.960  -27.686 1.00 6.55   ? 92  ASN A C   1 
ATOM   739  O O   . ASN A 1 94  ? 17.158  -0.446  -26.779 1.00 7.64   ? 92  ASN A O   1 
ATOM   740  C CB  . ASN A 1 94  ? 16.151  0.492   -29.685 1.00 7.39   ? 92  ASN A CB  1 
ATOM   741  C CG  . ASN A 1 94  ? 16.787  1.014   -30.956 1.00 8.63   ? 92  ASN A CG  1 
ATOM   742  O OD1 . ASN A 1 94  ? 17.877  0.569   -31.350 1.00 7.96   ? 92  ASN A OD1 1 
ATOM   743  N ND2 . ASN A 1 94  ? 16.114  1.981   -31.597 1.00 9.19   ? 92  ASN A ND2 1 
ATOM   744  N N   . GLU A 1 95  ? 15.426  -1.708  -27.457 1.00 9.35   ? 93  GLU A N   1 
ATOM   745  C CA  . GLU A 1 95  ? 14.964  -1.903  -26.083 1.00 9.03   ? 93  GLU A CA  1 
ATOM   746  C C   . GLU A 1 95  ? 15.937  -2.834  -25.340 1.00 9.28   ? 93  GLU A C   1 
ATOM   747  O O   . GLU A 1 95  ? 16.231  -2.632  -24.158 1.00 8.94   ? 93  GLU A O   1 
ATOM   748  C CB  . GLU A 1 95  ? 13.519  -2.424  -26.075 1.00 8.77   ? 93  GLU A CB  1 
ATOM   749  C CG  . GLU A 1 95  ? 12.529  -1.422  -26.689 1.00 9.36   ? 93  GLU A CG  1 
ATOM   750  C CD  . GLU A 1 95  ? 12.643  -0.010  -26.089 1.00 9.41   ? 93  GLU A CD  1 
ATOM   751  O OE1 . GLU A 1 95  ? 12.831  0.968   -26.859 1.00 10.52  ? 93  GLU A OE1 1 
ATOM   752  O OE2 . GLU A 1 95  ? 12.431  0.163   -24.861 1.00 9.42   ? 93  GLU A OE2 1 
ATOM   753  N N   . LEU A 1 96  ? 16.510  -3.796  -26.058 1.00 6.63   ? 94  LEU A N   1 
ATOM   754  C CA  . LEU A 1 96  ? 17.570  -4.639  -25.485 1.00 6.84   ? 94  LEU A CA  1 
ATOM   755  C C   . LEU A 1 96  ? 18.852  -3.845  -25.253 1.00 7.65   ? 94  LEU A C   1 
ATOM   756  O O   . LEU A 1 96  ? 19.479  -3.968  -24.206 1.00 7.88   ? 94  LEU A O   1 
ATOM   757  C CB  . LEU A 1 96  ? 17.878  -5.821  -26.417 1.00 8.31   ? 94  LEU A CB  1 
ATOM   758  C CG  . LEU A 1 96  ? 16.750  -6.831  -26.669 1.00 6.72   ? 94  LEU A CG  1 
ATOM   759  C CD1 . LEU A 1 96  ? 17.254  -7.977  -27.551 1.00 8.40   ? 94  LEU A CD1 1 
ATOM   760  C CD2 . LEU A 1 96  ? 16.152  -7.331  -25.376 1.00 7.45   ? 94  LEU A CD2 1 
ATOM   761  N N   . ILE A 1 97  ? 19.239  -3.033  -26.238 1.00 6.76   ? 95  ILE A N   1 
ATOM   762  C CA  . ILE A 1 97  ? 20.388  -2.126  -26.097 1.00 7.49   ? 95  ILE A CA  1 
ATOM   763  C C   . ILE A 1 97  ? 20.278  -1.271  -24.819 1.00 7.31   ? 95  ILE A C   1 
ATOM   764  O O   . ILE A 1 97  ? 21.274  -1.050  -24.122 1.00 7.92   ? 95  ILE A O   1 
ATOM   765  C CB  . ILE A 1 97  ? 20.516  -1.247  -27.375 1.00 7.46   ? 95  ILE A CB  1 
ATOM   766  C CG1 . ILE A 1 97  ? 20.870  -2.130  -28.585 1.00 7.99   ? 95  ILE A CG1 1 
ATOM   767  C CG2 . ILE A 1 97  ? 21.581  -0.146  -27.187 1.00 9.48   ? 95  ILE A CG2 1 
ATOM   768  C CD1 . ILE A 1 97  ? 20.695  -1.427  -29.953 1.00 7.86   ? 95  ILE A CD1 1 
ATOM   769  N N   . LYS A 1 98  ? 19.102  -0.696  -24.581 1.00 8.74   ? 96  LYS A N   1 
ATOM   770  C CA  . LYS A 1 98  ? 18.895  0.164   -23.411 1.00 9.13   ? 96  LYS A CA  1 
ATOM   771  C C   . LYS A 1 98  ? 19.095  -0.589  -22.086 1.00 9.36   ? 96  LYS A C   1 
ATOM   772  O O   . LYS A 1 98  ? 19.588  -0.025  -21.093 1.00 9.65   ? 96  LYS A O   1 
ATOM   773  C CB  . LYS A 1 98  ? 17.490  0.792   -23.466 1.00 8.85   ? 96  LYS A CB  1 
ATOM   774  C CG  . LYS A 1 98  ? 17.339  1.928   -24.495 1.00 9.28   ? 96  LYS A CG  1 
ATOM   775  C CD  . LYS A 1 98  ? 15.860  2.165   -24.799 1.00 9.00   ? 96  LYS A CD  1 
ATOM   776  C CE  . LYS A 1 98  ? 15.681  3.181   -25.915 1.00 11.27  ? 96  LYS A CE  1 
ATOM   777  N NZ  . LYS A 1 98  ? 14.232  3.457   -26.156 1.00 11.19  ? 96  LYS A NZ  1 
ATOM   778  N N   . VAL A 1 99  ? 18.766  -1.878  -22.083 1.00 9.10   ? 97  VAL A N   1 
ATOM   779  C CA  . VAL A 1 99  ? 19.035  -2.722  -20.915 1.00 9.33   ? 97  VAL A CA  1 
ATOM   780  C C   . VAL A 1 99  ? 20.524  -2.965  -20.594 1.00 10.16  ? 97  VAL A C   1 
ATOM   781  O O   . VAL A 1 99  ? 20.914  -2.988  -19.417 1.00 10.58  ? 97  VAL A O   1 
ATOM   782  C CB  . VAL A 1 99  ? 18.253  -4.058  -21.033 1.00 8.63   ? 97  VAL A CB  1 
ATOM   783  C CG1 . VAL A 1 99  ? 18.641  -4.986  -19.884 1.00 9.14   ? 97  VAL A CG1 1 
ATOM   784  C CG2 . VAL A 1 99  ? 16.763  -3.751  -21.006 1.00 8.26   ? 97  VAL A CG2 1 
ATOM   785  N N   . VAL A 1 100 ? 21.366  -3.115  -21.615 1.00 8.26   ? 98  VAL A N   1 
ATOM   786  C CA  . VAL A 1 100 ? 22.789  -3.423  -21.391 1.00 8.94   ? 98  VAL A CA  1 
ATOM   787  C C   . VAL A 1 100 ? 23.737  -2.210  -21.383 1.00 9.76   ? 98  VAL A C   1 
ATOM   788  O O   . VAL A 1 100 ? 24.847  -2.300  -20.866 1.00 10.56  ? 98  VAL A O   1 
ATOM   789  C CB  . VAL A 1 100 ? 23.316  -4.491  -22.378 1.00 8.79   ? 98  VAL A CB  1 
ATOM   790  C CG1 . VAL A 1 100 ? 22.474  -5.789  -22.284 1.00 8.11   ? 98  VAL A CG1 1 
ATOM   791  C CG2 . VAL A 1 100 ? 23.282  -3.955  -23.796 1.00 8.61   ? 98  VAL A CG2 1 
ATOM   792  N N   . SER A 1 101 ? 23.267  -1.077  -21.899 1.00 9.80   ? 99  SER A N   1 
ATOM   793  C CA  . SER A 1 101 ? 24.078  0.138   -22.010 1.00 10.37  ? 99  SER A CA  1 
ATOM   794  C C   . SER A 1 101 ? 24.110  0.912   -20.691 1.00 11.10  ? 99  SER A C   1 
ATOM   795  O O   . SER A 1 101 ? 23.058  1.257   -20.158 1.00 10.98  ? 99  SER A O   1 
ATOM   796  C CB  . SER A 1 101 ? 23.516  1.046   -23.103 1.00 10.12  ? 99  SER A CB  1 
ATOM   797  O OG  . SER A 1 101 ? 24.096  2.354   -23.043 1.00 10.99  ? 99  SER A OG  1 
ATOM   798  N N   . PRO A 1 102 ? 25.312  1.365   -20.278 1.00 13.47  ? 100 PRO A N   1 
ATOM   799  C CA  . PRO A 1 102 ? 25.483  2.274   -19.145 1.00 14.88  ? 100 PRO A CA  1 
ATOM   800  C C   . PRO A 1 102 ? 24.837  3.646   -19.342 1.00 15.76  ? 100 PRO A C   1 
ATOM   801  O O   . PRO A 1 102 ? 24.552  4.334   -18.352 1.00 17.14  ? 100 PRO A O   1 
ATOM   802  C CB  . PRO A 1 102 ? 27.011  2.428   -19.037 1.00 19.07  ? 100 PRO A CB  1 
ATOM   803  C CG  . PRO A 1 102 ? 27.555  1.196   -19.690 1.00 25.25  ? 100 PRO A CG  1 
ATOM   804  C CD  . PRO A 1 102 ? 26.606  0.894   -20.810 1.00 15.49  ? 100 PRO A CD  1 
ATOM   805  N N   . LYS A 1 103 ? 24.607  4.044   -20.594 1.00 14.24  ? 101 LYS A N   1 
ATOM   806  C CA  . LYS A 1 103 ? 23.884  5.286   -20.885 1.00 16.02  ? 101 LYS A CA  1 
ATOM   807  C C   . LYS A 1 103 ? 22.432  5.268   -20.416 1.00 14.54  ? 101 LYS A C   1 
ATOM   808  O O   . LYS A 1 103 ? 21.797  6.324   -20.317 1.00 15.48  ? 101 LYS A O   1 
ATOM   809  C CB  . LYS A 1 103 ? 23.915  5.611   -22.386 1.00 15.31  ? 101 LYS A CB  1 
ATOM   810  C CG  . LYS A 1 103 ? 25.292  5.977   -22.911 1.00 18.74  ? 101 LYS A CG  1 
ATOM   811  C CD  . LYS A 1 103 ? 25.339  6.058   -24.443 1.00 21.54  ? 101 LYS A CD  1 
ATOM   812  C CE  . LYS A 1 103 ? 24.952  7.441   -24.972 1.00 26.62  ? 101 LYS A CE  1 
ATOM   813  N NZ  . LYS A 1 103 ? 25.104  7.602   -26.463 1.00 25.05  ? 101 LYS A NZ  1 
ATOM   814  N N   . TYR A 1 104 ? 21.884  4.064   -20.244 1.00 11.77  ? 102 TYR A N   1 
ATOM   815  C CA  . TYR A 1 104 ? 20.450  3.886   -20.099 1.00 12.28  ? 102 TYR A CA  1 
ATOM   816  C C   . TYR A 1 104 ? 20.149  3.134   -18.797 1.00 12.28  ? 102 TYR A C   1 
ATOM   817  O O   . TYR A 1 104 ? 20.351  3.709   -17.713 1.00 11.96  ? 102 TYR A O   1 
ATOM   818  C CB  . TYR A 1 104 ? 19.887  3.193   -21.348 1.00 11.00  ? 102 TYR A CB  1 
ATOM   819  C CG  . TYR A 1 104 ? 19.966  4.099   -22.561 1.00 11.09  ? 102 TYR A CG  1 
ATOM   820  C CD1 . TYR A 1 104 ? 20.973  3.930   -23.508 1.00 11.62  ? 102 TYR A CD1 1 
ATOM   821  C CD2 . TYR A 1 104 ? 19.206  5.266   -22.622 1.00 11.65  ? 102 TYR A CD2 1 
ATOM   822  C CE1 . TYR A 1 104 ? 21.057  4.772   -24.615 1.00 10.99  ? 102 TYR A CE1 1 
ATOM   823  C CE2 . TYR A 1 104 ? 19.314  6.135   -23.694 1.00 11.13  ? 102 TYR A CE2 1 
ATOM   824  C CZ  . TYR A 1 104 ? 20.218  5.874   -24.697 1.00 11.57  ? 102 TYR A CZ  1 
ATOM   825  O OH  . TYR A 1 104 ? 20.323  6.761   -25.751 1.00 12.10  ? 102 TYR A OH  1 
ATOM   826  N N   . LEU A 1 105 ? 19.896  1.828   -18.887 1.00 12.14  ? 103 LEU A N   1 
ATOM   827  C CA  . LEU A 1 105 ? 19.525  1.035   -17.698 1.00 12.23  ? 103 LEU A CA  1 
ATOM   828  C C   . LEU A 1 105 ? 20.658  0.147   -17.182 1.00 11.94  ? 103 LEU A C   1 
ATOM   829  O O   . LEU A 1 105 ? 20.501  -0.520  -16.153 1.00 12.45  ? 103 LEU A O   1 
ATOM   830  C CB  . LEU A 1 105 ? 18.303  0.152   -17.978 1.00 10.01  ? 103 LEU A CB  1 
ATOM   831  C CG  . LEU A 1 105 ? 17.011  0.830   -18.448 1.00 11.87  ? 103 LEU A CG  1 
ATOM   832  C CD1 . LEU A 1 105 ? 15.986  -0.207  -18.905 1.00 15.17  ? 103 LEU A CD1 1 
ATOM   833  C CD2 . LEU A 1 105 ? 16.451  1.761   -17.354 1.00 17.71  ? 103 LEU A CD2 1 
ATOM   834  N N   . GLY A 1 106 ? 21.759  0.085   -17.929 1.00 13.13  ? 104 GLY A N   1 
ATOM   835  C CA  . GLY A 1 106 ? 22.803  -0.923  -17.724 1.00 14.18  ? 104 GLY A CA  1 
ATOM   836  C C   . GLY A 1 106 ? 23.441  -0.942  -16.344 1.00 15.47  ? 104 GLY A C   1 
ATOM   837  O O   . GLY A 1 106 ? 23.855  -2.000  -15.855 1.00 17.17  ? 104 GLY A O   1 
ATOM   838  N N   . SER A 1 107 ? 23.587  0.240   -15.754 1.00 16.35  ? 105 SER A N   1 
ATOM   839  C CA  . SER A 1 107 ? 24.185  0.408   -14.436 1.00 21.35  ? 105 SER A CA  1 
ATOM   840  C C   . SER A 1 107 ? 23.406  -0.233  -13.283 1.00 20.22  ? 105 SER A C   1 
ATOM   841  O O   . SER A 1 107 ? 23.988  -0.470  -12.216 1.00 24.07  ? 105 SER A O   1 
ATOM   842  C CB  . SER A 1 107 ? 24.429  1.894   -14.148 1.00 20.03  ? 105 SER A CB  1 
ATOM   843  O OG  . SER A 1 107 ? 23.247  2.498   -13.628 1.00 27.38  ? 105 SER A OG  1 
ATOM   844  N N   . ARG A 1 108 ? 22.109  -0.484  -13.455 1.00 19.70  ? 106 ARG A N   1 
ATOM   845  C CA  . ARG A 1 108 ? 21.336  -1.188  -12.433 1.00 25.44  ? 106 ARG A CA  1 
ATOM   846  C C   . ARG A 1 108 ? 20.603  -2.426  -12.928 1.00 23.08  ? 106 ARG A C   1 
ATOM   847  O O   . ARG A 1 108 ? 19.697  -2.931  -12.257 1.00 24.36  ? 106 ARG A O   1 
ATOM   848  C CB  . ARG A 1 108 ? 20.361  -0.266  -11.704 1.00 28.47  ? 106 ARG A CB  1 
ATOM   849  C CG  . ARG A 1 108 ? 19.299  0.361   -12.574 1.00 35.68  ? 106 ARG A CG  1 
ATOM   850  C CD  . ARG A 1 108 ? 18.938  1.752   -12.053 1.00 48.53  ? 106 ARG A CD  1 
ATOM   851  N NE  . ARG A 1 108 ? 18.387  2.608   -13.102 1.00 57.32  ? 106 ARG A NE  1 
ATOM   852  C CZ  . ARG A 1 108 ? 19.108  3.151   -14.081 1.00 61.51  ? 106 ARG A CZ  1 
ATOM   853  N NH1 . ARG A 1 108 ? 20.411  2.902   -14.167 1.00 62.34  ? 106 ARG A NH1 1 
ATOM   854  N NH2 . ARG A 1 108 ? 18.527  3.950   -14.968 1.00 59.61  ? 106 ARG A NH2 1 
ATOM   855  N N   . THR A 1 109 ? 20.990  -2.908  -14.102 1.00 14.41  ? 107 THR A N   1 
ATOM   856  C CA  . THR A 1 109 ? 20.530  -4.199  -14.586 1.00 13.43  ? 107 THR A CA  1 
ATOM   857  C C   . THR A 1 109 ? 21.389  -5.304  -13.985 1.00 14.38  ? 107 THR A C   1 
ATOM   858  O O   . THR A 1 109 ? 22.616  -5.189  -13.918 1.00 12.89  ? 107 THR A O   1 
ATOM   859  C CB  . THR A 1 109 ? 20.564  -4.290  -16.132 1.00 12.01  ? 107 THR A CB  1 
ATOM   860  O OG1 . THR A 1 109 ? 19.699  -3.284  -16.679 1.00 15.41  ? 107 THR A OG1 1 
ATOM   861  C CG2 . THR A 1 109 ? 20.032  -5.654  -16.579 1.00 12.74  ? 107 THR A CG2 1 
ATOM   862  N N   . SER A 1 110 ? 20.737  -6.421  -13.678 1.00 12.69  ? 108 SER A N   1 
ATOM   863  C CA  . SER A 1 110 ? 21.434  -7.599  -13.191 1.00 14.38  ? 108 SER A CA  1 
ATOM   864  C C   . SER A 1 110 ? 22.407  -8.137  -14.249 1.00 12.55  ? 108 SER A C   1 
ATOM   865  O O   . SER A 1 110 ? 22.088  -8.189  -15.444 1.00 11.73  ? 108 SER A O   1 
ATOM   866  C CB  . SER A 1 110 ? 20.385  -8.654  -12.813 1.00 17.59  ? 108 SER A CB  1 
ATOM   867  O OG  . SER A 1 110 ? 20.783  -9.956  -13.188 1.00 19.73  ? 108 SER A OG  1 
ATOM   868  N N   . GLU A 1 111 ? 23.612  -8.495  -13.814 1.00 16.00  ? 109 GLU A N   1 
ATOM   869  C CA  . GLU A 1 111 ? 24.579  -9.131  -14.710 1.00 17.51  ? 109 GLU A CA  1 
ATOM   870  C C   . GLU A 1 111 ? 24.000  -10.370 -15.394 1.00 16.01  ? 109 GLU A C   1 
ATOM   871  O O   . GLU A 1 111 ? 24.345  -10.664 -16.540 1.00 16.44  ? 109 GLU A O   1 
ATOM   872  C CB  . GLU A 1 111 ? 25.879  -9.487  -13.969 1.00 20.96  ? 109 GLU A CB  1 
ATOM   873  C CG  . GLU A 1 111 ? 26.732  -8.289  -13.557 1.00 30.57  ? 109 GLU A CG  1 
ATOM   874  C CD  . GLU A 1 111 ? 26.216  -7.597  -12.304 1.00 44.98  ? 109 GLU A CD  1 
ATOM   875  O OE1 . GLU A 1 111 ? 26.750  -6.521  -11.947 1.00 52.34  ? 109 GLU A OE1 1 
ATOM   876  O OE2 . GLU A 1 111 ? 25.312  -8.156  -11.643 1.00 52.07  ? 109 GLU A OE2 1 
ATOM   877  N N   . LYS A 1 112 ? 23.158  -11.127 -14.696 1.00 14.25  ? 110 LYS A N   1 
ATOM   878  C CA  . LYS A 1 112 ? 22.570  -12.331 -15.288 1.00 14.95  ? 110 LYS A CA  1 
ATOM   879  C C   . LYS A 1 112 ? 21.701  -11.990 -16.502 1.00 13.48  ? 110 LYS A C   1 
ATOM   880  O O   . LYS A 1 112 ? 21.744  -12.657 -17.542 1.00 12.45  ? 110 LYS A O   1 
ATOM   881  C CB  . LYS A 1 112 ? 21.739  -13.090 -14.247 1.00 14.75  ? 110 LYS A CB  1 
ATOM   882  C CG  . LYS A 1 112 ? 21.001  -14.307 -14.778 1.00 17.32  ? 110 LYS A CG  1 
ATOM   883  C CD  . LYS A 1 112 ? 20.509  -15.196 -13.636 1.00 27.48  ? 110 LYS A CD  1 
ATOM   884  C CE  . LYS A 1 112 ? 21.478  -15.147 -12.468 1.00 30.08  ? 110 LYS A CE  1 
ATOM   885  N NZ  . LYS A 1 112 ? 21.392  -16.339 -11.576 1.00 39.08  ? 110 LYS A NZ  1 
ATOM   886  N N   . VAL A 1 113 ? 20.972  -10.889 -16.388 1.00 9.49   ? 111 VAL A N   1 
ATOM   887  C CA  . VAL A 1 113 ? 20.105  -10.457 -17.463 1.00 8.47   ? 111 VAL A CA  1 
ATOM   888  C C   . VAL A 1 113 ? 20.940  -9.924  -18.619 1.00 8.10   ? 111 VAL A C   1 
ATOM   889  O O   . VAL A 1 113 ? 20.673  -10.225 -19.777 1.00 7.47   ? 111 VAL A O   1 
ATOM   890  C CB  . VAL A 1 113 ? 19.111  -9.397  -16.961 1.00 7.69   ? 111 VAL A CB  1 
ATOM   891  C CG1 . VAL A 1 113 ? 18.428  -8.705  -18.124 1.00 6.87   ? 111 VAL A CG1 1 
ATOM   892  C CG2 . VAL A 1 113 ? 18.108  -10.055 -15.997 1.00 8.28   ? 111 VAL A CG2 1 
ATOM   893  N N   . LYS A 1 114 ? 21.951  -9.119  -18.308 1.00 10.40  ? 112 LYS A N   1 
ATOM   894  C CA  . LYS A 1 114 ? 22.798  -8.562  -19.367 1.00 10.53  ? 112 LYS A CA  1 
ATOM   895  C C   . LYS A 1 114 ? 23.535  -9.673  -20.131 1.00 9.97   ? 112 LYS A C   1 
ATOM   896  O O   . LYS A 1 114 ? 23.581  -9.683  -21.367 1.00 10.29  ? 112 LYS A O   1 
ATOM   897  C CB  . LYS A 1 114 ? 23.761  -7.511  -18.784 1.00 11.91  ? 112 LYS A CB  1 
ATOM   898  C CG  . LYS A 1 114 ? 23.050  -6.244  -18.263 1.00 11.09  ? 112 LYS A CG  1 
ATOM   899  C CD  . LYS A 1 114 ? 23.964  -5.020  -18.000 1.00 11.93  ? 112 LYS A CD  1 
ATOM   900  C CE  . LYS A 1 114 ? 25.004  -5.266  -16.915 1.00 19.86  ? 112 LYS A CE  1 
ATOM   901  N NZ  . LYS A 1 114 ? 25.847  -4.043  -16.676 1.00 19.02  ? 112 LYS A NZ  1 
ATOM   902  N N   . ASN A 1 115 ? 24.050  -10.656 -19.395 1.00 10.02  ? 113 ASN A N   1 
ATOM   903  C CA  . ASN A 1 115 ? 24.803  -11.743 -20.018 1.00 9.67   ? 113 ASN A CA  1 
ATOM   904  C C   . ASN A 1 115 ? 23.898  -12.565 -20.949 1.00 9.46   ? 113 ASN A C   1 
ATOM   905  O O   . ASN A 1 115 ? 24.316  -12.997 -22.034 1.00 9.68   ? 113 ASN A O   1 
ATOM   906  C CB  . ASN A 1 115 ? 25.389  -12.671 -18.936 1.00 11.48  ? 113 ASN A CB  1 
ATOM   907  C CG  . ASN A 1 115 ? 26.531  -12.029 -18.117 1.00 13.26  ? 113 ASN A CG  1 
ATOM   908  O OD1 . ASN A 1 115 ? 27.033  -12.662 -17.180 1.00 18.78  ? 113 ASN A OD1 1 
ATOM   909  N ND2 . ASN A 1 115 ? 27.068  -10.911 -18.571 1.00 11.47  ? 113 ASN A ND2 1 
ATOM   910  N N   . LYS A 1 116 ? 22.661  -12.784 -20.514 1.00 10.66  ? 114 LYS A N   1 
ATOM   911  C CA  . LYS A 1 116 ? 21.700  -13.576 -21.292 1.00 12.81  ? 114 LYS A CA  1 
ATOM   912  C C   . LYS A 1 116 ? 21.317  -12.845 -22.589 1.00 11.24  ? 114 LYS A C   1 
ATOM   913  O O   . LYS A 1 116 ? 21.135  -13.473 -23.646 1.00 11.05  ? 114 LYS A O   1 
ATOM   914  C CB  . LYS A 1 116 ? 20.458  -13.910 -20.455 1.00 10.48  ? 114 LYS A CB  1 
ATOM   915  C CG  . LYS A 1 116 ? 19.352  -14.650 -21.214 1.00 13.46  ? 114 LYS A CG  1 
ATOM   916  C CD  . LYS A 1 116 ? 19.739  -16.069 -21.549 1.00 11.01  ? 114 LYS A CD  1 
ATOM   917  C CE  . LYS A 1 116 ? 18.478  -16.851 -21.935 1.00 14.71  ? 114 LYS A CE  1 
ATOM   918  N NZ  . LYS A 1 116 ? 18.845  -18.226 -22.349 1.00 13.40  ? 114 LYS A NZ  1 
ATOM   919  N N   . ILE A 1 117 ? 21.162  -11.525 -22.497 1.00 7.39   ? 115 ILE A N   1 
ATOM   920  C CA  . ILE A 1 117 ? 20.938  -10.722 -23.693 1.00 7.17   ? 115 ILE A CA  1 
ATOM   921  C C   . ILE A 1 117 ? 22.097  -10.858 -24.689 1.00 7.65   ? 115 ILE A C   1 
ATOM   922  O O   . ILE A 1 117 ? 21.885  -11.100 -25.874 1.00 7.67   ? 115 ILE A O   1 
ATOM   923  C CB  . ILE A 1 117 ? 20.644  -9.240  -23.363 1.00 6.76   ? 115 ILE A CB  1 
ATOM   924  C CG1 . ILE A 1 117 ? 19.214  -9.091  -22.805 1.00 6.59   ? 115 ILE A CG1 1 
ATOM   925  C CG2 . ILE A 1 117 ? 20.817  -8.371  -24.617 1.00 6.83   ? 115 ILE A CG2 1 
ATOM   926  C CD1 . ILE A 1 117 ? 18.950  -7.768  -22.084 1.00 6.21   ? 115 ILE A CD1 1 
ATOM   927  N N   . LEU A 1 118 ? 23.330  -10.795 -24.207 1.00 8.70   ? 116 LEU A N   1 
ATOM   928  C CA  . LEU A 1 118 ? 24.475  -10.914 -25.104 1.00 9.23   ? 116 LEU A CA  1 
ATOM   929  C C   . LEU A 1 118 ? 24.542  -12.316 -25.723 1.00 9.83   ? 116 LEU A C   1 
ATOM   930  O O   . LEU A 1 118 ? 24.876  -12.462 -26.906 1.00 10.30  ? 116 LEU A O   1 
ATOM   931  C CB  . LEU A 1 118 ? 25.767  -10.572 -24.358 1.00 9.73   ? 116 LEU A CB  1 
ATOM   932  C CG  . LEU A 1 118 ? 25.962  -9.099  -23.982 1.00 9.78   ? 116 LEU A CG  1 
ATOM   933  C CD1 . LEU A 1 118 ? 27.237  -8.953  -23.141 1.00 10.58  ? 116 LEU A CD1 1 
ATOM   934  C CD2 . LEU A 1 118 ? 26.074  -8.252  -25.254 1.00 10.73  ? 116 LEU A CD2 1 
ATOM   935  N N   . GLU A 1 119 ? 24.235  -13.343 -24.920 1.00 8.80   ? 117 GLU A N   1 
ATOM   936  C CA  . GLU A 1 119 ? 24.233  -14.728 -25.414 1.00 11.10  ? 117 GLU A CA  1 
ATOM   937  C C   . GLU A 1 119 ? 23.214  -14.873 -26.542 1.00 11.46  ? 117 GLU A C   1 
ATOM   938  O O   . GLU A 1 119 ? 23.473  -15.558 -27.530 1.00 10.45  ? 117 GLU A O   1 
ATOM   939  C CB  . GLU A 1 119 ? 23.836  -15.706 -24.302 1.00 12.68  ? 117 GLU A CB  1 
ATOM   940  C CG  . GLU A 1 119 ? 24.979  -16.362 -23.529 1.00 18.99  ? 117 GLU A CG  1 
ATOM   941  C CD  . GLU A 1 119 ? 25.940  -17.158 -24.404 1.00 18.13  ? 117 GLU A CD  1 
ATOM   942  O OE1 . GLU A 1 119 ? 27.064  -16.653 -24.569 1.00 17.43  ? 117 GLU A OE1 1 
ATOM   943  O OE2 . GLU A 1 119 ? 25.643  -18.308 -24.822 1.00 19.99  ? 117 GLU A OE2 1 
ATOM   944  N N   . LEU A 1 120 ? 22.006  -14.350 -26.325 1.00 8.60   ? 118 LEU A N   1 
ATOM   945  C CA  . LEU A 1 120 ? 20.905  -14.545 -27.280 1.00 8.34   ? 118 LEU A CA  1 
ATOM   946  C C   . LEU A 1 120 ? 21.224  -13.809 -28.595 1.00 8.86   ? 118 LEU A C   1 
ATOM   947  O O   . LEU A 1 120 ? 21.153  -14.396 -29.676 1.00 9.92   ? 118 LEU A O   1 
ATOM   948  C CB  . LEU A 1 120 ? 19.575  -14.021 -26.714 1.00 8.02   ? 118 LEU A CB  1 
ATOM   949  C CG  . LEU A 1 120 ? 18.854  -14.919 -25.695 1.00 8.30   ? 118 LEU A CG  1 
ATOM   950  C CD1 . LEU A 1 120 ? 17.596  -14.258 -25.169 1.00 7.84   ? 118 LEU A CD1 1 
ATOM   951  C CD2 . LEU A 1 120 ? 18.576  -16.302 -26.248 1.00 8.02   ? 118 LEU A CD2 1 
ATOM   952  N N   . LEU A 1 121 ? 21.654  -12.557 -28.481 1.00 8.15   ? 119 LEU A N   1 
ATOM   953  C CA  . LEU A 1 121 ? 22.072  -11.803 -29.666 1.00 7.90   ? 119 LEU A CA  1 
ATOM   954  C C   . LEU A 1 121 ? 23.164  -12.552 -30.446 1.00 9.12   ? 119 LEU A C   1 
ATOM   955  O O   . LEU A 1 121 ? 23.037  -12.752 -31.652 1.00 9.41   ? 119 LEU A O   1 
ATOM   956  C CB  . LEU A 1 121 ? 22.553  -10.400 -29.284 1.00 8.15   ? 119 LEU A CB  1 
ATOM   957  C CG  . LEU A 1 121 ? 21.443  -9.467  -28.797 1.00 7.33   ? 119 LEU A CG  1 
ATOM   958  C CD1 . LEU A 1 121 ? 22.091  -8.192  -28.278 1.00 7.44   ? 119 LEU A CD1 1 
ATOM   959  C CD2 . LEU A 1 121 ? 20.478  -9.112  -29.936 1.00 7.21   ? 119 LEU A CD2 1 
ATOM   960  N N   . TYR A 1 122 ? 24.192  -13.026 -29.740 1.00 9.15   ? 120 TYR A N   1 
ATOM   961  C CA  . TYR A 1 122 ? 25.295  -13.741 -30.390 1.00 10.61  ? 120 TYR A CA  1 
ATOM   962  C C   . TYR A 1 122 ? 24.761  -14.976 -31.092 1.00 11.25  ? 120 TYR A C   1 
ATOM   963  O O   . TYR A 1 122 ? 25.105  -15.237 -32.247 1.00 11.85  ? 120 TYR A O   1 
ATOM   964  C CB  . TYR A 1 122 ? 26.361  -14.161 -29.386 1.00 11.08  ? 120 TYR A CB  1 
ATOM   965  C CG  . TYR A 1 122 ? 27.502  -14.895 -30.063 1.00 12.02  ? 120 TYR A CG  1 
ATOM   966  C CD1 . TYR A 1 122 ? 28.402  -14.197 -30.859 1.00 13.78  ? 120 TYR A CD1 1 
ATOM   967  C CD2 . TYR A 1 122 ? 27.568  -16.291 -30.053 1.00 15.39  ? 120 TYR A CD2 1 
ATOM   968  C CE1 . TYR A 1 122 ? 29.374  -14.853 -31.590 1.00 16.07  ? 120 TYR A CE1 1 
ATOM   969  C CE2 . TYR A 1 122 ? 28.588  -16.956 -30.720 1.00 14.25  ? 120 TYR A CE2 1 
ATOM   970  C CZ  . TYR A 1 122 ? 29.467  -16.223 -31.515 1.00 15.39  ? 120 TYR A CZ  1 
ATOM   971  O OH  . TYR A 1 122 ? 30.516  -16.826 -32.195 1.00 16.03  ? 120 TYR A OH  1 
ATOM   972  N N   . SER A 1 123 ? 23.892  -15.701 -30.391 1.00 12.51  ? 121 SER A N   1 
ATOM   973  C CA  . SER A 1 123 ? 23.304  -16.927 -30.930 1.00 13.81  ? 121 SER A CA  1 
ATOM   974  C C   . SER A 1 123 ? 22.581  -16.674 -32.250 1.00 14.95  ? 121 SER A C   1 
ATOM   975  O O   . SER A 1 123 ? 22.734  -17.435 -33.211 1.00 12.94  ? 121 SER A O   1 
ATOM   976  C CB  . SER A 1 123 ? 22.401  -17.639 -29.918 1.00 14.44  ? 121 SER A CB  1 
ATOM   977  O OG  . SER A 1 123 ? 21.113  -17.062 -29.841 1.00 13.78  ? 121 SER A OG  1 
ATOM   978  N N   . TRP A 1 124 ? 21.818  -15.589 -32.300 1.00 12.30  ? 122 TRP A N   1 
ATOM   979  C CA  . TRP A 1 124 ? 21.112  -15.217 -33.516 1.00 11.99  ? 122 TRP A CA  1 
ATOM   980  C C   . TRP A 1 124 ? 22.028  -14.770 -34.650 1.00 12.07  ? 122 TRP A C   1 
ATOM   981  O O   . TRP A 1 124 ? 21.720  -15.026 -35.817 1.00 12.66  ? 122 TRP A O   1 
ATOM   982  C CB  . TRP A 1 124 ? 20.069  -14.135 -33.213 1.00 11.52  ? 122 TRP A CB  1 
ATOM   983  C CG  . TRP A 1 124 ? 19.052  -14.572 -32.177 1.00 10.48  ? 122 TRP A CG  1 
ATOM   984  C CD1 . TRP A 1 124 ? 18.522  -15.823 -32.003 1.00 11.24  ? 122 TRP A CD1 1 
ATOM   985  C CD2 . TRP A 1 124 ? 18.303  -13.708 -31.312 1.00 9.22   ? 122 TRP A CD2 1 
ATOM   986  N NE1 . TRP A 1 124 ? 17.630  -15.821 -30.951 1.00 10.83  ? 122 TRP A NE1 1 
ATOM   987  C CE2 . TRP A 1 124 ? 17.495  -14.534 -30.497 1.00 9.48   ? 122 TRP A CE2 1 
ATOM   988  C CE3 . TRP A 1 124 ? 18.324  -12.334 -31.072 1.00 8.55   ? 122 TRP A CE3 1 
ATOM   989  C CZ2 . TRP A 1 124 ? 16.688  -14.022 -29.480 1.00 8.58   ? 122 TRP A CZ2 1 
ATOM   990  C CZ3 . TRP A 1 124 ? 17.516  -11.821 -30.064 1.00 8.78   ? 122 TRP A CZ3 1 
ATOM   991  C CH2 . TRP A 1 124 ? 16.678  -12.667 -29.308 1.00 7.65   ? 122 TRP A CH2 1 
ATOM   992  N N   . THR A 1 125 ? 23.167  -14.157 -34.329 1.00 10.28  ? 123 THR A N   1 
ATOM   993  C CA  . THR A 1 125 ? 24.136  -13.802 -35.377 1.00 10.76  ? 123 THR A CA  1 
ATOM   994  C C   . THR A 1 125 ? 24.662  -15.011 -36.153 1.00 11.60  ? 123 THR A C   1 
ATOM   995  O O   . THR A 1 125 ? 25.009  -14.906 -37.339 1.00 12.38  ? 123 THR A O   1 
ATOM   996  C CB  . THR A 1 125 ? 25.331  -12.931 -34.888 1.00 10.62  ? 123 THR A CB  1 
ATOM   997  O OG1 . THR A 1 125 ? 26.256  -13.691 -34.088 1.00 10.94  ? 123 THR A OG1 1 
ATOM   998  C CG2 . THR A 1 125 ? 24.857  -11.687 -34.156 1.00 10.25  ? 123 THR A CG2 1 
ATOM   999  N N   . VAL A 1 126 ? 24.751  -16.148 -35.473 1.00 11.59  ? 124 VAL A N   1 
ATOM   1000 C CA  . VAL A 1 126 ? 25.230  -17.380 -36.086 1.00 12.50  ? 124 VAL A CA  1 
ATOM   1001 C C   . VAL A 1 126 ? 24.063  -18.198 -36.669 1.00 12.82  ? 124 VAL A C   1 
ATOM   1002 O O   . VAL A 1 126 ? 24.157  -18.748 -37.784 1.00 13.95  ? 124 VAL A O   1 
ATOM   1003 C CB  . VAL A 1 126 ? 26.042  -18.227 -35.070 1.00 12.71  ? 124 VAL A CB  1 
ATOM   1004 C CG1 . VAL A 1 126 ? 26.546  -19.518 -35.733 1.00 13.87  ? 124 VAL A CG1 1 
ATOM   1005 C CG2 . VAL A 1 126 ? 27.223  -17.407 -34.535 1.00 12.94  ? 124 VAL A CG2 1 
ATOM   1006 N N   . GLY A 1 127 ? 22.958  -18.248 -35.929 1.00 12.21  ? 125 GLY A N   1 
ATOM   1007 C CA  . GLY A 1 127 ? 21.813  -19.083 -36.293 1.00 12.40  ? 125 GLY A CA  1 
ATOM   1008 C C   . GLY A 1 127 ? 20.950  -18.495 -37.395 1.00 12.92  ? 125 GLY A C   1 
ATOM   1009 O O   . GLY A 1 127 ? 20.443  -19.229 -38.254 1.00 13.23  ? 125 GLY A O   1 
ATOM   1010 N N   . LEU A 1 128 ? 20.892  -17.167 -37.444 1.00 13.49  ? 126 LEU A N   1 
ATOM   1011 C CA  . LEU A 1 128 ? 20.057  -16.444 -38.404 1.00 13.49  ? 126 LEU A CA  1 
ATOM   1012 C C   . LEU A 1 128 ? 20.830  -15.286 -39.037 1.00 14.71  ? 126 LEU A C   1 
ATOM   1013 O O   . LEU A 1 128 ? 20.531  -14.112 -38.781 1.00 12.58  ? 126 LEU A O   1 
ATOM   1014 C CB  . LEU A 1 128 ? 18.805  -15.897 -37.708 1.00 12.36  ? 126 LEU A CB  1 
ATOM   1015 C CG  . LEU A 1 128 ? 17.910  -16.935 -37.024 1.00 13.52  ? 126 LEU A CG  1 
ATOM   1016 C CD1 . LEU A 1 128 ? 17.037  -16.284 -35.942 1.00 11.48  ? 126 LEU A CD1 1 
ATOM   1017 C CD2 . LEU A 1 128 ? 17.091  -17.701 -38.057 1.00 16.08  ? 126 LEU A CD2 1 
ATOM   1018 N N   . PRO A 1 129 ? 21.877  -15.614 -39.795 1.00 12.79  ? 127 PRO A N   1 
ATOM   1019 C CA  . PRO A 1 129 ? 22.779  -14.594 -40.339 1.00 15.67  ? 127 PRO A CA  1 
ATOM   1020 C C   . PRO A 1 129 ? 22.100  -13.632 -41.325 1.00 17.01  ? 127 PRO A C   1 
ATOM   1021 O O   . PRO A 1 129 ? 22.627  -12.537 -41.553 1.00 19.24  ? 127 PRO A O   1 
ATOM   1022 C CB  . PRO A 1 129 ? 23.892  -15.414 -40.996 1.00 17.76  ? 127 PRO A CB  1 
ATOM   1023 C CG  . PRO A 1 129 ? 23.305  -16.766 -41.233 1.00 17.55  ? 127 PRO A CG  1 
ATOM   1024 C CD  . PRO A 1 129 ? 22.295  -16.988 -40.142 1.00 13.87  ? 127 PRO A CD  1 
ATOM   1025 N N   . GLU A 1 130 ? 20.908  -13.971 -41.822 1.00 24.64  ? 128 GLU A N   1 
ATOM   1026 C CA  . GLU A 1 130 ? 20.186  -13.051 -42.712 1.00 26.04  ? 128 GLU A CA  1 
ATOM   1027 C C   . GLU A 1 130 ? 19.741  -11.787 -41.992 1.00 25.22  ? 128 GLU A C   1 
ATOM   1028 O O   . GLU A 1 130 ? 19.316  -10.844 -42.659 1.00 22.64  ? 128 GLU A O   1 
ATOM   1029 C CB  . GLU A 1 130 ? 18.926  -13.638 -43.363 1.00 28.75  ? 128 GLU A CB  1 
ATOM   1030 C CG  . GLU A 1 130 ? 18.749  -15.129 -43.411 1.00 37.08  ? 128 GLU A CG  1 
ATOM   1031 C CD  . GLU A 1 130 ? 18.539  -15.732 -42.046 1.00 23.56  ? 128 GLU A CD  1 
ATOM   1032 O OE1 . GLU A 1 130 ? 19.570  -16.118 -41.479 1.00 23.63  ? 128 GLU A OE1 1 
ATOM   1033 O OE2 . GLU A 1 130 ? 17.381  -15.922 -41.609 1.00 23.42  ? 128 GLU A OE2 1 
ATOM   1034 N N   . GLU A 1 131 ? 19.542  -11.883 -40.676 1.00 17.29  ? 129 GLU A N   1 
ATOM   1035 C CA  . GLU A 1 131 ? 18.979  -10.758 -39.919 1.00 17.78  ? 129 GLU A CA  1 
ATOM   1036 C C   . GLU A 1 131 ? 20.008  -9.661  -39.716 1.00 17.45  ? 129 GLU A C   1 
ATOM   1037 O O   . GLU A 1 131 ? 20.798  -9.715  -38.765 1.00 17.41  ? 129 GLU A O   1 
ATOM   1038 C CB  . GLU A 1 131 ? 18.401  -11.229 -38.583 1.00 16.21  ? 129 GLU A CB  1 
ATOM   1039 C CG  . GLU A 1 131 ? 17.227  -12.174 -38.750 1.00 17.95  ? 129 GLU A CG  1 
ATOM   1040 C CD  . GLU A 1 131 ? 15.967  -11.485 -39.265 1.00 22.66  ? 129 GLU A CD  1 
ATOM   1041 O OE1 . GLU A 1 131 ? 14.974  -12.207 -39.507 1.00 22.91  ? 129 GLU A OE1 1 
ATOM   1042 O OE2 . GLU A 1 131 ? 15.904  -10.230 -39.236 1.00 18.38  ? 129 GLU A OE2 1 
ATOM   1043 N N   . VAL A 1 132 ? 20.117  -8.784  -40.717 1.00 12.26  ? 130 VAL A N   1 
ATOM   1044 C CA  . VAL A 1 132 ? 21.218  -7.828  -40.807 1.00 12.72  ? 130 VAL A CA  1 
ATOM   1045 C C   . VAL A 1 132 ? 21.251  -6.839  -39.641 1.00 13.70  ? 130 VAL A C   1 
ATOM   1046 O O   . VAL A 1 132 ? 22.321  -6.510  -39.135 1.00 13.52  ? 130 VAL A O   1 
ATOM   1047 C CB  . VAL A 1 132 ? 21.216  -7.059  -42.162 1.00 15.06  ? 130 VAL A CB  1 
ATOM   1048 C CG1 . VAL A 1 132 ? 21.170  -8.023  -43.337 1.00 21.31  ? 130 VAL A CG1 1 
ATOM   1049 C CG2 . VAL A 1 132 ? 20.064  -6.095  -42.240 1.00 21.31  ? 130 VAL A CG2 1 
ATOM   1050 N N   . LYS A 1 133 ? 20.087  -6.459  -39.123 1.00 11.61  ? 131 LYS A N   1 
ATOM   1051 C CA  . LYS A 1 133 ? 20.046  -5.499  -38.012 1.00 11.67  ? 131 LYS A CA  1 
ATOM   1052 C C   . LYS A 1 133 ? 20.433  -6.133  -36.666 1.00 10.60  ? 131 LYS A C   1 
ATOM   1053 O O   . LYS A 1 133 ? 21.007  -5.458  -35.806 1.00 10.44  ? 131 LYS A O   1 
ATOM   1054 C CB  . LYS A 1 133 ? 18.671  -4.827  -37.930 1.00 10.65  ? 131 LYS A CB  1 
ATOM   1055 C CG  . LYS A 1 133 ? 18.356  -3.952  -39.143 1.00 11.90  ? 131 LYS A CG  1 
ATOM   1056 C CD  . LYS A 1 133 ? 16.987  -3.298  -38.975 1.00 11.59  ? 131 LYS A CD  1 
ATOM   1057 C CE  . LYS A 1 133 ? 16.619  -2.494  -40.219 1.00 12.98  ? 131 LYS A CE  1 
ATOM   1058 N NZ  . LYS A 1 133 ? 15.163  -2.159  -40.287 1.00 13.74  ? 131 LYS A NZ  1 
ATOM   1059 N N   . ILE A 1 134 ? 20.135  -7.423  -36.480 1.00 9.09   ? 132 ILE A N   1 
ATOM   1060 C CA  . ILE A 1 134 ? 20.652  -8.127  -35.300 1.00 9.36   ? 132 ILE A CA  1 
ATOM   1061 C C   . ILE A 1 134 ? 22.187  -8.129  -35.315 1.00 9.35   ? 132 ILE A C   1 
ATOM   1062 O O   . ILE A 1 134 ? 22.836  -7.792  -34.317 1.00 9.16   ? 132 ILE A O   1 
ATOM   1063 C CB  . ILE A 1 134 ? 20.126  -9.584  -35.201 1.00 8.62   ? 132 ILE A CB  1 
ATOM   1064 C CG1 . ILE A 1 134 ? 18.603  -9.606  -34.993 1.00 8.78   ? 132 ILE A CG1 1 
ATOM   1065 C CG2 . ILE A 1 134 ? 20.796  -10.287 -33.998 1.00 9.54   ? 132 ILE A CG2 1 
ATOM   1066 C CD1 . ILE A 1 134 ? 17.990  -11.023 -35.018 1.00 8.69   ? 132 ILE A CD1 1 
ATOM   1067 N N   . ALA A 1 135 ? 22.760  -8.416  -36.483 1.00 11.22  ? 133 ALA A N   1 
ATOM   1068 C CA  . ALA A 1 135 ? 24.220  -8.365  -36.668 1.00 11.46  ? 133 ALA A CA  1 
ATOM   1069 C C   . ALA A 1 135 ? 24.808  -6.966  -36.400 1.00 11.98  ? 133 ALA A C   1 
ATOM   1070 O O   . ALA A 1 135 ? 25.824  -6.818  -35.703 1.00 11.64  ? 133 ALA A O   1 
ATOM   1071 C CB  . ALA A 1 135 ? 24.586  -8.839  -38.061 1.00 13.34  ? 133 ALA A CB  1 
ATOM   1072 N N   . GLU A 1 136 ? 24.145  -5.932  -36.911 1.00 11.48  ? 134 GLU A N   1 
ATOM   1073 C CA  . GLU A 1 136 ? 24.601  -4.554  -36.680 1.00 11.77  ? 134 GLU A CA  1 
ATOM   1074 C C   . GLU A 1 136 ? 24.561  -4.123  -35.221 1.00 10.63  ? 134 GLU A C   1 
ATOM   1075 O O   . GLU A 1 136 ? 25.463  -3.417  -34.750 1.00 10.99  ? 134 GLU A O   1 
ATOM   1076 C CB  . GLU A 1 136 ? 23.797  -3.571  -37.522 1.00 12.83  ? 134 GLU A CB  1 
ATOM   1077 C CG  . GLU A 1 136 ? 23.969  -3.768  -38.996 1.00 16.00  ? 134 GLU A CG  1 
ATOM   1078 C CD  . GLU A 1 136 ? 23.382  -2.616  -39.783 1.00 28.28  ? 134 GLU A CD  1 
ATOM   1079 O OE1 . GLU A 1 136 ? 23.722  -2.491  -40.980 1.00 32.24  ? 134 GLU A OE1 1 
ATOM   1080 O OE2 . GLU A 1 136 ? 22.586  -1.844  -39.201 1.00 21.82  ? 134 GLU A OE2 1 
ATOM   1081 N N   . ALA A 1 137 ? 23.484  -4.504  -34.534 1.00 10.47  ? 135 ALA A N   1 
ATOM   1082 C CA  . ALA A 1 137 ? 23.302  -4.158  -33.123 1.00 9.70   ? 135 ALA A CA  1 
ATOM   1083 C C   . ALA A 1 137 ? 24.397  -4.862  -32.312 1.00 9.87   ? 135 ALA A C   1 
ATOM   1084 O O   . ALA A 1 137 ? 24.999  -4.267  -31.419 1.00 9.75   ? 135 ALA A O   1 
ATOM   1085 C CB  . ALA A 1 137 ? 21.920  -4.603  -32.638 1.00 8.90   ? 135 ALA A CB  1 
ATOM   1086 N N   . TYR A 1 138 ? 24.641  -6.134  -32.625 1.00 12.86  ? 136 TYR A N   1 
ATOM   1087 C CA  . TYR A 1 138 ? 25.633  -6.893  -31.870 1.00 11.91  ? 136 TYR A CA  1 
ATOM   1088 C C   . TYR A 1 138 ? 27.045  -6.337  -32.098 1.00 13.46  ? 136 TYR A C   1 
ATOM   1089 O O   . TYR A 1 138 ? 27.792  -6.150  -31.132 1.00 13.67  ? 136 TYR A O   1 
ATOM   1090 C CB  . TYR A 1 138 ? 25.555  -8.388  -32.185 1.00 13.27  ? 136 TYR A CB  1 
ATOM   1091 C CG  . TYR A 1 138 ? 26.540  -9.220  -31.402 1.00 14.56  ? 136 TYR A CG  1 
ATOM   1092 C CD1 . TYR A 1 138 ? 26.284  -9.565  -30.077 1.00 13.31  ? 136 TYR A CD1 1 
ATOM   1093 C CD2 . TYR A 1 138 ? 27.741  -9.630  -31.973 1.00 14.80  ? 136 TYR A CD2 1 
ATOM   1094 C CE1 . TYR A 1 138 ? 27.209  -10.285 -29.336 1.00 14.69  ? 136 TYR A CE1 1 
ATOM   1095 C CE2 . TYR A 1 138 ? 28.685  -10.332 -31.230 1.00 14.60  ? 136 TYR A CE2 1 
ATOM   1096 C CZ  . TYR A 1 138 ? 28.417  -10.632 -29.906 1.00 16.59  ? 136 TYR A CZ  1 
ATOM   1097 O OH  . TYR A 1 138 ? 29.263  -11.449 -29.184 1.00 16.60  ? 136 TYR A OH  1 
ATOM   1098 N N   . GLN A 1 139 ? 27.355  -5.973  -33.344 1.00 12.04  ? 137 GLN A N   1 
ATOM   1099 C CA  . GLN A 1 139 ? 28.651  -5.393  -33.729 1.00 15.78  ? 137 GLN A CA  1 
ATOM   1100 C C   . GLN A 1 139 ? 28.863  -4.064  -32.996 1.00 15.57  ? 137 GLN A C   1 
ATOM   1101 O O   . GLN A 1 139 ? 29.908  -3.836  -32.392 1.00 14.37  ? 137 GLN A O   1 
ATOM   1102 C CB  . GLN A 1 139 ? 28.701  -5.157  -35.251 1.00 16.95  ? 137 GLN A CB  1 
ATOM   1103 C CG  . GLN A 1 139 ? 29.824  -4.221  -35.783 1.00 24.86  ? 137 GLN A CG  1 
ATOM   1104 C CD  . GLN A 1 139 ? 29.759  -3.989  -37.300 1.00 31.83  ? 137 GLN A CD  1 
ATOM   1105 O OE1 . GLN A 1 139 ? 28.760  -3.482  -37.835 1.00 32.35  ? 137 GLN A OE1 1 
ATOM   1106 N NE2 . GLN A 1 139 ? 30.821  -4.387  -38.002 1.00 31.58  ? 137 GLN A NE2 1 
ATOM   1107 N N   . MET A 1 140 ? 27.801  -3.271  -32.916 1.00 13.63  ? 138 MET A N   1 
ATOM   1108 C CA  . MET A 1 140 ? 27.832  -2.011  -32.166 1.00 13.72  ? 138 MET A CA  1 
ATOM   1109 C C   . MET A 1 140 ? 28.077  -2.239  -30.668 1.00 14.28  ? 138 MET A C   1 
ATOM   1110 O O   . MET A 1 140 ? 28.901  -1.552  -30.062 1.00 14.13  ? 138 MET A O   1 
ATOM   1111 C CB  . MET A 1 140 ? 26.554  -1.205  -32.419 1.00 12.86  ? 138 MET A CB  1 
ATOM   1112 C CG  . MET A 1 140 ? 26.436  0.113   -31.637 1.00 13.90  ? 138 MET A CG  1 
ATOM   1113 S SD  . MET A 1 140 ? 25.852  -0.127  -29.943 1.00 12.01  ? 138 MET A SD  1 
ATOM   1114 C CE  . MET A 1 140 ? 24.152  -0.638  -30.225 1.00 11.78  ? 138 MET A CE  1 
ATOM   1115 N N   . LEU A 1 141 ? 27.392  -3.211  -30.067 1.00 14.16  ? 139 LEU A N   1 
ATOM   1116 C CA  . LEU A 1 141 ? 27.584  -3.483  -28.645 1.00 14.16  ? 139 LEU A CA  1 
ATOM   1117 C C   . LEU A 1 141 ? 29.037  -3.847  -28.338 1.00 13.29  ? 139 LEU A C   1 
ATOM   1118 O O   . LEU A 1 141 ? 29.633  -3.328  -27.390 1.00 14.87  ? 139 LEU A O   1 
ATOM   1119 C CB  . LEU A 1 141 ? 26.656  -4.583  -28.133 1.00 13.33  ? 139 LEU A CB  1 
ATOM   1120 C CG  . LEU A 1 141 ? 25.176  -4.194  -28.099 1.00 12.03  ? 139 LEU A CG  1 
ATOM   1121 C CD1 . LEU A 1 141 ? 24.399  -5.449  -27.789 1.00 11.86  ? 139 LEU A CD1 1 
ATOM   1122 C CD2 . LEU A 1 141 ? 24.893  -3.122  -27.059 1.00 10.33  ? 139 LEU A CD2 1 
ATOM   1123 N N   . LYS A 1 142 ? 29.659  -4.609  -29.229 1.00 15.30  ? 140 LYS A N   1 
ATOM   1124 C CA  . LYS A 1 142 ? 31.073  -4.947  -29.020 1.00 16.08  ? 140 LYS A CA  1 
ATOM   1125 C C   . LYS A 1 142 ? 31.984  -3.732  -29.194 1.00 19.16  ? 140 LYS A C   1 
ATOM   1126 O O   . LYS A 1 142 ? 32.995  -3.573  -28.493 1.00 20.15  ? 140 LYS A O   1 
ATOM   1127 C CB  . LYS A 1 142 ? 31.500  -6.069  -29.967 1.00 20.95  ? 140 LYS A CB  1 
ATOM   1128 C CG  . LYS A 1 142 ? 30.713  -7.360  -29.795 1.00 17.81  ? 140 LYS A CG  1 
ATOM   1129 C CD  . LYS A 1 142 ? 30.134  -7.464  -28.386 1.00 30.27  ? 140 LYS A CD  1 
ATOM   1130 C CE  . LYS A 1 142 ? 30.494  -8.782  -27.722 1.00 31.65  ? 140 LYS A CE  1 
ATOM   1131 N NZ  . LYS A 1 142 ? 30.279  -8.812  -26.237 1.00 19.50  ? 140 LYS A NZ  1 
ATOM   1132 N N   . LYS A 1 143 ? 31.714  -2.955  -30.233 1.00 20.07  ? 141 LYS A N   1 
ATOM   1133 C CA  . LYS A 1 143 ? 32.456  -1.725  -30.490 1.00 22.96  ? 141 LYS A CA  1 
ATOM   1134 C C   . LYS A 1 143 ? 32.421  -0.784  -29.284 1.00 21.99  ? 141 LYS A C   1 
ATOM   1135 O O   . LYS A 1 143 ? 33.418  -0.115  -28.984 1.00 21.60  ? 141 LYS A O   1 
ATOM   1136 C CB  . LYS A 1 143 ? 31.883  -1.021  -31.716 1.00 24.67  ? 141 LYS A CB  1 
ATOM   1137 C CG  . LYS A 1 143 ? 32.893  -0.208  -32.502 1.00 36.55  ? 141 LYS A CG  1 
ATOM   1138 C CD  . LYS A 1 143 ? 32.788  1.269   -32.173 1.00 50.43  ? 141 LYS A CD  1 
ATOM   1139 C CE  . LYS A 1 143 ? 34.166  1.916   -32.145 1.00 56.50  ? 141 LYS A CE  1 
ATOM   1140 N NZ  . LYS A 1 143 ? 34.980  1.558   -33.344 1.00 59.22  ? 141 LYS A NZ  1 
ATOM   1141 N N   . GLN A 1 144 ? 31.279  -0.709  -28.637 1.00 22.80  ? 142 GLN A N   1 
ATOM   1142 C CA  . GLN A 1 144 ? 31.084  0.131   -27.487 1.00 23.45  ? 142 GLN A CA  1 
ATOM   1143 C C   . GLN A 1 144 ? 31.476  -0.520  -26.160 1.00 24.00  ? 142 GLN A C   1 
ATOM   1144 O O   . GLN A 1 144 ? 31.272  0.042   -25.102 1.00 24.61  ? 142 GLN A O   1 
ATOM   1145 C CB  . GLN A 1 144 ? 29.647  0.667   -27.398 1.00 23.07  ? 142 GLN A CB  1 
ATOM   1146 C CG  . GLN A 1 144 ? 29.122  1.402   -28.611 1.00 20.48  ? 142 GLN A CG  1 
ATOM   1147 C CD  . GLN A 1 144 ? 29.913  2.668   -28.994 1.00 30.81  ? 142 GLN A CD  1 
ATOM   1148 O OE1 . GLN A 1 144 ? 30.217  2.869   -30.135 1.00 28.63  ? 142 GLN A OE1 1 
ATOM   1149 N NE2 . GLN A 1 144 ? 30.172  3.497   -28.055 1.00 31.56  ? 142 GLN A NE2 1 
ATOM   1150 N N   . GLY A 1 145 ? 32.055  -1.707  -26.245 1.00 16.83  ? 143 GLY A N   1 
ATOM   1151 C CA  . GLY A 1 145 ? 32.620  -2.348  -25.062 1.00 19.93  ? 143 GLY A CA  1 
ATOM   1152 C C   . GLY A 1 145 ? 31.638  -2.957  -24.073 1.00 16.16  ? 143 GLY A C   1 
ATOM   1153 O O   . GLY A 1 145 ? 31.982  -3.136  -22.904 1.00 16.47  ? 143 GLY A O   1 
ATOM   1154 N N   . ILE A 1 146 ? 30.439  -3.313  -24.539 1.00 17.81  ? 144 ILE A N   1 
ATOM   1155 C CA  . ILE A 1 146 ? 29.471  -4.070  -23.740 1.00 16.61  ? 144 ILE A CA  1 
ATOM   1156 C C   . ILE A 1 146 ? 29.800  -5.566  -23.760 1.00 17.48  ? 144 ILE A C   1 
ATOM   1157 O O   . ILE A 1 146 ? 29.630  -6.235  -24.780 1.00 17.04  ? 144 ILE A O   1 
ATOM   1158 C CB  . ILE A 1 146 ? 28.031  -3.844  -24.255 1.00 14.68  ? 144 ILE A CB  1 
ATOM   1159 C CG1 . ILE A 1 146 ? 27.806  -2.364  -24.589 1.00 15.16  ? 144 ILE A CG1 1 
ATOM   1160 C CG2 . ILE A 1 146 ? 26.984  -4.372  -23.255 1.00 16.90  ? 144 ILE A CG2 1 
ATOM   1161 C CD1 . ILE A 1 146 ? 27.779  -1.448  -23.385 1.00 16.34  ? 144 ILE A CD1 1 
ATOM   1162 N N   . VAL A 1 147 ? 30.300  -6.075  -22.638 1.00 15.79  ? 145 VAL A N   1 
ATOM   1163 C CA  . VAL A 1 147 ? 30.805  -7.442  -22.581 1.00 15.54  ? 145 VAL A CA  1 
ATOM   1164 C C   . VAL A 1 147 ? 30.253  -8.137  -21.343 1.00 17.33  ? 145 VAL A C   1 
ATOM   1165 O O   . VAL A 1 147 ? 29.668  -7.496  -20.467 1.00 18.12  ? 145 VAL A O   1 
ATOM   1166 C CB  . VAL A 1 147 ? 32.352  -7.462  -22.575 1.00 17.25  ? 145 VAL A CB  1 
ATOM   1167 C CG1 . VAL A 1 147 ? 32.889  -6.733  -23.799 1.00 16.58  ? 145 VAL A CG1 1 
ATOM   1168 C CG2 . VAL A 1 147 ? 32.873  -6.797  -21.315 1.00 19.32  ? 145 VAL A CG2 1 
ATOM   1169 N N   . LYS A 1 148 ? 30.427  -9.450  -21.276 1.00 16.87  ? 146 LYS A N   1 
ATOM   1170 C CA  . LYS A 1 148 ? 29.923  -10.221 -20.153 1.00 21.09  ? 146 LYS A CA  1 
ATOM   1171 C C   . LYS A 1 148 ? 30.663  -9.888  -18.864 1.00 23.52  ? 146 LYS A C   1 
ATOM   1172 O O   . LYS A 1 148 ? 31.860  -9.585  -18.890 1.00 21.98  ? 146 LYS A O   1 
ATOM   1173 C CB  . LYS A 1 148 ? 29.998  -11.712 -20.471 1.00 23.56  ? 146 LYS A CB  1 
ATOM   1174 C CG  . LYS A 1 148 ? 28.941  -12.080 -21.501 1.00 22.53  ? 146 LYS A CG  1 
ATOM   1175 C CD  . LYS A 1 148 ? 28.354  -13.443 -21.241 1.00 31.70  ? 146 LYS A CD  1 
ATOM   1176 C CE  . LYS A 1 148 ? 27.680  -13.989 -22.485 1.00 23.75  ? 146 LYS A CE  1 
ATOM   1177 N NZ  . LYS A 1 148 ? 27.879  -15.461 -22.519 1.00 23.97  ? 146 LYS A NZ  1 
ATOM   1178 N N   . SER A 1 149 ? 29.952  -9.945  -17.743 1.00 90.39  ? 147 SER A N   1 
ATOM   1179 C CA  . SER A 1 149 ? 30.545  -9.649  -16.444 1.00 96.62  ? 147 SER A CA  1 
ATOM   1180 C C   . SER A 1 149 ? 31.278  -8.311  -16.464 1.00 99.81  ? 147 SER A C   1 
ATOM   1181 O O   . SER A 1 149 ? 30.863  -7.356  -15.808 1.00 99.09  ? 147 SER A O   1 
ATOM   1182 C CB  . SER A 1 149 ? 31.502  -10.766 -16.025 1.00 101.39 ? 147 SER A CB  1 
ATOM   1183 O OG  . SER A 1 149 ? 30.833  -11.750 -15.255 1.00 101.70 ? 147 SER A OG  1 
ATOM   1184 O OXT . SER A 1 149 ? 32.298  -8.162  -17.137 1.00 82.16  ? 147 SER A OXT 1 
ATOM   1185 N N   . GLU B 1 8   ? 8.084   -13.993 1.539   1.00 60.39  ? 6   GLU B N   1 
ATOM   1186 C CA  . GLU B 1 8   ? 8.503   -12.822 0.724   1.00 53.96  ? 6   GLU B CA  1 
ATOM   1187 C C   . GLU B 1 8   ? 7.376   -11.812 0.499   1.00 51.94  ? 6   GLU B C   1 
ATOM   1188 O O   . GLU B 1 8   ? 7.539   -10.896 -0.293  1.00 46.61  ? 6   GLU B O   1 
ATOM   1189 C CB  . GLU B 1 8   ? 9.059   -13.279 -0.627  1.00 53.97  ? 6   GLU B CB  1 
ATOM   1190 C CG  . GLU B 1 8   ? 8.006   -13.839 -1.573  1.00 57.10  ? 6   GLU B CG  1 
ATOM   1191 C CD  . GLU B 1 8   ? 7.427   -15.166 -1.090  1.00 58.89  ? 6   GLU B CD  1 
ATOM   1192 O OE1 . GLU B 1 8   ? 6.230   -15.426 -1.324  1.00 61.46  ? 6   GLU B OE1 1 
ATOM   1193 O OE2 . GLU B 1 8   ? 8.158   -15.938 -0.437  1.00 63.26  ? 6   GLU B OE2 1 
ATOM   1194 N N   . PRO B 1 9   ? 6.210   -12.015 1.138   1.00 43.08  ? 7   PRO B N   1 
ATOM   1195 C CA  . PRO B 1 9   ? 5.005   -11.256 0.787   1.00 42.42  ? 7   PRO B CA  1 
ATOM   1196 C C   . PRO B 1 9   ? 4.923   -9.793  1.246   1.00 41.02  ? 7   PRO B C   1 
ATOM   1197 O O   . PRO B 1 9   ? 4.164   -9.026  0.653   1.00 37.32  ? 7   PRO B O   1 
ATOM   1198 C CB  . PRO B 1 9   ? 3.874   -12.071 1.434   1.00 44.50  ? 7   PRO B CB  1 
ATOM   1199 C CG  . PRO B 1 9   ? 4.456   -13.445 1.646   1.00 45.14  ? 7   PRO B CG  1 
ATOM   1200 C CD  . PRO B 1 9   ? 5.891   -13.177 1.989   1.00 46.44  ? 7   PRO B CD  1 
ATOM   1201 N N   . GLU B 1 10  ? 5.873   -9.614  2.158   1.00 42.37  ? 8   GLU B N   1 
ATOM   1202 C CA  . GLU B 1 10  ? 6.360   -8.421  2.687   1.00 40.61  ? 8   GLU B CA  1 
ATOM   1203 C C   . GLU B 1 10  ? 7.484   -7.806  1.899   1.00 35.64  ? 8   GLU B C   1 
ATOM   1204 O O   . GLU B 1 10  ? 7.772   -6.700  2.261   1.00 34.70  ? 8   GLU B O   1 
ATOM   1205 C CB  . GLU B 1 10  ? 6.862   -8.590  4.121   1.00 46.20  ? 8   GLU B CB  1 
ATOM   1206 C CG  . GLU B 1 10  ? 5.955   -9.214  5.132   1.00 54.21  ? 8   GLU B CG  1 
ATOM   1207 C CD  . GLU B 1 10  ? 6.762   -9.669  6.373   1.00 65.94  ? 8   GLU B CD  1 
ATOM   1208 O OE1 . GLU B 1 10  ? 6.751   -8.963  7.397   1.00 69.09  ? 8   GLU B OE1 1 
ATOM   1209 O OE2 . GLU B 1 10  ? 7.414   -10.733 6.309   1.00 68.66  ? 8   GLU B OE2 1 
ATOM   1210 N N   . THR B 1 11  ? 8.154   -8.431  0.887   1.00 29.46  ? 9   THR B N   1 
ATOM   1211 C CA  . THR B 1 11  ? 9.097   -7.544  0.218   1.00 24.62  ? 9   THR B CA  1 
ATOM   1212 C C   . THR B 1 11  ? 8.373   -6.415  -0.500  1.00 20.40  ? 9   THR B C   1 
ATOM   1213 O O   . THR B 1 11  ? 7.213   -6.561  -0.891  1.00 18.60  ? 9   THR B O   1 
ATOM   1214 C CB  . THR B 1 11  ? 9.913   -8.317  -0.822  1.00 25.08  ? 9   THR B CB  1 
ATOM   1215 O OG1 . THR B 1 11  ? 9.019   -8.950  -1.749  1.00 22.76  ? 9   THR B OG1 1 
ATOM   1216 C CG2 . THR B 1 11  ? 10.775  -9.379  -0.136  1.00 26.60  ? 9   THR B CG2 1 
ATOM   1217 N N   . LEU B 1 12  ? 9.130   -5.369  -0.819  1.00 17.36  ? 10  LEU B N   1 
ATOM   1218 C CA  . LEU B 1 12  ? 8.670   -4.294  -1.687  1.00 18.39  ? 10  LEU B CA  1 
ATOM   1219 C C   . LEU B 1 12  ? 8.232   -4.832  -3.042  1.00 15.41  ? 10  LEU B C   1 
ATOM   1220 O O   . LEU B 1 12  ? 7.222   -4.390  -3.574  1.00 14.73  ? 10  LEU B O   1 
ATOM   1221 C CB  . LEU B 1 12  ? 9.760   -3.240  -1.884  1.00 18.69  ? 10  LEU B CB  1 
ATOM   1222 C CG  . LEU B 1 12  ? 9.965   -2.308  -0.682  1.00 19.58  ? 10  LEU B CG  1 
ATOM   1223 C CD1 . LEU B 1 12  ? 10.768  -1.091  -1.131  1.00 23.06  ? 10  LEU B CD1 1 
ATOM   1224 C CD2 . LEU B 1 12  ? 8.627   -1.889  -0.074  1.00 17.18  ? 10  LEU B CD2 1 
ATOM   1225 N N   . GLU B 1 13  ? 8.907   -5.878  -3.508  1.00 14.22  ? 11  GLU B N   1 
ATOM   1226 C CA  . GLU B 1 13  ? 8.592   -6.475  -4.803  1.00 14.61  ? 11  GLU B CA  1 
ATOM   1227 C C   . GLU B 1 13  ? 7.226   -7.143  -4.752  1.00 13.80  ? 11  GLU B C   1 
ATOM   1228 O O   . GLU B 1 13  ? 6.352   -6.856  -5.564  1.00 13.31  ? 11  GLU B O   1 
ATOM   1229 C CB  . GLU B 1 13  ? 9.664   -7.482  -5.229  1.00 13.56  ? 11  GLU B CB  1 
ATOM   1230 C CG  . GLU B 1 13  ? 10.959  -6.856  -5.729  1.00 14.61  ? 11  GLU B CG  1 
ATOM   1231 C CD  . GLU B 1 13  ? 11.976  -6.662  -4.616  1.00 18.28  ? 11  GLU B CD  1 
ATOM   1232 O OE1 . GLU B 1 13  ? 13.169  -6.494  -4.949  1.00 18.82  ? 11  GLU B OE1 1 
ATOM   1233 O OE2 . GLU B 1 13  ? 11.593  -6.739  -3.422  1.00 16.43  ? 11  GLU B OE2 1 
ATOM   1234 N N   . ALA B 1 14  ? 7.010   -7.994  -3.760  1.00 14.41  ? 12  ALA B N   1 
ATOM   1235 C CA  . ALA B 1 14  ? 5.715   -8.657  -3.671  1.00 15.20  ? 12  ALA B CA  1 
ATOM   1236 C C   . ALA B 1 14  ? 4.588   -7.655  -3.417  1.00 14.78  ? 12  ALA B C   1 
ATOM   1237 O O   . ALA B 1 14  ? 3.520   -7.739  -4.026  1.00 14.30  ? 12  ALA B O   1 
ATOM   1238 C CB  . ALA B 1 14  ? 5.738   -9.726  -2.586  1.00 16.81  ? 12  ALA B CB  1 
ATOM   1239 N N   . ARG B 1 15  ? 4.871   -6.641  -2.602  1.00 15.27  ? 13  ARG B N   1 
ATOM   1240 C CA  . ARG B 1 15  ? 3.892   -5.609  -2.300  1.00 15.14  ? 13  ARG B CA  1 
ATOM   1241 C C   . ARG B 1 15  ? 3.476   -4.803  -3.520  1.00 13.66  ? 13  ARG B C   1 
ATOM   1242 O O   . ARG B 1 15  ? 2.287   -4.612  -3.746  1.00 13.46  ? 13  ARG B O   1 
ATOM   1243 C CB  . ARG B 1 15  ? 4.406   -4.680  -1.207  1.00 15.19  ? 13  ARG B CB  1 
ATOM   1244 C CG  . ARG B 1 15  ? 4.433   -5.330  0.167   1.00 16.86  ? 13  ARG B CG  1 
ATOM   1245 C CD  . ARG B 1 15  ? 4.296   -4.250  1.230   1.00 17.05  ? 13  ARG B CD  1 
ATOM   1246 N NE  . ARG B 1 15  ? 3.857   -4.742  2.532   1.00 34.61  ? 13  ARG B NE  1 
ATOM   1247 C CZ  . ARG B 1 15  ? 4.704   -5.169  3.456   1.00 28.92  ? 13  ARG B CZ  1 
ATOM   1248 N NH1 . ARG B 1 15  ? 4.282   -5.500  4.669   1.00 27.37  ? 13  ARG B NH1 1 
ATOM   1249 N NH2 . ARG B 1 15  ? 5.992   -5.239  3.149   1.00 36.95  ? 13  ARG B NH2 1 
ATOM   1250 N N   . ILE B 1 16  ? 4.453   -4.341  -4.298  1.00 14.03  ? 14  ILE B N   1 
ATOM   1251 C CA  . ILE B 1 16  ? 4.148   -3.557  -5.497  1.00 12.57  ? 14  ILE B CA  1 
ATOM   1252 C C   . ILE B 1 16  ? 3.449   -4.383  -6.569  1.00 12.51  ? 14  ILE B C   1 
ATOM   1253 O O   . ILE B 1 16  ? 2.479   -3.916  -7.170  1.00 12.69  ? 14  ILE B O   1 
ATOM   1254 C CB  . ILE B 1 16  ? 5.373   -2.834  -6.089  1.00 10.97  ? 14  ILE B CB  1 
ATOM   1255 C CG1 . ILE B 1 16  ? 4.925   -1.721  -7.036  1.00 10.25  ? 14  ILE B CG1 1 
ATOM   1256 C CG2 . ILE B 1 16  ? 6.261   -3.788  -6.884  1.00 11.27  ? 14  ILE B CG2 1 
ATOM   1257 C CD1 . ILE B 1 16  ? 4.077   -0.653  -6.371  1.00 12.82  ? 14  ILE B CD1 1 
ATOM   1258 N N   . ASN B 1 17  ? 3.771   -5.672  -6.613  1.00 12.23  ? 15  ASN B N   1 
ATOM   1259 C CA  . ASN B 1 17  ? 3.109   -6.567  -7.553  1.00 12.35  ? 15  ASN B CA  1 
ATOM   1260 C C   . ASN B 1 17  ? 1.627   -6.733  -7.228  1.00 14.16  ? 15  ASN B C   1 
ATOM   1261 O O   . ASN B 1 17  ? 0.793   -6.692  -8.126  1.00 13.12  ? 15  ASN B O   1 
ATOM   1262 C CB  . ASN B 1 17  ? 3.857   -7.902  -7.660  1.00 14.01  ? 15  ASN B CB  1 
ATOM   1263 C CG  . ASN B 1 17  ? 5.221   -7.749  -8.317  1.00 12.34  ? 15  ASN B CG  1 
ATOM   1264 O OD1 . ASN B 1 17  ? 5.487   -6.753  -8.997  1.00 11.45  ? 15  ASN B OD1 1 
ATOM   1265 N ND2 . ASN B 1 17  ? 6.090   -8.743  -8.124  1.00 12.84  ? 15  ASN B ND2 1 
ATOM   1266 N N   . ARG B 1 18  ? 1.290   -6.791  -5.939  1.00 15.02  ? 16  ARG B N   1 
ATOM   1267 C CA  . ARG B 1 18  ? -0.111  -6.839  -5.524  1.00 16.96  ? 16  ARG B CA  1 
ATOM   1268 C C   . ARG B 1 18  ? -0.785  -5.490  -5.817  1.00 15.13  ? 16  ARG B C   1 
ATOM   1269 O O   . ARG B 1 18  ? -1.902  -5.458  -6.338  1.00 17.89  ? 16  ARG B O   1 
ATOM   1270 C CB  . ARG B 1 18  ? -0.210  -7.177  -4.027  1.00 17.35  ? 16  ARG B CB  1 
ATOM   1271 C CG  . ARG B 1 18  ? -1.003  -8.429  -3.702  1.00 31.83  ? 16  ARG B CG  1 
ATOM   1272 C CD  . ARG B 1 18  ? -1.104  -8.655  -2.191  1.00 24.30  ? 16  ARG B CD  1 
ATOM   1273 N NE  . ARG B 1 18  ? -0.164  -9.682  -1.748  1.00 47.73  ? 16  ARG B NE  1 
ATOM   1274 C CZ  . ARG B 1 18  ? 0.981   -9.438  -1.112  1.00 50.20  ? 16  ARG B CZ  1 
ATOM   1275 N NH1 . ARG B 1 18  ? 1.799   -10.442 -0.814  1.00 48.10  ? 16  ARG B NH1 1 
ATOM   1276 N NH2 . ARG B 1 18  ? 1.276   -8.208  -0.706  1.00 45.42  ? 16  ARG B NH2 1 
ATOM   1277 N N   . ALA B 1 19  ? -0.174  -4.404  -5.345  1.00 13.27  ? 17  ALA B N   1 
ATOM   1278 C CA  . ALA B 1 19  ? -0.747  -3.058  -5.451  1.00 13.04  ? 17  ALA B CA  1 
ATOM   1279 C C   . ALA B 1 19  ? -0.997  -2.595  -6.892  1.00 13.37  ? 17  ALA B C   1 
ATOM   1280 O O   . ALA B 1 19  ? -1.773  -1.671  -7.126  1.00 12.70  ? 17  ALA B O   1 
ATOM   1281 C CB  . ALA B 1 19  ? 0.141   -2.041  -4.723  1.00 13.92  ? 17  ALA B CB  1 
ATOM   1282 N N   . THR B 1 20  ? -0.311  -3.198  -7.859  1.00 12.14  ? 18  THR B N   1 
ATOM   1283 C CA  . THR B 1 20  ? -0.399  -2.734  -9.248  1.00 11.94  ? 18  THR B CA  1 
ATOM   1284 C C   . THR B 1 20  ? -0.851  -3.829  -10.223 1.00 12.53  ? 18  THR B C   1 
ATOM   1285 O O   . THR B 1 20  ? -0.788  -3.671  -11.446 1.00 12.42  ? 18  THR B O   1 
ATOM   1286 C CB  . THR B 1 20  ? 0.911   -2.086  -9.730  1.00 10.64  ? 18  THR B CB  1 
ATOM   1287 O OG1 . THR B 1 20  ? 1.955   -3.071  -9.795  1.00 10.52  ? 18  THR B OG1 1 
ATOM   1288 C CG2 . THR B 1 20  ? 1.312   -0.933  -8.801  1.00 10.39  ? 18  THR B CG2 1 
ATOM   1289 N N   . ASN B 1 21  ? -1.331  -4.937  -9.662  1.00 12.58  ? 19  ASN B N   1 
ATOM   1290 C CA  . ASN B 1 21  ? -1.745  -6.075  -10.477 1.00 14.10  ? 19  ASN B CA  1 
ATOM   1291 C C   . ASN B 1 21  ? -2.822  -5.646  -11.477 1.00 14.04  ? 19  ASN B C   1 
ATOM   1292 O O   . ASN B 1 21  ? -3.843  -5.069  -11.090 1.00 13.97  ? 19  ASN B O   1 
ATOM   1293 C CB  . ASN B 1 21  ? -2.290  -7.151  -9.543  1.00 13.65  ? 19  ASN B CB  1 
ATOM   1294 C CG  . ASN B 1 21  ? -2.455  -8.491  -10.213 1.00 16.16  ? 19  ASN B CG  1 
ATOM   1295 O OD1 . ASN B 1 21  ? -2.548  -8.582  -11.438 1.00 19.09  ? 19  ASN B OD1 1 
ATOM   1296 N ND2 . ASN B 1 21  ? -2.780  -9.491  -9.400  1.00 24.24  ? 19  ASN B ND2 1 
ATOM   1297 N N   . PRO B 1 22  ? -2.568  -5.843  -12.780 1.00 15.57  ? 20  PRO B N   1 
ATOM   1298 C CA  . PRO B 1 22  ? -3.580  -5.460  -13.772 1.00 16.13  ? 20  PRO B CA  1 
ATOM   1299 C C   . PRO B 1 22  ? -4.889  -6.262  -13.728 1.00 19.71  ? 20  PRO B C   1 
ATOM   1300 O O   . PRO B 1 22  ? -5.877  -5.864  -14.363 1.00 18.68  ? 20  PRO B O   1 
ATOM   1301 C CB  . PRO B 1 22  ? -2.872  -5.694  -15.109 1.00 17.80  ? 20  PRO B CB  1 
ATOM   1302 C CG  . PRO B 1 22  ? -1.785  -6.667  -14.806 1.00 19.17  ? 20  PRO B CG  1 
ATOM   1303 C CD  . PRO B 1 22  ? -1.335  -6.358  -13.401 1.00 14.48  ? 20  PRO B CD  1 
ATOM   1304 N N   . LEU B 1 23  ? -4.926  -7.313  -12.916 1.00 16.51  ? 21  LEU B N   1 
ATOM   1305 C CA  . LEU B 1 23  ? -6.151  -8.076  -12.692 1.00 21.17  ? 21  LEU B CA  1 
ATOM   1306 C C   . LEU B 1 23  ? -6.976  -7.518  -11.534 1.00 21.62  ? 21  LEU B C   1 
ATOM   1307 O O   . LEU B 1 23  ? -8.114  -7.946  -11.311 1.00 24.96  ? 21  LEU B O   1 
ATOM   1308 C CB  . LEU B 1 23  ? -5.813  -9.533  -12.400 1.00 22.82  ? 21  LEU B CB  1 
ATOM   1309 C CG  . LEU B 1 23  ? -5.134  -10.334 -13.515 1.00 27.27  ? 21  LEU B CG  1 
ATOM   1310 C CD1 . LEU B 1 23  ? -5.060  -11.778 -13.103 1.00 26.63  ? 21  LEU B CD1 1 
ATOM   1311 C CD2 . LEU B 1 23  ? -5.854  -10.176 -14.847 1.00 22.79  ? 21  LEU B CD2 1 
ATOM   1312 N N   . ASN B 1 24  ? -6.394  -6.604  -10.760 1.00 22.70  ? 22  ASN B N   1 
ATOM   1313 C CA  . ASN B 1 24  ? -7.130  -5.984  -9.657  1.00 22.60  ? 22  ASN B CA  1 
ATOM   1314 C C   . ASN B 1 24  ? -8.454  -5.413  -10.153 1.00 21.74  ? 22  ASN B C   1 
ATOM   1315 O O   . ASN B 1 24  ? -8.482  -4.664  -11.131 1.00 21.26  ? 22  ASN B O   1 
ATOM   1316 C CB  . ASN B 1 24  ? -6.321  -4.873  -8.982  1.00 19.99  ? 22  ASN B CB  1 
ATOM   1317 C CG  . ASN B 1 24  ? -5.248  -5.404  -8.049  1.00 17.21  ? 22  ASN B CG  1 
ATOM   1318 O OD1 . ASN B 1 24  ? -5.278  -6.568  -7.635  1.00 20.07  ? 22  ASN B OD1 1 
ATOM   1319 N ND2 . ASN B 1 24  ? -4.335  -4.520  -7.650  1.00 14.81  ? 22  ASN B ND2 1 
ATOM   1320 N N   . LYS B 1 25  ? -9.536  -5.714  -9.443  1.00 29.09  ? 23  LYS B N   1 
ATOM   1321 C CA  . LYS B 1 25  ? -10.851 -5.240  -9.853  1.00 33.48  ? 23  LYS B CA  1 
ATOM   1322 C C   . LYS B 1 25  ? -11.065 -3.776  -9.484  1.00 32.50  ? 23  LYS B C   1 
ATOM   1323 O O   . LYS B 1 25  ? -11.963 -3.125  -10.021 1.00 35.08  ? 23  LYS B O   1 
ATOM   1324 C CB  . LYS B 1 25  ? -11.962 -6.116  -9.270  1.00 34.05  ? 23  LYS B CB  1 
ATOM   1325 C CG  . LYS B 1 25  ? -12.016 -7.503  -9.912  1.00 37.89  ? 23  LYS B CG  1 
ATOM   1326 C CD  . LYS B 1 25  ? -13.064 -8.403  -9.279  1.00 46.67  ? 23  LYS B CD  1 
ATOM   1327 C CE  . LYS B 1 25  ? -13.306 -9.627  -10.149 1.00 57.85  ? 23  LYS B CE  1 
ATOM   1328 N NZ  . LYS B 1 25  ? -14.765 -9.823  -10.415 1.00 66.86  ? 23  LYS B NZ  1 
ATOM   1329 N N   . GLU B 1 26  ? -10.304 -3.305  -8.499  1.00 29.70  ? 24  GLU B N   1 
ATOM   1330 C CA  . GLU B 1 26  ? -10.373 -1.923  -8.023  1.00 30.56  ? 24  GLU B CA  1 
ATOM   1331 C C   . GLU B 1 26  ? -9.120  -1.650  -7.195  1.00 26.79  ? 24  GLU B C   1 
ATOM   1332 O O   . GLU B 1 26  ? -8.330  -2.572  -6.950  1.00 26.40  ? 24  GLU B O   1 
ATOM   1333 C CB  . GLU B 1 26  ? -11.626 -1.708  -7.167  1.00 35.09  ? 24  GLU B CB  1 
ATOM   1334 C CG  . GLU B 1 26  ? -11.611 -2.462  -5.846  1.00 32.91  ? 24  GLU B CG  1 
ATOM   1335 C CD  . GLU B 1 26  ? -12.979 -2.523  -5.192  1.00 43.68  ? 24  GLU B CD  1 
ATOM   1336 O OE1 . GLU B 1 26  ? -13.073 -2.211  -3.988  1.00 43.54  ? 24  GLU B OE1 1 
ATOM   1337 O OE2 . GLU B 1 26  ? -13.945 -2.976  -5.847  1.00 56.98  ? 24  GLU B OE2 1 
ATOM   1338 N N   . LEU B 1 27  ? -8.900  -0.388  -6.831  1.00 24.38  ? 25  LEU B N   1 
ATOM   1339 C CA  . LEU B 1 27  ? -7.682  0.001   -6.125  1.00 22.20  ? 25  LEU B CA  1 
ATOM   1340 C C   . LEU B 1 27  ? -7.561  -0.837  -4.858  1.00 26.00  ? 25  LEU B C   1 
ATOM   1341 O O   . LEU B 1 27  ? -8.562  -1.121  -4.198  1.00 27.55  ? 25  LEU B O   1 
ATOM   1342 C CB  . LEU B 1 27  ? -7.680  1.497   -5.768  1.00 21.07  ? 25  LEU B CB  1 
ATOM   1343 C CG  . LEU B 1 27  ? -7.494  2.512   -6.901  1.00 21.88  ? 25  LEU B CG  1 
ATOM   1344 C CD1 . LEU B 1 27  ? -7.718  3.941   -6.410  1.00 20.75  ? 25  LEU B CD1 1 
ATOM   1345 C CD2 . LEU B 1 27  ? -6.100  2.363   -7.503  1.00 19.40  ? 25  LEU B CD2 1 
ATOM   1346 N N   . ASP B 1 28  ? -6.377  -1.398  -4.640  1.00 25.25  ? 26  ASP B N   1 
ATOM   1347 C CA  . ASP B 1 28  ? -6.147  -2.270  -3.488  1.00 24.66  ? 26  ASP B CA  1 
ATOM   1348 C C   . ASP B 1 28  ? -5.451  -1.507  -2.367  1.00 23.18  ? 26  ASP B C   1 
ATOM   1349 O O   . ASP B 1 28  ? -4.222  -1.424  -2.323  1.00 22.09  ? 26  ASP B O   1 
ATOM   1350 C CB  . ASP B 1 28  ? -5.312  -3.488  -3.897  1.00 22.35  ? 26  ASP B CB  1 
ATOM   1351 C CG  . ASP B 1 28  ? -4.938  -4.371  -2.709  1.00 28.69  ? 26  ASP B CG  1 
ATOM   1352 O OD1 . ASP B 1 28  ? -5.392  -4.104  -1.572  1.00 25.54  ? 26  ASP B OD1 1 
ATOM   1353 O OD2 . ASP B 1 28  ? -4.167  -5.334  -2.914  1.00 32.35  ? 26  ASP B OD2 1 
ATOM   1354 N N   . TRP B 1 29  ? -6.235  -0.875  -1.498  1.00 21.13  ? 27  TRP B N   1 
ATOM   1355 C CA  . TRP B 1 29  ? -5.679  0.189   -0.677  1.00 23.35  ? 27  TRP B CA  1 
ATOM   1356 C C   . TRP B 1 29  ? -4.829  -0.391  0.454   1.00 25.02  ? 27  TRP B C   1 
ATOM   1357 O O   . TRP B 1 29  ? -3.798  0.183   0.815   1.00 24.24  ? 27  TRP B O   1 
ATOM   1358 C CB  . TRP B 1 29  ? -6.789  1.108   -0.150  1.00 23.11  ? 27  TRP B CB  1 
ATOM   1359 C CG  . TRP B 1 29  ? -7.146  2.217   -1.120  1.00 22.50  ? 27  TRP B CG  1 
ATOM   1360 C CD1 . TRP B 1 29  ? -8.297  2.339   -1.848  1.00 28.06  ? 27  TRP B CD1 1 
ATOM   1361 C CD2 . TRP B 1 29  ? -6.292  3.288   -1.549  1.00 21.12  ? 27  TRP B CD2 1 
ATOM   1362 N NE1 . TRP B 1 29  ? -8.237  3.461   -2.653  1.00 22.36  ? 27  TRP B NE1 1 
ATOM   1363 C CE2 . TRP B 1 29  ? -7.006  4.040   -2.510  1.00 18.51  ? 27  TRP B CE2 1 
ATOM   1364 C CE3 . TRP B 1 29  ? -5.007  3.703   -1.190  1.00 21.51  ? 27  TRP B CE3 1 
ATOM   1365 C CZ2 . TRP B 1 29  ? -6.474  5.178   -3.115  1.00 17.61  ? 27  TRP B CZ2 1 
ATOM   1366 C CZ3 . TRP B 1 29  ? -4.501  4.861   -1.757  1.00 18.45  ? 27  TRP B CZ3 1 
ATOM   1367 C CH2 . TRP B 1 29  ? -5.191  5.525   -2.781  1.00 20.23  ? 27  TRP B CH2 1 
ATOM   1368 N N   . ALA B 1 30  ? -5.188  -1.596  0.896   1.00 23.69  ? 28  ALA B N   1 
ATOM   1369 C CA  . ALA B 1 30  ? -4.359  -2.360  1.830   1.00 24.63  ? 28  ALA B CA  1 
ATOM   1370 C C   . ALA B 1 30  ? -2.937  -2.556  1.280   1.00 25.56  ? 28  ALA B C   1 
ATOM   1371 O O   . ALA B 1 30  ? -1.953  -2.331  1.989   1.00 22.66  ? 28  ALA B O   1 
ATOM   1372 C CB  . ALA B 1 30  ? -5.013  -3.709  2.160   1.00 29.64  ? 28  ALA B CB  1 
ATOM   1373 N N   . SER B 1 31  ? -2.829  -2.945  0.011   1.00 22.92  ? 29  SER B N   1 
ATOM   1374 C CA  . SER B 1 31  ? -1.521  -3.178  -0.597  1.00 20.22  ? 29  SER B CA  1 
ATOM   1375 C C   . SER B 1 31  ? -0.768  -1.883  -0.902  1.00 19.26  ? 29  SER B C   1 
ATOM   1376 O O   . SER B 1 31  ? 0.431   -1.783  -0.655  1.00 18.18  ? 29  SER B O   1 
ATOM   1377 C CB  . SER B 1 31  ? -1.650  -4.042  -1.856  1.00 21.22  ? 29  SER B CB  1 
ATOM   1378 O OG  . SER B 1 31  ? -1.977  -5.379  -1.521  1.00 27.98  ? 29  SER B OG  1 
ATOM   1379 N N   . ILE B 1 32  ? -1.495  -0.848  -1.306  1.00 21.27  ? 30  ILE B N   1 
ATOM   1380 C CA  . ILE B 1 32  ? -0.856  0.445   -1.614  1.00 19.38  ? 30  ILE B CA  1 
ATOM   1381 C C   . ILE B 1 32  ? -0.218  1.039   -0.357  1.00 20.29  ? 30  ILE B C   1 
ATOM   1382 O O   . ILE B 1 32  ? 0.975   1.346   -0.324  1.00 18.77  ? 30  ILE B O   1 
ATOM   1383 C CB  . ILE B 1 32  ? -1.868  1.453   -2.223  1.00 19.62  ? 30  ILE B CB  1 
ATOM   1384 C CG1 . ILE B 1 32  ? -2.324  0.989   -3.611  1.00 17.99  ? 30  ILE B CG1 1 
ATOM   1385 C CG2 . ILE B 1 32  ? -1.277  2.867   -2.287  1.00 17.91  ? 30  ILE B CG2 1 
ATOM   1386 C CD1 . ILE B 1 32  ? -3.611  1.664   -4.088  1.00 19.32  ? 30  ILE B CD1 1 
ATOM   1387 N N   . ASN B 1 33  ? -1.017  1.183   0.695   1.00 25.50  ? 31  ASN B N   1 
ATOM   1388 C CA  . ASN B 1 33  ? -0.546  1.758   1.947   1.00 23.93  ? 31  ASN B CA  1 
ATOM   1389 C C   . ASN B 1 33  ? 0.512   0.867   2.617   1.00 25.06  ? 31  ASN B C   1 
ATOM   1390 O O   . ASN B 1 33  ? 1.499   1.362   3.160   1.00 24.55  ? 31  ASN B O   1 
ATOM   1391 C CB  . ASN B 1 33  ? -1.738  2.015   2.891   1.00 26.77  ? 31  ASN B CB  1 
ATOM   1392 C CG  . ASN B 1 33  ? -2.658  3.145   2.406   1.00 27.95  ? 31  ASN B CG  1 
ATOM   1393 O OD1 . ASN B 1 33  ? -3.887  3.031   2.468   1.00 27.70  ? 31  ASN B OD1 1 
ATOM   1394 N ND2 . ASN B 1 33  ? -2.073  4.290   2.091   1.00 26.54  ? 31  ASN B ND2 1 
ATOM   1395 N N   . GLY B 1 34  ? 0.389   -0.446  2.443   1.00 23.06  ? 32  GLY B N   1 
ATOM   1396 C CA  . GLY B 1 34  ? 1.389   -1.384  2.945   1.00 23.88  ? 32  GLY B CA  1 
ATOM   1397 C C   . GLY B 1 34  ? 2.766   -1.203  2.336   1.00 21.12  ? 32  GLY B C   1 
ATOM   1398 O O   . GLY B 1 34  ? 3.779   -1.265  3.039   1.00 22.23  ? 32  GLY B O   1 
ATOM   1399 N N   . PHE B 1 35  ? 2.796   -1.017  1.021   1.00 21.91  ? 33  PHE B N   1 
ATOM   1400 C CA  . PHE B 1 35  ? 4.007   -0.639  0.289   1.00 19.53  ? 33  PHE B CA  1 
ATOM   1401 C C   . PHE B 1 35  ? 4.688   0.608   0.848   1.00 19.27  ? 33  PHE B C   1 
ATOM   1402 O O   . PHE B 1 35  ? 5.884   0.587   1.125   1.00 20.14  ? 33  PHE B O   1 
ATOM   1403 C CB  . PHE B 1 35  ? 3.715   -0.447  -1.203  1.00 17.68  ? 33  PHE B CB  1 
ATOM   1404 C CG  . PHE B 1 35  ? 4.937   -0.115  -2.018  1.00 14.94  ? 33  PHE B CG  1 
ATOM   1405 C CD1 . PHE B 1 35  ? 5.232   1.201   -2.350  1.00 16.80  ? 33  PHE B CD1 1 
ATOM   1406 C CD2 . PHE B 1 35  ? 5.728   -1.125  -2.553  1.00 18.29  ? 33  PHE B CD2 1 
ATOM   1407 C CE1 . PHE B 1 35  ? 6.363   1.515   -3.100  1.00 15.27  ? 33  PHE B CE1 1 
ATOM   1408 C CE2 . PHE B 1 35  ? 6.868   -0.827  -3.286  1.00 15.66  ? 33  PHE B CE2 1 
ATOM   1409 C CZ  . PHE B 1 35  ? 7.132   0.484   -3.660  1.00 13.93  ? 33  PHE B CZ  1 
ATOM   1410 N N   . CYS B 1 36  ? 3.946   1.701   0.998   1.00 20.90  ? 34  CYS B N   1 
ATOM   1411 C CA  . CYS B 1 36  ? 4.548   2.930   1.517   1.00 20.77  ? 34  CYS B CA  1 
ATOM   1412 C C   . CYS B 1 36  ? 5.090   2.763   2.935   1.00 21.88  ? 34  CYS B C   1 
ATOM   1413 O O   . CYS B 1 36  ? 6.176   3.258   3.255   1.00 23.35  ? 34  CYS B O   1 
ATOM   1414 C CB  . CYS B 1 36  ? 3.571   4.108   1.453   1.00 21.02  ? 34  CYS B CB  1 
ATOM   1415 S SG  . CYS B 1 36  ? 2.933   4.487   -0.195  1.00 24.02  ? 34  CYS B SG  1 
ATOM   1416 N N   . GLU B 1 37  ? 4.361   2.014   3.758   1.00 27.22  ? 35  GLU B N   1 
ATOM   1417 C CA  . GLU B 1 37  ? 4.784   1.732   5.127   1.00 31.59  ? 35  GLU B CA  1 
ATOM   1418 C C   . GLU B 1 37  ? 6.076   0.927   5.199   1.00 32.21  ? 35  GLU B C   1 
ATOM   1419 O O   . GLU B 1 37  ? 6.950   1.208   6.020   1.00 34.83  ? 35  GLU B O   1 
ATOM   1420 C CB  . GLU B 1 37  ? 3.662   1.037   5.895   1.00 34.09  ? 35  GLU B CB  1 
ATOM   1421 C CG  . GLU B 1 37  ? 2.643   2.011   6.463   1.00 43.01  ? 35  GLU B CG  1 
ATOM   1422 C CD  . GLU B 1 37  ? 1.242   1.433   6.567   1.00 56.11  ? 35  GLU B CD  1 
ATOM   1423 O OE1 . GLU B 1 37  ? 1.103   0.193   6.673   1.00 55.30  ? 35  GLU B OE1 1 
ATOM   1424 O OE2 . GLU B 1 37  ? 0.281   2.234   6.631   1.00 58.12  ? 35  GLU B OE2 1 
ATOM   1425 N N   . GLN B 1 38  ? 6.222   -0.051  4.311   1.00 28.58  ? 36  GLN B N   1 
ATOM   1426 C CA  . GLN B 1 38  ? 7.401   -0.907  4.329   1.00 28.34  ? 36  GLN B CA  1 
ATOM   1427 C C   . GLN B 1 38  ? 8.662   -0.239  3.771   1.00 28.84  ? 36  GLN B C   1 
ATOM   1428 O O   . GLN B 1 38  ? 9.767   -0.551  4.214   1.00 27.46  ? 36  GLN B O   1 
ATOM   1429 C CB  . GLN B 1 38  ? 7.113   -2.214  3.585   1.00 29.89  ? 36  GLN B CB  1 
ATOM   1430 C CG  . GLN B 1 38  ? 8.353   -2.891  3.028   1.00 29.92  ? 36  GLN B CG  1 
ATOM   1431 C CD  . GLN B 1 38  ? 8.762   -4.112  3.813   1.00 41.22  ? 36  GLN B CD  1 
ATOM   1432 O OE1 . GLN B 1 38  ? 8.391   -4.272  4.982   1.00 40.90  ? 36  GLN B OE1 1 
ATOM   1433 N NE2 . GLN B 1 38  ? 9.476   -5.023  3.150   1.00 46.85  ? 36  GLN B NE2 1 
ATOM   1434 N N   . LEU B 1 39  ? 8.536   0.636   2.772   1.00 29.51  ? 37  LEU B N   1 
ATOM   1435 C CA  . LEU B 1 39  ? 9.748   1.208   2.181   1.00 29.34  ? 37  LEU B CA  1 
ATOM   1436 C C   . LEU B 1 39  ? 10.462  2.081   3.214   1.00 36.72  ? 37  LEU B C   1 
ATOM   1437 O O   . LEU B 1 39  ? 11.683  2.249   3.170   1.00 37.98  ? 37  LEU B O   1 
ATOM   1438 C CB  . LEU B 1 39  ? 9.478   1.975   0.877   1.00 28.73  ? 37  LEU B CB  1 
ATOM   1439 C CG  . LEU B 1 39  ? 9.007   3.429   0.934   1.00 23.57  ? 37  LEU B CG  1 
ATOM   1440 C CD1 . LEU B 1 39  ? 10.137  4.393   1.286   1.00 26.47  ? 37  LEU B CD1 1 
ATOM   1441 C CD2 . LEU B 1 39  ? 8.366   3.813   -0.393  1.00 22.63  ? 37  LEU B CD2 1 
ATOM   1442 N N   . ASN B 1 40  ? 9.677   2.626   4.137   1.00 42.08  ? 38  ASN B N   1 
ATOM   1443 C CA  . ASN B 1 40  ? 10.192  3.112   5.410   1.00 53.99  ? 38  ASN B CA  1 
ATOM   1444 C C   . ASN B 1 40  ? 10.479  1.925   6.327   1.00 57.45  ? 38  ASN B C   1 
ATOM   1445 O O   . ASN B 1 40  ? 9.669   1.604   7.200   1.00 59.68  ? 38  ASN B O   1 
ATOM   1446 C CB  . ASN B 1 40  ? 9.175   4.047   6.074   1.00 54.17  ? 38  ASN B CB  1 
ATOM   1447 C CG  . ASN B 1 40  ? 8.849   5.263   5.220   1.00 60.15  ? 38  ASN B CG  1 
ATOM   1448 O OD1 . ASN B 1 40  ? 7.701   5.713   5.166   1.00 57.33  ? 38  ASN B OD1 1 
ATOM   1449 N ND2 . ASN B 1 40  ? 9.870   5.824   4.578   1.00 60.29  ? 38  ASN B ND2 1 
ATOM   1450 N N   . GLU B 1 41  ? 11.471  1.136   5.924   1.00 67.50  ? 39  GLU B N   1 
ATOM   1451 C CA  . GLU B 1 41  ? 12.302  0.370   6.839   1.00 72.61  ? 39  GLU B CA  1 
ATOM   1452 C C   . GLU B 1 41  ? 13.438  -0.270  6.064   1.00 73.86  ? 39  GLU B C   1 
ATOM   1453 O O   . GLU B 1 41  ? 13.299  -1.360  5.501   1.00 77.22  ? 39  GLU B O   1 
ATOM   1454 C CB  . GLU B 1 41  ? 11.491  -0.714  7.545   1.00 71.89  ? 39  GLU B CB  1 
ATOM   1455 C CG  . GLU B 1 41  ? 10.322  -0.146  8.310   1.00 76.76  ? 39  GLU B CG  1 
ATOM   1456 C CD  . GLU B 1 41  ? 9.113   -1.043  8.261   1.00 81.17  ? 39  GLU B CD  1 
ATOM   1457 O OE1 . GLU B 1 41  ? 8.062   -0.637  8.796   1.00 84.14  ? 39  GLU B OE1 1 
ATOM   1458 O OE2 . GLU B 1 41  ? 9.228   -2.168  7.729   1.00 83.99  ? 39  GLU B OE2 1 
ATOM   1459 N N   . ASP B 1 42  ? 14.492  0.513   5.890   1.00 71.61  ? 40  ASP B N   1 
ATOM   1460 C CA  . ASP B 1 42  ? 15.692  0.074   5.209   1.00 72.76  ? 40  ASP B CA  1 
ATOM   1461 C C   . ASP B 1 42  ? 16.471  1.365   5.090   1.00 73.23  ? 40  ASP B C   1 
ATOM   1462 O O   . ASP B 1 42  ? 15.930  2.441   5.349   1.00 73.88  ? 40  ASP B O   1 
ATOM   1463 C CB  . ASP B 1 42  ? 15.336  -0.448  3.813   1.00 71.31  ? 40  ASP B CB  1 
ATOM   1464 C CG  . ASP B 1 42  ? 16.071  -1.732  3.455   1.00 70.68  ? 40  ASP B CG  1 
ATOM   1465 O OD1 . ASP B 1 42  ? 17.163  -1.983  4.010   1.00 65.69  ? 40  ASP B OD1 1 
ATOM   1466 O OD2 . ASP B 1 42  ? 15.590  -2.451  2.551   1.00 74.71  ? 40  ASP B OD2 1 
ATOM   1467 N N   . PHE B 1 43  ? 17.712  1.276   4.628   1.00 78.10  ? 41  PHE B N   1 
ATOM   1468 C CA  . PHE B 1 43  ? 18.304  2.446   3.982   1.00 74.29  ? 41  PHE B CA  1 
ATOM   1469 C C   . PHE B 1 43  ? 18.274  2.216   2.483   1.00 70.09  ? 41  PHE B C   1 
ATOM   1470 O O   . PHE B 1 43  ? 18.340  3.165   1.695   1.00 69.33  ? 41  PHE B O   1 
ATOM   1471 C CB  . PHE B 1 43  ? 19.711  2.743   4.501   1.00 77.12  ? 41  PHE B CB  1 
ATOM   1472 C CG  . PHE B 1 43  ? 19.728  3.781   5.582   1.00 79.69  ? 41  PHE B CG  1 
ATOM   1473 C CD1 . PHE B 1 43  ? 20.214  5.050   5.317   1.00 83.76  ? 41  PHE B CD1 1 
ATOM   1474 C CD2 . PHE B 1 43  ? 18.959  3.596   6.722   1.00 82.72  ? 41  PHE B CD2 1 
ATOM   1475 C CE1 . PHE B 1 43  ? 20.075  6.067   6.243   1.00 83.84  ? 41  PHE B CE1 1 
ATOM   1476 C CE2 . PHE B 1 43  ? 18.818  4.605   7.655   1.00 82.24  ? 41  PHE B CE2 1 
ATOM   1477 C CZ  . PHE B 1 43  ? 19.377  5.842   7.415   1.00 82.33  ? 41  PHE B CZ  1 
ATOM   1478 N N   . GLU B 1 44  ? 17.909  0.992   2.114   1.00 48.43  ? 42  GLU B N   1 
ATOM   1479 C CA  . GLU B 1 44  ? 17.813  0.650   0.708   1.00 45.00  ? 42  GLU B CA  1 
ATOM   1480 C C   . GLU B 1 44  ? 16.378  0.648   0.187   1.00 37.44  ? 42  GLU B C   1 
ATOM   1481 O O   . GLU B 1 44  ? 16.163  0.547   -1.019  1.00 33.52  ? 42  GLU B O   1 
ATOM   1482 C CB  . GLU B 1 44  ? 18.520  -0.677  0.425   1.00 47.99  ? 42  GLU B CB  1 
ATOM   1483 C CG  . GLU B 1 44  ? 20.018  -0.639  0.701   1.00 55.62  ? 42  GLU B CG  1 
ATOM   1484 C CD  . GLU B 1 44  ? 20.358  -1.107  2.102   1.00 65.21  ? 42  GLU B CD  1 
ATOM   1485 O OE1 . GLU B 1 44  ? 20.934  -0.313  2.879   1.00 74.89  ? 42  GLU B OE1 1 
ATOM   1486 O OE2 . GLU B 1 44  ? 20.044  -2.273  2.428   1.00 67.42  ? 42  GLU B OE2 1 
ATOM   1487 N N   . GLY B 1 45  ? 15.414  0.867   1.079   1.00 29.95  ? 43  GLY B N   1 
ATOM   1488 C CA  . GLY B 1 45  ? 14.006  0.918   0.689   1.00 24.78  ? 43  GLY B CA  1 
ATOM   1489 C C   . GLY B 1 45  ? 13.703  1.951   -0.381  1.00 20.85  ? 43  GLY B C   1 
ATOM   1490 O O   . GLY B 1 45  ? 13.186  1.620   -1.449  1.00 18.14  ? 43  GLY B O   1 
ATOM   1491 N N   . PRO B 1 46  ? 13.981  3.231   -0.094  1.00 17.73  ? 44  PRO B N   1 
ATOM   1492 C CA  . PRO B 1 46  ? 13.585  4.257   -1.058  1.00 15.91  ? 44  PRO B CA  1 
ATOM   1493 C C   . PRO B 1 46  ? 14.128  4.044   -2.484  1.00 16.14  ? 44  PRO B C   1 
ATOM   1494 O O   . PRO B 1 46  ? 13.365  4.131   -3.443  1.00 14.77  ? 44  PRO B O   1 
ATOM   1495 C CB  . PRO B 1 46  ? 14.112  5.543   -0.424  1.00 17.80  ? 44  PRO B CB  1 
ATOM   1496 C CG  . PRO B 1 46  ? 14.035  5.267   1.060   1.00 18.70  ? 44  PRO B CG  1 
ATOM   1497 C CD  . PRO B 1 46  ? 14.380  3.803   1.207   1.00 19.65  ? 44  PRO B CD  1 
ATOM   1498 N N   . PRO B 1 47  ? 15.441  3.793   -2.644  1.00 16.16  ? 45  PRO B N   1 
ATOM   1499 C CA  . PRO B 1 47  ? 15.957  3.641   -4.013  1.00 15.76  ? 45  PRO B CA  1 
ATOM   1500 C C   . PRO B 1 47  ? 15.409  2.411   -4.754  1.00 14.38  ? 45  PRO B C   1 
ATOM   1501 O O   . PRO B 1 47  ? 15.174  2.458   -5.960  1.00 15.82  ? 45  PRO B O   1 
ATOM   1502 C CB  . PRO B 1 47  ? 17.469  3.502   -3.815  1.00 19.44  ? 45  PRO B CB  1 
ATOM   1503 C CG  . PRO B 1 47  ? 17.750  3.999   -2.428  1.00 20.16  ? 45  PRO B CG  1 
ATOM   1504 C CD  . PRO B 1 47  ? 16.509  3.845   -1.626  1.00 18.11  ? 45  PRO B CD  1 
ATOM   1505 N N   . LEU B 1 48  ? 15.143  1.334   -4.028  1.00 14.15  ? 46  LEU B N   1 
ATOM   1506 C CA  . LEU B 1 48  ? 14.470  0.179   -4.615  1.00 14.65  ? 46  LEU B CA  1 
ATOM   1507 C C   . LEU B 1 48  ? 13.021  0.497   -5.026  1.00 13.87  ? 46  LEU B C   1 
ATOM   1508 O O   . LEU B 1 48  ? 12.555  0.107   -6.108  1.00 10.97  ? 46  LEU B O   1 
ATOM   1509 C CB  . LEU B 1 48  ? 14.513  -0.982  -3.611  1.00 13.83  ? 46  LEU B CB  1 
ATOM   1510 C CG  . LEU B 1 48  ? 13.835  -2.287  -4.024  1.00 16.35  ? 46  LEU B CG  1 
ATOM   1511 C CD1 . LEU B 1 48  ? 14.271  -2.752  -5.394  1.00 18.92  ? 46  LEU B CD1 1 
ATOM   1512 C CD2 . LEU B 1 48  ? 14.109  -3.370  -2.990  1.00 17.26  ? 46  LEU B CD2 1 
ATOM   1513 N N   . ALA B 1 49  ? 12.318  1.225   -4.161  1.00 11.88  ? 47  ALA B N   1 
ATOM   1514 C CA  . ALA B 1 49  ? 10.933  1.624   -4.418  1.00 11.07  ? 47  ALA B CA  1 
ATOM   1515 C C   . ALA B 1 49  ? 10.769  2.417   -5.719  1.00 9.77   ? 47  ALA B C   1 
ATOM   1516 O O   . ALA B 1 49  ? 9.861   2.163   -6.530  1.00 9.09   ? 47  ALA B O   1 
ATOM   1517 C CB  . ALA B 1 49  ? 10.379  2.420   -3.241  1.00 11.45  ? 47  ALA B CB  1 
ATOM   1518 N N   . THR B 1 50  ? 11.666  3.372   -5.933  1.00 10.40  ? 48  THR B N   1 
ATOM   1519 C CA  . THR B 1 50  ? 11.590  4.185   -7.140  1.00 9.69   ? 48  THR B CA  1 
ATOM   1520 C C   . THR B 1 50  ? 11.855  3.372   -8.415  1.00 9.25   ? 48  THR B C   1 
ATOM   1521 O O   . THR B 1 50  ? 11.211  3.603   -9.437  1.00 8.00   ? 48  THR B O   1 
ATOM   1522 C CB  . THR B 1 50  ? 12.488  5.451   -7.065  1.00 10.43  ? 48  THR B CB  1 
ATOM   1523 O OG1 . THR B 1 50  ? 13.841  5.083   -6.780  1.00 11.36  ? 48  THR B OG1 1 
ATOM   1524 C CG2 . THR B 1 50  ? 11.993  6.392   -5.964  1.00 10.39  ? 48  THR B CG2 1 
ATOM   1525 N N   . ARG B 1 51  ? 12.808  2.444   -8.354  1.00 10.41  ? 49  ARG B N   1 
ATOM   1526 C CA  . ARG B 1 51  ? 13.133  1.609   -9.507  1.00 10.69  ? 49  ARG B CA  1 
ATOM   1527 C C   . ARG B 1 51  ? 11.947  0.726   -9.871  1.00 9.02   ? 49  ARG B C   1 
ATOM   1528 O O   . ARG B 1 51  ? 11.618  0.547   -11.037 1.00 10.29  ? 49  ARG B O   1 
ATOM   1529 C CB  . ARG B 1 51  ? 14.363  0.738   -9.221  1.00 11.52  ? 49  ARG B CB  1 
ATOM   1530 C CG  . ARG B 1 51  ? 15.679  1.487   -9.389  1.00 18.15  ? 49  ARG B CG  1 
ATOM   1531 C CD  . ARG B 1 51  ? 16.896  0.593   -9.164  1.00 23.04  ? 49  ARG B CD  1 
ATOM   1532 N NE  . ARG B 1 51  ? 16.650  -0.792  -9.565  1.00 35.78  ? 49  ARG B NE  1 
ATOM   1533 C CZ  . ARG B 1 51  ? 16.742  -1.840  -8.752  1.00 40.01  ? 49  ARG B CZ  1 
ATOM   1534 N NH1 . ARG B 1 51  ? 16.566  -3.064  -9.231  1.00 47.72  ? 49  ARG B NH1 1 
ATOM   1535 N NH2 . ARG B 1 51  ? 17.037  -1.673  -7.468  1.00 49.25  ? 49  ARG B NH2 1 
ATOM   1536 N N   . LEU B 1 52  ? 11.313  0.170   -8.847  1.00 8.59   ? 50  LEU B N   1 
ATOM   1537 C CA  . LEU B 1 52  ? 10.147  -0.684  -9.060  1.00 8.68   ? 50  LEU B CA  1 
ATOM   1538 C C   . LEU B 1 52  ? 8.981   0.105   -9.650  1.00 8.62   ? 50  LEU B C   1 
ATOM   1539 O O   . LEU B 1 52  ? 8.300   -0.351  -10.584 1.00 8.02   ? 50  LEU B O   1 
ATOM   1540 C CB  . LEU B 1 52  ? 9.728   -1.293  -7.712  1.00 9.87   ? 50  LEU B CB  1 
ATOM   1541 C CG  . LEU B 1 52  ? 10.709  -2.331  -7.154  1.00 11.19  ? 50  LEU B CG  1 
ATOM   1542 C CD1 . LEU B 1 52  ? 10.293  -2.745  -5.765  1.00 11.70  ? 50  LEU B CD1 1 
ATOM   1543 C CD2 . LEU B 1 52  ? 10.709  -3.564  -8.073  1.00 10.99  ? 50  LEU B CD2 1 
ATOM   1544 N N   . LEU B 1 53  ? 8.726   1.273   -9.067  1.00 9.09   ? 51  LEU B N   1 
ATOM   1545 C CA  . LEU B 1 53  ? 7.674   2.157   -9.546  1.00 7.70   ? 51  LEU B CA  1 
ATOM   1546 C C   . LEU B 1 53  ? 7.886   2.581   -10.995 1.00 7.35   ? 51  LEU B C   1 
ATOM   1547 O O   . LEU B 1 53  ? 6.943   2.566   -11.776 1.00 7.46   ? 51  LEU B O   1 
ATOM   1548 C CB  . LEU B 1 53  ? 7.516   3.387   -8.649  1.00 8.81   ? 51  LEU B CB  1 
ATOM   1549 C CG  . LEU B 1 53  ? 6.822   3.099   -7.314  1.00 7.72   ? 51  LEU B CG  1 
ATOM   1550 C CD1 . LEU B 1 53  ? 7.019   4.233   -6.286  1.00 8.06   ? 51  LEU B CD1 1 
ATOM   1551 C CD2 . LEU B 1 53  ? 5.334   2.797   -7.551  1.00 9.06   ? 51  LEU B CD2 1 
ATOM   1552 N N   . ALA B 1 54  ? 9.109   2.975   -11.342 1.00 7.94   ? 52  ALA B N   1 
ATOM   1553 C CA  . ALA B 1 54  ? 9.370   3.492   -12.683 1.00 7.31   ? 52  ALA B CA  1 
ATOM   1554 C C   . ALA B 1 54  ? 8.930   2.460   -13.716 1.00 8.22   ? 52  ALA B C   1 
ATOM   1555 O O   . ALA B 1 54  ? 8.365   2.805   -14.766 1.00 7.21   ? 52  ALA B O   1 
ATOM   1556 C CB  . ALA B 1 54  ? 10.869  3.805   -12.841 1.00 7.41   ? 52  ALA B CB  1 
ATOM   1557 N N   . HIS B 1 55  ? 9.301   1.203   -13.461 1.00 6.57   ? 53  HIS B N   1 
ATOM   1558 C CA  . HIS B 1 55  ? 8.969   0.154   -14.400 1.00 6.89   ? 53  HIS B CA  1 
ATOM   1559 C C   . HIS B 1 55  ? 7.462   -0.038  -14.532 1.00 7.10   ? 53  HIS B C   1 
ATOM   1560 O O   . HIS B 1 55  ? 6.961   -0.172  -15.639 1.00 7.32   ? 53  HIS B O   1 
ATOM   1561 C CB  . HIS B 1 55  ? 9.687   -1.147  -14.034 1.00 7.33   ? 53  HIS B CB  1 
ATOM   1562 C CG  . HIS B 1 55  ? 9.433   -2.260  -15.001 1.00 7.57   ? 53  HIS B CG  1 
ATOM   1563 N ND1 . HIS B 1 55  ? 8.754   -3.412  -14.662 1.00 8.24   ? 53  HIS B ND1 1 
ATOM   1564 C CD2 . HIS B 1 55  ? 9.814   -2.412  -16.290 1.00 8.01   ? 53  HIS B CD2 1 
ATOM   1565 C CE1 . HIS B 1 55  ? 8.666   -4.192  -15.726 1.00 8.46   ? 53  HIS B CE1 1 
ATOM   1566 N NE2 . HIS B 1 55  ? 9.342   -3.630  -16.712 1.00 8.48   ? 53  HIS B NE2 1 
ATOM   1567 N N   . LYS B 1 56  ? 6.727   -0.036  -13.426 1.00 7.99   ? 54  LYS B N   1 
ATOM   1568 C CA  . LYS B 1 56  ? 5.272   -0.214  -13.495 1.00 8.82   ? 54  LYS B CA  1 
ATOM   1569 C C   . LYS B 1 56  ? 4.579   0.964   -14.210 1.00 7.75   ? 54  LYS B C   1 
ATOM   1570 O O   . LYS B 1 56  ? 3.665   0.782   -15.011 1.00 7.80   ? 54  LYS B O   1 
ATOM   1571 C CB  . LYS B 1 56  ? 4.703   -0.376  -12.080 1.00 8.90   ? 54  LYS B CB  1 
ATOM   1572 C CG  . LYS B 1 56  ? 5.264   -1.569  -11.292 1.00 9.21   ? 54  LYS B CG  1 
ATOM   1573 C CD  . LYS B 1 56  ? 4.727   -2.891  -11.791 1.00 10.65  ? 54  LYS B CD  1 
ATOM   1574 C CE  . LYS B 1 56  ? 5.160   -3.999  -10.836 1.00 11.16  ? 54  LYS B CE  1 
ATOM   1575 N NZ  . LYS B 1 56  ? 4.870   -5.343  -11.394 1.00 11.85  ? 54  LYS B NZ  1 
ATOM   1576 N N   . ILE B 1 57  ? 5.087   2.173   -13.994 1.00 10.27  ? 55  ILE B N   1 
ATOM   1577 C CA  . ILE B 1 57  ? 4.514   3.348   -14.639 1.00 11.58  ? 55  ILE B CA  1 
ATOM   1578 C C   . ILE B 1 57  ? 4.701   3.329   -16.160 1.00 9.81   ? 55  ILE B C   1 
ATOM   1579 O O   . ILE B 1 57  ? 3.908   3.900   -16.903 1.00 10.06  ? 55  ILE B O   1 
ATOM   1580 C CB  . ILE B 1 57  ? 5.116   4.636   -14.013 1.00 9.91   ? 55  ILE B CB  1 
ATOM   1581 C CG1 . ILE B 1 57  ? 4.642   4.753   -12.555 1.00 10.42  ? 55  ILE B CG1 1 
ATOM   1582 C CG2 . ILE B 1 57  ? 4.719   5.866   -14.819 1.00 10.12  ? 55  ILE B CG2 1 
ATOM   1583 C CD1 . ILE B 1 57  ? 5.452   5.753   -11.730 1.00 9.93   ? 55  ILE B CD1 1 
ATOM   1584 N N   . GLN B 1 58  ? 5.756   2.672   -16.630 1.00 9.40   ? 56  GLN B N   1 
ATOM   1585 C CA  . GLN B 1 58  ? 5.966   2.476   -18.066 1.00 9.80   ? 56  GLN B CA  1 
ATOM   1586 C C   . GLN B 1 58  ? 5.221   1.279   -18.692 1.00 10.31  ? 56  GLN B C   1 
ATOM   1587 O O   . GLN B 1 58  ? 5.445   0.950   -19.860 1.00 10.85  ? 56  GLN B O   1 
ATOM   1588 C CB  . GLN B 1 58  ? 7.469   2.393   -18.344 1.00 10.22  ? 56  GLN B CB  1 
ATOM   1589 C CG  . GLN B 1 58  ? 8.180   3.694   -17.962 1.00 10.86  ? 56  GLN B CG  1 
ATOM   1590 C CD  . GLN B 1 58  ? 9.693   3.627   -17.934 1.00 13.96  ? 56  GLN B CD  1 
ATOM   1591 O OE1 . GLN B 1 58  ? 10.379  4.673   -17.964 1.00 17.21  ? 56  GLN B OE1 1 
ATOM   1592 N NE2 . GLN B 1 58  ? 10.214  2.435   -18.140 1.00 11.29  ? 56  GLN B NE2 1 
ATOM   1593 N N   . SER B 1 59  ? 4.319   0.645   -17.945 1.00 10.77  ? 57  SER B N   1 
ATOM   1594 C CA  . SER B 1 59  ? 3.625   -0.547  -18.470 1.00 9.50   ? 57  SER B CA  1 
ATOM   1595 C C   . SER B 1 59  ? 2.772   -0.156  -19.681 1.00 12.19  ? 57  SER B C   1 
ATOM   1596 O O   . SER B 1 59  ? 2.066   0.853   -19.628 1.00 12.97  ? 57  SER B O   1 
ATOM   1597 C CB  . SER B 1 59  ? 2.693   -1.159  -17.422 1.00 11.57  ? 57  SER B CB  1 
ATOM   1598 O OG  . SER B 1 59  ? 2.006   -2.284  -17.956 1.00 10.85  ? 57  SER B OG  1 
ATOM   1599 N N   . PRO B 1 60  ? 2.734   -1.016  -20.714 1.00 11.01  ? 58  PRO B N   1 
ATOM   1600 C CA  . PRO B 1 60  ? 1.772   -0.874  -21.814 1.00 11.76  ? 58  PRO B CA  1 
ATOM   1601 C C   . PRO B 1 60  ? 0.333   -1.087  -21.346 1.00 13.01  ? 58  PRO B C   1 
ATOM   1602 O O   . PRO B 1 60  ? -0.611  -0.642  -22.008 1.00 13.36  ? 58  PRO B O   1 
ATOM   1603 C CB  . PRO B 1 60  ? 2.182   -1.984  -22.792 1.00 16.46  ? 58  PRO B CB  1 
ATOM   1604 C CG  . PRO B 1 60  ? 3.602   -2.316  -22.440 1.00 13.67  ? 58  PRO B CG  1 
ATOM   1605 C CD  . PRO B 1 60  ? 3.667   -2.131  -20.941 1.00 10.59  ? 58  PRO B CD  1 
ATOM   1606 N N   . GLN B 1 61  ? 0.174   -1.718  -20.188 1.00 12.87  ? 59  GLN B N   1 
ATOM   1607 C CA  . GLN B 1 61  ? -1.160  -1.954  -19.638 1.00 13.61  ? 59  GLN B CA  1 
ATOM   1608 C C   . GLN B 1 61  ? -1.601  -0.775  -18.758 1.00 12.88  ? 59  GLN B C   1 
ATOM   1609 O O   . GLN B 1 61  ? -1.048  -0.573  -17.669 1.00 11.97  ? 59  GLN B O   1 
ATOM   1610 C CB  . GLN B 1 61  ? -1.173  -3.282  -18.862 1.00 13.45  ? 59  GLN B CB  1 
ATOM   1611 C CG  . GLN B 1 61  ? -0.961  -4.525  -19.748 1.00 19.23  ? 59  GLN B CG  1 
ATOM   1612 C CD  . GLN B 1 61  ? -0.456  -5.775  -18.999 1.00 17.78  ? 59  GLN B CD  1 
ATOM   1613 O OE1 . GLN B 1 61  ? -1.168  -6.348  -18.198 1.00 21.58  ? 59  GLN B OE1 1 
ATOM   1614 N NE2 . GLN B 1 61  ? 0.771   -6.204  -19.291 1.00 29.81  ? 59  GLN B NE2 1 
ATOM   1615 N N   . GLU B 1 62  ? -2.566  0.017   -19.237 1.00 13.73  ? 60  GLU B N   1 
ATOM   1616 C CA  . GLU B 1 62  ? -2.902  1.290   -18.571 1.00 13.71  ? 60  GLU B CA  1 
ATOM   1617 C C   . GLU B 1 62  ? -3.216  1.163   -17.080 1.00 13.39  ? 60  GLU B C   1 
ATOM   1618 O O   . GLU B 1 62  ? -2.787  2.006   -16.287 1.00 13.38  ? 60  GLU B O   1 
ATOM   1619 C CB  . GLU B 1 62  ? -3.991  2.073   -19.320 1.00 14.64  ? 60  GLU B CB  1 
ATOM   1620 C CG  . GLU B 1 62  ? -4.382  3.415   -18.701 1.00 15.43  ? 60  GLU B CG  1 
ATOM   1621 C CD  . GLU B 1 62  ? -5.699  3.974   -19.231 1.00 20.98  ? 60  GLU B CD  1 
ATOM   1622 O OE1 . GLU B 1 62  ? -6.784  3.424   -18.924 1.00 26.81  ? 60  GLU B OE1 1 
ATOM   1623 O OE2 . GLU B 1 62  ? -5.676  5.055   -19.852 1.00 23.85  ? 60  GLU B OE2 1 
ATOM   1624 N N   . TRP B 1 63  ? -4.056  0.188   -16.725 1.00 13.00  ? 61  TRP B N   1 
ATOM   1625 C CA  . TRP B 1 63  ? -4.460  -0.028  -15.334 1.00 13.88  ? 61  TRP B CA  1 
ATOM   1626 C C   . TRP B 1 63  ? -3.286  -0.354  -14.401 1.00 12.18  ? 61  TRP B C   1 
ATOM   1627 O O   . TRP B 1 63  ? -3.263  0.084   -13.250 1.00 13.14  ? 61  TRP B O   1 
ATOM   1628 C CB  . TRP B 1 63  ? -5.577  -1.079  -15.266 1.00 14.19  ? 61  TRP B CB  1 
ATOM   1629 C CG  . TRP B 1 63  ? -6.112  -1.432  -13.901 1.00 16.33  ? 61  TRP B CG  1 
ATOM   1630 C CD1 . TRP B 1 63  ? -6.358  -2.690  -13.427 1.00 18.06  ? 61  TRP B CD1 1 
ATOM   1631 C CD2 . TRP B 1 63  ? -6.577  -0.528  -12.884 1.00 17.72  ? 61  TRP B CD2 1 
ATOM   1632 N NE1 . TRP B 1 63  ? -6.852  -2.623  -12.145 1.00 18.26  ? 61  TRP B NE1 1 
ATOM   1633 C CE2 . TRP B 1 63  ? -7.120  -1.315  -11.843 1.00 18.95  ? 61  TRP B CE2 1 
ATOM   1634 C CE3 . TRP B 1 63  ? -6.622  0.865   -12.769 1.00 18.12  ? 61  TRP B CE3 1 
ATOM   1635 C CZ2 . TRP B 1 63  ? -7.688  -0.756  -10.694 1.00 20.13  ? 61  TRP B CZ2 1 
ATOM   1636 C CZ3 . TRP B 1 63  ? -7.263  1.418   -11.673 1.00 18.30  ? 61  TRP B CZ3 1 
ATOM   1637 C CH2 . TRP B 1 63  ? -7.743  0.612   -10.626 1.00 20.75  ? 61  TRP B CH2 1 
ATOM   1638 N N   . GLU B 1 64  ? -2.298  -1.094  -14.899 1.00 12.84  ? 62  GLU B N   1 
ATOM   1639 C CA  . GLU B 1 64  ? -1.044  -1.277  -14.166 1.00 12.56  ? 62  GLU B CA  1 
ATOM   1640 C C   . GLU B 1 64  ? -0.354  0.067   -13.902 1.00 11.47  ? 62  GLU B C   1 
ATOM   1641 O O   . GLU B 1 64  ? 0.006   0.356   -12.759 1.00 11.59  ? 62  GLU B O   1 
ATOM   1642 C CB  . GLU B 1 64  ? -0.104  -2.245  -14.914 1.00 11.15  ? 62  GLU B CB  1 
ATOM   1643 C CG  . GLU B 1 64  ? 1.209   -2.532  -14.164 1.00 12.43  ? 62  GLU B CG  1 
ATOM   1644 C CD  . GLU B 1 64  ? 1.930   -3.767  -14.698 1.00 14.90  ? 62  GLU B CD  1 
ATOM   1645 O OE1 . GLU B 1 64  ? 1.833   -4.817  -14.037 1.00 20.03  ? 62  GLU B OE1 1 
ATOM   1646 O OE2 . GLU B 1 64  ? 2.257   -3.797  -15.903 1.00 16.30  ? 62  GLU B OE2 1 
ATOM   1647 N N   . ALA B 1 65  ? -0.240  0.899   -14.942 1.00 9.85   ? 63  ALA B N   1 
ATOM   1648 C CA  . ALA B 1 65  ? 0.431   2.194   -14.825 1.00 8.99   ? 63  ALA B CA  1 
ATOM   1649 C C   . ALA B 1 65  ? -0.331  3.152   -13.905 1.00 9.79   ? 63  ALA B C   1 
ATOM   1650 O O   . ALA B 1 65  ? 0.279   3.883   -13.131 1.00 9.58   ? 63  ALA B O   1 
ATOM   1651 C CB  . ALA B 1 65  ? 0.647   2.831   -16.183 1.00 8.85   ? 63  ALA B CB  1 
ATOM   1652 N N   . ILE B 1 66  ? -1.645  3.231   -14.085 1.00 10.79  ? 64  ILE B N   1 
ATOM   1653 C CA  . ILE B 1 66  ? -2.482  4.071   -13.226 1.00 12.21  ? 64  ILE B CA  1 
ATOM   1654 C C   . ILE B 1 66  ? -2.393  3.715   -11.745 1.00 12.67  ? 64  ILE B C   1 
ATOM   1655 O O   . ILE B 1 66  ? -2.255  4.603   -10.887 1.00 12.74  ? 64  ILE B O   1 
ATOM   1656 C CB  . ILE B 1 66  ? -3.955  4.098   -13.705 1.00 13.41  ? 64  ILE B CB  1 
ATOM   1657 C CG1 . ILE B 1 66  ? -4.073  4.910   -15.002 1.00 13.74  ? 64  ILE B CG1 1 
ATOM   1658 C CG2 . ILE B 1 66  ? -4.859  4.648   -12.604 1.00 13.67  ? 64  ILE B CG2 1 
ATOM   1659 C CD1 . ILE B 1 66  ? -3.809  6.409   -14.812 1.00 14.54  ? 64  ILE B CD1 1 
ATOM   1660 N N   . GLN B 1 67  ? -2.475  2.420   -11.443 1.00 10.57  ? 65  GLN B N   1 
ATOM   1661 C CA  . GLN B 1 67  ? -2.277  1.947   -10.076 1.00 11.67  ? 65  GLN B CA  1 
ATOM   1662 C C   . GLN B 1 67  ? -0.903  2.328   -9.536  1.00 10.93  ? 65  GLN B C   1 
ATOM   1663 O O   . GLN B 1 67  ? -0.793  2.797   -8.396  1.00 10.90  ? 65  GLN B O   1 
ATOM   1664 C CB  . GLN B 1 67  ? -2.484  0.442   -9.979  1.00 12.44  ? 65  GLN B CB  1 
ATOM   1665 C CG  . GLN B 1 67  ? -3.960  0.043   -10.108 1.00 13.55  ? 65  GLN B CG  1 
ATOM   1666 C CD  . GLN B 1 67  ? -4.153  -1.454  -10.089 1.00 14.48  ? 65  GLN B CD  1 
ATOM   1667 O OE1 . GLN B 1 67  ? -4.526  -2.011  -9.062  1.00 16.57  ? 65  GLN B OE1 1 
ATOM   1668 N NE2 . GLN B 1 67  ? -3.803  -2.123  -11.185 1.00 13.68  ? 65  GLN B NE2 1 
ATOM   1669 N N   . ALA B 1 68  ? 0.139   2.146   -10.347 1.00 10.70  ? 66  ALA B N   1 
ATOM   1670 C CA  . ALA B 1 68  ? 1.490   2.528   -9.915  1.00 9.55   ? 66  ALA B CA  1 
ATOM   1671 C C   . ALA B 1 68  ? 1.617   4.035   -9.631  1.00 9.39   ? 66  ALA B C   1 
ATOM   1672 O O   . ALA B 1 68  ? 2.315   4.441   -8.699  1.00 8.93   ? 66  ALA B O   1 
ATOM   1673 C CB  . ALA B 1 68  ? 2.539   2.103   -10.925 1.00 8.51   ? 66  ALA B CB  1 
ATOM   1674 N N   . LEU B 1 69  ? 0.995   4.877   -10.454 1.00 10.72  ? 67  LEU B N   1 
ATOM   1675 C CA  . LEU B 1 69  ? 1.011   6.318   -10.178 1.00 11.08  ? 67  LEU B CA  1 
ATOM   1676 C C   . LEU B 1 69  ? 0.262   6.666   -8.882  1.00 11.69  ? 67  LEU B C   1 
ATOM   1677 O O   . LEU B 1 69  ? 0.638   7.598   -8.162  1.00 11.93  ? 67  LEU B O   1 
ATOM   1678 C CB  . LEU B 1 69  ? 0.440   7.103   -11.369 1.00 10.24  ? 67  LEU B CB  1 
ATOM   1679 C CG  . LEU B 1 69  ? 1.331   7.120   -12.611 1.00 9.13   ? 67  LEU B CG  1 
ATOM   1680 C CD1 . LEU B 1 69  ? 0.542   7.619   -13.814 1.00 9.08   ? 67  LEU B CD1 1 
ATOM   1681 C CD2 . LEU B 1 69  ? 2.599   7.970   -12.373 1.00 8.56   ? 67  LEU B CD2 1 
ATOM   1682 N N   . THR B 1 70  ? -0.755  5.870   -8.547  1.00 13.49  ? 68  THR B N   1 
ATOM   1683 C CA  . THR B 1 70  ? -1.484  6.004   -7.281  1.00 15.18  ? 68  THR B CA  1 
ATOM   1684 C C   . THR B 1 70  ? -0.616  5.614   -6.084  1.00 15.39  ? 68  THR B C   1 
ATOM   1685 O O   . THR B 1 70  ? -0.585  6.310   -5.065  1.00 14.20  ? 68  THR B O   1 
ATOM   1686 C CB  . THR B 1 70  ? -2.782  5.149   -7.309  1.00 13.54  ? 68  THR B CB  1 
ATOM   1687 O OG1 . THR B 1 70  ? -3.679  5.696   -8.288  1.00 14.80  ? 68  THR B OG1 1 
ATOM   1688 C CG2 . THR B 1 70  ? -3.489  5.179   -5.951  1.00 14.40  ? 68  THR B CG2 1 
ATOM   1689 N N   . VAL B 1 71  ? 0.175   4.558   -6.255  1.00 10.77  ? 69  VAL B N   1 
ATOM   1690 C CA  . VAL B 1 71  ? 1.159   4.203   -5.238  1.00 10.96  ? 69  VAL B CA  1 
ATOM   1691 C C   . VAL B 1 71  ? 2.182   5.317   -5.056  1.00 9.81   ? 69  VAL B C   1 
ATOM   1692 O O   . VAL B 1 71  ? 2.434   5.728   -3.930  1.00 11.19  ? 69  VAL B O   1 
ATOM   1693 C CB  . VAL B 1 71  ? 1.890   2.897   -5.570  1.00 10.03  ? 69  VAL B CB  1 
ATOM   1694 C CG1 . VAL B 1 71  ? 2.960   2.632   -4.522  1.00 10.08  ? 69  VAL B CG1 1 
ATOM   1695 C CG2 . VAL B 1 71  ? 0.895   1.740   -5.641  1.00 11.57  ? 69  VAL B CG2 1 
ATOM   1696 N N   . LEU B 1 72  ? 2.676   5.860   -6.169  1.00 11.33  ? 70  LEU B N   1 
ATOM   1697 C CA  . LEU B 1 72  ? 3.667   6.945   -6.144  1.00 10.77  ? 70  LEU B CA  1 
ATOM   1698 C C   . LEU B 1 72  ? 3.115   8.148   -5.388  1.00 11.47  ? 70  LEU B C   1 
ATOM   1699 O O   . LEU B 1 72  ? 3.769   8.691   -4.496  1.00 11.71  ? 70  LEU B O   1 
ATOM   1700 C CB  . LEU B 1 72  ? 4.067   7.350   -7.569  1.00 9.57   ? 70  LEU B CB  1 
ATOM   1701 C CG  . LEU B 1 72  ? 5.076   8.491   -7.768  1.00 9.13   ? 70  LEU B CG  1 
ATOM   1702 C CD1 . LEU B 1 72  ? 6.391   8.293   -7.009  1.00 8.85   ? 70  LEU B CD1 1 
ATOM   1703 C CD2 . LEU B 1 72  ? 5.334   8.670   -9.272  1.00 8.26   ? 70  LEU B CD2 1 
ATOM   1704 N N   . GLU B 1 73  ? 1.924   8.573   -5.790  1.00 12.61  ? 71  GLU B N   1 
ATOM   1705 C CA  . GLU B 1 73  ? 1.255   9.716   -5.171  1.00 14.27  ? 71  GLU B CA  1 
ATOM   1706 C C   . GLU B 1 73  ? 1.131   9.518   -3.661  1.00 14.48  ? 71  GLU B C   1 
ATOM   1707 O O   . GLU B 1 73  ? 1.383   10.433  -2.879  1.00 16.29  ? 71  GLU B O   1 
ATOM   1708 C CB  . GLU B 1 73  ? -0.129  9.883   -5.800  1.00 16.11  ? 71  GLU B CB  1 
ATOM   1709 C CG  . GLU B 1 73  ? -0.903  11.038  -5.239  1.00 16.35  ? 71  GLU B CG  1 
ATOM   1710 C CD  . GLU B 1 73  ? -2.299  11.124  -5.803  1.00 13.89  ? 71  GLU B CD  1 
ATOM   1711 O OE1 . GLU B 1 73  ? -2.721  10.189  -6.514  1.00 16.58  ? 71  GLU B OE1 1 
ATOM   1712 O OE2 . GLU B 1 73  ? -2.938  12.174  -5.585  1.00 23.93  ? 71  GLU B OE2 1 
ATOM   1713 N N   . THR B 1 74  ? 0.717   8.320   -3.259  1.00 12.67  ? 72  THR B N   1 
ATOM   1714 C CA  . THR B 1 74  ? 0.488   8.002   -1.860  1.00 13.77  ? 72  THR B CA  1 
ATOM   1715 C C   . THR B 1 74  ? 1.784   8.022   -1.050  1.00 16.08  ? 72  THR B C   1 
ATOM   1716 O O   . THR B 1 74  ? 1.871   8.667   0.000   1.00 14.81  ? 72  THR B O   1 
ATOM   1717 C CB  . THR B 1 74  ? -0.187  6.625   -1.733  1.00 14.22  ? 72  THR B CB  1 
ATOM   1718 O OG1 . THR B 1 74  ? -1.475  6.690   -2.367  1.00 15.31  ? 72  THR B OG1 1 
ATOM   1719 C CG2 . THR B 1 74  ? -0.370  6.271   -0.252  1.00 15.50  ? 72  THR B CG2 1 
ATOM   1720 N N   . CYS B 1 75  ? 2.826   7.393   -1.581  1.00 18.25  ? 73  CYS B N   1 
ATOM   1721 C CA  . CYS B 1 75  ? 4.097   7.395   -0.874  1.00 18.25  ? 73  CYS B CA  1 
ATOM   1722 C C   . CYS B 1 75  ? 4.739   8.777   -0.749  1.00 16.62  ? 73  CYS B C   1 
ATOM   1723 O O   . CYS B 1 75  ? 5.442   9.041   0.232   1.00 15.86  ? 73  CYS B O   1 
ATOM   1724 C CB  . CYS B 1 75  ? 5.078   6.401   -1.490  1.00 14.87  ? 73  CYS B CB  1 
ATOM   1725 S SG  . CYS B 1 75  ? 4.568   4.654   -1.451  1.00 15.82  ? 73  CYS B SG  1 
ATOM   1726 N N   . MET B 1 76  ? 4.541   9.639   -1.742  1.00 14.90  ? 74  MET B N   1 
ATOM   1727 C CA  . MET B 1 76  ? 5.027   11.019  -1.622  1.00 14.78  ? 74  MET B CA  1 
ATOM   1728 C C   . MET B 1 76  ? 4.320   11.739  -0.477  1.00 16.55  ? 74  MET B C   1 
ATOM   1729 O O   . MET B 1 76  ? 4.944   12.439  0.334   1.00 17.42  ? 74  MET B O   1 
ATOM   1730 C CB  . MET B 1 76  ? 4.876   11.791  -2.939  1.00 14.37  ? 74  MET B CB  1 
ATOM   1731 C CG  . MET B 1 76  ? 5.863   11.353  -4.029  1.00 13.41  ? 74  MET B CG  1 
ATOM   1732 S SD  . MET B 1 76  ? 7.611   11.693  -3.673  1.00 12.67  ? 74  MET B SD  1 
ATOM   1733 C CE  . MET B 1 76  ? 7.716   13.438  -4.119  1.00 14.86  ? 74  MET B CE  1 
ATOM   1734 N N   . LYS B 1 77  ? 3.059   11.379  -0.259  1.00 17.69  ? 75  LYS B N   1 
ATOM   1735 C CA  . LYS B 1 77  ? 2.311   11.953  0.858   1.00 20.59  ? 75  LYS B CA  1 
ATOM   1736 C C   . LYS B 1 77  ? 2.712   11.371  2.221   1.00 20.62  ? 75  LYS B C   1 
ATOM   1737 O O   . LYS B 1 77  ? 2.879   12.135  3.176   1.00 22.49  ? 75  LYS B O   1 
ATOM   1738 C CB  . LYS B 1 77  ? 0.806   11.811  0.636   1.00 23.81  ? 75  LYS B CB  1 
ATOM   1739 C CG  . LYS B 1 77  ? 0.284   12.601  -0.555  1.00 29.09  ? 75  LYS B CG  1 
ATOM   1740 C CD  . LYS B 1 77  ? -1.242  12.521  -0.627  1.00 38.73  ? 75  LYS B CD  1 
ATOM   1741 C CE  . LYS B 1 77  ? -1.716  11.896  -1.940  1.00 33.06  ? 75  LYS B CE  1 
ATOM   1742 N NZ  . LYS B 1 77  ? -2.685  10.784  -1.718  1.00 28.20  ? 75  LYS B NZ  1 
ATOM   1743 N N   . SER B 1 78  ? 3.050   10.079  2.256   1.00 19.22  ? 76  SER B N   1 
ATOM   1744 C CA  A SER B 1 78  ? 3.193   9.350   3.517   0.50 22.12  ? 76  SER B CA  1 
ATOM   1745 C CA  B SER B 1 78  ? 3.190   9.330   3.510   0.50 20.81  ? 76  SER B CA  1 
ATOM   1746 C C   . SER B 1 78  ? 4.638   9.177   3.990   1.00 21.90  ? 76  SER B C   1 
ATOM   1747 O O   . SER B 1 78  ? 4.884   8.967   5.186   1.00 24.99  ? 76  SER B O   1 
ATOM   1748 C CB  A SER B 1 78  ? 2.499   7.983   3.444   0.50 21.89  ? 76  SER B CB  1 
ATOM   1749 C CB  B SER B 1 78  ? 2.539   7.941   3.408   0.50 20.22  ? 76  SER B CB  1 
ATOM   1750 O OG  A SER B 1 78  ? 3.345   7.012   2.850   0.50 24.76  ? 76  SER B OG  1 
ATOM   1751 O OG  B SER B 1 78  ? 1.151   8.014   3.124   0.50 18.81  ? 76  SER B OG  1 
ATOM   1752 N N   . CYS B 1 79  ? 5.589   9.194   3.057   1.00 19.04  ? 77  CYS B N   1 
ATOM   1753 C CA  . CYS B 1 79  ? 6.908   8.624   3.313   1.00 20.99  ? 77  CYS B CA  1 
ATOM   1754 C C   . CYS B 1 79  ? 7.998   9.607   3.715   1.00 23.64  ? 77  CYS B C   1 
ATOM   1755 O O   . CYS B 1 79  ? 9.084   9.202   4.131   1.00 28.36  ? 77  CYS B O   1 
ATOM   1756 C CB  . CYS B 1 79  ? 7.378   7.777   2.130   1.00 20.46  ? 77  CYS B CB  1 
ATOM   1757 S SG  . CYS B 1 79  ? 6.307   6.368   1.828   1.00 20.48  ? 77  CYS B SG  1 
ATOM   1758 N N   . GLY B 1 80  ? 7.726   10.898  3.590   1.00 21.56  ? 78  GLY B N   1 
ATOM   1759 C CA  . GLY B 1 80  ? 8.685   11.890  4.069   1.00 21.10  ? 78  GLY B CA  1 
ATOM   1760 C C   . GLY B 1 80  ? 9.954   12.032  3.241   1.00 20.82  ? 78  GLY B C   1 
ATOM   1761 O O   . GLY B 1 80  ? 10.042  11.559  2.101   1.00 19.26  ? 78  GLY B O   1 
ATOM   1762 N N   . LYS B 1 81  ? 10.968  12.640  3.853   1.00 26.96  ? 79  LYS B N   1 
ATOM   1763 C CA  . LYS B 1 81  ? 12.112  13.167  3.106   1.00 27.23  ? 79  LYS B CA  1 
ATOM   1764 C C   . LYS B 1 81  ? 12.922  12.106  2.362   1.00 24.36  ? 79  LYS B C   1 
ATOM   1765 O O   . LYS B 1 81  ? 13.360  12.335  1.239   1.00 22.09  ? 79  LYS B O   1 
ATOM   1766 C CB  . LYS B 1 81  ? 13.038  13.959  4.032   1.00 33.37  ? 79  LYS B CB  1 
ATOM   1767 C CG  . LYS B 1 81  ? 14.083  14.772  3.280   1.00 30.35  ? 79  LYS B CG  1 
ATOM   1768 C CD  . LYS B 1 81  ? 14.434  16.044  4.042   1.00 35.57  ? 79  LYS B CD  1 
ATOM   1769 C CE  . LYS B 1 81  ? 15.717  16.661  3.521   1.00 41.78  ? 79  LYS B CE  1 
ATOM   1770 N NZ  . LYS B 1 81  ? 16.348  17.551  4.548   1.00 50.76  ? 79  LYS B NZ  1 
ATOM   1771 N N   . ARG B 1 82  ? 13.210  10.989  3.018   1.00 23.70  ? 80  ARG B N   1 
ATOM   1772 C CA  . ARG B 1 82  ? 13.997  9.940   2.379   1.00 21.77  ? 80  ARG B CA  1 
ATOM   1773 C C   . ARG B 1 82  ? 13.424  9.477   1.034   1.00 18.29  ? 80  ARG B C   1 
ATOM   1774 O O   . ARG B 1 82  ? 14.164  9.273   0.075   1.00 19.00  ? 80  ARG B O   1 
ATOM   1775 C CB  . ARG B 1 82  ? 14.201  8.753   3.322   1.00 22.13  ? 80  ARG B CB  1 
ATOM   1776 C CG  . ARG B 1 82  ? 15.209  9.040   4.430   1.00 32.15  ? 80  ARG B CG  1 
ATOM   1777 C CD  . ARG B 1 82  ? 15.920  7.778   4.907   1.00 36.67  ? 80  ARG B CD  1 
ATOM   1778 N NE  . ARG B 1 82  ? 14.996  6.656   5.024   1.00 47.40  ? 80  ARG B NE  1 
ATOM   1779 C CZ  . ARG B 1 82  ? 15.191  5.475   4.448   1.00 53.08  ? 80  ARG B CZ  1 
ATOM   1780 N NH1 . ARG B 1 82  ? 16.321  5.242   3.790   1.00 60.72  ? 80  ARG B NH1 1 
ATOM   1781 N NH2 . ARG B 1 82  ? 14.249  4.541   4.506   1.00 48.30  ? 80  ARG B NH2 1 
ATOM   1782 N N   . PHE B 1 83  ? 12.105  9.342   0.944   1.00 16.47  ? 81  PHE B N   1 
ATOM   1783 C CA  . PHE B 1 83  ? 11.481  8.966   -0.327  1.00 14.63  ? 81  PHE B CA  1 
ATOM   1784 C C   . PHE B 1 83  ? 11.494  10.155  -1.288  1.00 13.81  ? 81  PHE B C   1 
ATOM   1785 O O   . PHE B 1 83  ? 11.778  10.000  -2.473  1.00 12.98  ? 81  PHE B O   1 
ATOM   1786 C CB  . PHE B 1 83  ? 10.042  8.476   -0.120  1.00 14.10  ? 81  PHE B CB  1 
ATOM   1787 C CG  . PHE B 1 83  ? 9.412   7.921   -1.366  1.00 12.73  ? 81  PHE B CG  1 
ATOM   1788 C CD1 . PHE B 1 83  ? 9.906   6.764   -1.952  1.00 12.19  ? 81  PHE B CD1 1 
ATOM   1789 C CD2 . PHE B 1 83  ? 8.300   8.522   -1.932  1.00 12.21  ? 81  PHE B CD2 1 
ATOM   1790 C CE1 . PHE B 1 83  ? 9.403   6.301   -3.159  1.00 11.15  ? 81  PHE B CE1 1 
ATOM   1791 C CE2 . PHE B 1 83  ? 7.735   8.011   -3.088  1.00 11.37  ? 81  PHE B CE2 1 
ATOM   1792 C CZ  . PHE B 1 83  ? 8.276   6.893   -3.695  1.00 10.70  ? 81  PHE B CZ  1 
ATOM   1793 N N   . HIS B 1 84  ? 11.177  11.335  -0.770  1.00 14.06  ? 82  HIS B N   1 
ATOM   1794 C CA  . HIS B 1 84  ? 11.200  12.545  -1.585  1.00 14.16  ? 82  HIS B CA  1 
ATOM   1795 C C   . HIS B 1 84  ? 12.536  12.706  -2.303  1.00 14.06  ? 82  HIS B C   1 
ATOM   1796 O O   . HIS B 1 84  ? 12.558  13.078  -3.478  1.00 12.58  ? 82  HIS B O   1 
ATOM   1797 C CB  . HIS B 1 84  ? 10.909  13.784  -0.743  1.00 15.21  ? 82  HIS B CB  1 
ATOM   1798 C CG  . HIS B 1 84  ? 9.561   13.773  -0.092  1.00 15.03  ? 82  HIS B CG  1 
ATOM   1799 N ND1 . HIS B 1 84  ? 9.269   14.560  1.003   1.00 18.10  ? 82  HIS B ND1 1 
ATOM   1800 C CD2 . HIS B 1 84  ? 8.420   13.112  -0.395  1.00 14.13  ? 82  HIS B CD2 1 
ATOM   1801 C CE1 . HIS B 1 84  ? 8.024   14.336  1.382   1.00 17.68  ? 82  HIS B CE1 1 
ATOM   1802 N NE2 . HIS B 1 84  ? 7.518   13.395  0.607   1.00 15.42  ? 82  HIS B NE2 1 
ATOM   1803 N N   . ASP B 1 85  ? 13.627  12.447  -1.583  1.00 15.80  ? 83  ASP B N   1 
ATOM   1804 C CA  . ASP B 1 85  ? 14.986  12.670  -2.083  1.00 17.08  ? 83  ASP B CA  1 
ATOM   1805 C C   . ASP B 1 85  ? 15.323  11.713  -3.235  1.00 16.62  ? 83  ASP B C   1 
ATOM   1806 O O   . ASP B 1 85  ? 15.995  12.108  -4.186  1.00 17.34  ? 83  ASP B O   1 
ATOM   1807 C CB  . ASP B 1 85  ? 16.015  12.517  -0.949  1.00 17.10  ? 83  ASP B CB  1 
ATOM   1808 C CG  . ASP B 1 85  ? 16.049  13.713  -0.001  1.00 21.83  ? 83  ASP B CG  1 
ATOM   1809 O OD1 . ASP B 1 85  ? 16.707  13.593  1.050   1.00 25.51  ? 83  ASP B OD1 1 
ATOM   1810 O OD2 . ASP B 1 85  ? 15.590  14.820  -0.361  1.00 22.59  ? 83  ASP B OD2 1 
ATOM   1811 N N   . GLU B 1 86  ? 14.757  10.504  -3.228  1.00 15.36  ? 84  GLU B N   1 
ATOM   1812 C CA  . GLU B 1 86  ? 14.993  9.553   -4.309  1.00 15.31  ? 84  GLU B CA  1 
ATOM   1813 C C   . GLU B 1 86  ? 14.106  9.839   -5.521  1.00 12.89  ? 84  GLU B C   1 
ATOM   1814 O O   . GLU B 1 86  ? 14.533  9.663   -6.665  1.00 13.24  ? 84  GLU B O   1 
ATOM   1815 C CB  . GLU B 1 86  ? 14.770  8.112   -3.831  1.00 16.94  ? 84  GLU B CB  1 
ATOM   1816 C CG  . GLU B 1 86  ? 15.932  7.537   -3.027  1.00 22.20  ? 84  GLU B CG  1 
ATOM   1817 C CD  . GLU B 1 86  ? 17.269  7.629   -3.760  1.00 22.10  ? 84  GLU B CD  1 
ATOM   1818 O OE1 . GLU B 1 86  ? 17.367  7.167   -4.918  1.00 30.64  ? 84  GLU B OE1 1 
ATOM   1819 O OE2 . GLU B 1 86  ? 18.218  8.188   -3.181  1.00 35.01  ? 84  GLU B OE2 1 
ATOM   1820 N N   . VAL B 1 87  ? 12.863  10.248  -5.280  1.00 11.39  ? 85  VAL B N   1 
ATOM   1821 C CA  . VAL B 1 87  ? 11.997  10.739  -6.368  1.00 10.34  ? 85  VAL B CA  1 
ATOM   1822 C C   . VAL B 1 87  ? 12.608  11.972  -7.048  1.00 11.08  ? 85  VAL B C   1 
ATOM   1823 O O   . VAL B 1 87  ? 12.564  12.125  -8.280  1.00 10.36  ? 85  VAL B O   1 
ATOM   1824 C CB  . VAL B 1 87  ? 10.552  10.975  -5.880  1.00 10.18  ? 85  VAL B CB  1 
ATOM   1825 C CG1 . VAL B 1 87  ? 9.711   11.656  -6.952  1.00 9.78   ? 85  VAL B CG1 1 
ATOM   1826 C CG2 . VAL B 1 87  ? 9.928   9.634   -5.484  1.00 10.10  ? 85  VAL B CG2 1 
ATOM   1827 N N   . GLY B 1 88  ? 13.241  12.824  -6.247  1.00 11.74  ? 86  GLY B N   1 
ATOM   1828 C CA  . GLY B 1 88  ? 13.854  14.052  -6.771  1.00 14.16  ? 86  GLY B CA  1 
ATOM   1829 C C   . GLY B 1 88  ? 15.259  13.905  -7.320  1.00 17.02  ? 86  GLY B C   1 
ATOM   1830 O O   . GLY B 1 88  ? 16.082  14.817  -7.160  1.00 16.63  ? 86  GLY B O   1 
ATOM   1831 N N   . LYS B 1 89  ? 15.534  12.755  -7.937  1.00 9.86   ? 87  LYS B N   1 
ATOM   1832 C CA  . LYS B 1 89  ? 16.746  12.561  -8.731  1.00 10.63  ? 87  LYS B CA  1 
ATOM   1833 C C   . LYS B 1 89  ? 16.411  12.223  -10.190 1.00 9.56   ? 87  LYS B C   1 
ATOM   1834 O O   . LYS B 1 89  ? 15.376  11.596  -10.455 1.00 8.32   ? 87  LYS B O   1 
ATOM   1835 C CB  . LYS B 1 89  ? 17.574  11.429  -8.130  1.00 11.56  ? 87  LYS B CB  1 
ATOM   1836 C CG  . LYS B 1 89  ? 18.184  11.769  -6.768  1.00 13.29  ? 87  LYS B CG  1 
ATOM   1837 C CD  . LYS B 1 89  ? 18.821  10.532  -6.151  1.00 14.26  ? 87  LYS B CD  1 
ATOM   1838 C CE  . LYS B 1 89  ? 19.152  10.779  -4.695  1.00 15.99  ? 87  LYS B CE  1 
ATOM   1839 N NZ  . LYS B 1 89  ? 19.861  9.639   -4.035  1.00 23.08  ? 87  LYS B NZ  1 
ATOM   1840 N N   . PHE B 1 90  ? 17.267  12.639  -11.122 1.00 9.40   ? 88  PHE B N   1 
ATOM   1841 C CA  . PHE B 1 90  ? 17.010  12.386  -12.546 1.00 8.94   ? 88  PHE B CA  1 
ATOM   1842 C C   . PHE B 1 90  ? 16.993  10.901  -12.891 1.00 8.79   ? 88  PHE B C   1 
ATOM   1843 O O   . PHE B 1 90  ? 16.265  10.466  -13.787 1.00 8.26   ? 88  PHE B O   1 
ATOM   1844 C CB  . PHE B 1 90  ? 17.971  13.162  -13.452 1.00 9.42   ? 88  PHE B CB  1 
ATOM   1845 C CG  . PHE B 1 90  ? 17.808  14.646  -13.353 1.00 9.40   ? 88  PHE B CG  1 
ATOM   1846 C CD1 . PHE B 1 90  ? 16.555  15.231  -13.518 1.00 9.10   ? 88  PHE B CD1 1 
ATOM   1847 C CD2 . PHE B 1 90  ? 18.884  15.449  -13.007 1.00 10.93  ? 88  PHE B CD2 1 
ATOM   1848 C CE1 . PHE B 1 90  ? 16.386  16.604  -13.390 1.00 9.26   ? 88  PHE B CE1 1 
ATOM   1849 C CE2 . PHE B 1 90  ? 18.719  16.829  -12.875 1.00 11.24  ? 88  PHE B CE2 1 
ATOM   1850 C CZ  . PHE B 1 90  ? 17.453  17.382  -12.982 1.00 10.04  ? 88  PHE B CZ  1 
ATOM   1851 N N   . ARG B 1 91  ? 17.730  10.107  -12.119 1.00 10.88  ? 89  ARG B N   1 
ATOM   1852 C CA  . ARG B 1 91  ? 17.635  8.653   -12.214 1.00 10.89  ? 89  ARG B CA  1 
ATOM   1853 C C   . ARG B 1 91  ? 16.180  8.151   -12.204 1.00 10.47  ? 89  ARG B C   1 
ATOM   1854 O O   . ARG B 1 91  ? 15.802  7.254   -12.979 1.00 9.96   ? 89  ARG B O   1 
ATOM   1855 C CB  . ARG B 1 91  ? 18.428  8.007   -11.077 1.00 13.27  ? 89  ARG B CB  1 
ATOM   1856 C CG  . ARG B 1 91  ? 18.499  6.507   -11.185 1.00 22.20  ? 89  ARG B CG  1 
ATOM   1857 C CD  . ARG B 1 91  ? 19.459  5.964   -10.146 1.00 19.80  ? 89  ARG B CD  1 
ATOM   1858 N NE  . ARG B 1 91  ? 20.830  6.294   -10.524 1.00 29.78  ? 89  ARG B NE  1 
ATOM   1859 C CZ  . ARG B 1 91  ? 21.561  7.245   -9.955  1.00 26.66  ? 89  ARG B CZ  1 
ATOM   1860 N NH1 . ARG B 1 91  ? 21.125  7.865   -8.863  1.00 42.74  ? 89  ARG B NH1 1 
ATOM   1861 N NH2 . ARG B 1 91  ? 22.787  7.479   -10.401 1.00 29.17  ? 89  ARG B NH2 1 
ATOM   1862 N N   . PHE B 1 92  ? 15.345  8.797   -11.390 1.00 8.91   ? 90  PHE B N   1 
ATOM   1863 C CA  . PHE B 1 92  ? 13.907  8.536   -11.412 1.00 8.53   ? 90  PHE B CA  1 
ATOM   1864 C C   . PHE B 1 92  ? 13.138  9.436   -12.380 1.00 7.50   ? 90  PHE B C   1 
ATOM   1865 O O   . PHE B 1 92  ? 12.309  8.961   -13.161 1.00 7.06   ? 90  PHE B O   1 
ATOM   1866 C CB  . PHE B 1 92  ? 13.294  8.643   -10.010 1.00 7.30   ? 90  PHE B CB  1 
ATOM   1867 C CG  . PHE B 1 92  ? 11.821  8.301   -9.972  1.00 6.81   ? 90  PHE B CG  1 
ATOM   1868 C CD1 . PHE B 1 92  ? 11.384  7.002   -10.237 1.00 7.94   ? 90  PHE B CD1 1 
ATOM   1869 C CD2 . PHE B 1 92  ? 10.884  9.299   -9.771  1.00 8.09   ? 90  PHE B CD2 1 
ATOM   1870 C CE1 . PHE B 1 92  ? 10.018  6.696   -10.260 1.00 6.41   ? 90  PHE B CE1 1 
ATOM   1871 C CE2 . PHE B 1 92  ? 9.526   9.009   -9.776  1.00 6.66   ? 90  PHE B CE2 1 
ATOM   1872 C CZ  . PHE B 1 92  ? 9.085   7.708   -10.050 1.00 6.45   ? 90  PHE B CZ  1 
ATOM   1873 N N   . LEU B 1 93  ? 13.362  10.742  -12.282 1.00 7.36   ? 91  LEU B N   1 
ATOM   1874 C CA  . LEU B 1 93  ? 12.569  11.690  -13.061 1.00 7.28   ? 91  LEU B CA  1 
ATOM   1875 C C   . LEU B 1 93  ? 12.665  11.438  -14.566 1.00 7.42   ? 91  LEU B C   1 
ATOM   1876 O O   . LEU B 1 93  ? 11.682  11.640  -15.293 1.00 7.71   ? 91  LEU B O   1 
ATOM   1877 C CB  . LEU B 1 93  ? 13.000  13.127  -12.739 1.00 7.74   ? 91  LEU B CB  1 
ATOM   1878 C CG  . LEU B 1 93  ? 12.685  13.552  -11.296 1.00 7.60   ? 91  LEU B CG  1 
ATOM   1879 C CD1 . LEU B 1 93  ? 13.464  14.858  -10.963 1.00 10.38  ? 91  LEU B CD1 1 
ATOM   1880 C CD2 . LEU B 1 93  ? 11.172  13.754  -11.085 1.00 8.33   ? 91  LEU B CD2 1 
ATOM   1881 N N   . ASN B 1 94  ? 13.832  10.995  -15.026 1.00 8.75   ? 92  ASN B N   1 
ATOM   1882 C CA  . ASN B 1 94  ? 14.021  10.685  -16.450 1.00 8.47   ? 92  ASN B CA  1 
ATOM   1883 C C   . ASN B 1 94  ? 13.044  9.598   -16.918 1.00 8.06   ? 92  ASN B C   1 
ATOM   1884 O O   . ASN B 1 94  ? 12.599  9.595   -18.070 1.00 8.18   ? 92  ASN B O   1 
ATOM   1885 C CB  . ASN B 1 94  ? 15.472  10.244  -16.722 1.00 8.95   ? 92  ASN B CB  1 
ATOM   1886 C CG  . ASN B 1 94  ? 16.458  11.416  -16.727 1.00 9.76   ? 92  ASN B CG  1 
ATOM   1887 O OD1 . ASN B 1 94  ? 16.067  12.586  -16.817 1.00 10.18  ? 92  ASN B OD1 1 
ATOM   1888 N ND2 . ASN B 1 94  ? 17.750  11.097  -16.681 1.00 10.25  ? 92  ASN B ND2 1 
ATOM   1889 N N   . GLU B 1 95  ? 12.675  8.694   -16.009 1.00 9.61   ? 93  GLU B N   1 
ATOM   1890 C CA  . GLU B 1 95  ? 11.731  7.633   -16.362 1.00 9.73   ? 93  GLU B CA  1 
ATOM   1891 C C   . GLU B 1 95  ? 10.318  8.166   -16.580 1.00 9.47   ? 93  GLU B C   1 
ATOM   1892 O O   . GLU B 1 95  ? 9.585   7.667   -17.457 1.00 10.33  ? 93  GLU B O   1 
ATOM   1893 C CB  . GLU B 1 95  ? 11.745  6.500   -15.324 1.00 9.48   ? 93  GLU B CB  1 
ATOM   1894 C CG  . GLU B 1 95  ? 13.111  5.819   -15.188 1.00 11.44  ? 93  GLU B CG  1 
ATOM   1895 C CD  . GLU B 1 95  ? 13.720  5.380   -16.515 1.00 9.86   ? 93  GLU B CD  1 
ATOM   1896 O OE1 . GLU B 1 95  ? 13.019  4.777   -17.346 1.00 15.25  ? 93  GLU B OE1 1 
ATOM   1897 O OE2 . GLU B 1 95  ? 14.900  5.705   -16.787 1.00 21.71  ? 93  GLU B OE2 1 
ATOM   1898 N N   . LEU B 1 96  ? 9.941   9.184   -15.808 1.00 7.99   ? 94  LEU B N   1 
ATOM   1899 C CA  . LEU B 1 96  ? 8.659   9.882   -16.013 1.00 7.83   ? 94  LEU B CA  1 
ATOM   1900 C C   . LEU B 1 96  ? 8.712   10.717  -17.304 1.00 6.35   ? 94  LEU B C   1 
ATOM   1901 O O   . LEU B 1 96  ? 7.721   10.837  -18.026 1.00 7.31   ? 94  LEU B O   1 
ATOM   1902 C CB  . LEU B 1 96  ? 8.357   10.785  -14.810 1.00 8.29   ? 94  LEU B CB  1 
ATOM   1903 C CG  . LEU B 1 96  ? 8.228   10.055  -13.462 1.00 6.85   ? 94  LEU B CG  1 
ATOM   1904 C CD1 . LEU B 1 96  ? 7.844   11.061  -12.381 1.00 8.27   ? 94  LEU B CD1 1 
ATOM   1905 C CD2 . LEU B 1 96  ? 7.204   8.918   -13.528 1.00 7.08   ? 94  LEU B CD2 1 
ATOM   1906 N N   . ILE B 1 97  ? 9.857   11.339  -17.571 1.00 6.79   ? 95  ILE B N   1 
ATOM   1907 C CA  . ILE B 1 97  ? 10.015  12.177  -18.771 1.00 6.89   ? 95  ILE B CA  1 
ATOM   1908 C C   . ILE B 1 97  ? 9.825   11.339  -20.046 1.00 7.74   ? 95  ILE B C   1 
ATOM   1909 O O   . ILE B 1 97  ? 9.098   11.729  -20.967 1.00 7.83   ? 95  ILE B O   1 
ATOM   1910 C CB  . ILE B 1 97  ? 11.399  12.895  -18.769 1.00 8.11   ? 95  ILE B CB  1 
ATOM   1911 C CG1 . ILE B 1 97  ? 11.441  13.989  -17.687 1.00 8.12   ? 95  ILE B CG1 1 
ATOM   1912 C CG2 . ILE B 1 97  ? 11.703  13.509  -20.138 1.00 7.79   ? 95  ILE B CG2 1 
ATOM   1913 C CD1 . ILE B 1 97  ? 12.823  14.584  -17.435 1.00 7.93   ? 95  ILE B CD1 1 
ATOM   1914 N N   . LYS B 1 98  ? 10.315  10.104  -20.009 1.00 10.77  ? 96  LYS B N   1 
ATOM   1915 C CA  . LYS B 1 98  ? 10.172  9.183   -21.133 1.00 13.06  ? 96  LYS B CA  1 
ATOM   1916 C C   . LYS B 1 98  ? 8.706   8.790   -21.366 1.00 12.93  ? 96  LYS B C   1 
ATOM   1917 O O   . LYS B 1 98  ? 8.293   8.591   -22.512 1.00 12.29  ? 96  LYS B O   1 
ATOM   1918 C CB  . LYS B 1 98  ? 11.081  7.961   -20.934 1.00 12.88  ? 96  LYS B CB  1 
ATOM   1919 C CG  . LYS B 1 98  ? 12.566  8.236   -21.227 1.00 9.69   ? 96  LYS B CG  1 
ATOM   1920 C CD  . LYS B 1 98  ? 13.501  7.267   -20.481 1.00 12.71  ? 96  LYS B CD  1 
ATOM   1921 C CE  . LYS B 1 98  ? 14.838  7.045   -21.205 1.00 28.80  ? 96  LYS B CE  1 
ATOM   1922 N NZ  . LYS B 1 98  ? 15.539  8.227   -21.824 1.00 19.60  ? 96  LYS B NZ  1 
ATOM   1923 N N   . VAL B 1 99  ? 7.910   8.780   -20.301 1.00 8.18   ? 97  VAL B N   1 
ATOM   1924 C CA  . VAL B 1 99  ? 6.492   8.421   -20.429 1.00 8.99   ? 97  VAL B CA  1 
ATOM   1925 C C   . VAL B 1 99  ? 5.694   9.527   -21.131 1.00 9.42   ? 97  VAL B C   1 
ATOM   1926 O O   . VAL B 1 99  ? 4.793   9.232   -21.923 1.00 10.30  ? 97  VAL B O   1 
ATOM   1927 C CB  . VAL B 1 99  ? 5.843   8.034   -19.073 1.00 8.04   ? 97  VAL B CB  1 
ATOM   1928 C CG1 . VAL B 1 99  ? 4.336   7.809   -19.277 1.00 8.87   ? 97  VAL B CG1 1 
ATOM   1929 C CG2 . VAL B 1 99  ? 6.508   6.761   -18.543 1.00 7.66   ? 97  VAL B CG2 1 
ATOM   1930 N N   . VAL B 1 100 ? 6.026   10.794  -20.858 1.00 9.05   ? 98  VAL B N   1 
ATOM   1931 C CA  . VAL B 1 100 ? 5.245   11.905  -21.406 1.00 10.02  ? 98  VAL B CA  1 
ATOM   1932 C C   . VAL B 1 100 ? 5.796   12.544  -22.679 1.00 10.95  ? 98  VAL B C   1 
ATOM   1933 O O   . VAL B 1 100 ? 5.064   13.254  -23.378 1.00 12.32  ? 98  VAL B O   1 
ATOM   1934 C CB  . VAL B 1 100 ? 4.985   13.008  -20.362 1.00 9.88   ? 98  VAL B CB  1 
ATOM   1935 C CG1 . VAL B 1 100 ? 4.321   12.406  -19.117 1.00 9.08   ? 98  VAL B CG1 1 
ATOM   1936 C CG2 . VAL B 1 100 ? 6.265   13.717  -20.010 1.00 9.67   ? 98  VAL B CG2 1 
ATOM   1937 N N   . SER B 1 101 ? 7.030   12.196  -23.051 1.00 11.41  ? 99  SER B N   1 
ATOM   1938 C CA  . SER B 1 101 ? 7.665   12.787  -24.235 1.00 11.31  ? 99  SER B CA  1 
ATOM   1939 C C   . SER B 1 101 ? 7.320   12.045  -25.531 1.00 12.00  ? 99  SER B C   1 
ATOM   1940 O O   . SER B 1 101 ? 7.523   10.836  -25.613 1.00 13.47  ? 99  SER B O   1 
ATOM   1941 C CB  . SER B 1 101 ? 9.186   12.840  -24.043 1.00 13.16  ? 99  SER B CB  1 
ATOM   1942 O OG  . SER B 1 101 ? 9.868   13.076  -25.270 1.00 12.93  ? 99  SER B OG  1 
ATOM   1943 N N   . PRO B 1 102 ? 7.026   12.788  -26.614 1.00 15.34  ? 100 PRO B N   1 
ATOM   1944 C CA  . PRO B 1 102 ? 6.772   12.138  -27.909 1.00 16.78  ? 100 PRO B CA  1 
ATOM   1945 C C   . PRO B 1 102 ? 8.007   11.432  -28.469 1.00 16.49  ? 100 PRO B C   1 
ATOM   1946 O O   . PRO B 1 102 ? 7.876   10.585  -29.359 1.00 16.22  ? 100 PRO B O   1 
ATOM   1947 C CB  . PRO B 1 102 ? 6.358   13.296  -28.831 1.00 19.60  ? 100 PRO B CB  1 
ATOM   1948 C CG  . PRO B 1 102 ? 6.083   14.456  -27.924 1.00 22.75  ? 100 PRO B CG  1 
ATOM   1949 C CD  . PRO B 1 102 ? 6.868   14.250  -26.670 1.00 17.02  ? 100 PRO B CD  1 
ATOM   1950 N N   . LYS B 1 103 ? 9.189   11.819  -27.983 1.00 13.29  ? 101 LYS B N   1 
ATOM   1951 C CA  A LYS B 1 103 ? 10.459  11.261  -28.450 0.50 14.25  ? 101 LYS B CA  1 
ATOM   1952 C CA  B LYS B 1 103 ? 10.442  11.250  -28.471 0.50 14.61  ? 101 LYS B CA  1 
ATOM   1953 C C   . LYS B 1 103 ? 10.604  9.814   -27.990 1.00 13.33  ? 101 LYS B C   1 
ATOM   1954 O O   . LYS B 1 103 ? 11.328  9.026   -28.604 1.00 13.79  ? 101 LYS B O   1 
ATOM   1955 C CB  A LYS B 1 103 ? 11.638  12.067  -27.894 0.50 14.46  ? 101 LYS B CB  1 
ATOM   1956 C CB  B LYS B 1 103 ? 11.633  12.078  -27.986 0.50 14.88  ? 101 LYS B CB  1 
ATOM   1957 C CG  A LYS B 1 103 ? 11.679  13.541  -28.286 0.50 17.83  ? 101 LYS B CG  1 
ATOM   1958 C CG  B LYS B 1 103 ? 11.884  13.346  -28.785 0.50 17.60  ? 101 LYS B CG  1 
ATOM   1959 C CD  A LYS B 1 103 ? 12.894  14.223  -27.653 0.50 15.63  ? 101 LYS B CD  1 
ATOM   1960 C CD  B LYS B 1 103 ? 13.001  14.178  -28.158 0.50 18.55  ? 101 LYS B CD  1 
ATOM   1961 C CE  A LYS B 1 103 ? 13.176  15.591  -28.262 0.50 16.00  ? 101 LYS B CE  1 
ATOM   1962 C CE  B LYS B 1 103 ? 14.146  13.306  -27.656 0.50 21.73  ? 101 LYS B CE  1 
ATOM   1963 N NZ  A LYS B 1 103 ? 13.890  16.499  -27.313 0.50 15.07  ? 101 LYS B NZ  1 
ATOM   1964 N NZ  B LYS B 1 103 ? 15.478  13.802  -28.148 0.50 27.62  ? 101 LYS B NZ  1 
ATOM   1965 N N   . TYR B 1 104 ? 9.895   9.473   -26.914 1.00 13.32  ? 102 TYR B N   1 
ATOM   1966 C CA  . TYR B 1 104 ? 10.094  8.199   -26.223 1.00 12.33  ? 102 TYR B CA  1 
ATOM   1967 C C   . TYR B 1 104 ? 8.780   7.407   -26.219 1.00 15.14  ? 102 TYR B C   1 
ATOM   1968 O O   . TYR B 1 104 ? 8.349   6.927   -27.269 1.00 15.53  ? 102 TYR B O   1 
ATOM   1969 C CB  . TYR B 1 104 ? 10.670  8.464   -24.826 1.00 12.44  ? 102 TYR B CB  1 
ATOM   1970 C CG  . TYR B 1 104 ? 12.045  9.110   -24.900 1.00 9.81   ? 102 TYR B CG  1 
ATOM   1971 C CD1 . TYR B 1 104 ? 12.232  10.461  -24.638 1.00 12.43  ? 102 TYR B CD1 1 
ATOM   1972 C CD2 . TYR B 1 104 ? 13.137  8.391   -25.377 1.00 14.97  ? 102 TYR B CD2 1 
ATOM   1973 C CE1 . TYR B 1 104 ? 13.486  11.059  -24.754 1.00 12.74  ? 102 TYR B CE1 1 
ATOM   1974 C CE2 . TYR B 1 104 ? 14.398  8.964   -25.469 1.00 13.07  ? 102 TYR B CE2 1 
ATOM   1975 C CZ  . TYR B 1 104 ? 14.577  10.297  -25.138 1.00 15.17  ? 102 TYR B CZ  1 
ATOM   1976 O OH  . TYR B 1 104 ? 15.802  10.905  -25.380 1.00 16.80  ? 102 TYR B OH  1 
ATOM   1977 N N   . LEU B 1 105 ? 8.064   7.409   -25.101 1.00 13.71  ? 103 LEU B N   1 
ATOM   1978 C CA  . LEU B 1 105 ? 6.848   6.596   -25.001 1.00 13.65  ? 103 LEU B CA  1 
ATOM   1979 C C   . LEU B 1 105 ? 5.550   7.382   -25.171 1.00 15.34  ? 103 LEU B C   1 
ATOM   1980 O O   . LEU B 1 105 ? 4.476   6.788   -25.259 1.00 17.71  ? 103 LEU B O   1 
ATOM   1981 C CB  . LEU B 1 105 ? 6.825   5.849   -23.671 1.00 13.29  ? 103 LEU B CB  1 
ATOM   1982 C CG  . LEU B 1 105 ? 8.027   4.966   -23.352 1.00 13.95  ? 103 LEU B CG  1 
ATOM   1983 C CD1 . LEU B 1 105 ? 7.988   4.545   -21.881 1.00 16.18  ? 103 LEU B CD1 1 
ATOM   1984 C CD2 . LEU B 1 105 ? 8.098   3.774   -24.298 1.00 15.48  ? 103 LEU B CD2 1 
ATOM   1985 N N   . GLY B 1 106 ? 5.637   8.710   -25.145 1.00 12.31  ? 104 GLY B N   1 
ATOM   1986 C CA  . GLY B 1 106 ? 4.455   9.569   -25.090 1.00 12.11  ? 104 GLY B CA  1 
ATOM   1987 C C   . GLY B 1 106 ? 3.351   9.261   -26.095 1.00 16.00  ? 104 GLY B C   1 
ATOM   1988 O O   . GLY B 1 106 ? 2.160   9.391   -25.800 1.00 17.40  ? 104 GLY B O   1 
ATOM   1989 N N   . SER B 1 107 ? 3.722   8.928   -27.321 1.00 18.93  ? 105 SER B N   1 
ATOM   1990 C CA  . SER B 1 107 ? 2.713   8.822   -28.371 1.00 20.54  ? 105 SER B CA  1 
ATOM   1991 C C   . SER B 1 107 ? 1.907   7.525   -28.279 1.00 22.20  ? 105 SER B C   1 
ATOM   1992 O O   . SER B 1 107 ? 0.823   7.420   -28.862 1.00 28.50  ? 105 SER B O   1 
ATOM   1993 C CB  . SER B 1 107 ? 3.348   9.012   -29.749 1.00 24.49  ? 105 SER B CB  1 
ATOM   1994 O OG  . SER B 1 107 ? 4.133   7.884   -30.091 1.00 28.86  ? 105 SER B OG  1 
ATOM   1995 N N   . ARG B 1 108 ? 2.408   6.559   -27.511 1.00 21.52  ? 106 ARG B N   1 
ATOM   1996 C CA  . ARG B 1 108 ? 1.651   5.336   -27.246 1.00 26.59  ? 106 ARG B CA  1 
ATOM   1997 C C   . ARG B 1 108 ? 1.045   5.250   -25.849 1.00 25.65  ? 106 ARG B C   1 
ATOM   1998 O O   . ARG B 1 108 ? 0.381   4.265   -25.521 1.00 29.82  ? 106 ARG B O   1 
ATOM   1999 C CB  . ARG B 1 108 ? 2.480   4.079   -27.549 1.00 30.03  ? 106 ARG B CB  1 
ATOM   2000 C CG  . ARG B 1 108 ? 3.747   3.913   -26.712 1.00 34.82  ? 106 ARG B CG  1 
ATOM   2001 C CD  . ARG B 1 108 ? 4.686   2.906   -27.374 1.00 38.01  ? 106 ARG B CD  1 
ATOM   2002 N NE  . ARG B 1 108 ? 6.101   3.144   -27.092 1.00 39.09  ? 106 ARG B NE  1 
ATOM   2003 C CZ  . ARG B 1 108 ? 6.980   3.579   -27.991 1.00 38.42  ? 106 ARG B CZ  1 
ATOM   2004 N NH1 . ARG B 1 108 ? 6.582   3.850   -29.228 1.00 50.61  ? 106 ARG B NH1 1 
ATOM   2005 N NH2 . ARG B 1 108 ? 8.265   3.707   -27.666 1.00 41.73  ? 106 ARG B NH2 1 
ATOM   2006 N N   . THR B 1 109 ? 1.283   6.263   -25.023 1.00 18.19  ? 107 THR B N   1 
ATOM   2007 C CA  . THR B 1 109 ? 0.788   6.262   -23.652 1.00 17.47  ? 107 THR B CA  1 
ATOM   2008 C C   . THR B 1 109 ? -0.547  6.987   -23.616 1.00 16.30  ? 107 THR B C   1 
ATOM   2009 O O   . THR B 1 109 ? -0.705  8.017   -24.265 1.00 19.04  ? 107 THR B O   1 
ATOM   2010 C CB  . THR B 1 109 ? 1.758   6.960   -22.683 1.00 16.85  ? 107 THR B CB  1 
ATOM   2011 O OG1 . THR B 1 109 ? 3.050   6.340   -22.770 1.00 15.78  ? 107 THR B OG1 1 
ATOM   2012 C CG2 . THR B 1 109 ? 1.236   6.850   -21.256 1.00 13.98  ? 107 THR B CG2 1 
ATOM   2013 N N   . SER B 1 110 ? -1.463  6.520   -22.775 1.00 19.52  ? 108 SER B N   1 
ATOM   2014 C CA  . SER B 1 110 ? -2.786  7.126   -22.724 1.00 20.47  ? 108 SER B CA  1 
ATOM   2015 C C   . SER B 1 110 ? -2.699  8.526   -22.130 1.00 20.52  ? 108 SER B C   1 
ATOM   2016 O O   . SER B 1 110 ? -1.790  8.812   -21.345 1.00 17.44  ? 108 SER B O   1 
ATOM   2017 C CB  . SER B 1 110 ? -3.761  6.263   -21.917 1.00 22.52  ? 108 SER B CB  1 
ATOM   2018 O OG  . SER B 1 110 ? -3.485  6.338   -20.531 1.00 22.73  ? 108 SER B OG  1 
ATOM   2019 N N   . GLU B 1 111 ? -3.596  9.407   -22.570 1.00 19.74  ? 109 GLU B N   1 
ATOM   2020 C CA  . GLU B 1 111 ? -3.640  10.765  -22.035 1.00 18.59  ? 109 GLU B CA  1 
ATOM   2021 C C   . GLU B 1 111 ? -3.810  10.750  -20.516 1.00 19.43  ? 109 GLU B C   1 
ATOM   2022 O O   . GLU B 1 111 ? -3.232  11.573  -19.807 1.00 17.89  ? 109 GLU B O   1 
ATOM   2023 C CB  . GLU B 1 111 ? -4.747  11.586  -22.714 1.00 22.70  ? 109 GLU B CB  1 
ATOM   2024 C CG  . GLU B 1 111 ? -4.580  11.750  -24.238 1.00 24.25  ? 109 GLU B CG  1 
ATOM   2025 C CD  . GLU B 1 111 ? -3.262  12.399  -24.645 1.00 37.17  ? 109 GLU B CD  1 
ATOM   2026 O OE1 . GLU B 1 111 ? -2.991  13.539  -24.201 1.00 33.90  ? 109 GLU B OE1 1 
ATOM   2027 O OE2 . GLU B 1 111 ? -2.541  11.808  -25.485 1.00 34.54  ? 109 GLU B OE2 1 
ATOM   2028 N N   . LYS B 1 112 ? -4.572  9.782   -20.016 1.00 21.29  ? 110 LYS B N   1 
ATOM   2029 C CA  . LYS B 1 112 ? -4.860  9.682   -18.589 1.00 21.47  ? 110 LYS B CA  1 
ATOM   2030 C C   . LYS B 1 112 ? -3.584  9.511   -17.755 1.00 19.41  ? 110 LYS B C   1 
ATOM   2031 O O   . LYS B 1 112 ? -3.414  10.166  -16.721 1.00 18.79  ? 110 LYS B O   1 
ATOM   2032 C CB  . LYS B 1 112 ? -5.822  8.513   -18.357 1.00 21.25  ? 110 LYS B CB  1 
ATOM   2033 C CG  . LYS B 1 112 ? -6.273  8.337   -16.926 1.00 24.54  ? 110 LYS B CG  1 
ATOM   2034 C CD  . LYS B 1 112 ? -7.444  7.352   -16.837 1.00 31.77  ? 110 LYS B CD  1 
ATOM   2035 C CE  . LYS B 1 112 ? -8.724  7.971   -17.391 1.00 39.83  ? 110 LYS B CE  1 
ATOM   2036 N NZ  . LYS B 1 112 ? -9.810  6.988   -17.690 1.00 43.52  ? 110 LYS B NZ  1 
ATOM   2037 N N   . VAL B 1 113 ? -2.718  8.597   -18.184 1.00 13.13  ? 111 VAL B N   1 
ATOM   2038 C CA  . VAL B 1 113 ? -1.414  8.366   -17.552 1.00 11.72  ? 111 VAL B CA  1 
ATOM   2039 C C   . VAL B 1 113 ? -0.514  9.600   -17.631 1.00 11.48  ? 111 VAL B C   1 
ATOM   2040 O O   . VAL B 1 113 ? 0.132   9.976   -16.654 1.00 11.93  ? 111 VAL B O   1 
ATOM   2041 C CB  . VAL B 1 113 ? -0.714  7.129   -18.203 1.00 12.77  ? 111 VAL B CB  1 
ATOM   2042 C CG1 . VAL B 1 113 ? 0.745   7.033   -17.820 1.00 11.94  ? 111 VAL B CG1 1 
ATOM   2043 C CG2 . VAL B 1 113 ? -1.479  5.852   -17.846 1.00 12.93  ? 111 VAL B CG2 1 
ATOM   2044 N N   . LYS B 1 114 ? -0.419  10.197  -18.817 1.00 12.78  ? 112 LYS B N   1 
ATOM   2045 C CA  . LYS B 1 114 ? 0.440   11.369  -18.999 1.00 11.05  ? 112 LYS B CA  1 
ATOM   2046 C C   . LYS B 1 114 ? -0.084  12.555  -18.181 1.00 11.99  ? 112 LYS B C   1 
ATOM   2047 O O   . LYS B 1 114 ? 0.686   13.228  -17.495 1.00 12.02  ? 112 LYS B O   1 
ATOM   2048 C CB  . LYS B 1 114 ? 0.590   11.711  -20.488 1.00 11.85  ? 112 LYS B CB  1 
ATOM   2049 C CG  . LYS B 1 114 ? 1.366   10.646  -21.274 1.00 13.07  ? 112 LYS B CG  1 
ATOM   2050 C CD  . LYS B 1 114 ? 1.582   11.062  -22.729 1.00 12.99  ? 112 LYS B CD  1 
ATOM   2051 C CE  . LYS B 1 114 ? 0.250   11.286  -23.428 1.00 15.75  ? 112 LYS B CE  1 
ATOM   2052 N NZ  . LYS B 1 114 ? 0.429   11.346  -24.913 1.00 23.36  ? 112 LYS B NZ  1 
ATOM   2053 N N   . ASN B 1 115 ? -1.398  12.776  -18.215 1.00 11.62  ? 113 ASN B N   1 
ATOM   2054 C CA  . ASN B 1 115 ? -2.015  13.873  -17.462 1.00 12.01  ? 113 ASN B CA  1 
ATOM   2055 C C   . ASN B 1 115 ? -1.700  13.702  -15.989 1.00 11.52  ? 113 ASN B C   1 
ATOM   2056 O O   . ASN B 1 115 ? -1.410  14.680  -15.304 1.00 11.63  ? 113 ASN B O   1 
ATOM   2057 C CB  . ASN B 1 115 ? -3.545  13.880  -17.634 1.00 14.29  ? 113 ASN B CB  1 
ATOM   2058 C CG  . ASN B 1 115 ? -3.983  14.441  -18.965 1.00 16.09  ? 113 ASN B CG  1 
ATOM   2059 O OD1 . ASN B 1 115 ? -5.186  14.432  -19.268 1.00 23.70  ? 113 ASN B OD1 1 
ATOM   2060 N ND2 . ASN B 1 115 ? -3.065  15.081  -19.681 1.00 15.06  ? 113 ASN B ND2 1 
ATOM   2061 N N   . LYS B 1 116 ? -1.855  12.474  -15.493 1.00 12.14  ? 114 LYS B N   1 
ATOM   2062 C CA  . LYS B 1 116 ? -1.571  12.183  -14.092 1.00 14.04  ? 114 LYS B CA  1 
ATOM   2063 C C   . LYS B 1 116 ? -0.134  12.530  -13.713 1.00 11.33  ? 114 LYS B C   1 
ATOM   2064 O O   . LYS B 1 116 ? 0.120   13.093  -12.642 1.00 12.24  ? 114 LYS B O   1 
ATOM   2065 C CB  . LYS B 1 116 ? -1.872  10.725  -13.725 1.00 13.80  ? 114 LYS B CB  1 
ATOM   2066 C CG  . LYS B 1 116 ? -1.823  10.473  -12.203 1.00 15.05  ? 114 LYS B CG  1 
ATOM   2067 C CD  . LYS B 1 116 ? -2.732  11.454  -11.446 1.00 14.86  ? 114 LYS B CD  1 
ATOM   2068 C CE  . LYS B 1 116 ? -2.944  11.119  -9.967  1.00 24.39  ? 114 LYS B CE  1 
ATOM   2069 N NZ  . LYS B 1 116 ? -3.568  9.782   -9.771  1.00 26.73  ? 114 LYS B NZ  1 
ATOM   2070 N N   . ILE B 1 117 ? 0.816   12.112  -14.545 1.00 10.38  ? 115 ILE B N   1 
ATOM   2071 C CA  . ILE B 1 117 ? 2.218   12.455  -14.310 1.00 9.85   ? 115 ILE B CA  1 
ATOM   2072 C C   . ILE B 1 117 ? 2.447   13.974  -14.243 1.00 10.53  ? 115 ILE B C   1 
ATOM   2073 O O   . ILE B 1 117 ? 3.104   14.460  -13.319 1.00 10.83  ? 115 ILE B O   1 
ATOM   2074 C CB  . ILE B 1 117 ? 3.148   11.835  -15.366 1.00 9.15   ? 115 ILE B CB  1 
ATOM   2075 C CG1 . ILE B 1 117 ? 3.232   10.317  -15.188 1.00 8.66   ? 115 ILE B CG1 1 
ATOM   2076 C CG2 . ILE B 1 117 ? 4.525   12.522  -15.321 1.00 8.83   ? 115 ILE B CG2 1 
ATOM   2077 C CD1 . ILE B 1 117 ? 3.939   9.606   -16.356 1.00 8.10   ? 115 ILE B CD1 1 
ATOM   2078 N N   . LEU B 1 118 ? 1.871   14.738  -15.171 1.00 9.54   ? 116 LEU B N   1 
ATOM   2079 C CA  . LEU B 1 118 ? 2.009   16.201  -15.165 1.00 11.06  ? 116 LEU B CA  1 
ATOM   2080 C C   . LEU B 1 118 ? 1.393   16.853  -13.930 1.00 12.19  ? 116 LEU B C   1 
ATOM   2081 O O   . LEU B 1 118 ? 1.983   17.761  -13.330 1.00 12.76  ? 116 LEU B O   1 
ATOM   2082 C CB  . LEU B 1 118 ? 1.425   16.838  -16.439 1.00 11.92  ? 116 LEU B CB  1 
ATOM   2083 C CG  . LEU B 1 118 ? 2.158   16.495  -17.734 1.00 14.35  ? 116 LEU B CG  1 
ATOM   2084 C CD1 . LEU B 1 118 ? 1.411   16.983  -18.982 1.00 15.48  ? 116 LEU B CD1 1 
ATOM   2085 C CD2 . LEU B 1 118 ? 3.573   17.085  -17.674 1.00 12.42  ? 116 LEU B CD2 1 
ATOM   2086 N N   . GLU B 1 119 ? 0.282   16.283  -13.473 1.00 11.57  ? 117 GLU B N   1 
ATOM   2087 C CA  . GLU B 1 119 ? -0.419  16.805  -12.296 1.00 13.36  ? 117 GLU B CA  1 
ATOM   2088 C C   . GLU B 1 119 ? 0.408   16.559  -11.032 1.00 13.00  ? 117 GLU B C   1 
ATOM   2089 O O   . GLU B 1 119 ? 0.536   17.439  -10.174 1.00 13.55  ? 117 GLU B O   1 
ATOM   2090 C CB  . GLU B 1 119 ? -1.786  16.124  -12.168 1.00 16.10  ? 117 GLU B CB  1 
ATOM   2091 C CG  . GLU B 1 119 ? -2.413  16.279  -10.789 1.00 22.66  ? 117 GLU B CG  1 
ATOM   2092 C CD  . GLU B 1 119 ? -3.394  15.169  -10.454 1.00 33.58  ? 117 GLU B CD  1 
ATOM   2093 O OE1 . GLU B 1 119 ? -3.144  14.398  -9.496  1.00 37.83  ? 117 GLU B OE1 1 
ATOM   2094 O OE2 . GLU B 1 119 ? -4.358  15.000  -11.227 1.00 33.96  ? 117 GLU B OE2 1 
ATOM   2095 N N   . LEU B 1 120 ? 0.914   15.335  -10.893 1.00 12.01  ? 118 LEU B N   1 
ATOM   2096 C CA  . LEU B 1 120 ? 1.818   15.016  -9.791  1.00 11.31  ? 118 LEU B CA  1 
ATOM   2097 C C   . LEU B 1 120 ? 3.078   15.878  -9.749  1.00 10.91  ? 118 LEU B C   1 
ATOM   2098 O O   . LEU B 1 120 ? 3.403   16.460  -8.711  1.00 11.30  ? 118 LEU B O   1 
ATOM   2099 C CB  . LEU B 1 120 ? 2.193   13.534  -9.787  1.00 10.70  ? 118 LEU B CB  1 
ATOM   2100 C CG  . LEU B 1 120 ? 1.122   12.508  -9.381  1.00 11.16  ? 118 LEU B CG  1 
ATOM   2101 C CD1 . LEU B 1 120 ? 1.606   11.081  -9.638  1.00 11.69  ? 118 LEU B CD1 1 
ATOM   2102 C CD2 . LEU B 1 120 ? 0.698   12.673  -7.919  1.00 11.71  ? 118 LEU B CD2 1 
ATOM   2103 N N   . LEU B 1 121 ? 3.747   16.024  -10.888 1.00 10.45  ? 119 LEU B N   1 
ATOM   2104 C CA  . LEU B 1 121 ? 4.963   16.835  -10.953 1.00 9.09   ? 119 LEU B CA  1 
ATOM   2105 C C   . LEU B 1 121 ? 4.671   18.276  -10.527 1.00 10.85  ? 119 LEU B C   1 
ATOM   2106 O O   . LEU B 1 121 ? 5.424   18.868  -9.744  1.00 10.64  ? 119 LEU B O   1 
ATOM   2107 C CB  . LEU B 1 121 ? 5.565   16.809  -12.364 1.00 9.44   ? 119 LEU B CB  1 
ATOM   2108 C CG  . LEU B 1 121 ? 6.333   15.535  -12.765 1.00 8.86   ? 119 LEU B CG  1 
ATOM   2109 C CD1 . LEU B 1 121 ? 6.645   15.593  -14.277 1.00 8.15   ? 119 LEU B CD1 1 
ATOM   2110 C CD2 . LEU B 1 121 ? 7.621   15.342  -11.956 1.00 7.63   ? 119 LEU B CD2 1 
ATOM   2111 N N   . TYR B 1 122 ? 3.541   18.816  -10.982 1.00 10.77  ? 120 TYR B N   1 
ATOM   2112 C CA  . TYR B 1 122 ? 3.190   20.199  -10.632 1.00 13.24  ? 120 TYR B CA  1 
ATOM   2113 C C   . TYR B 1 122 ? 2.968   20.299  -9.128  1.00 12.86  ? 120 TYR B C   1 
ATOM   2114 O O   . TYR B 1 122 ? 3.485   21.207  -8.471  1.00 12.60  ? 120 TYR B O   1 
ATOM   2115 C CB  . TYR B 1 122 ? 1.929   20.645  -11.378 1.00 14.77  ? 120 TYR B CB  1 
ATOM   2116 C CG  . TYR B 1 122 ? 1.421   22.006  -10.930 1.00 15.41  ? 120 TYR B CG  1 
ATOM   2117 C CD1 . TYR B 1 122 ? 2.185   23.146  -11.133 1.00 17.05  ? 120 TYR B CD1 1 
ATOM   2118 C CD2 . TYR B 1 122 ? 0.322   22.105  -10.077 1.00 16.44  ? 120 TYR B CD2 1 
ATOM   2119 C CE1 . TYR B 1 122 ? 1.751   24.394  -10.682 1.00 14.94  ? 120 TYR B CE1 1 
ATOM   2120 C CE2 . TYR B 1 122 ? -0.067  23.326  -9.541  1.00 21.52  ? 120 TYR B CE2 1 
ATOM   2121 C CZ  . TYR B 1 122 ? 0.607   24.479  -9.905  1.00 20.06  ? 120 TYR B CZ  1 
ATOM   2122 O OH  . TYR B 1 122 ? 0.212   25.684  -9.339  1.00 21.89  ? 120 TYR B OH  1 
ATOM   2123 N N   . SER B 1 123 ? 2.263   19.313  -8.578  1.00 12.65  ? 121 SER B N   1 
ATOM   2124 C CA  . SER B 1 123 ? 1.968   19.330  -7.148  1.00 14.38  ? 121 SER B CA  1 
ATOM   2125 C C   . SER B 1 123 ? 3.246   19.345  -6.311  1.00 15.12  ? 121 SER B C   1 
ATOM   2126 O O   . SER B 1 123 ? 3.326   20.061  -5.307  1.00 16.84  ? 121 SER B O   1 
ATOM   2127 C CB  . SER B 1 123 ? 1.016   18.197  -6.752  1.00 15.12  ? 121 SER B CB  1 
ATOM   2128 O OG  . SER B 1 123 ? 1.688   16.947  -6.674  1.00 12.27  ? 121 SER B OG  1 
ATOM   2129 N N   . TRP B 1 124 ? 4.247   18.581  -6.743  1.00 13.68  ? 122 TRP B N   1 
ATOM   2130 C CA  . TRP B 1 124 ? 5.529   18.548  -6.049  1.00 13.53  ? 122 TRP B CA  1 
ATOM   2131 C C   . TRP B 1 124 ? 6.359   19.813  -6.239  1.00 14.18  ? 122 TRP B C   1 
ATOM   2132 O O   . TRP B 1 124 ? 7.094   20.211  -5.340  1.00 14.84  ? 122 TRP B O   1 
ATOM   2133 C CB  . TRP B 1 124 ? 6.345   17.307  -6.453  1.00 12.71  ? 122 TRP B CB  1 
ATOM   2134 C CG  . TRP B 1 124 ? 5.603   15.989  -6.318  1.00 12.25  ? 122 TRP B CG  1 
ATOM   2135 C CD1 . TRP B 1 124 ? 4.654   15.666  -5.393  1.00 12.73  ? 122 TRP B CD1 1 
ATOM   2136 C CD2 . TRP B 1 124 ? 5.826   14.799  -7.094  1.00 10.76  ? 122 TRP B CD2 1 
ATOM   2137 N NE1 . TRP B 1 124 ? 4.244   14.356  -5.559  1.00 12.20  ? 122 TRP B NE1 1 
ATOM   2138 C CE2 . TRP B 1 124 ? 4.917   13.822  -6.628  1.00 11.16  ? 122 TRP B CE2 1 
ATOM   2139 C CE3 . TRP B 1 124 ? 6.668   14.481  -8.170  1.00 9.92   ? 122 TRP B CE3 1 
ATOM   2140 C CZ2 . TRP B 1 124 ? 4.801   12.568  -7.222  1.00 10.30  ? 122 TRP B CZ2 1 
ATOM   2141 C CZ3 . TRP B 1 124 ? 6.607   13.188  -8.716  1.00 9.33   ? 122 TRP B CZ3 1 
ATOM   2142 C CH2 . TRP B 1 124 ? 5.696   12.244  -8.208  1.00 9.58   ? 122 TRP B CH2 1 
ATOM   2143 N N   . THR B 1 125 ? 6.289   20.431  -7.413  1.00 14.56  ? 123 THR B N   1 
ATOM   2144 C CA  . THR B 1 125 ? 6.992   21.698  -7.610  1.00 13.54  ? 123 THR B CA  1 
ATOM   2145 C C   . THR B 1 125 ? 6.504   22.777  -6.645  1.00 14.30  ? 123 THR B C   1 
ATOM   2146 O O   . THR B 1 125 ? 7.268   23.653  -6.254  1.00 17.69  ? 123 THR B O   1 
ATOM   2147 C CB  . THR B 1 125 ? 6.870   22.225  -9.050  1.00 14.44  ? 123 THR B CB  1 
ATOM   2148 O OG1 . THR B 1 125 ? 5.508   22.606  -9.292  1.00 17.37  ? 123 THR B OG1 1 
ATOM   2149 C CG2 . THR B 1 125 ? 7.364   21.185  -10.069 1.00 12.85  ? 123 THR B CG2 1 
ATOM   2150 N N   . VAL B 1 126 ? 5.206   22.777  -6.345  1.00 17.93  ? 124 VAL B N   1 
ATOM   2151 C CA  A VAL B 1 126 ? 4.613   23.774  -5.454  0.50 19.64  ? 124 VAL B CA  1 
ATOM   2152 C CA  B VAL B 1 126 ? 4.627   23.778  -5.452  0.50 19.57  ? 124 VAL B CA  1 
ATOM   2153 C C   . VAL B 1 126 ? 4.754   23.381  -3.984  1.00 22.69  ? 124 VAL B C   1 
ATOM   2154 O O   . VAL B 1 126 ? 5.015   24.230  -3.111  1.00 23.99  ? 124 VAL B O   1 
ATOM   2155 C CB  A VAL B 1 126 ? 3.121   24.006  -5.787  0.50 19.23  ? 124 VAL B CB  1 
ATOM   2156 C CB  B VAL B 1 126 ? 3.148   24.067  -5.794  0.50 19.46  ? 124 VAL B CB  1 
ATOM   2157 C CG1 A VAL B 1 126 ? 2.525   25.066  -4.865  0.50 22.49  ? 124 VAL B CG1 1 
ATOM   2158 C CG1 B VAL B 1 126 ? 3.056   24.929  -7.049  0.50 21.17  ? 124 VAL B CG1 1 
ATOM   2159 C CG2 A VAL B 1 126 ? 2.967   24.414  -7.252  0.50 20.82  ? 124 VAL B CG2 1 
ATOM   2160 C CG2 B VAL B 1 126 ? 2.372   22.770  -5.963  0.50 19.41  ? 124 VAL B CG2 1 
ATOM   2161 N N   . GLY B 1 127 ? 4.555   22.096  -3.718  1.00 17.96  ? 125 GLY B N   1 
ATOM   2162 C CA  . GLY B 1 127 ? 4.568   21.530  -2.381  1.00 20.36  ? 125 GLY B CA  1 
ATOM   2163 C C   . GLY B 1 127 ? 5.899   21.085  -1.798  1.00 18.06  ? 125 GLY B C   1 
ATOM   2164 O O   . GLY B 1 127 ? 6.019   20.997  -0.564  1.00 20.01  ? 125 GLY B O   1 
ATOM   2165 N N   . LEU B 1 128 ? 6.874   20.794  -2.660  1.00 17.20  ? 126 LEU B N   1 
ATOM   2166 C CA  . LEU B 1 128 ? 8.177   20.265  -2.229  1.00 16.49  ? 126 LEU B CA  1 
ATOM   2167 C C   . LEU B 1 128 ? 9.317   21.058  -2.874  1.00 19.41  ? 126 LEU B C   1 
ATOM   2168 O O   . LEU B 1 128 ? 10.156  20.502  -3.607  1.00 16.35  ? 126 LEU B O   1 
ATOM   2169 C CB  . LEU B 1 128 ? 8.315   18.769  -2.537  1.00 15.27  ? 126 LEU B CB  1 
ATOM   2170 C CG  . LEU B 1 128 ? 7.509   17.806  -1.666  1.00 16.83  ? 126 LEU B CG  1 
ATOM   2171 C CD1 . LEU B 1 128 ? 7.542   16.381  -2.230  1.00 16.79  ? 126 LEU B CD1 1 
ATOM   2172 C CD2 . LEU B 1 128 ? 8.075   17.847  -0.255  1.00 18.00  ? 126 LEU B CD2 1 
ATOM   2173 N N   . PRO B 1 129 ? 9.311   22.381  -2.658  1.00 21.75  ? 127 PRO B N   1 
ATOM   2174 C CA  . PRO B 1 129 ? 10.252  23.223  -3.406  1.00 22.34  ? 127 PRO B CA  1 
ATOM   2175 C C   . PRO B 1 129 ? 11.693  22.978  -2.952  1.00 23.77  ? 127 PRO B C   1 
ATOM   2176 O O   . PRO B 1 129 ? 12.631  23.340  -3.674  1.00 24.50  ? 127 PRO B O   1 
ATOM   2177 C CB  . PRO B 1 129 ? 9.789   24.654  -3.101  1.00 25.26  ? 127 PRO B CB  1 
ATOM   2178 C CG  . PRO B 1 129 ? 8.415   24.518  -2.507  1.00 31.33  ? 127 PRO B CG  1 
ATOM   2179 C CD  . PRO B 1 129 ? 8.366   23.170  -1.848  1.00 22.75  ? 127 PRO B CD  1 
ATOM   2180 N N   . GLU B 1 130 ? 11.852  22.169  -1.903  1.00 20.66  ? 128 GLU B N   1 
ATOM   2181 C CA  . GLU B 1 130 ? 13.161  21.616  -1.561  1.00 22.51  ? 128 GLU B CA  1 
ATOM   2182 C C   . GLU B 1 130 ? 13.829  20.797  -2.666  1.00 22.29  ? 128 GLU B C   1 
ATOM   2183 O O   . GLU B 1 130 ? 15.057  20.875  -2.834  1.00 23.55  ? 128 GLU B O   1 
ATOM   2184 C CB  . GLU B 1 130 ? 13.114  20.790  -0.269  1.00 21.09  ? 128 GLU B CB  1 
ATOM   2185 C CG  . GLU B 1 130 ? 12.091  19.680  -0.236  1.00 30.07  ? 128 GLU B CG  1 
ATOM   2186 C CD  . GLU B 1 130 ? 10.929  20.006  0.683   1.00 39.23  ? 128 GLU B CD  1 
ATOM   2187 O OE1 . GLU B 1 130 ? 10.280  21.063  0.486   1.00 27.07  ? 128 GLU B OE1 1 
ATOM   2188 O OE2 . GLU B 1 130 ? 10.727  19.235  1.648   1.00 37.45  ? 128 GLU B OE2 1 
ATOM   2189 N N   . GLU B 1 131 ? 13.034  19.960  -3.336  1.00 16.69  ? 129 GLU B N   1 
ATOM   2190 C CA  . GLU B 1 131 ? 13.536  19.015  -4.333  1.00 14.76  ? 129 GLU B CA  1 
ATOM   2191 C C   . GLU B 1 131 ? 13.682  19.793  -5.639  1.00 15.08  ? 129 GLU B C   1 
ATOM   2192 O O   . GLU B 1 131 ? 12.800  19.753  -6.490  1.00 15.93  ? 129 GLU B O   1 
ATOM   2193 C CB  . GLU B 1 131 ? 12.569  17.832  -4.538  1.00 14.87  ? 129 GLU B CB  1 
ATOM   2194 C CG  . GLU B 1 131 ? 12.206  17.025  -3.280  1.00 14.56  ? 129 GLU B CG  1 
ATOM   2195 C CD  . GLU B 1 131 ? 13.375  16.237  -2.711  1.00 21.40  ? 129 GLU B CD  1 
ATOM   2196 O OE1 . GLU B 1 131 ? 13.346  15.875  -1.506  1.00 17.34  ? 129 GLU B OE1 1 
ATOM   2197 O OE2 . GLU B 1 131 ? 14.356  16.021  -3.457  1.00 20.90  ? 129 GLU B OE2 1 
ATOM   2198 N N   . VAL B 1 132 ? 14.792  20.510  -5.787  1.00 14.05  ? 130 VAL B N   1 
ATOM   2199 C CA  . VAL B 1 132 ? 14.996  21.371  -6.950  1.00 16.04  ? 130 VAL B CA  1 
ATOM   2200 C C   . VAL B 1 132 ? 14.913  20.669  -8.309  1.00 14.56  ? 130 VAL B C   1 
ATOM   2201 O O   . VAL B 1 132 ? 14.554  21.285  -9.312  1.00 13.68  ? 130 VAL B O   1 
ATOM   2202 C CB  . VAL B 1 132 ? 16.324  22.134  -6.833  1.00 18.95  ? 130 VAL B CB  1 
ATOM   2203 C CG1 . VAL B 1 132 ? 16.249  23.131  -5.682  1.00 23.44  ? 130 VAL B CG1 1 
ATOM   2204 C CG2 . VAL B 1 132 ? 17.462  21.153  -6.601  1.00 19.27  ? 130 VAL B CG2 1 
ATOM   2205 N N   . LYS B 1 133 ? 15.311  19.402  -8.371  1.00 13.05  ? 131 LYS B N   1 
ATOM   2206 C CA  . LYS B 1 133 ? 15.388  18.729  -9.660  1.00 11.83  ? 131 LYS B CA  1 
ATOM   2207 C C   . LYS B 1 133 ? 13.979  18.430  -10.175 1.00 10.16  ? 131 LYS B C   1 
ATOM   2208 O O   . LYS B 1 133 ? 13.763  18.296  -11.382 1.00 9.37   ? 131 LYS B O   1 
ATOM   2209 C CB  . LYS B 1 133 ? 16.228  17.448  -9.553  1.00 11.55  ? 131 LYS B CB  1 
ATOM   2210 C CG  . LYS B 1 133 ? 17.727  17.687  -9.403  1.00 13.17  ? 131 LYS B CG  1 
ATOM   2211 C CD  . LYS B 1 133 ? 18.451  16.357  -9.150  1.00 13.61  ? 131 LYS B CD  1 
ATOM   2212 C CE  . LYS B 1 133 ? 19.958  16.568  -9.190  1.00 16.85  ? 131 LYS B CE  1 
ATOM   2213 N NZ  . LYS B 1 133 ? 20.739  15.411  -8.665  1.00 14.87  ? 131 LYS B NZ  1 
ATOM   2214 N N   . ILE B 1 134 ? 13.040  18.223  -9.254  1.00 9.92   ? 132 ILE B N   1 
ATOM   2215 C CA  . ILE B 1 134 ? 11.644  18.040  -9.652  1.00 9.95   ? 132 ILE B CA  1 
ATOM   2216 C C   . ILE B 1 134 ? 11.143  19.288  -10.369 1.00 10.05  ? 132 ILE B C   1 
ATOM   2217 O O   . ILE B 1 134 ? 10.610  19.201  -11.470 1.00 9.09   ? 132 ILE B O   1 
ATOM   2218 C CB  . ILE B 1 134 ? 10.703  17.741  -8.464  1.00 9.64   ? 132 ILE B CB  1 
ATOM   2219 C CG1 . ILE B 1 134 ? 11.071  16.390  -7.839  1.00 9.11   ? 132 ILE B CG1 1 
ATOM   2220 C CG2 . ILE B 1 134 ? 9.253   17.649  -8.978  1.00 9.05   ? 132 ILE B CG2 1 
ATOM   2221 C CD1 . ILE B 1 134 ? 10.215  16.029  -6.630  1.00 9.32   ? 132 ILE B CD1 1 
ATOM   2222 N N   . ALA B 1 135 ? 11.417  20.456  -9.788  1.00 11.74  ? 133 ALA B N   1 
ATOM   2223 C CA  . ALA B 1 135 ? 11.131  21.719  -10.463 1.00 12.52  ? 133 ALA B CA  1 
ATOM   2224 C C   . ALA B 1 135 ? 11.877  21.818  -11.796 1.00 11.82  ? 133 ALA B C   1 
ATOM   2225 O O   . ALA B 1 135 ? 11.301  22.259  -12.795 1.00 12.62  ? 133 ALA B O   1 
ATOM   2226 C CB  . ALA B 1 135 ? 11.464  22.896  -9.554  1.00 13.11  ? 133 ALA B CB  1 
ATOM   2227 N N   . GLU B 1 136 ? 13.144  21.402  -11.827 1.00 12.04  ? 134 GLU B N   1 
ATOM   2228 C CA  . GLU B 1 136 ? 13.921  21.491  -13.067 1.00 12.07  ? 134 GLU B CA  1 
ATOM   2229 C C   . GLU B 1 136 ? 13.271  20.648  -14.161 1.00 11.19  ? 134 GLU B C   1 
ATOM   2230 O O   . GLU B 1 136 ? 13.091  21.116  -15.275 1.00 11.87  ? 134 GLU B O   1 
ATOM   2231 C CB  . GLU B 1 136 ? 15.360  21.012  -12.848 1.00 13.22  ? 134 GLU B CB  1 
ATOM   2232 C CG  . GLU B 1 136 ? 16.221  21.978  -12.051 1.00 17.57  ? 134 GLU B CG  1 
ATOM   2233 C CD  . GLU B 1 136 ? 17.582  21.380  -11.695 1.00 26.41  ? 134 GLU B CD  1 
ATOM   2234 O OE1 . GLU B 1 136 ? 17.947  21.404  -10.499 1.00 35.31  ? 134 GLU B OE1 1 
ATOM   2235 O OE2 . GLU B 1 136 ? 18.223  20.760  -12.575 1.00 18.85  ? 134 GLU B OE2 1 
ATOM   2236 N N   . ALA B 1 137 ? 12.843  19.435  -13.820 1.00 9.27   ? 135 ALA B N   1 
ATOM   2237 C CA  . ALA B 1 137 ? 12.227  18.559  -14.814 1.00 9.04   ? 135 ALA B CA  1 
ATOM   2238 C C   . ALA B 1 137 ? 10.877  19.119  -15.278 1.00 9.18   ? 135 ALA B C   1 
ATOM   2239 O O   . ALA B 1 137 ? 10.602  19.176  -16.475 1.00 8.95   ? 135 ALA B O   1 
ATOM   2240 C CB  . ALA B 1 137 ? 12.085  17.124  -14.266 1.00 7.92   ? 135 ALA B CB  1 
ATOM   2241 N N   . TYR B 1 138 ? 10.065  19.611  -14.345 1.00 10.09  ? 136 TYR B N   1 
ATOM   2242 C CA  . TYR B 1 138 ? 8.744   20.144  -14.717 1.00 10.39  ? 136 TYR B CA  1 
ATOM   2243 C C   . TYR B 1 138 ? 8.889   21.397  -15.597 1.00 11.14  ? 136 TYR B C   1 
ATOM   2244 O O   . TYR B 1 138 ? 8.150   21.588  -16.573 1.00 11.63  ? 136 TYR B O   1 
ATOM   2245 C CB  . TYR B 1 138 ? 7.941   20.492  -13.460 1.00 10.64  ? 136 TYR B CB  1 
ATOM   2246 C CG  . TYR B 1 138 ? 6.513   20.913  -13.750 1.00 11.16  ? 136 TYR B CG  1 
ATOM   2247 C CD1 . TYR B 1 138 ? 5.613   20.029  -14.328 1.00 11.08  ? 136 TYR B CD1 1 
ATOM   2248 C CD2 . TYR B 1 138 ? 6.114   22.232  -13.585 1.00 13.16  ? 136 TYR B CD2 1 
ATOM   2249 C CE1 . TYR B 1 138 ? 4.296   20.406  -14.569 1.00 12.04  ? 136 TYR B CE1 1 
ATOM   2250 C CE2 . TYR B 1 138 ? 4.843   22.651  -13.938 1.00 13.28  ? 136 TYR B CE2 1 
ATOM   2251 C CZ  . TYR B 1 138 ? 3.928   21.722  -14.402 1.00 14.38  ? 136 TYR B CZ  1 
ATOM   2252 O OH  . TYR B 1 138 ? 2.638   22.139  -14.663 1.00 15.05  ? 136 TYR B OH  1 
ATOM   2253 N N   . GLN B 1 139 ? 9.851   22.251  -15.253 1.00 11.15  ? 137 GLN B N   1 
ATOM   2254 C CA  . GLN B 1 139 ? 10.091  23.461  -16.030 1.00 13.03  ? 137 GLN B CA  1 
ATOM   2255 C C   . GLN B 1 139 ? 10.509  23.108  -17.462 1.00 12.05  ? 137 GLN B C   1 
ATOM   2256 O O   . GLN B 1 139 ? 10.085  23.762  -18.406 1.00 13.07  ? 137 GLN B O   1 
ATOM   2257 C CB  . GLN B 1 139 ? 11.138  24.352  -15.346 1.00 12.54  ? 137 GLN B CB  1 
ATOM   2258 C CG  . GLN B 1 139 ? 10.596  25.088  -14.113 1.00 14.11  ? 137 GLN B CG  1 
ATOM   2259 C CD  . GLN B 1 139 ? 9.533   26.114  -14.459 1.00 13.74  ? 137 GLN B CD  1 
ATOM   2260 O OE1 . GLN B 1 139 ? 8.357   25.953  -14.119 1.00 13.88  ? 137 GLN B OE1 1 
ATOM   2261 N NE2 . GLN B 1 139 ? 9.949   27.194  -15.125 1.00 14.40  ? 137 GLN B NE2 1 
ATOM   2262 N N   . MET B 1 140 ? 11.345  22.081  -17.613 1.00 12.57  ? 138 MET B N   1 
ATOM   2263 C CA  . MET B 1 140 ? 11.771  21.620  -18.936 1.00 12.77  ? 138 MET B CA  1 
ATOM   2264 C C   . MET B 1 140 ? 10.562  21.137  -19.733 1.00 12.81  ? 138 MET B C   1 
ATOM   2265 O O   . MET B 1 140 ? 10.414  21.446  -20.918 1.00 13.09  ? 138 MET B O   1 
ATOM   2266 C CB  . MET B 1 140 ? 12.840  20.526  -18.801 1.00 12.51  ? 138 MET B CB  1 
ATOM   2267 C CG  . MET B 1 140 ? 13.294  19.872  -20.104 1.00 13.43  ? 138 MET B CG  1 
ATOM   2268 S SD  . MET B 1 140 ? 12.143  18.596  -20.655 1.00 12.27  ? 138 MET B SD  1 
ATOM   2269 C CE  . MET B 1 140 ? 12.472  17.334  -19.426 1.00 10.70  ? 138 MET B CE  1 
ATOM   2270 N N   . LEU B 1 141 ? 9.670   20.384  -19.088 1.00 11.26  ? 139 LEU B N   1 
ATOM   2271 C CA  . LEU B 1 141 ? 8.470   19.923  -19.788 1.00 11.01  ? 139 LEU B CA  1 
ATOM   2272 C C   . LEU B 1 141 ? 7.595   21.077  -20.291 1.00 12.57  ? 139 LEU B C   1 
ATOM   2273 O O   . LEU B 1 141 ? 7.175   21.097  -21.450 1.00 13.43  ? 139 LEU B O   1 
ATOM   2274 C CB  . LEU B 1 141 ? 7.659   18.962  -18.907 1.00 10.31  ? 139 LEU B CB  1 
ATOM   2275 C CG  . LEU B 1 141 ? 8.397   17.655  -18.602 1.00 9.25   ? 139 LEU B CG  1 
ATOM   2276 C CD1 . LEU B 1 141 ? 7.701   16.894  -17.472 1.00 8.48   ? 139 LEU B CD1 1 
ATOM   2277 C CD2 . LEU B 1 141 ? 8.502   16.759  -19.855 1.00 8.54   ? 139 LEU B CD2 1 
ATOM   2278 N N   . LYS B 1 142 ? 7.415   22.096  -19.458 1.00 11.41  ? 140 LYS B N   1 
ATOM   2279 C CA  A LYS B 1 142 ? 6.707   23.326  -19.832 0.50 12.32  ? 140 LYS B CA  1 
ATOM   2280 C CA  B LYS B 1 142 ? 6.663   23.258  -19.902 0.50 12.58  ? 140 LYS B CA  1 
ATOM   2281 C C   . LYS B 1 142 ? 7.394   23.979  -21.031 1.00 13.31  ? 140 LYS B C   1 
ATOM   2282 O O   . LYS B 1 142 ? 6.770   24.328  -22.035 1.00 14.23  ? 140 LYS B O   1 
ATOM   2283 C CB  A LYS B 1 142 ? 6.736   24.324  -18.661 0.50 12.38  ? 140 LYS B CB  1 
ATOM   2284 C CB  B LYS B 1 142 ? 6.348   24.206  -18.739 0.50 12.66  ? 140 LYS B CB  1 
ATOM   2285 C CG  A LYS B 1 142 ? 5.548   24.277  -17.701 0.50 15.51  ? 140 LYS B CG  1 
ATOM   2286 C CG  B LYS B 1 142 ? 5.746   23.529  -17.508 0.50 11.89  ? 140 LYS B CG  1 
ATOM   2287 C CD  A LYS B 1 142 ? 5.868   24.898  -16.332 0.50 12.50  ? 140 LYS B CD  1 
ATOM   2288 C CD  B LYS B 1 142 ? 4.708   22.475  -17.877 0.50 12.35  ? 140 LYS B CD  1 
ATOM   2289 C CE  A LYS B 1 142 ? 6.171   26.397  -16.388 0.50 16.31  ? 140 LYS B CE  1 
ATOM   2290 C CE  B LYS B 1 142 ? 3.466   23.063  -18.525 0.50 17.76  ? 140 LYS B CE  1 
ATOM   2291 N NZ  A LYS B 1 142 ? 6.069   27.003  -15.017 0.50 13.87  ? 140 LYS B NZ  1 
ATOM   2292 N NZ  B LYS B 1 142 ? 2.451   21.985  -18.745 0.50 17.08  ? 140 LYS B NZ  1 
ATOM   2293 N N   . LYS B 1 143 ? 8.711   24.122  -20.909 1.00 13.01  ? 141 LYS B N   1 
ATOM   2294 C CA  . LYS B 1 143 ? 9.494   24.795  -21.938 1.00 16.30  ? 141 LYS B CA  1 
ATOM   2295 C C   . LYS B 1 143 ? 9.402   24.078  -23.291 1.00 15.43  ? 141 LYS B C   1 
ATOM   2296 O O   . LYS B 1 143 ? 9.252   24.739  -24.318 1.00 16.87  ? 141 LYS B O   1 
ATOM   2297 C CB  . LYS B 1 143 ? 10.947  24.974  -21.509 1.00 13.52  ? 141 LYS B CB  1 
ATOM   2298 C CG  . LYS B 1 143 ? 11.798  25.671  -22.568 1.00 16.93  ? 141 LYS B CG  1 
ATOM   2299 C CD  . LYS B 1 143 ? 13.205  25.924  -22.085 1.00 16.42  ? 141 LYS B CD  1 
ATOM   2300 C CE  . LYS B 1 143 ? 14.033  26.492  -23.238 1.00 22.94  ? 141 LYS B CE  1 
ATOM   2301 N NZ  . LYS B 1 143 ? 15.205  27.254  -22.759 1.00 32.05  ? 141 LYS B NZ  1 
ATOM   2302 N N   . GLN B 1 144 ? 9.401   22.744  -23.302 1.00 15.56  ? 142 GLN B N   1 
ATOM   2303 C CA  . GLN B 1 144 ? 9.263   21.935  -24.500 1.00 16.67  ? 142 GLN B CA  1 
ATOM   2304 C C   . GLN B 1 144 ? 7.825   21.774  -24.980 1.00 18.96  ? 142 GLN B C   1 
ATOM   2305 O O   . GLN B 1 144 ? 7.579   21.097  -25.920 1.00 19.55  ? 142 GLN B O   1 
ATOM   2306 C CB  . GLN B 1 144 ? 9.848   20.534  -24.274 1.00 15.94  ? 142 GLN B CB  1 
ATOM   2307 C CG  . GLN B 1 144 ? 11.256  20.523  -23.948 1.00 15.01  ? 142 GLN B CG  1 
ATOM   2308 C CD  . GLN B 1 144 ? 12.122  21.160  -25.051 1.00 25.65  ? 142 GLN B CD  1 
ATOM   2309 O OE1 . GLN B 1 144 ? 12.649  22.210  -24.890 1.00 30.64  ? 142 GLN B OE1 1 
ATOM   2310 N NE2 . GLN B 1 144 ? 12.267  20.471  -26.133 1.00 23.53  ? 142 GLN B NE2 1 
ATOM   2311 N N   . GLY B 1 145 ? 6.889   22.416  -24.296 1.00 14.91  ? 143 GLY B N   1 
ATOM   2312 C CA  . GLY B 1 145 ? 5.491   22.428  -24.723 1.00 16.50  ? 143 GLY B CA  1 
ATOM   2313 C C   . GLY B 1 145 ? 4.667   21.192  -24.383 1.00 17.62  ? 143 GLY B C   1 
ATOM   2314 O O   . GLY B 1 145 ? 3.620   20.954  -24.995 1.00 19.07  ? 143 GLY B O   1 
ATOM   2315 N N   . ILE B 1 146 ? 5.127   20.395  -23.422 1.00 17.53  ? 144 ILE B N   1 
ATOM   2316 C CA  . ILE B 1 146 ? 4.376   19.207  -23.003 1.00 19.77  ? 144 ILE B CA  1 
ATOM   2317 C C   . ILE B 1 146 ? 3.251   19.685  -22.087 1.00 22.68  ? 144 ILE B C   1 
ATOM   2318 O O   . ILE B 1 146 ? 3.521   20.298  -21.049 1.00 24.88  ? 144 ILE B O   1 
ATOM   2319 C CB  . ILE B 1 146 ? 5.231   18.244  -22.164 1.00 17.26  ? 144 ILE B CB  1 
ATOM   2320 C CG1 . ILE B 1 146 ? 6.532   17.849  -22.870 1.00 16.87  ? 144 ILE B CG1 1 
ATOM   2321 C CG2 . ILE B 1 146 ? 4.422   17.006  -21.773 1.00 18.52  ? 144 ILE B CG2 1 
ATOM   2322 C CD1 . ILE B 1 146 ? 6.350   17.253  -24.242 1.00 17.71  ? 144 ILE B CD1 1 
ATOM   2323 N N   . VAL B 1 147 ? 2.007   19.439  -22.486 1.00 19.82  ? 145 VAL B N   1 
ATOM   2324 C CA  . VAL B 1 147 ? 0.830   19.958  -21.776 1.00 20.01  ? 145 VAL B CA  1 
ATOM   2325 C C   . VAL B 1 147 ? -0.163  18.818  -21.556 1.00 21.80  ? 145 VAL B C   1 
ATOM   2326 O O   . VAL B 1 147 ? -0.141  17.813  -22.275 1.00 20.76  ? 145 VAL B O   1 
ATOM   2327 C CB  . VAL B 1 147 ? 0.081   21.079  -22.563 1.00 27.98  ? 145 VAL B CB  1 
ATOM   2328 C CG1 . VAL B 1 147 ? 0.916   22.354  -22.683 1.00 27.97  ? 145 VAL B CG1 1 
ATOM   2329 C CG2 . VAL B 1 147 ? -0.377  20.583  -23.936 1.00 27.85  ? 145 VAL B CG2 1 
ATOM   2330 N N   . LYS B 1 148 ? -1.156  19.011  -20.695 1.00 26.85  ? 146 LYS B N   1 
ATOM   2331 C CA  . LYS B 1 148 ? -2.244  18.021  -20.573 1.00 28.40  ? 146 LYS B CA  1 
ATOM   2332 C C   . LYS B 1 148 ? -3.131  17.925  -21.817 1.00 30.91  ? 146 LYS B C   1 
ATOM   2333 O O   . LYS B 1 148 ? -3.188  18.825  -22.578 1.00 41.55  ? 146 LYS B O   1 
ATOM   2334 C CB  . LYS B 1 148 ? -3.180  18.273  -19.411 1.00 31.13  ? 146 LYS B CB  1 
ATOM   2335 C CG  . LYS B 1 148 ? -2.572  18.451  -18.123 1.00 32.18  ? 146 LYS B CG  1 
ATOM   2336 C CD  . LYS B 1 148 ? -3.604  19.205  -17.210 1.00 34.60  ? 146 LYS B CD  1 
ATOM   2337 C CE  . LYS B 1 148 ? -4.215  18.224  -16.188 1.00 35.85  ? 146 LYS B CE  1 
ATOM   2338 N NZ  . LYS B 1 148 ? -4.009  18.809  -14.822 1.00 37.57  ? 146 LYS B NZ  1 
ATOM   2339 N N   . GLY C 2 3   ? 11.143  4.087   -50.771 1.00 49.19  ? 3   GLY C N   1 
ATOM   2340 C CA  . GLY C 2 3   ? 10.221  4.901   -49.930 1.00 43.62  ? 3   GLY C CA  1 
ATOM   2341 C C   . GLY C 2 3   ? 10.678  4.986   -48.489 1.00 39.85  ? 3   GLY C C   1 
ATOM   2342 O O   . GLY C 2 3   ? 11.757  5.506   -48.198 1.00 36.68  ? 3   GLY C O   1 
ATOM   2343 N N   . PHE C 2 4   ? 9.894   4.391   -47.593 1.00 26.38  ? 4   PHE C N   1 
ATOM   2344 C CA  . PHE C 2 4   ? 9.998   4.687   -46.167 1.00 25.02  ? 4   PHE C CA  1 
ATOM   2345 C C   . PHE C 2 4   ? 10.202  3.421   -45.343 1.00 23.38  ? 4   PHE C C   1 
ATOM   2346 O O   . PHE C 2 4   ? 9.588   2.395   -45.618 1.00 27.29  ? 4   PHE C O   1 
ATOM   2347 C CB  . PHE C 2 4   ? 8.756   5.437   -45.683 1.00 23.85  ? 4   PHE C CB  1 
ATOM   2348 C CG  . PHE C 2 4   ? 8.580   6.780   -46.324 1.00 22.89  ? 4   PHE C CG  1 
ATOM   2349 C CD1 . PHE C 2 4   ? 9.355   7.856   -45.919 1.00 23.83  ? 4   PHE C CD1 1 
ATOM   2350 C CD2 . PHE C 2 4   ? 7.735   6.939   -47.410 1.00 28.53  ? 4   PHE C CD2 1 
ATOM   2351 C CE1 . PHE C 2 4   ? 9.221   9.098   -46.521 1.00 24.84  ? 4   PHE C CE1 1 
ATOM   2352 C CE2 . PHE C 2 4   ? 7.609   8.175   -48.038 1.00 35.46  ? 4   PHE C CE2 1 
ATOM   2353 C CZ  . PHE C 2 4   ? 8.362   9.255   -47.594 1.00 28.31  ? 4   PHE C CZ  1 
ATOM   2354 N N   . SER C 2 5   ? 11.149  3.477   -44.411 1.00 19.65  ? 5   SER C N   1 
ATOM   2355 C CA  . SER C 2 5   ? 11.298  2.468   -43.363 1.00 21.59  ? 5   SER C CA  1 
ATOM   2356 C C   . SER C 2 5   ? 10.026  2.333   -42.538 1.00 20.28  ? 5   SER C C   1 
ATOM   2357 O O   . SER C 2 5   ? 9.365   3.336   -42.251 1.00 24.41  ? 5   SER C O   1 
ATOM   2358 C CB  . SER C 2 5   ? 12.436  2.868   -42.426 1.00 18.87  ? 5   SER C CB  1 
ATOM   2359 O OG  . SER C 2 5   ? 12.848  1.737   -41.680 1.00 20.31  ? 5   SER C OG  1 
ATOM   2360 N N   . ASP C 2 6   ? 9.696   1.108   -42.136 1.00 20.42  ? 6   ASP C N   1 
ATOM   2361 C CA  . ASP C 2 6   ? 8.769   0.923   -41.021 1.00 21.33  ? 6   ASP C CA  1 
ATOM   2362 C C   . ASP C 2 6   ? 9.511   0.738   -39.689 1.00 20.36  ? 6   ASP C C   1 
ATOM   2363 O O   . ASP C 2 6   ? 8.933   0.281   -38.699 1.00 23.50  ? 6   ASP C O   1 
ATOM   2364 C CB  . ASP C 2 6   ? 7.787   -0.221  -41.311 1.00 22.28  ? 6   ASP C CB  1 
ATOM   2365 C CG  . ASP C 2 6   ? 8.482   -1.560  -41.474 1.00 30.46  ? 6   ASP C CG  1 
ATOM   2366 O OD1 . ASP C 2 6   ? 9.678   -1.663  -41.123 1.00 28.28  ? 6   ASP C OD1 1 
ATOM   2367 O OD2 . ASP C 2 6   ? 7.815   -2.522  -41.912 1.00 42.71  ? 6   ASP C OD2 1 
ATOM   2368 N N   . ASP C 2 7   ? 10.802  1.067   -39.672 1.00 15.08  ? 7   ASP C N   1 
ATOM   2369 C CA  . ASP C 2 7   ? 11.633  0.914   -38.470 1.00 13.32  ? 7   ASP C CA  1 
ATOM   2370 C C   . ASP C 2 7   ? 12.108  2.293   -38.002 1.00 12.92  ? 7   ASP C C   1 
ATOM   2371 O O   . ASP C 2 7   ? 11.751  3.321   -38.590 1.00 13.35  ? 7   ASP C O   1 
ATOM   2372 C CB  . ASP C 2 7   ? 12.845  0.021   -38.774 1.00 13.43  ? 7   ASP C CB  1 
ATOM   2373 C CG  . ASP C 2 7   ? 13.445  -0.659  -37.537 1.00 12.45  ? 7   ASP C CG  1 
ATOM   2374 O OD1 . ASP C 2 7   ? 12.934  -0.502  -36.403 1.00 11.84  ? 7   ASP C OD1 1 
ATOM   2375 O OD2 . ASP C 2 7   ? 14.406  -1.445  -37.727 1.00 12.57  ? 7   ASP C OD2 1 
ATOM   2376 N N   . VAL C 2 8   ? 12.984  2.280   -36.997 1.00 12.12  ? 8   VAL C N   1 
ATOM   2377 C CA  . VAL C 2 8   ? 13.539  3.487   -36.393 1.00 12.00  ? 8   VAL C CA  1 
ATOM   2378 C C   . VAL C 2 8   ? 15.069  3.339   -36.381 1.00 11.48  ? 8   VAL C C   1 
ATOM   2379 O O   . VAL C 2 8   ? 15.598  2.235   -36.587 1.00 11.75  ? 8   VAL C O   1 
ATOM   2380 C CB  . VAL C 2 8   ? 12.994  3.667   -34.951 1.00 10.45  ? 8   VAL C CB  1 
ATOM   2381 C CG1 . VAL C 2 8   ? 11.458  3.729   -34.958 1.00 10.98  ? 8   VAL C CG1 1 
ATOM   2382 C CG2 . VAL C 2 8   ? 13.470  2.523   -34.041 1.00 10.39  ? 8   VAL C CG2 1 
ATOM   2383 N N   . PRO C 2 9   ? 15.798  4.455   -36.225 1.00 11.44  ? 9   PRO C N   1 
ATOM   2384 C CA  . PRO C 2 9   ? 17.264  4.389   -36.138 1.00 11.27  ? 9   PRO C CA  1 
ATOM   2385 C C   . PRO C 2 9   ? 17.767  3.580   -34.936 1.00 10.72  ? 9   PRO C C   1 
ATOM   2386 O O   . PRO C 2 9   ? 17.079  3.490   -33.923 1.00 10.40  ? 9   PRO C O   1 
ATOM   2387 C CB  . PRO C 2 9   ? 17.679  5.869   -35.990 1.00 12.75  ? 9   PRO C CB  1 
ATOM   2388 C CG  . PRO C 2 9   ? 16.528  6.659   -36.561 1.00 12.10  ? 9   PRO C CG  1 
ATOM   2389 C CD  . PRO C 2 9   ? 15.295  5.841   -36.212 1.00 11.64  ? 9   PRO C CD  1 
ATOM   2390 N N   . MET C 2 10  ? 18.975  3.025   -35.052 1.00 12.36  ? 10  MET C N   1 
ATOM   2391 C CA  . MET C 2 10  ? 19.558  2.247   -33.970 1.00 11.67  ? 10  MET C CA  1 
ATOM   2392 C C   . MET C 2 10  ? 19.997  3.177   -32.845 1.00 11.56  ? 10  MET C C   1 
ATOM   2393 O O   . MET C 2 10  ? 20.583  4.233   -33.109 1.00 11.95  ? 10  MET C O   1 
ATOM   2394 C CB  . MET C 2 10  ? 20.768  1.448   -34.463 1.00 12.51  ? 10  MET C CB  1 
ATOM   2395 C CG  . MET C 2 10  ? 21.413  0.612   -33.367 1.00 12.44  ? 10  MET C CG  1 
ATOM   2396 S SD  . MET C 2 10  ? 22.741  -0.437  -33.995 1.00 13.21  ? 10  MET C SD  1 
ATOM   2397 C CE  . MET C 2 10  ? 23.919  0.843   -34.344 1.00 15.09  ? 10  MET C CE  1 
ATOM   2398 N N   . VAL C 2 11  ? 19.681  2.801   -31.606 1.00 9.53   ? 11  VAL C N   1 
ATOM   2399 C CA  . VAL C 2 11  ? 20.192  3.499   -30.425 1.00 9.50   ? 11  VAL C CA  1 
ATOM   2400 C C   . VAL C 2 11  ? 21.622  3.057   -30.105 1.00 9.32   ? 11  VAL C C   1 
ATOM   2401 O O   . VAL C 2 11  ? 21.960  1.878   -30.137 1.00 9.41   ? 11  VAL C O   1 
ATOM   2402 C CB  . VAL C 2 11  ? 19.270  3.296   -29.186 1.00 8.54   ? 11  VAL C CB  1 
ATOM   2403 C CG1 . VAL C 2 11  ? 19.929  3.797   -27.902 1.00 8.34   ? 11  VAL C CG1 1 
ATOM   2404 C CG2 . VAL C 2 11  ? 17.937  4.018   -29.392 1.00 8.58   ? 11  VAL C CG2 1 
ATOM   2405 N N   . ILE C 2 12  ? 22.494  4.034   -29.888 1.00 11.21  ? 12  ILE C N   1 
ATOM   2406 C CA  . ILE C 2 12  ? 23.897  3.735   -29.626 1.00 11.43  ? 12  ILE C CA  1 
ATOM   2407 C C   . ILE C 2 12  ? 24.136  3.492   -28.130 1.00 10.78  ? 12  ILE C C   1 
ATOM   2408 O O   . ILE C 2 12  ? 23.683  4.270   -27.278 1.00 10.21  ? 12  ILE C O   1 
ATOM   2409 C CB  . ILE C 2 12  ? 24.826  4.870   -30.145 1.00 11.90  ? 12  ILE C CB  1 
ATOM   2410 C CG1 . ILE C 2 12  ? 24.473  5.266   -31.576 1.00 12.95  ? 12  ILE C CG1 1 
ATOM   2411 C CG2 . ILE C 2 12  ? 26.290  4.432   -30.085 1.00 12.56  ? 12  ILE C CG2 1 
ATOM   2412 C CD1 . ILE C 2 12  ? 24.454  4.127   -32.566 1.00 13.94  ? 12  ILE C CD1 1 
ATOM   2413 N N   . ALA C 2 13  ? 24.780  2.367   -27.815 1.00 12.72  ? 13  ALA C N   1 
ATOM   2414 C CA  . ALA C 2 13  ? 25.072  1.980   -26.428 1.00 12.57  ? 13  ALA C CA  1 
ATOM   2415 C C   . ALA C 2 13  ? 26.210  2.813   -25.821 1.00 13.39  ? 13  ALA C C   1 
ATOM   2416 O O   . ALA C 2 13  ? 26.933  3.525   -26.537 1.00 12.75  ? 13  ALA C O   1 
ATOM   2417 C CB  . ALA C 2 13  ? 25.439  0.489   -26.362 1.00 13.62  ? 13  ALA C CB  1 
ATOM   2418 O OXT . ALA C 2 13  ? 26.382  2.780   -24.594 1.00 13.10  ? 13  ALA C OXT 1 
ATOM   2419 N N   . GLY D 2 3   ? 23.664  4.572   -3.302  1.00 53.97  ? 3   GLY D N   1 
ATOM   2420 C CA  . GLY D 2 3   ? 23.627  6.028   -3.641  1.00 54.53  ? 3   GLY D CA  1 
ATOM   2421 C C   . GLY D 2 3   ? 23.154  6.856   -2.457  1.00 54.76  ? 3   GLY D C   1 
ATOM   2422 O O   . GLY D 2 3   ? 21.930  6.956   -2.202  1.00 57.12  ? 3   GLY D O   1 
ATOM   2423 N N   . PHE D 2 4   ? 24.095  7.460   -1.725  1.00 38.75  ? 4   PHE D N   1 
ATOM   2424 C CA  . PHE D 2 4   ? 24.835  8.655   -2.138  1.00 34.62  ? 4   PHE D CA  1 
ATOM   2425 C C   . PHE D 2 4   ? 25.489  8.719   -3.521  1.00 34.44  ? 4   PHE D C   1 
ATOM   2426 O O   . PHE D 2 4   ? 26.180  9.686   -3.823  1.00 36.53  ? 4   PHE D O   1 
ATOM   2427 C CB  . PHE D 2 4   ? 25.851  8.992   -1.042  1.00 32.99  ? 4   PHE D CB  1 
ATOM   2428 C CG  . PHE D 2 4   ? 25.205  9.353   0.257   1.00 27.00  ? 4   PHE D CG  1 
ATOM   2429 C CD1 . PHE D 2 4   ? 24.637  8.376   1.052   1.00 23.77  ? 4   PHE D CD1 1 
ATOM   2430 C CD2 . PHE D 2 4   ? 24.952  10.676  0.560   1.00 27.69  ? 4   PHE D CD2 1 
ATOM   2431 C CE1 . PHE D 2 4   ? 23.947  8.722   2.203   1.00 27.65  ? 4   PHE D CE1 1 
ATOM   2432 C CE2 . PHE D 2 4   ? 24.248  11.020  1.687   1.00 24.87  ? 4   PHE D CE2 1 
ATOM   2433 C CZ  . PHE D 2 4   ? 23.706  10.046  2.484   1.00 24.67  ? 4   PHE D CZ  1 
ATOM   2434 N N   . SER D 2 5   ? 25.206  7.751   -4.386  1.00 40.76  ? 5   SER D N   1 
ATOM   2435 C CA  . SER D 2 5   ? 25.738  7.782   -5.746  1.00 42.00  ? 5   SER D CA  1 
ATOM   2436 C C   . SER D 2 5   ? 25.250  9.019   -6.499  1.00 40.99  ? 5   SER D C   1 
ATOM   2437 O O   . SER D 2 5   ? 24.088  9.396   -6.358  1.00 44.66  ? 5   SER D O   1 
ATOM   2438 C CB  . SER D 2 5   ? 25.365  6.506   -6.501  1.00 40.94  ? 5   SER D CB  1 
ATOM   2439 O OG  . SER D 2 5   ? 25.724  5.358   -5.745  1.00 45.24  ? 5   SER D OG  1 
ATOM   2440 N N   . ASP D 2 6   ? 26.206  9.801   -6.996  1.00 32.29  ? 6   ASP D N   1 
ATOM   2441 C CA  . ASP D 2 6   ? 26.056  10.594  -8.215  1.00 30.63  ? 6   ASP D CA  1 
ATOM   2442 C C   . ASP D 2 6   ? 24.777  10.305  -9.002  1.00 27.88  ? 6   ASP D C   1 
ATOM   2443 O O   . ASP D 2 6   ? 24.544  9.163   -9.411  1.00 27.30  ? 6   ASP D O   1 
ATOM   2444 C CB  . ASP D 2 6   ? 27.260  10.367  -9.132  1.00 32.07  ? 6   ASP D CB  1 
ATOM   2445 C CG  . ASP D 2 6   ? 28.472  11.169  -8.713  1.00 38.58  ? 6   ASP D CG  1 
ATOM   2446 O OD1 . ASP D 2 6   ? 29.380  11.355  -9.550  1.00 41.51  ? 6   ASP D OD1 1 
ATOM   2447 O OD2 . ASP D 2 6   ? 28.510  11.627  -7.551  1.00 33.59  ? 6   ASP D OD2 1 
ATOM   2448 N N   . ASP D 2 7   ? 24.116  11.374  -9.440  1.00 16.81  ? 7   ASP D N   1 
ATOM   2449 C CA  . ASP D 2 7   ? 22.920  11.295  -10.285 1.00 16.11  ? 7   ASP D CA  1 
ATOM   2450 C C   . ASP D 2 7   ? 23.376  11.346  -11.746 1.00 15.29  ? 7   ASP D C   1 
ATOM   2451 O O   . ASP D 2 7   ? 24.582  11.443  -12.018 1.00 16.66  ? 7   ASP D O   1 
ATOM   2452 C CB  . ASP D 2 7   ? 22.013  12.498  -9.974  1.00 15.96  ? 7   ASP D CB  1 
ATOM   2453 C CG  . ASP D 2 7   ? 20.571  12.308  -10.417 1.00 14.72  ? 7   ASP D CG  1 
ATOM   2454 O OD1 . ASP D 2 7   ? 20.216  11.244  -10.988 1.00 14.11  ? 7   ASP D OD1 1 
ATOM   2455 O OD2 . ASP D 2 7   ? 19.789  13.289  -10.255 1.00 15.00  ? 7   ASP D OD2 1 
ATOM   2456 N N   . VAL D 2 8   ? 22.437  11.111  -12.659 1.00 13.95  ? 8   VAL D N   1 
ATOM   2457 C CA  . VAL D 2 8   ? 22.663  11.228  -14.094 1.00 13.56  ? 8   VAL D CA  1 
ATOM   2458 C C   . VAL D 2 8   ? 22.123  12.558  -14.625 1.00 13.65  ? 8   VAL D C   1 
ATOM   2459 O O   . VAL D 2 8   ? 21.230  13.146  -14.003 1.00 14.06  ? 8   VAL D O   1 
ATOM   2460 C CB  . VAL D 2 8   ? 21.998  10.041  -14.836 1.00 12.53  ? 8   VAL D CB  1 
ATOM   2461 C CG1 . VAL D 2 8   ? 22.665  8.739   -14.430 1.00 12.27  ? 8   VAL D CG1 1 
ATOM   2462 C CG2 . VAL D 2 8   ? 20.510  9.989   -14.549 1.00 12.03  ? 8   VAL D CG2 1 
ATOM   2463 N N   . PRO D 2 9   ? 22.523  12.946  -15.848 1.00 13.54  ? 9   PRO D N   1 
ATOM   2464 C CA  . PRO D 2 9   ? 21.989  14.175  -16.453 1.00 13.73  ? 9   PRO D CA  1 
ATOM   2465 C C   . PRO D 2 9   ? 20.498  14.043  -16.773 1.00 13.03  ? 9   PRO D C   1 
ATOM   2466 O O   . PRO D 2 9   ? 20.048  12.949  -17.110 1.00 12.37  ? 9   PRO D O   1 
ATOM   2467 C CB  . PRO D 2 9   ? 22.785  14.288  -17.760 1.00 13.53  ? 9   PRO D CB  1 
ATOM   2468 C CG  . PRO D 2 9   ? 24.061  13.476  -17.518 1.00 13.72  ? 9   PRO D CG  1 
ATOM   2469 C CD  . PRO D 2 9   ? 23.528  12.303  -16.717 1.00 13.32  ? 9   PRO D CD  1 
ATOM   2470 N N   . MET D 2 10  ? 19.759  15.150  -16.718 1.00 16.13  ? 10  MET D N   1 
ATOM   2471 C CA  . MET D 2 10  ? 18.376  15.177  -17.174 1.00 14.72  ? 10  MET D CA  1 
ATOM   2472 C C   . MET D 2 10  ? 18.226  14.888  -18.674 1.00 14.08  ? 10  MET D C   1 
ATOM   2473 O O   . MET D 2 10  ? 18.964  15.437  -19.504 1.00 15.46  ? 10  MET D O   1 
ATOM   2474 C CB  . MET D 2 10  ? 17.724  16.508  -16.783 1.00 15.49  ? 10  MET D CB  1 
ATOM   2475 C CG  . MET D 2 10  ? 16.226  16.620  -17.064 1.00 14.62  ? 10  MET D CG  1 
ATOM   2476 S SD  . MET D 2 10  ? 15.576  18.264  -16.619 1.00 15.56  ? 10  MET D SD  1 
ATOM   2477 C CE  . MET D 2 10  ? 16.302  19.316  -17.878 1.00 16.51  ? 10  MET D CE  1 
ATOM   2478 N N   . VAL D 2 11  ? 17.268  14.027  -19.007 1.00 13.63  ? 11  VAL D N   1 
ATOM   2479 C CA  A VAL D 2 11  ? 16.838  13.857  -20.389 0.50 12.81  ? 11  VAL D CA  1 
ATOM   2480 C CA  B VAL D 2 11  ? 16.807  13.830  -20.379 0.50 12.85  ? 11  VAL D CA  1 
ATOM   2481 C C   . VAL D 2 11  ? 15.859  14.948  -20.822 1.00 12.99  ? 11  VAL D C   1 
ATOM   2482 O O   . VAL D 2 11  ? 14.962  15.343  -20.077 1.00 13.12  ? 11  VAL D O   1 
ATOM   2483 C CB  A VAL D 2 11  ? 16.222  12.464  -20.649 0.50 11.54  ? 11  VAL D CB  1 
ATOM   2484 C CB  B VAL D 2 11  ? 16.076  12.476  -20.527 0.50 11.50  ? 11  VAL D CB  1 
ATOM   2485 C CG1 A VAL D 2 11  ? 17.258  11.363  -20.431 0.50 11.43  ? 11  VAL D CG1 1 
ATOM   2486 C CG1 B VAL D 2 11  ? 15.427  12.369  -21.898 0.50 10.62  ? 11  VAL D CG1 1 
ATOM   2487 C CG2 A VAL D 2 11  ? 15.008  12.243  -19.777 0.50 11.11  ? 11  VAL D CG2 1 
ATOM   2488 C CG2 B VAL D 2 11  ? 17.044  11.312  -20.306 0.50 11.17  ? 11  VAL D CG2 1 
ATOM   2489 N N   . ILE D 2 12  ? 16.027  15.431  -22.049 1.00 14.41  ? 12  ILE D N   1 
ATOM   2490 C CA  . ILE D 2 12  ? 15.158  16.475  -22.582 1.00 13.13  ? 12  ILE D CA  1 
ATOM   2491 C C   . ILE D 2 12  ? 13.972  15.886  -23.356 1.00 12.03  ? 12  ILE D C   1 
ATOM   2492 O O   . ILE D 2 12  ? 14.142  14.991  -24.195 1.00 12.04  ? 12  ILE D O   1 
ATOM   2493 C CB  . ILE D 2 12  ? 15.967  17.457  -23.481 1.00 15.28  ? 12  ILE D CB  1 
ATOM   2494 C CG1 . ILE D 2 12  ? 17.266  17.896  -22.795 1.00 15.15  ? 12  ILE D CG1 1 
ATOM   2495 C CG2 . ILE D 2 12  ? 15.102  18.636  -23.910 1.00 14.59  ? 12  ILE D CG2 1 
ATOM   2496 C CD1 . ILE D 2 12  ? 17.081  18.930  -21.698 1.00 24.93  ? 12  ILE D CD1 1 
ATOM   2497 N N   . ALA D 2 13  ? 12.765  16.377  -23.068 1.00 14.11  ? 13  ALA D N   1 
ATOM   2498 C CA  . ALA D 2 13  ? 11.545  15.791  -23.635 1.00 13.90  ? 13  ALA D CA  1 
ATOM   2499 C C   . ALA D 2 13  ? 11.364  16.181  -25.099 1.00 14.44  ? 13  ALA D C   1 
ATOM   2500 O O   . ALA D 2 13  ? 10.531  15.590  -25.801 1.00 13.06  ? 13  ALA D O   1 
ATOM   2501 C CB  . ALA D 2 13  ? 10.311  16.200  -22.833 1.00 12.69  ? 13  ALA D CB  1 
ATOM   2502 O OXT . ALA D 2 13  ? 11.990  17.146  -25.543 1.00 13.65  ? 13  ALA D OXT 1 
HETATM 2503 O O1  . HEZ E 3 .   ? 7.268   -11.881 -6.505  1.00 38.67  ? 148 HEZ B O1  1 
HETATM 2504 C C1  . HEZ E 3 .   ? 7.800   -11.626 -5.202  1.00 36.95  ? 148 HEZ B C1  1 
HETATM 2505 C C2  . HEZ E 3 .   ? 9.186   -11.033 -5.403  1.00 29.28  ? 148 HEZ B C2  1 
HETATM 2506 C C3  . HEZ E 3 .   ? 10.240  -11.867 -4.698  1.00 40.84  ? 148 HEZ B C3  1 
HETATM 2507 C C4  . HEZ E 3 .   ? 10.688  -11.170 -3.423  1.00 34.89  ? 148 HEZ B C4  1 
HETATM 2508 C C5  . HEZ E 3 .   ? 12.201  -11.296 -3.303  1.00 44.99  ? 148 HEZ B C5  1 
HETATM 2509 C C6  . HEZ E 3 .   ? 12.872  -9.978  -3.673  1.00 41.91  ? 148 HEZ B C6  1 
HETATM 2510 O O6  . HEZ E 3 .   ? 13.805  -10.229 -4.727  1.00 43.87  ? 148 HEZ B O6  1 
HETATM 2511 O O   . HOH F 4 .   ? 0.486   -16.441 -13.041 1.00 31.27  ? 148 HOH A O   1 
HETATM 2512 O O   . HOH F 4 .   ? 16.108  -5.878  -16.681 1.00 8.60   ? 149 HOH A O   1 
HETATM 2513 O O   . HOH F 4 .   ? 19.952  -19.785 -40.835 1.00 14.90  ? 150 HOH A O   1 
HETATM 2514 O O   . HOH F 4 .   ? 5.034   -10.258 -15.295 1.00 13.07  ? 151 HOH A O   1 
HETATM 2515 O O   . HOH F 4 .   ? 17.157  -7.019  -11.595 1.00 29.99  ? 152 HOH A O   1 
HETATM 2516 O O   . HOH F 4 .   ? -0.923  -13.736 -14.217 1.00 34.08  ? 153 HOH A O   1 
HETATM 2517 O O   . HOH F 4 .   ? 18.519  -16.897 -45.943 1.00 37.56  ? 154 HOH A O   1 
HETATM 2518 O O   . HOH F 4 .   ? 2.905   -11.087 -13.756 1.00 11.85  ? 155 HOH A O   1 
HETATM 2519 O O   . HOH F 4 .   ? 5.157   -5.596  -15.487 1.00 29.42  ? 156 HOH A O   1 
HETATM 2520 O O   . HOH F 4 .   ? 12.209  1.106   -29.366 1.00 13.81  ? 157 HOH A O   1 
HETATM 2521 O O   . HOH F 4 .   ? 17.628  -22.505 -27.143 1.00 35.06  ? 158 HOH A O   1 
HETATM 2522 O O   . HOH F 4 .   ? 16.887  -3.267  -16.553 1.00 18.30  ? 160 HOH A O   1 
HETATM 2523 O O   . HOH F 4 .   ? 13.915  -4.519  -41.054 1.00 31.36  ? 161 HOH A O   1 
HETATM 2524 O O   . HOH F 4 .   ? 9.834   -2.739  -29.087 1.00 14.86  ? 162 HOH A O   1 
HETATM 2525 O O   . HOH F 4 .   ? 3.509   -26.867 -23.685 1.00 28.84  ? 163 HOH A O   1 
HETATM 2526 O O   . HOH F 4 .   ? 0.077   -18.808 -22.718 1.00 21.64  ? 164 HOH A O   1 
HETATM 2527 O O   . HOH F 4 .   ? -2.431  -13.307 -16.391 1.00 12.06  ? 165 HOH A O   1 
HETATM 2528 O O   . HOH F 4 .   ? 6.804   -23.641 -10.848 1.00 31.28  ? 166 HOH A O   1 
HETATM 2529 O O   . HOH F 4 .   ? 9.625   -4.468  -33.757 1.00 14.48  ? 167 HOH A O   1 
HETATM 2530 O O   . HOH F 4 .   ? 7.723   -2.048  -24.852 1.00 19.74  ? 168 HOH A O   1 
HETATM 2531 O O   . HOH F 4 .   ? 13.981  -9.212  -40.706 1.00 30.47  ? 169 HOH A O   1 
HETATM 2532 O O   . HOH F 4 .   ? 5.162   -14.956 -36.830 1.00 29.80  ? 170 HOH A O   1 
HETATM 2533 O O   . HOH F 4 .   ? 22.779  3.015   -16.414 1.00 19.76  ? 171 HOH A O   1 
HETATM 2534 O O   . HOH F 4 .   ? -5.109  -7.499  -35.764 1.00 36.71  ? 172 HOH A O   1 
HETATM 2535 O O   . HOH F 4 .   ? 34.655  -3.167  -22.071 1.00 29.06  ? 173 HOH A O   1 
HETATM 2536 O O   . HOH F 4 .   ? 19.764  -18.775 -33.491 1.00 26.39  ? 175 HOH A O   1 
HETATM 2537 O O   . HOH F 4 .   ? -2.635  -10.559 -15.895 1.00 15.39  ? 176 HOH A O   1 
HETATM 2538 O O   . HOH F 4 .   ? 13.829  3.197   -30.351 1.00 12.57  ? 177 HOH A O   1 
HETATM 2539 O O   . HOH F 4 .   ? 22.145  -11.950 -37.662 1.00 14.41  ? 178 HOH A O   1 
HETATM 2540 O O   . HOH F 4 .   ? 30.864  -19.351 -32.283 1.00 33.07  ? 179 HOH A O   1 
HETATM 2541 O O   . HOH F 4 .   ? -0.115  -12.373 -10.031 1.00 24.51  ? 180 HOH A O   1 
HETATM 2542 O O   . HOH F 4 .   ? 8.564   -4.031  -31.275 1.00 13.50  ? 182 HOH A O   1 
HETATM 2543 O O   . HOH F 4 .   ? 0.069   -4.358  -32.905 1.00 26.90  ? 184 HOH A O   1 
HETATM 2544 O O   . HOH F 4 .   ? -8.868  -12.267 -27.380 1.00 24.36  ? 186 HOH A O   1 
HETATM 2545 O O   . HOH F 4 .   ? 17.483  -7.838  -38.733 1.00 18.56  ? 187 HOH A O   1 
HETATM 2546 O O   . HOH F 4 .   ? 8.815   -3.579  -10.887 1.00 17.26  ? 188 HOH A O   1 
HETATM 2547 O O   . HOH F 4 .   ? 16.455  -18.397 -29.910 1.00 18.81  ? 190 HOH A O   1 
HETATM 2548 O O   . HOH F 4 .   ? 6.725   -22.490 -28.206 1.00 32.14  ? 192 HOH A O   1 
HETATM 2549 O O   . HOH F 4 .   ? 27.021  -6.587  -19.824 1.00 23.90  ? 194 HOH A O   1 
HETATM 2550 O O   . HOH F 4 .   ? 9.563   -21.358 -4.123  1.00 59.50  ? 196 HOH A O   1 
HETATM 2551 O O   . HOH F 4 .   ? 19.597  -21.239 -23.073 1.00 37.21  ? 197 HOH A O   1 
HETATM 2552 O O   . HOH F 4 .   ? 3.174   -0.427  -25.943 1.00 37.98  ? 198 HOH A O   1 
HETATM 2553 O O   . HOH F 4 .   ? 17.808  -0.212  -14.188 1.00 45.11  ? 200 HOH A O   1 
HETATM 2554 O O   . HOH F 4 .   ? 32.768  -9.634  -26.160 1.00 20.82  ? 201 HOH A O   1 
HETATM 2555 O O   . HOH F 4 .   ? -2.973  -9.942  -30.170 1.00 38.17  ? 202 HOH A O   1 
HETATM 2556 O O   . HOH F 4 .   ? 15.313  -14.847 -39.474 1.00 34.68  ? 205 HOH A O   1 
HETATM 2557 O O   . HOH F 4 .   ? 22.896  -15.160 -17.656 1.00 19.13  ? 207 HOH A O   1 
HETATM 2558 O O   . HOH F 4 .   ? -7.930  -12.810 -21.740 1.00 17.80  ? 208 HOH A O   1 
HETATM 2559 O O   . HOH F 4 .   ? -4.072  -10.275 -27.545 1.00 17.91  ? 209 HOH A O   1 
HETATM 2560 O O   . HOH F 4 .   ? 20.842  6.367   -16.838 1.00 15.84  ? 210 HOH A O   1 
HETATM 2561 O O   . HOH F 4 .   ? 12.374  2.158   -23.640 1.00 37.87  ? 211 HOH A O   1 
HETATM 2562 O O   . HOH F 4 .   ? 27.581  -15.045 -38.151 1.00 41.32  ? 212 HOH A O   1 
HETATM 2563 O O   . HOH F 4 .   ? 8.059   4.990   -33.505 1.00 36.03  ? 214 HOH A O   1 
HETATM 2564 O O   . HOH F 4 .   ? 29.390  -0.901  -34.866 1.00 28.82  ? 215 HOH A O   1 
HETATM 2565 O O   . HOH F 4 .   ? 6.687   -3.063  -35.192 1.00 39.00  ? 217 HOH A O   1 
HETATM 2566 O O   . HOH F 4 .   ? 0.945   -10.165 -8.885  1.00 26.23  ? 218 HOH A O   1 
HETATM 2567 O O   . HOH F 4 .   ? 27.017  -5.845  -39.019 1.00 31.54  ? 219 HOH A O   1 
HETATM 2568 O O   . HOH F 4 .   ? 10.263  -1.413  -23.507 1.00 23.63  ? 220 HOH A O   1 
HETATM 2569 O O   . HOH F 4 .   ? 15.145  -9.041  -8.385  1.00 20.55  ? 221 HOH A O   1 
HETATM 2570 O O   . HOH F 4 .   ? 20.522  -17.388 -43.909 1.00 20.43  ? 222 HOH A O   1 
HETATM 2571 O O   . HOH F 4 .   ? 10.773  -10.326 -7.624  1.00 21.94  ? 223 HOH A O   1 
HETATM 2572 O O   . HOH F 4 .   ? -2.003  -20.434 -28.061 1.00 45.80  ? 224 HOH A O   1 
HETATM 2573 O O   . HOH F 4 .   ? 17.975  -20.451 -29.483 1.00 31.28  ? 225 HOH A O   1 
HETATM 2574 O O   . HOH F 4 .   ? 3.402   -11.333 -9.175  1.00 18.59  ? 226 HOH A O   1 
HETATM 2575 O O   . HOH F 4 .   ? 27.185  6.451   -27.081 1.00 40.68  ? 227 HOH A O   1 
HETATM 2576 O O   . HOH F 4 .   ? -5.057  -9.445  -37.843 1.00 55.39  ? 228 HOH A O   1 
HETATM 2577 O O   . HOH F 4 .   ? 16.280  -14.970 -11.470 1.00 21.87  ? 230 HOH A O   1 
HETATM 2578 O O   . HOH F 4 .   ? 13.427  -25.964 -18.161 1.00 24.24  ? 232 HOH A O   1 
HETATM 2579 O O   . HOH F 4 .   ? -5.619  -6.947  -22.990 1.00 19.19  ? 233 HOH A O   1 
HETATM 2580 O O   . HOH F 4 .   ? -0.366  -19.632 -13.782 1.00 47.94  ? 234 HOH A O   1 
HETATM 2581 O O   . HOH F 4 .   ? 15.989  -19.650 -18.339 1.00 22.18  ? 235 HOH A O   1 
HETATM 2582 O O   . HOH F 4 .   ? 12.732  -23.348 -13.852 1.00 19.82  ? 236 HOH A O   1 
HETATM 2583 O O   . HOH F 4 .   ? -5.501  -13.157 -30.643 1.00 28.54  ? 237 HOH A O   1 
HETATM 2584 O O   . HOH F 4 .   ? 26.322  -16.338 -20.360 1.00 32.69  ? 239 HOH A O   1 
HETATM 2585 O O   . HOH F 4 .   ? 19.874  -19.195 -28.862 1.00 30.05  ? 240 HOH A O   1 
HETATM 2586 O O   . HOH F 4 .   ? -11.009 -10.683 -23.835 1.00 28.26  ? 241 HOH A O   1 
HETATM 2587 O O   . HOH F 4 .   ? 33.742  -10.327 -20.924 1.00 30.30  ? 242 HOH A O   1 
HETATM 2588 O O   . HOH F 4 .   ? 26.211  -19.012 -39.506 1.00 15.55  ? 243 HOH A O   1 
HETATM 2589 O O   . HOH F 4 .   ? -11.491 -15.625 -23.016 1.00 22.70  ? 246 HOH A O   1 
HETATM 2590 O O   . HOH F 4 .   ? 27.633  -2.811  -40.507 1.00 42.77  ? 248 HOH A O   1 
HETATM 2591 O O   . HOH F 4 .   ? 24.373  -17.972 -27.030 1.00 54.39  ? 249 HOH A O   1 
HETATM 2592 O O   . HOH F 4 .   ? 12.351  -16.350 -40.588 1.00 35.35  ? 250 HOH A O   1 
HETATM 2593 O O   . HOH F 4 .   ? 12.344  -25.060 -34.169 1.00 46.61  ? 252 HOH A O   1 
HETATM 2594 O O   . HOH F 4 .   ? 8.005   -18.907 -16.834 1.00 11.19  ? 253 HOH A O   1 
HETATM 2595 O O   . HOH F 4 .   ? 8.949   -24.644 -27.768 1.00 27.29  ? 255 HOH A O   1 
HETATM 2596 O O   . HOH F 4 .   ? 28.804  -13.104 -34.818 1.00 27.50  ? 256 HOH A O   1 
HETATM 2597 O O   . HOH F 4 .   ? -4.926  -7.979  -26.525 1.00 21.43  ? 259 HOH A O   1 
HETATM 2598 O O   . HOH F 4 .   ? 13.427  -11.340 -8.977  1.00 16.56  ? 260 HOH A O   1 
HETATM 2599 O O   . HOH F 4 .   ? -3.285  -4.656  -26.682 1.00 23.43  ? 261 HOH A O   1 
HETATM 2600 O O   . HOH F 4 .   ? 5.866   -23.055 -13.634 1.00 28.06  ? 262 HOH A O   1 
HETATM 2601 O O   . HOH F 4 .   ? 34.579  -7.851  -26.936 1.00 19.62  ? 263 HOH A O   1 
HETATM 2602 O O   . HOH F 4 .   ? 20.090  -15.034 -9.583  1.00 47.04  ? 264 HOH A O   1 
HETATM 2603 O O   . HOH F 4 .   ? 16.923  -12.624 -7.907  1.00 32.09  ? 265 HOH A O   1 
HETATM 2604 O O   . HOH F 4 .   ? 18.085  -22.238 -31.870 1.00 24.26  ? 267 HOH A O   1 
HETATM 2605 O O   . HOH F 4 .   ? 17.167  6.560   -26.056 1.00 15.54  ? 268 HOH A O   1 
HETATM 2606 O O   . HOH F 4 .   ? 24.340  -4.372  -11.565 1.00 47.44  ? 269 HOH A O   1 
HETATM 2607 O O   . HOH F 4 .   ? 12.994  -0.485  -15.723 1.00 16.58  ? 271 HOH A O   1 
HETATM 2608 O O   . HOH F 4 .   ? -2.510  -12.442 -31.611 1.00 42.34  ? 272 HOH A O   1 
HETATM 2609 O O   . HOH F 4 .   ? 26.810  -3.781  -19.644 1.00 22.46  ? 275 HOH A O   1 
HETATM 2610 O O   . HOH F 4 .   ? 14.863  -19.865 -35.199 1.00 39.41  ? 276 HOH A O   1 
HETATM 2611 O O   . HOH F 4 .   ? 1.209   -24.971 -23.514 1.00 32.92  ? 277 HOH A O   1 
HETATM 2612 O O   . HOH F 4 .   ? 15.340  -21.906 -22.774 1.00 26.24  ? 278 HOH A O   1 
HETATM 2613 O O   . HOH F 4 .   ? 27.231  -2.040  -36.152 1.00 18.16  ? 280 HOH A O   1 
HETATM 2614 O O   . HOH F 4 .   ? -7.247  -19.244 -25.267 1.00 27.74  ? 283 HOH A O   1 
HETATM 2615 O O   . HOH F 4 .   ? 23.935  -19.521 -23.225 1.00 35.19  ? 284 HOH A O   1 
HETATM 2616 O O   . HOH F 4 .   ? 12.412  5.136   -24.272 1.00 24.30  ? 286 HOH A O   1 
HETATM 2617 O O   . HOH F 4 .   ? 4.571   -5.978  -20.788 1.00 16.44  ? 287 HOH A O   1 
HETATM 2618 O O   . HOH F 4 .   ? 6.417   -8.550  -38.540 1.00 49.86  ? 288 HOH A O   1 
HETATM 2619 O O   . HOH F 4 .   ? 24.912  -9.079  -41.508 1.00 27.37  ? 290 HOH A O   1 
HETATM 2620 O O   . HOH F 4 .   ? 32.341  -4.690  -33.339 1.00 32.26  ? 291 HOH A O   1 
HETATM 2621 O O   . HOH F 4 .   ? 30.138  -4.380  -20.178 1.00 41.94  ? 293 HOH A O   1 
HETATM 2622 O O   . HOH F 4 .   ? 9.490   1.063   -21.812 1.00 35.76  ? 294 HOH A O   1 
HETATM 2623 O O   . HOH F 4 .   ? 17.989  -18.428 -14.713 1.00 40.82  ? 298 HOH A O   1 
HETATM 2624 O O   . HOH F 4 .   ? 13.383  -27.880 -11.852 1.00 27.21  ? 300 HOH A O   1 
HETATM 2625 O O   . HOH F 4 .   ? -3.848  -8.353  -17.539 1.00 26.31  ? 302 HOH A O   1 
HETATM 2626 O O   . HOH F 4 .   ? -6.483  -11.624 -28.610 1.00 26.29  ? 305 HOH A O   1 
HETATM 2627 O O   . HOH F 4 .   ? 14.562  5.249   -28.452 1.00 19.62  ? 313 HOH A O   1 
HETATM 2628 O O   . HOH F 4 .   ? -6.316  -8.792  -21.209 1.00 20.84  ? 314 HOH A O   1 
HETATM 2629 O O   . HOH F 4 .   ? 4.717   -21.848 -9.541  1.00 25.48  ? 316 HOH A O   1 
HETATM 2630 O O   . HOH F 4 .   ? -0.958  -3.861  -23.635 1.00 24.31  ? 317 HOH A O   1 
HETATM 2631 O O   . HOH F 4 .   ? 19.861  8.380   -20.547 1.00 22.31  ? 322 HOH A O   1 
HETATM 2632 O O   . HOH F 4 .   ? 26.869  -8.144  -17.681 1.00 29.00  ? 324 HOH A O   1 
HETATM 2633 O O   . HOH F 4 .   ? 7.440   -5.173  -12.976 1.00 20.92  ? 325 HOH A O   1 
HETATM 2634 O O   . HOH F 4 .   ? 17.309  -10.093 -7.267  1.00 33.58  ? 328 HOH A O   1 
HETATM 2635 O O   . HOH F 4 .   ? 31.920  -12.034 -29.829 1.00 25.67  ? 329 HOH A O   1 
HETATM 2636 O O   . HOH F 4 .   ? 8.457   -1.196  -27.444 1.00 17.29  ? 330 HOH A O   1 
HETATM 2637 O O   . HOH F 4 .   ? 24.883  -6.446  -40.753 1.00 24.96  ? 332 HOH A O   1 
HETATM 2638 O O   . HOH F 4 .   ? 23.744  -16.009 -20.230 1.00 20.14  ? 334 HOH A O   1 
HETATM 2639 O O   . HOH F 4 .   ? -9.958  -13.392 -23.387 1.00 23.24  ? 338 HOH A O   1 
HETATM 2640 O O   . HOH F 4 .   ? 2.289   -19.386 -13.859 1.00 23.62  ? 339 HOH A O   1 
HETATM 2641 O O   . HOH F 4 .   ? 23.148  -10.172 -42.783 1.00 32.82  ? 340 HOH A O   1 
HETATM 2642 O O   . HOH F 4 .   ? 16.791  -19.406 -32.821 1.00 26.37  ? 341 HOH A O   1 
HETATM 2643 O O   . HOH F 4 .   ? 13.588  -22.530 -25.196 1.00 25.09  ? 343 HOH A O   1 
HETATM 2644 O O   . HOH F 4 .   ? 17.353  -8.238  -42.060 1.00 35.03  ? 344 HOH A O   1 
HETATM 2645 O O   . HOH F 4 .   ? 12.978  -6.982  -39.908 1.00 22.24  ? 345 HOH A O   1 
HETATM 2646 O O   . HOH F 4 .   ? 25.123  -12.399 -38.331 1.00 24.82  ? 347 HOH A O   1 
HETATM 2647 O O   . HOH F 4 .   ? 25.300  -15.145 -16.179 1.00 26.70  ? 348 HOH A O   1 
HETATM 2648 O O   . HOH F 4 .   ? 17.582  -6.720  -14.247 1.00 29.01  ? 350 HOH A O   1 
HETATM 2649 O O   . HOH G 4 .   ? -5.395  11.668  -15.531 1.00 25.91  ? 149 HOH B O   1 
HETATM 2650 O O   . HOH G 4 .   ? 5.685   13.005  3.328   1.00 30.63  ? 150 HOH B O   1 
HETATM 2651 O O   . HOH G 4 .   ? 13.539  -6.801  -1.536  1.00 24.94  ? 151 HOH B O   1 
HETATM 2652 O O   . HOH G 4 .   ? 22.050  10.472  -5.080  1.00 47.49  ? 152 HOH B O   1 
HETATM 2653 O O   . HOH G 4 .   ? 21.816  12.822  -6.203  1.00 31.15  ? 153 HOH B O   1 
HETATM 2654 O O   . HOH G 4 .   ? -4.243  -7.283  -5.125  1.00 31.63  ? 155 HOH B O   1 
HETATM 2655 O O   . HOH G 4 .   ? 4.856   -11.013 -6.630  1.00 16.59  ? 159 HOH B O   1 
HETATM 2656 O O   . HOH G 4 .   ? 15.562  5.926   -23.586 1.00 27.75  ? 160 HOH B O   1 
HETATM 2657 O O   . HOH G 4 .   ? 3.689   27.874  -16.867 1.00 35.42  ? 161 HOH B O   1 
HETATM 2658 O O   . HOH G 4 .   ? 17.141  3.804   -7.543  1.00 30.41  ? 162 HOH B O   1 
HETATM 2659 O O   . HOH G 4 .   ? 10.297  24.029  -0.600  1.00 35.15  ? 163 HOH B O   1 
HETATM 2660 O O   . HOH G 4 .   ? 14.455  25.116  -3.211  1.00 38.02  ? 164 HOH B O   1 
HETATM 2661 O O   . HOH G 4 .   ? 4.181   24.769  -21.651 1.00 50.03  ? 165 HOH B O   1 
HETATM 2662 O O   . HOH G 4 .   ? 10.348  -0.220  -18.995 1.00 23.82  ? 166 HOH B O   1 
HETATM 2663 O O   . HOH G 4 .   ? 9.907   13.695  6.676   1.00 40.38  ? 167 HOH B O   1 
HETATM 2664 O O   . HOH G 4 .   ? -7.725  6.171   -21.183 1.00 40.33  ? 168 HOH B O   1 
HETATM 2665 O O   . HOH G 4 .   ? 11.507  16.280  1.753   1.00 43.18  ? 169 HOH B O   1 
HETATM 2666 O O   . HOH G 4 .   ? 6.312   8.307   -28.620 1.00 29.95  ? 170 HOH B O   1 
HETATM 2667 O O   . HOH G 4 .   ? 9.540   27.426  -25.082 1.00 27.41  ? 171 HOH B O   1 
HETATM 2668 O O   . HOH G 4 .   ? 11.701  -2.269  3.614   1.00 52.37  ? 172 HOH B O   1 
HETATM 2669 O O   . HOH G 4 .   ? 16.294  7.775   -8.020  1.00 15.26  ? 174 HOH B O   1 
HETATM 2670 O O   . HOH G 4 .   ? 22.046  5.448   -12.480 1.00 32.64  ? 175 HOH B O   1 
HETATM 2671 O O   . HOH G 4 .   ? 18.044  21.046  -14.866 1.00 47.79  ? 176 HOH B O   1 
HETATM 2672 O O   . HOH G 4 .   ? -1.367  10.359  1.913   1.00 53.12  ? 177 HOH B O   1 
HETATM 2673 O O   . HOH G 4 .   ? 9.247   8.910   -31.193 1.00 31.37  ? 178 HOH B O   1 
HETATM 2674 O O   . HOH G 4 .   ? 9.709   24.356  -7.042  1.00 30.69  ? 179 HOH B O   1 
HETATM 2675 O O   . HOH G 4 .   ? -11.067 0.071   -4.093  1.00 34.93  ? 180 HOH B O   1 
HETATM 2676 O O   . HOH G 4 .   ? -1.523  -10.281 -13.380 1.00 20.53  ? 181 HOH B O   1 
HETATM 2677 O O   . HOH G 4 .   ? -4.016  -0.528  -21.743 1.00 16.93  ? 183 HOH B O   1 
HETATM 2678 O O   . HOH G 4 .   ? 9.692   15.899  -30.117 1.00 44.60  ? 184 HOH B O   1 
HETATM 2679 O O   . HOH G 4 .   ? 14.511  5.002   -11.627 1.00 14.16  ? 185 HOH B O   1 
HETATM 2680 O O   . HOH G 4 .   ? 13.613  4.212   -19.806 1.00 27.77  ? 186 HOH B O   1 
HETATM 2681 O O   . HOH G 4 .   ? -5.674  -1.356  -18.775 1.00 33.33  ? 187 HOH B O   1 
HETATM 2682 O O   . HOH G 4 .   ? -3.361  6.382   2.052   1.00 29.68  ? 188 HOH B O   1 
HETATM 2683 O O   . HOH G 4 .   ? 1.940   -5.272  -11.405 1.00 15.82  ? 189 HOH B O   1 
HETATM 2684 O O   . HOH G 4 .   ? 23.083  16.146  -10.029 1.00 33.89  ? 190 HOH B O   1 
HETATM 2685 O O   . HOH G 4 .   ? 13.525  0.561   -13.070 1.00 18.81  ? 193 HOH B O   1 
HETATM 2686 O O   . HOH G 4 .   ? 15.511  -1.575  7.342   1.00 54.79  ? 194 HOH B O   1 
HETATM 2687 O O   . HOH G 4 .   ? 2.177   24.678  -14.373 1.00 20.31  ? 195 HOH B O   1 
HETATM 2688 O O   . HOH G 4 .   ? 5.396   6.284   -28.356 1.00 48.74  ? 196 HOH B O   1 
HETATM 2689 O O   . HOH G 4 .   ? 18.922  10.354  -1.216  1.00 47.09  ? 197 HOH B O   1 
HETATM 2690 O O   . HOH G 4 .   ? 12.060  6.353   -28.843 1.00 24.64  ? 199 HOH B O   1 
HETATM 2691 O O   . HOH G 4 .   ? 8.342   -13.671 -3.832  1.00 33.59  ? 200 HOH B O   1 
HETATM 2692 O O   . HOH G 4 .   ? 12.768  1.698   -17.129 1.00 22.20  ? 201 HOH B O   1 
HETATM 2693 O O   . HOH G 4 .   ? 1.185   -7.878  -10.820 1.00 19.39  ? 203 HOH B O   1 
HETATM 2694 O O   . HOH G 4 .   ? 10.216  20.945  -6.460  1.00 18.94  ? 204 HOH B O   1 
HETATM 2695 O O   . HOH G 4 .   ? 15.418  5.493   -9.063  1.00 15.73  ? 206 HOH B O   1 
HETATM 2696 O O   . HOH G 4 .   ? 16.321  -0.397  -12.532 1.00 25.55  ? 207 HOH B O   1 
HETATM 2697 O O   . HOH G 4 .   ? 1.819   18.404  -25.216 1.00 43.90  ? 208 HOH B O   1 
HETATM 2698 O O   . HOH G 4 .   ? 9.456   12.718  -31.520 1.00 31.56  ? 209 HOH B O   1 
HETATM 2699 O O   . HOH G 4 .   ? 8.232   24.507  -11.672 1.00 27.09  ? 210 HOH B O   1 
HETATM 2700 O O   . HOH G 4 .   ? 16.962  6.401   -15.289 1.00 15.99  ? 213 HOH B O   1 
HETATM 2701 O O   . HOH G 4 .   ? 12.917  27.446  -15.504 1.00 17.22  ? 216 HOH B O   1 
HETATM 2702 O O   . HOH G 4 .   ? 15.171  17.173  1.281   1.00 40.56  ? 221 HOH B O   1 
HETATM 2703 O O   . HOH G 4 .   ? 8.149   19.032  3.004   1.00 35.26  ? 222 HOH B O   1 
HETATM 2704 O O   . HOH G 4 .   ? -10.658 4.006   -4.189  1.00 33.87  ? 223 HOH B O   1 
HETATM 2705 O O   . HOH G 4 .   ? -0.711  20.736  -18.966 1.00 41.35  ? 226 HOH B O   1 
HETATM 2706 O O   . HOH G 4 .   ? 14.542  2.875   -13.325 1.00 16.98  ? 231 HOH B O   1 
HETATM 2707 O O   . HOH G 4 .   ? -6.891  1.998   -15.991 1.00 48.46  ? 232 HOH B O   1 
HETATM 2708 O O   . HOH G 4 .   ? 14.157  9.120   -29.294 1.00 42.89  ? 233 HOH B O   1 
HETATM 2709 O O   . HOH G 4 .   ? -1.534  9.129   -27.052 1.00 56.08  ? 235 HOH B O   1 
HETATM 2710 O O   . HOH G 4 .   ? 11.988  8.964   -31.660 1.00 28.62  ? 236 HOH B O   1 
HETATM 2711 O O   . HOH G 4 .   ? 16.154  27.559  -25.356 1.00 38.31  ? 238 HOH B O   1 
HETATM 2712 O O   . HOH G 4 .   ? -6.862  12.912  -17.135 1.00 31.38  ? 239 HOH B O   1 
HETATM 2713 O O   . HOH G 4 .   ? 9.584   25.720  -9.660  1.00 38.25  ? 240 HOH B O   1 
HETATM 2714 O O   . HOH G 4 .   ? 18.266  -0.343  -2.734  1.00 33.70  ? 241 HOH B O   1 
HETATM 2715 O O   . HOH G 4 .   ? -2.499  -9.582  -6.506  1.00 42.60  ? 242 HOH B O   1 
HETATM 2716 O O   . HOH G 4 .   ? 0.860   15.175  -22.265 1.00 32.40  ? 243 HOH B O   1 
HETATM 2717 O O   . HOH G 4 .   ? 18.224  8.197   -16.992 1.00 15.62  ? 244 HOH B O   1 
HETATM 2718 O O   . HOH G 4 .   ? 14.448  25.260  -14.456 1.00 20.26  ? 245 HOH B O   1 
HETATM 2719 O O   . HOH G 4 .   ? -1.694  -1.628  4.993   1.00 51.33  ? 246 HOH B O   1 
HETATM 2720 O O   . HOH G 4 .   ? 3.986   4.266   -21.622 1.00 30.63  ? 247 HOH B O   1 
HETATM 2721 O O   . HOH G 4 .   ? 1.938   13.172  -4.252  1.00 16.67  ? 251 HOH B O   1 
HETATM 2722 O O   . HOH G 4 .   ? -3.134  8.723   -2.864  1.00 34.87  ? 256 HOH B O   1 
HETATM 2723 O O   . HOH G 4 .   ? -0.187  0.172   -24.500 1.00 35.89  ? 257 HOH B O   1 
HETATM 2724 O O   . HOH G 4 .   ? -1.553  14.022  -21.970 1.00 21.79  ? 258 HOH B O   1 
HETATM 2725 O O   . HOH G 4 .   ? -1.543  19.136  -9.611  1.00 28.16  ? 259 HOH B O   1 
HETATM 2726 O O   . HOH G 4 .   ? 1.254   20.858  -16.613 1.00 37.01  ? 261 HOH B O   1 
HETATM 2727 O O   . HOH G 4 .   ? -6.257  6.398   -8.765  1.00 32.20  ? 262 HOH B O   1 
HETATM 2728 O O   . HOH G 4 .   ? 9.537   1.217   -26.373 1.00 53.03  ? 265 HOH B O   1 
HETATM 2729 O O   . HOH G 4 .   ? 4.075   26.170  -12.990 1.00 18.69  ? 266 HOH B O   1 
HETATM 2730 O O   . HOH G 4 .   ? -9.672  -7.725  -7.310  1.00 48.31  ? 267 HOH B O   1 
HETATM 2731 O O   . HOH G 4 .   ? -3.163  21.670  -22.276 1.00 43.62  ? 268 HOH B O   1 
HETATM 2732 O O   . HOH G 4 .   ? 2.598   -7.447  -14.524 1.00 17.64  ? 270 HOH B O   1 
HETATM 2733 O O   . HOH G 4 .   ? 13.806  -6.745  -7.612  1.00 24.02  ? 273 HOH B O   1 
HETATM 2734 O O   . HOH G 4 .   ? 2.740   -10.348 -4.977  1.00 18.55  ? 274 HOH B O   1 
HETATM 2735 O O   . HOH G 4 .   ? -3.462  7.246   -10.719 1.00 28.22  ? 278 HOH B O   1 
HETATM 2736 O O   . HOH G 4 .   ? 19.945  14.965  -5.832  1.00 21.73  ? 279 HOH B O   1 
HETATM 2737 O O   . HOH G 4 .   ? -4.053  7.964   -0.035  1.00 42.49  ? 280 HOH B O   1 
HETATM 2738 O O   . HOH G 4 .   ? -3.381  -2.918  -22.602 1.00 20.52  ? 281 HOH B O   1 
HETATM 2739 O O   . HOH G 4 .   ? 12.025  5.147   -31.281 1.00 18.71  ? 282 HOH B O   1 
HETATM 2740 O O   . HOH G 4 .   ? 1.963   -6.244  6.962   1.00 46.27  ? 283 HOH B O   1 
HETATM 2741 O O   . HOH G 4 .   ? 11.331  8.480   3.253   1.00 40.48  ? 285 HOH B O   1 
HETATM 2742 O O   . HOH G 4 .   ? 8.070   16.562  3.547   1.00 47.56  ? 286 HOH B O   1 
HETATM 2743 O O   . HOH G 4 .   ? 3.304   -9.502  -11.172 1.00 19.91  ? 289 HOH B O   1 
HETATM 2744 O O   . HOH G 4 .   ? 18.260  0.806   -6.103  1.00 42.54  ? 291 HOH B O   1 
HETATM 2745 O O   . HOH G 4 .   ? 12.161  24.336  -6.289  1.00 30.32  ? 292 HOH B O   1 
HETATM 2746 O O   . HOH G 4 .   ? -7.687  -3.255  -0.066  1.00 59.94  ? 293 HOH B O   1 
HETATM 2747 O O   . HOH G 4 .   ? 14.608  23.249  -16.162 1.00 18.62  ? 295 HOH B O   1 
HETATM 2748 O O   . HOH G 4 .   ? -4.303  -1.013  -6.454  1.00 18.08  ? 297 HOH B O   1 
HETATM 2749 O O   . HOH G 4 .   ? 14.002  24.332  -18.694 1.00 17.09  ? 299 HOH B O   1 
HETATM 2750 O O   . HOH G 4 .   ? 1.646   26.285  -16.641 1.00 29.82  ? 300 HOH B O   1 
HETATM 2751 O O   . HOH G 4 .   ? 2.811   14.411  -24.102 1.00 20.28  ? 301 HOH B O   1 
HETATM 2752 O O   . HOH G 4 .   ? 10.995  4.826   -26.575 1.00 22.21  ? 304 HOH B O   1 
HETATM 2753 O O   . HOH G 4 .   ? 12.251  27.950  -25.598 1.00 21.44  ? 306 HOH B O   1 
HETATM 2754 O O   . HOH G 4 .   ? 13.419  -2.690  0.880   1.00 33.50  ? 308 HOH B O   1 
HETATM 2755 O O   . HOH G 4 .   ? 0.195   15.093  -5.157  1.00 23.99  ? 309 HOH B O   1 
HETATM 2756 O O   . HOH G 4 .   ? 2.593   3.398   -19.249 1.00 17.55  ? 310 HOH B O   1 
HETATM 2757 O O   . HOH G 4 .   ? 0.984   -9.264  -13.633 1.00 21.40  ? 311 HOH B O   1 
HETATM 2758 O O   . HOH G 4 .   ? 15.782  17.358  -6.245  1.00 21.86  ? 312 HOH B O   1 
HETATM 2759 O O   . HOH G 4 .   ? 4.688   -7.751  -12.564 1.00 21.95  ? 318 HOH B O   1 
HETATM 2760 O O   . HOH G 4 .   ? 0.684   5.262   2.982   1.00 22.75  ? 320 HOH B O   1 
HETATM 2761 O O   . HOH G 4 .   ? 2.305   22.849  -26.490 1.00 34.31  ? 321 HOH B O   1 
HETATM 2762 O O   . HOH G 4 .   ? 17.382  14.454  -4.457  1.00 22.75  ? 327 HOH B O   1 
HETATM 2763 O O   . HOH G 4 .   ? 14.763  22.806  -20.820 1.00 35.57  ? 331 HOH B O   1 
HETATM 2764 O O   . HOH G 4 .   ? 17.295  9.182   -24.059 1.00 21.83  ? 333 HOH B O   1 
HETATM 2765 O O   . HOH G 4 .   ? 15.699  -6.782  -4.317  1.00 28.05  ? 335 HOH B O   1 
HETATM 2766 O O   . HOH G 4 .   ? 11.947  -5.210  0.253   1.00 26.50  ? 336 HOH B O   1 
HETATM 2767 O O   . HOH G 4 .   ? 1.526   -4.146  0.516   1.00 27.05  ? 337 HOH B O   1 
HETATM 2768 O O   . HOH G 4 .   ? 17.429  22.651  -16.285 1.00 27.50  ? 342 HOH B O   1 
HETATM 2769 O O   . HOH G 4 .   ? 5.447   24.986  -10.751 1.00 27.01  ? 346 HOH B O   1 
HETATM 2770 O O   . HOH G 4 .   ? 17.763  7.513   -19.659 1.00 21.11  ? 349 HOH B O   1 
HETATM 2771 O O   . HOH H 4 .   ? 28.458  3.614   -23.406 1.00 28.29  ? 151 HOH C O   1 
HETATM 2772 O O   . HOH H 4 .   ? 9.986   6.050   -42.278 1.00 29.22  ? 157 HOH C O   1 
HETATM 2773 O O   . HOH H 4 .   ? 14.519  -0.321  -42.347 1.00 37.99  ? 182 HOH C O   1 
HETATM 2774 O O   . HOH H 4 .   ? 20.173  2.938   -37.804 1.00 17.30  ? 247 HOH C O   1 
HETATM 2775 O O   . HOH H 4 .   ? 21.845  5.382   -35.234 1.00 19.38  ? 257 HOH C O   1 
HETATM 2776 O O   . HOH H 4 .   ? 7.227   2.978   -48.216 1.00 36.01  ? 263 HOH C O   1 
HETATM 2777 O O   . HOH H 4 .   ? 12.159  5.962   -38.382 1.00 27.11  ? 303 HOH C O   1 
HETATM 2778 O O   . HOH H 4 .   ? 14.835  3.812   -39.844 1.00 28.86  ? 307 HOH C O   1 
HETATM 2779 O O   . HOH H 4 .   ? 16.230  1.418   -39.218 1.00 23.34  ? 319 HOH C O   1 
HETATM 2780 O O   . HOH I 4 .   ? 28.531  8.167   -7.482  1.00 44.22  ? 231 HOH D O   1 
HETATM 2781 O O   . HOH I 4 .   ? 22.494  15.205  -12.490 1.00 33.87  ? 245 HOH D O   1 
HETATM 2782 O O   . HOH I 4 .   ? 20.996  10.793  -18.779 1.00 16.80  ? 296 HOH D O   1 
HETATM 2783 O O   . HOH I 4 .   ? 21.284  17.547  -16.083 1.00 19.32  ? 315 HOH D O   1 
HETATM 2784 O O   . HOH I 4 .   ? 16.070  13.548  -25.206 1.00 14.04  ? 323 HOH D O   1 
HETATM 2785 O O   . HOH I 4 .   ? 18.213  14.574  -23.664 1.00 19.62  ? 326 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLU A 4   ? 0.5882 0.8506 0.9434 -0.2518 0.1514  -0.1978 2   GLU A N   
2    C CA  . GLU A 4   ? 0.5397 0.8167 0.8983 -0.2303 0.1400  -0.1827 2   GLU A CA  
3    C C   . GLU A 4   ? 0.5052 0.7578 0.8308 -0.2136 0.1298  -0.1721 2   GLU A C   
4    O O   . GLU A 4   ? 0.4843 0.7401 0.8065 -0.1956 0.1221  -0.1594 2   GLU A O   
5    C CB  . GLU A 4   ? 0.5081 0.7704 0.8746 -0.2226 0.1573  -0.1748 2   GLU A CB  
6    C CG  . GLU A 4   ? 0.5925 0.8058 0.9382 -0.2268 0.1800  -0.1757 2   GLU A CG  
7    C CD  . GLU A 4   ? 0.7053 0.8884 1.0356 -0.2088 0.1906  -0.1615 2   GLU A CD  
8    O OE1 . GLU A 4   ? 0.6395 0.8262 0.9612 -0.1910 0.1783  -0.1500 2   GLU A OE1 
9    O OE2 . GLU A 4   ? 0.6558 0.8089 0.9801 -0.2130 0.2119  -0.1621 2   GLU A OE2 
10   N N   . PRO A 5   ? 0.3475 0.5765 0.6499 -0.2202 0.1303  -0.1777 3   PRO A N   
11   C CA  . PRO A 5   ? 0.3068 0.5200 0.5816 -0.2073 0.1185  -0.1699 3   PRO A CA  
12   C C   . PRO A 5   ? 0.2478 0.4993 0.5313 -0.2003 0.0957  -0.1668 3   PRO A C   
13   O O   . PRO A 5   ? 0.2643 0.5528 0.5685 -0.2117 0.0868  -0.1759 3   PRO A O   
14   C CB  . PRO A 5   ? 0.3654 0.5577 0.6231 -0.2212 0.1236  -0.1809 3   PRO A CB  
15   C CG  . PRO A 5   ? 0.3997 0.5789 0.6678 -0.2370 0.1443  -0.1905 3   PRO A CG  
16   C CD  . PRO A 5   ? 0.3940 0.6098 0.6960 -0.2410 0.1434  -0.1923 3   PRO A CD  
17   N N   . ALA A 6   ? 0.2245 0.4688 0.4945 -0.1813 0.0872  -0.1533 4   ALA A N   
18   C CA  . ALA A 6   ? 0.1513 0.4284 0.4289 -0.1713 0.0679  -0.1474 4   ALA A CA  
19   C C   . ALA A 6   ? 0.1369 0.4252 0.4036 -0.1775 0.0537  -0.1537 4   ALA A C   
20   O O   . ALA A 6   ? 0.1436 0.4032 0.3849 -0.1771 0.0554  -0.1540 4   ALA A O   
21   C CB  . ALA A 6   ? 0.1175 0.3776 0.3806 -0.1505 0.0653  -0.1321 4   ALA A CB  
22   N N   . MET A 7   ? 0.1284 0.4589 0.4134 -0.1818 0.0394  -0.1579 5   MET A N   
23   C CA  . MET A 7   ? 0.1335 0.4780 0.4072 -0.1864 0.0244  -0.1632 5   MET A CA  
24   C C   . MET A 7   ? 0.1197 0.4614 0.3757 -0.1682 0.0113  -0.1505 5   MET A C   
25   O O   . MET A 7   ? 0.1254 0.4559 0.3596 -0.1691 0.0053  -0.1523 5   MET A O   
26   C CB  . MET A 7   ? 0.1364 0.5288 0.4357 -0.1990 0.0135  -0.1732 5   MET A CB  
27   C CG  . MET A 7   ? 0.1524 0.5490 0.4695 -0.2202 0.0261  -0.1881 5   MET A CG  
28   S SD  . MET A 7   ? 0.2898 0.7486 0.6390 -0.2349 0.0107  -0.1998 5   MET A SD  
29   C CE  . MET A 7   ? 0.2563 0.7413 0.6439 -0.2282 0.0172  -0.1928 5   MET A CE  
30   N N   . GLU A 8   ? 0.1397 0.4898 0.4043 -0.1517 0.0082  -0.1377 6   GLU A N   
31   C CA  . GLU A 8   ? 0.1234 0.4713 0.3729 -0.1348 -0.0031 -0.1257 6   GLU A CA  
32   C C   . GLU A 8   ? 0.1245 0.4284 0.3450 -0.1296 0.0040  -0.1215 6   GLU A C   
33   O O   . GLU A 8   ? 0.1276 0.4037 0.3439 -0.1296 0.0180  -0.1205 6   GLU A O   
34   C CB  . GLU A 8   ? 0.1039 0.4652 0.3686 -0.1187 -0.0045 -0.1132 6   GLU A CB  
35   C CG  . GLU A 8   ? 0.0999 0.4643 0.3523 -0.1019 -0.0166 -0.1013 6   GLU A CG  
36   C CD  . GLU A 8   ? 0.0774 0.4468 0.3412 -0.0854 -0.0149 -0.0886 6   GLU A CD  
37   O OE1 . GLU A 8   ? 0.0833 0.4754 0.3518 -0.0742 -0.0262 -0.0808 6   GLU A OE1 
38   O OE2 . GLU A 8   ? 0.0849 0.4293 0.3468 -0.0817 -0.0019 -0.0853 6   GLU A OE2 
39   N N   . PRO A 9   ? 0.1021 0.4002 0.3027 -0.1258 -0.0053 -0.1195 7   PRO A N   
40   C CA  . PRO A 9   ? 0.1029 0.3626 0.2783 -0.1222 0.0012  -0.1166 7   PRO A CA  
41   C C   . PRO A 9   ? 0.0911 0.3292 0.2617 -0.1074 0.0071  -0.1044 7   PRO A C   
42   O O   . PRO A 9   ? 0.0830 0.3342 0.2611 -0.0958 0.0014  -0.0955 7   PRO A O   
43   C CB  . PRO A 9   ? 0.1050 0.3703 0.2645 -0.1183 -0.0116 -0.1146 7   PRO A CB  
44   C CG  . PRO A 9   ? 0.1124 0.4143 0.2847 -0.1280 -0.0221 -0.1230 7   PRO A CG  
45   C CD  . PRO A 9   ? 0.1071 0.4342 0.3074 -0.1288 -0.0208 -0.1230 7   PRO A CD  
46   N N   . GLU A 10  ? 0.1351 0.3403 0.2933 -0.1081 0.0192  -0.1042 8   GLU A N   
47   C CA  . GLU A 10  ? 0.1308 0.3143 0.2797 -0.0945 0.0230  -0.0932 8   GLU A CA  
48   C C   . GLU A 10  ? 0.1117 0.2954 0.2483 -0.0831 0.0120  -0.0848 8   GLU A C   
49   O O   . GLU A 10  ? 0.1176 0.2999 0.2425 -0.0856 0.0062  -0.0871 8   GLU A O   
50   C CB  . GLU A 10  ? 0.1404 0.2897 0.2748 -0.0971 0.0358  -0.0944 8   GLU A CB  
51   C CG  . GLU A 10  ? 0.1535 0.2801 0.2779 -0.0850 0.0406  -0.0845 8   GLU A CG  
52   C CD  . GLU A 10  ? 0.1646 0.2612 0.2775 -0.0876 0.0541  -0.0856 8   GLU A CD  
53   O OE1 . GLU A 10  ? 0.2007 0.2826 0.3101 -0.0808 0.0608  -0.0798 8   GLU A OE1 
54   O OE2 . GLU A 10  ? 0.2274 0.3145 0.3340 -0.0962 0.0587  -0.0922 8   GLU A OE2 
55   N N   . THR A 11  ? 0.0753 0.2560 0.2124 -0.0706 0.0108  -0.0751 9   THR A N   
56   C CA  . THR A 11  ? 0.0669 0.2457 0.1926 -0.0602 0.0020  -0.0671 9   THR A CA  
57   C C   . THR A 11  ? 0.0739 0.2247 0.1792 -0.0585 0.0047  -0.0651 9   THR A C   
58   O O   . THR A 11  ? 0.0768 0.2063 0.1762 -0.0601 0.0138  -0.0659 9   THR A O   
59   C CB  . THR A 11  ? 0.0642 0.2450 0.1951 -0.0478 0.0015  -0.0577 9   THR A CB  
60   O OG1 . THR A 11  ? 0.0639 0.2209 0.1896 -0.0455 0.0118  -0.0556 9   THR A OG1 
61   C CG2 . THR A 11  ? 0.0667 0.2780 0.2200 -0.0472 -0.0012 -0.0579 9   THR A CG2 
62   N N   . LEU A 12  ? 0.0991 0.2500 0.1940 -0.0535 -0.0031 -0.0611 10  LEU A N   
63   C CA  . LEU A 12  ? 0.0987 0.2259 0.1768 -0.0504 -0.0012 -0.0579 10  LEU A CA  
64   C C   . LEU A 12  ? 0.0931 0.2026 0.1676 -0.0426 0.0037  -0.0514 10  LEU A C   
65   O O   . LEU A 12  ? 0.0964 0.1856 0.1604 -0.0424 0.0085  -0.0506 10  LEU A O   
66   C CB  . LEU A 12  ? 0.0960 0.2280 0.1653 -0.0461 -0.0098 -0.0543 10  LEU A CB  
67   C CG  . LEU A 12  ? 0.1057 0.2499 0.1721 -0.0541 -0.0143 -0.0612 10  LEU A CG  
68   C CD1 . LEU A 12  ? 0.1057 0.2503 0.1603 -0.0488 -0.0211 -0.0565 10  LEU A CD1 
69   C CD2 . LEU A 12  ? 0.1180 0.2479 0.1789 -0.0639 -0.0065 -0.0692 10  LEU A CD2 
70   N N   . GLU A 13  ? 0.0954 0.2124 0.1776 -0.0360 0.0026  -0.0465 11  GLU A N   
71   C CA  . GLU A 13  ? 0.0930 0.1928 0.1704 -0.0296 0.0077  -0.0414 11  GLU A CA  
72   C C   . GLU A 13  ? 0.1021 0.1893 0.1798 -0.0342 0.0176  -0.0451 11  GLU A C   
73   O O   . GLU A 13  ? 0.1077 0.1747 0.1736 -0.0328 0.0216  -0.0434 11  GLU A O   
74   C CB  . GLU A 13  ? 0.0900 0.2001 0.1763 -0.0219 0.0064  -0.0362 11  GLU A CB  
75   C CG  . GLU A 13  ? 0.0841 0.1990 0.1663 -0.0145 -0.0009 -0.0301 11  GLU A CG  
76   C CD  . GLU A 13  ? 0.0835 0.2232 0.1738 -0.0151 -0.0088 -0.0307 11  GLU A CD  
77   O OE1 . GLU A 13  ? 0.0822 0.2245 0.1669 -0.0090 -0.0144 -0.0254 11  GLU A OE1 
78   O OE2 . GLU A 13  ? 0.0887 0.2458 0.1907 -0.0215 -0.0093 -0.0364 11  GLU A OE2 
79   N N   . ALA A 14  ? 0.0697 0.1695 0.1606 -0.0406 0.0214  -0.0504 12  ALA A N   
80   C CA  . ALA A 14  ? 0.0774 0.1638 0.1683 -0.0451 0.0325  -0.0537 12  ALA A CA  
81   C C   . ALA A 14  ? 0.0864 0.1549 0.1644 -0.0496 0.0360  -0.0564 12  ALA A C   
82   O O   . ALA A 14  ? 0.0998 0.1479 0.1682 -0.0480 0.0435  -0.0547 12  ALA A O   
83   C CB  . ALA A 14  ? 0.0830 0.1878 0.1925 -0.0529 0.0365  -0.0600 12  ALA A CB  
84   N N   . ARG A 15  ? 0.0991 0.1752 0.1760 -0.0546 0.0309  -0.0604 13  ARG A N   
85   C CA  . ARG A 15  ? 0.1116 0.1710 0.1770 -0.0586 0.0353  -0.0630 13  ARG A CA  
86   C C   . ARG A 15  ? 0.1072 0.1487 0.1581 -0.0504 0.0341  -0.0561 13  ARG A C   
87   O O   . ARG A 15  ? 0.1181 0.1410 0.1602 -0.0499 0.0412  -0.0552 13  ARG A O   
88   C CB  . ARG A 15  ? 0.1142 0.1853 0.1804 -0.0659 0.0305  -0.0692 13  ARG A CB  
89   C CG  . ARG A 15  ? 0.1255 0.2122 0.2045 -0.0771 0.0330  -0.0785 13  ARG A CG  
90   C CD  . ARG A 15  ? 0.1332 0.2290 0.2085 -0.0843 0.0276  -0.0849 13  ARG A CD  
91   N NE  . ARG A 15  ? 0.1491 0.2625 0.2363 -0.0964 0.0283  -0.0949 13  ARG A NE  
92   C CZ  . ARG A 15  ? 0.1696 0.2727 0.2562 -0.1075 0.0384  -0.1036 13  ARG A CZ  
93   N NH1 . ARG A 15  ? 0.1830 0.3045 0.2808 -0.1200 0.0378  -0.1139 13  ARG A NH1 
94   N NH2 . ARG A 15  ? 0.1840 0.2588 0.2599 -0.1059 0.0497  -0.1018 13  ARG A NH2 
95   N N   . ILE A 16  ? 0.1120 0.1595 0.1605 -0.0443 0.0252  -0.0513 14  ILE A N   
96   C CA  A ILE A 16  ? 0.1142 0.1480 0.1512 -0.0379 0.0232  -0.0455 14  ILE A CA  
97   C CA  B ILE A 16  ? 0.1102 0.1440 0.1472 -0.0379 0.0232  -0.0455 14  ILE A CA  
98   C C   . ILE A 16  ? 0.1118 0.1321 0.1436 -0.0327 0.0273  -0.0412 14  ILE A C   
99   O O   . ILE A 16  ? 0.1196 0.1255 0.1414 -0.0296 0.0291  -0.0382 14  ILE A O   
100  C CB  A ILE A 16  ? 0.0952 0.1378 0.1312 -0.0338 0.0139  -0.0418 14  ILE A CB  
101  C CB  B ILE A 16  ? 0.1034 0.1461 0.1395 -0.0336 0.0139  -0.0417 14  ILE A CB  
102  C CG1 A ILE A 16  ? 0.0967 0.1277 0.1228 -0.0303 0.0124  -0.0381 14  ILE A CG1 
103  C CG1 B ILE A 16  ? 0.1012 0.1320 0.1273 -0.0300 0.0123  -0.0378 14  ILE A CG1 
104  C CG2 A ILE A 16  ? 0.0888 0.1367 0.1289 -0.0281 0.0109  -0.0377 14  ILE A CG2 
105  C CG2 B ILE A 16  ? 0.0885 0.1369 0.1290 -0.0282 0.0110  -0.0377 14  ILE A CG2 
106  C CD1 A ILE A 16  ? 0.0938 0.1323 0.1187 -0.0281 0.0052  -0.0356 14  ILE A CD1 
107  C CD1 B ILE A 16  ? 0.1024 0.1265 0.1241 -0.0337 0.0162  -0.0407 14  ILE A CD1 
108  N N   . ASN A 17  ? 0.1108 0.1358 0.1491 -0.0317 0.0293  -0.0410 15  ASN A N   
109  C CA  . ASN A 17  ? 0.1151 0.1261 0.1467 -0.0273 0.0344  -0.0377 15  ASN A CA  
110  C C   . ASN A 17  ? 0.1398 0.1354 0.1650 -0.0296 0.0438  -0.0391 15  ASN A C   
111  O O   . ASN A 17  ? 0.1431 0.1235 0.1564 -0.0250 0.0464  -0.0352 15  ASN A O   
112  C CB  . ASN A 17  ? 0.1141 0.1325 0.1542 -0.0253 0.0362  -0.0372 15  ASN A CB  
113  C CG  . ASN A 17  ? 0.1074 0.1360 0.1506 -0.0206 0.0283  -0.0340 15  ASN A CG  
114  O OD1 . ASN A 17  ? 0.0993 0.1255 0.1357 -0.0184 0.0220  -0.0315 15  ASN A OD1 
115  N ND2 . ASN A 17  ? 0.1037 0.1436 0.1580 -0.0187 0.0296  -0.0336 15  ASN A ND2 
116  N N   . ARG A 18  ? 0.1533 0.1526 0.1853 -0.0366 0.0490  -0.0445 16  ARG A N   
117  C CA  . ARG A 18  ? 0.1751 0.1580 0.2008 -0.0391 0.0598  -0.0458 16  ARG A CA  
118  C C   . ARG A 18  ? 0.1691 0.1408 0.1841 -0.0371 0.0593  -0.0437 16  ARG A C   
119  O O   . ARG A 18  ? 0.1802 0.1346 0.1846 -0.0336 0.0659  -0.0404 16  ARG A O   
120  C CB  . ARG A 18  ? 0.2016 0.1916 0.2392 -0.0488 0.0670  -0.0533 16  ARG A CB  
121  C CG  . ARG A 18  ? 0.2047 0.1758 0.2369 -0.0515 0.0811  -0.0546 16  ARG A CG  
122  C CD  . ARG A 18  ? 0.2605 0.2402 0.3069 -0.0627 0.0887  -0.0631 16  ARG A CD  
123  N NE  . ARG A 18  ? 0.4080 0.4014 0.4610 -0.0704 0.0833  -0.0697 16  ARG A NE  
124  C CZ  . ARG A 18  ? 0.2843 0.3027 0.3514 -0.0750 0.0750  -0.0740 16  ARG A CZ  
125  N NH1 . ARG A 18  ? 0.4031 0.4323 0.4729 -0.0820 0.0701  -0.0801 16  ARG A NH1 
126  N NH2 . ARG A 18  ? 0.4583 0.4909 0.5363 -0.0720 0.0718  -0.0719 16  ARG A NH2 
127  N N   . ALA A 19  ? 0.1337 0.1154 0.1513 -0.0386 0.0518  -0.0451 17  ALA A N   
128  C CA  . ALA A 19  ? 0.1337 0.1067 0.1433 -0.0365 0.0518  -0.0432 17  ALA A CA  
129  C C   . ALA A 19  ? 0.1198 0.0870 0.1207 -0.0277 0.0462  -0.0356 17  ALA A C   
130  O O   . ALA A 19  ? 0.1287 0.0877 0.1233 -0.0242 0.0474  -0.0325 17  ALA A O   
131  C CB  . ALA A 19  ? 0.1407 0.1258 0.1551 -0.0413 0.0466  -0.0474 17  ALA A CB  
132  N N   . THR A 20  ? 0.1180 0.0907 0.1194 -0.0244 0.0400  -0.0330 18  THR A N   
133  C CA  . THR A 20  ? 0.1008 0.0707 0.0950 -0.0179 0.0333  -0.0274 18  THR A CA  
134  C C   . THR A 20  ? 0.1081 0.0693 0.0947 -0.0141 0.0350  -0.0246 18  THR A C   
135  O O   . THR A 20  ? 0.1113 0.0707 0.0914 -0.0100 0.0293  -0.0212 18  THR A O   
136  C CB  . THR A 20  ? 0.0898 0.0724 0.0891 -0.0179 0.0239  -0.0271 18  THR A CB  
137  O OG1 . THR A 20  ? 0.0869 0.0767 0.0916 -0.0188 0.0224  -0.0285 18  THR A OG1 
138  C CG2 . THR A 20  ? 0.1066 0.0967 0.1108 -0.0214 0.0224  -0.0296 18  THR A CG2 
139  N N   . ASN A 21  ? 0.1818 0.1366 0.1683 -0.0159 0.0438  -0.0265 19  ASN A N   
140  C CA  . ASN A 21  ? 0.1674 0.1124 0.1454 -0.0124 0.0471  -0.0242 19  ASN A CA  
141  C C   . ASN A 21  ? 0.1689 0.1017 0.1317 -0.0062 0.0460  -0.0188 19  ASN A C   
142  O O   . ASN A 21  ? 0.1791 0.1043 0.1375 -0.0046 0.0506  -0.0168 19  ASN A O   
143  C CB  . ASN A 21  ? 0.1926 0.1314 0.1733 -0.0158 0.0590  -0.0270 19  ASN A CB  
144  C CG  . ASN A 21  ? 0.2224 0.1542 0.1976 -0.0132 0.0631  -0.0257 19  ASN A CG  
145  O OD1 . ASN A 21  ? 0.2068 0.1290 0.1678 -0.0078 0.0606  -0.0217 19  ASN A OD1 
146  N ND2 . ASN A 21  ? 0.1837 0.1226 0.1708 -0.0172 0.0685  -0.0294 19  ASN A ND2 
147  N N   . PRO A 22  ? 0.1857 0.1170 0.1401 -0.0027 0.0398  -0.0164 20  PRO A N   
148  C CA  . PRO A 22  ? 0.2174 0.1399 0.1567 0.0030  0.0371  -0.0116 20  PRO A CA  
149  C C   . PRO A 22  ? 0.2129 0.1193 0.1397 0.0065  0.0469  -0.0088 20  PRO A C   
150  O O   . PRO A 22  ? 0.2441 0.1441 0.1590 0.0122  0.0454  -0.0037 20  PRO A O   
151  C CB  . PRO A 22  ? 0.2356 0.1591 0.1689 0.0035  0.0302  -0.0120 20  PRO A CB  
152  C CG  . PRO A 22  ? 0.2146 0.1488 0.1614 -0.0007 0.0282  -0.0158 20  PRO A CG  
153  C CD  . PRO A 22  ? 0.1925 0.1303 0.1510 -0.0041 0.0357  -0.0184 20  PRO A CD  
154  N N   . LEU A 23  ? 0.2016 0.1024 0.1317 0.0035  0.0572  -0.0115 21  LEU A N   
155  C CA  . LEU A 23  ? 0.2361 0.1196 0.1545 0.0063  0.0689  -0.0089 21  LEU A CA  
156  C C   . LEU A 23  ? 0.2475 0.1249 0.1675 0.0067  0.0761  -0.0074 21  LEU A C   
157  O O   . LEU A 23  ? 0.2768 0.1377 0.1849 0.0105  0.0862  -0.0036 21  LEU A O   
158  C CB  . LEU A 23  ? 0.2646 0.1443 0.1874 0.0024  0.0788  -0.0125 21  LEU A CB  
159  C CG  . LEU A 23  ? 0.2745 0.1532 0.1906 0.0040  0.0759  -0.0128 21  LEU A CG  
160  C CD1 . LEU A 23  ? 0.2732 0.1522 0.1996 -0.0001 0.0863  -0.0167 21  LEU A CD1 
161  C CD2 . LEU A 23  ? 0.3383 0.2010 0.2302 0.0108  0.0761  -0.0078 21  LEU A CD2 
162  N N   . ASN A 24  ? 0.2109 0.0998 0.1453 0.0020  0.0733  -0.0109 22  ASN A N   
163  C CA  . ASN A 24  ? 0.2184 0.1002 0.1546 0.0012  0.0816  -0.0107 22  ASN A CA  
164  C C   . ASN A 24  ? 0.2412 0.1114 0.1626 0.0109  0.0822  -0.0025 22  ASN A C   
165  O O   . ASN A 24  ? 0.2572 0.1351 0.1749 0.0161  0.0709  0.0016  22  ASN A O   
166  C CB  . ASN A 24  ? 0.2044 0.1000 0.1547 -0.0042 0.0765  -0.0152 22  ASN A CB  
167  C CG  . ASN A 24  ? 0.1960 0.1032 0.1610 -0.0137 0.0775  -0.0232 22  ASN A CG  
168  O OD1 . ASN A 24  ? 0.2032 0.1070 0.1704 -0.0171 0.0848  -0.0259 22  ASN A OD1 
169  N ND2 . ASN A 24  ? 0.1838 0.1058 0.1591 -0.0177 0.0699  -0.0267 22  ASN A ND2 
170  N N   . LYS A 25  ? 0.2822 0.1345 0.1956 0.0133  0.0956  0.0002  23  LYS A N   
171  C CA  . LYS A 25  ? 0.2916 0.1324 0.1906 0.0241  0.0975  0.0093  23  LYS A CA  
172  C C   . LYS A 25  ? 0.3251 0.1698 0.2309 0.0262  0.0965  0.0109  23  LYS A C   
173  O O   . LYS A 25  ? 0.3575 0.2012 0.2559 0.0361  0.0929  0.0190  23  LYS A O   
174  C CB  . LYS A 25  ? 0.3285 0.1458 0.2138 0.0275  0.1136  0.0129  23  LYS A CB  
175  C CG  . LYS A 25  ? 0.3460 0.1580 0.2208 0.0280  0.1144  0.0132  23  LYS A CG  
176  C CD  . LYS A 25  ? 0.4876 0.2765 0.3524 0.0283  0.1329  0.0148  23  LYS A CD  
177  C CE  . LYS A 25  ? 0.6504 0.4368 0.5114 0.0251  0.1357  0.0119  23  LYS A CE  
178  N NZ  . LYS A 25  ? 0.8484 0.6112 0.6870 0.0326  0.1476  0.0189  23  LYS A NZ  
179  N N   . GLU A 26  ? 0.3221 0.1714 0.2415 0.0172  0.1001  0.0034  24  GLU A N   
180  C CA  . GLU A 26  ? 0.3216 0.1741 0.2479 0.0175  0.1003  0.0033  24  GLU A CA  
181  C C   . GLU A 26  ? 0.2765 0.1440 0.2179 0.0061  0.0956  -0.0065 24  GLU A C   
182  O O   . GLU A 26  ? 0.2605 0.1336 0.2072 -0.0014 0.0947  -0.0124 24  GLU A O   
183  C CB  . GLU A 26  ? 0.3382 0.1692 0.2589 0.0190  0.1175  0.0047  24  GLU A CB  
184  C CG  . GLU A 26  ? 0.4198 0.2329 0.3240 0.0308  0.1251  0.0149  24  GLU A CG  
185  C CD  . GLU A 26  ? 0.6077 0.4202 0.5077 0.0433  0.1230  0.0246  24  GLU A CD  
186  O OE1 . GLU A 26  ? 0.5750 0.3692 0.4619 0.0532  0.1333  0.0331  24  GLU A OE1 
187  O OE2 . GLU A 26  ? 0.5518 0.3822 0.4614 0.0440  0.1112  0.0245  24  GLU A OE2 
188  N N   . LEU A 27  ? 0.2481 0.1227 0.1959 0.0055  0.0923  -0.0075 25  LEU A N   
189  C CA  . LEU A 27  ? 0.2207 0.1080 0.1802 -0.0047 0.0886  -0.0163 25  LEU A CA  
190  C C   . LEU A 27  ? 0.2504 0.1317 0.2134 -0.0153 0.0989  -0.0249 25  LEU A C   
191  O O   . LEU A 27  ? 0.2827 0.1459 0.2404 -0.0161 0.1130  -0.0254 25  LEU A O   
192  C CB  . LEU A 27  ? 0.2370 0.1262 0.1995 -0.0034 0.0886  -0.0159 25  LEU A CB  
193  C CG  . LEU A 27  ? 0.2097 0.1102 0.1735 0.0050  0.0773  -0.0088 25  LEU A CG  
194  C CD1 . LEU A 27  ? 0.2394 0.1379 0.2058 0.0074  0.0814  -0.0076 25  LEU A CD1 
195  C CD2 . LEU A 27  ? 0.2075 0.1270 0.1784 0.0011  0.0633  -0.0115 25  LEU A CD2 
196  N N   . ASP A 28  ? 0.2076 0.1042 0.1800 -0.0232 0.0923  -0.0314 26  ASP A N   
197  C CA  . ASP A 28  ? 0.2237 0.1204 0.2027 -0.0342 0.1000  -0.0402 26  ASP A CA  
198  C C   . ASP A 28  ? 0.2364 0.1400 0.2217 -0.0432 0.1001  -0.0484 26  ASP A C   
199  O O   . ASP A 28  ? 0.2295 0.1522 0.2235 -0.0482 0.0903  -0.0529 26  ASP A O   
200  C CB  . ASP A 28  ? 0.2091 0.1210 0.1962 -0.0370 0.0927  -0.0423 26  ASP A CB  
201  C CG  . ASP A 28  ? 0.2421 0.1571 0.2387 -0.0480 0.1006  -0.0508 26  ASP A CG  
202  O OD1 . ASP A 28  ? 0.2484 0.1541 0.2452 -0.0551 0.1110  -0.0564 26  ASP A OD1 
203  O OD2 . ASP A 28  ? 0.2490 0.1763 0.2537 -0.0499 0.0967  -0.0523 26  ASP A OD2 
204  N N   . TRP A 29  ? 0.2716 0.1594 0.2511 -0.0440 0.1107  -0.0495 27  TRP A N   
205  C CA  . TRP A 29  ? 0.2762 0.1686 0.2581 -0.0513 0.1103  -0.0566 27  TRP A CA  
206  C C   . TRP A 29  ? 0.2660 0.1710 0.2571 -0.0653 0.1098  -0.0682 27  TRP A C   
207  O O   . TRP A 29  ? 0.2650 0.1848 0.2600 -0.0708 0.1018  -0.0735 27  TRP A O   
208  C CB  . TRP A 29  ? 0.2799 0.1498 0.2528 -0.0495 0.1244  -0.0560 27  TRP A CB  
209  C CG  . TRP A 29  ? 0.2612 0.1269 0.2285 -0.0362 0.1213  -0.0455 27  TRP A CG  
210  C CD1 . TRP A 29  ? 0.2951 0.1459 0.2548 -0.0245 0.1276  -0.0356 27  TRP A CD1 
211  C CD2 . TRP A 29  ? 0.2462 0.1259 0.2164 -0.0327 0.1102  -0.0433 27  TRP A CD2 
212  N NE1 . TRP A 29  ? 0.2858 0.1429 0.2452 -0.0144 0.1200  -0.0277 27  TRP A NE1 
213  C CE2 . TRP A 29  ? 0.2441 0.1173 0.2101 -0.0197 0.1108  -0.0327 27  TRP A CE2 
214  C CE3 . TRP A 29  ? 0.2641 0.1603 0.2395 -0.0393 0.1011  -0.0493 27  TRP A CE3 
215  C CZ2 . TRP A 29  ? 0.2540 0.1381 0.2231 -0.0140 0.1023  -0.0283 27  TRP A CZ2 
216  C CZ3 . TRP A 29  ? 0.2529 0.1572 0.2292 -0.0332 0.0935  -0.0445 27  TRP A CZ3 
217  C CH2 . TRP A 29  ? 0.2841 0.1831 0.2583 -0.0211 0.0939  -0.0343 27  TRP A CH2 
218  N N   . ALA A 30  ? 0.2970 0.1985 0.2922 -0.0709 0.1172  -0.0717 28  ALA A N   
219  C CA  . ALA A 30  ? 0.2909 0.2074 0.2974 -0.0847 0.1165  -0.0828 28  ALA A CA  
220  C C   . ALA A 30  ? 0.2768 0.2213 0.2932 -0.0840 0.0996  -0.0826 28  ALA A C   
221  O O   . ALA A 30  ? 0.2878 0.2495 0.3105 -0.0924 0.0931  -0.0901 28  ALA A O   
222  C CB  . ALA A 30  ? 0.2994 0.2074 0.3104 -0.0905 0.1287  -0.0860 28  ALA A CB  
223  N N   . SER A 31  ? 0.2119 0.1601 0.2286 -0.0741 0.0933  -0.0739 29  SER A N   
224  C CA  . SER A 31  ? 0.2101 0.1809 0.2345 -0.0714 0.0789  -0.0720 29  SER A CA  
225  C C   . SER A 31  ? 0.1990 0.1767 0.2191 -0.0679 0.0689  -0.0700 29  SER A C   
226  O O   . SER A 31  ? 0.2025 0.1992 0.2286 -0.0706 0.0592  -0.0726 29  SER A O   
227  C CB  . SER A 31  ? 0.2045 0.1730 0.2276 -0.0619 0.0765  -0.0638 29  SER A CB  
228  O OG  . SER A 31  ? 0.2299 0.1951 0.2585 -0.0656 0.0854  -0.0660 29  SER A OG  
229  N N   . ILE A 32  ? 0.1966 0.1591 0.2064 -0.0612 0.0716  -0.0646 30  ILE A N   
230  C CA  . ILE A 32  ? 0.2000 0.1674 0.2060 -0.0577 0.0640  -0.0624 30  ILE A CA  
231  C C   . ILE A 32  ? 0.2195 0.1928 0.2257 -0.0672 0.0645  -0.0712 30  ILE A C   
232  O O   . ILE A 32  ? 0.2002 0.1901 0.2092 -0.0687 0.0545  -0.0727 30  ILE A O   
233  C CB  . ILE A 32  ? 0.1808 0.1314 0.1779 -0.0492 0.0689  -0.0554 30  ILE A CB  
234  C CG1 . ILE A 32  ? 0.1680 0.1158 0.1633 -0.0396 0.0655  -0.0465 30  ILE A CG1 
235  C CG2 . ILE A 32  ? 0.1997 0.1542 0.1942 -0.0476 0.0643  -0.0547 30  ILE A CG2 
236  C CD1 . ILE A 32  ? 0.1746 0.1079 0.1620 -0.0305 0.0700  -0.0390 30  ILE A CD1 
237  N N   . ASN A 33  ? 0.2803 0.2401 0.2833 -0.0744 0.0764  -0.0777 31  ASN A N   
238  C CA  . ASN A 33  ? 0.2834 0.2460 0.2843 -0.0853 0.0784  -0.0878 31  ASN A CA  
239  C C   . ASN A 33  ? 0.3056 0.2923 0.3168 -0.0941 0.0698  -0.0949 31  ASN A C   
240  O O   . ASN A 33  ? 0.2910 0.2924 0.3015 -0.0981 0.0614  -0.0990 31  ASN A O   
241  C CB  . ASN A 33  ? 0.3016 0.2418 0.2966 -0.0919 0.0950  -0.0937 31  ASN A CB  
242  C CG  . ASN A 33  ? 0.2716 0.1887 0.2563 -0.0823 0.1042  -0.0864 31  ASN A CG  
243  O OD1 . ASN A 33  ? 0.3320 0.2510 0.3132 -0.0743 0.0985  -0.0803 31  ASN A OD1 
244  N ND2 . ASN A 33  ? 0.3768 0.2716 0.3569 -0.0837 0.1196  -0.0875 31  ASN A ND2 
245  N N   . GLY A 34  ? 0.2873 0.2801 0.3085 -0.0952 0.0706  -0.0947 32  GLY A N   
246  C CA  . GLY A 34  ? 0.2413 0.2597 0.2752 -0.1021 0.0624  -0.1002 32  GLY A CA  
247  C C   . GLY A 34  ? 0.2286 0.2675 0.2649 -0.0954 0.0472  -0.0951 32  GLY A C   
248  O O   . GLY A 34  ? 0.2296 0.2900 0.2717 -0.1010 0.0389  -0.1001 32  GLY A O   
249  N N   . PHE A 35  ? 0.1851 0.2182 0.2177 -0.0835 0.0436  -0.0848 33  PHE A N   
250  C CA  . PHE A 35  ? 0.1593 0.2073 0.1929 -0.0763 0.0312  -0.0788 33  PHE A CA  
251  C C   . PHE A 35  ? 0.1796 0.2313 0.2047 -0.0783 0.0263  -0.0812 33  PHE A C   
252  O O   . PHE A 35  ? 0.1867 0.2574 0.2143 -0.0796 0.0171  -0.0826 33  PHE A O   
253  C CB  . PHE A 35  ? 0.1454 0.1826 0.1752 -0.0647 0.0303  -0.0686 33  PHE A CB  
254  C CG  . PHE A 35  ? 0.1287 0.1768 0.1583 -0.0576 0.0197  -0.0624 33  PHE A CG  
255  C CD1 . PHE A 35  ? 0.1271 0.1711 0.1483 -0.0543 0.0167  -0.0594 33  PHE A CD1 
256  C CD2 . PHE A 35  ? 0.1178 0.1796 0.1558 -0.0541 0.0140  -0.0595 33  PHE A CD2 
257  C CE1 . PHE A 35  ? 0.1230 0.1748 0.1436 -0.0479 0.0085  -0.0535 33  PHE A CE1 
258  C CE2 . PHE A 35  ? 0.1106 0.1795 0.1474 -0.0471 0.0059  -0.0533 33  PHE A CE2 
259  C CZ  . PHE A 35  ? 0.1079 0.1707 0.1357 -0.0441 0.0034  -0.0503 33  PHE A CZ  
260  N N   . CYS A 36  ? 0.2013 0.2351 0.2161 -0.0791 0.0336  -0.0824 34  CYS A N   
261  C CA  . CYS A 36  ? 0.2646 0.2993 0.2698 -0.0809 0.0308  -0.0848 34  CYS A CA  
262  C C   . CYS A 36  ? 0.2890 0.3370 0.2943 -0.0927 0.0285  -0.0957 34  CYS A C   
263  O O   . CYS A 36  ? 0.2729 0.3352 0.2744 -0.0934 0.0196  -0.0967 34  CYS A O   
264  C CB  . CYS A 36  ? 0.2413 0.2533 0.2365 -0.0790 0.0408  -0.0837 34  CYS A CB  
265  S SG  . CYS A 36  ? 0.2807 0.2809 0.2758 -0.0654 0.0417  -0.0712 34  CYS A SG  
266  N N   . GLU A 37  ? 0.2683 0.3129 0.2786 -0.1021 0.0363  -0.1036 35  GLU A N   
267  C CA  . GLU A 37  ? 0.3754 0.4321 0.3869 -0.1158 0.0354  -0.1158 35  GLU A CA  
268  C C   . GLU A 37  ? 0.3584 0.4463 0.3812 -0.1169 0.0219  -0.1165 35  GLU A C   
269  O O   . GLU A 37  ? 0.4307 0.5345 0.4521 -0.1260 0.0163  -0.1249 35  GLU A O   
270  C CB  . GLU A 37  ? 0.3692 0.4135 0.3851 -0.1258 0.0485  -0.1238 35  GLU A CB  
271  C CG  . GLU A 37  ? 0.4132 0.4281 0.4158 -0.1283 0.0628  -0.1269 35  GLU A CG  
272  C CD  . GLU A 37  ? 0.5136 0.5098 0.5196 -0.1328 0.0778  -0.1298 35  GLU A CD  
273  O OE1 . GLU A 37  ? 0.5384 0.5458 0.5577 -0.1376 0.0778  -0.1325 35  GLU A OE1 
274  O OE2 . GLU A 37  ? 0.5235 0.4930 0.5191 -0.1305 0.0905  -0.1285 35  GLU A OE2 
275  N N   . GLN A 38  ? 0.3747 0.4713 0.4080 -0.1075 0.0171  -0.1076 36  GLN A N   
276  C CA  . GLN A 38  ? 0.3517 0.4771 0.3986 -0.1070 0.0066  -0.1070 36  GLN A CA  
277  C C   . GLN A 38  ? 0.3309 0.4699 0.3745 -0.0966 -0.0056 -0.0985 36  GLN A C   
278  O O   . GLN A 38  ? 0.3251 0.4892 0.3785 -0.0952 -0.0149 -0.0974 36  GLN A O   
279  C CB  . GLN A 38  ? 0.3955 0.5225 0.4575 -0.1041 0.0108  -0.1035 36  GLN A CB  
280  C CG  . GLN A 38  ? 0.3379 0.4897 0.4132 -0.0969 0.0008  -0.0974 36  GLN A CG  
281  C CD  . GLN A 38  ? 0.5043 0.6860 0.5941 -0.1061 -0.0052 -0.1054 36  GLN A CD  
282  O OE1 . GLN A 38  ? 0.5221 0.7051 0.6189 -0.1185 0.0014  -0.1153 36  GLN A OE1 
283  N NE2 . GLN A 38  ? 0.4359 0.6422 0.5306 -0.1000 -0.0175 -0.1008 36  GLN A NE2 
284  N N   . LEU A 39  ? 0.2791 0.4015 0.3110 -0.0879 -0.0047 -0.0909 37  LEU A N   
285  C CA  . LEU A 39  ? 0.2527 0.3839 0.2812 -0.0775 -0.0140 -0.0819 37  LEU A CA  
286  C C   . LEU A 39  ? 0.2988 0.4435 0.3176 -0.0805 -0.0220 -0.0853 37  LEU A C   
287  O O   . LEU A 39  ? 0.2905 0.4488 0.3084 -0.0730 -0.0309 -0.0787 37  LEU A O   
288  C CB  . LEU A 39  ? 0.1533 0.2633 0.1737 -0.0683 -0.0101 -0.0734 37  LEU A CB  
289  C CG  . LEU A 39  ? 0.1943 0.2843 0.2015 -0.0708 -0.0031 -0.0757 37  LEU A CG  
290  C CD1 . LEU A 39  ? 0.2227 0.3166 0.2178 -0.0696 -0.0083 -0.0749 37  LEU A CD1 
291  C CD2 . LEU A 39  ? 0.1947 0.2664 0.2010 -0.0629 0.0021  -0.0681 37  LEU A CD2 
292  N N   . ASN A 40  ? 0.3677 0.5095 0.3794 -0.0921 -0.0186 -0.0960 38  ASN A N   
293  C CA  . ASN A 40  ? 0.4475 0.6020 0.4477 -0.0969 -0.0260 -0.1011 38  ASN A CA  
294  C C   . ASN A 40  ? 0.4485 0.6347 0.4588 -0.1025 -0.0364 -0.1064 38  ASN A C   
295  O O   . ASN A 40  ? 0.4530 0.6533 0.4535 -0.1065 -0.0443 -0.1106 38  ASN A O   
296  C CB  . ASN A 40  ? 0.4919 0.6282 0.4772 -0.1070 -0.0176 -0.1108 38  ASN A CB  
297  C CG  . ASN A 40  ? 0.5676 0.6741 0.5473 -0.1023 -0.0056 -0.1065 38  ASN A CG  
298  O OD1 . ASN A 40  ? 0.5872 0.6828 0.5762 -0.1022 0.0022  -0.1058 38  ASN A OD1 
299  N ND2 . ASN A 40  ? 0.5689 0.6621 0.5328 -0.0996 -0.0030 -0.1048 38  ASN A ND2 
300  N N   . GLU A 41  ? 0.4004 0.5989 0.4303 -0.1027 -0.0364 -0.1059 39  GLU A N   
301  C CA  . GLU A 41  ? 0.4183 0.6464 0.4619 -0.1115 -0.0434 -0.1137 39  GLU A CA  
302  C C   . GLU A 41  ? 0.4380 0.6960 0.4851 -0.1032 -0.0580 -0.1071 39  GLU A C   
303  O O   . GLU A 41  ? 0.4182 0.7054 0.4750 -0.1100 -0.0663 -0.1133 39  GLU A O   
304  C CB  . GLU A 41  ? 0.4172 0.6477 0.4818 -0.1143 -0.0366 -0.1152 39  GLU A CB  
305  C CG  . GLU A 41  ? 0.4359 0.6439 0.4990 -0.1263 -0.0227 -0.1249 39  GLU A CG  
306  C CD  . GLU A 41  ? 0.5527 0.7616 0.6050 -0.1415 -0.0223 -0.1387 39  GLU A CD  
307  O OE1 . GLU A 41  ? 0.5435 0.7271 0.5775 -0.1433 -0.0152 -0.1408 39  GLU A OE1 
308  O OE2 . GLU A 41  ? 0.5833 0.8186 0.6461 -0.1522 -0.0285 -0.1478 39  GLU A OE2 
309  N N   . ASP A 42  ? 0.4621 0.7135 0.5031 -0.0883 -0.0605 -0.0941 40  ASP A N   
310  C CA  . ASP A 42  ? 0.4882 0.7632 0.5290 -0.0782 -0.0729 -0.0859 40  ASP A CA  
311  C C   . ASP A 42  ? 0.4801 0.7381 0.5020 -0.0667 -0.0733 -0.0757 40  ASP A C   
312  O O   . ASP A 42  ? 0.4274 0.6573 0.4381 -0.0669 -0.0645 -0.0753 40  ASP A O   
313  C CB  . ASP A 42  ? 0.4745 0.7667 0.5373 -0.0694 -0.0752 -0.0782 40  ASP A CB  
314  C CG  . ASP A 42  ? 0.5352 0.8043 0.5980 -0.0572 -0.0678 -0.0671 40  ASP A CG  
315  O OD1 . ASP A 42  ? 0.5344 0.7749 0.5864 -0.0590 -0.0592 -0.0679 40  ASP A OD1 
316  O OD2 . ASP A 42  ? 0.6378 0.9175 0.7108 -0.0457 -0.0708 -0.0575 40  ASP A OD2 
317  N N   . PHE A 43  ? 0.6460 0.9213 0.6648 -0.0562 -0.0830 -0.0670 41  PHE A N   
318  C CA  . PHE A 43  ? 0.6743 0.9338 0.6762 -0.0448 -0.0825 -0.0564 41  PHE A CA  
319  C C   . PHE A 43  ? 0.6217 0.8604 0.6295 -0.0350 -0.0744 -0.0468 41  PHE A C   
320  O O   . PHE A 43  ? 0.6257 0.8411 0.6209 -0.0310 -0.0687 -0.0423 41  PHE A O   
321  C CB  . PHE A 43  ? 0.7274 1.0100 0.7234 -0.0353 -0.0942 -0.0488 41  PHE A CB  
322  C CG  . PHE A 43  ? 0.7727 1.0381 0.7478 -0.0255 -0.0928 -0.0394 41  PHE A CG  
323  C CD1 . PHE A 43  ? 0.8357 1.0967 0.8124 -0.0104 -0.0920 -0.0255 41  PHE A CD1 
324  C CD2 . PHE A 43  ? 0.8664 1.1150 0.8208 -0.0320 -0.0894 -0.0448 41  PHE A CD2 
325  C CE1 . PHE A 43  ? 0.9049 1.1474 0.8631 -0.0024 -0.0888 -0.0171 41  PHE A CE1 
326  C CE2 . PHE A 43  ? 0.9103 1.1413 0.8466 -0.0235 -0.0862 -0.0362 41  PHE A CE2 
327  C CZ  . PHE A 43  ? 0.8844 1.1124 0.8230 -0.0091 -0.0859 -0.0224 41  PHE A CZ  
328  N N   . GLU A 44  ? 0.4104 0.6585 0.4372 -0.0310 -0.0739 -0.0436 42  GLU A N   
329  C CA  . GLU A 44  ? 0.3455 0.5747 0.3769 -0.0221 -0.0667 -0.0351 42  GLU A CA  
330  C C   . GLU A 44  ? 0.2923 0.4967 0.3233 -0.0292 -0.0566 -0.0405 42  GLU A C   
331  O O   . GLU A 44  ? 0.2152 0.4012 0.2466 -0.0234 -0.0506 -0.0348 42  GLU A O   
332  C CB  . GLU A 44  ? 0.3352 0.5812 0.3860 -0.0151 -0.0683 -0.0301 42  GLU A CB  
333  C CG  . GLU A 44  ? 0.5055 0.7844 0.5628 -0.0105 -0.0792 -0.0273 42  GLU A CG  
334  C CD  . GLU A 44  ? 0.6282 0.9091 0.6681 -0.0015 -0.0855 -0.0192 42  GLU A CD  
335  O OE1 . GLU A 44  ? 0.7316 1.0397 0.7752 0.0044  -0.0950 -0.0153 42  GLU A OE1 
336  O OE2 . GLU A 44  ? 0.6489 0.9056 0.6717 -0.0003 -0.0809 -0.0169 42  GLU A OE2 
337  N N   . GLY A 45  ? 0.2429 0.4466 0.2726 -0.0416 -0.0544 -0.0515 43  GLY A N   
338  C CA  . GLY A 45  ? 0.2082 0.3906 0.2393 -0.0478 -0.0444 -0.0564 43  GLY A CA  
339  C C   . GLY A 45  ? 0.1956 0.3518 0.2149 -0.0434 -0.0383 -0.0515 43  GLY A C   
340  O O   . GLY A 45  ? 0.1626 0.3046 0.1863 -0.0396 -0.0328 -0.0476 43  GLY A O   
341  N N   . PRO A 46  ? 0.1828 0.3320 0.1871 -0.0454 -0.0385 -0.0530 44  PRO A N   
342  C CA  . PRO A 46  ? 0.1880 0.3140 0.1835 -0.0429 -0.0317 -0.0498 44  PRO A CA  
343  C C   . PRO A 46  ? 0.1850 0.3028 0.1807 -0.0324 -0.0316 -0.0391 44  PRO A C   
344  O O   . PRO A 46  ? 0.1450 0.2478 0.1434 -0.0309 -0.0260 -0.0370 44  PRO A O   
345  C CB  . PRO A 46  ? 0.2224 0.3464 0.2020 -0.0465 -0.0324 -0.0532 44  PRO A CB  
346  C CG  . PRO A 46  ? 0.2167 0.3575 0.1969 -0.0558 -0.0368 -0.0628 44  PRO A CG  
347  C CD  . PRO A 46  ? 0.2250 0.3867 0.2207 -0.0527 -0.0433 -0.0603 44  PRO A CD  
348  N N   . PRO A 47  ? 0.1868 0.3159 0.1814 -0.0251 -0.0377 -0.0326 45  PRO A N   
349  C CA  . PRO A 47  ? 0.1747 0.2950 0.1707 -0.0158 -0.0362 -0.0232 45  PRO A CA  
350  C C   . PRO A 47  ? 0.1491 0.2670 0.1580 -0.0140 -0.0337 -0.0221 45  PRO A C   
351  O O   . PRO A 47  ? 0.1353 0.2382 0.1441 -0.0108 -0.0295 -0.0182 45  PRO A O   
352  C CB  . PRO A 47  ? 0.1905 0.3245 0.1825 -0.0082 -0.0426 -0.0167 45  PRO A CB  
353  C CG  . PRO A 47  ? 0.2456 0.3944 0.2310 -0.0137 -0.0481 -0.0226 45  PRO A CG  
354  C CD  . PRO A 47  ? 0.2052 0.3550 0.1965 -0.0247 -0.0458 -0.0333 45  PRO A CD  
355  N N   . LEU A 48  ? 0.1097 0.2424 0.1293 -0.0162 -0.0359 -0.0256 46  LEU A N   
356  C CA  . LEU A 48  ? 0.0997 0.2282 0.1303 -0.0153 -0.0319 -0.0254 46  LEU A CA  
357  C C   . LEU A 48  ? 0.0945 0.2049 0.1232 -0.0206 -0.0251 -0.0294 46  LEU A C   
358  O O   . LEU A 48  ? 0.0904 0.1879 0.1199 -0.0173 -0.0214 -0.0261 46  LEU A O   
359  C CB  . LEU A 48  ? 0.1003 0.2492 0.1442 -0.0181 -0.0344 -0.0294 46  LEU A CB  
360  C CG  . LEU A 48  ? 0.0915 0.2364 0.1466 -0.0175 -0.0289 -0.0296 46  LEU A CG  
361  C CD1 . LEU A 48  ? 0.0880 0.2231 0.1425 -0.0076 -0.0269 -0.0211 46  LEU A CD1 
362  C CD2 . LEU A 48  ? 0.0931 0.2598 0.1635 -0.0210 -0.0306 -0.0339 46  LEU A CD2 
363  N N   . ALA A 49  ? 0.0964 0.2053 0.1217 -0.0285 -0.0234 -0.0363 47  ALA A N   
364  C CA  . ALA A 49  ? 0.0857 0.1776 0.1085 -0.0323 -0.0166 -0.0393 47  ALA A CA  
365  C C   . ALA A 49  ? 0.0875 0.1640 0.1037 -0.0274 -0.0148 -0.0335 47  ALA A C   
366  O O   . ALA A 49  ? 0.0807 0.1455 0.0980 -0.0262 -0.0109 -0.0321 47  ALA A O   
367  C CB  . ALA A 49  ? 0.0987 0.1897 0.1169 -0.0408 -0.0139 -0.0471 47  ALA A CB  
368  N N   . THR A 50  ? 0.1092 0.1864 0.1185 -0.0247 -0.0175 -0.0302 48  THR A N   
369  C CA  . THR A 50  ? 0.1209 0.1853 0.1260 -0.0212 -0.0154 -0.0254 48  THR A CA  
370  C C   . THR A 50  ? 0.1063 0.1667 0.1148 -0.0157 -0.0161 -0.0199 48  THR A C   
371  O O   . THR A 50  ? 0.1042 0.1538 0.1127 -0.0150 -0.0137 -0.0182 48  THR A O   
372  C CB  . THR A 50  ? 0.1130 0.1765 0.1091 -0.0205 -0.0160 -0.0234 48  THR A CB  
373  O OG1 . THR A 50  ? 0.1237 0.1976 0.1172 -0.0166 -0.0209 -0.0201 48  THR A OG1 
374  C CG2 . THR A 50  ? 0.1324 0.1952 0.1231 -0.0265 -0.0134 -0.0297 48  THR A CG2 
375  N N   . ARG A 51  ? 0.1022 0.1716 0.1139 -0.0119 -0.0191 -0.0174 49  ARG A N   
376  C CA  . ARG A 51  ? 0.0992 0.1632 0.1136 -0.0068 -0.0182 -0.0128 49  ARG A CA  
377  C C   . ARG A 51  ? 0.0942 0.1518 0.1130 -0.0087 -0.0151 -0.0155 49  ARG A C   
378  O O   . ARG A 51  ? 0.0941 0.1403 0.1109 -0.0073 -0.0131 -0.0136 49  ARG A O   
379  C CB  . ARG A 51  ? 0.1026 0.1777 0.1199 -0.0009 -0.0211 -0.0087 49  ARG A CB  
380  C CG  . ARG A 51  ? 0.1696 0.2478 0.1794 0.0024  -0.0236 -0.0045 49  ARG A CG  
381  C CD  . ARG A 51  ? 0.2765 0.3636 0.2877 0.0107  -0.0259 0.0018  49  ARG A CD  
382  N NE  . ARG A 51  ? 0.4113 0.5193 0.4256 0.0106  -0.0316 0.0001  49  ARG A NE  
383  C CZ  . ARG A 51  ? 0.4002 0.5225 0.4257 0.0116  -0.0335 -0.0011 49  ARG A CZ  
384  N NH1 . ARG A 51  ? 0.2664 0.4101 0.2956 0.0105  -0.0395 -0.0033 49  ARG A NH1 
385  N NH2 . ARG A 51  ? 0.5285 0.6442 0.5612 0.0139  -0.0291 0.0000  49  ARG A NH2 
386  N N   . LEU A 52  ? 0.0827 0.1473 0.1064 -0.0125 -0.0143 -0.0203 50  LEU A N   
387  C CA  . LEU A 52  ? 0.0803 0.1374 0.1065 -0.0142 -0.0101 -0.0226 50  LEU A CA  
388  C C   . LEU A 52  ? 0.0657 0.1094 0.0860 -0.0162 -0.0076 -0.0232 50  LEU A C   
389  O O   . LEU A 52  ? 0.0843 0.1181 0.1024 -0.0148 -0.0056 -0.0220 50  LEU A O   
390  C CB  . LEU A 52  ? 0.0792 0.1461 0.1124 -0.0189 -0.0084 -0.0280 50  LEU A CB  
391  C CG  . LEU A 52  ? 0.0766 0.1593 0.1191 -0.0163 -0.0107 -0.0271 50  LEU A CG  
392  C CD1 . LEU A 52  ? 0.0687 0.1629 0.1193 -0.0233 -0.0092 -0.0338 50  LEU A CD1 
393  C CD2 . LEU A 52  ? 0.0789 0.1551 0.1238 -0.0109 -0.0075 -0.0233 50  LEU A CD2 
394  N N   . LEU A 53  ? 0.0726 0.1165 0.0900 -0.0192 -0.0076 -0.0251 51  LEU A N   
395  C CA  . LEU A 53  ? 0.0714 0.1046 0.0850 -0.0198 -0.0050 -0.0247 51  LEU A CA  
396  C C   . LEU A 53  ? 0.0574 0.0849 0.0688 -0.0164 -0.0071 -0.0202 51  LEU A C   
397  O O   . LEU A 53  ? 0.0759 0.0961 0.0858 -0.0157 -0.0062 -0.0192 51  LEU A O   
398  C CB  . LEU A 53  ? 0.0731 0.1067 0.0841 -0.0229 -0.0032 -0.0272 51  LEU A CB  
399  C CG  . LEU A 53  ? 0.0954 0.1297 0.1071 -0.0280 0.0010  -0.0331 51  LEU A CG  
400  C CD1 . LEU A 53  ? 0.0756 0.1112 0.0828 -0.0314 0.0022  -0.0361 51  LEU A CD1 
401  C CD2 . LEU A 53  ? 0.0733 0.0957 0.0840 -0.0274 0.0065  -0.0329 51  LEU A CD2 
402  N N   . ALA A 54  ? 0.0895 0.1206 0.1003 -0.0147 -0.0097 -0.0175 52  ALA A N   
403  C CA  . ALA A 54  ? 0.0933 0.1184 0.1026 -0.0129 -0.0107 -0.0140 52  ALA A CA  
404  C C   . ALA A 54  ? 0.0954 0.1140 0.1040 -0.0116 -0.0107 -0.0134 52  ALA A C   
405  O O   . ALA A 54  ? 0.0974 0.1101 0.1045 -0.0124 -0.0112 -0.0130 52  ALA A O   
406  C CB  . ALA A 54  ? 0.0958 0.1235 0.1034 -0.0109 -0.0119 -0.0108 52  ALA A CB  
407  N N   . HIS A 55  ? 0.1063 0.1267 0.1161 -0.0099 -0.0100 -0.0138 53  HIS A N   
408  C CA  . HIS A 55  ? 0.1107 0.1232 0.1182 -0.0087 -0.0086 -0.0138 53  HIS A CA  
409  C C   . HIS A 55  ? 0.1140 0.1211 0.1188 -0.0104 -0.0076 -0.0158 53  HIS A C   
410  O O   . HIS A 55  ? 0.1149 0.1143 0.1148 -0.0105 -0.0083 -0.0155 53  HIS A O   
411  C CB  . HIS A 55  ? 0.1149 0.1314 0.1257 -0.0058 -0.0068 -0.0136 53  HIS A CB  
412  C CG  . HIS A 55  ? 0.1175 0.1242 0.1247 -0.0043 -0.0039 -0.0137 53  HIS A CG  
413  N ND1 . HIS A 55  ? 0.1304 0.1358 0.1383 -0.0045 -0.0005 -0.0158 53  HIS A ND1 
414  C CD2 . HIS A 55  ? 0.1246 0.1202 0.1257 -0.0035 -0.0031 -0.0126 53  HIS A CD2 
415  C CE1 . HIS A 55  ? 0.1252 0.1194 0.1269 -0.0031 0.0021  -0.0156 53  HIS A CE1 
416  N NE2 . HIS A 55  ? 0.1288 0.1168 0.1260 -0.0027 0.0004  -0.0141 53  HIS A NE2 
417  N N   . LYS A 56  ? 0.0902 0.1007 0.0971 -0.0119 -0.0056 -0.0179 54  LYS A N   
418  C CA  . LYS A 56  ? 0.0799 0.0836 0.0831 -0.0122 -0.0032 -0.0188 54  LYS A CA  
419  C C   . LYS A 56  ? 0.0969 0.0977 0.0973 -0.0120 -0.0057 -0.0170 54  LYS A C   
420  O O   . LYS A 56  ? 0.1008 0.0956 0.0959 -0.0108 -0.0062 -0.0161 54  LYS A O   
421  C CB  . LYS A 56  ? 0.0892 0.0951 0.0951 -0.0143 0.0011  -0.0216 54  LYS A CB  
422  C CG  . LYS A 56  ? 0.0978 0.1086 0.1086 -0.0151 0.0038  -0.0239 54  LYS A CG  
423  C CD  . LYS A 56  ? 0.0705 0.0735 0.0779 -0.0128 0.0067  -0.0231 54  LYS A CD  
424  C CE  . LYS A 56  ? 0.0779 0.0872 0.0930 -0.0141 0.0112  -0.0256 54  LYS A CE  
425  N NZ  . LYS A 56  ? 0.1048 0.1068 0.1172 -0.0115 0.0155  -0.0247 54  LYS A NZ  
426  N N   . ILE A 57  ? 0.0899 0.0959 0.0939 -0.0129 -0.0074 -0.0162 55  ILE A N   
427  C CA  . ILE A 57  ? 0.0877 0.0939 0.0923 -0.0126 -0.0092 -0.0143 55  ILE A CA  
428  C C   . ILE A 57  ? 0.1090 0.1131 0.1117 -0.0129 -0.0133 -0.0132 55  ILE A C   
429  O O   . ILE A 57  ? 0.1020 0.1073 0.1050 -0.0127 -0.0158 -0.0119 55  ILE A O   
430  C CB  . ILE A 57  ? 0.1015 0.1131 0.1104 -0.0137 -0.0085 -0.0140 55  ILE A CB  
431  C CG1 . ILE A 57  ? 0.0920 0.1037 0.1009 -0.0143 -0.0040 -0.0161 55  ILE A CG1 
432  C CG2 . ILE A 57  ? 0.0808 0.0946 0.0931 -0.0134 -0.0103 -0.0115 55  ILE A CG2 
433  C CD1 . ILE A 57  ? 0.1042 0.1204 0.1143 -0.0161 -0.0028 -0.0171 55  ILE A CD1 
434  N N   . GLN A 58  ? 0.1100 0.1117 0.1111 -0.0136 -0.0137 -0.0137 56  GLN A N   
435  C CA  . GLN A 58  ? 0.1159 0.1130 0.1137 -0.0151 -0.0162 -0.0140 56  GLN A CA  
436  C C   . GLN A 58  ? 0.1268 0.1164 0.1162 -0.0146 -0.0165 -0.0154 56  GLN A C   
437  O O   . GLN A 58  ? 0.1332 0.1176 0.1175 -0.0167 -0.0185 -0.0167 56  GLN A O   
438  C CB  . GLN A 58  ? 0.1167 0.1117 0.1152 -0.0154 -0.0148 -0.0134 56  GLN A CB  
439  C CG  . GLN A 58  ? 0.1189 0.1197 0.1229 -0.0160 -0.0146 -0.0116 56  GLN A CG  
440  C CD  . GLN A 58  ? 0.1897 0.1868 0.1929 -0.0155 -0.0126 -0.0098 56  GLN A CD  
441  O OE1 . GLN A 58  ? 0.1808 0.1799 0.1867 -0.0164 -0.0118 -0.0080 56  GLN A OE1 
442  N NE2 . GLN A 58  ? 0.1520 0.1421 0.1510 -0.0138 -0.0109 -0.0099 56  GLN A NE2 
443  N N   . SER A 59  ? 0.1065 0.0947 0.0935 -0.0123 -0.0141 -0.0154 57  SER A N   
444  C CA  . SER A 59  ? 0.1176 0.0972 0.0947 -0.0113 -0.0132 -0.0164 57  SER A CA  
445  C C   . SER A 59  ? 0.1254 0.1043 0.0965 -0.0121 -0.0184 -0.0161 57  SER A C   
446  O O   . SER A 59  ? 0.1221 0.1081 0.0974 -0.0113 -0.0212 -0.0142 57  SER A O   
447  C CB  . SER A 59  ? 0.1205 0.0977 0.0960 -0.0088 -0.0084 -0.0161 57  SER A CB  
448  O OG  . SER A 59  ? 0.1243 0.0918 0.0887 -0.0075 -0.0066 -0.0166 57  SER A OG  
449  N N   . PRO A 60  ? 0.1398 0.1105 0.1004 -0.0133 -0.0194 -0.0181 58  PRO A N   
450  C CA  . PRO A 60  ? 0.1495 0.1208 0.1024 -0.0143 -0.0254 -0.0184 58  PRO A CA  
451  C C   . PRO A 60  ? 0.1669 0.1363 0.1124 -0.0095 -0.0247 -0.0157 58  PRO A C   
452  O O   . PRO A 60  ? 0.1745 0.1469 0.1138 -0.0085 -0.0302 -0.0145 58  PRO A O   
453  C CB  . PRO A 60  ? 0.1997 0.1603 0.1413 -0.0176 -0.0253 -0.0223 58  PRO A CB  
454  C CG  . PRO A 60  ? 0.1953 0.1472 0.1362 -0.0155 -0.0174 -0.0227 58  PRO A CG  
455  C CD  . PRO A 60  ? 0.1529 0.1138 0.1082 -0.0138 -0.0152 -0.0203 58  PRO A CD  
456  N N   . GLN A 61  ? 0.1595 0.1236 0.1050 -0.0065 -0.0175 -0.0148 59  GLN A N   
457  C CA  . GLN A 61  ? 0.1787 0.1382 0.1174 -0.0018 -0.0141 -0.0119 59  GLN A CA  
458  C C   . GLN A 61  ? 0.1503 0.1178 0.0992 0.0005  -0.0135 -0.0087 59  GLN A C   
459  O O   . GLN A 61  ? 0.1544 0.1244 0.1129 -0.0007 -0.0091 -0.0096 59  GLN A O   
460  C CB  . GLN A 61  ? 0.1711 0.1209 0.1067 -0.0010 -0.0052 -0.0131 59  GLN A CB  
461  C CG  . GLN A 61  ? 0.1965 0.1364 0.1211 -0.0022 -0.0039 -0.0159 59  GLN A CG  
462  C CD  . GLN A 61  ? 0.2106 0.1417 0.1331 -0.0008 0.0057  -0.0165 59  GLN A CD  
463  O OE1 . GLN A 61  ? 0.2232 0.1488 0.1408 0.0020  0.0110  -0.0146 59  GLN A OE1 
464  N NE2 . GLN A 61  ? 0.2597 0.1887 0.1854 -0.0023 0.0089  -0.0190 59  GLN A NE2 
465  N N   . GLU A 62  ? 0.1411 0.1136 0.0879 0.0036  -0.0183 -0.0053 60  GLU A N   
466  C CA  . GLU A 62  ? 0.1336 0.1148 0.0911 0.0061  -0.0182 -0.0020 60  GLU A CA  
467  C C   . GLU A 62  ? 0.1418 0.1164 0.1018 0.0081  -0.0086 -0.0012 60  GLU A C   
468  O O   . GLU A 62  ? 0.1191 0.0985 0.0895 0.0067  -0.0062 -0.0018 60  GLU A O   
469  C CB  . GLU A 62  ? 0.1468 0.1343 0.1007 0.0111  -0.0242 0.0028  60  GLU A CB  
470  C CG  . GLU A 62  ? 0.1555 0.1517 0.1212 0.0149  -0.0230 0.0069  60  GLU A CG  
471  C CD  . GLU A 62  ? 0.2095 0.2124 0.1721 0.0221  -0.0277 0.0131  60  GLU A CD  
472  O OE1 . GLU A 62  ? 0.2269 0.2204 0.1793 0.0289  -0.0228 0.0175  60  GLU A OE1 
473  O OE2 . GLU A 62  ? 0.2260 0.2441 0.1966 0.0212  -0.0362 0.0140  60  GLU A OE2 
474  N N   . TRP A 63  ? 0.1646 0.1276 0.1142 0.0110  -0.0025 -0.0002 61  TRP A N   
475  C CA  . TRP A 63  ? 0.1700 0.1255 0.1216 0.0120  0.0076  0.0000  61  TRP A CA  
476  C C   . TRP A 63  ? 0.1493 0.1069 0.1102 0.0056  0.0113  -0.0055 61  TRP A C   
477  O O   . TRP A 63  ? 0.1500 0.1069 0.1167 0.0040  0.0173  -0.0070 61  TRP A O   
478  C CB  . TRP A 63  ? 0.1738 0.1152 0.1116 0.0161  0.0143  0.0024  61  TRP A CB  
479  C CG  . TRP A 63  ? 0.1996 0.1304 0.1381 0.0161  0.0266  0.0020  61  TRP A CG  
480  C CD1 . TRP A 63  ? 0.1895 0.1086 0.1220 0.0148  0.0354  0.0003  61  TRP A CD1 
481  C CD2 . TRP A 63  ? 0.2057 0.1348 0.1497 0.0177  0.0326  0.0036  61  TRP A CD2 
482  N NE1 . TRP A 63  ? 0.2126 0.1235 0.1477 0.0141  0.0463  -0.0001 61  TRP A NE1 
483  C CE2 . TRP A 63  ? 0.2083 0.1238 0.1490 0.0162  0.0450  0.0020  61  TRP A CE2 
484  C CE3 . TRP A 63  ? 0.1906 0.1275 0.1421 0.0200  0.0298  0.0060  61  TRP A CE3 
485  C CZ2 . TRP A 63  ? 0.1965 0.1048 0.1401 0.0163  0.0546  0.0020  61  TRP A CZ2 
486  C CZ3 . TRP A 63  ? 0.2052 0.1345 0.1588 0.0215  0.0396  0.0069  61  TRP A CZ3 
487  C CH2 . TRP A 63  ? 0.2130 0.1273 0.1621 0.0193  0.0519  0.0046  61  TRP A CH2 
488  N N   . GLU A 64  ? 0.1545 0.1143 0.1157 0.0022  0.0080  -0.0087 62  GLU A N   
489  C CA  . GLU A 64  ? 0.1511 0.1162 0.1218 -0.0026 0.0096  -0.0128 62  GLU A CA  
490  C C   . GLU A 64  ? 0.1480 0.1233 0.1282 -0.0045 0.0058  -0.0132 62  GLU A C   
491  O O   . GLU A 64  ? 0.1372 0.1157 0.1238 -0.0071 0.0092  -0.0156 62  GLU A O   
492  C CB  . GLU A 64  ? 0.1561 0.1208 0.1248 -0.0040 0.0074  -0.0148 62  GLU A CB  
493  C CG  . GLU A 64  ? 0.1493 0.1209 0.1279 -0.0072 0.0088  -0.0178 62  GLU A CG  
494  C CD  . GLU A 64  ? 0.1423 0.1111 0.1186 -0.0070 0.0092  -0.0188 62  GLU A CD  
495  O OE1 . GLU A 64  ? 0.1509 0.1216 0.1326 -0.0078 0.0142  -0.0206 62  GLU A OE1 
496  O OE2 . GLU A 64  ? 0.1466 0.1106 0.1153 -0.0061 0.0056  -0.0181 62  GLU A OE2 
497  N N   . ALA A 65  ? 0.0914 0.0719 0.0723 -0.0036 -0.0010 -0.0112 63  ALA A N   
498  C CA  . ALA A 65  ? 0.0814 0.0706 0.0709 -0.0052 -0.0037 -0.0111 63  ALA A CA  
499  C C   . ALA A 65  ? 0.0850 0.0744 0.0776 -0.0033 0.0006  -0.0095 63  ALA A C   
500  O O   . ALA A 65  ? 0.0794 0.0726 0.0777 -0.0055 0.0024  -0.0110 63  ALA A O   
501  C CB  . ALA A 65  ? 0.0890 0.0835 0.0794 -0.0054 -0.0110 -0.0096 63  ALA A CB  
502  N N   . ILE A 66  ? 0.0967 0.0811 0.0844 0.0014  0.0025  -0.0060 64  ILE A N   
503  C CA  . ILE A 66  ? 0.1074 0.0893 0.0971 0.0045  0.0084  -0.0037 64  ILE A CA  
504  C C   . ILE A 66  ? 0.0991 0.0734 0.0882 0.0012  0.0173  -0.0078 64  ILE A C   
505  O O   . ILE A 66  ? 0.1120 0.0863 0.1049 -0.0002 0.0217  -0.0092 64  ILE A O   
506  C CB  . ILE A 66  ? 0.1172 0.0949 0.1008 0.0119  0.0088  0.0021  64  ILE A CB  
507  C CG1 . ILE A 66  ? 0.1076 0.0972 0.0949 0.0143  -0.0007 0.0056  64  ILE A CG1 
508  C CG2 . ILE A 66  ? 0.1142 0.0838 0.0972 0.0162  0.0184  0.0048  64  ILE A CG2 
509  C CD1 . ILE A 66  ? 0.1128 0.1120 0.1120 0.0146  -0.0011 0.0070  64  ILE A CD1 
510  N N   . GLN A 67  ? 0.1375 0.1056 0.1220 -0.0008 0.0204  -0.0103 65  GLN A N   
511  C CA  . GLN A 67  ? 0.1417 0.1055 0.1279 -0.0058 0.0281  -0.0154 65  GLN A CA  
512  C C   . GLN A 67  ? 0.1341 0.1085 0.1277 -0.0114 0.0247  -0.0199 65  GLN A C   
513  O O   . GLN A 67  ? 0.1382 0.1121 0.1337 -0.0151 0.0294  -0.0235 65  GLN A O   
514  C CB  . GLN A 67  ? 0.1428 0.1002 0.1251 -0.0073 0.0322  -0.0172 65  GLN A CB  
515  C CG  . GLN A 67  ? 0.1560 0.0996 0.1286 -0.0019 0.0387  -0.0129 65  GLN A CG  
516  C CD  . GLN A 67  ? 0.1633 0.0989 0.1309 -0.0031 0.0441  -0.0143 65  GLN A CD  
517  O OE1 . GLN A 67  ? 0.1720 0.0997 0.1402 -0.0065 0.0540  -0.0173 65  GLN A OE1 
518  N NE2 . GLN A 67  ? 0.1635 0.1014 0.1273 -0.0014 0.0382  -0.0131 65  GLN A NE2 
519  N N   . ALA A 68  ? 0.1089 0.0918 0.1050 -0.0119 0.0170  -0.0196 66  ALA A N   
520  C CA  . ALA A 68  ? 0.1004 0.0932 0.1018 -0.0157 0.0133  -0.0224 66  ALA A CA  
521  C C   . ALA A 68  ? 0.1058 0.1008 0.1089 -0.0157 0.0137  -0.0219 66  ALA A C   
522  O O   . ALA A 68  ? 0.1049 0.1034 0.1092 -0.0196 0.0152  -0.0256 66  ALA A O   
523  C CB  . ALA A 68  ? 0.0993 0.0977 0.1019 -0.0147 0.0064  -0.0209 66  ALA A CB  
524  N N   . LEU A 69  ? 0.0788 0.0721 0.0817 -0.0114 0.0127  -0.0174 67  LEU A N   
525  C CA  . LEU A 69  ? 0.0919 0.0869 0.0974 -0.0107 0.0144  -0.0162 67  LEU A CA  
526  C C   . LEU A 69  ? 0.1034 0.0902 0.1063 -0.0116 0.0236  -0.0187 67  LEU A C   
527  O O   . LEU A 69  ? 0.1074 0.0945 0.1105 -0.0139 0.0267  -0.0209 67  LEU A O   
528  C CB  . LEU A 69  ? 0.0832 0.0810 0.0917 -0.0055 0.0111  -0.0106 67  LEU A CB  
529  C CG  . LEU A 69  ? 0.0795 0.0855 0.0915 -0.0065 0.0030  -0.0094 67  LEU A CG  
530  C CD1 . LEU A 69  ? 0.0703 0.0803 0.0855 -0.0025 -0.0007 -0.0047 67  LEU A CD1 
531  C CD2 . LEU A 69  ? 0.0665 0.0775 0.0820 -0.0094 0.0029  -0.0106 67  LEU A CD2 
532  N N   . THR A 70  ? 0.1279 0.1055 0.1270 -0.0103 0.0290  -0.0186 68  THR A N   
533  C CA  . THR A 70  ? 0.1408 0.1075 0.1365 -0.0122 0.0394  -0.0217 68  THR A CA  
534  C C   . THR A 70  ? 0.1473 0.1161 0.1428 -0.0210 0.0412  -0.0298 68  THR A C   
535  O O   . THR A 70  ? 0.1565 0.1213 0.1499 -0.0246 0.0470  -0.0339 68  THR A O   
536  C CB  . THR A 70  ? 0.1494 0.1041 0.1401 -0.0084 0.0456  -0.0190 68  THR A CB  
537  O OG1 . THR A 70  ? 0.1479 0.1028 0.1382 0.0003  0.0429  -0.0111 68  THR A OG1 
538  C CG2 . THR A 70  ? 0.1654 0.1060 0.1521 -0.0108 0.0584  -0.0224 68  THR A CG2 
539  N N   . VAL A 71  ? 0.1140 0.0918 0.1122 -0.0241 0.0349  -0.0320 69  VAL A N   
540  C CA  . VAL A 71  ? 0.1284 0.1135 0.1283 -0.0318 0.0341  -0.0390 69  VAL A CA  
541  C C   . VAL A 71  ? 0.1155 0.1076 0.1145 -0.0331 0.0304  -0.0400 69  VAL A C   
542  O O   . VAL A 71  ? 0.1305 0.1224 0.1265 -0.0388 0.0337  -0.0459 69  VAL A O   
543  C CB  . VAL A 71  ? 0.1108 0.1056 0.1152 -0.0333 0.0284  -0.0400 69  VAL A CB  
544  C CG1 . VAL A 71  ? 0.1104 0.1168 0.1180 -0.0405 0.0263  -0.0467 69  VAL A CG1 
545  C CG2 . VAL A 71  ? 0.1188 0.1050 0.1228 -0.0324 0.0340  -0.0395 69  VAL A CG2 
546  N N   . LEU A 72  ? 0.1247 0.1224 0.1255 -0.0283 0.0239  -0.0346 70  LEU A N   
547  C CA  . LEU A 72  ? 0.1116 0.1145 0.1110 -0.0287 0.0212  -0.0344 70  LEU A CA  
548  C C   . LEU A 72  ? 0.1281 0.1225 0.1235 -0.0294 0.0291  -0.0359 70  LEU A C   
549  O O   . LEU A 72  ? 0.1334 0.1289 0.1239 -0.0338 0.0306  -0.0404 70  LEU A O   
550  C CB  . LEU A 72  ? 0.0867 0.0938 0.0895 -0.0235 0.0154  -0.0279 70  LEU A CB  
551  C CG  . LEU A 72  ? 0.0950 0.1060 0.0967 -0.0232 0.0139  -0.0264 70  LEU A CG  
552  C CD1 . LEU A 72  ? 0.0894 0.1076 0.0871 -0.0267 0.0103  -0.0296 70  LEU A CD1 
553  C CD2 . LEU A 72  ? 0.0835 0.0972 0.0901 -0.0192 0.0094  -0.0206 70  LEU A CD2 
554  N N   . GLU A 73  ? 0.1369 0.1223 0.1333 -0.0246 0.0345  -0.0321 71  GLU A N   
555  C CA  . GLU A 73  ? 0.1462 0.1215 0.1395 -0.0233 0.0439  -0.0322 71  GLU A CA  
556  C C   . GLU A 73  ? 0.1635 0.1307 0.1501 -0.0307 0.0515  -0.0406 71  GLU A C   
557  O O   . GLU A 73  ? 0.1846 0.1471 0.1655 -0.0338 0.0568  -0.0444 71  GLU A O   
558  C CB  . GLU A 73  ? 0.1504 0.1185 0.1466 -0.0158 0.0481  -0.0259 71  GLU A CB  
559  C CG  . GLU A 73  ? 0.1727 0.1295 0.1670 -0.0121 0.0592  -0.0243 71  GLU A CG  
560  C CD  . GLU A 73  ? 0.1835 0.1347 0.1805 -0.0030 0.0628  -0.0167 71  GLU A CD  
561  O OE1 . GLU A 73  ? 0.2330 0.1749 0.2294 0.0019  0.0726  -0.0140 71  GLU A OE1 
562  O OE2 . GLU A 73  ? 0.1964 0.1514 0.1951 -0.0001 0.0569  -0.0133 71  GLU A OE2 
563  N N   . THR A 74  ? 0.1543 0.1191 0.1410 -0.0342 0.0527  -0.0439 72  THR A N   
564  C CA  . THR A 74  ? 0.1733 0.1296 0.1550 -0.0424 0.0610  -0.0525 72  THR A CA  
565  C C   . THR A 74  ? 0.1837 0.1511 0.1626 -0.0510 0.0558  -0.0602 72  THR A C   
566  O O   . THR A 74  ? 0.2022 0.1633 0.1741 -0.0578 0.0620  -0.0675 72  THR A O   
567  C CB  . THR A 74  ? 0.1741 0.1266 0.1584 -0.0441 0.0636  -0.0536 72  THR A CB  
568  O OG1 . THR A 74  ? 0.1679 0.1093 0.1520 -0.0353 0.0685  -0.0459 72  THR A OG1 
569  C CG2 . THR A 74  ? 0.1958 0.1402 0.1765 -0.0542 0.0727  -0.0634 72  THR A CG2 
570  N N   . CYS A 75  ? 0.1854 0.1690 0.1691 -0.0505 0.0444  -0.0585 73  CYS A N   
571  C CA  . CYS A 75  ? 0.1832 0.1798 0.1644 -0.0569 0.0381  -0.0642 73  CYS A CA  
572  C C   . CYS A 75  ? 0.1982 0.1935 0.1712 -0.0563 0.0383  -0.0641 73  CYS A C   
573  O O   . CYS A 75  ? 0.1941 0.1935 0.1598 -0.0630 0.0373  -0.0708 73  CYS A O   
574  C CB  . CYS A 75  ? 0.1891 0.2020 0.1774 -0.0541 0.0270  -0.0605 73  CYS A CB  
575  S SG  . CYS A 75  ? 0.1729 0.1913 0.1705 -0.0572 0.0266  -0.0630 73  CYS A SG  
576  N N   . MET A 76  ? 0.1905 0.1807 0.1646 -0.0484 0.0395  -0.0565 74  MET A N   
577  C CA  . MET A 76  ? 0.1941 0.1814 0.1608 -0.0476 0.0419  -0.0561 74  MET A CA  
578  C C   . MET A 76  ? 0.2381 0.2108 0.1955 -0.0527 0.0534  -0.0629 74  MET A C   
579  O O   . MET A 76  ? 0.2560 0.2264 0.2034 -0.0557 0.0557  -0.0665 74  MET A O   
580  C CB  . MET A 76  ? 0.1872 0.1735 0.1593 -0.0389 0.0416  -0.0468 74  MET A CB  
581  C CG  . MET A 76  ? 0.1472 0.1461 0.1246 -0.0353 0.0311  -0.0412 74  MET A CG  
582  S SD  . MET A 76  ? 0.1688 0.1760 0.1368 -0.0378 0.0260  -0.0428 74  MET A SD  
583  C CE  . MET A 76  ? 0.1937 0.1929 0.1593 -0.0337 0.0331  -0.0383 74  MET A CE  
584  N N   . LYS A 77  ? 0.2509 0.2114 0.2104 -0.0528 0.0620  -0.0640 75  LYS A N   
585  C CA  . LYS A 77  ? 0.2879 0.2317 0.2384 -0.0585 0.0748  -0.0715 75  LYS A CA  
586  C C   . LYS A 77  ? 0.3072 0.2529 0.2510 -0.0712 0.0749  -0.0835 75  LYS A C   
587  O O   . LYS A 77  ? 0.3611 0.2984 0.2936 -0.0778 0.0813  -0.0911 75  LYS A O   
588  C CB  . LYS A 77  ? 0.2860 0.2139 0.2399 -0.0530 0.0856  -0.0673 75  LYS A CB  
589  C CG  . LYS A 77  ? 0.3012 0.2249 0.2583 -0.0427 0.0890  -0.0584 75  LYS A CG  
590  C CD  . LYS A 77  ? 0.4731 0.3858 0.4353 -0.0345 0.0966  -0.0516 75  LYS A CD  
591  C CE  . LYS A 77  ? 0.4899 0.4053 0.4565 -0.0353 0.0926  -0.0511 75  LYS A CE  
592  N NZ  . LYS A 77  ? 0.4782 0.3840 0.4481 -0.0258 0.0987  -0.0431 75  LYS A NZ  
593  N N   . SER A 78  ? 0.2682 0.2257 0.2194 -0.0749 0.0679  -0.0856 76  SER A N   
594  C CA  A SER A 78  ? 0.3056 0.2663 0.2543 -0.0876 0.0688  -0.0972 76  SER A CA  
595  C CA  B SER A 78  ? 0.3043 0.2654 0.2534 -0.0875 0.0685  -0.0970 76  SER A CA  
596  C C   . SER A 78  ? 0.2818 0.2636 0.2278 -0.0930 0.0562  -0.1017 76  SER A C   
597  O O   . SER A 78  ? 0.3874 0.3737 0.3282 -0.1045 0.0561  -0.1126 76  SER A O   
598  C CB  A SER A 78  ? 0.2866 0.2488 0.2461 -0.0891 0.0697  -0.0973 76  SER A CB  
599  C CB  B SER A 78  ? 0.2803 0.2445 0.2409 -0.0884 0.0684  -0.0965 76  SER A CB  
600  O OG  A SER A 78  ? 0.2620 0.2427 0.2314 -0.0836 0.0573  -0.0908 76  SER A OG  
601  O OG  B SER A 78  ? 0.2879 0.2310 0.2482 -0.0852 0.0814  -0.0941 76  SER A OG  
602  N N   . CYS A 79  ? 0.3090 0.3046 0.2590 -0.0849 0.0454  -0.0932 77  CYS A N   
603  C CA  . CYS A 79  ? 0.2828 0.2994 0.2311 -0.0877 0.0330  -0.0953 77  CYS A CA  
604  C C   . CYS A 79  ? 0.3145 0.3280 0.2475 -0.0877 0.0330  -0.0963 77  CYS A C   
605  O O   . CYS A 79  ? 0.3622 0.3584 0.2888 -0.0844 0.0424  -0.0942 77  CYS A O   
606  C CB  . CYS A 79  ? 0.2393 0.2704 0.1988 -0.0788 0.0227  -0.0856 77  CYS A CB  
607  S SG  . CYS A 79  ? 0.3026 0.3370 0.2784 -0.0785 0.0231  -0.0844 77  CYS A SG  
608  N N   . GLY A 80  ? 0.3481 0.3786 0.2751 -0.0907 0.0228  -0.0989 78  GLY A N   
609  C CA  . GLY A 80  ? 0.3958 0.4236 0.3062 -0.0898 0.0223  -0.0990 78  GLY A CA  
610  C C   . GLY A 80  ? 0.4027 0.4434 0.3133 -0.0805 0.0122  -0.0890 78  GLY A C   
611  O O   . GLY A 80  ? 0.3229 0.3650 0.2455 -0.0718 0.0102  -0.0795 78  GLY A O   
612  N N   . LYS A 81  ? 0.4138 0.4636 0.3101 -0.0825 0.0061  -0.0913 79  LYS A N   
613  C CA  . LYS A 81  ? 0.3719 0.4235 0.2614 -0.0731 0.0022  -0.0816 79  LYS A CA  
614  C C   . LYS A 81  ? 0.3229 0.3894 0.2252 -0.0646 -0.0073 -0.0720 79  LYS A C   
615  O O   . LYS A 81  ? 0.3062 0.3672 0.2101 -0.0558 -0.0061 -0.0623 79  LYS A O   
616  C CB  . LYS A 81  ? 0.4052 0.4607 0.2729 -0.0766 -0.0012 -0.0859 79  LYS A CB  
617  C CG  . LYS A 81  ? 0.3887 0.4423 0.2475 -0.0665 -0.0026 -0.0752 79  LYS A CG  
618  C CD  . LYS A 81  ? 0.5047 0.5554 0.3380 -0.0695 -0.0023 -0.0794 79  LYS A CD  
619  C CE  . LYS A 81  ? 0.5242 0.5738 0.3484 -0.0591 -0.0038 -0.0679 79  LYS A CE  
620  N NZ  . LYS A 81  ? 0.4988 0.5665 0.3332 -0.0514 -0.0152 -0.0592 79  LYS A NZ  
621  N N   . ARG A 82  ? 0.3201 0.4060 0.2299 -0.0673 -0.0165 -0.0747 80  ARG A N   
622  C CA  . ARG A 82  ? 0.2875 0.3873 0.2088 -0.0587 -0.0248 -0.0656 80  ARG A CA  
623  C C   . ARG A 82  ? 0.2624 0.3512 0.1981 -0.0528 -0.0196 -0.0589 80  ARG A C   
624  O O   . ARG A 82  ? 0.2430 0.3310 0.1815 -0.0440 -0.0213 -0.0494 80  ARG A O   
625  C CB  . ARG A 82  ? 0.2841 0.4072 0.2147 -0.0628 -0.0340 -0.0702 80  ARG A CB  
626  C CG  . ARG A 82  ? 0.4171 0.5583 0.3347 -0.0653 -0.0435 -0.0734 80  ARG A CG  
627  C CD  . ARG A 82  ? 0.5331 0.7018 0.4641 -0.0637 -0.0546 -0.0723 80  ARG A CD  
628  N NE  . ARG A 82  ? 0.5968 0.7732 0.5430 -0.0737 -0.0534 -0.0817 80  ARG A NE  
629  C CZ  . ARG A 82  ? 0.5124 0.6991 0.4787 -0.0708 -0.0550 -0.0787 80  ARG A CZ  
630  N NH1 . ARG A 82  ? 0.4519 0.6435 0.4250 -0.0583 -0.0586 -0.0669 80  ARG A NH1 
631  N NH2 . ARG A 82  ? 0.5213 0.7134 0.5004 -0.0807 -0.0524 -0.0877 80  ARG A NH2 
632  N N   . PHE A 83  ? 0.2315 0.3114 0.1754 -0.0578 -0.0130 -0.0640 81  PHE A N   
633  C CA  . PHE A 83  ? 0.1998 0.2687 0.1549 -0.0527 -0.0080 -0.0582 81  PHE A CA  
634  C C   . PHE A 83  ? 0.2009 0.2549 0.1509 -0.0473 -0.0021 -0.0522 81  PHE A C   
635  O O   . PHE A 83  ? 0.1565 0.2087 0.1126 -0.0404 -0.0032 -0.0442 81  PHE A O   
636  C CB  . PHE A 83  ? 0.2366 0.2981 0.1990 -0.0586 -0.0015 -0.0644 81  PHE A CB  
637  C CG  . PHE A 83  ? 0.1883 0.2408 0.1611 -0.0529 0.0020  -0.0583 81  PHE A CG  
638  C CD1 . PHE A 83  ? 0.1797 0.2407 0.1630 -0.0489 -0.0031 -0.0541 81  PHE A CD1 
639  C CD2 . PHE A 83  ? 0.1645 0.2004 0.1361 -0.0513 0.0106  -0.0569 81  PHE A CD2 
640  C CE1 . PHE A 83  ? 0.1408 0.1933 0.1308 -0.0435 -0.0007 -0.0483 81  PHE A CE1 
641  C CE2 . PHE A 83  ? 0.1645 0.1942 0.1445 -0.0456 0.0123  -0.0509 81  PHE A CE2 
642  C CZ  . PHE A 83  ? 0.1326 0.1703 0.1208 -0.0421 0.0064  -0.0469 81  PHE A CZ  
643  N N   . HIS A 84  ? 0.2350 0.2789 0.1736 -0.0509 0.0043  -0.0563 82  HIS A N   
644  C CA  . HIS A 84  ? 0.2060 0.2377 0.1407 -0.0461 0.0106  -0.0509 82  HIS A CA  
645  C C   . HIS A 84  ? 0.2133 0.2500 0.1445 -0.0396 0.0058  -0.0429 82  HIS A C   
646  O O   . HIS A 84  ? 0.1820 0.2133 0.1197 -0.0341 0.0082  -0.0358 82  HIS A O   
647  C CB  . HIS A 84  ? 0.2215 0.2418 0.1428 -0.0509 0.0191  -0.0570 82  HIS A CB  
648  C CG  . HIS A 84  ? 0.2740 0.2820 0.1995 -0.0544 0.0284  -0.0619 82  HIS A CG  
649  N ND1 . HIS A 84  ? 0.4953 0.4877 0.4142 -0.0546 0.0396  -0.0633 82  HIS A ND1 
650  C CD2 . HIS A 84  ? 0.4012 0.4092 0.3345 -0.0583 0.0292  -0.0662 82  HIS A CD2 
651  C CE1 . HIS A 84  ? 0.4829 0.4657 0.4059 -0.0574 0.0470  -0.0674 82  HIS A CE1 
652  N NE2 . HIS A 84  ? 0.4046 0.3962 0.3358 -0.0601 0.0409  -0.0694 82  HIS A NE2 
653  N N   . ASP A 85  ? 0.2348 0.2835 0.1578 -0.0400 -0.0018 -0.0436 83  ASP A N   
654  C CA  . ASP A 85  ? 0.2504 0.3027 0.1674 -0.0332 -0.0057 -0.0356 83  ASP A CA  
655  C C   . ASP A 85  ? 0.2406 0.2965 0.1711 -0.0269 -0.0093 -0.0281 83  ASP A C   
656  O O   . ASP A 85  ? 0.2347 0.2843 0.1653 -0.0214 -0.0070 -0.0207 83  ASP A O   
657  C CB  . ASP A 85  ? 0.2717 0.3371 0.1752 -0.0343 -0.0134 -0.0378 83  ASP A CB  
658  C CG  . ASP A 85  ? 0.3667 0.4255 0.2509 -0.0390 -0.0092 -0.0434 83  ASP A CG  
659  O OD1 . ASP A 85  ? 0.3308 0.4010 0.2028 -0.0418 -0.0160 -0.0474 83  ASP A OD1 
660  O OD2 . ASP A 85  ? 0.3041 0.3469 0.1841 -0.0390 0.0005  -0.0428 83  ASP A OD2 
661  N N   . GLU A 86  ? 0.2141 0.2775 0.1563 -0.0285 -0.0130 -0.0306 84  GLU A N   
662  C CA  . GLU A 86  ? 0.1876 0.2533 0.1416 -0.0232 -0.0157 -0.0246 84  GLU A CA  
663  C C   . GLU A 86  ? 0.1622 0.2149 0.1239 -0.0221 -0.0097 -0.0220 84  GLU A C   
664  O O   . GLU A 86  ? 0.1500 0.1987 0.1150 -0.0174 -0.0094 -0.0157 84  GLU A O   
665  C CB  . GLU A 86  ? 0.1912 0.2686 0.1550 -0.0253 -0.0205 -0.0284 84  GLU A CB  
666  C CG  . GLU A 86  ? 0.2598 0.3551 0.2208 -0.0241 -0.0285 -0.0285 84  GLU A CG  
667  C CD  . GLU A 86  ? 0.2514 0.3490 0.2067 -0.0151 -0.0316 -0.0191 84  GLU A CD  
668  O OE1 . GLU A 86  ? 0.2064 0.2963 0.1673 -0.0095 -0.0293 -0.0126 84  GLU A OE1 
669  O OE2 . GLU A 86  ? 0.2796 0.3889 0.2258 -0.0134 -0.0371 -0.0184 84  GLU A OE2 
670  N N   . VAL A 87  ? 0.1400 0.1856 0.1034 -0.0264 -0.0043 -0.0268 85  VAL A N   
671  C CA  . VAL A 87  ? 0.1337 0.1699 0.1052 -0.0248 0.0004  -0.0240 85  VAL A CA  
672  C C   . VAL A 87  ? 0.1346 0.1645 0.1026 -0.0221 0.0045  -0.0191 85  VAL A C   
673  O O   . VAL A 87  ? 0.1256 0.1525 0.1012 -0.0195 0.0054  -0.0145 85  VAL A O   
674  C CB  . VAL A 87  ? 0.1355 0.1656 0.1092 -0.0286 0.0060  -0.0293 85  VAL A CB  
675  C CG1 . VAL A 87  ? 0.1304 0.1528 0.1112 -0.0259 0.0108  -0.0255 85  VAL A CG1 
676  C CG2 . VAL A 87  ? 0.1321 0.1666 0.1115 -0.0311 0.0034  -0.0331 85  VAL A CG2 
677  N N   . GLY A 88  ? 0.1329 0.1620 0.0889 -0.0230 0.0064  -0.0203 86  GLY A N   
678  C CA  . GLY A 88  ? 0.1583 0.1805 0.1098 -0.0209 0.0119  -0.0159 86  GLY A CA  
679  C C   . GLY A 88  ? 0.1665 0.1899 0.1138 -0.0165 0.0094  -0.0094 86  GLY A C   
680  O O   . GLY A 88  ? 0.1482 0.1656 0.0887 -0.0150 0.0145  -0.0060 86  GLY A O   
681  N N   . LYS A 89  ? 0.1506 0.1803 0.1019 -0.0141 0.0029  -0.0073 87  LYS A N   
682  C CA  . LYS A 89  ? 0.1667 0.1949 0.1160 -0.0090 0.0019  -0.0001 87  LYS A CA  
683  C C   . LYS A 89  ? 0.1384 0.1615 0.1004 -0.0084 0.0035  0.0028  87  LYS A C   
684  O O   . LYS A 89  ? 0.1268 0.1519 0.0988 -0.0105 0.0014  -0.0003 87  LYS A O   
685  C CB  . LYS A 89  ? 0.1695 0.2077 0.1147 -0.0056 -0.0055 0.0011  87  LYS A CB  
686  C CG  . LYS A 89  ? 0.2023 0.2476 0.1326 -0.0052 -0.0085 -0.0002 87  LYS A CG  
687  C CD  . LYS A 89  ? 0.1704 0.2300 0.1010 -0.0017 -0.0170 0.0008  87  LYS A CD  
688  C CE  . LYS A 89  ? 0.2389 0.3102 0.1570 -0.0037 -0.0222 -0.0032 87  LYS A CE  
689  N NZ  . LYS A 89  ? 0.2425 0.3320 0.1652 -0.0009 -0.0312 -0.0029 87  LYS A NZ  
690  N N   . PHE A 90  ? 0.1232 0.1395 0.0837 -0.0058 0.0070  0.0086  88  PHE A N   
691  C CA  . PHE A 90  ? 0.1122 0.1236 0.0836 -0.0064 0.0083  0.0104  88  PHE A CA  
692  C C   . PHE A 90  ? 0.1114 0.1260 0.0860 -0.0043 0.0029  0.0103  88  PHE A C   
693  O O   . PHE A 90  ? 0.1037 0.1161 0.0872 -0.0063 0.0022  0.0090  88  PHE A O   
694  C CB  . PHE A 90  ? 0.1323 0.1340 0.1006 -0.0050 0.0147  0.0161  88  PHE A CB  
695  C CG  . PHE A 90  ? 0.1381 0.1361 0.1065 -0.0076 0.0216  0.0162  88  PHE A CG  
696  C CD1 . PHE A 90  ? 0.1217 0.1226 0.1021 -0.0119 0.0230  0.0126  88  PHE A CD1 
697  C CD2 . PHE A 90  ? 0.1420 0.1339 0.0982 -0.0049 0.0271  0.0205  88  PHE A CD2 
698  C CE1 . PHE A 90  ? 0.1273 0.1259 0.1097 -0.0136 0.0302  0.0131  88  PHE A CE1 
699  C CE2 . PHE A 90  ? 0.1488 0.1366 0.1056 -0.0073 0.0350  0.0208  88  PHE A CE2 
700  C CZ  . PHE A 90  ? 0.1438 0.1355 0.1143 -0.0115 0.0365  0.0168  88  PHE A CZ  
701  N N   . ARG A 91  ? 0.1345 0.1557 0.1023 -0.0005 -0.0013 0.0113  89  ARG A N   
702  C CA  . ARG A 91  ? 0.1294 0.1552 0.1022 0.0019  -0.0057 0.0110  89  ARG A CA  
703  C C   . ARG A 91  ? 0.1160 0.1439 0.0984 -0.0028 -0.0074 0.0052  89  ARG A C   
704  O O   . ARG A 91  ? 0.1106 0.1362 0.0986 -0.0024 -0.0082 0.0050  89  ARG A O   
705  C CB  . ARG A 91  ? 0.1311 0.1688 0.0983 0.0058  -0.0109 0.0117  89  ARG A CB  
706  C CG  . ARG A 91  ? 0.1740 0.2167 0.1472 0.0098  -0.0140 0.0132  89  ARG A CG  
707  C CD  . ARG A 91  ? 0.1797 0.2371 0.1488 0.0150  -0.0194 0.0155  89  ARG A CD  
708  N NE  . ARG A 91  ? 0.2807 0.3368 0.2374 0.0204  -0.0187 0.0218  89  ARG A NE  
709  C CZ  . ARG A 91  ? 0.2572 0.3074 0.2097 0.0286  -0.0162 0.0302  89  ARG A CZ  
710  N NH1 . ARG A 91  ? 0.3108 0.3526 0.2704 0.0311  -0.0127 0.0325  89  ARG A NH1 
711  N NH2 . ARG A 91  ? 0.3099 0.3587 0.2493 0.0339  -0.0152 0.0363  89  ARG A NH2 
712  N N   . PHE A 92  ? 0.0892 0.1206 0.0718 -0.0068 -0.0073 0.0005  90  PHE A N   
713  C CA  . PHE A 92  ? 0.0922 0.1234 0.0824 -0.0104 -0.0076 -0.0040 90  PHE A CA  
714  C C   . PHE A 92  ? 0.0772 0.1018 0.0729 -0.0125 -0.0042 -0.0033 90  PHE A C   
715  O O   . PHE A 92  ? 0.0801 0.1027 0.0820 -0.0134 -0.0053 -0.0042 90  PHE A O   
716  C CB  . PHE A 92  ? 0.0861 0.1226 0.0743 -0.0136 -0.0078 -0.0093 90  PHE A CB  
717  C CG  . PHE A 92  ? 0.0738 0.1085 0.0684 -0.0163 -0.0067 -0.0131 90  PHE A CG  
718  C CD1 . PHE A 92  ? 0.0677 0.1042 0.0669 -0.0159 -0.0091 -0.0142 90  PHE A CD1 
719  C CD2 . PHE A 92  ? 0.0914 0.1216 0.0869 -0.0183 -0.0025 -0.0148 90  PHE A CD2 
720  C CE1 . PHE A 92  ? 0.0739 0.1069 0.0771 -0.0176 -0.0074 -0.0168 90  PHE A CE1 
721  C CE2 . PHE A 92  ? 0.0852 0.1129 0.0854 -0.0195 -0.0009 -0.0172 90  PHE A CE2 
722  C CZ  . PHE A 92  ? 0.0747 0.1035 0.0779 -0.0193 -0.0035 -0.0182 90  PHE A CZ  
723  N N   . LEU A 93  ? 0.0818 0.1041 0.0754 -0.0132 -0.0002 -0.0021 91  LEU A N   
724  C CA  A LEU A 93  ? 0.0772 0.0968 0.0786 -0.0152 0.0030  -0.0016 91  LEU A CA  
725  C CA  B LEU A 93  ? 0.0807 0.1004 0.0822 -0.0153 0.0029  -0.0017 91  LEU A CA  
726  C C   . LEU A 93  ? 0.0798 0.0963 0.0872 -0.0159 0.0020  0.0004  91  LEU A C   
727  O O   . LEU A 93  ? 0.0762 0.0939 0.0918 -0.0180 0.0012  -0.0006 91  LEU A O   
728  C CB  A LEU A 93  ? 0.0901 0.1073 0.0882 -0.0154 0.0087  0.0002  91  LEU A CB  
729  C CB  B LEU A 93  ? 0.0836 0.1013 0.0825 -0.0156 0.0086  -0.0003 91  LEU A CB  
730  C CG  A LEU A 93  ? 0.0879 0.1057 0.0847 -0.0164 0.0126  -0.0025 91  LEU A CG  
731  C CG  B LEU A 93  ? 0.0891 0.1077 0.0813 -0.0161 0.0110  -0.0035 91  LEU A CG  
732  C CD1 A LEU A 93  ? 0.0880 0.1081 0.0846 -0.0173 0.0105  -0.0071 91  LEU A CD1 
733  C CD1 B LEU A 93  ? 0.0830 0.1024 0.0827 -0.0173 0.0127  -0.0064 91  LEU A CD1 
734  C CD2 A LEU A 93  ? 0.0979 0.1125 0.0836 -0.0159 0.0174  -0.0016 91  LEU A CD2 
735  C CD2 B LEU A 93  ? 0.0927 0.1149 0.0757 -0.0157 0.0066  -0.0058 91  LEU A CD2 
736  N N   . ASN A 94  ? 0.0846 0.0968 0.0871 -0.0142 0.0022  0.0032  92  ASN A N   
737  C CA  . ASN A 94  ? 0.0831 0.0896 0.0896 -0.0157 0.0026  0.0043  92  ASN A CA  
738  C C   . ASN A 94  ? 0.0770 0.0846 0.0873 -0.0169 -0.0017 0.0011  92  ASN A C   
739  O O   . ASN A 94  ? 0.0901 0.0950 0.1051 -0.0202 -0.0023 0.0000  92  ASN A O   
740  C CB  . ASN A 94  ? 0.0940 0.0938 0.0929 -0.0122 0.0047  0.0083  92  ASN A CB  
741  C CG  . ASN A 94  ? 0.1128 0.1078 0.1071 -0.0114 0.0106  0.0123  92  ASN A CG  
742  O OD1 . ASN A 94  ? 0.1025 0.0989 0.1011 -0.0145 0.0137  0.0117  92  ASN A OD1 
743  N ND2 . ASN A 94  ? 0.1249 0.1140 0.1103 -0.0066 0.0129  0.0171  92  ASN A ND2 
744  N N   . GLU A 95  ? 0.1120 0.1235 0.1197 -0.0147 -0.0047 -0.0006 93  GLU A N   
745  C CA  . GLU A 95  ? 0.1076 0.1186 0.1170 -0.0152 -0.0077 -0.0032 93  GLU A CA  
746  C C   . GLU A 95  ? 0.1079 0.1219 0.1230 -0.0177 -0.0090 -0.0052 93  GLU A C   
747  O O   . GLU A 95  ? 0.1036 0.1159 0.1203 -0.0193 -0.0112 -0.0065 93  GLU A O   
748  C CB  . GLU A 95  ? 0.1040 0.1187 0.1105 -0.0124 -0.0093 -0.0043 93  GLU A CB  
749  C CG  . GLU A 95  ? 0.1131 0.1271 0.1154 -0.0084 -0.0088 -0.0012 93  GLU A CG  
750  C CD  . GLU A 95  ? 0.1175 0.1217 0.1185 -0.0076 -0.0068 0.0009  93  GLU A CD  
751  O OE1 . GLU A 95  ? 0.1342 0.1337 0.1320 -0.0057 -0.0038 0.0048  93  GLU A OE1 
752  O OE2 . GLU A 95  ? 0.1188 0.1186 0.1204 -0.0086 -0.0073 -0.0012 93  GLU A OE2 
753  N N   . LEU A 96  ? 0.0721 0.0904 0.0895 -0.0177 -0.0072 -0.0052 94  LEU A N   
754  C CA  . LEU A 96  ? 0.0714 0.0933 0.0953 -0.0186 -0.0075 -0.0056 94  LEU A CA  
755  C C   . LEU A 96  ? 0.0787 0.1023 0.1098 -0.0214 -0.0078 -0.0044 94  LEU A C   
756  O O   . LEU A 96  ? 0.0788 0.1060 0.1148 -0.0225 -0.0110 -0.0050 94  LEU A O   
757  C CB  . LEU A 96  ? 0.0890 0.1132 0.1133 -0.0174 -0.0036 -0.0056 94  LEU A CB  
758  C CG  . LEU A 96  ? 0.0714 0.0945 0.0895 -0.0164 -0.0026 -0.0082 94  LEU A CG  
759  C CD1 . LEU A 96  ? 0.0929 0.1158 0.1106 -0.0162 0.0025  -0.0089 94  LEU A CD1 
760  C CD2 . LEU A 96  ? 0.0811 0.1029 0.0990 -0.0157 -0.0049 -0.0097 94  LEU A CD2 
761  N N   . ILE A 97  ? 0.0679 0.0896 0.0995 -0.0227 -0.0043 -0.0026 95  ILE A N   
762  C CA  . ILE A 97  ? 0.0741 0.0970 0.1135 -0.0268 -0.0034 -0.0021 95  ILE A CA  
763  C C   . ILE A 97  ? 0.0729 0.0929 0.1118 -0.0300 -0.0076 -0.0044 95  ILE A C   
764  O O   . ILE A 97  ? 0.0762 0.1016 0.1231 -0.0341 -0.0101 -0.0058 95  ILE A O   
765  C CB  . ILE A 97  ? 0.0765 0.0937 0.1131 -0.0274 0.0026  0.0004  95  ILE A CB  
766  C CG1 . ILE A 97  ? 0.0823 0.1024 0.1188 -0.0250 0.0071  0.0022  95  ILE A CG1 
767  C CG2 . ILE A 97  ? 0.0999 0.1160 0.1444 -0.0330 0.0048  0.0003  95  ILE A CG2 
768  C CD1 . ILE A 97  ? 0.0858 0.0988 0.1142 -0.0239 0.0130  0.0051  95  ILE A CD1 
769  N N   . LYS A 98  ? 0.0969 0.1086 0.1266 -0.0285 -0.0080 -0.0049 96  LYS A N   
770  C CA  . LYS A 98  ? 0.1048 0.1106 0.1314 -0.0315 -0.0104 -0.0076 96  LYS A CA  
771  C C   . LYS A 98  ? 0.1057 0.1169 0.1333 -0.0320 -0.0162 -0.0101 96  LYS A C   
772  O O   . LYS A 98  ? 0.1095 0.1200 0.1373 -0.0365 -0.0193 -0.0129 96  LYS A O   
773  C CB  . LYS A 98  ? 0.1078 0.1039 0.1247 -0.0279 -0.0084 -0.0068 96  LYS A CB  
774  C CG  . LYS A 98  ? 0.1170 0.1050 0.1308 -0.0271 -0.0026 -0.0037 96  LYS A CG  
775  C CD  . LYS A 98  ? 0.1174 0.1011 0.1235 -0.0207 -0.0014 -0.0013 96  LYS A CD  
776  C CE  . LYS A 98  ? 0.1501 0.1265 0.1518 -0.0178 0.0043  0.0034  96  LYS A CE  
777  N NZ  . LYS A 98  ? 0.1515 0.1264 0.1471 -0.0105 0.0047  0.0065  96  LYS A NZ  
778  N N   . VAL A 99  ? 0.1008 0.1170 0.1282 -0.0277 -0.0174 -0.0091 97  VAL A N   
779  C CA  . VAL A 99  ? 0.1020 0.1229 0.1297 -0.0268 -0.0219 -0.0101 97  VAL A CA  
780  C C   . VAL A 99  ? 0.1055 0.1374 0.1432 -0.0290 -0.0252 -0.0096 97  VAL A C   
781  O O   . VAL A 99  ? 0.1099 0.1453 0.1467 -0.0303 -0.0306 -0.0110 97  VAL A O   
782  C CB  . VAL A 99  ? 0.0942 0.1152 0.1186 -0.0216 -0.0204 -0.0090 97  VAL A CB  
783  C CG1 . VAL A 99  ? 0.0997 0.1241 0.1236 -0.0195 -0.0237 -0.0087 97  VAL A CG1 
784  C CG2 . VAL A 99  ? 0.0948 0.1079 0.1110 -0.0202 -0.0187 -0.0102 97  VAL A CG2 
785  N N   . VAL A 100 ? 0.0761 0.1144 0.1234 -0.0294 -0.0221 -0.0075 98  VAL A N   
786  C CA  . VAL A 100 ? 0.0760 0.1276 0.1360 -0.0307 -0.0246 -0.0064 98  VAL A CA  
787  C C   . VAL A 100 ? 0.0820 0.1382 0.1506 -0.0383 -0.0256 -0.0085 98  VAL A C   
788  O O   . VAL A 100 ? 0.0840 0.1536 0.1635 -0.0407 -0.0299 -0.0086 98  VAL A O   
789  C CB  . VAL A 100 ? 0.0697 0.1272 0.1373 -0.0261 -0.0197 -0.0028 98  VAL A CB  
790  C CG1 . VAL A 100 ? 0.0653 0.1179 0.1249 -0.0198 -0.0182 -0.0016 98  VAL A CG1 
791  C CG2 . VAL A 100 ? 0.0689 0.1212 0.1371 -0.0279 -0.0129 -0.0022 98  VAL A CG2 
792  N N   . SER A 101 ? 0.0880 0.1330 0.1514 -0.0421 -0.0215 -0.0100 99  SER A N   
793  C CA  . SER A 101 ? 0.0928 0.1381 0.1631 -0.0502 -0.0199 -0.0124 99  SER A CA  
794  C C   . SER A 101 ? 0.1041 0.1475 0.1702 -0.0565 -0.0257 -0.0175 99  SER A C   
795  O O   . SER A 101 ? 0.1112 0.1422 0.1638 -0.0553 -0.0260 -0.0193 99  SER A O   
796  C CB  . SER A 101 ? 0.0963 0.1275 0.1606 -0.0507 -0.0118 -0.0112 99  SER A CB  
797  O OG  . SER A 101 ? 0.1078 0.1342 0.1755 -0.0591 -0.0089 -0.0140 99  SER A OG  
798  N N   . PRO A 102 ? 0.1264 0.1812 0.2042 -0.0642 -0.0290 -0.0205 100 PRO A N   
799  C CA  . PRO A 102 ? 0.1464 0.1989 0.2199 -0.0727 -0.0338 -0.0269 100 PRO A CA  
800  C C   . PRO A 102 ? 0.1680 0.1996 0.2311 -0.0779 -0.0268 -0.0301 100 PRO A C   
801  O O   . PRO A 102 ? 0.1917 0.2148 0.2449 -0.0832 -0.0292 -0.0356 100 PRO A O   
802  C CB  . PRO A 102 ? 0.1867 0.2588 0.2790 -0.0805 -0.0374 -0.0291 100 PRO A CB  
803  C CG  . PRO A 102 ? 0.2556 0.3431 0.3607 -0.0726 -0.0372 -0.0227 100 PRO A CG  
804  C CD  . PRO A 102 ? 0.1398 0.2124 0.2364 -0.0651 -0.0287 -0.0182 100 PRO A CD  
805  N N   . LYS A 103 ? 0.1517 0.1739 0.2156 -0.0760 -0.0175 -0.0266 101 LYS A N   
806  C CA  . LYS A 103 ? 0.1850 0.1857 0.2380 -0.0781 -0.0095 -0.0277 101 LYS A CA  
807  C C   . LYS A 103 ? 0.1762 0.1635 0.2126 -0.0713 -0.0097 -0.0270 101 LYS A C   
808  O O   . LYS A 103 ? 0.1976 0.1669 0.2239 -0.0728 -0.0039 -0.0284 101 LYS A O   
809  C CB  . LYS A 103 ? 0.1772 0.1714 0.2330 -0.0754 0.0003  -0.0225 101 LYS A CB  
810  C CG  . LYS A 103 ? 0.2127 0.2152 0.2842 -0.0835 0.0041  -0.0235 101 LYS A CG  
811  C CD  . LYS A 103 ? 0.2495 0.2464 0.3224 -0.0791 0.0139  -0.0173 101 LYS A CD  
812  C CE  . LYS A 103 ? 0.3245 0.2990 0.3879 -0.0814 0.0247  -0.0165 101 LYS A CE  
813  N NZ  . LYS A 103 ? 0.3067 0.2751 0.3699 -0.0775 0.0347  -0.0101 101 LYS A NZ  
814  N N   . TYR A 104 ? 0.1393 0.1343 0.1736 -0.0634 -0.0147 -0.0242 102 TYR A N   
815  C CA  . TYR A 104 ? 0.1533 0.1381 0.1751 -0.0558 -0.0135 -0.0223 102 TYR A CA  
816  C C   . TYR A 104 ? 0.1538 0.1429 0.1700 -0.0544 -0.0208 -0.0248 102 TYR A C   
817  O O   . TYR A 104 ? 0.1530 0.1377 0.1635 -0.0602 -0.0235 -0.0299 102 TYR A O   
818  C CB  . TYR A 104 ? 0.1358 0.1233 0.1590 -0.0477 -0.0103 -0.0163 102 TYR A CB  
819  C CG  . TYR A 104 ? 0.1395 0.1188 0.1632 -0.0480 -0.0023 -0.0133 102 TYR A CG  
820  C CD1 . TYR A 104 ? 0.1405 0.1271 0.1740 -0.0500 0.0003  -0.0113 102 TYR A CD1 
821  C CD2 . TYR A 104 ? 0.1551 0.1179 0.1696 -0.0471 0.0037  -0.0128 102 TYR A CD2 
822  C CE1 . TYR A 104 ? 0.1360 0.1134 0.1681 -0.0499 0.0086  -0.0080 102 TYR A CE1 
823  C CE2 . TYR A 104 ? 0.1520 0.1056 0.1655 -0.0467 0.0118  -0.0091 102 TYR A CE2 
824  C CZ  . TYR A 104 ? 0.1525 0.1132 0.1740 -0.0481 0.0141  -0.0068 102 TYR A CZ  
825  O OH  . TYR A 104 ? 0.1638 0.1135 0.1825 -0.0473 0.0231  -0.0027 102 TYR A OH  
826  N N   . LEU A 105 ? 0.1482 0.1467 0.1664 -0.0478 -0.0238 -0.0216 103 LEU A N   
827  C CA  . LEU A 105 ? 0.1510 0.1515 0.1623 -0.0451 -0.0292 -0.0228 103 LEU A CA  
828  C C   . LEU A 105 ? 0.1394 0.1559 0.1583 -0.0458 -0.0362 -0.0226 103 LEU A C   
829  O O   . LEU A 105 ? 0.1474 0.1659 0.1598 -0.0432 -0.0409 -0.0229 103 LEU A O   
830  C CB  . LEU A 105 ? 0.1253 0.1230 0.1320 -0.0371 -0.0268 -0.0196 103 LEU A CB  
831  C CG  . LEU A 105 ? 0.1549 0.1407 0.1552 -0.0341 -0.0208 -0.0187 103 LEU A CG  
832  C CD1 . LEU A 105 ? 0.1959 0.1846 0.1960 -0.0274 -0.0194 -0.0159 103 LEU A CD1 
833  C CD2 . LEU A 105 ? 0.2370 0.2096 0.2264 -0.0363 -0.0197 -0.0223 103 LEU A CD2 
834  N N   . GLY A 106 ? 0.1462 0.1740 0.1788 -0.0482 -0.0362 -0.0211 104 GLY A N   
835  C CA  . GLY A 106 ? 0.1501 0.1954 0.1933 -0.0463 -0.0414 -0.0189 104 GLY A CA  
836  C C   . GLY A 106 ? 0.1641 0.2182 0.2054 -0.0493 -0.0503 -0.0217 104 GLY A C   
837  O O   . GLY A 106 ? 0.1811 0.2464 0.2250 -0.0440 -0.0551 -0.0185 104 GLY A O   
838  N N   . SER A 107 ? 0.1785 0.2275 0.2152 -0.0580 -0.0523 -0.0276 105 SER A N   
839  C CA  . SER A 107 ? 0.2405 0.2974 0.2732 -0.0629 -0.0614 -0.0318 105 SER A CA  
840  C C   . SER A 107 ? 0.2341 0.2847 0.2496 -0.0570 -0.0652 -0.0312 105 SER A C   
841  O O   . SER A 107 ? 0.2807 0.3414 0.2925 -0.0581 -0.0740 -0.0327 105 SER A O   
842  C CB  . SER A 107 ? 0.2274 0.2767 0.2571 -0.0749 -0.0609 -0.0395 105 SER A CB  
843  O OG  . SER A 107 ? 0.3341 0.3615 0.3447 -0.0751 -0.0569 -0.0426 105 SER A OG  
844  N N   . ARG A 108 ? 0.2364 0.2710 0.2412 -0.0510 -0.0588 -0.0293 106 ARG A N   
845  C CA  . ARG A 108 ? 0.3164 0.3442 0.3059 -0.0450 -0.0604 -0.0282 106 ARG A CA  
846  C C   . ARG A 108 ? 0.2869 0.3127 0.2772 -0.0353 -0.0555 -0.0222 106 ARG A C   
847  O O   . ARG A 108 ? 0.3106 0.3267 0.2882 -0.0306 -0.0537 -0.0213 106 ARG A O   
848  C CB  . ARG A 108 ? 0.3669 0.3757 0.3392 -0.0484 -0.0574 -0.0333 106 ARG A CB  
849  C CG  . ARG A 108 ? 0.4632 0.4573 0.4351 -0.0477 -0.0478 -0.0332 106 ARG A CG  
850  C CD  . ARG A 108 ? 0.6350 0.6133 0.5957 -0.0545 -0.0448 -0.0394 106 ARG A CD  
851  N NE  . ARG A 108 ? 0.7482 0.7164 0.7132 -0.0549 -0.0363 -0.0387 106 ARG A NE  
852  C CZ  . ARG A 108 ? 0.7958 0.7686 0.7728 -0.0592 -0.0346 -0.0384 106 ARG A CZ  
853  N NH1 . ARG A 108 ? 0.7972 0.7861 0.7854 -0.0638 -0.0407 -0.0391 106 ARG A NH1 
854  N NH2 . ARG A 108 ? 0.7751 0.7367 0.7530 -0.0583 -0.0263 -0.0370 106 ARG A NH2 
855  N N   . THR A 109 ? 0.1697 0.2036 0.1742 -0.0329 -0.0525 -0.0185 107 THR A N   
856  C CA  . THR A 109 ? 0.1568 0.1905 0.1629 -0.0248 -0.0482 -0.0136 107 THR A CA  
857  C C   . THR A 109 ? 0.1640 0.2096 0.1730 -0.0194 -0.0530 -0.0093 107 THR A C   
858  O O   . THR A 109 ? 0.1366 0.1973 0.1559 -0.0213 -0.0587 -0.0086 107 THR A O   
859  C CB  . THR A 109 ? 0.1343 0.1699 0.1520 -0.0245 -0.0423 -0.0117 107 THR A CB  
860  O OG1 . THR A 109 ? 0.1823 0.2070 0.1962 -0.0278 -0.0379 -0.0144 107 THR A OG1 
861  C CG2 . THR A 109 ? 0.1443 0.1780 0.1618 -0.0174 -0.0374 -0.0080 107 THR A CG2 
862  N N   . SER A 110 ? 0.1471 0.1863 0.1486 -0.0122 -0.0496 -0.0060 108 SER A N   
863  C CA  . SER A 110 ? 0.1653 0.2128 0.1682 -0.0048 -0.0519 -0.0004 108 SER A CA  
864  C C   . SER A 110 ? 0.1321 0.1922 0.1525 -0.0024 -0.0500 0.0034  108 SER A C   
865  O O   . SER A 110 ? 0.1210 0.1770 0.1475 -0.0035 -0.0432 0.0028  108 SER A O   
866  C CB  . SER A 110 ? 0.2145 0.2484 0.2055 0.0018  -0.0455 0.0021  108 SER A CB  
867  O OG  . SER A 110 ? 0.2386 0.2755 0.2353 0.0092  -0.0412 0.0078  108 SER A OG  
868  N N   . GLU A 111 ? 0.1678 0.2439 0.1961 0.0010  -0.0559 0.0072  109 GLU A N   
869  C CA  . GLU A 111 ? 0.1773 0.2655 0.2226 0.0050  -0.0530 0.0118  109 GLU A CA  
870  C C   . GLU A 111 ? 0.1629 0.2395 0.2059 0.0120  -0.0424 0.0154  109 GLU A C   
871  O O   . GLU A 111 ? 0.1640 0.2427 0.2178 0.0126  -0.0363 0.0166  109 GLU A O   
872  C CB  . GLU A 111 ? 0.2112 0.3198 0.2652 0.0098  -0.0611 0.0168  109 GLU A CB  
873  C CG  . GLU A 111 ? 0.3249 0.4500 0.3868 0.0010  -0.0714 0.0124  109 GLU A CG  
874  C CD  . GLU A 111 ? 0.5153 0.6343 0.5595 -0.0037 -0.0790 0.0076  109 GLU A CD  
875  O OE1 . GLU A 111 ? 0.6042 0.7327 0.6518 -0.0129 -0.0866 0.0021  109 GLU A OE1 
876  O OE2 . GLU A 111 ? 0.6159 0.7201 0.6424 0.0017  -0.0768 0.0091  109 GLU A OE2 
877  N N   . LYS A 112 ? 0.1497 0.2134 0.1783 0.0171  -0.0395 0.0170  110 LYS A N   
878  C CA  . LYS A 112 ? 0.1637 0.2150 0.1894 0.0224  -0.0287 0.0194  110 LYS A CA  
879  C C   . LYS A 112 ? 0.1479 0.1900 0.1745 0.0159  -0.0223 0.0140  110 LYS A C   
880  O O   . LYS A 112 ? 0.1341 0.1733 0.1659 0.0173  -0.0146 0.0146  110 LYS A O   
881  C CB  . LYS A 112 ? 0.1712 0.2088 0.1806 0.0276  -0.0260 0.0213  110 LYS A CB  
882  C CG  . LYS A 112 ? 0.2101 0.2325 0.2154 0.0312  -0.0137 0.0224  110 LYS A CG  
883  C CD  . LYS A 112 ? 0.3477 0.3580 0.3384 0.0380  -0.0102 0.0264  110 LYS A CD  
884  C CE  . LYS A 112 ? 0.3779 0.3994 0.3658 0.0447  -0.0193 0.0324  110 LYS A CE  
885  N NZ  . LYS A 112 ? 0.4994 0.5103 0.4751 0.0552  -0.0138 0.0396  110 LYS A NZ  
886  N N   . VAL A 113 ? 0.1002 0.1386 0.1216 0.0090  -0.0257 0.0087  111 VAL A N   
887  C CA  . VAL A 113 ? 0.0895 0.1212 0.1111 0.0037  -0.0210 0.0043  111 VAL A CA  
888  C C   . VAL A 113 ? 0.0777 0.1184 0.1117 0.0006  -0.0208 0.0041  111 VAL A C   
889  O O   . VAL A 113 ? 0.0702 0.1074 0.1063 -0.0001 -0.0147 0.0032  111 VAL A O   
890  C CB  . VAL A 113 ? 0.0847 0.1099 0.0978 -0.0012 -0.0240 -0.0001 111 VAL A CB  
891  C CG1 . VAL A 113 ? 0.0743 0.0968 0.0898 -0.0059 -0.0209 -0.0035 111 VAL A CG1 
892  C CG2 . VAL A 113 ? 0.0998 0.1141 0.1006 0.0019  -0.0213 0.0000  111 VAL A CG2 
893  N N   . LYS A 114 ? 0.1005 0.1526 0.1421 -0.0018 -0.0273 0.0045  112 LYS A N   
894  C CA  . LYS A 114 ? 0.0951 0.1555 0.1493 -0.0052 -0.0260 0.0045  112 LYS A CA  
895  C C   . LYS A 114 ? 0.0836 0.1484 0.1466 0.0003  -0.0198 0.0087  112 LYS A C   
896  O O   . LYS A 114 ? 0.0873 0.1497 0.1539 -0.0011 -0.0136 0.0081  112 LYS A O   
897  C CB  . LYS A 114 ? 0.1060 0.1786 0.1679 -0.0101 -0.0338 0.0034  112 LYS A CB  
898  C CG  . LYS A 114 ? 0.1012 0.1662 0.1538 -0.0168 -0.0375 -0.0017 112 LYS A CG  
899  C CD  . LYS A 114 ? 0.1063 0.1804 0.1667 -0.0245 -0.0429 -0.0046 112 LYS A CD  
900  C CE  . LYS A 114 ? 0.1996 0.2895 0.2656 -0.0238 -0.0515 -0.0034 112 LYS A CE  
901  N NZ  . LYS A 114 ? 0.1830 0.2824 0.2571 -0.0334 -0.0567 -0.0078 112 LYS A NZ  
902  N N   . ASN A 115 ? 0.0822 0.1516 0.1468 0.0074  -0.0206 0.0133  113 ASN A N   
903  C CA  . ASN A 115 ? 0.0738 0.1465 0.1470 0.0140  -0.0136 0.0180  113 ASN A CA  
904  C C   . ASN A 115 ? 0.0795 0.1360 0.1441 0.0148  -0.0033 0.0162  113 ASN A C   
905  O O   . ASN A 115 ? 0.0807 0.1362 0.1507 0.0158  0.0043  0.0169  113 ASN A O   
906  C CB  . ASN A 115 ? 0.0944 0.1733 0.1686 0.0231  -0.0159 0.0243  113 ASN A CB  
907  C CG  . ASN A 115 ? 0.1061 0.2060 0.1917 0.0230  -0.0267 0.0266  113 ASN A CG  
908  O OD1 . ASN A 115 ? 0.1734 0.2810 0.2593 0.0308  -0.0305 0.0321  113 ASN A OD1 
909  N ND2 . ASN A 115 ? 0.0765 0.1867 0.1727 0.0152  -0.0303 0.0232  113 ASN A ND2 
910  N N   . LYS A 116 ? 0.1033 0.1474 0.1545 0.0137  -0.0027 0.0133  114 LYS A N   
911  C CA  . LYS A 116 ? 0.1380 0.1680 0.1809 0.0129  0.0062  0.0103  114 LYS A CA  
912  C C   . LYS A 116 ? 0.1182 0.1473 0.1614 0.0062  0.0078  0.0058  114 LYS A C   
913  O O   . LYS A 116 ? 0.1188 0.1414 0.1597 0.0056  0.0154  0.0040  114 LYS A O   
914  C CB  . LYS A 116 ? 0.1162 0.1352 0.1469 0.0126  0.0064  0.0082  114 LYS A CB  
915  C CG  . LYS A 116 ? 0.1606 0.1670 0.1839 0.0097  0.0148  0.0037  114 LYS A CG  
916  C CD  . LYS A 116 ? 0.1324 0.1307 0.1552 0.0146  0.0250  0.0059  114 LYS A CD  
917  C CE  . LYS A 116 ? 0.1870 0.1715 0.2006 0.0104  0.0328  0.0003  114 LYS A CE  
918  N NZ  . LYS A 116 ? 0.1746 0.1481 0.1864 0.0142  0.0446  0.0015  114 LYS A NZ  
919  N N   . ILE A 117 ? 0.0675 0.1016 0.1117 0.0013  0.0009  0.0038  115 ILE A N   
920  C CA  . ILE A 117 ? 0.0648 0.0985 0.1090 -0.0036 0.0022  0.0011  115 ILE A CA  
921  C C   . ILE A 117 ? 0.0662 0.1049 0.1194 -0.0026 0.0071  0.0034  115 ILE A C   
922  O O   . ILE A 117 ? 0.0694 0.1030 0.1189 -0.0039 0.0131  0.0017  115 ILE A O   
923  C CB  . ILE A 117 ? 0.0591 0.0953 0.1026 -0.0082 -0.0046 -0.0006 115 ILE A CB  
924  C CG1 . ILE A 117 ? 0.0628 0.0916 0.0961 -0.0094 -0.0066 -0.0036 115 ILE A CG1 
925  C CG2 . ILE A 117 ? 0.0590 0.0959 0.1045 -0.0117 -0.0024 -0.0013 115 ILE A CG2 
926  C CD1 . ILE A 117 ? 0.0585 0.0876 0.0900 -0.0124 -0.0124 -0.0048 115 ILE A CD1 
927  N N   . LEU A 118 ? 0.0720 0.1214 0.1371 -0.0001 0.0050  0.0072  116 LEU A N   
928  C CA  . LEU A 118 ? 0.0730 0.1285 0.1490 0.0012  0.0105  0.0098  116 LEU A CA  
929  C C   . LEU A 118 ? 0.0841 0.1319 0.1573 0.0063  0.0204  0.0111  116 LEU A C   
930  O O   . LEU A 118 ? 0.0909 0.1356 0.1648 0.0057  0.0279  0.0107  116 LEU A O   
931  C CB  . LEU A 118 ? 0.0688 0.1406 0.1605 0.0027  0.0054  0.0137  116 LEU A CB  
932  C CG  . LEU A 118 ? 0.0653 0.1445 0.1615 -0.0043 -0.0023 0.0114  116 LEU A CG  
933  C CD1 . LEU A 118 ? 0.0640 0.1618 0.1763 -0.0033 -0.0082 0.0144  116 LEU A CD1 
934  C CD2 . LEU A 118 ? 0.0781 0.1540 0.1757 -0.0095 0.0029  0.0098  116 LEU A CD2 
935  N N   . GLU A 119 ? 0.0742 0.1172 0.1431 0.0113  0.0214  0.0126  117 GLU A N   
936  C CA  . GLU A 119 ? 0.1082 0.1406 0.1729 0.0160  0.0322  0.0134  117 GLU A CA  
937  C C   . GLU A 119 ? 0.1213 0.1408 0.1732 0.0103  0.0377  0.0070  117 GLU A C   
938  O O   . GLU A 119 ? 0.1118 0.1241 0.1613 0.0111  0.0473  0.0062  117 GLU A O   
939  C CB  . GLU A 119 ? 0.1323 0.1582 0.1913 0.0215  0.0328  0.0155  117 GLU A CB  
940  C CG  . GLU A 119 ? 0.2061 0.2402 0.2754 0.0313  0.0336  0.0235  117 GLU A CG  
941  C CD  . GLU A 119 ? 0.1928 0.2260 0.2700 0.0369  0.0447  0.0270  117 GLU A CD  
942  O OE1 . GLU A 119 ? 0.1736 0.2225 0.2661 0.0386  0.0424  0.0307  117 GLU A OE1 
943  O OE2 . GLU A 119 ? 0.2244 0.2415 0.2935 0.0399  0.0563  0.0265  117 GLU A OE2 
944  N N   . LEU A 120 ? 0.0892 0.1055 0.1321 0.0050  0.0320  0.0025  118 LEU A N   
945  C CA  . LEU A 120 ? 0.0930 0.0999 0.1239 -0.0004 0.0355  -0.0036 118 LEU A CA  
946  C C   . LEU A 120 ? 0.0989 0.1083 0.1293 -0.0036 0.0369  -0.0048 118 LEU A C   
947  O O   . LEU A 120 ? 0.1173 0.1192 0.1406 -0.0051 0.0444  -0.0076 118 LEU A O   
948  C CB  . LEU A 120 ? 0.0912 0.0977 0.1157 -0.0045 0.0285  -0.0072 118 LEU A CB  
949  C CG  . LEU A 120 ? 0.0986 0.0980 0.1187 -0.0030 0.0300  -0.0081 118 LEU A CG  
950  C CD1 . LEU A 120 ? 0.0938 0.0944 0.1096 -0.0069 0.0236  -0.0113 118 LEU A CD1 
951  C CD2 . LEU A 120 ? 0.1012 0.0885 0.1149 -0.0035 0.0406  -0.0113 118 LEU A CD2 
952  N N   . LEU A 121 ? 0.0846 0.1032 0.1219 -0.0047 0.0306  -0.0024 119 LEU A N   
953  C CA  . LEU A 121 ? 0.0811 0.1009 0.1180 -0.0071 0.0329  -0.0022 119 LEU A CA  
954  C C   . LEU A 121 ? 0.0959 0.1136 0.1371 -0.0040 0.0430  -0.0002 119 LEU A C   
955  O O   . LEU A 121 ? 0.1050 0.1156 0.1369 -0.0058 0.0494  -0.0026 119 LEU A O   
956  C CB  . LEU A 121 ? 0.0785 0.1072 0.1240 -0.0087 0.0265  0.0004  119 LEU A CB  
957  C CG  . LEU A 121 ? 0.0704 0.0986 0.1097 -0.0118 0.0186  -0.0017 119 LEU A CG  
958  C CD1 . LEU A 121 ? 0.0666 0.1015 0.1148 -0.0136 0.0138  0.0006  119 LEU A CD1 
959  C CD2 . LEU A 121 ? 0.0749 0.0976 0.1016 -0.0143 0.0197  -0.0043 119 LEU A CD2 
960  N N   . TYR A 122 ? 0.0899 0.1136 0.1441 0.0011  0.0447  0.0043  120 TYR A N   
961  C CA  . TYR A 122 ? 0.1065 0.1294 0.1674 0.0054  0.0552  0.0073  120 TYR A CA  
962  C C   . TYR A 122 ? 0.1244 0.1316 0.1715 0.0059  0.0649  0.0035  120 TYR A C   
963  O O   . TYR A 122 ? 0.1359 0.1364 0.1781 0.0054  0.0741  0.0023  120 TYR A O   
964  C CB  . TYR A 122 ? 0.1033 0.1370 0.1808 0.0122  0.0545  0.0134  120 TYR A CB  
965  C CG  . TYR A 122 ? 0.1123 0.1459 0.1986 0.0178  0.0663  0.0173  120 TYR A CG  
966  C CD1 . TYR A 122 ? 0.1290 0.1696 0.2249 0.0163  0.0700  0.0190  120 TYR A CD1 
967  C CD2 . TYR A 122 ? 0.1596 0.1829 0.2422 0.0241  0.0759  0.0185  120 TYR A CD2 
968  C CE1 . TYR A 122 ? 0.1561 0.1954 0.2592 0.0212  0.0824  0.0222  120 TYR A CE1 
969  C CE2 . TYR A 122 ? 0.1433 0.1649 0.2333 0.0298  0.0882  0.0222  120 TYR A CE2 
970  C CZ  . TYR A 122 ? 0.1515 0.1815 0.2518 0.0283  0.0914  0.0238  120 TYR A CZ  
971  O OH  . TYR A 122 ? 0.1570 0.1860 0.2661 0.0341  0.1046  0.0277  120 TYR A OH  
972  N N   . SER A 123 ? 0.1448 0.1456 0.1849 0.0061  0.0633  0.0011  121 SER A N   
973  C CA  . SER A 123 ? 0.1710 0.1558 0.1979 0.0051  0.0729  -0.0036 121 SER A CA  
974  C C   . SER A 123 ? 0.1926 0.1708 0.2048 -0.0021 0.0746  -0.0104 121 SER A C   
975  O O   . SER A 123 ? 0.1738 0.1407 0.1772 -0.0030 0.0852  -0.0135 121 SER A O   
976  C CB  . SER A 123 ? 0.1826 0.1614 0.2048 0.0053  0.0711  -0.0055 121 SER A CB  
977  O OG  . SER A 123 ? 0.1764 0.1564 0.1905 -0.0016 0.0629  -0.0108 121 SER A OG  
978  N N   . TRP A 124 ? 0.1578 0.1430 0.1667 -0.0069 0.0645  -0.0123 122 TRP A N   
979  C CA  . TRP A 124 ? 0.1597 0.1415 0.1545 -0.0127 0.0642  -0.0175 122 TRP A CA  
980  C C   . TRP A 124 ? 0.1614 0.1424 0.1549 -0.0119 0.0701  -0.0153 122 TRP A C   
981  O O   . TRP A 124 ? 0.1764 0.1495 0.1551 -0.0153 0.0750  -0.0197 122 TRP A O   
982  C CB  . TRP A 124 ? 0.1517 0.1417 0.1444 -0.0161 0.0522  -0.0186 122 TRP A CB  
983  C CG  . TRP A 124 ? 0.1383 0.1285 0.1312 -0.0175 0.0476  -0.0214 122 TRP A CG  
984  C CD1 . TRP A 124 ? 0.1528 0.1341 0.1403 -0.0194 0.0531  -0.0260 122 TRP A CD1 
985  C CD2 . TRP A 124 ? 0.1185 0.1167 0.1153 -0.0182 0.0375  -0.0204 122 TRP A CD2 
986  N NE1 . TRP A 124 ? 0.1459 0.1299 0.1359 -0.0203 0.0474  -0.0270 122 TRP A NE1 
987  C CE2 . TRP A 124 ? 0.1234 0.1178 0.1190 -0.0194 0.0377  -0.0236 122 TRP A CE2 
988  C CE3 . TRP A 124 ? 0.1057 0.1120 0.1071 -0.0176 0.0299  -0.0169 122 TRP A CE3 
989  C CZ2 . TRP A 124 ? 0.1093 0.1087 0.1081 -0.0197 0.0303  -0.0233 122 TRP A CZ2 
990  C CZ3 . TRP A 124 ? 0.1063 0.1168 0.1103 -0.0179 0.0225  -0.0169 122 TRP A CZ3 
991  C CH2 . TRP A 124 ? 0.0936 0.1011 0.0961 -0.0189 0.0227  -0.0201 122 TRP A CH2 
992  N N   . THR A 125 ? 0.1310 0.1200 0.1395 -0.0078 0.0702  -0.0087 123 THR A N   
993  C CA  . THR A 125 ? 0.1373 0.1249 0.1465 -0.0068 0.0780  -0.0062 123 THR A CA  
994  C C   . THR A 125 ? 0.1541 0.1296 0.1572 -0.0048 0.0919  -0.0079 123 THR A C   
995  O O   . THR A 125 ? 0.1692 0.1381 0.1632 -0.0058 0.0996  -0.0087 123 THR A O   
996  C CB  . THR A 125 ? 0.1248 0.1248 0.1541 -0.0039 0.0764  0.0006  123 THR A CB  
997  O OG1 . THR A 125 ? 0.1216 0.1269 0.1670 0.0018  0.0800  0.0046  123 THR A OG1 
998  C CG2 . THR A 125 ? 0.1155 0.1247 0.1491 -0.0067 0.0642  0.0015  123 THR A CG2 
999  N N   . VAL A 126 ? 0.1540 0.1251 0.1612 -0.0013 0.0962  -0.0080 124 VAL A N   
1000 C CA  . VAL A 126 ? 0.1721 0.1293 0.1736 0.0013  0.1109  -0.0095 124 VAL A CA  
1001 C C   . VAL A 126 ? 0.1886 0.1305 0.1680 -0.0051 0.1140  -0.0188 124 VAL A C   
1002 O O   . VAL A 126 ? 0.2121 0.1408 0.1772 -0.0073 0.1247  -0.0233 124 VAL A O   
1003 C CB  . VAL A 126 ? 0.1687 0.1279 0.1864 0.0098  0.1159  -0.0035 124 VAL A CB  
1004 C CG1 . VAL A 126 ? 0.1911 0.1333 0.2024 0.0135  0.1333  -0.0046 124 VAL A CG1 
1005 C CG2 . VAL A 126 ? 0.1578 0.1354 0.1985 0.0151  0.1119  0.0049  124 VAL A CG2 
1006 N N   . GLY A 127 ? 0.1809 0.1253 0.1576 -0.0087 0.1049  -0.0223 125 GLY A N   
1007 C CA  . GLY A 127 ? 0.1931 0.1255 0.1525 -0.0157 0.1072  -0.0316 125 GLY A CA  
1008 C C   . GLY A 127 ? 0.2048 0.1385 0.1475 -0.0236 0.1017  -0.0381 125 GLY A C   
1009 O O   . GLY A 127 ? 0.2183 0.1404 0.1438 -0.0296 0.1078  -0.0463 125 GLY A O   
1010 N N   . LEU A 128 ? 0.2062 0.1532 0.1531 -0.0231 0.0913  -0.0341 126 LEU A N   
1011 C CA  . LEU A 128 ? 0.2100 0.1606 0.1418 -0.0286 0.0845  -0.0381 126 LEU A CA  
1012 C C   . LEU A 128 ? 0.2235 0.1788 0.1567 -0.0252 0.0841  -0.0318 126 LEU A C   
1013 O O   . LEU A 128 ? 0.1913 0.1574 0.1292 -0.0244 0.0743  -0.0279 126 LEU A O   
1014 C CB  . LEU A 128 ? 0.1910 0.1532 0.1254 -0.0316 0.0710  -0.0397 126 LEU A CB  
1015 C CG  . LEU A 128 ? 0.2070 0.1657 0.1411 -0.0358 0.0711  -0.0461 126 LEU A CG  
1016 C CD1 . LEU A 128 ? 0.1736 0.1447 0.1177 -0.0358 0.0593  -0.0443 126 LEU A CD1 
1017 C CD2 . LEU A 128 ? 0.2480 0.1996 0.1634 -0.0442 0.0742  -0.0564 126 LEU A CD2 
1018 N N   . PRO A 129 ? 0.2031 0.1493 0.1334 -0.0228 0.0962  -0.0302 127 PRO A N   
1019 C CA  . PRO A 129 ? 0.2374 0.1867 0.1714 -0.0194 0.0986  -0.0237 127 PRO A CA  
1020 C C   . PRO A 129 ? 0.2596 0.2104 0.1762 -0.0224 0.0926  -0.0246 127 PRO A C   
1021 O O   . PRO A 129 ? 0.2852 0.2399 0.2060 -0.0198 0.0921  -0.0184 127 PRO A O   
1022 C CB  . PRO A 129 ? 0.2683 0.2055 0.2008 -0.0167 0.1147  -0.0233 127 PRO A CB  
1023 C CG  . PRO A 129 ? 0.2749 0.1991 0.1931 -0.0204 0.1206  -0.0317 127 PRO A CG  
1024 C CD  . PRO A 129 ? 0.2239 0.1550 0.1479 -0.0228 0.1099  -0.0344 127 PRO A CD  
1025 N N   . GLU A 130 ? 0.3630 0.3121 0.2613 -0.0276 0.0875  -0.0318 128 GLU A N   
1026 C CA  . GLU A 130 ? 0.3849 0.3379 0.2666 -0.0291 0.0803  -0.0317 128 GLU A CA  
1027 C C   . GLU A 130 ? 0.3663 0.3324 0.2594 -0.0265 0.0685  -0.0258 128 GLU A C   
1028 O O   . GLU A 130 ? 0.3364 0.3056 0.2183 -0.0254 0.0636  -0.0230 128 GLU A O   
1029 C CB  . GLU A 130 ? 0.4261 0.3789 0.2873 -0.0355 0.0751  -0.0409 128 GLU A CB  
1030 C CG  . GLU A 130 ? 0.5370 0.4799 0.3919 -0.0411 0.0821  -0.0503 128 GLU A CG  
1031 C CD  . GLU A 130 ? 0.3584 0.3045 0.2321 -0.0414 0.0803  -0.0512 128 GLU A CD  
1032 O OE1 . GLU A 130 ? 0.3568 0.2968 0.2441 -0.0368 0.0891  -0.0471 128 GLU A OE1 
1033 O OE2 . GLU A 130 ? 0.3540 0.3078 0.2280 -0.0460 0.0715  -0.0563 128 GLU A OE2 
1034 N N   . GLU A 131 ? 0.2575 0.2308 0.1686 -0.0260 0.0631  -0.0251 129 GLU A N   
1035 C CA  . GLU A 131 ? 0.2569 0.2412 0.1774 -0.0242 0.0522  -0.0208 129 GLU A CA  
1036 C C   . GLU A 131 ? 0.2488 0.2337 0.1807 -0.0201 0.0547  -0.0127 129 GLU A C   
1037 O O   . GLU A 131 ? 0.2415 0.2287 0.1915 -0.0187 0.0565  -0.0101 129 GLU A O   
1038 C CB  . GLU A 131 ? 0.2307 0.2209 0.1643 -0.0253 0.0463  -0.0232 129 GLU A CB  
1039 C CG  . GLU A 131 ? 0.2559 0.2467 0.1794 -0.0305 0.0433  -0.0315 129 GLU A CG  
1040 C CD  . GLU A 131 ? 0.3159 0.3162 0.2290 -0.0321 0.0333  -0.0328 129 GLU A CD  
1041 O OE1 . GLU A 131 ? 0.3205 0.3240 0.2259 -0.0374 0.0302  -0.0403 129 GLU A OE1 
1042 O OE2 . GLU A 131 ? 0.2590 0.2648 0.1745 -0.0279 0.0282  -0.0264 129 GLU A OE2 
1043 N N   . VAL A 132 ? 0.1880 0.1698 0.1081 -0.0186 0.0565  -0.0091 130 VAL A N   
1044 C CA  . VAL A 132 ? 0.1918 0.1710 0.1203 -0.0160 0.0625  -0.0022 130 VAL A CA  
1045 C C   . VAL A 132 ? 0.1961 0.1825 0.1419 -0.0150 0.0561  0.0019  130 VAL A C   
1046 O O   . VAL A 132 ? 0.1880 0.1756 0.1500 -0.0149 0.0603  0.0051  130 VAL A O   
1047 C CB  . VAL A 132 ? 0.2303 0.2024 0.1396 -0.0142 0.0666  0.0013  130 VAL A CB  
1048 C CG1 . VAL A 132 ? 0.3189 0.2829 0.2080 -0.0157 0.0728  -0.0035 130 VAL A CG1 
1049 C CG2 . VAL A 132 ? 0.3110 0.2879 0.2110 -0.0123 0.0567  0.0038  130 VAL A CG2 
1050 N N   . LYS A 133 ? 0.1684 0.1606 0.1122 -0.0149 0.0459  0.0010  131 LYS A N   
1051 C CA  . LYS A 133 ? 0.1630 0.1599 0.1207 -0.0143 0.0406  0.0042  131 LYS A CA  
1052 C C   . LYS A 133 ? 0.1418 0.1439 0.1172 -0.0158 0.0384  0.0020  131 LYS A C   
1053 O O   . LYS A 133 ? 0.1342 0.1391 0.1233 -0.0161 0.0373  0.0045  131 LYS A O   
1054 C CB  . LYS A 133 ? 0.1515 0.1521 0.1010 -0.0125 0.0317  0.0048  131 LYS A CB  
1055 C CG  . LYS A 133 ? 0.1744 0.1705 0.1072 -0.0092 0.0333  0.0094  131 LYS A CG  
1056 C CD  . LYS A 133 ? 0.1703 0.1724 0.0978 -0.0061 0.0243  0.0109  131 LYS A CD  
1057 C CE  . LYS A 133 ? 0.1953 0.1937 0.1043 -0.0012 0.0254  0.0164  131 LYS A CE  
1058 N NZ  . LYS A 133 ? 0.2040 0.2119 0.1061 0.0027  0.0160  0.0175  131 LYS A NZ  
1059 N N   . ILE A 134 ? 0.1226 0.1257 0.0970 -0.0168 0.0382  -0.0029 132 ILE A N   
1060 C CA  . ILE A 134 ? 0.1199 0.1264 0.1094 -0.0168 0.0379  -0.0038 132 ILE A CA  
1061 C C   . ILE A 134 ? 0.1155 0.1223 0.1176 -0.0157 0.0454  -0.0003 132 ILE A C   
1062 O O   . ILE A 134 ? 0.1057 0.1189 0.1234 -0.0155 0.0430  0.0020  132 ILE A O   
1063 C CB  . ILE A 134 ? 0.1129 0.1171 0.0976 -0.0178 0.0391  -0.0092 132 ILE A CB  
1064 C CG1 . ILE A 134 ? 0.1165 0.1236 0.0933 -0.0197 0.0313  -0.0131 132 ILE A CG1 
1065 C CG2 . ILE A 134 ? 0.1187 0.1253 0.1183 -0.0160 0.0401  -0.0083 132 ILE A CG2 
1066 C CD1 . ILE A 134 ? 0.1185 0.1222 0.0895 -0.0224 0.0335  -0.0195 132 ILE A CD1 
1067 N N   . ALA A 135 ? 0.1434 0.1443 0.1387 -0.0153 0.0544  0.0001  133 ALA A N   
1068 C CA  . ALA A 135 ? 0.1418 0.1437 0.1498 -0.0141 0.0630  0.0038  133 ALA A CA  
1069 C C   . ALA A 135 ? 0.1433 0.1498 0.1622 -0.0155 0.0616  0.0081  133 ALA A C   
1070 O O   . ALA A 135 ? 0.1300 0.1445 0.1679 -0.0158 0.0625  0.0103  133 ALA A O   
1071 C CB  . ALA A 135 ? 0.1730 0.1654 0.1684 -0.0135 0.0739  0.0033  133 ALA A CB  
1072 N N   . GLU A 136 ? 0.1426 0.1442 0.1495 -0.0164 0.0593  0.0092  134 GLU A N   
1073 C CA  . GLU A 136 ? 0.1432 0.1457 0.1583 -0.0182 0.0594  0.0128  134 GLU A CA  
1074 C C   . GLU A 136 ? 0.1213 0.1320 0.1506 -0.0203 0.0509  0.0121  134 GLU A C   
1075 O O   . GLU A 136 ? 0.1194 0.1345 0.1635 -0.0232 0.0522  0.0136  134 GLU A O   
1076 C CB  . GLU A 136 ? 0.1655 0.1592 0.1626 -0.0173 0.0593  0.0151  134 GLU A CB  
1077 C CG  . GLU A 136 ? 0.2139 0.1989 0.1953 -0.0155 0.0682  0.0165  134 GLU A CG  
1078 C CD  . GLU A 136 ? 0.3776 0.3542 0.3426 -0.0136 0.0689  0.0207  134 GLU A CD  
1079 O OE1 . GLU A 136 ? 0.4349 0.4029 0.3870 -0.0121 0.0776  0.0233  134 GLU A OE1 
1080 O OE2 . GLU A 136 ? 0.2956 0.2734 0.2599 -0.0128 0.0616  0.0217  134 GLU A OE2 
1081 N N   . ALA A 137 ? 0.1206 0.1328 0.1446 -0.0193 0.0424  0.0093  135 ALA A N   
1082 C CA  . ALA A 137 ? 0.1055 0.1237 0.1393 -0.0208 0.0343  0.0082  135 ALA A CA  
1083 C C   . ALA A 137 ? 0.0986 0.1265 0.1499 -0.0212 0.0344  0.0080  135 ALA A C   
1084 O O   . ALA A 137 ? 0.0907 0.1253 0.1547 -0.0239 0.0310  0.0083  135 ALA A O   
1085 C CB  . ALA A 137 ? 0.0987 0.1163 0.1230 -0.0193 0.0271  0.0053  135 ALA A CB  
1086 N N   . TYR A 138 ? 0.1363 0.1649 0.1876 -0.0182 0.0384  0.0075  136 TYR A N   
1087 C CA  . TYR A 138 ? 0.1156 0.1539 0.1831 -0.0165 0.0388  0.0086  136 TYR A CA  
1088 C C   . TYR A 138 ? 0.1271 0.1731 0.2111 -0.0183 0.0441  0.0116  136 TYR A C   
1089 O O   . TYR A 138 ? 0.1202 0.1784 0.2207 -0.0194 0.0397  0.0125  136 TYR A O   
1090 C CB  . TYR A 138 ? 0.1355 0.1702 0.1984 -0.0122 0.0438  0.0078  136 TYR A CB  
1091 C CG  . TYR A 138 ? 0.1433 0.1875 0.2223 -0.0083 0.0448  0.0103  136 TYR A CG  
1092 C CD1 . TYR A 138 ? 0.1244 0.1741 0.2074 -0.0066 0.0370  0.0103  136 TYR A CD1 
1093 C CD2 . TYR A 138 ? 0.1414 0.1895 0.2316 -0.0057 0.0539  0.0134  136 TYR A CD2 
1094 C CE1 . TYR A 138 ? 0.1337 0.1935 0.2310 -0.0018 0.0372  0.0137  136 TYR A CE1 
1095 C CE2 . TYR A 138 ? 0.1294 0.1889 0.2365 -0.0008 0.0544  0.0169  136 TYR A CE2 
1096 C CZ  . TYR A 138 ? 0.1514 0.2172 0.2617 0.0013  0.0454  0.0173  136 TYR A CZ  
1097 O OH  . TYR A 138 ? 0.1433 0.2198 0.2677 0.0077  0.0458  0.0216  136 TYR A OH  
1098 N N   . GLN A 139 ? 0.1130 0.1522 0.1922 -0.0191 0.0529  0.0130  137 GLN A N   
1099 C CA  . GLN A 139 ? 0.1533 0.1984 0.2480 -0.0215 0.0601  0.0157  137 GLN A CA  
1100 C C   . GLN A 139 ? 0.1458 0.1961 0.2498 -0.0275 0.0546  0.0153  137 GLN A C   
1101 O O   . GLN A 139 ? 0.1193 0.1831 0.2436 -0.0304 0.0538  0.0158  137 GLN A O   
1102 C CB  . GLN A 139 ? 0.1764 0.2091 0.2584 -0.0212 0.0712  0.0172  137 GLN A CB  
1103 C CG  . GLN A 139 ? 0.2719 0.3064 0.3661 -0.0249 0.0800  0.0200  137 GLN A CG  
1104 C CD  . GLN A 139 ? 0.3708 0.3904 0.4482 -0.0239 0.0914  0.0220  137 GLN A CD  
1105 O OE1 . GLN A 139 ? 0.3884 0.3959 0.4448 -0.0235 0.0898  0.0219  137 GLN A OE1 
1106 N NE2 . GLN A 139 ? 0.3643 0.3851 0.4504 -0.0227 0.1033  0.0242  137 GLN A NE2 
1107 N N   . MET A 140 ? 0.1293 0.1699 0.2187 -0.0292 0.0500  0.0138  138 MET A N   
1108 C CA  . MET A 140 ? 0.1283 0.1700 0.2231 -0.0350 0.0454  0.0126  138 MET A CA  
1109 C C   . MET A 140 ? 0.1267 0.1817 0.2342 -0.0368 0.0354  0.0101  138 MET A C   
1110 O O   . MET A 140 ? 0.1169 0.1808 0.2392 -0.0427 0.0337  0.0090  138 MET A O   
1111 C CB  . MET A 140 ? 0.1287 0.1560 0.2040 -0.0346 0.0435  0.0123  138 MET A CB  
1112 C CG  . MET A 140 ? 0.1421 0.1663 0.2197 -0.0401 0.0402  0.0108  138 MET A CG  
1113 S SD  . MET A 140 ? 0.1151 0.1463 0.1950 -0.0409 0.0273  0.0067  138 MET A SD  
1114 C CE  . MET A 140 ? 0.1221 0.1441 0.1812 -0.0339 0.0239  0.0070  138 MET A CE  
1115 N N   . LEU A 141 ? 0.1266 0.1831 0.2281 -0.0321 0.0291  0.0092  139 LEU A N   
1116 C CA  . LEU A 141 ? 0.1199 0.1878 0.2304 -0.0326 0.0198  0.0076  139 LEU A CA  
1117 C C   . LEU A 141 ? 0.0956 0.1813 0.2281 -0.0331 0.0204  0.0094  139 LEU A C   
1118 O O   . LEU A 141 ? 0.1076 0.2051 0.2522 -0.0378 0.0140  0.0078  139 LEU A O   
1119 C CB  . LEU A 141 ? 0.1137 0.1789 0.2139 -0.0268 0.0152  0.0071  139 LEU A CB  
1120 C CG  . LEU A 141 ? 0.1076 0.1599 0.1896 -0.0268 0.0122  0.0049  139 LEU A CG  
1121 C CD1 . LEU A 141 ? 0.1087 0.1589 0.1829 -0.0217 0.0102  0.0043  139 LEU A CD1 
1122 C CD2 . LEU A 141 ? 0.0865 0.1382 0.1679 -0.0314 0.0055  0.0025  139 LEU A CD2 
1123 N N   . LYS A 142 ? 0.1183 0.2062 0.2567 -0.0290 0.0288  0.0125  140 LYS A N   
1124 C CA  . LYS A 142 ? 0.1141 0.2207 0.2759 -0.0284 0.0305  0.0150  140 LYS A CA  
1125 C C   . LYS A 142 ? 0.1457 0.2598 0.3226 -0.0370 0.0331  0.0140  140 LYS A C   
1126 O O   . LYS A 142 ? 0.1448 0.2784 0.3425 -0.0402 0.0289  0.0139  140 LYS A O   
1127 C CB  . LYS A 142 ? 0.1756 0.2808 0.3396 -0.0213 0.0409  0.0187  140 LYS A CB  
1128 C CG  . LYS A 142 ? 0.1429 0.2402 0.2935 -0.0136 0.0400  0.0192  140 LYS A CG  
1129 C CD  . LYS A 142 ? 0.3003 0.4020 0.4477 -0.0131 0.0277  0.0177  140 LYS A CD  
1130 C CE  . LYS A 142 ? 0.3131 0.4227 0.4669 -0.0046 0.0268  0.0213  140 LYS A CE  
1131 N NZ  . LYS A 142 ? 0.1563 0.2742 0.3106 -0.0038 0.0148  0.0210  140 LYS A NZ  
1132 N N   . LYS A 143 ? 0.1653 0.2645 0.3326 -0.0403 0.0414  0.0137  141 LYS A N   
1133 C CA  . LYS A 143 ? 0.1974 0.2987 0.3761 -0.0491 0.0462  0.0126  141 LYS A CA  
1134 C C   . LYS A 143 ? 0.1817 0.2888 0.3650 -0.0572 0.0363  0.0080  141 LYS A C   
1135 O O   . LYS A 143 ? 0.1662 0.2861 0.3685 -0.0653 0.0366  0.0061  141 LYS A O   
1136 C CB  . LYS A 143 ? 0.2321 0.3119 0.3931 -0.0499 0.0561  0.0137  141 LYS A CB  
1137 C CG  . LYS A 143 ? 0.3785 0.4583 0.5518 -0.0559 0.0677  0.0149  141 LYS A CG  
1138 C CD  . LYS A 143 ? 0.5572 0.6295 0.7294 -0.0652 0.0674  0.0119  141 LYS A CD  
1139 C CE  . LYS A 143 ? 0.6213 0.7067 0.8190 -0.0745 0.0734  0.0106  141 LYS A CE  
1140 N NZ  . LYS A 143 ? 0.6527 0.7388 0.8585 -0.0719 0.0872  0.0150  141 LYS A NZ  
1141 N N   . GLN A 144 ? 0.2010 0.2983 0.3669 -0.0558 0.0284  0.0058  142 GLN A N   
1142 C CA  . GLN A 144 ? 0.2089 0.3077 0.3744 -0.0628 0.0197  0.0010  142 GLN A CA  
1143 C C   . GLN A 144 ? 0.2060 0.3242 0.3817 -0.0619 0.0078  -0.0004 142 GLN A C   
1144 O O   . GLN A 144 ? 0.2142 0.3339 0.3871 -0.0673 -0.0005 -0.0048 142 GLN A O   
1145 C CB  . GLN A 144 ? 0.2189 0.2969 0.3606 -0.0617 0.0181  -0.0005 142 GLN A CB  
1146 C CG  . GLN A 144 ? 0.1970 0.2556 0.3257 -0.0614 0.0283  0.0016  142 GLN A CG  
1147 C CD  . GLN A 144 ? 0.3262 0.3809 0.4637 -0.0705 0.0365  0.0004  142 GLN A CD  
1148 O OE1 . GLN A 144 ? 0.3009 0.3487 0.4379 -0.0698 0.0470  0.0037  142 GLN A OE1 
1149 N NE2 . GLN A 144 ? 0.3330 0.3901 0.4763 -0.0792 0.0322  -0.0045 142 GLN A NE2 
1150 N N   . GLY A 145 ? 0.1069 0.2390 0.2935 -0.0547 0.0078  0.0037  143 GLY A N   
1151 C CA  . GLY A 145 ? 0.1352 0.2882 0.3337 -0.0525 -0.0027 0.0040  143 GLY A CA  
1152 C C   . GLY A 145 ? 0.0950 0.2424 0.2768 -0.0469 -0.0117 0.0036  143 GLY A C   
1153 O O   . GLY A 145 ? 0.0921 0.2542 0.2794 -0.0471 -0.0219 0.0027  143 GLY A O   
1154 N N   . ILE A 146 ? 0.1291 0.2566 0.2909 -0.0418 -0.0079 0.0043  144 ILE A N   
1155 C CA  . ILE A 146 ? 0.1210 0.2423 0.2678 -0.0356 -0.0139 0.0045  144 ILE A CA  
1156 C C   . ILE A 146 ? 0.1279 0.2566 0.2797 -0.0255 -0.0123 0.0098  144 ILE A C   
1157 O O   . ILE A 146 ? 0.1261 0.2467 0.2747 -0.0207 -0.0033 0.0122  144 ILE A O   
1158 C CB  . ILE A 146 ? 0.1111 0.2100 0.2367 -0.0348 -0.0102 0.0029  144 ILE A CB  
1159 C CG1 . ILE A 146 ? 0.1216 0.2110 0.2433 -0.0430 -0.0079 -0.0005 144 ILE A CG1 
1160 C CG2 . ILE A 146 ? 0.1461 0.2388 0.2574 -0.0308 -0.0166 0.0019  144 ILE A CG2 
1161 C CD1 . ILE A 146 ? 0.1365 0.2275 0.2570 -0.0499 -0.0158 -0.0051 144 ILE A CD1 
1162 N N   . VAL A 147 ? 0.0992 0.2428 0.2579 -0.0221 -0.0204 0.0115  145 VAL A N   
1163 C CA  . VAL A 147 ? 0.0908 0.2430 0.2567 -0.0116 -0.0182 0.0176  145 VAL A CA  
1164 C C   . VAL A 147 ? 0.1178 0.2686 0.2722 -0.0057 -0.0258 0.0190  145 VAL A C   
1165 O O   . VAL A 147 ? 0.1326 0.2796 0.2763 -0.0104 -0.0337 0.0150  145 VAL A O   
1166 C CB  . VAL A 147 ? 0.0954 0.2728 0.2874 -0.0112 -0.0191 0.0211  145 VAL A CB  
1167 C CG1 . VAL A 147 ? 0.0833 0.2604 0.2863 -0.0176 -0.0101 0.0197  145 VAL A CG1 
1168 C CG2 . VAL A 147 ? 0.1128 0.3088 0.3126 -0.0167 -0.0323 0.0186  145 VAL A CG2 
1169 N N   . LYS A 148 ? 0.1112 0.2632 0.2666 0.0050  -0.0222 0.0248  146 LYS A N   
1170 C CA  . LYS A 148 ? 0.1696 0.3183 0.3132 0.0119  -0.0273 0.0273  146 LYS A CA  
1171 C C   . LYS A 148 ? 0.1910 0.3604 0.3421 0.0116  -0.0401 0.0285  146 LYS A C   
1172 O O   . LYS A 148 ? 0.1574 0.3490 0.3288 0.0102  -0.0436 0.0301  146 LYS A O   
1173 C CB  . LYS A 148 ? 0.2030 0.3461 0.3461 0.0235  -0.0183 0.0337  146 LYS A CB  
1174 C CG  . LYS A 148 ? 0.2025 0.3220 0.3315 0.0224  -0.0076 0.0305  146 LYS A CG  
1175 C CD  . LYS A 148 ? 0.3273 0.4329 0.4443 0.0312  -0.0014 0.0338  146 LYS A CD  
1176 C CE  . LYS A 148 ? 0.2358 0.3226 0.3441 0.0302  0.0108  0.0309  146 LYS A CE  
1177 N NZ  . LYS A 148 ? 0.2416 0.3208 0.3485 0.0403  0.0205  0.0361  146 LYS A NZ  
1178 N N   . SER A 149 ? 1.0456 1.2085 1.1803 0.0127  -0.0471 0.0274  147 SER A N   
1179 C CA  . SER A 149 ? 1.1177 1.2986 1.2547 0.0124  -0.0601 0.0280  147 SER A CA  
1180 C C   . SER A 149 ? 1.1484 1.3452 1.2989 0.0001  -0.0669 0.0220  147 SER A C   
1181 O O   . SER A 149 ? 1.1442 1.3367 1.2842 -0.0088 -0.0737 0.0155  147 SER A O   
1182 C CB  . SER A 149 ? 1.1684 1.3672 1.3168 0.0250  -0.0619 0.0373  147 SER A CB  
1183 O OG  . SER A 149 ? 1.1825 1.3687 1.3129 0.0350  -0.0612 0.0419  147 SER A OG  
1184 O OXT . SER A 149 ? 0.9122 1.1252 1.0842 -0.0015 -0.0647 0.0235  147 SER A OXT 
1185 N N   . GLU B 8   ? 0.9763 0.6320 0.6862 0.0451  0.0688  0.0814  6   GLU B N   
1186 C CA  . GLU B 8   ? 0.8727 0.5675 0.6101 0.0436  0.0551  0.0724  6   GLU B CA  
1187 C C   . GLU B 8   ? 0.8405 0.5485 0.5846 0.0316  0.0654  0.0605  6   GLU B C   
1188 O O   . GLU B 8   ? 0.7548 0.4933 0.5229 0.0295  0.0576  0.0524  6   GLU B O   
1189 C CB  . GLU B 8   ? 0.8519 0.5699 0.6287 0.0476  0.0523  0.0676  6   GLU B CB  
1190 C CG  . GLU B 8   ? 0.8835 0.6041 0.6820 0.0391  0.0713  0.0570  6   GLU B CG  
1191 C CD  . GLU B 8   ? 0.9228 0.6089 0.7059 0.0385  0.0886  0.0622  6   GLU B CD  
1192 O OE1 . GLU B 8   ? 0.9551 0.6358 0.7443 0.0282  0.1064  0.0542  6   GLU B OE1 
1193 O OE2 . GLU B 8   ? 0.9915 0.6552 0.7569 0.0484  0.0844  0.0747  6   GLU B OE2 
1194 N N   . PRO B 9   ? 0.7421 0.4270 0.4678 0.0240  0.0844  0.0594  7   PRO B N   
1195 C CA  . PRO B 9   ? 0.7239 0.4224 0.4653 0.0131  0.0973  0.0478  7   PRO B CA  
1196 C C   . PRO B 9   ? 0.7065 0.4148 0.4373 0.0098  0.0912  0.0445  7   PRO B C   
1197 O O   . PRO B 9   ? 0.6449 0.3739 0.3991 0.0032  0.0970  0.0347  7   PRO B O   
1198 C CB  . PRO B 9   ? 0.7658 0.4333 0.4919 0.0068  0.1212  0.0489  7   PRO B CB  
1199 C CG  . PRO B 9   ? 0.7862 0.4294 0.4996 0.0141  0.1218  0.0589  7   PRO B CG  
1200 C CD  . PRO B 9   ? 0.8069 0.4529 0.5047 0.0254  0.0979  0.0684  7   PRO B CD  
1201 N N   . GLU B 10  ? 0.7390 0.4331 0.4378 0.0161  0.0771  0.0537  8   GLU B N   
1202 C CA  . GLU B 10  ? 0.7203 0.4200 0.4026 0.0160  0.0640  0.0535  8   GLU B CA  
1203 C C   . GLU B 10  ? 0.6381 0.3703 0.3456 0.0210  0.0425  0.0516  8   GLU B C   
1204 O O   . GLU B 10  ? 0.6274 0.3662 0.3248 0.0190  0.0333  0.0494  8   GLU B O   
1205 C CB  . GLU B 10  ? 0.8193 0.4852 0.4511 0.0194  0.0574  0.0646  8   GLU B CB  
1206 C CG  . GLU B 10  ? 0.9462 0.5719 0.5417 0.0154  0.0780  0.0691  8   GLU B CG  
1207 C CD  . GLU B 10  ? 1.1230 0.7147 0.6679 0.0220  0.0659  0.0830  8   GLU B CD  
1208 O OE1 . GLU B 10  ? 1.1829 0.7551 0.6873 0.0186  0.0635  0.0844  8   GLU B OE1 
1209 O OE2 . GLU B 10  ? 1.1599 0.7438 0.7051 0.0308  0.0583  0.0927  8   GLU B OE2 
1210 N N   . THR B 11  ? 0.5435 0.2942 0.2814 0.0270  0.0352  0.0520  9   THR B N   
1211 C CA  . THR B 11  ? 0.4646 0.2459 0.2250 0.0296  0.0180  0.0486  9   THR B CA  
1212 C C   . THR B 11  ? 0.3971 0.2005 0.1775 0.0219  0.0240  0.0372  9   THR B C   
1213 O O   . THR B 11  ? 0.3710 0.1740 0.1617 0.0159  0.0403  0.0313  9   THR B O   
1214 C CB  . THR B 11  ? 0.4549 0.2523 0.2459 0.0368  0.0120  0.0497  9   THR B CB  
1215 O OG1 . THR B 11  ? 0.4176 0.2181 0.2290 0.0327  0.0283  0.0431  9   THR B OG1 
1216 C CG2 . THR B 11  ? 0.4858 0.2635 0.2614 0.0466  0.0037  0.0623  9   THR B CG2 
1217 N N   . LEU B 12  ? 0.3477 0.1728 0.1392 0.0226  0.0102  0.0344  10  LEU B N   
1218 C CA  . LEU B 12  ? 0.3453 0.1937 0.1596 0.0174  0.0133  0.0249  10  LEU B CA  
1219 C C   . LEU B 12  ? 0.2918 0.1561 0.1374 0.0168  0.0210  0.0195  10  LEU B C   
1220 O O   . LEU B 12  ? 0.2762 0.1490 0.1344 0.0111  0.0306  0.0127  10  LEU B O   
1221 C CB  . LEU B 12  ? 0.3399 0.2076 0.1625 0.0191  -0.0030 0.0237  10  LEU B CB  
1222 C CG  . LEU B 12  ? 0.3651 0.2205 0.1582 0.0160  -0.0099 0.0249  10  LEU B CG  
1223 C CD1 . LEU B 12  ? 0.3963 0.2744 0.2053 0.0149  -0.0219 0.0204  10  LEU B CD1 
1224 C CD2 . LEU B 12  ? 0.3469 0.1850 0.1209 0.0089  0.0070  0.0211  10  LEU B CD2 
1225 N N   . GLU B 13  ? 0.2733 0.1379 0.1290 0.0227  0.0177  0.0230  11  GLU B N   
1226 C CA  . GLU B 13  ? 0.2658 0.1422 0.1471 0.0217  0.0245  0.0174  11  GLU B CA  
1227 C C   . GLU B 13  ? 0.2607 0.1238 0.1398 0.0155  0.0408  0.0142  11  GLU B C   
1228 O O   . GLU B 13  ? 0.2445 0.1205 0.1407 0.0095  0.0471  0.0063  11  GLU B O   
1229 C CB  . GLU B 13  ? 0.2494 0.1254 0.1406 0.0296  0.0194  0.0218  11  GLU B CB  
1230 C CG  . GLU B 13  ? 0.2506 0.1469 0.1576 0.0347  0.0058  0.0222  11  GLU B CG  
1231 C CD  . GLU B 13  ? 0.3037 0.1943 0.1967 0.0407  -0.0084 0.0311  11  GLU B CD  
1232 O OE1 . GLU B 13  ? 0.3000 0.2052 0.2100 0.0463  -0.0193 0.0329  11  GLU B OE1 
1233 O OE2 . GLU B 13  ? 0.2962 0.1667 0.1614 0.0396  -0.0084 0.0361  11  GLU B OE2 
1234 N N   . ALA B 14  ? 0.2842 0.1212 0.1420 0.0165  0.0476  0.0205  12  ALA B N   
1235 C CA  . ALA B 14  ? 0.2987 0.1222 0.1566 0.0097  0.0650  0.0171  12  ALA B CA  
1236 C C   . ALA B 14  ? 0.2913 0.1199 0.1503 0.0020  0.0729  0.0115  12  ALA B C   
1237 O O   . ALA B 14  ? 0.2757 0.1128 0.1547 -0.0047 0.0828  0.0043  12  ALA B O   
1238 C CB  . ALA B 14  ? 0.3388 0.1296 0.1704 0.0124  0.0723  0.0260  12  ALA B CB  
1239 N N   . ARG B 15  ? 0.3044 0.1304 0.1452 0.0029  0.0673  0.0142  13  ARG B N   
1240 C CA  . ARG B 15  ? 0.3015 0.1306 0.1429 -0.0033 0.0756  0.0092  13  ARG B CA  
1241 C C   . ARG B 15  ? 0.2619 0.1211 0.1359 -0.0060 0.0728  0.0011  13  ARG B C   
1242 O O   . ARG B 15  ? 0.2523 0.1168 0.1423 -0.0116 0.0839  -0.0043 13  ARG B O   
1243 C CB  . ARG B 15  ? 0.3157 0.1336 0.1280 -0.0019 0.0696  0.0131  13  ARG B CB  
1244 C CG  . ARG B 15  ? 0.3614 0.1443 0.1350 -0.0013 0.0758  0.0207  13  ARG B CG  
1245 C CD  . ARG B 15  ? 0.3778 0.1469 0.1229 -0.0045 0.0778  0.0205  13  ARG B CD  
1246 N NE  . ARG B 15  ? 0.6257 0.3576 0.3318 -0.0067 0.0907  0.0257  13  ARG B NE  
1247 C CZ  . ARG B 15  ? 0.5738 0.2824 0.2425 -0.0025 0.0809  0.0347  13  ARG B CZ  
1248 N NH1 . ARG B 15  ? 0.5803 0.2519 0.2079 -0.0050 0.0931  0.0395  13  ARG B NH1 
1249 N NH2 . ARG B 15  ? 0.6695 0.3919 0.3427 0.0045  0.0584  0.0390  13  ARG B NH2 
1250 N N   . ILE B 16  ? 0.2569 0.1351 0.1410 -0.0017 0.0581  0.0006  14  ILE B N   
1251 C CA  . ILE B 16  ? 0.2210 0.1251 0.1315 -0.0036 0.0544  -0.0059 14  ILE B CA  
1252 C C   . ILE B 16  ? 0.2099 0.1228 0.1427 -0.0069 0.0592  -0.0111 14  ILE B C   
1253 O O   . ILE B 16  ? 0.2012 0.1279 0.1531 -0.0113 0.0624  -0.0165 14  ILE B O   
1254 C CB  . ILE B 16  ? 0.1940 0.1141 0.1087 0.0011  0.0397  -0.0053 14  ILE B CB  
1255 C CG1 . ILE B 16  ? 0.1714 0.1126 0.1053 -0.0011 0.0378  -0.0107 14  ILE B CG1 
1256 C CG2 . ILE B 16  ? 0.1936 0.1180 0.1165 0.0053  0.0338  -0.0043 14  ILE B CG2 
1257 C CD1 . ILE B 16  ? 0.2058 0.1447 0.1365 -0.0043 0.0444  -0.0120 14  ILE B CD1 
1258 N N   . ASN B 17  ? 0.2115 0.1127 0.1404 -0.0055 0.0614  -0.0092 15  ASN B N   
1259 C CA  . ASN B 17  ? 0.2056 0.1112 0.1526 -0.0101 0.0667  -0.0151 15  ASN B CA  
1260 C C   . ASN B 17  ? 0.2268 0.1282 0.1831 -0.0179 0.0801  -0.0190 15  ASN B C   
1261 O O   . ASN B 17  ? 0.2008 0.1178 0.1799 -0.0233 0.0805  -0.0260 15  ASN B O   
1262 C CB  . ASN B 17  ? 0.2335 0.1249 0.1739 -0.0066 0.0675  -0.0122 15  ASN B CB  
1263 C CG  . ASN B 17  ? 0.2086 0.1099 0.1505 0.0005  0.0555  -0.0104 15  ASN B CG  
1264 O OD1 . ASN B 17  ? 0.1880 0.1084 0.1388 0.0009  0.0474  -0.0132 15  ASN B OD1 
1265 N ND2 . ASN B 17  ? 0.2218 0.1094 0.1567 0.0062  0.0554  -0.0055 15  ASN B ND2 
1266 N N   . ARG B 18  ? 0.2501 0.1314 0.1892 -0.0186 0.0904  -0.0146 16  ARG B N   
1267 C CA  . ARG B 18  ? 0.2726 0.1494 0.2224 -0.0260 0.1058  -0.0181 16  ARG B CA  
1268 C C   . ARG B 18  ? 0.2362 0.1342 0.2045 -0.0278 0.1038  -0.0222 16  ARG B C   
1269 O O   . ARG B 18  ? 0.2574 0.1689 0.2533 -0.0336 0.1089  -0.0282 16  ARG B O   
1270 C CB  . ARG B 18  ? 0.2975 0.1433 0.2185 -0.0260 0.1191  -0.0118 16  ARG B CB  
1271 C CG  . ARG B 18  ? 0.4867 0.3132 0.4096 -0.0318 0.1362  -0.0126 16  ARG B CG  
1272 C CD  . ARG B 18  ? 0.4139 0.2064 0.3031 -0.0316 0.1504  -0.0055 16  ARG B CD  
1273 N NE  . ARG B 18  ? 0.7278 0.4962 0.5894 -0.0260 0.1476  0.0028  16  ARG B NE  
1274 C CZ  . ARG B 18  ? 0.7729 0.5302 0.6041 -0.0179 0.1356  0.0112  16  ARG B CZ  
1275 N NH1 . ARG B 18  ? 0.7594 0.4970 0.5712 -0.0119 0.1321  0.0192  16  ARG B NH1 
1276 N NH2 . ARG B 18  ? 0.7140 0.4780 0.5338 -0.0161 0.1277  0.0118  16  ARG B NH2 
1277 N N   . ALA B 19  ? 0.2176 0.1159 0.1707 -0.0231 0.0977  -0.0186 17  ALA B N   
1278 C CA  . ALA B 19  ? 0.2050 0.1185 0.1719 -0.0237 0.0976  -0.0213 17  ALA B CA  
1279 C C   . ALA B 19  ? 0.1896 0.1321 0.1861 -0.0239 0.0867  -0.0261 17  ALA B C   
1280 O O   . ALA B 19  ? 0.1702 0.1266 0.1858 -0.0248 0.0881  -0.0284 17  ALA B O   
1281 C CB  . ALA B 19  ? 0.2268 0.1330 0.1689 -0.0192 0.0920  -0.0171 17  ALA B CB  
1282 N N   . THR B 20  ? 0.1710 0.1211 0.1694 -0.0224 0.0758  -0.0271 18  THR B N   
1283 C CA  . THR B 20  ? 0.1539 0.1277 0.1722 -0.0224 0.0643  -0.0310 18  THR B CA  
1284 C C   . THR B 20  ? 0.1544 0.1340 0.1875 -0.0275 0.0627  -0.0366 18  THR B C   
1285 O O   . THR B 20  ? 0.1446 0.1397 0.1874 -0.0279 0.0521  -0.0400 18  THR B O   
1286 C CB  . THR B 20  ? 0.1395 0.1190 0.1456 -0.0163 0.0518  -0.0283 18  THR B CB  
1287 O OG1 . THR B 20  ? 0.1460 0.1153 0.1383 -0.0139 0.0490  -0.0265 18  THR B OG1 
1288 C CG2 . THR B 20  ? 0.1425 0.1170 0.1353 -0.0128 0.0525  -0.0242 18  THR B CG2 
1289 N N   . ASN B 21  ? 0.1601 0.1249 0.1929 -0.0320 0.0741  -0.0378 19  ASN B N   
1290 C CA  . ASN B 21  ? 0.1747 0.1413 0.2198 -0.0382 0.0743  -0.0440 19  ASN B CA  
1291 C C   . ASN B 21  ? 0.1563 0.1467 0.2305 -0.0436 0.0676  -0.0505 19  ASN B C   
1292 O O   . ASN B 21  ? 0.1461 0.1450 0.2397 -0.0459 0.0728  -0.0510 19  ASN B O   
1293 C CB  . ASN B 21  ? 0.1767 0.1226 0.2194 -0.0431 0.0907  -0.0439 19  ASN B CB  
1294 C CG  . ASN B 21  ? 0.2082 0.1487 0.2573 -0.0493 0.0927  -0.0498 19  ASN B CG  
1295 O OD1 . ASN B 21  ? 0.2362 0.1919 0.2974 -0.0525 0.0825  -0.0562 19  ASN B OD1 
1296 N ND2 . ASN B 21  ? 0.3195 0.2383 0.3634 -0.0529 0.1079  -0.0489 19  ASN B ND2 
1297 N N   . PRO B 22  ? 0.1711 0.1724 0.2480 -0.0450 0.0553  -0.0550 20  PRO B N   
1298 C CA  . PRO B 22  ? 0.1625 0.1860 0.2644 -0.0501 0.0457  -0.0606 20  PRO B CA  
1299 C C   . PRO B 22  ? 0.1978 0.2250 0.3261 -0.0603 0.0522  -0.0675 20  PRO B C   
1300 O O   . PRO B 22  ? 0.1690 0.2169 0.3238 -0.0644 0.0440  -0.0714 20  PRO B O   
1301 C CB  . PRO B 22  ? 0.1865 0.2135 0.2763 -0.0501 0.0327  -0.0641 20  PRO B CB  
1302 C CG  . PRO B 22  ? 0.2186 0.2241 0.2857 -0.0480 0.0399  -0.0630 20  PRO B CG  
1303 C CD  . PRO B 22  ? 0.1668 0.1600 0.2234 -0.0417 0.0496  -0.0549 20  PRO B CD  
1304 N N   . LEU B 23  ? 0.1657 0.1730 0.2886 -0.0640 0.0672  -0.0681 21  LEU B N   
1305 C CA  . LEU B 23  ? 0.2158 0.2238 0.3646 -0.0743 0.0773  -0.0743 21  LEU B CA  
1306 C C   . LEU B 23  ? 0.2164 0.2241 0.3810 -0.0740 0.0917  -0.0707 21  LEU B C   
1307 O O   . LEU B 23  ? 0.2478 0.2597 0.4408 -0.0824 0.1014  -0.0757 21  LEU B O   
1308 C CB  . LEU B 23  ? 0.2499 0.2330 0.3842 -0.0789 0.0890  -0.0766 21  LEU B CB  
1309 C CG  . LEU B 23  ? 0.3119 0.2910 0.4332 -0.0812 0.0796  -0.0821 21  LEU B CG  
1310 C CD1 . LEU B 23  ? 0.3150 0.2685 0.4284 -0.0865 0.0945  -0.0846 21  LEU B CD1 
1311 C CD2 . LEU B 23  ? 0.2405 0.2430 0.3826 -0.0888 0.0638  -0.0913 21  LEU B CD2 
1312 N N   . ASN B 24  ? 0.2384 0.2394 0.3846 -0.0650 0.0946  -0.0627 22  ASN B N   
1313 C CA  . ASN B 24  ? 0.2347 0.2325 0.3916 -0.0645 0.1097  -0.0597 22  ASN B CA  
1314 C C   . ASN B 24  ? 0.1998 0.2248 0.4013 -0.0687 0.1068  -0.0644 22  ASN B C   
1315 O O   . ASN B 24  ? 0.1822 0.2298 0.3958 -0.0657 0.0891  -0.0650 22  ASN B O   
1316 C CB  . ASN B 24  ? 0.2125 0.2029 0.3441 -0.0548 0.1092  -0.0519 22  ASN B CB  
1317 C CG  . ASN B 24  ? 0.2004 0.1615 0.2918 -0.0511 0.1162  -0.0462 22  ASN B CG  
1318 O OD1 . ASN B 24  ? 0.2459 0.1881 0.3286 -0.0552 0.1266  -0.0466 22  ASN B OD1 
1319 N ND2 . ASN B 24  ? 0.1796 0.1359 0.2471 -0.0433 0.1108  -0.0404 22  ASN B ND2 
1320 N N   . LYS B 25  ? 0.2856 0.3078 0.5117 -0.0750 0.1246  -0.0670 23  LYS B N   
1321 C CA  . LYS B 25  ? 0.3156 0.3653 0.5910 -0.0791 0.1228  -0.0714 23  LYS B CA  
1322 C C   . LYS B 25  ? 0.2970 0.3563 0.5815 -0.0706 0.1242  -0.0660 23  LYS B C   
1323 O O   . LYS B 25  ? 0.3076 0.3934 0.6320 -0.0704 0.1169  -0.0677 23  LYS B O   
1324 C CB  . LYS B 25  ? 0.3148 0.3595 0.6192 -0.0897 0.1430  -0.0768 23  LYS B CB  
1325 C CG  . LYS B 25  ? 0.3633 0.4054 0.6710 -0.0999 0.1390  -0.0843 23  LYS B CG  
1326 C CD  . LYS B 25  ? 0.4679 0.5021 0.8033 -0.1113 0.1613  -0.0898 23  LYS B CD  
1327 C CE  . LYS B 25  ? 0.6037 0.6422 0.9521 -0.1230 0.1538  -0.0993 23  LYS B CE  
1328 N NZ  . LYS B 25  ? 0.6901 0.7530 1.0973 -0.1345 0.1569  -0.1080 23  LYS B NZ  
1329 N N   . GLU B 26  ? 0.2812 0.3174 0.5300 -0.0642 0.1347  -0.0598 24  GLU B N   
1330 C CA  . GLU B 26  ? 0.2908 0.3296 0.5409 -0.0565 0.1387  -0.0551 24  GLU B CA  
1331 C C   . GLU B 26  ? 0.2693 0.2807 0.4679 -0.0507 0.1425  -0.0493 24  GLU B C   
1332 O O   . GLU B 26  ? 0.2812 0.2733 0.4485 -0.0523 0.1428  -0.0483 24  GLU B O   
1333 C CB  . GLU B 26  ? 0.3376 0.3756 0.6200 -0.0599 0.1619  -0.0568 24  GLU B CB  
1334 C CG  . GLU B 26  ? 0.3296 0.3338 0.5869 -0.0647 0.1877  -0.0564 24  GLU B CG  
1335 C CD  . GLU B 26  ? 0.4529 0.4578 0.7488 -0.0706 0.2123  -0.0599 24  GLU B CD  
1336 O OE1 . GLU B 26  ? 0.4659 0.4454 0.7429 -0.0698 0.2355  -0.0576 24  GLU B OE1 
1337 O OE2 . GLU B 26  ? 0.5976 0.6262 0.9411 -0.0770 0.2096  -0.0656 24  GLU B OE2 
1338 N N   . LEU B 27  ? 0.2418 0.2523 0.4324 -0.0439 0.1435  -0.0455 25  LEU B N   
1339 C CA  . LEU B 27  ? 0.2374 0.2251 0.3811 -0.0389 0.1435  -0.0406 25  LEU B CA  
1340 C C   . LEU B 27  ? 0.3059 0.2614 0.4205 -0.0430 0.1623  -0.0396 25  LEU B C   
1341 O O   . LEU B 27  ? 0.3231 0.2704 0.4532 -0.0480 0.1826  -0.0418 25  LEU B O   
1342 C CB  . LEU B 27  ? 0.2232 0.2116 0.3656 -0.0330 0.1464  -0.0381 25  LEU B CB  
1343 C CG  . LEU B 27  ? 0.2197 0.2332 0.3787 -0.0269 0.1273  -0.0368 25  LEU B CG  
1344 C CD1 . LEU B 27  ? 0.2051 0.2160 0.3674 -0.0218 0.1356  -0.0347 25  LEU B CD1 
1345 C CD2 . LEU B 27  ? 0.1988 0.2110 0.3274 -0.0241 0.1087  -0.0346 25  LEU B CD2 
1346 N N   . ASP B 28  ? 0.3151 0.2534 0.3909 -0.0412 0.1551  -0.0362 26  ASP B N   
1347 C CA  . ASP B 28  ? 0.3294 0.2350 0.3725 -0.0440 0.1699  -0.0335 26  ASP B CA  
1348 C C   . ASP B 28  ? 0.3322 0.2140 0.3346 -0.0402 0.1744  -0.0290 26  ASP B C   
1349 O O   . ASP B 28  ? 0.3303 0.2060 0.3029 -0.0357 0.1601  -0.0251 26  ASP B O   
1350 C CB  . ASP B 28  ? 0.3075 0.2071 0.3346 -0.0441 0.1594  -0.0319 26  ASP B CB  
1351 C CG  . ASP B 28  ? 0.4125 0.2761 0.4015 -0.0451 0.1723  -0.0271 26  ASP B CG  
1352 O OD1 . ASP B 28  ? 0.3851 0.2269 0.3583 -0.0470 0.1905  -0.0256 26  ASP B OD1 
1353 O OD2 . ASP B 28  ? 0.4668 0.3221 0.4402 -0.0437 0.1646  -0.0245 26  ASP B OD2 
1354 N N   . TRP B 29  ? 0.3101 0.1798 0.3132 -0.0422 0.1938  -0.0301 27  TRP B N   
1355 C CA  . TRP B 29  ? 0.3544 0.2077 0.3251 -0.0389 0.1955  -0.0279 27  TRP B CA  
1356 C C   . TRP B 29  ? 0.4055 0.2231 0.3220 -0.0394 0.1984  -0.0229 27  TRP B C   
1357 O O   . TRP B 29  ? 0.4095 0.2181 0.2936 -0.0359 0.1868  -0.0202 27  TRP B O   
1358 C CB  . TRP B 29  ? 0.3462 0.1967 0.3351 -0.0407 0.2166  -0.0313 27  TRP B CB  
1359 C CG  . TRP B 29  ? 0.3146 0.1972 0.3432 -0.0365 0.2071  -0.0336 27  TRP B CG  
1360 C CD1 . TRP B 29  ? 0.3587 0.2675 0.4400 -0.0372 0.2108  -0.0368 27  TRP B CD1 
1361 C CD2 . TRP B 29  ? 0.2968 0.1894 0.3161 -0.0309 0.1900  -0.0322 27  TRP B CD2 
1362 N NE1 . TRP B 29  ? 0.2716 0.2038 0.3741 -0.0314 0.1975  -0.0365 27  TRP B NE1 
1363 C CE2 . TRP B 29  ? 0.2388 0.1610 0.3036 -0.0277 0.1853  -0.0339 27  TRP B CE2 
1364 C CE3 . TRP B 29  ? 0.3200 0.1990 0.2982 -0.0285 0.1783  -0.0297 27  TRP B CE3 
1365 C CZ2 . TRP B 29  ? 0.2221 0.1576 0.2893 -0.0220 0.1713  -0.0326 27  TRP B CZ2 
1366 C CZ3 . TRP B 29  ? 0.2747 0.1681 0.2581 -0.0239 0.1655  -0.0296 27  TRP B CZ3 
1367 C CH2 . TRP B 29  ? 0.2735 0.1948 0.3002 -0.0206 0.1616  -0.0307 27  TRP B CH2 
1368 N N   . ALA B 30  ? 0.3975 0.1966 0.3060 -0.0434 0.2111  -0.0215 28  ALA B N   
1369 C CA  . ALA B 30  ? 0.4374 0.2030 0.2954 -0.0428 0.2110  -0.0151 28  ALA B CA  
1370 C C   . ALA B 30  ? 0.4505 0.2261 0.2946 -0.0366 0.1836  -0.0109 28  ALA B C   
1371 O O   . ALA B 30  ? 0.4331 0.1908 0.2370 -0.0335 0.1746  -0.0061 28  ALA B O   
1372 C CB  . ALA B 30  ? 0.5069 0.2539 0.3653 -0.0478 0.2285  -0.0139 28  ALA B CB  
1373 N N   . SER B 31  ? 0.3961 0.2005 0.2741 -0.0351 0.1703  -0.0131 29  SER B N   
1374 C CA  . SER B 31  ? 0.3613 0.1759 0.2311 -0.0293 0.1472  -0.0097 29  SER B CA  
1375 C C   . SER B 31  ? 0.3441 0.1750 0.2127 -0.0252 0.1315  -0.0104 29  SER B C   
1376 O O   . SER B 31  ? 0.3403 0.1658 0.1845 -0.0210 0.1171  -0.0061 29  SER B O   
1377 C CB  . SER B 31  ? 0.3560 0.1918 0.2583 -0.0299 0.1405  -0.0126 29  SER B CB  
1378 O OG  . SER B 31  ? 0.4502 0.2666 0.3463 -0.0330 0.1522  -0.0109 29  SER B OG  
1379 N N   . ILE B 32  ? 0.3552 0.2036 0.2493 -0.0266 0.1355  -0.0153 30  ILE B N   
1380 C CA  . ILE B 32  ? 0.3268 0.1889 0.2208 -0.0232 0.1228  -0.0162 30  ILE B CA  
1381 C C   . ILE B 32  ? 0.3606 0.1973 0.2129 -0.0232 0.1240  -0.0137 30  ILE B C   
1382 O O   . ILE B 32  ? 0.3471 0.1846 0.1816 -0.0201 0.1077  -0.0113 30  ILE B O   
1383 C CB  . ILE B 32  ? 0.3111 0.1938 0.2405 -0.0239 0.1288  -0.0210 30  ILE B CB  
1384 C CG1 . ILE B 32  ? 0.2682 0.1789 0.2366 -0.0237 0.1212  -0.0234 30  ILE B CG1 
1385 C CG2 . ILE B 32  ? 0.2893 0.1782 0.2129 -0.0209 0.1205  -0.0214 30  ILE B CG2 
1386 C CD1 . ILE B 32  ? 0.2661 0.1950 0.2730 -0.0249 0.1291  -0.0272 30  ILE B CD1 
1387 N N   . ASN B 33  ? 0.4401 0.2529 0.2760 -0.0272 0.1439  -0.0146 31  ASN B N   
1388 C CA  . ASN B 33  ? 0.4445 0.2289 0.2359 -0.0286 0.1469  -0.0133 31  ASN B CA  
1389 C C   . ASN B 33  ? 0.4790 0.2425 0.2306 -0.0270 0.1355  -0.0066 31  ASN B C   
1390 O O   . ASN B 33  ? 0.4858 0.2398 0.2072 -0.0261 0.1225  -0.0048 31  ASN B O   
1391 C CB  . ASN B 33  ? 0.4914 0.2520 0.2738 -0.0337 0.1744  -0.0162 31  ASN B CB  
1392 C CG  . ASN B 33  ? 0.4879 0.2669 0.3071 -0.0341 0.1847  -0.0221 31  ASN B CG  
1393 O OD1 . ASN B 33  ? 0.4768 0.2556 0.3202 -0.0367 0.2053  -0.0248 31  ASN B OD1 
1394 N ND2 . ASN B 33  ? 0.4657 0.2564 0.2863 -0.0317 0.1728  -0.0240 31  ASN B ND2 
1395 N N   . GLY B 34  ? 0.4535 0.2135 0.2094 -0.0262 0.1375  -0.0029 32  GLY B N   
1396 C CA  . GLY B 34  ? 0.4803 0.2227 0.2042 -0.0228 0.1257  0.0048  32  GLY B CA  
1397 C C   . GLY B 34  ? 0.4370 0.1996 0.1660 -0.0171 0.0994  0.0071  32  GLY B C   
1398 O O   . GLY B 34  ? 0.4666 0.2149 0.1632 -0.0146 0.0860  0.0124  32  GLY B O   
1399 N N   . PHE B 35  ? 0.4224 0.2178 0.1923 -0.0152 0.0922  0.0033  33  PHE B N   
1400 C CA  . PHE B 35  ? 0.3809 0.1987 0.1623 -0.0106 0.0707  0.0038  33  PHE B CA  
1401 C C   . PHE B 35  ? 0.3849 0.2003 0.1472 -0.0116 0.0614  0.0026  33  PHE B C   
1402 O O   . PHE B 35  ? 0.4011 0.2155 0.1484 -0.0087 0.0444  0.0063  33  PHE B O   
1403 C CB  . PHE B 35  ? 0.3325 0.1822 0.1571 -0.0098 0.0684  -0.0011 33  PHE B CB  
1404 C CG  . PHE B 35  ? 0.2867 0.1575 0.1235 -0.0054 0.0497  -0.0006 33  PHE B CG  
1405 C CD1 . PHE B 35  ? 0.3028 0.1879 0.1477 -0.0060 0.0437  -0.0042 33  PHE B CD1 
1406 C CD2 . PHE B 35  ? 0.3248 0.2012 0.1687 -0.0009 0.0404  0.0029  33  PHE B CD2 
1407 C CE1 . PHE B 35  ? 0.2732 0.1766 0.1304 -0.0026 0.0286  -0.0039 33  PHE B CE1 
1408 C CE2 . PHE B 35  ? 0.2811 0.1760 0.1380 0.0031  0.0256  0.0031  33  PHE B CE2 
1409 C CZ  . PHE B 35  ? 0.2512 0.1612 0.1171 0.0018  0.0204  -0.0007 33  PHE B CZ  
1410 N N   . CYS B 36  ? 0.4046 0.2198 0.1698 -0.0157 0.0723  -0.0030 34  CYS B N   
1411 C CA  . CYS B 36  ? 0.4105 0.2214 0.1573 -0.0178 0.0651  -0.0056 34  CYS B CA  
1412 C C   . CYS B 36  ? 0.4515 0.2308 0.1490 -0.0199 0.0612  -0.0019 34  CYS B C   
1413 O O   . CYS B 36  ? 0.4754 0.2548 0.1571 -0.0200 0.0441  -0.0014 34  CYS B O   
1414 C CB  . CYS B 36  ? 0.4090 0.2220 0.1678 -0.0214 0.0803  -0.0121 34  CYS B CB  
1415 S SG  . CYS B 36  ? 0.4166 0.2659 0.2302 -0.0186 0.0817  -0.0155 34  CYS B SG  
1416 N N   . GLU B 37  ? 0.5363 0.2883 0.2096 -0.0217 0.0764  0.0009  35  GLU B N   
1417 C CA  . GLU B 37  ? 0.6208 0.3380 0.2414 -0.0236 0.0736  0.0055  35  GLU B CA  
1418 C C   . GLU B 37  ? 0.6317 0.3509 0.2413 -0.0179 0.0498  0.0136  35  GLU B C   
1419 O O   . GLU B 37  ? 0.6809 0.3861 0.2565 -0.0187 0.0345  0.0161  35  GLU B O   
1420 C CB  . GLU B 37  ? 0.6701 0.3565 0.2688 -0.0266 0.0980  0.0073  35  GLU B CB  
1421 C CG  . GLU B 37  ? 0.7920 0.4621 0.3802 -0.0333 0.1206  0.0001  35  GLU B CG  
1422 C CD  . GLU B 37  ? 0.9581 0.6163 0.5575 -0.0358 0.1491  -0.0009 35  GLU B CD  
1423 O OE1 . GLU B 37  ? 0.9531 0.6007 0.5472 -0.0343 0.1530  0.0051  35  GLU B OE1 
1424 O OE2 . GLU B 37  ? 0.9797 0.6368 0.5919 -0.0397 0.1688  -0.0075 35  GLU B OE2 
1425 N N   . GLN B 38  ? 0.5695 0.3067 0.2095 -0.0122 0.0460  0.0174  36  GLN B N   
1426 C CA  . GLN B 38  ? 0.5675 0.3069 0.2026 -0.0054 0.0257  0.0257  36  GLN B CA  
1427 C C   . GLN B 38  ? 0.5579 0.3248 0.2129 -0.0027 0.0026  0.0243  36  GLN B C   
1428 O O   . GLN B 38  ? 0.5462 0.3101 0.1872 0.0013  -0.0170 0.0306  36  GLN B O   
1429 C CB  . GLN B 38  ? 0.5766 0.3225 0.2366 -0.0005 0.0321  0.0296  36  GLN B CB  
1430 C CG  . GLN B 38  ? 0.5658 0.3282 0.2430 0.0077  0.0122  0.0355  36  GLN B CG  
1431 C CD  . GLN B 38  ? 0.7268 0.4633 0.3760 0.0133  0.0077  0.0466  36  GLN B CD  
1432 O OE1 . GLN B 38  ? 0.7481 0.4515 0.3544 0.0108  0.0141  0.0508  36  GLN B OE1 
1433 N NE2 . GLN B 38  ? 0.7861 0.5352 0.4587 0.0211  -0.0013 0.0517  36  GLN B NE2 
1434 N N   . LEU B 39  ? 0.5458 0.3400 0.2356 -0.0045 0.0043  0.0167  37  LEU B N   
1435 C CA  . LEU B 39  ? 0.5278 0.3477 0.2391 -0.0022 -0.0153 0.0155  37  LEU B CA  
1436 C C   . LEU B 39  ? 0.6358 0.4436 0.3159 -0.0065 -0.0287 0.0145  37  LEU B C   
1437 O O   . LEU B 39  ? 0.6448 0.4660 0.3322 -0.0044 -0.0492 0.0162  37  LEU B O   
1438 C CB  . LEU B 39  ? 0.4972 0.3457 0.2486 -0.0032 -0.0100 0.0084  37  LEU B CB  
1439 C CG  . LEU B 39  ? 0.4318 0.2817 0.1821 -0.0095 -0.0029 0.0006  37  LEU B CG  
1440 C CD1 . LEU B 39  ? 0.4697 0.3240 0.2121 -0.0122 -0.0194 -0.0016 37  LEU B CD1 
1441 C CD2 . LEU B 39  ? 0.3995 0.2726 0.1878 -0.0088 0.0065  -0.0038 37  LEU B CD2 
1442 N N   . ASN B 40  ? 0.7235 0.5056 0.3699 -0.0130 -0.0163 0.0111  38  ASN B N   
1443 C CA  . ASN B 40  ? 0.8972 0.6555 0.4987 -0.0178 -0.0271 0.0113  38  ASN B CA  
1444 C C   . ASN B 40  ? 0.9613 0.6942 0.5274 -0.0138 -0.0347 0.0216  38  ASN B C   
1445 O O   . ASN B 40  ? 1.0131 0.7132 0.5414 -0.0167 -0.0197 0.0235  38  ASN B O   
1446 C CB  . ASN B 40  ? 0.9161 0.6511 0.4911 -0.0262 -0.0074 0.0038  38  ASN B CB  
1447 C CG  . ASN B 40  ? 0.9733 0.7304 0.5819 -0.0294 0.0007  -0.0053 38  ASN B CG  
1448 O OD1 . ASN B 40  ? 0.9389 0.6886 0.5509 -0.0323 0.0228  -0.0101 38  ASN B OD1 
1449 N ND2 . ASN B 40  ? 0.9580 0.7411 0.5916 -0.0286 -0.0168 -0.0074 38  ASN B ND2 
1450 N N   . GLU B 41  ? 1.0764 0.8262 0.6622 -0.0059 -0.0532 0.0289  39  GLU B N   
1451 C CA  . GLU B 41  ? 1.1574 0.8896 0.7118 -0.0015 -0.0723 0.0391  39  GLU B CA  
1452 C C   . GLU B 41  ? 1.1503 0.9117 0.7445 0.0079  -0.0914 0.0450  39  GLU B C   
1453 O O   . GLU B 41  ? 1.1848 0.9503 0.7989 0.0154  -0.0850 0.0508  39  GLU B O   
1454 C CB  . GLU B 41  ? 1.1717 0.8688 0.6910 0.0006  -0.0574 0.0468  39  GLU B CB  
1455 C CG  . GLU B 41  ? 1.2561 0.9227 0.7379 -0.0085 -0.0348 0.0409  39  GLU B CG  
1456 C CD  . GLU B 41  ? 1.3185 0.9674 0.7982 -0.0076 -0.0080 0.0434  39  GLU B CD  
1457 O OE1 . GLU B 41  ? 1.3717 0.9974 0.8280 -0.0147 0.0144  0.0384  39  GLU B OE1 
1458 O OE2 . GLU B 41  ? 1.3444 1.0010 0.8456 -0.0001 -0.0086 0.0503  39  GLU B OE2 
1459 N N   . ASP B 42  ? 1.1083 0.8922 0.7203 0.0064  -0.1114 0.0416  40  ASP B N   
1460 C CA  . ASP B 42  ? 1.0996 0.9127 0.7522 0.0146  -0.1298 0.0462  40  ASP B CA  
1461 C C   . ASP B 42  ? 1.0935 0.9276 0.7614 0.0079  -0.1439 0.0379  40  ASP B C   
1462 O O   . ASP B 42  ? 1.1103 0.9361 0.7608 -0.0017 -0.1354 0.0289  40  ASP B O   
1463 C CB  . ASP B 42  ? 1.0587 0.8936 0.7571 0.0198  -0.1139 0.0447  40  ASP B CB  
1464 C CG  . ASP B 42  ? 1.0405 0.8836 0.7613 0.0315  -0.1226 0.0547  40  ASP B CG  
1465 O OD1 . ASP B 42  ? 0.9775 0.8227 0.6957 0.0365  -0.1455 0.0620  40  ASP B OD1 
1466 O OD2 . ASP B 42  ? 1.0818 0.9308 0.8261 0.0355  -0.1070 0.0547  40  ASP B OD2 
1467 N N   . PHE B 43  ? 1.1338 0.9956 0.8382 0.0129  -0.1631 0.0403  41  PHE B N   
1468 C CA  . PHE B 43  ? 1.0654 0.9548 0.8027 0.0070  -0.1679 0.0308  41  PHE B CA  
1469 C C   . PHE B 43  ? 0.9865 0.9025 0.7741 0.0121  -0.1542 0.0288  41  PHE B C   
1470 O O   . PHE B 43  ? 0.9621 0.8968 0.7753 0.0071  -0.1479 0.0203  41  PHE B O   
1471 C CB  . PHE B 43  ? 1.0939 0.9969 0.8393 0.0063  -0.1978 0.0325  41  PHE B CB  
1472 C CG  . PHE B 43  ? 1.1457 1.0312 0.8507 -0.0055 -0.2081 0.0261  41  PHE B CG  
1473 C CD1 . PHE B 43  ? 1.1851 1.0881 0.9091 -0.0149 -0.2128 0.0154  41  PHE B CD1 
1474 C CD2 . PHE B 43  ? 1.2167 1.0640 0.8623 -0.0087 -0.2044 0.0286  41  PHE B CD2 
1475 C CE1 . PHE B 43  ? 1.2057 1.0892 0.8906 -0.0270 -0.2177 0.0076  41  PHE B CE1 
1476 C CE2 . PHE B 43  ? 1.2312 1.0580 0.8355 -0.0207 -0.2087 0.0209  41  PHE B CE2 
1477 C CZ  . PHE B 43  ? 1.2197 1.0647 0.8437 -0.0300 -0.2157 0.0101  41  PHE B CZ  
1478 N N   . GLU B 44  ? 0.7118 0.6231 0.5054 0.0208  -0.1450 0.0358  42  GLU B N   
1479 C CA  . GLU B 44  ? 0.6476 0.5796 0.4826 0.0253  -0.1312 0.0337  42  GLU B CA  
1480 C C   . GLU B 44  ? 0.5578 0.4798 0.3851 0.0221  -0.1064 0.0290  42  GLU B C   
1481 O O   . GLU B 44  ? 0.4929 0.4307 0.3500 0.0238  -0.0948 0.0256  42  GLU B O   
1482 C CB  . GLU B 44  ? 0.6762 0.6144 0.5328 0.0370  -0.1377 0.0431  42  GLU B CB  
1483 C CG  . GLU B 44  ? 0.7596 0.7156 0.6380 0.0413  -0.1623 0.0475  42  GLU B CG  
1484 C CD  . GLU B 44  ? 0.8996 0.8353 0.7429 0.0442  -0.1821 0.0570  42  GLU B CD  
1485 O OE1 . GLU B 44  ? 1.0260 0.9632 0.8564 0.0385  -0.2011 0.0552  42  GLU B OE1 
1486 O OE2 . GLU B 44  ? 0.9395 0.8560 0.7663 0.0520  -0.1789 0.0663  42  GLU B OE2 
1487 N N   . GLY B 45  ? 0.4845 0.3809 0.2727 0.0167  -0.0986 0.0281  43  GLY B N   
1488 C CA  . GLY B 45  ? 0.4234 0.3111 0.2069 0.0133  -0.0756 0.0235  43  GLY B CA  
1489 C C   . GLY B 45  ? 0.3576 0.2659 0.1686 0.0090  -0.0665 0.0147  43  GLY B C   
1490 O O   . GLY B 45  ? 0.3119 0.2311 0.1462 0.0111  -0.0547 0.0129  43  GLY B O   
1491 N N   . PRO B 46  ? 0.3188 0.2303 0.1246 0.0025  -0.0716 0.0090  44  PRO B N   
1492 C CA  . PRO B 46  ? 0.2833 0.2101 0.1114 -0.0012 -0.0612 0.0015  44  PRO B CA  
1493 C C   . PRO B 46  ? 0.2640 0.2169 0.1324 0.0035  -0.0613 0.0012  44  PRO B C   
1494 O O   . PRO B 46  ? 0.2396 0.1993 0.1225 0.0037  -0.0482 -0.0016 44  PRO B O   
1495 C CB  . PRO B 46  ? 0.3117 0.2365 0.1279 -0.0085 -0.0698 -0.0037 44  PRO B CB  
1496 C CG  . PRO B 46  ? 0.3466 0.2443 0.1198 -0.0109 -0.0762 -0.0007 44  PRO B CG  
1497 C CD  . PRO B 46  ? 0.3598 0.2547 0.1321 -0.0028 -0.0836 0.0086  44  PRO B CD  
1498 N N   . PRO B 47  ? 0.2533 0.2206 0.1401 0.0070  -0.0758 0.0039  45  PRO B N   
1499 C CA  . PRO B 47  ? 0.2287 0.2181 0.1520 0.0108  -0.0727 0.0029  45  PRO B CA  
1500 C C   . PRO B 47  ? 0.2090 0.1971 0.1404 0.0168  -0.0624 0.0058  45  PRO B C   
1501 O O   . PRO B 47  ? 0.2171 0.2161 0.1677 0.0174  -0.0529 0.0027  45  PRO B O   
1502 C CB  . PRO B 47  ? 0.2647 0.2676 0.2063 0.0137  -0.0899 0.0057  45  PRO B CB  
1503 C CG  . PRO B 47  ? 0.2867 0.2777 0.2017 0.0090  -0.1041 0.0062  45  PRO B CG  
1504 C CD  . PRO B 47  ? 0.2822 0.2473 0.1587 0.0065  -0.0954 0.0068  45  PRO B CD  
1505 N N   . LEU B 48  ? 0.2172 0.1894 0.1311 0.0205  -0.0637 0.0116  46  LEU B N   
1506 C CA  . LEU B 48  ? 0.2238 0.1908 0.1419 0.0244  -0.0523 0.0134  46  LEU B CA  
1507 C C   . LEU B 48  ? 0.2178 0.1798 0.1296 0.0193  -0.0367 0.0082  46  LEU B C   
1508 O O   . LEU B 48  ? 0.1735 0.1425 0.1007 0.0200  -0.0276 0.0055  46  LEU B O   
1509 C CB  . LEU B 48  ? 0.2266 0.1742 0.1245 0.0291  -0.0566 0.0213  46  LEU B CB  
1510 C CG  . LEU B 48  ? 0.2615 0.1992 0.1607 0.0326  -0.0445 0.0235  46  LEU B CG  
1511 C CD1 . LEU B 48  ? 0.2781 0.2322 0.2087 0.0364  -0.0402 0.0211  46  LEU B CD1 
1512 C CD2 . LEU B 48  ? 0.2862 0.2037 0.1657 0.0383  -0.0503 0.0329  46  LEU B CD2 
1513 N N   . ALA B 49  ? 0.2041 0.1538 0.0935 0.0140  -0.0339 0.0065  47  ALA B N   
1514 C CA  . ALA B 49  ? 0.1961 0.1418 0.0828 0.0096  -0.0195 0.0020  47  ALA B CA  
1515 C C   . ALA B 49  ? 0.1651 0.1301 0.0759 0.0084  -0.0157 -0.0031 47  ALA B C   
1516 O O   . ALA B 49  ? 0.1516 0.1208 0.0729 0.0079  -0.0066 -0.0054 47  ALA B O   
1517 C CB  . ALA B 49  ? 0.2153 0.1442 0.0755 0.0044  -0.0164 0.0007  47  ALA B CB  
1518 N N   . THR B 50  ? 0.1666 0.1429 0.0857 0.0075  -0.0232 -0.0048 48  THR B N   
1519 C CA  . THR B 50  ? 0.1461 0.1376 0.0843 0.0065  -0.0192 -0.0087 48  THR B CA  
1520 C C   . THR B 50  ? 0.1306 0.1331 0.0877 0.0104  -0.0175 -0.0085 48  THR B C   
1521 O O   . THR B 50  ? 0.1098 0.1186 0.0755 0.0096  -0.0111 -0.0111 48  THR B O   
1522 C CB  . THR B 50  ? 0.1516 0.1504 0.0942 0.0038  -0.0256 -0.0109 48  THR B CB  
1523 O OG1 . THR B 50  ? 0.1594 0.1638 0.1085 0.0059  -0.0373 -0.0086 48  THR B OG1 
1524 C CG2 . THR B 50  ? 0.1625 0.1479 0.0845 -0.0014 -0.0241 -0.0131 48  THR B CG2 
1525 N N   . ARG B 51  ? 0.1429 0.1468 0.1057 0.0146  -0.0233 -0.0054 49  ARG B N   
1526 C CA  . ARG B 51  ? 0.1387 0.1498 0.1176 0.0182  -0.0198 -0.0057 49  ARG B CA  
1527 C C   . ARG B 51  ? 0.1219 0.1253 0.0957 0.0176  -0.0112 -0.0069 49  ARG B C   
1528 O O   . ARG B 51  ? 0.1333 0.1421 0.1156 0.0170  -0.0058 -0.0102 49  ARG B O   
1529 C CB  . ARG B 51  ? 0.1458 0.1582 0.1337 0.0238  -0.0269 -0.0015 49  ARG B CB  
1530 C CG  . ARG B 51  ? 0.2193 0.2458 0.2246 0.0244  -0.0341 -0.0018 49  ARG B CG  
1531 C CD  . ARG B 51  ? 0.2748 0.3052 0.2954 0.0310  -0.0413 0.0028  49  ARG B CD  
1532 N NE  . ARG B 51  ? 0.4382 0.4608 0.4603 0.0361  -0.0345 0.0048  49  ARG B NE  
1533 C CZ  . ARG B 51  ? 0.4980 0.5094 0.5127 0.0411  -0.0389 0.0108  49  ARG B CZ  
1534 N NH1 . ARG B 51  ? 0.5971 0.6007 0.6153 0.0453  -0.0307 0.0119  49  ARG B NH1 
1535 N NH2 . ARG B 51  ? 0.6209 0.6272 0.6231 0.0418  -0.0514 0.0158  49  ARG B NH2 
1536 N N   . LEU B 52  ? 0.1261 0.1155 0.0847 0.0171  -0.0098 -0.0044 50  LEU B N   
1537 C CA  . LEU B 52  ? 0.1308 0.1123 0.0866 0.0153  -0.0009 -0.0059 50  LEU B CA  
1538 C C   . LEU B 52  ? 0.1265 0.1144 0.0865 0.0106  0.0047  -0.0106 50  LEU B C   
1539 O O   . LEU B 52  ? 0.1149 0.1067 0.0831 0.0089  0.0091  -0.0139 50  LEU B O   
1540 C CB  . LEU B 52  ? 0.1585 0.1213 0.0953 0.0152  0.0010  -0.0018 50  LEU B CB  
1541 C CG  . LEU B 52  ? 0.1799 0.1335 0.1116 0.0210  -0.0046 0.0043  50  LEU B CG  
1542 C CD1 . LEU B 52  ? 0.2018 0.1339 0.1088 0.0206  -0.0031 0.0092  50  LEU B CD1 
1543 C CD2 . LEU B 52  ? 0.1734 0.1266 0.1176 0.0235  0.0013  0.0033  50  LEU B CD2 
1544 N N   . LEU B 53  ? 0.1343 0.1225 0.0884 0.0084  0.0040  -0.0108 51  LEU B N   
1545 C CA  . LEU B 53  ? 0.1125 0.1070 0.0730 0.0054  0.0088  -0.0140 51  LEU B CA  
1546 C C   . LEU B 53  ? 0.0988 0.1077 0.0728 0.0061  0.0064  -0.0162 51  LEU B C   
1547 O O   . LEU B 53  ? 0.0959 0.1101 0.0775 0.0046  0.0091  -0.0185 51  LEU B O   
1548 C CB  . LEU B 53  ? 0.1311 0.1210 0.0826 0.0035  0.0097  -0.0138 51  LEU B CB  
1549 C CG  . LEU B 53  ? 0.1284 0.1011 0.0636 0.0013  0.0162  -0.0127 51  LEU B CG  
1550 C CD1 . LEU B 53  ? 0.1410 0.1046 0.0606 -0.0009 0.0161  -0.0130 51  LEU B CD1 
1551 C CD2 . LEU B 53  ? 0.1421 0.1149 0.0871 -0.0010 0.0265  -0.0149 51  LEU B CD2 
1552 N N   . ALA B 54  ? 0.1035 0.1179 0.0802 0.0082  0.0014  -0.0155 52  ALA B N   
1553 C CA  . ALA B 54  ? 0.0893 0.1138 0.0748 0.0086  0.0011  -0.0172 52  ALA B CA  
1554 C C   . ALA B 54  ? 0.0994 0.1249 0.0881 0.0084  0.0034  -0.0195 52  ALA B C   
1555 O O   . ALA B 54  ? 0.0841 0.1147 0.0750 0.0072  0.0037  -0.0214 52  ALA B O   
1556 C CB  . ALA B 54  ? 0.0874 0.1165 0.0778 0.0105  -0.0024 -0.0163 52  ALA B CB  
1557 N N   . HIS B 55  ? 0.0808 0.1001 0.0685 0.0098  0.0043  -0.0192 53  HIS B N   
1558 C CA  . HIS B 55  ? 0.0850 0.1024 0.0743 0.0087  0.0074  -0.0225 53  HIS B CA  
1559 C C   . HIS B 55  ? 0.0876 0.1048 0.0773 0.0044  0.0091  -0.0253 53  HIS B C   
1560 O O   . HIS B 55  ? 0.0887 0.1097 0.0799 0.0019  0.0085  -0.0289 53  HIS B O   
1561 C CB  . HIS B 55  ? 0.0935 0.1022 0.0827 0.0116  0.0094  -0.0213 53  HIS B CB  
1562 C CG  . HIS B 55  ? 0.0979 0.1019 0.0877 0.0100  0.0142  -0.0257 53  HIS B CG  
1563 N ND1 . HIS B 55  ? 0.1105 0.1044 0.0980 0.0080  0.0183  -0.0270 53  HIS B ND1 
1564 C CD2 . HIS B 55  ? 0.1028 0.1084 0.0931 0.0095  0.0165  -0.0296 53  HIS B CD2 
1565 C CE1 . HIS B 55  ? 0.1146 0.1050 0.1020 0.0058  0.0221  -0.0323 53  HIS B CE1 
1566 N NE2 . HIS B 55  ? 0.1126 0.1092 0.1004 0.0069  0.0212  -0.0339 53  HIS B NE2 
1567 N N   . LYS B 56  ? 0.1009 0.1134 0.0893 0.0031  0.0113  -0.0237 54  LYS B N   
1568 C CA  . LYS B 56  ? 0.1089 0.1229 0.1035 -0.0012 0.0142  -0.0265 54  LYS B CA  
1569 C C   . LYS B 56  ? 0.0886 0.1149 0.0909 -0.0020 0.0105  -0.0273 54  LYS B C   
1570 O O   . LYS B 56  ? 0.0844 0.1172 0.0947 -0.0050 0.0084  -0.0304 54  LYS B O   
1571 C CB  . LYS B 56  ? 0.1143 0.1185 0.1053 -0.0023 0.0202  -0.0243 54  LYS B CB  
1572 C CG  . LYS B 56  ? 0.1267 0.1159 0.1075 -0.0010 0.0236  -0.0220 54  LYS B CG  
1573 C CD  . LYS B 56  ? 0.1448 0.1293 0.1307 -0.0043 0.0281  -0.0257 54  LYS B CD  
1574 C CE  . LYS B 56  ? 0.1610 0.1273 0.1358 -0.0023 0.0331  -0.0219 54  LYS B CE  
1575 N NZ  . LYS B 56  ? 0.1707 0.1300 0.1496 -0.0051 0.0382  -0.0256 54  LYS B NZ  
1576 N N   . ILE B 57  ? 0.1204 0.1495 0.1202 0.0008  0.0087  -0.0243 55  ILE B N   
1577 C CA  . ILE B 57  ? 0.1319 0.1702 0.1380 0.0013  0.0058  -0.0236 55  ILE B CA  
1578 C C   . ILE B 57  ? 0.1080 0.1520 0.1126 0.0013  0.0003  -0.0251 55  ILE B C   
1579 O O   . ILE B 57  ? 0.1070 0.1583 0.1169 0.0012  -0.0040 -0.0247 55  ILE B O   
1580 C CB  . ILE B 57  ? 0.1126 0.1493 0.1147 0.0037  0.0067  -0.0205 55  ILE B CB  
1581 C CG1 . ILE B 57  ? 0.1224 0.1511 0.1224 0.0027  0.0126  -0.0198 55  ILE B CG1 
1582 C CG2 . ILE B 57  ? 0.1111 0.1551 0.1185 0.0054  0.0042  -0.0188 55  ILE B CG2 
1583 C CD1 . ILE B 57  ? 0.1213 0.1441 0.1120 0.0035  0.0132  -0.0181 55  ILE B CD1 
1584 N N   . GLN B 58  ? 0.1069 0.1466 0.1036 0.0018  0.0006  -0.0264 56  GLN B N   
1585 C CA  . GLN B 58  ? 0.1138 0.1544 0.1043 0.0010  -0.0023 -0.0287 56  GLN B CA  
1586 C C   . GLN B 58  ? 0.1209 0.1599 0.1109 -0.0035 -0.0038 -0.0340 56  GLN B C   
1587 O O   . GLN B 58  ? 0.1319 0.1681 0.1121 -0.0052 -0.0056 -0.0371 56  GLN B O   
1588 C CB  . GLN B 58  ? 0.1227 0.1586 0.1068 0.0034  0.0012  -0.0283 56  GLN B CB  
1589 C CG  . GLN B 58  ? 0.1295 0.1681 0.1151 0.0062  0.0017  -0.0243 56  GLN B CG  
1590 C CD  . GLN B 58  ? 0.1691 0.2056 0.1556 0.0082  0.0053  -0.0238 56  GLN B CD  
1591 O OE1 . GLN B 58  ? 0.2089 0.2477 0.1971 0.0093  0.0063  -0.0217 56  GLN B OE1 
1592 N NE2 . GLN B 58  ? 0.1366 0.1689 0.1233 0.0086  0.0082  -0.0262 56  GLN B NE2 
1593 N N   . SER B 59  ? 0.1235 0.1628 0.1227 -0.0062 -0.0024 -0.0355 57  SER B N   
1594 C CA  . SER B 59  ? 0.1077 0.1448 0.1083 -0.0118 -0.0031 -0.0415 57  SER B CA  
1595 C C   . SER B 59  ? 0.1388 0.1845 0.1399 -0.0149 -0.0126 -0.0439 57  SER B C   
1596 O O   . SER B 59  ? 0.1422 0.1979 0.1526 -0.0132 -0.0177 -0.0404 57  SER B O   
1597 C CB  . SER B 59  ? 0.1300 0.1663 0.1433 -0.0149 0.0014  -0.0425 57  SER B CB  
1598 O OG  . SER B 59  ? 0.1203 0.1546 0.1371 -0.0215 0.0010  -0.0490 57  SER B OG  
1599 N N   . PRO B 60  ? 0.1287 0.1694 0.1201 -0.0197 -0.0154 -0.0500 58  PRO B N   
1600 C CA  . PRO B 60  ? 0.1361 0.1840 0.1265 -0.0242 -0.0269 -0.0532 58  PRO B CA  
1601 C C   . PRO B 60  ? 0.1402 0.1998 0.1543 -0.0287 -0.0312 -0.0552 58  PRO B C   
1602 O O   . PRO B 60  ? 0.1383 0.2094 0.1600 -0.0306 -0.0430 -0.0555 58  PRO B O   
1603 C CB  . PRO B 60  ? 0.2059 0.2413 0.1780 -0.0297 -0.0259 -0.0609 58  PRO B CB  
1604 C CG  . PRO B 60  ? 0.1779 0.2008 0.1406 -0.0252 -0.0137 -0.0595 58  PRO B CG  
1605 C CD  . PRO B 60  ? 0.1320 0.1589 0.1114 -0.0209 -0.0079 -0.0541 58  PRO B CD  
1606 N N   . GLN B 61  ? 0.1353 0.1918 0.1618 -0.0298 -0.0214 -0.0558 59  GLN B N   
1607 C CA  . GLN B 61  ? 0.1332 0.1993 0.1846 -0.0343 -0.0216 -0.0579 59  GLN B CA  
1608 C C   . GLN B 61  ? 0.1154 0.1909 0.1829 -0.0287 -0.0194 -0.0510 59  GLN B C   
1609 O O   . GLN B 61  ? 0.1078 0.1753 0.1716 -0.0247 -0.0091 -0.0470 59  GLN B O   
1610 C CB  . GLN B 61  ? 0.1342 0.1885 0.1886 -0.0391 -0.0099 -0.0622 59  GLN B CB  
1611 C CG  . GLN B 61  ? 0.2147 0.2590 0.2570 -0.0460 -0.0109 -0.0705 59  GLN B CG  
1612 C CD  . GLN B 61  ? 0.2041 0.2303 0.2413 -0.0474 0.0029  -0.0724 59  GLN B CD  
1613 O OE1 . GLN B 61  ? 0.2481 0.2721 0.2997 -0.0514 0.0103  -0.0738 59  GLN B OE1 
1614 N NE2 . GLN B 61  ? 0.3676 0.3800 0.3850 -0.0439 0.0072  -0.0722 59  GLN B NE2 
1615 N N   . GLU B 62  ? 0.1155 0.2067 0.1996 -0.0282 -0.0294 -0.0494 60  GLU B N   
1616 C CA  . GLU B 62  ? 0.1081 0.2067 0.2060 -0.0217 -0.0269 -0.0426 60  GLU B CA  
1617 C C   . GLU B 62  ? 0.1014 0.1952 0.2122 -0.0218 -0.0117 -0.0418 60  GLU B C   
1618 O O   . GLU B 62  ? 0.1048 0.1932 0.2103 -0.0163 -0.0046 -0.0368 60  GLU B O   
1619 C CB  . GLU B 62  ? 0.1070 0.2238 0.2254 -0.0204 -0.0401 -0.0405 60  GLU B CB  
1620 C CG  . GLU B 62  ? 0.1095 0.2327 0.2441 -0.0129 -0.0363 -0.0333 60  GLU B CG  
1621 C CD  . GLU B 62  ? 0.1629 0.3061 0.3281 -0.0115 -0.0479 -0.0312 60  GLU B CD  
1622 O OE1 . GLU B 62  ? 0.2230 0.3774 0.4182 -0.0164 -0.0467 -0.0352 60  GLU B OE1 
1623 O OE2 . GLU B 62  ? 0.1987 0.3464 0.3612 -0.0048 -0.0569 -0.0247 60  GLU B OE2 
1624 N N   . TRP B 63  ? 0.0904 0.1856 0.2181 -0.0285 -0.0067 -0.0470 61  TRP B N   
1625 C CA  . TRP B 63  ? 0.1006 0.1882 0.2385 -0.0296 0.0095  -0.0465 61  TRP B CA  
1626 C C   . TRP B 63  ? 0.0953 0.1619 0.2055 -0.0272 0.0200  -0.0440 61  TRP B C   
1627 O O   . TRP B 63  ? 0.1112 0.1692 0.2187 -0.0246 0.0310  -0.0406 61  TRP B O   
1628 C CB  . TRP B 63  ? 0.0948 0.1873 0.2569 -0.0385 0.0133  -0.0530 61  TRP B CB  
1629 C CG  . TRP B 63  ? 0.1217 0.2043 0.2944 -0.0410 0.0322  -0.0531 61  TRP B CG  
1630 C CD1 . TRP B 63  ? 0.1471 0.2181 0.3209 -0.0482 0.0430  -0.0575 61  TRP B CD1 
1631 C CD2 . TRP B 63  ? 0.1358 0.2176 0.3196 -0.0370 0.0440  -0.0489 61  TRP B CD2 
1632 N NE1 . TRP B 63  ? 0.1506 0.2117 0.3316 -0.0486 0.0611  -0.0556 61  TRP B NE1 
1633 C CE2 . TRP B 63  ? 0.1534 0.2227 0.3438 -0.0425 0.0619  -0.0512 61  TRP B CE2 
1634 C CE3 . TRP B 63  ? 0.1371 0.2256 0.3257 -0.0297 0.0425  -0.0437 61  TRP B CE3 
1635 C CZ2 . TRP B 63  ? 0.1675 0.2301 0.3671 -0.0411 0.0789  -0.0488 61  TRP B CZ2 
1636 C CZ3 . TRP B 63  ? 0.1366 0.2205 0.3383 -0.0284 0.0587  -0.0419 61  TRP B CZ3 
1637 C CH2 . TRP B 63  ? 0.1711 0.2413 0.3762 -0.0340 0.0771  -0.0446 61  TRP B CH2 
1638 N N   . GLU B 64  ? 0.1136 0.1714 0.2030 -0.0277 0.0164  -0.0456 62  GLU B N   
1639 C CA  . GLU B 64  ? 0.1236 0.1646 0.1889 -0.0237 0.0224  -0.0421 62  GLU B CA  
1640 C C   . GLU B 64  ? 0.1124 0.1548 0.1685 -0.0169 0.0202  -0.0365 62  GLU B C   
1641 O O   . GLU B 64  ? 0.1206 0.1525 0.1674 -0.0145 0.0277  -0.0331 62  GLU B O   
1642 C CB  . GLU B 64  ? 0.1135 0.1471 0.1632 -0.0245 0.0188  -0.0448 62  GLU B CB  
1643 C CG  . GLU B 64  ? 0.1414 0.1596 0.1712 -0.0197 0.0238  -0.0406 62  GLU B CG  
1644 C CD  . GLU B 64  ? 0.1792 0.1875 0.1995 -0.0207 0.0246  -0.0436 62  GLU B CD  
1645 O OE1 . GLU B 64  ? 0.2493 0.2442 0.2674 -0.0227 0.0327  -0.0440 62  GLU B OE1 
1646 O OE2 . GLU B 64  ? 0.1964 0.2095 0.2135 -0.0214 0.0182  -0.0470 62  GLU B OE2 
1647 N N   . ALA B 65  ? 0.0876 0.1414 0.1453 -0.0144 0.0101  -0.0356 63  ALA B N   
1648 C CA  . ALA B 65  ? 0.0791 0.1336 0.1289 -0.0086 0.0085  -0.0307 63  ALA B CA  
1649 C C   . ALA B 65  ? 0.0848 0.1407 0.1464 -0.0069 0.0151  -0.0281 63  ALA B C   
1650 O O   . ALA B 65  ? 0.0885 0.1365 0.1392 -0.0040 0.0196  -0.0252 63  ALA B O   
1651 C CB  . ALA B 65  ? 0.0751 0.1385 0.1225 -0.0065 -0.0022 -0.0299 63  ALA B CB  
1652 N N   . ILE B 66  ? 0.0861 0.1528 0.1711 -0.0088 0.0151  -0.0294 64  ILE B N   
1653 C CA  . ILE B 66  ? 0.0986 0.1664 0.1990 -0.0070 0.0241  -0.0275 64  ILE B CA  
1654 C C   . ILE B 66  ? 0.1136 0.1642 0.2037 -0.0090 0.0390  -0.0279 64  ILE B C   
1655 O O   . ILE B 66  ? 0.1197 0.1616 0.2027 -0.0065 0.0467  -0.0256 64  ILE B O   
1656 C CB  . ILE B 66  ? 0.0969 0.1818 0.2308 -0.0086 0.0215  -0.0290 64  ILE B CB  
1657 C CG1 . ILE B 66  ? 0.0938 0.1934 0.2347 -0.0044 0.0062  -0.0260 64  ILE B CG1 
1658 C CG2 . ILE B 66  ? 0.0948 0.1775 0.2472 -0.0078 0.0361  -0.0281 64  ILE B CG2 
1659 C CD1 . ILE B 66  ? 0.1057 0.2032 0.2438 0.0028  0.0083  -0.0202 64  ILE B CD1 
1660 N N   . GLN B 67  ? 0.0905 0.1338 0.1773 -0.0138 0.0434  -0.0309 65  GLN B N   
1661 C CA  . GLN B 67  ? 0.1167 0.1397 0.1869 -0.0156 0.0566  -0.0303 65  GLN B CA  
1662 C C   . GLN B 67  ? 0.1217 0.1316 0.1621 -0.0120 0.0542  -0.0269 65  GLN B C   
1663 O O   . GLN B 67  ? 0.1307 0.1263 0.1570 -0.0116 0.0629  -0.0252 65  GLN B O   
1664 C CB  . GLN B 67  ? 0.1290 0.1448 0.1989 -0.0208 0.0609  -0.0332 65  GLN B CB  
1665 C CG  . GLN B 67  ? 0.1295 0.1549 0.2306 -0.0263 0.0675  -0.0373 65  GLN B CG  
1666 C CD  . GLN B 67  ? 0.1439 0.1612 0.2452 -0.0325 0.0723  -0.0409 65  GLN B CD  
1667 O OE1 . GLN B 67  ? 0.1771 0.1782 0.2744 -0.0357 0.0875  -0.0408 65  GLN B OE1 
1668 N NE2 . GLN B 67  ? 0.1313 0.1558 0.2326 -0.0343 0.0606  -0.0439 65  GLN B NE2 
1669 N N   . ALA B 68  ? 0.1203 0.1346 0.1516 -0.0098 0.0427  -0.0263 66  ALA B N   
1670 C CA  . ALA B 68  ? 0.1161 0.1216 0.1250 -0.0066 0.0389  -0.0233 66  ALA B CA  
1671 C C   . ALA B 68  ? 0.1144 0.1211 0.1214 -0.0042 0.0392  -0.0217 66  ALA B C   
1672 O O   . ALA B 68  ? 0.1187 0.1133 0.1074 -0.0038 0.0409  -0.0203 66  ALA B O   
1673 C CB  . ALA B 68  ? 0.1023 0.1138 0.1073 -0.0047 0.0286  -0.0234 66  ALA B CB  
1674 N N   . LEU B 69  ? 0.1207 0.1412 0.1454 -0.0027 0.0366  -0.0219 67  LEU B N   
1675 C CA  . LEU B 69  ? 0.1257 0.1452 0.1501 -0.0002 0.0391  -0.0203 67  LEU B CA  
1676 C C   . LEU B 69  ? 0.1383 0.1450 0.1609 -0.0019 0.0530  -0.0210 67  LEU B C   
1677 O O   . LEU B 69  ? 0.1492 0.1452 0.1587 -0.0015 0.0574  -0.0207 67  LEU B O   
1678 C CB  . LEU B 69  ? 0.1033 0.1387 0.1472 0.0029  0.0333  -0.0190 67  LEU B CB  
1679 C CG  . LEU B 69  ? 0.0885 0.1316 0.1269 0.0047  0.0215  -0.0179 67  LEU B CG  
1680 C CD1 . LEU B 69  ? 0.0776 0.1346 0.1328 0.0073  0.0148  -0.0161 67  LEU B CD1 
1681 C CD2 . LEU B 69  ? 0.0890 0.1249 0.1113 0.0061  0.0208  -0.0164 67  LEU B CD2 
1682 N N   . THR B 70  ? 0.1578 0.1632 0.1916 -0.0046 0.0612  -0.0226 68  THR B N   
1683 C CA  . THR B 70  ? 0.1855 0.1755 0.2158 -0.0069 0.0777  -0.0237 68  THR B CA  
1684 C C   . THR B 70  ? 0.2077 0.1744 0.2028 -0.0092 0.0813  -0.0232 68  THR B C   
1685 O O   . THR B 70  ? 0.2039 0.1539 0.1818 -0.0103 0.0904  -0.0237 68  THR B O   
1686 C CB  . THR B 70  ? 0.1549 0.1501 0.2093 -0.0101 0.0864  -0.0258 68  THR B CB  
1687 O OG1 . THR B 70  ? 0.1521 0.1693 0.2409 -0.0076 0.0821  -0.0259 68  THR B OG1 
1688 C CG2 . THR B 70  ? 0.1744 0.1501 0.2227 -0.0130 0.1066  -0.0270 68  THR B CG2 
1689 N N   . VAL B 71  ? 0.1537 0.1187 0.1367 -0.0097 0.0728  -0.0221 69  VAL B N   
1690 C CA  . VAL B 71  ? 0.1737 0.1188 0.1239 -0.0105 0.0715  -0.0202 69  VAL B CA  
1691 C C   . VAL B 71  ? 0.1645 0.1080 0.1001 -0.0090 0.0637  -0.0197 69  VAL B C   
1692 O O   . VAL B 71  ? 0.1963 0.1212 0.1075 -0.0110 0.0682  -0.0199 69  VAL B O   
1693 C CB  . VAL B 71  ? 0.1638 0.1093 0.1082 -0.0096 0.0629  -0.0182 69  VAL B CB  
1694 C CG1 . VAL B 71  ? 0.1814 0.1079 0.0937 -0.0091 0.0588  -0.0149 69  VAL B CG1 
1695 C CG2 . VAL B 71  ? 0.1799 0.1233 0.1363 -0.0125 0.0720  -0.0194 69  VAL B CG2 
1696 N N   . LEU B 72  ? 0.1727 0.1345 0.1232 -0.0062 0.0534  -0.0197 70  LEU B N   
1697 C CA  . LEU B 72  ? 0.1685 0.1307 0.1099 -0.0055 0.0465  -0.0198 70  LEU B CA  
1698 C C   . LEU B 72  ? 0.1830 0.1341 0.1186 -0.0073 0.0570  -0.0218 70  LEU B C   
1699 O O   . LEU B 72  ? 0.1984 0.1351 0.1113 -0.0098 0.0566  -0.0230 70  LEU B O   
1700 C CB  . LEU B 72  ? 0.1405 0.1225 0.1006 -0.0025 0.0374  -0.0193 70  LEU B CB  
1701 C CG  . LEU B 72  ? 0.1355 0.1198 0.0915 -0.0021 0.0315  -0.0195 70  LEU B CG  
1702 C CD1 . LEU B 72  ? 0.1409 0.1173 0.0780 -0.0040 0.0240  -0.0194 70  LEU B CD1 
1703 C CD2 . LEU B 72  ? 0.1132 0.1146 0.0861 0.0009  0.0251  -0.0183 70  LEU B CD2 
1704 N N   . GLU B 73  ? 0.1880 0.1459 0.1453 -0.0059 0.0660  -0.0225 71  GLU B N   
1705 C CA  . GLU B 73  ? 0.2123 0.1600 0.1697 -0.0065 0.0788  -0.0244 71  GLU B CA  
1706 C C   . GLU B 73  ? 0.2332 0.1547 0.1623 -0.0111 0.0904  -0.0265 71  GLU B C   
1707 O O   . GLU B 73  ? 0.2679 0.1732 0.1780 -0.0135 0.0959  -0.0290 71  GLU B O   
1708 C CB  . GLU B 73  ? 0.2203 0.1811 0.2107 -0.0036 0.0866  -0.0238 71  GLU B CB  
1709 C CG  . GLU B 73  ? 0.2246 0.1758 0.2210 -0.0028 0.1018  -0.0253 71  GLU B CG  
1710 C CD  . GLU B 73  ? 0.1759 0.1420 0.2100 0.0008  0.1088  -0.0242 71  GLU B CD  
1711 O OE1 . GLU B 73  ? 0.1983 0.1806 0.2511 0.0012  0.1020  -0.0230 71  GLU B OE1 
1712 O OE2 . GLU B 73  ? 0.3002 0.2623 0.3467 0.0034  0.1202  -0.0244 71  GLU B OE2 
1713 N N   . THR B 74  ? 0.2139 0.1291 0.1383 -0.0127 0.0950  -0.0256 72  THR B N   
1714 C CA  . THR B 74  ? 0.2469 0.1344 0.1419 -0.0169 0.1077  -0.0268 72  THR B CA  
1715 C C   . THR B 74  ? 0.2946 0.1654 0.1508 -0.0194 0.0972  -0.0263 72  THR B C   
1716 O O   . THR B 74  ? 0.2956 0.1436 0.1236 -0.0233 0.1044  -0.0289 72  THR B O   
1717 C CB  . THR B 74  ? 0.2519 0.1366 0.1518 -0.0180 0.1145  -0.0252 72  THR B CB  
1718 O OG1 . THR B 74  ? 0.2479 0.1481 0.1859 -0.0169 0.1245  -0.0265 72  THR B OG1 
1719 C CG2 . THR B 74  ? 0.2912 0.1428 0.1548 -0.0225 0.1286  -0.0254 72  THR B CG2 
1720 N N   . CYS B 75  ? 0.3183 0.2008 0.1742 -0.0174 0.0795  -0.0234 73  CYS B N   
1721 C CA  . CYS B 75  ? 0.3325 0.2033 0.1577 -0.0192 0.0668  -0.0224 73  CYS B CA  
1722 C C   . CYS B 75  ? 0.3143 0.1844 0.1328 -0.0215 0.0620  -0.0262 73  CYS B C   
1723 O O   . CYS B 75  ? 0.3211 0.1735 0.1081 -0.0256 0.0567  -0.0275 73  CYS B O   
1724 C CB  . CYS B 75  ? 0.2828 0.1677 0.1147 -0.0156 0.0500  -0.0183 73  CYS B CB  
1725 S SG  . CYS B 75  ? 0.2965 0.1759 0.1288 -0.0136 0.0546  -0.0139 73  CYS B SG  
1726 N N   . MET B 76  ? 0.2771 0.1654 0.1236 -0.0194 0.0629  -0.0278 74  MET B N   
1727 C CA  . MET B 76  ? 0.2785 0.1634 0.1198 -0.0221 0.0618  -0.0317 74  MET B CA  
1728 C C   . MET B 76  ? 0.3172 0.1757 0.1359 -0.0267 0.0783  -0.0361 74  MET B C   
1729 O O   . MET B 76  ? 0.3428 0.1844 0.1347 -0.0321 0.0761  -0.0401 74  MET B O   
1730 C CB  . MET B 76  ? 0.2550 0.1615 0.1293 -0.0181 0.0611  -0.0313 74  MET B CB  
1731 C CG  . MET B 76  ? 0.2303 0.1587 0.1204 -0.0151 0.0451  -0.0283 74  MET B CG  
1732 S SD  . MET B 76  ? 0.2263 0.1539 0.1012 -0.0192 0.0291  -0.0301 74  MET B SD  
1733 C CE  . MET B 76  ? 0.2504 0.1791 0.1352 -0.0212 0.0344  -0.0338 74  MET B CE  
1734 N N   . LYS B 77  ? 0.3318 0.1835 0.1569 -0.0254 0.0951  -0.0356 75  LYS B N   
1735 C CA  . LYS B 77  ? 0.3849 0.2089 0.1885 -0.0297 0.1146  -0.0399 75  LYS B CA  
1736 C C   . LYS B 77  ? 0.4110 0.2055 0.1671 -0.0354 0.1146  -0.0407 75  LYS B C   
1737 O O   . LYS B 77  ? 0.4536 0.2231 0.1779 -0.0411 0.1207  -0.0457 75  LYS B O   
1738 C CB  . LYS B 77  ? 0.4154 0.2428 0.2464 -0.0265 0.1343  -0.0394 75  LYS B CB  
1739 C CG  . LYS B 77  ? 0.4599 0.3118 0.3337 -0.0208 0.1352  -0.0385 75  LYS B CG  
1740 C CD  . LYS B 77  ? 0.5713 0.4261 0.4743 -0.0179 0.1545  -0.0383 75  LYS B CD  
1741 C CE  . LYS B 77  ? 0.4751 0.3617 0.4192 -0.0124 0.1451  -0.0339 75  LYS B CE  
1742 N NZ  . LYS B 77  ? 0.4093 0.2963 0.3657 -0.0134 0.1553  -0.0333 75  LYS B NZ  
1743 N N   . SER B 78  ? 0.3948 0.1919 0.1438 -0.0339 0.1047  -0.0356 76  SER B N   
1744 C CA  A SER B 78  ? 0.4562 0.2234 0.1609 -0.0379 0.1069  -0.0343 76  SER B CA  
1745 C CA  B SER B 78  ? 0.4394 0.2068 0.1444 -0.0378 0.1068  -0.0342 76  SER B CA  
1746 C C   . SER B 78  ? 0.4653 0.2271 0.1398 -0.0400 0.0836  -0.0326 76  SER B C   
1747 O O   . SER B 78  ? 0.5294 0.2617 0.1585 -0.0445 0.0832  -0.0325 76  SER B O   
1748 C CB  A SER B 78  ? 0.4507 0.2177 0.1633 -0.0351 0.1144  -0.0292 76  SER B CB  
1749 C CB  B SER B 78  ? 0.4290 0.1971 0.1423 -0.0348 0.1134  -0.0289 76  SER B CB  
1750 O OG  A SER B 78  ? 0.4783 0.2627 0.1999 -0.0310 0.0947  -0.0236 76  SER B OG  
1751 O OG  B SER B 78  ? 0.4007 0.1724 0.1417 -0.0340 0.1351  -0.0308 76  SER B OG  
1752 N N   . CYS B 79  ? 0.4114 0.2012 0.1109 -0.0366 0.0641  -0.0308 77  CYS B N   
1753 C CA  . CYS B 79  ? 0.4408 0.2327 0.1242 -0.0362 0.0409  -0.0270 77  CYS B CA  
1754 C C   . CYS B 79  ? 0.4805 0.2698 0.1479 -0.0417 0.0260  -0.0315 77  CYS B C   
1755 O O   . CYS B 79  ? 0.5458 0.3344 0.1973 -0.0422 0.0059  -0.0287 77  CYS B O   
1756 C CB  . CYS B 79  ? 0.4119 0.2339 0.1315 -0.0291 0.0290  -0.0217 77  CYS B CB  
1757 S SG  . CYS B 79  ? 0.4085 0.2297 0.1401 -0.0244 0.0423  -0.0165 77  CYS B SG  
1758 N N   . GLY B 80  ? 0.4524 0.2407 0.1259 -0.0457 0.0352  -0.0385 78  GLY B N   
1759 C CA  . GLY B 80  ? 0.4546 0.2367 0.1105 -0.0528 0.0232  -0.0444 78  GLY B CA  
1760 C C   . GLY B 80  ? 0.4318 0.2432 0.1161 -0.0513 0.0020  -0.0435 78  GLY B C   
1761 O O   . GLY B 80  ? 0.3909 0.2288 0.1121 -0.0444 -0.0007 -0.0390 78  GLY B O   
1762 N N   . LYS B 81  ? 0.5177 0.3231 0.1835 -0.0586 -0.0131 -0.0480 79  LYS B N   
1763 C CA  . LYS B 81  ? 0.5026 0.3338 0.1983 -0.0597 -0.0285 -0.0499 79  LYS B CA  
1764 C C   . LYS B 81  ? 0.4477 0.3060 0.1720 -0.0520 -0.0445 -0.0423 79  LYS B C   
1765 O O   . LYS B 81  ? 0.3978 0.2816 0.1599 -0.0490 -0.0464 -0.0420 79  LYS B O   
1766 C CB  . LYS B 81  ? 0.5933 0.4117 0.2627 -0.0704 -0.0428 -0.0571 79  LYS B CB  
1767 C CG  . LYS B 81  ? 0.5360 0.3786 0.2387 -0.0737 -0.0535 -0.0613 79  LYS B CG  
1768 C CD  . LYS B 81  ? 0.6160 0.4403 0.2953 -0.0864 -0.0551 -0.0721 79  LYS B CD  
1769 C CE  . LYS B 81  ? 0.6768 0.5245 0.3863 -0.0914 -0.0706 -0.0761 79  LYS B CE  
1770 N NZ  . LYS B 81  ? 0.8062 0.6358 0.4865 -0.1054 -0.0814 -0.0864 79  LYS B NZ  
1771 N N   . ARG B 82  ? 0.4482 0.2992 0.1531 -0.0492 -0.0562 -0.0362 80  ARG B N   
1772 C CA  . ARG B 82  ? 0.4069 0.2813 0.1390 -0.0413 -0.0703 -0.0287 80  ARG B CA  
1773 C C   . ARG B 82  ? 0.3440 0.2381 0.1128 -0.0334 -0.0575 -0.0255 80  ARG B C   
1774 O O   . ARG B 82  ? 0.3335 0.2523 0.1361 -0.0293 -0.0647 -0.0236 80  ARG B O   
1775 C CB  . ARG B 82  ? 0.4263 0.2853 0.1292 -0.0381 -0.0818 -0.0213 80  ARG B CB  
1776 C CG  . ARG B 82  ? 0.5661 0.4146 0.2408 -0.0445 -0.1041 -0.0228 80  ARG B CG  
1777 C CD  . ARG B 82  ? 0.6263 0.4744 0.2924 -0.0378 -0.1236 -0.0127 80  ARG B CD  
1778 N NE  . ARG B 82  ? 0.7726 0.6047 0.4236 -0.0310 -0.1102 -0.0053 80  ARG B NE  
1779 C CZ  . ARG B 82  ? 0.8324 0.6776 0.5067 -0.0210 -0.1128 0.0032  80  ARG B CZ  
1780 N NH1 . ARG B 82  ? 0.9073 0.7809 0.6191 -0.0161 -0.1290 0.0058  80  ARG B NH1 
1781 N NH2 . ARG B 82  ? 0.7813 0.6108 0.4432 -0.0163 -0.0976 0.0084  80  ARG B NH2 
1782 N N   . PHE B 83  ? 0.3267 0.2096 0.0894 -0.0318 -0.0381 -0.0253 81  PHE B N   
1783 C CA  . PHE B 83  ? 0.2866 0.1873 0.0821 -0.0255 -0.0273 -0.0231 81  PHE B CA  
1784 C C   . PHE B 83  ? 0.2626 0.1785 0.0837 -0.0271 -0.0218 -0.0279 81  PHE B C   
1785 O O   . PHE B 83  ? 0.2350 0.1721 0.0861 -0.0228 -0.0231 -0.0261 81  PHE B O   
1786 C CB  . PHE B 83  ? 0.2882 0.1741 0.0734 -0.0239 -0.0093 -0.0217 81  PHE B CB  
1787 C CG  . PHE B 83  ? 0.2543 0.1583 0.0713 -0.0181 -0.0015 -0.0194 81  PHE B CG  
1788 C CD1 . PHE B 83  ? 0.2383 0.1549 0.0698 -0.0126 -0.0095 -0.0145 81  PHE B CD1 
1789 C CD2 . PHE B 83  ? 0.2416 0.1489 0.0734 -0.0181 0.0136  -0.0221 81  PHE B CD2 
1790 C CE1 . PHE B 83  ? 0.2110 0.1433 0.0695 -0.0085 -0.0036 -0.0136 81  PHE B CE1 
1791 C CE2 . PHE B 83  ? 0.2163 0.1403 0.0755 -0.0134 0.0179  -0.0203 81  PHE B CE2 
1792 C CZ  . PHE B 83  ? 0.2001 0.1357 0.0707 -0.0093 0.0095  -0.0165 81  PHE B CZ  
1793 N N   . HIS B 84  ? 0.2751 0.1774 0.0819 -0.0333 -0.0146 -0.0337 82  HIS B N   
1794 C CA  . HIS B 84  ? 0.2659 0.1784 0.0937 -0.0349 -0.0086 -0.0378 82  HIS B CA  
1795 C C   . HIS B 84  ? 0.2497 0.1835 0.1009 -0.0351 -0.0224 -0.0378 82  HIS B C   
1796 O O   . HIS B 84  ? 0.2171 0.1664 0.0946 -0.0322 -0.0177 -0.0372 82  HIS B O   
1797 C CB  . HIS B 84  ? 0.2936 0.1850 0.0993 -0.0426 -0.0005 -0.0448 82  HIS B CB  
1798 C CG  . HIS B 84  ? 0.3049 0.1748 0.0914 -0.0425 0.0171  -0.0455 82  HIS B CG  
1799 N ND1 . HIS B 84  ? 0.3629 0.2061 0.1188 -0.0497 0.0254  -0.0517 82  HIS B ND1 
1800 C CD2 . HIS B 84  ? 0.2903 0.1610 0.0857 -0.0368 0.0294  -0.0416 82  HIS B CD2 
1801 C CE1 . HIS B 84  ? 0.3658 0.1937 0.1122 -0.0478 0.0430  -0.0511 82  HIS B CE1 
1802 N NE2 . HIS B 84  ? 0.3236 0.1684 0.0938 -0.0402 0.0446  -0.0448 82  HIS B NE2 
1803 N N   . ASP B 85  ? 0.2753 0.2087 0.1164 -0.0386 -0.0391 -0.0383 83  ASP B N   
1804 C CA  . ASP B 85  ? 0.2767 0.2300 0.1421 -0.0401 -0.0524 -0.0393 83  ASP B CA  
1805 C C   . ASP B 85  ? 0.2535 0.2287 0.1491 -0.0316 -0.0541 -0.0334 83  ASP B C   
1806 O O   . ASP B 85  ? 0.2479 0.2400 0.1709 -0.0314 -0.0541 -0.0343 83  ASP B O   
1807 C CB  . ASP B 85  ? 0.2842 0.2328 0.1328 -0.0454 -0.0721 -0.0406 83  ASP B CB  
1808 C CG  . ASP B 85  ? 0.3588 0.2888 0.1819 -0.0564 -0.0727 -0.0490 83  ASP B CG  
1809 O OD1 . ASP B 85  ? 0.4154 0.3370 0.2168 -0.0616 -0.0892 -0.0505 83  ASP B OD1 
1810 O OD2 . ASP B 85  ? 0.3688 0.2939 0.1957 -0.0601 -0.0586 -0.0543 83  ASP B OD2 
1811 N N   . GLU B 86  ? 0.2404 0.2128 0.1305 -0.0251 -0.0523 -0.0278 84  GLU B N   
1812 C CA  . GLU B 86  ? 0.2256 0.2150 0.1410 -0.0176 -0.0520 -0.0231 84  GLU B CA  
1813 C C   . GLU B 86  ? 0.1885 0.1835 0.1179 -0.0149 -0.0370 -0.0235 84  GLU B C   
1814 O O   . GLU B 86  ? 0.1802 0.1903 0.1327 -0.0116 -0.0356 -0.0224 84  GLU B O   
1815 C CB  . GLU B 86  ? 0.2524 0.2350 0.1563 -0.0121 -0.0559 -0.0172 84  GLU B CB  
1816 C CG  . GLU B 86  ? 0.3198 0.3037 0.2200 -0.0113 -0.0743 -0.0140 84  GLU B CG  
1817 C CD  . GLU B 86  ? 0.2993 0.3066 0.2339 -0.0098 -0.0835 -0.0142 84  GLU B CD  
1818 O OE1 . GLU B 86  ? 0.3948 0.4154 0.3542 -0.0046 -0.0765 -0.0126 84  GLU B OE1 
1819 O OE2 . GLU B 86  ? 0.4605 0.4723 0.3973 -0.0145 -0.0970 -0.0164 84  GLU B OE2 
1820 N N   . VAL B 87  ? 0.1785 0.1606 0.0937 -0.0161 -0.0256 -0.0248 85  VAL B N   
1821 C CA  . VAL B 87  ? 0.1589 0.1464 0.0877 -0.0139 -0.0135 -0.0250 85  VAL B CA  
1822 C C   . VAL B 87  ? 0.1613 0.1561 0.1037 -0.0166 -0.0122 -0.0277 85  VAL B C   
1823 O O   . VAL B 87  ? 0.1431 0.1483 0.1022 -0.0135 -0.0077 -0.0262 85  VAL B O   
1824 C CB  . VAL B 87  ? 0.1661 0.1393 0.0815 -0.0143 -0.0017 -0.0257 85  VAL B CB  
1825 C CG1 . VAL B 87  ? 0.1534 0.1332 0.0848 -0.0117 0.0082  -0.0254 85  VAL B CG1 
1826 C CG2 . VAL B 87  ? 0.1697 0.1374 0.0767 -0.0114 -0.0006 -0.0226 85  VAL B CG2 
1827 N N   . GLY B 88  ? 0.1747 0.1629 0.1085 -0.0230 -0.0164 -0.0319 86  GLY B N   
1828 C CA  . GLY B 88  ? 0.1997 0.1924 0.1460 -0.0269 -0.0140 -0.0352 86  GLY B CA  
1829 C C   . GLY B 88  ? 0.2235 0.2324 0.1908 -0.0278 -0.0226 -0.0353 86  GLY B C   
1830 O O   . GLY B 88  ? 0.2161 0.2263 0.1896 -0.0342 -0.0251 -0.0397 86  GLY B O   
1831 N N   . LYS B 89  ? 0.1247 0.1455 0.1043 -0.0218 -0.0260 -0.0311 87  LYS B N   
1832 C CA  . LYS B 89  ? 0.1209 0.1578 0.1254 -0.0210 -0.0294 -0.0307 87  LYS B CA  
1833 C C   . LYS B 89  ? 0.1016 0.1446 0.1172 -0.0153 -0.0194 -0.0276 87  LYS B C   
1834 O O   . LYS B 89  ? 0.0904 0.1291 0.0966 -0.0107 -0.0153 -0.0248 87  LYS B O   
1835 C CB  . LYS B 89  ? 0.1283 0.1726 0.1382 -0.0188 -0.0429 -0.0287 87  LYS B CB  
1836 C CG  . LYS B 89  ? 0.1550 0.1950 0.1548 -0.0250 -0.0566 -0.0316 87  LYS B CG  
1837 C CD  . LYS B 89  ? 0.1649 0.2101 0.1668 -0.0207 -0.0710 -0.0274 87  LYS B CD  
1838 C CE  . LYS B 89  ? 0.1967 0.2326 0.1783 -0.0266 -0.0861 -0.0295 87  LYS B CE  
1839 N NZ  . LYS B 89  ? 0.2844 0.3249 0.2676 -0.0219 -0.1029 -0.0241 87  LYS B NZ  
1840 N N   . PHE B 90  ? 0.0903 0.1421 0.1248 -0.0162 -0.0151 -0.0283 88  PHE B N   
1841 C CA  . PHE B 90  ? 0.0818 0.1361 0.1218 -0.0116 -0.0052 -0.0257 88  PHE B CA  
1842 C C   . PHE B 90  ? 0.0773 0.1365 0.1201 -0.0057 -0.0073 -0.0230 88  PHE B C   
1843 O O   . PHE B 90  ? 0.0737 0.1301 0.1102 -0.0020 -0.0012 -0.0211 88  PHE B O   
1844 C CB  . PHE B 90  ? 0.0806 0.1398 0.1374 -0.0144 0.0023  -0.0270 88  PHE B CB  
1845 C CG  . PHE B 90  ? 0.0847 0.1355 0.1368 -0.0198 0.0078  -0.0291 88  PHE B CG  
1846 C CD1 . PHE B 90  ? 0.0907 0.1297 0.1253 -0.0179 0.0136  -0.0270 88  PHE B CD1 
1847 C CD2 . PHE B 90  ? 0.0980 0.1526 0.1648 -0.0269 0.0068  -0.0333 88  PHE B CD2 
1848 C CE1 . PHE B 90  ? 0.0974 0.1266 0.1279 -0.0221 0.0198  -0.0285 88  PHE B CE1 
1849 C CE2 . PHE B 90  ? 0.1071 0.1515 0.1686 -0.0325 0.0131  -0.0358 88  PHE B CE2 
1850 C CZ  . PHE B 90  ? 0.1030 0.1336 0.1450 -0.0298 0.0195  -0.0333 88  PHE B CZ  
1851 N N   . ARG B 91  ? 0.0992 0.1643 0.1499 -0.0048 -0.0170 -0.0228 89  ARG B N   
1852 C CA  . ARG B 91  ? 0.0986 0.1651 0.1499 0.0011  -0.0191 -0.0201 89  ARG B CA  
1853 C C   . ARG B 91  ? 0.1035 0.1598 0.1345 0.0033  -0.0160 -0.0186 89  ARG B C   
1854 O O   . ARG B 91  ? 0.0973 0.1530 0.1280 0.0070  -0.0114 -0.0175 89  ARG B O   
1855 C CB  . ARG B 91  ? 0.1253 0.1961 0.1828 0.0020  -0.0322 -0.0187 89  ARG B CB  
1856 C CG  . ARG B 91  ? 0.2370 0.3083 0.2982 0.0088  -0.0335 -0.0152 89  ARG B CG  
1857 C CD  . ARG B 91  ? 0.2017 0.2783 0.2724 0.0108  -0.0476 -0.0126 89  ARG B CD  
1858 N NE  . ARG B 91  ? 0.3124 0.4048 0.4142 0.0103  -0.0497 -0.0139 89  ARG B NE  
1859 C CZ  . ARG B 91  ? 0.2672 0.3671 0.3787 0.0045  -0.0582 -0.0165 89  ARG B CZ  
1860 N NH1 . ARG B 91  ? 0.4812 0.5723 0.5703 -0.0008 -0.0671 -0.0178 89  ARG B NH1 
1861 N NH2 . ARG B 91  ? 0.2826 0.3983 0.4273 0.0038  -0.0582 -0.0181 89  ARG B NH2 
1862 N N   . PHE B 92  ? 0.0919 0.1397 0.1070 0.0003  -0.0172 -0.0192 90  PHE B N   
1863 C CA  . PHE B 92  ? 0.0945 0.1342 0.0954 0.0017  -0.0125 -0.0183 90  PHE B CA  
1864 C C   . PHE B 92  ? 0.0819 0.1208 0.0822 0.0014  -0.0045 -0.0186 90  PHE B C   
1865 O O   . PHE B 92  ? 0.0770 0.1159 0.0755 0.0039  -0.0010 -0.0175 90  PHE B O   
1866 C CB  . PHE B 92  ? 0.0881 0.1169 0.0723 -0.0006 -0.0156 -0.0185 90  PHE B CB  
1867 C CG  . PHE B 92  ? 0.0875 0.1090 0.0620 0.0006  -0.0092 -0.0177 90  PHE B CG  
1868 C CD1 . PHE B 92  ? 0.1018 0.1233 0.0767 0.0037  -0.0085 -0.0161 90  PHE B CD1 
1869 C CD2 . PHE B 92  ? 0.1078 0.1232 0.0764 -0.0014 -0.0031 -0.0189 90  PHE B CD2 
1870 C CE1 . PHE B 92  ? 0.0855 0.1022 0.0560 0.0039  -0.0025 -0.0161 90  PHE B CE1 
1871 C CE2 . PHE B 92  ? 0.0920 0.1033 0.0578 -0.0002 0.0031  -0.0183 90  PHE B CE2 
1872 C CZ  . PHE B 92  ? 0.0881 0.1011 0.0560 0.0021  0.0030  -0.0171 90  PHE B CZ  
1873 N N   . LEU B 93  ? 0.0806 0.1176 0.0814 -0.0019 -0.0023 -0.0199 91  LEU B N   
1874 C CA  . LEU B 93  ? 0.0813 0.1152 0.0801 -0.0013 0.0049  -0.0188 91  LEU B CA  
1875 C C   . LEU B 93  ? 0.0801 0.1184 0.0834 0.0017  0.0085  -0.0169 91  LEU B C   
1876 O O   . LEU B 93  ? 0.0861 0.1222 0.0846 0.0041  0.0112  -0.0147 91  LEU B O   
1877 C CB  . LEU B 93  ? 0.0885 0.1178 0.0880 -0.0055 0.0078  -0.0206 91  LEU B CB  
1878 C CG  . LEU B 93  ? 0.0932 0.1134 0.0822 -0.0093 0.0059  -0.0233 91  LEU B CG  
1879 C CD1 . LEU B 93  ? 0.1291 0.1451 0.1201 -0.0152 0.0075  -0.0269 91  LEU B CD1 
1880 C CD2 . LEU B 93  ? 0.1078 0.1200 0.0885 -0.0068 0.0117  -0.0219 91  LEU B CD2 
1881 N N   . ASN B 94  ? 0.0920 0.1359 0.1043 0.0015  0.0085  -0.0178 92  ASN B N   
1882 C CA  . ASN B 94  ? 0.0880 0.1328 0.1009 0.0036  0.0139  -0.0167 92  ASN B CA  
1883 C C   . ASN B 94  ? 0.0860 0.1297 0.0906 0.0066  0.0122  -0.0160 92  ASN B C   
1884 O O   . ASN B 94  ? 0.0911 0.1318 0.0880 0.0079  0.0151  -0.0149 92  ASN B O   
1885 C CB  . ASN B 94  ? 0.0874 0.1380 0.1145 0.0031  0.0160  -0.0184 92  ASN B CB  
1886 C CG  . ASN B 94  ? 0.0936 0.1457 0.1316 -0.0008 0.0202  -0.0195 92  ASN B CG  
1887 O OD1 . ASN B 94  ? 0.1031 0.1491 0.1346 -0.0028 0.0237  -0.0186 92  ASN B OD1 
1888 N ND2 . ASN B 94  ? 0.0909 0.1510 0.1477 -0.0019 0.0208  -0.0213 92  ASN B ND2 
1889 N N   . GLU B 95  ? 0.1054 0.1500 0.1098 0.0072  0.0072  -0.0168 93  GLU B N   
1890 C CA  . GLU B 95  ? 0.1092 0.1526 0.1079 0.0087  0.0061  -0.0170 93  GLU B CA  
1891 C C   . GLU B 95  ? 0.1084 0.1502 0.1013 0.0088  0.0056  -0.0157 93  GLU B C   
1892 O O   . GLU B 95  ? 0.1206 0.1626 0.1095 0.0094  0.0047  -0.0159 93  GLU B O   
1893 C CB  . GLU B 95  ? 0.1059 0.1484 0.1059 0.0092  0.0026  -0.0176 93  GLU B CB  
1894 C CG  . GLU B 95  ? 0.1268 0.1720 0.1359 0.0107  0.0018  -0.0179 93  GLU B CG  
1895 C CD  . GLU B 95  ? 0.1052 0.1514 0.1183 0.0120  0.0075  -0.0193 93  GLU B CD  
1896 O OE1 . GLU B 95  ? 0.1773 0.2196 0.1824 0.0120  0.0101  -0.0207 93  GLU B OE1 
1897 O OE2 . GLU B 95  ? 0.2502 0.3004 0.2743 0.0122  0.0104  -0.0195 93  GLU B OE2 
1898 N N   . LEU B 96  ? 0.0900 0.1300 0.0834 0.0082  0.0060  -0.0146 94  LEU B N   
1899 C CA  . LEU B 96  ? 0.0884 0.1278 0.0813 0.0094  0.0065  -0.0125 94  LEU B CA  
1900 C C   . LEU B 96  ? 0.0710 0.1096 0.0607 0.0112  0.0077  -0.0096 94  LEU B C   
1901 O O   . LEU B 96  ? 0.0832 0.1231 0.0716 0.0133  0.0052  -0.0072 94  LEU B O   
1902 C CB  . LEU B 96  ? 0.0955 0.1302 0.0894 0.0083  0.0092  -0.0125 94  LEU B CB  
1903 C CG  . LEU B 96  ? 0.0793 0.1105 0.0705 0.0064  0.0088  -0.0147 94  LEU B CG  
1904 C CD1 . LEU B 96  ? 0.1010 0.1242 0.0888 0.0048  0.0132  -0.0153 94  LEU B CD1 
1905 C CD2 . LEU B 96  ? 0.0807 0.1142 0.0742 0.0071  0.0081  -0.0150 94  LEU B CD2 
1906 N N   . ILE B 97  ? 0.0778 0.1138 0.0665 0.0101  0.0115  -0.0095 95  ILE B N   
1907 C CA  . ILE B 97  ? 0.0827 0.1142 0.0650 0.0116  0.0148  -0.0061 95  ILE B CA  
1908 C C   . ILE B 97  ? 0.0968 0.1278 0.0694 0.0127  0.0126  -0.0058 95  ILE B C   
1909 O O   . ILE B 97  ? 0.1020 0.1298 0.0656 0.0149  0.0102  -0.0021 95  ILE B O   
1910 C CB  . ILE B 97  ? 0.0981 0.1264 0.0836 0.0089  0.0214  -0.0070 95  ILE B CB  
1911 C CG1 . ILE B 97  ? 0.0972 0.1229 0.0884 0.0069  0.0232  -0.0075 95  ILE B CG1 
1912 C CG2 . ILE B 97  ? 0.0998 0.1205 0.0756 0.0100  0.0271  -0.0036 95  ILE B CG2 
1913 C CD1 . ILE B 97  ? 0.0927 0.1175 0.0911 0.0025  0.0279  -0.0101 95  ILE B CD1 
1914 N N   . LYS B 98  ? 0.1339 0.1676 0.1078 0.0112  0.0122  -0.0098 96  LYS B N   
1915 C CA  . LYS B 98  ? 0.1674 0.1984 0.1303 0.0111  0.0113  -0.0113 96  LYS B CA  
1916 C C   . LYS B 98  ? 0.1659 0.1998 0.1254 0.0116  0.0029  -0.0108 96  LYS B C   
1917 O O   . LYS B 98  ? 0.1637 0.1936 0.1097 0.0115  -0.0003 -0.0105 96  LYS B O   
1918 C CB  . LYS B 98  ? 0.1632 0.1951 0.1311 0.0098  0.0145  -0.0157 96  LYS B CB  
1919 C CG  . LYS B 98  ? 0.1221 0.1516 0.0944 0.0093  0.0233  -0.0164 96  LYS B CG  
1920 C CD  . LYS B 98  ? 0.1537 0.1883 0.1409 0.0095  0.0246  -0.0193 96  LYS B CD  
1921 C CE  . LYS B 98  ? 0.3565 0.3886 0.3493 0.0095  0.0346  -0.0211 96  LYS B CE  
1922 N NZ  . LYS B 98  ? 0.2411 0.2697 0.2338 0.0081  0.0428  -0.0195 96  LYS B NZ  
1923 N N   . VAL B 99  ? 0.0998 0.1397 0.0711 0.0119  -0.0004 -0.0108 97  VAL B N   
1924 C CA  . VAL B 99  ? 0.1072 0.1523 0.0820 0.0120  -0.0075 -0.0108 97  VAL B CA  
1925 C C   . VAL B 99  ? 0.1132 0.1587 0.0858 0.0152  -0.0121 -0.0052 97  VAL B C   
1926 O O   . VAL B 99  ? 0.1243 0.1730 0.0941 0.0153  -0.0204 -0.0047 97  VAL B O   
1927 C CB  . VAL B 99  ? 0.0889 0.1387 0.0778 0.0111  -0.0070 -0.0125 97  VAL B CB  
1928 C CG1 . VAL B 99  ? 0.0940 0.1509 0.0920 0.0110  -0.0132 -0.0123 97  VAL B CG1 
1929 C CG2 . VAL B 99  ? 0.0851 0.1327 0.0734 0.0087  -0.0043 -0.0168 97  VAL B CG2 
1930 N N   . VAL B 100 ? 0.1093 0.1511 0.0833 0.0178  -0.0075 -0.0011 98  VAL B N   
1931 C CA  . VAL B 100 ? 0.1220 0.1629 0.0958 0.0223  -0.0111 0.0055  98  VAL B CA  
1932 C C   . VAL B 100 ? 0.1437 0.1743 0.0982 0.0240  -0.0106 0.0100  98  VAL B C   
1933 O O   . VAL B 100 ? 0.1631 0.1918 0.1132 0.0282  -0.0164 0.0164  98  VAL B O   
1934 C CB  . VAL B 100 ? 0.1159 0.1563 0.1031 0.0247  -0.0055 0.0080  98  VAL B CB  
1935 C CG1 . VAL B 100 ? 0.0982 0.1455 0.1010 0.0229  -0.0046 0.0039  98  VAL B CG1 
1936 C CG2 . VAL B 100 ? 0.1180 0.1497 0.0998 0.0230  0.0037  0.0074  98  VAL B CG2 
1937 N N   . SER B 101 ? 0.1557 0.1794 0.0984 0.0209  -0.0038 0.0069  99  SER B N   
1938 C CA  . SER B 101 ? 0.1655 0.1763 0.0877 0.0217  0.0003  0.0108  99  SER B CA  
1939 C C   . SER B 101 ? 0.1832 0.1888 0.0838 0.0208  -0.0067 0.0105  99  SER B C   
1940 O O   . SER B 101 ? 0.2019 0.2096 0.1002 0.0170  -0.0072 0.0039  99  SER B O   
1941 C CB  . SER B 101 ? 0.1907 0.1960 0.1132 0.0184  0.0129  0.0075  99  SER B CB  
1942 O OG  . SER B 101 ? 0.1995 0.1910 0.1010 0.0179  0.0195  0.0096  99  SER B OG  
1943 N N   . PRO B 102 ? 0.2359 0.2306 0.1163 0.0238  -0.0101 0.0173  100 PRO B N   
1944 C CA  . PRO B 102 ? 0.2660 0.2522 0.1192 0.0221  -0.0172 0.0167  100 PRO B CA  
1945 C C   . PRO B 102 ? 0.2722 0.2462 0.1080 0.0173  -0.0049 0.0108  100 PRO B C   
1946 O O   . PRO B 102 ? 0.2786 0.2451 0.0927 0.0141  -0.0088 0.0070  100 PRO B O   
1947 C CB  . PRO B 102 ? 0.3125 0.2865 0.1459 0.0273  -0.0220 0.0271  100 PRO B CB  
1948 C CG  . PRO B 102 ? 0.3425 0.3226 0.1993 0.0324  -0.0194 0.0329  100 PRO B CG  
1949 C CD  . PRO B 102 ? 0.2595 0.2476 0.1395 0.0290  -0.0079 0.0262  100 PRO B CD  
1950 N N   . LYS B 103 ? 0.2294 0.2007 0.0750 0.0165  0.0100  0.0097  101 LYS B N   
1951 C CA  A LYS B 103 ? 0.2482 0.2092 0.0842 0.0127  0.0242  0.0045  101 LYS B CA  
1952 C CA  B LYS B 103 ? 0.2530 0.2138 0.0884 0.0127  0.0240  0.0045  101 LYS B CA  
1953 C C   . LYS B 103 ? 0.2294 0.1995 0.0773 0.0096  0.0235  -0.0042 101 LYS B C   
1954 O O   . LYS B 103 ? 0.2424 0.2030 0.0786 0.0067  0.0324  -0.0093 101 LYS B O   
1955 C CB  A LYS B 103 ? 0.2456 0.2060 0.0979 0.0125  0.0387  0.0054  101 LYS B CB  
1956 C CB  B LYS B 103 ? 0.2520 0.2112 0.1021 0.0125  0.0388  0.0056  101 LYS B CB  
1957 C CG  A LYS B 103 ? 0.2955 0.2442 0.1378 0.0150  0.0434  0.0136  101 LYS B CG  
1958 C CG  B LYS B 103 ? 0.2985 0.2406 0.1296 0.0141  0.0464  0.0131  101 LYS B CG  
1959 C CD  A LYS B 103 ? 0.2606 0.2103 0.1231 0.0129  0.0578  0.0124  101 LYS B CD  
1960 C CD  B LYS B 103 ? 0.3034 0.2463 0.1549 0.0126  0.0605  0.0130  101 LYS B CD  
1961 C CE  A LYS B 103 ? 0.2755 0.2081 0.1242 0.0140  0.0675  0.0196  101 LYS B CE  
1962 C CE  B LYS B 103 ? 0.3338 0.2856 0.2063 0.0087  0.0694  0.0047  101 LYS B CE  
1963 N NZ  A LYS B 103 ? 0.2534 0.1913 0.1279 0.0119  0.0759  0.0188  101 LYS B NZ  
1964 N NZ  B LYS B 103 ? 0.4118 0.3526 0.2852 0.0057  0.0886  0.0042  101 LYS B NZ  
1965 N N   . TYR B 104 ? 0.2164 0.2028 0.0868 0.0103  0.0142  -0.0056 102 TYR B N   
1966 C CA  . TYR B 104 ? 0.1961 0.1908 0.0815 0.0080  0.0148  -0.0126 102 TYR B CA  
1967 C C   . TYR B 104 ? 0.2299 0.2309 0.1144 0.0066  0.0015  -0.0150 102 TYR B C   
1968 O O   . TYR B 104 ? 0.2447 0.2376 0.1077 0.0042  -0.0033 -0.0171 102 TYR B O   
1969 C CB  . TYR B 104 ? 0.1847 0.1904 0.0974 0.0092  0.0186  -0.0126 102 TYR B CB  
1970 C CG  . TYR B 104 ? 0.1517 0.1525 0.0685 0.0090  0.0312  -0.0118 102 TYR B CG  
1971 C CD1 . TYR B 104 ? 0.1835 0.1837 0.1050 0.0101  0.0339  -0.0071 102 TYR B CD1 
1972 C CD2 . TYR B 104 ? 0.2194 0.2145 0.1351 0.0075  0.0420  -0.0160 102 TYR B CD2 
1973 C CE1 . TYR B 104 ? 0.1870 0.1829 0.1143 0.0088  0.0461  -0.0070 102 TYR B CE1 
1974 C CE2 . TYR B 104 ? 0.1934 0.1857 0.1177 0.0069  0.0544  -0.0157 102 TYR B CE2 
1975 C CZ  . TYR B 104 ? 0.2174 0.2108 0.1482 0.0070  0.0561  -0.0114 102 TYR B CZ  
1976 O OH  . TYR B 104 ? 0.2367 0.2260 0.1757 0.0053  0.0695  -0.0115 102 TYR B OH  
1977 N N   . LEU B 105 ? 0.2001 0.2145 0.1063 0.0077  -0.0047 -0.0145 103 LEU B N   
1978 C CA  . LEU B 105 ? 0.1953 0.2170 0.1063 0.0056  -0.0153 -0.0175 103 LEU B CA  
1979 C C   . LEU B 105 ? 0.2130 0.2419 0.1278 0.0079  -0.0273 -0.0122 103 LEU B C   
1980 O O   . LEU B 105 ? 0.2387 0.2749 0.1592 0.0057  -0.0372 -0.0147 103 LEU B O   
1981 C CB  . LEU B 105 ? 0.1807 0.2109 0.1133 0.0047  -0.0128 -0.0209 103 LEU B CB  
1982 C CG  . LEU B 105 ? 0.1903 0.2155 0.1245 0.0037  -0.0029 -0.0251 103 LEU B CG  
1983 C CD1 . LEU B 105 ? 0.2096 0.2419 0.1632 0.0043  -0.0019 -0.0257 103 LEU B CD1 
1984 C CD2 . LEU B 105 ? 0.2176 0.2338 0.1369 -0.0001 -0.0017 -0.0313 103 LEU B CD2 
1985 N N   . GLY B 106 ? 0.1750 0.2025 0.0902 0.0125  -0.0259 -0.0051 104 GLY B N   
1986 C CA  . GLY B 106 ? 0.1666 0.2017 0.0919 0.0165  -0.0355 0.0011  104 GLY B CA  
1987 C C   . GLY B 106 ? 0.2177 0.2557 0.1344 0.0159  -0.0509 0.0019  104 GLY B C   
1988 O O   . GLY B 106 ? 0.2247 0.2756 0.1610 0.0176  -0.0606 0.0039  104 GLY B O   
1989 N N   . SER B 107 ? 0.2688 0.2943 0.1562 0.0133  -0.0535 0.0006  105 SER B N   
1990 C CA  . SER B 107 ? 0.2935 0.3196 0.1675 0.0126  -0.0706 0.0024  105 SER B CA  
1991 C C   . SER B 107 ? 0.3073 0.3441 0.1922 0.0062  -0.0798 -0.0062 105 SER B C   
1992 O O   . SER B 107 ? 0.3843 0.4285 0.2699 0.0051  -0.0969 -0.0054 105 SER B O   
1993 C CB  . SER B 107 ? 0.3642 0.3694 0.1969 0.0117  -0.0702 0.0044  105 SER B CB  
1994 O OG  . SER B 107 ? 0.4289 0.4233 0.2443 0.0050  -0.0616 -0.0049 105 SER B OG  
1995 N N   . ARG B 108 ? 0.2947 0.3328 0.1901 0.0019  -0.0691 -0.0139 106 ARG B N   
1996 C CA  . ARG B 108 ? 0.3512 0.3985 0.2606 -0.0044 -0.0748 -0.0221 106 ARG B CA  
1997 C C   . ARG B 108 ? 0.3220 0.3849 0.2679 -0.0033 -0.0715 -0.0223 106 ARG B C   
1998 O O   . ARG B 108 ? 0.3675 0.4376 0.3279 -0.0087 -0.0742 -0.0287 106 ARG B O   
1999 C CB  . ARG B 108 ? 0.4052 0.4392 0.2966 -0.0108 -0.0659 -0.0313 106 ARG B CB  
2000 C CG  . ARG B 108 ? 0.4661 0.4944 0.3626 -0.0087 -0.0479 -0.0321 106 ARG B CG  
2001 C CD  . ARG B 108 ? 0.5194 0.5312 0.3935 -0.0131 -0.0388 -0.0394 106 ARG B CD  
2002 N NE  . ARG B 108 ? 0.5364 0.5402 0.4086 -0.0095 -0.0232 -0.0377 106 ARG B NE  
2003 C CZ  . ARG B 108 ? 0.5403 0.5300 0.3895 -0.0086 -0.0160 -0.0363 106 ARG B CZ  
2004 N NH1 . ARG B 108 ? 0.7075 0.6870 0.5283 -0.0107 -0.0233 -0.0357 106 ARG B NH1 
2005 N NH2 . ARG B 108 ? 0.5820 0.5672 0.4362 -0.0060 -0.0013 -0.0356 106 ARG B NH2 
2006 N N   . THR B 109 ? 0.2222 0.2880 0.1811 0.0029  -0.0643 -0.0159 107 THR B N   
2007 C CA  . THR B 109 ? 0.1997 0.2761 0.1881 0.0039  -0.0586 -0.0161 107 THR B CA  
2008 C C   . THR B 109 ? 0.1725 0.2630 0.1837 0.0074  -0.0685 -0.0112 107 THR B C   
2009 O O   . THR B 109 ? 0.2094 0.2994 0.2147 0.0128  -0.0752 -0.0039 107 THR B O   
2010 C CB  . THR B 109 ? 0.1933 0.2638 0.1830 0.0079  -0.0451 -0.0130 107 THR B CB  
2011 O OG1 . THR B 109 ? 0.1891 0.2485 0.1618 0.0055  -0.0368 -0.0168 107 THR B OG1 
2012 C CG2 . THR B 109 ? 0.1467 0.2240 0.1605 0.0078  -0.0386 -0.0141 107 THR B CG2 
2013 N N   . SER B 110 ? 0.2002 0.3023 0.2392 0.0052  -0.0675 -0.0142 108 SER B N   
2014 C CA  . SER B 110 ? 0.1977 0.3153 0.2649 0.0086  -0.0759 -0.0100 108 SER B CA  
2015 C C   . SER B 110 ? 0.1960 0.3121 0.2716 0.0170  -0.0685 -0.0020 108 SER B C   
2016 O O   . SER B 110 ? 0.1635 0.2689 0.2302 0.0180  -0.0549 -0.0020 108 SER B O   
2017 C CB  . SER B 110 ? 0.2097 0.3390 0.3071 0.0034  -0.0731 -0.0159 108 SER B CB  
2018 O OG  . SER B 110 ? 0.2112 0.3353 0.3173 0.0043  -0.0560 -0.0164 108 SER B OG  
2019 N N   . GLU B 111 ? 0.1776 0.3034 0.2692 0.0230  -0.0784 0.0050  109 GLU B N   
2020 C CA  . GLU B 111 ? 0.1603 0.2837 0.2623 0.0314  -0.0706 0.0127  109 GLU B CA  
2021 C C   . GLU B 111 ? 0.1641 0.2877 0.2867 0.0304  -0.0537 0.0093  109 GLU B C   
2022 O O   . GLU B 111 ? 0.1499 0.2628 0.2670 0.0336  -0.0412 0.0116  109 GLU B O   
2023 C CB  . GLU B 111 ? 0.2017 0.3371 0.3236 0.0388  -0.0846 0.0211  109 GLU B CB  
2024 C CG  . GLU B 111 ? 0.2317 0.3630 0.3268 0.0405  -0.1024 0.0261  109 GLU B CG  
2025 C CD  . GLU B 111 ? 0.4149 0.5247 0.4725 0.0427  -0.0949 0.0299  109 GLU B CD  
2026 O OE1 . GLU B 111 ? 0.3749 0.4774 0.4358 0.0492  -0.0848 0.0361  109 GLU B OE1 
2027 O OE2 . GLU B 111 ? 0.3956 0.4954 0.4213 0.0377  -0.0990 0.0267  109 GLU B OE2 
2028 N N   . LYS B 112 ? 0.1772 0.3110 0.3209 0.0251  -0.0526 0.0032  110 LYS B N   
2029 C CA  . LYS B 112 ? 0.1742 0.3062 0.3354 0.0236  -0.0359 0.0000  110 LYS B CA  
2030 C C   . LYS B 112 ? 0.1631 0.2770 0.2974 0.0208  -0.0226 -0.0031 110 LYS B C   
2031 O O   . LYS B 112 ? 0.1577 0.2629 0.2932 0.0228  -0.0093 -0.0022 110 LYS B O   
2032 C CB  . LYS B 112 ? 0.1594 0.3034 0.3445 0.0169  -0.0370 -0.0064 110 LYS B CB  
2033 C CG  . LYS B 112 ? 0.1962 0.3369 0.3993 0.0149  -0.0186 -0.0096 110 LYS B CG  
2034 C CD  . LYS B 112 ? 0.2725 0.4276 0.5070 0.0088  -0.0197 -0.0149 110 LYS B CD  
2035 C CE  . LYS B 112 ? 0.3541 0.5309 0.6282 0.0136  -0.0300 -0.0107 110 LYS B CE  
2036 N NZ  . LYS B 112 ? 0.3842 0.5793 0.6900 0.0066  -0.0377 -0.0163 110 LYS B NZ  
2037 N N   . VAL B 113 ? 0.0932 0.2013 0.2043 0.0159  -0.0264 -0.0072 111 VAL B N   
2038 C CA  . VAL B 113 ? 0.0882 0.1815 0.1756 0.0138  -0.0172 -0.0095 111 VAL B CA  
2039 C C   . VAL B 113 ? 0.0930 0.1775 0.1657 0.0185  -0.0144 -0.0046 111 VAL B C   
2040 O O   . VAL B 113 ? 0.1043 0.1790 0.1699 0.0184  -0.0044 -0.0052 111 VAL B O   
2041 C CB  . VAL B 113 ? 0.1086 0.1987 0.1780 0.0086  -0.0224 -0.0143 111 VAL B CB  
2042 C CG1 . VAL B 113 ? 0.1096 0.1869 0.1572 0.0083  -0.0158 -0.0151 111 VAL B CG1 
2043 C CG2 . VAL B 113 ? 0.1045 0.1992 0.1874 0.0027  -0.0213 -0.0200 111 VAL B CG2 
2044 N N   . LYS B 114 ? 0.1113 0.1976 0.1768 0.0221  -0.0236 -0.0001 112 LYS B N   
2045 C CA  . LYS B 114 ? 0.0972 0.1737 0.1488 0.0260  -0.0199 0.0046  112 LYS B CA  
2046 C C   . LYS B 114 ? 0.1046 0.1793 0.1715 0.0306  -0.0117 0.0083  112 LYS B C   
2047 O O   . LYS B 114 ? 0.1115 0.1753 0.1699 0.0305  -0.0022 0.0081  112 LYS B O   
2048 C CB  . LYS B 114 ? 0.1124 0.1881 0.1498 0.0288  -0.0304 0.0093  112 LYS B CB  
2049 C CG  . LYS B 114 ? 0.1361 0.2080 0.1525 0.0237  -0.0345 0.0048  112 LYS B CG  
2050 C CD  . LYS B 114 ? 0.1438 0.2100 0.1398 0.0260  -0.0427 0.0095  112 LYS B CD  
2051 C CE  . LYS B 114 ? 0.1720 0.2481 0.1784 0.0293  -0.0571 0.0141  112 LYS B CE  
2052 N NZ  . LYS B 114 ? 0.2799 0.3484 0.2594 0.0298  -0.0676 0.0174  112 LYS B NZ  
2053 N N   . ASN B 115 ? 0.0884 0.1736 0.1797 0.0343  -0.0150 0.0111  113 ASN B N   
2054 C CA  . ASN B 115 ? 0.0881 0.1710 0.1973 0.0393  -0.0054 0.0145  113 ASN B CA  
2055 C C   . ASN B 115 ? 0.0861 0.1592 0.1926 0.0348  0.0097  0.0086  113 ASN B C   
2056 O O   . ASN B 115 ? 0.0925 0.1541 0.1954 0.0365  0.0203  0.0094  113 ASN B O   
2057 C CB  . ASN B 115 ? 0.1006 0.1993 0.2432 0.0434  -0.0105 0.0173  113 ASN B CB  
2058 C CG  . ASN B 115 ? 0.1194 0.2258 0.2661 0.0501  -0.0259 0.0255  113 ASN B CG  
2059 O OD1 . ASN B 115 ? 0.2011 0.3230 0.3765 0.0539  -0.0341 0.0285  113 ASN B OD1 
2060 N ND2 . ASN B 115 ? 0.1190 0.2138 0.2396 0.0525  -0.0286 0.0299  113 ASN B ND2 
2061 N N   . LYS B 116 ? 0.0922 0.1687 0.2003 0.0291  0.0107  0.0028  114 LYS B N   
2062 C CA  . LYS B 116 ? 0.1226 0.1875 0.2233 0.0246  0.0238  -0.0022 114 LYS B CA  
2063 C C   . LYS B 116 ? 0.1020 0.1529 0.1757 0.0223  0.0267  -0.0036 114 LYS B C   
2064 O O   . LYS B 116 ? 0.1202 0.1583 0.1865 0.0210  0.0373  -0.0054 114 LYS B O   
2065 C CB  . LYS B 116 ? 0.1175 0.1859 0.2208 0.0189  0.0240  -0.0073 114 LYS B CB  
2066 C CG  . LYS B 116 ? 0.1408 0.1949 0.2362 0.0150  0.0386  -0.0112 114 LYS B CG  
2067 C CD  . LYS B 116 ? 0.1343 0.1840 0.2461 0.0179  0.0519  -0.0102 114 LYS B CD  
2068 C CE  . LYS B 116 ? 0.2631 0.2968 0.3666 0.0134  0.0681  -0.0144 114 LYS B CE  
2069 N NZ  . LYS B 116 ? 0.2882 0.3264 0.4010 0.0090  0.0701  -0.0172 114 LYS B NZ  
2070 N N   . ILE B 117 ? 0.0941 0.1468 0.1533 0.0211  0.0177  -0.0034 115 ILE B N   
2071 C CA  . ILE B 117 ? 0.0975 0.1401 0.1368 0.0190  0.0194  -0.0046 115 ILE B CA  
2072 C C   . ILE B 117 ? 0.1092 0.1438 0.1471 0.0219  0.0249  -0.0016 115 ILE B C   
2073 O O   . ILE B 117 ? 0.1200 0.1435 0.1480 0.0189  0.0316  -0.0044 115 ILE B O   
2074 C CB  . ILE B 117 ? 0.0911 0.1373 0.1192 0.0180  0.0109  -0.0046 115 ILE B CB  
2075 C CG1 . ILE B 117 ? 0.0848 0.1339 0.1104 0.0143  0.0081  -0.0087 115 ILE B CG1 
2076 C CG2 . ILE B 117 ? 0.0941 0.1323 0.1090 0.0168  0.0132  -0.0046 115 ILE B CG2 
2077 C CD1 . ILE B 117 ? 0.0796 0.1318 0.0963 0.0136  0.0012  -0.0092 115 ILE B CD1 
2078 N N   . LEU B 118 ? 0.0922 0.1310 0.1395 0.0275  0.0219  0.0040  116 LEU B N   
2079 C CA  . LEU B 118 ? 0.1146 0.1439 0.1616 0.0309  0.0283  0.0076  116 LEU B CA  
2080 C C   . LEU B 118 ? 0.1291 0.1497 0.1844 0.0310  0.0408  0.0056  116 LEU B C   
2081 O O   . LEU B 118 ? 0.1439 0.1509 0.1900 0.0291  0.0492  0.0038  116 LEU B O   
2082 C CB  . LEU B 118 ? 0.1213 0.1555 0.1759 0.0381  0.0217  0.0157  116 LEU B CB  
2083 C CG  . LEU B 118 ? 0.1566 0.1928 0.1957 0.0378  0.0120  0.0181  116 LEU B CG  
2084 C CD1 . LEU B 118 ? 0.1683 0.2084 0.2114 0.0451  0.0031  0.0267  116 LEU B CD1 
2085 C CD2 . LEU B 118 ? 0.1420 0.1659 0.1642 0.0344  0.0185  0.0166  116 LEU B CD2 
2086 N N   . GLU B 119 ? 0.1136 0.1408 0.1850 0.0318  0.0431  0.0044  117 GLU B N   
2087 C CA  . GLU B 119 ? 0.1368 0.1543 0.2165 0.0319  0.0576  0.0020  117 GLU B CA  
2088 C C   . GLU B 119 ? 0.1449 0.1472 0.2017 0.0242  0.0649  -0.0050 117 GLU B C   
2089 O O   . GLU B 119 ? 0.1599 0.1462 0.2087 0.0225  0.0763  -0.0077 117 GLU B O   
2090 C CB  . GLU B 119 ? 0.1591 0.1885 0.2640 0.0339  0.0591  0.0022  117 GLU B CB  
2091 C CG  . GLU B 119 ? 0.2447 0.2620 0.3541 0.0318  0.0767  -0.0021 117 GLU B CG  
2092 C CD  . GLU B 119 ? 0.3742 0.4008 0.5010 0.0298  0.0793  -0.0045 117 GLU B CD  
2093 O OE1 . GLU B 119 ? 0.4369 0.4532 0.5472 0.0233  0.0859  -0.0098 117 GLU B OE1 
2094 O OE2 . GLU B 119 ? 0.3631 0.4079 0.5193 0.0343  0.0729  -0.0008 117 GLU B OE2 
2095 N N   . LEU B 120 ? 0.1348 0.1411 0.1805 0.0194  0.0582  -0.0080 118 LEU B N   
2096 C CA  . LEU B 120 ? 0.1382 0.1311 0.1604 0.0127  0.0610  -0.0134 118 LEU B CA  
2097 C C   . LEU B 120 ? 0.1414 0.1256 0.1476 0.0100  0.0592  -0.0147 118 LEU B C   
2098 O O   . LEU B 120 ? 0.1564 0.1248 0.1483 0.0057  0.0666  -0.0189 118 LEU B O   
2099 C CB  . LEU B 120 ? 0.1308 0.1299 0.1458 0.0096  0.0529  -0.0149 118 LEU B CB  
2100 C CG  . LEU B 120 ? 0.1325 0.1342 0.1571 0.0090  0.0574  -0.0158 118 LEU B CG  
2101 C CD1 . LEU B 120 ? 0.1395 0.1471 0.1576 0.0067  0.0485  -0.0166 118 LEU B CD1 
2102 C CD2 . LEU B 120 ? 0.1491 0.1326 0.1631 0.0057  0.0718  -0.0193 118 LEU B CD2 
2103 N N   . LEU B 121 ? 0.1316 0.1249 0.1404 0.0120  0.0505  -0.0116 119 LEU B N   
2104 C CA  . LEU B 121 ? 0.1202 0.1068 0.1184 0.0088  0.0497  -0.0129 119 LEU B CA  
2105 C C   . LEU B 121 ? 0.1471 0.1196 0.1455 0.0092  0.0610  -0.0135 119 LEU B C   
2106 O O   . LEU B 121 ? 0.1531 0.1129 0.1382 0.0032  0.0646  -0.0185 119 LEU B O   
2107 C CB  . LEU B 121 ? 0.1199 0.1168 0.1221 0.0115  0.0419  -0.0088 119 LEU B CB  
2108 C CG  . LEU B 121 ? 0.1106 0.1173 0.1086 0.0096  0.0325  -0.0099 119 LEU B CG  
2109 C CD1 . LEU B 121 ? 0.0983 0.1121 0.0991 0.0129  0.0280  -0.0055 119 LEU B CD1 
2110 C CD2 . LEU B 121 ? 0.0998 0.1024 0.0875 0.0034  0.0303  -0.0147 119 LEU B CD2 
2111 N N   . TYR B 122 ? 0.1402 0.1144 0.1545 0.0161  0.0663  -0.0087 120 TYR B N   
2112 C CA  . TYR B 122 ? 0.1755 0.1349 0.1925 0.0178  0.0787  -0.0085 120 TYR B CA  
2113 C C   . TYR B 122 ? 0.1798 0.1231 0.1856 0.0122  0.0900  -0.0157 120 TYR B C   
2114 O O   . TYR B 122 ? 0.1866 0.1127 0.1793 0.0073  0.0976  -0.0204 120 TYR B O   
2115 C CB  . TYR B 122 ? 0.1850 0.1510 0.2252 0.0277  0.0814  -0.0009 120 TYR B CB  
2116 C CG  . TYR B 122 ? 0.1966 0.1462 0.2429 0.0308  0.0964  -0.0003 120 TYR B CG  
2117 C CD1 . TYR B 122 ? 0.2248 0.1609 0.2621 0.0295  0.1009  0.0000  120 TYR B CD1 
2118 C CD2 . TYR B 122 ? 0.2076 0.1514 0.2656 0.0328  0.1089  -0.0022 120 TYR B CD2 
2119 C CE1 . TYR B 122 ? 0.2026 0.1207 0.2443 0.0320  0.1163  -0.0002 120 TYR B CE1 
2120 C CE2 . TYR B 122 ? 0.2768 0.2023 0.3385 0.0349  0.1253  -0.0031 120 TYR B CE2 
2121 C CZ  . TYR B 122 ? 0.2650 0.1780 0.3193 0.0352  0.1285  -0.0016 120 TYR B CZ  
2122 O OH  . TYR B 122 ? 0.2940 0.1862 0.3514 0.0370  0.1464  -0.0031 120 TYR B OH  
2123 N N   . SER B 123 ? 0.1752 0.1223 0.1832 0.0120  0.0910  -0.0171 121 SER B N   
2124 C CA  . SER B 123 ? 0.2080 0.1368 0.2014 0.0067  0.1033  -0.0235 121 SER B CA  
2125 C C   . SER B 123 ? 0.2318 0.1472 0.1954 -0.0027 0.0992  -0.0302 121 SER B C   
2126 O O   . SER B 123 ? 0.2663 0.1605 0.2128 -0.0080 0.1097  -0.0360 121 SER B O   
2127 C CB  . SER B 123 ? 0.2132 0.1475 0.2138 0.0077  0.1061  -0.0234 121 SER B CB  
2128 O OG  . SER B 123 ? 0.1793 0.1202 0.1666 0.0036  0.0941  -0.0245 121 SER B OG  
2129 N N   . TRP B 124 ? 0.2112 0.1389 0.1696 -0.0049 0.0840  -0.0294 122 TRP B N   
2130 C CA  . TRP B 124 ? 0.2196 0.1392 0.1553 -0.0132 0.0768  -0.0348 122 TRP B CA  
2131 C C   . TRP B 124 ? 0.2308 0.1435 0.1643 -0.0169 0.0779  -0.0375 122 TRP B C   
2132 O O   . TRP B 124 ? 0.2503 0.1491 0.1644 -0.0252 0.0772  -0.0441 122 TRP B O   
2133 C CB  . TRP B 124 ? 0.2040 0.1395 0.1395 -0.0135 0.0611  -0.0328 122 TRP B CB  
2134 C CG  . TRP B 124 ? 0.1955 0.1368 0.1330 -0.0106 0.0601  -0.0304 122 TRP B CG  
2135 C CD1 . TRP B 124 ? 0.2084 0.1375 0.1379 -0.0113 0.0702  -0.0319 122 TRP B CD1 
2136 C CD2 . TRP B 124 ? 0.1678 0.1262 0.1148 -0.0075 0.0496  -0.0267 122 TRP B CD2 
2137 N NE1 . TRP B 124 ? 0.1969 0.1351 0.1318 -0.0090 0.0666  -0.0292 122 TRP B NE1 
2138 C CE2 . TRP B 124 ? 0.1739 0.1302 0.1199 -0.0065 0.0538  -0.0261 122 TRP B CE2 
2139 C CE3 . TRP B 124 ? 0.1490 0.1226 0.1054 -0.0057 0.0392  -0.0242 122 TRP B CE3 
2140 C CZ2 . TRP B 124 ? 0.1559 0.1250 0.1106 -0.0040 0.0472  -0.0233 122 TRP B CZ2 
2141 C CZ3 . TRP B 124 ? 0.1355 0.1208 0.0981 -0.0030 0.0326  -0.0217 122 TRP B CZ3 
2142 C CH2 . TRP B 124 ? 0.1402 0.1227 0.1012 -0.0025 0.0362  -0.0215 122 TRP B CH2 
2143 N N   . THR B 125 ? 0.2266 0.1480 0.1785 -0.0115 0.0788  -0.0324 123 THR B N   
2144 C CA  . THR B 125 ? 0.2172 0.1294 0.1680 -0.0150 0.0828  -0.0346 123 THR B CA  
2145 C C   . THR B 125 ? 0.2382 0.1265 0.1786 -0.0184 0.0980  -0.0400 123 THR B C   
2146 O O   . THR B 125 ? 0.2891 0.1641 0.2190 -0.0259 0.1007  -0.0459 123 THR B O   
2147 C CB  . THR B 125 ? 0.2193 0.1408 0.1886 -0.0075 0.0834  -0.0268 123 THR B CB  
2148 O OG1 . THR B 125 ? 0.2530 0.1719 0.2350 0.0010  0.0928  -0.0216 123 THR B OG1 
2149 C CG2 . THR B 125 ? 0.1900 0.1320 0.1663 -0.0048 0.0702  -0.0222 123 THR B CG2 
2150 N N   . VAL B 126 ? 0.2842 0.1667 0.2303 -0.0128 0.1093  -0.0381 124 VAL B N   
2151 C CA  A VAL B 126 ? 0.3168 0.1749 0.2547 -0.0149 0.1271  -0.0432 124 VAL B CA  
2152 C CA  B VAL B 126 ? 0.3160 0.1740 0.2537 -0.0150 0.1270  -0.0433 124 VAL B CA  
2153 C C   . VAL B 126 ? 0.3710 0.2114 0.2796 -0.0242 0.1298  -0.0521 124 VAL B C   
2154 O O   . VAL B 126 ? 0.4022 0.2186 0.2907 -0.0320 0.1390  -0.0602 124 VAL B O   
2155 C CB  A VAL B 126 ? 0.3032 0.1628 0.2646 -0.0040 0.1399  -0.0370 124 VAL B CB  
2156 C CB  B VAL B 126 ? 0.3065 0.1654 0.2676 -0.0042 0.1401  -0.0371 124 VAL B CB  
2157 C CG1 A VAL B 126 ? 0.3560 0.1883 0.3104 -0.0058 0.1611  -0.0426 124 VAL B CG1 
2158 C CG1 B VAL B 126 ? 0.3186 0.1845 0.3013 0.0041  0.1403  -0.0290 124 VAL B CG1 
2159 C CG2 A VAL B 126 ? 0.3099 0.1851 0.2962 0.0056  0.1349  -0.0272 124 VAL B CG2 
2160 C CG2 B VAL B 126 ? 0.2958 0.1728 0.2690 0.0009  0.1343  -0.0327 124 VAL B CG2 
2161 N N   . GLY B 127 ? 0.3094 0.1593 0.2136 -0.0236 0.1224  -0.0506 125 GLY B N   
2162 C CA  . GLY B 127 ? 0.3555 0.1882 0.2299 -0.0308 0.1245  -0.0569 125 GLY B CA  
2163 C C   . GLY B 127 ? 0.3357 0.1662 0.1842 -0.0402 0.1078  -0.0616 125 GLY B C   
2164 O O   . GLY B 127 ? 0.3784 0.1871 0.1948 -0.0479 0.1103  -0.0680 125 GLY B O   
2165 N N   . LEU B 128 ? 0.3133 0.1652 0.1751 -0.0395 0.0913  -0.0583 126 LEU B N   
2166 C CA  . LEU B 128 ? 0.3084 0.1639 0.1541 -0.0468 0.0733  -0.0615 126 LEU B CA  
2167 C C   . LEU B 128 ? 0.3384 0.2028 0.1961 -0.0507 0.0657  -0.0634 126 LEU B C   
2168 O O   . LEU B 128 ? 0.2876 0.1730 0.1605 -0.0491 0.0521  -0.0599 126 LEU B O   
2169 C CB  . LEU B 128 ? 0.2848 0.1590 0.1365 -0.0420 0.0605  -0.0554 126 LEU B CB  
2170 C CG  . LEU B 128 ? 0.3144 0.1773 0.1479 -0.0410 0.0651  -0.0545 126 LEU B CG  
2171 C CD1 . LEU B 128 ? 0.3031 0.1856 0.1492 -0.0350 0.0548  -0.0477 126 LEU B CD1 
2172 C CD2 . LEU B 128 ? 0.3496 0.1894 0.1448 -0.0505 0.0607  -0.0609 126 LEU B CD2 
2173 N N   . PRO B 129 ? 0.3752 0.2227 0.2284 -0.0557 0.0767  -0.0691 127 PRO B N   
2174 C CA  . PRO B 129 ? 0.3751 0.2299 0.2437 -0.0589 0.0734  -0.0703 127 PRO B CA  
2175 C C   . PRO B 129 ? 0.3939 0.2547 0.2546 -0.0690 0.0554  -0.0759 127 PRO B C   
2176 O O   . PRO B 129 ? 0.3927 0.2663 0.2719 -0.0714 0.0499  -0.0760 127 PRO B O   
2177 C CB  . PRO B 129 ? 0.4223 0.2528 0.2847 -0.0623 0.0914  -0.0756 127 PRO B CB  
2178 C CG  . PRO B 129 ? 0.5075 0.3229 0.3600 -0.0572 0.1061  -0.0747 127 PRO B CG  
2179 C CD  . PRO B 129 ? 0.4024 0.2227 0.2393 -0.0576 0.0955  -0.0739 127 PRO B CD  
2180 N N   . GLU B 130 ? 0.3641 0.2195 0.2014 -0.0730 0.0452  -0.0786 128 GLU B N   
2181 C CA  . GLU B 130 ? 0.3844 0.2515 0.2192 -0.0795 0.0240  -0.0811 128 GLU B CA  
2182 C C   . GLU B 130 ? 0.3616 0.2587 0.2268 -0.0728 0.0130  -0.0737 128 GLU B C   
2183 O O   . GLU B 130 ? 0.3687 0.2789 0.2473 -0.0781 0.0005  -0.0762 128 GLU B O   
2184 C CB  . GLU B 130 ? 0.3818 0.2360 0.1834 -0.0830 0.0144  -0.0831 128 GLU B CB  
2185 C CG  . GLU B 130 ? 0.4973 0.3516 0.2935 -0.0734 0.0195  -0.0756 128 GLU B CG  
2186 C CD  . GLU B 130 ? 0.6327 0.4577 0.4002 -0.0750 0.0369  -0.0791 128 GLU B CD  
2187 O OE1 . GLU B 130 ? 0.4807 0.2944 0.2533 -0.0751 0.0546  -0.0821 128 GLU B OE1 
2188 O OE2 . GLU B 130 ? 0.6243 0.4357 0.3629 -0.0765 0.0333  -0.0790 128 GLU B OE2 
2189 N N   . GLU B 131 ? 0.2839 0.1909 0.1593 -0.0619 0.0174  -0.0655 129 GLU B N   
2190 C CA  . GLU B 131 ? 0.2432 0.1751 0.1424 -0.0552 0.0085  -0.0587 129 GLU B CA  
2191 C C   . GLU B 131 ? 0.2361 0.1771 0.1598 -0.0525 0.0169  -0.0565 129 GLU B C   
2192 O O   . GLU B 131 ? 0.2430 0.1867 0.1755 -0.0444 0.0264  -0.0508 129 GLU B O   
2193 C CB  . GLU B 131 ? 0.2435 0.1798 0.1416 -0.0458 0.0106  -0.0518 129 GLU B CB  
2194 C CG  . GLU B 131 ? 0.2531 0.1760 0.1241 -0.0473 0.0063  -0.0526 129 GLU B CG  
2195 C CD  . GLU B 131 ? 0.3395 0.2691 0.2045 -0.0505 -0.0129 -0.0528 129 GLU B CD  
2196 O OE1 . GLU B 131 ? 0.3028 0.2168 0.1393 -0.0542 -0.0187 -0.0546 129 GLU B OE1 
2197 O OE2 . GLU B 131 ? 0.3185 0.2682 0.2074 -0.0492 -0.0221 -0.0510 129 GLU B OE2 
2198 N N   . VAL B 132 ? 0.2182 0.1631 0.1524 -0.0598 0.0133  -0.0611 130 VAL B N   
2199 C CA  . VAL B 132 ? 0.2357 0.1844 0.1894 -0.0586 0.0233  -0.0592 130 VAL B CA  
2200 C C   . VAL B 132 ? 0.2053 0.1708 0.1772 -0.0490 0.0245  -0.0508 130 VAL B C   
2201 O O   . VAL B 132 ? 0.1922 0.1556 0.1719 -0.0448 0.0354  -0.0467 130 VAL B O   
2202 C CB  . VAL B 132 ? 0.2681 0.2194 0.2325 -0.0694 0.0189  -0.0662 130 VAL B CB  
2203 C CG1 . VAL B 132 ? 0.3389 0.2685 0.2831 -0.0798 0.0216  -0.0754 130 VAL B CG1 
2204 C CG2 . VAL B 132 ? 0.2619 0.2325 0.2379 -0.0718 0.0011  -0.0670 130 VAL B CG2 
2205 N N   . LYS B 133 ? 0.1792 0.1599 0.1567 -0.0458 0.0134  -0.0482 131 LYS B N   
2206 C CA  . LYS B 133 ? 0.1539 0.1487 0.1469 -0.0383 0.0149  -0.0419 131 LYS B CA  
2207 C C   . LYS B 133 ? 0.1365 0.1272 0.1224 -0.0296 0.0218  -0.0359 131 LYS B C   
2208 O O   . LYS B 133 ? 0.1218 0.1182 0.1158 -0.0238 0.0262  -0.0308 131 LYS B O   
2209 C CB  . LYS B 133 ? 0.1420 0.1525 0.1443 -0.0371 0.0022  -0.0411 131 LYS B CB  
2210 C CG  . LYS B 133 ? 0.1532 0.1739 0.1732 -0.0442 -0.0050 -0.0456 131 LYS B CG  
2211 C CD  . LYS B 133 ? 0.1505 0.1861 0.1804 -0.0414 -0.0184 -0.0439 131 LYS B CD  
2212 C CE  . LYS B 133 ? 0.1782 0.2280 0.2342 -0.0473 -0.0251 -0.0476 131 LYS B CE  
2213 N NZ  . LYS B 133 ? 0.1447 0.2084 0.2118 -0.0450 -0.0408 -0.0462 131 LYS B NZ  
2214 N N   . ILE B 134 ? 0.1415 0.1228 0.1124 -0.0288 0.0221  -0.0368 132 ILE B N   
2215 C CA  . ILE B 134 ? 0.1436 0.1221 0.1123 -0.0213 0.0291  -0.0319 132 ILE B CA  
2216 C C   . ILE B 134 ? 0.1457 0.1168 0.1194 -0.0190 0.0402  -0.0294 132 ILE B C   
2217 O O   . ILE B 134 ? 0.1292 0.1058 0.1103 -0.0122 0.0426  -0.0234 132 ILE B O   
2218 C CB  . ILE B 134 ? 0.1485 0.1159 0.1020 -0.0218 0.0310  -0.0338 132 ILE B CB  
2219 C CG1 . ILE B 134 ? 0.1423 0.1151 0.0887 -0.0224 0.0203  -0.0342 132 ILE B CG1 
2220 C CG2 . ILE B 134 ? 0.1391 0.1065 0.0982 -0.0142 0.0390  -0.0289 132 ILE B CG2 
2221 C CD1 . ILE B 134 ? 0.1559 0.1146 0.0835 -0.0235 0.0235  -0.0359 132 ILE B CD1 
2222 N N   . ALA B 135 ? 0.1733 0.1309 0.1419 -0.0250 0.0463  -0.0341 133 ALA B N   
2223 C CA  . ALA B 135 ? 0.1846 0.1329 0.1582 -0.0230 0.0575  -0.0315 133 ALA B CA  
2224 C C   . ALA B 135 ? 0.1691 0.1261 0.1539 -0.0212 0.0572  -0.0272 133 ALA B C   
2225 O O   . ALA B 135 ? 0.1790 0.1334 0.1671 -0.0145 0.0633  -0.0204 133 ALA B O   
2226 C CB  . ALA B 135 ? 0.2006 0.1312 0.1661 -0.0315 0.0644  -0.0388 133 ALA B CB  
2227 N N   . GLU B 136 ? 0.1667 0.1334 0.1574 -0.0269 0.0504  -0.0307 134 GLU B N   
2228 C CA  . GLU B 136 ? 0.1614 0.1346 0.1627 -0.0260 0.0531  -0.0274 134 GLU B CA  
2229 C C   . GLU B 136 ? 0.1478 0.1287 0.1485 -0.0167 0.0514  -0.0198 134 GLU B C   
2230 O O   . GLU B 136 ? 0.1582 0.1346 0.1583 -0.0125 0.0578  -0.0140 134 GLU B O   
2231 C CB  . GLU B 136 ? 0.1681 0.1533 0.1808 -0.0330 0.0460  -0.0326 134 GLU B CB  
2232 C CG  . GLU B 136 ? 0.2241 0.2029 0.2407 -0.0438 0.0470  -0.0404 134 GLU B CG  
2233 C CD  . GLU B 136 ? 0.3257 0.3201 0.3577 -0.0503 0.0364  -0.0455 134 GLU B CD  
2234 O OE1 . GLU B 136 ? 0.4398 0.4338 0.4682 -0.0573 0.0270  -0.0521 134 GLU B OE1 
2235 O OE2 . GLU B 136 ? 0.2208 0.2279 0.2674 -0.0475 0.0364  -0.0426 134 GLU B OE2 
2236 N N   . ALA B 137 ? 0.1212 0.1114 0.1198 -0.0138 0.0429  -0.0197 135 ALA B N   
2237 C CA  . ALA B 137 ? 0.1161 0.1135 0.1138 -0.0065 0.0403  -0.0141 135 ALA B CA  
2238 C C   . ALA B 137 ? 0.1216 0.1121 0.1151 0.0002  0.0444  -0.0082 135 ALA B C   
2239 O O   . ALA B 137 ? 0.1195 0.1098 0.1109 0.0051  0.0454  -0.0023 135 ALA B O   
2240 C CB  . ALA B 137 ? 0.0988 0.1061 0.0960 -0.0057 0.0312  -0.0160 135 ALA B CB  
2241 N N   . TYR B 138 ? 0.1360 0.1193 0.1281 0.0003  0.0472  -0.0095 136 TYR B N   
2242 C CA  . TYR B 138 ? 0.1408 0.1193 0.1346 0.0076  0.0511  -0.0036 136 TYR B CA  
2243 C C   . TYR B 138 ? 0.1540 0.1219 0.1472 0.0102  0.0586  0.0017  136 TYR B C   
2244 O O   . TYR B 138 ? 0.1603 0.1279 0.1538 0.0177  0.0578  0.0096  136 TYR B O   
2245 C CB  . TYR B 138 ? 0.1465 0.1172 0.1405 0.0068  0.0561  -0.0069 136 TYR B CB  
2246 C CG  . TYR B 138 ? 0.1510 0.1198 0.1533 0.0151  0.0601  -0.0009 136 TYR B CG  
2247 C CD1 . TYR B 138 ? 0.1433 0.1248 0.1529 0.0209  0.0530  0.0035  136 TYR B CD1 
2248 C CD2 . TYR B 138 ? 0.1802 0.1348 0.1852 0.0174  0.0707  0.0010  136 TYR B CD2 
2249 C CE1 . TYR B 138 ? 0.1509 0.1335 0.1732 0.0286  0.0551  0.0091  136 TYR B CE1 
2250 C CE2 . TYR B 138 ? 0.1777 0.1320 0.1947 0.0264  0.0738  0.0078  136 TYR B CE2 
2251 C CZ  . TYR B 138 ? 0.1833 0.1529 0.2102 0.0320  0.0652  0.0118  136 TYR B CZ  
2252 O OH  . TYR B 138 ? 0.1855 0.1572 0.2292 0.0408  0.0672  0.0183  136 TYR B OH  
2253 N N   . GLN B 139 ? 0.1578 0.1162 0.1496 0.0036  0.0653  -0.0024 137 GLN B N   
2254 C CA  . GLN B 139 ? 0.1864 0.1318 0.1767 0.0050  0.0745  0.0024  137 GLN B CA  
2255 C C   . GLN B 139 ? 0.1742 0.1234 0.1602 0.0082  0.0724  0.0084  137 GLN B C   
2256 O O   . GLN B 139 ? 0.1920 0.1318 0.1727 0.0143  0.0764  0.0168  137 GLN B O   
2257 C CB  . GLN B 139 ? 0.1835 0.1184 0.1746 -0.0048 0.0823  -0.0049 137 GLN B CB  
2258 C CG  . GLN B 139 ? 0.2080 0.1306 0.1977 -0.0075 0.0882  -0.0099 137 GLN B CG  
2259 C CD  . GLN B 139 ? 0.2077 0.1160 0.1983 0.0008  0.0979  -0.0027 137 GLN B CD  
2260 O OE1 . GLN B 139 ? 0.2082 0.1173 0.2018 0.0073  0.0977  -0.0002 137 GLN B OE1 
2261 N NE2 . GLN B 139 ? 0.2210 0.1154 0.2107 0.0007  0.1075  0.0010  137 GLN B NE2 
2262 N N   . MET B 140 ? 0.1765 0.1376 0.1635 0.0042  0.0668  0.0045  138 MET B N   
2263 C CA  . MET B 140 ? 0.1806 0.1435 0.1612 0.0064  0.0665  0.0089  138 MET B CA  
2264 C C   . MET B 140 ? 0.1829 0.1484 0.1554 0.0152  0.0593  0.0162  138 MET B C   
2265 O O   . MET B 140 ? 0.1931 0.1504 0.1539 0.0196  0.0610  0.0235  138 MET B O   
2266 C CB  . MET B 140 ? 0.1710 0.1466 0.1576 0.0010  0.0626  0.0025  138 MET B CB  
2267 C CG  . MET B 140 ? 0.1847 0.1615 0.1641 0.0028  0.0639  0.0055  138 MET B CG  
2268 S SD  . MET B 140 ? 0.1708 0.1554 0.1402 0.0096  0.0524  0.0088  138 MET B SD  
2269 C CE  . MET B 140 ? 0.1411 0.1417 0.1239 0.0058  0.0445  0.0006  138 MET B CE  
2270 N N   . LEU B 141 ? 0.1579 0.1339 0.1358 0.0174  0.0509  0.0145  139 LEU B N   
2271 C CA  . LEU B 141 ? 0.1543 0.1350 0.1289 0.0248  0.0427  0.0205  139 LEU B CA  
2272 C C   . LEU B 141 ? 0.1781 0.1484 0.1512 0.0322  0.0450  0.0295  139 LEU B C   
2273 O O   . LEU B 141 ? 0.1932 0.1608 0.1562 0.0377  0.0400  0.0371  139 LEU B O   
2274 C CB  . LEU B 141 ? 0.1380 0.1313 0.1223 0.0249  0.0354  0.0164  139 LEU B CB  
2275 C CG  . LEU B 141 ? 0.1216 0.1244 0.1055 0.0196  0.0313  0.0096  139 LEU B CG  
2276 C CD1 . LEU B 141 ? 0.1066 0.1171 0.0986 0.0187  0.0275  0.0054  139 LEU B CD1 
2277 C CD2 . LEU B 141 ? 0.1145 0.1211 0.0889 0.0210  0.0258  0.0115  139 LEU B CD2 
2278 N N   . LYS B 142 ? 0.1635 0.1255 0.1446 0.0321  0.0531  0.0289  140 LYS B N   
2279 C CA  A LYS B 142 ? 0.1789 0.1283 0.1609 0.0396  0.0579  0.0377  140 LYS B CA  
2280 C CA  B LYS B 142 ? 0.1820 0.1323 0.1638 0.0400  0.0570  0.0381  140 LYS B CA  
2281 C C   . LYS B 142 ? 0.2015 0.1367 0.1676 0.0407  0.0627  0.0444  140 LYS B C   
2282 O O   . LYS B 142 ? 0.2178 0.1471 0.1757 0.0489  0.0587  0.0547  140 LYS B O   
2283 C CB  A LYS B 142 ? 0.1802 0.1190 0.1710 0.0368  0.0697  0.0334  140 LYS B CB  
2284 C CB  B LYS B 142 ? 0.1821 0.1236 0.1752 0.0394  0.0671  0.0351  140 LYS B CB  
2285 C CG  A LYS B 142 ? 0.2134 0.1569 0.2189 0.0404  0.0696  0.0320  140 LYS B CG  
2286 C CG  B LYS B 142 ? 0.1650 0.1170 0.1696 0.0371  0.0649  0.0279  140 LYS B CG  
2287 C CD  A LYS B 142 ? 0.1781 0.1108 0.1861 0.0336  0.0811  0.0233  140 LYS B CD  
2288 C CD  B LYS B 142 ? 0.1628 0.1315 0.1749 0.0425  0.0529  0.0310  140 LYS B CD  
2289 C CE  A LYS B 142 ? 0.2342 0.1458 0.2397 0.0338  0.0944  0.0257  140 LYS B CE  
2290 C CE  B LYS B 142 ? 0.2279 0.1965 0.2505 0.0535  0.0500  0.0414  140 LYS B CE  
2291 N NZ  A LYS B 142 ? 0.2064 0.1059 0.2146 0.0286  0.1055  0.0174  140 LYS B NZ  
2292 N NZ  B LYS B 142 ? 0.2093 0.1965 0.2431 0.0569  0.0375  0.0424  140 LYS B NZ  
2293 N N   . LYS B 143 ? 0.2009 0.1306 0.1627 0.0323  0.0712  0.0385  141 LYS B N   
2294 C CA  . LYS B 143 ? 0.2526 0.1664 0.2002 0.0317  0.0799  0.0437  141 LYS B CA  
2295 C C   . LYS B 143 ? 0.2474 0.1621 0.1769 0.0356  0.0724  0.0498  141 LYS B C   
2296 O O   . LYS B 143 ? 0.2764 0.1751 0.1894 0.0409  0.0753  0.0596  141 LYS B O   
2297 C CB  . LYS B 143 ? 0.2168 0.1279 0.1690 0.0207  0.0903  0.0349  141 LYS B CB  
2298 C CG  . LYS B 143 ? 0.2700 0.1636 0.2094 0.0191  0.1023  0.0397  141 LYS B CG  
2299 C CD  . LYS B 143 ? 0.2601 0.1531 0.2108 0.0076  0.1130  0.0305  141 LYS B CD  
2300 C CE  . LYS B 143 ? 0.3526 0.2281 0.2910 0.0058  0.1269  0.0354  141 LYS B CE  
2301 N NZ  . LYS B 143 ? 0.4651 0.3346 0.4179 -0.0049 0.1405  0.0281  141 LYS B NZ  
2302 N N   . GLN B 144 ? 0.2435 0.1743 0.1736 0.0335  0.0627  0.0446  142 GLN B N   
2303 C CA  . GLN B 144 ? 0.2635 0.1948 0.1750 0.0360  0.0551  0.0483  142 GLN B CA  
2304 C C   . GLN B 144 ? 0.2925 0.2280 0.1999 0.0448  0.0407  0.0560  142 GLN B C   
2305 O O   . GLN B 144 ? 0.3053 0.2413 0.1963 0.0463  0.0321  0.0585  142 GLN B O   
2306 C CB  . GLN B 144 ? 0.2480 0.1940 0.1635 0.0299  0.0514  0.0388  142 GLN B CB  
2307 C CG  . GLN B 144 ? 0.2345 0.1794 0.1565 0.0221  0.0628  0.0319  142 GLN B CG  
2308 C CD  . GLN B 144 ? 0.3810 0.3073 0.2862 0.0207  0.0757  0.0361  142 GLN B CD  
2309 O OE1 . GLN B 144 ? 0.4465 0.3621 0.3556 0.0183  0.0869  0.0372  142 GLN B OE1 
2310 N NE2 . GLN B 144 ? 0.3623 0.2837 0.2480 0.0213  0.0750  0.0377  142 GLN B NE2 
2311 N N   . GLY B 145 ? 0.2346 0.1732 0.1586 0.0500  0.0386  0.0593  143 GLY B N   
2312 C CA  . GLY B 145 ? 0.2520 0.1961 0.1789 0.0592  0.0251  0.0675  143 GLY B CA  
2313 C C   . GLY B 145 ? 0.2545 0.2202 0.1948 0.0586  0.0116  0.0623  143 GLY B C   
2314 O O   . GLY B 145 ? 0.2704 0.2429 0.2113 0.0646  -0.0024 0.0682  143 GLY B O   
2315 N N   . ILE B 146 ? 0.2462 0.2225 0.1974 0.0512  0.0150  0.0515  144 ILE B N   
2316 C CA  . ILE B 146 ? 0.2641 0.2587 0.2283 0.0499  0.0047  0.0462  144 ILE B CA  
2317 C C   . ILE B 146 ? 0.2903 0.2919 0.2797 0.0547  0.0049  0.0477  144 ILE B C   
2318 O O   . ILE B 146 ? 0.3167 0.3132 0.3154 0.0529  0.0163  0.0445  144 ILE B O   
2319 C CB  . ILE B 146 ? 0.2292 0.2302 0.1965 0.0414  0.0094  0.0352  144 ILE B CB  
2320 C CG1 . ILE B 146 ? 0.2329 0.2267 0.1813 0.0364  0.0136  0.0325  144 ILE B CG1 
2321 C CG2 . ILE B 146 ? 0.2358 0.2528 0.2149 0.0400  0.0002  0.0304  144 ILE B CG2 
2322 C CD1 . ILE B 146 ? 0.2511 0.2424 0.1795 0.0377  0.0052  0.0356  144 ILE B CD1 
2323 N N   . VAL B 147 ? 0.2467 0.2592 0.2474 0.0604  -0.0073 0.0525  145 VAL B N   
2324 C CA  . VAL B 147 ? 0.2375 0.2569 0.2660 0.0665  -0.0064 0.0554  145 VAL B CA  
2325 C C   . VAL B 147 ? 0.2472 0.2865 0.2945 0.0652  -0.0167 0.0512  145 VAL B C   
2326 O O   . VAL B 147 ? 0.2351 0.2816 0.2720 0.0617  -0.0281 0.0490  145 VAL B O   
2327 C CB  . VAL B 147 ? 0.3389 0.3527 0.3715 0.0776  -0.0114 0.0684  145 VAL B CB  
2328 C CG1 . VAL B 147 ? 0.3513 0.3429 0.3686 0.0795  0.0016  0.0732  145 VAL B CG1 
2329 C CG2 . VAL B 147 ? 0.3395 0.3592 0.3596 0.0808  -0.0305 0.0747  145 VAL B CG2 
2330 N N   . LYS B 148 ? 0.2989 0.3464 0.3750 0.0683  -0.0128 0.0509  146 LYS B N   
2331 C CA  . LYS B 148 ? 0.3044 0.3715 0.4032 0.0675  -0.0221 0.0479  146 LYS B CA  
2332 C C   . LYS B 148 ? 0.3301 0.4088 0.4353 0.0733  -0.0416 0.0556  146 LYS B C   
2333 O O   . LYS B 148 ? 0.4697 0.5413 0.5678 0.0807  -0.0465 0.0652  146 LYS B O   
2334 C CB  . LYS B 148 ? 0.3263 0.3993 0.4573 0.0698  -0.0117 0.0460  146 LYS B CB  
2335 C CG  . LYS B 148 ? 0.3454 0.4062 0.4710 0.0647  0.0062  0.0390  146 LYS B CG  
2336 C CD  . LYS B 148 ? 0.3662 0.4267 0.5218 0.0702  0.0187  0.0404  146 LYS B CD  
2337 C CE  . LYS B 148 ? 0.3737 0.4427 0.5458 0.0645  0.0252  0.0322  146 LYS B CE  
2338 N NZ  . LYS B 148 ? 0.4023 0.4541 0.5712 0.0620  0.0459  0.0272  146 LYS B NZ  
2339 N N   . GLY C 3   ? 0.8035 0.6223 0.4433 -0.0054 -0.0893 0.0593  3   GLY C N   
2340 C CA  . GLY C 3   ? 0.7118 0.5538 0.3918 -0.0121 -0.0977 0.0634  3   GLY C CA  
2341 C C   . GLY C 3   ? 0.6413 0.5106 0.3623 -0.0153 -0.0863 0.0615  3   GLY C C   
2342 O O   . GLY C 3   ? 0.5952 0.4739 0.3247 -0.0121 -0.0679 0.0630  3   GLY C O   
2343 N N   . PHE C 4   ? 0.4591 0.3389 0.2042 -0.0210 -0.0970 0.0577  4   PHE C N   
2344 C CA  . PHE C 4   ? 0.4200 0.3249 0.2059 -0.0250 -0.0897 0.0573  4   PHE C CA  
2345 C C   . PHE C 4   ? 0.3954 0.3040 0.1890 -0.0258 -0.0891 0.0493  4   PHE C C   
2346 O O   . PHE C 4   ? 0.4529 0.3496 0.2344 -0.0265 -0.1015 0.0446  4   PHE C O   
2347 C CB  . PHE C 4   ? 0.3917 0.3079 0.2066 -0.0314 -0.1009 0.0624  4   PHE C CB  
2348 C CG  . PHE C 4   ? 0.3797 0.2966 0.1934 -0.0311 -0.0998 0.0710  4   PHE C CG  
2349 C CD1 . PHE C 4   ? 0.3809 0.3133 0.2110 -0.0300 -0.0833 0.0752  4   PHE C CD1 
2350 C CD2 . PHE C 4   ? 0.4634 0.3640 0.2568 -0.0312 -0.1148 0.0748  4   PHE C CD2 
2351 C CE1 . PHE C 4   ? 0.3934 0.3271 0.2232 -0.0293 -0.0808 0.0832  4   PHE C CE1 
2352 C CE2 . PHE C 4   ? 0.5520 0.4527 0.3428 -0.0304 -0.1131 0.0831  4   PHE C CE2 
2353 C CZ  . PHE C 4   ? 0.4496 0.3673 0.2588 -0.0293 -0.0952 0.0874  4   PHE C CZ  
2354 N N   . SER C 5   ? 0.3371 0.2606 0.1488 -0.0249 -0.0743 0.0475  5   SER C N   
2355 C CA  . SER C 5   ? 0.3542 0.2855 0.1807 -0.0261 -0.0729 0.0409  5   SER C CA  
2356 C C   . SER C 5   ? 0.3266 0.2654 0.1787 -0.0317 -0.0853 0.0405  5   SER C C   
2357 O O   . SER C 5   ? 0.3695 0.3166 0.2413 -0.0354 -0.0884 0.0461  5   SER C O   
2358 C CB  . SER C 5   ? 0.3078 0.2554 0.1537 -0.0248 -0.0566 0.0407  5   SER C CB  
2359 O OG  . SER C 5   ? 0.3236 0.2740 0.1741 -0.0242 -0.0538 0.0340  5   SER C OG  
2360 N N   . ASP C 6   ? 0.3291 0.2645 0.1824 -0.0321 -0.0909 0.0342  6   ASP C N   
2361 C CA  . ASP C 6   ? 0.3275 0.2720 0.2108 -0.0363 -0.0968 0.0332  6   ASP C CA  
2362 C C   . ASP C 6   ? 0.3042 0.2629 0.2066 -0.0356 -0.0843 0.0302  6   ASP C C   
2363 O O   . ASP C 6   ? 0.3357 0.2990 0.2582 -0.0374 -0.0867 0.0278  6   ASP C O   
2364 C CB  . ASP C 6   ? 0.3453 0.2776 0.2235 -0.0371 -0.1113 0.0287  6   ASP C CB  
2365 C CG  . ASP C 6   ? 0.4576 0.3829 0.3167 -0.0332 -0.1076 0.0210  6   ASP C CG  
2366 O OD1 . ASP C 6   ? 0.4291 0.3609 0.2845 -0.0304 -0.0934 0.0192  6   ASP C OD1 
2367 O OD2 . ASP C 6   ? 0.6196 0.5333 0.4697 -0.0332 -0.1190 0.0168  6   ASP C OD2 
2368 N N   . ASP C 7   ? 0.2376 0.2018 0.1337 -0.0325 -0.0711 0.0302  7   ASP C N   
2369 C CA  . ASP C 7   ? 0.2057 0.1823 0.1180 -0.0315 -0.0603 0.0273  7   ASP C CA  
2370 C C   . ASP C 7   ? 0.1909 0.1801 0.1198 -0.0326 -0.0518 0.0324  7   ASP C C   
2371 O O   . ASP C 7   ? 0.1963 0.1856 0.1253 -0.0342 -0.0536 0.0383  7   ASP C O   
2372 C CB  . ASP C 7   ? 0.2145 0.1867 0.1089 -0.0269 -0.0518 0.0226  7   ASP C CB  
2373 C CG  . ASP C 7   ? 0.1943 0.1757 0.1032 -0.0258 -0.0453 0.0178  7   ASP C CG  
2374 O OD1 . ASP C 7   ? 0.1766 0.1662 0.1071 -0.0280 -0.0471 0.0176  7   ASP C OD1 
2375 O OD2 . ASP C 7   ? 0.2006 0.1789 0.0979 -0.0224 -0.0385 0.0143  7   ASP C OD2 
2376 N N   . VAL C 8   ? 0.1731 0.1725 0.1149 -0.0313 -0.0426 0.0300  8   VAL C N   
2377 C CA  . VAL C 8   ? 0.1616 0.1734 0.1211 -0.0322 -0.0346 0.0335  8   VAL C CA  
2378 C C   . VAL C 8   ? 0.1551 0.1701 0.1108 -0.0278 -0.0235 0.0311  8   VAL C C   
2379 O O   . VAL C 8   ? 0.1650 0.1738 0.1076 -0.0248 -0.0219 0.0266  8   VAL C O   
2380 C CB  . VAL C 8   ? 0.1314 0.1511 0.1145 -0.0355 -0.0358 0.0328  8   VAL C CB  
2381 C CG1 . VAL C 8   ? 0.1375 0.1522 0.1274 -0.0397 -0.0459 0.0356  8   VAL C CG1 
2382 C CG2 . VAL C 8   ? 0.1304 0.1502 0.1143 -0.0330 -0.0339 0.0262  8   VAL C CG2 
2383 N N   . PRO C 9   ? 0.1475 0.1717 0.1154 -0.0272 -0.0153 0.0343  9   PRO C N   
2384 C CA  . PRO C 9   ? 0.1435 0.1711 0.1136 -0.0231 -0.0048 0.0325  9   PRO C CA  
2385 C C   . PRO C 9   ? 0.1316 0.1640 0.1117 -0.0225 -0.0044 0.0269  9   PRO C C   
2386 O O   . PRO C 9   ? 0.1228 0.1589 0.1136 -0.0254 -0.0099 0.0253  9   PRO C O   
2387 C CB  . PRO C 9   ? 0.1529 0.1910 0.1407 -0.0235 0.0018  0.0371  9   PRO C CB  
2388 C CG  . PRO C 9   ? 0.1459 0.1826 0.1314 -0.0268 -0.0036 0.0424  9   PRO C CG  
2389 C CD  . PRO C 9   ? 0.1431 0.1744 0.1246 -0.0304 -0.0152 0.0402  9   PRO C CD  
2390 N N   . MET C 10  ? 0.1539 0.1850 0.1309 -0.0186 0.0028  0.0245  10  MET C N   
2391 C CA  . MET C 10  ? 0.1407 0.1760 0.1269 -0.0177 0.0032  0.0196  10  MET C CA  
2392 C C   . MET C 10  ? 0.1276 0.1746 0.1371 -0.0187 0.0046  0.0199  10  MET C C   
2393 O O   . MET C 10  ? 0.1274 0.1797 0.1471 -0.0181 0.0103  0.0233  10  MET C O   
2394 C CB  . MET C 10  ? 0.1554 0.1858 0.1341 -0.0135 0.0109  0.0179  10  MET C CB  
2395 C CG  . MET C 10  ? 0.1496 0.1845 0.1384 -0.0124 0.0110  0.0133  10  MET C CG  
2396 S SD  . MET C 10  ? 0.1642 0.1922 0.1454 -0.0082 0.0206  0.0120  10  MET C SD  
2397 C CE  . MET C 10  ? 0.1812 0.2135 0.1786 -0.0058 0.0304  0.0166  10  MET C CE  
2398 N N   . VAL C 11  ? 0.0983 0.1482 0.1157 -0.0201 -0.0004 0.0165  11  VAL C N   
2399 C CA  . VAL C 11  ? 0.0889 0.1471 0.1252 -0.0206 0.0000  0.0156  11  VAL C CA  
2400 C C   . VAL C 11  ? 0.0833 0.1442 0.1266 -0.0170 0.0041  0.0128  11  VAL C C   
2401 O O   . VAL C 11  ? 0.0887 0.1452 0.1237 -0.0148 0.0044  0.0098  11  VAL C O   
2402 C CB  . VAL C 11  ? 0.0760 0.1328 0.1154 -0.0230 -0.0064 0.0133  11  VAL C CB  
2403 C CG1 . VAL C 11  ? 0.0670 0.1289 0.1210 -0.0227 -0.0067 0.0112  11  VAL C CG1 
2404 C CG2 . VAL C 11  ? 0.0770 0.1323 0.1169 -0.0272 -0.0095 0.0173  11  VAL C CG2 
2405 N N   . ILE C 12  ? 0.0992 0.1673 0.1595 -0.0163 0.0078  0.0142  12  ILE C N   
2406 C CA  . ILE C 12  ? 0.0974 0.1680 0.1689 -0.0130 0.0114  0.0122  12  ILE C CA  
2407 C C   . ILE C 12  ? 0.0853 0.1584 0.1660 -0.0131 0.0047  0.0079  12  ILE C C   
2408 O O   . ILE C 12  ? 0.0747 0.1507 0.1625 -0.0155 0.0003  0.0075  12  ILE C O   
2409 C CB  . ILE C 12  ? 0.0959 0.1721 0.1843 -0.0114 0.0188  0.0157  12  ILE C CB  
2410 C CG1 . ILE C 12  ? 0.1144 0.1864 0.1914 -0.0108 0.0255  0.0205  12  ILE C CG1 
2411 C CG2 . ILE C 12  ? 0.0998 0.1764 0.2010 -0.0075 0.0233  0.0144  12  ILE C CG2 
2412 C CD1 . ILE C 12  ? 0.1378 0.1987 0.1930 -0.0087 0.0287  0.0205  12  ILE C CD1 
2413 N N   . ALA C 13  ? 0.1114 0.1818 0.1899 -0.0106 0.0040  0.0048  13  ALA C N   
2414 C CA  . ALA C 13  ? 0.1075 0.1783 0.1918 -0.0098 -0.0027 0.0006  13  ALA C CA  
2415 C C   . ALA C 13  ? 0.1086 0.1854 0.2149 -0.0089 -0.0041 0.0002  13  ALA C C   
2416 O O   . ALA C 13  ? 0.0945 0.1758 0.2143 -0.0081 0.0018  0.0031  13  ALA C O   
2417 C CB  . ALA C 13  ? 0.1250 0.1915 0.2010 -0.0072 -0.0025 -0.0021 13  ALA C CB  
2418 O OXT . ALA C 13  ? 0.1036 0.1798 0.2142 -0.0086 -0.0113 -0.0031 13  ALA C OXT 
2419 N N   . GLY D 3   ? 0.6196 0.8754 0.5557 0.0693  -0.0101 0.0063  3   GLY D N   
2420 C CA  . GLY D 3   ? 0.6312 0.8741 0.5667 0.0611  -0.0128 0.0010  3   GLY D CA  
2421 C C   . GLY D 3   ? 0.6425 0.8738 0.5642 0.0616  -0.0152 -0.0063 3   GLY D C   
2422 O O   . GLY D 3   ? 0.6794 0.8969 0.5939 0.0667  -0.0106 -0.0075 3   GLY D O   
2423 N N   . PHE D 4   ? 0.4393 0.6756 0.3574 0.0564  -0.0222 -0.0113 4   PHE D N   
2424 C CA  . PHE D 4   ? 0.3862 0.6204 0.3089 0.0462  -0.0270 -0.0155 4   PHE D CA  
2425 C C   . PHE D 4   ? 0.3773 0.6169 0.3143 0.0398  -0.0267 -0.0117 4   PHE D C   
2426 O O   . PHE D 4   ? 0.4029 0.6413 0.3438 0.0314  -0.0306 -0.0155 4   PHE D O   
2427 C CB  . PHE D 4   ? 0.3646 0.6071 0.2820 0.0431  -0.0345 -0.0210 4   PHE D CB  
2428 C CG  . PHE D 4   ? 0.2967 0.5299 0.1992 0.0470  -0.0354 -0.0264 4   PHE D CG  
2429 C CD1 . PHE D 4   ? 0.2583 0.4927 0.1523 0.0563  -0.0326 -0.0243 4   PHE D CD1 
2430 C CD2 . PHE D 4   ? 0.3115 0.5320 0.2086 0.0416  -0.0375 -0.0331 4   PHE D CD2 
2431 C CE1 . PHE D 4   ? 0.3156 0.5395 0.1955 0.0599  -0.0326 -0.0292 4   PHE D CE1 
2432 C CE2 . PHE D 4   ? 0.2837 0.4941 0.1672 0.0450  -0.0375 -0.0379 4   PHE D CE2 
2433 C CZ  . PHE D 4   ? 0.2838 0.4951 0.1586 0.0542  -0.0348 -0.0359 4   PHE D CZ  
2434 N N   . SER D 5   ? 0.4533 0.6974 0.3980 0.0438  -0.0216 -0.0046 5   SER D N   
2435 C CA  . SER D 5   ? 0.4634 0.7113 0.4212 0.0380  -0.0207 -0.0006 5   SER D CA  
2436 C C   . SER D 5   ? 0.4559 0.6873 0.4143 0.0322  -0.0196 -0.0035 5   SER D C   
2437 O O   . SER D 5   ? 0.5095 0.7264 0.4610 0.0356  -0.0163 -0.0052 5   SER D O   
2438 C CB  . SER D 5   ? 0.4453 0.6998 0.4104 0.0441  -0.0148 0.0075  5   SER D CB  
2439 O OG  . SER D 5   ? 0.4955 0.7644 0.4591 0.0501  -0.0154 0.0101  5   SER D OG  
2440 N N   . ASP D 6   ? 0.3430 0.5762 0.3077 0.0231  -0.0233 -0.0059 6   ASP D N   
2441 C CA  . ASP D 6   ? 0.3234 0.5461 0.2942 0.0171  -0.0213 -0.0054 6   ASP D CA  
2442 C C   . ASP D 6   ? 0.2924 0.5037 0.2632 0.0223  -0.0146 -0.0010 6   ASP D C   
2443 O O   . ASP D 6   ? 0.2811 0.4996 0.2567 0.0280  -0.0108 0.0053  6   ASP D O   
2444 C CB  . ASP D 6   ? 0.3337 0.5677 0.3170 0.0108  -0.0227 -0.0023 6   ASP D CB  
2445 C CG  . ASP D 6   ? 0.4139 0.6532 0.3989 0.0027  -0.0290 -0.0083 6   ASP D CG  
2446 O OD1 . ASP D 6   ? 0.4462 0.6900 0.4411 -0.0042 -0.0299 -0.0074 6   ASP D OD1 
2447 O OD2 . ASP D 6   ? 0.3537 0.5923 0.3301 0.0032  -0.0329 -0.0142 6   ASP D OD2 
2448 N N   . ASP D 7   ? 0.1587 0.3533 0.1269 0.0192  -0.0134 -0.0040 7   ASP D N   
2449 C CA  . ASP D 7   ? 0.1538 0.3357 0.1225 0.0232  -0.0077 -0.0007 7   ASP D CA  
2450 C C   . ASP D 7   ? 0.1399 0.3221 0.1191 0.0180  -0.0061 0.0037  7   ASP D C   
2451 O O   . ASP D 7   ? 0.1517 0.3437 0.1375 0.0115  -0.0093 0.0037  7   ASP D O   
2452 C CB  . ASP D 7   ? 0.1610 0.3242 0.1211 0.0219  -0.0076 -0.0066 7   ASP D CB  
2453 C CG  . ASP D 7   ? 0.1505 0.3003 0.1085 0.0284  -0.0020 -0.0044 7   ASP D CG  
2454 O OD1 . ASP D 7   ? 0.1395 0.2941 0.1025 0.0342  0.0021  0.0017  7   ASP D OD1 
2455 O OD2 . ASP D 7   ? 0.1615 0.2952 0.1133 0.0273  -0.0018 -0.0090 7   ASP D OD2 
2456 N N   . VAL D 8   ? 0.1251 0.2983 0.1066 0.0217  -0.0012 0.0077  8   VAL D N   
2457 C CA  . VAL D 8   ? 0.1184 0.2886 0.1084 0.0173  0.0009  0.0117  8   VAL D CA  
2458 C C   . VAL D 8   ? 0.1270 0.2780 0.1135 0.0128  0.0010  0.0079  8   VAL D C   
2459 O O   . VAL D 8   ? 0.1390 0.2781 0.1171 0.0153  0.0012  0.0036  8   VAL D O   
2460 C CB  . VAL D 8   ? 0.1025 0.2757 0.0977 0.0246  0.0063  0.0190  8   VAL D CB  
2461 C CG1 . VAL D 8   ? 0.0910 0.2841 0.0910 0.0282  0.0063  0.0232  8   VAL D CG1 
2462 C CG2 . VAL D 8   ? 0.1027 0.2633 0.0910 0.0326  0.0099  0.0181  8   VAL D CG2 
2463 N N   . PRO D 9   ? 0.1250 0.2718 0.1178 0.0070  0.0019  0.0101  9   PRO D N   
2464 C CA  . PRO D 9   ? 0.1347 0.2627 0.1243 0.0030  0.0024  0.0071  9   PRO D CA  
2465 C C   . PRO D 9   ? 0.1316 0.2461 0.1174 0.0102  0.0065  0.0087  9   PRO D C   
2466 O O   . PRO D 9   ? 0.1204 0.2401 0.1097 0.0169  0.0099  0.0141  9   PRO D O   
2467 C CB  . PRO D 9   ? 0.1291 0.2578 0.1270 -0.0034 0.0032  0.0106  9   PRO D CB  
2468 C CG  . PRO D 9   ? 0.1225 0.2713 0.1275 -0.0057 0.0011  0.0128  9   PRO D CG  
2469 C CD  . PRO D 9   ? 0.1148 0.2735 0.1179 0.0035  0.0023  0.0154  9   PRO D CD  
2470 N N   . MET D 10  ? 0.1788 0.2761 0.1582 0.0087  0.0063  0.0040  10  MET D N   
2471 C CA  . MET D 10  ? 0.1666 0.2492 0.1433 0.0146  0.0099  0.0050  10  MET D CA  
2472 C C   . MET D 10  ? 0.1578 0.2361 0.1409 0.0147  0.0129  0.0108  10  MET D C   
2473 O O   . MET D 10  ? 0.1749 0.2511 0.1615 0.0076  0.0120  0.0115  10  MET D O   
2474 C CB  . MET D 10  ? 0.1847 0.2501 0.1536 0.0119  0.0085  -0.0016 10  MET D CB  
2475 C CG  . MET D 10  ? 0.1803 0.2295 0.1458 0.0181  0.0118  -0.0018 10  MET D CG  
2476 S SD  . MET D 10  ? 0.2015 0.2309 0.1587 0.0137  0.0099  -0.0097 10  MET D SD  
2477 C CE  . MET D 10  ? 0.2150 0.2366 0.1756 0.0043  0.0089  -0.0094 10  MET D CE  
2478 N N   . VAL D 11  ? 0.1522 0.2289 0.1368 0.0230  0.0167  0.0148  11  VAL D N   
2479 C CA  A VAL D 11  ? 0.1429 0.2119 0.1321 0.0242  0.0198  0.0195  11  VAL D CA  
2480 C CA  B VAL D 11  ? 0.1433 0.2124 0.1325 0.0245  0.0198  0.0195  11  VAL D CA  
2481 C C   . VAL D 11  ? 0.1541 0.2015 0.1380 0.0237  0.0201  0.0161  11  VAL D C   
2482 O O   . VAL D 11  ? 0.1608 0.1991 0.1386 0.0272  0.0200  0.0116  11  VAL D O   
2483 C CB  A VAL D 11  ? 0.1226 0.1993 0.1167 0.0334  0.0239  0.0251  11  VAL D CB  
2484 C CB  B VAL D 11  ? 0.1227 0.1984 0.1159 0.0342  0.0240  0.0246  11  VAL D CB  
2485 C CG1 A VAL D 11  ? 0.1119 0.2101 0.1124 0.0333  0.0238  0.0294  11  VAL D CG1 
2486 C CG1 B VAL D 11  ? 0.1136 0.1792 0.1105 0.0365  0.0270  0.0286  11  VAL D CG1 
2487 C CG2 A VAL D 11  ? 0.1209 0.1918 0.1096 0.0416  0.0256  0.0221  11  VAL D CG2 
2488 C CG2 B VAL D 11  ? 0.1092 0.2064 0.1088 0.0348  0.0242  0.0290  11  VAL D CG2 
2489 N N   . ILE D 12  ? 0.1741 0.2129 0.1605 0.0195  0.0205  0.0182  12  ILE D N   
2490 C CA  . ILE D 12  ? 0.1664 0.1843 0.1480 0.0187  0.0207  0.0154  12  ILE D CA  
2491 C C   . ILE D 12  ? 0.1546 0.1644 0.1380 0.0268  0.0242  0.0190  12  ILE D C   
2492 O O   . ILE D 12  ? 0.1503 0.1671 0.1400 0.0292  0.0264  0.0250  12  ILE D O   
2493 C CB  . ILE D 12  ? 0.1959 0.2067 0.1780 0.0095  0.0193  0.0152  12  ILE D CB  
2494 C CG1 . ILE D 12  ? 0.1906 0.2118 0.1730 0.0016  0.0162  0.0120  12  ILE D CG1 
2495 C CG2 . ILE D 12  ? 0.1964 0.1853 0.1727 0.0083  0.0192  0.0117  12  ILE D CG2 
2496 C CD1 . ILE D 12  ? 0.3191 0.3339 0.2944 -0.0011 0.0136  0.0045  12  ILE D CD1 
2497 N N   . ALA D 13  ? 0.1876 0.1826 0.1658 0.0310  0.0246  0.0151  13  ALA D N   
2498 C CA  . ALA D 13  ? 0.1868 0.1743 0.1669 0.0396  0.0277  0.0175  13  ALA D CA  
2499 C C   . ALA D 13  ? 0.1974 0.1725 0.1789 0.0379  0.0283  0.0204  13  ALA D C   
2500 O O   . ALA D 13  ? 0.1804 0.1510 0.1649 0.0446  0.0308  0.0234  13  ALA D O   
2501 C CB  . ALA D 13  ? 0.1775 0.1527 0.1519 0.0445  0.0280  0.0119  13  ALA D CB  
2502 O OXT . ALA D 13  ? 0.1903 0.1588 0.1696 0.0300  0.0263  0.0192  13  ALA D OXT 
2503 O O1  . HEZ E .   ? 0.5793 0.4059 0.4839 0.0200  0.0672  0.0133  148 HEZ B O1  
2504 C C1  . HEZ E .   ? 0.5693 0.3831 0.4513 0.0261  0.0605  0.0240  148 HEZ B C1  
2505 C C2  . HEZ E .   ? 0.4642 0.2949 0.3536 0.0345  0.0439  0.0277  148 HEZ B C2  
2506 C C3  . HEZ E .   ? 0.6194 0.4335 0.4989 0.0455  0.0376  0.0396  148 HEZ B C3  
2507 C C4  . HEZ E .   ? 0.5539 0.3621 0.4098 0.0489  0.0248  0.0482  148 HEZ B C4  
2508 C C5  . HEZ E .   ? 0.6765 0.4918 0.5409 0.0604  0.0083  0.0565  148 HEZ B C5  
2509 C C6  . HEZ E .   ? 0.6230 0.4670 0.5025 0.0594  -0.0052 0.0520  148 HEZ B C6  
2510 O O6  . HEZ E .   ? 0.6311 0.4932 0.5424 0.0651  -0.0078 0.0501  148 HEZ B O6  
2511 O O   . HOH F .   ? 0.4119 0.3561 0.4201 -0.0328 0.0848  -0.0400 148 HOH A O   
2512 O O   . HOH F .   ? 0.1088 0.1132 0.1049 -0.0138 -0.0246 -0.0116 149 HOH A O   
2513 O O   . HOH F .   ? 0.2593 0.1630 0.1439 -0.0413 0.1179  -0.0608 150 HOH A O   
2514 O O   . HOH F .   ? 0.1735 0.1529 0.1703 -0.0129 0.0243  -0.0252 151 HOH A O   
2515 O O   . HOH F .   ? 0.3945 0.3914 0.3537 -0.0059 -0.0379 -0.0087 152 HOH A O   
2516 O O   . HOH F .   ? 0.4240 0.4110 0.4597 -0.0321 0.0674  -0.0419 153 HOH A O   
2517 O O   . HOH F .   ? 0.5699 0.4851 0.3721 -0.0535 0.0986  -0.0689 154 HOH A O   
2518 O O   . HOH F .   ? 0.1607 0.1304 0.1592 -0.0142 0.0409  -0.0280 155 HOH A O   
2519 O O   . HOH F .   ? 0.3799 0.3629 0.3749 -0.0054 0.0118  -0.0202 156 HOH A O   
2520 O O   . HOH F .   ? 0.1764 0.1834 0.1649 0.0015  -0.0029 0.0116  157 HOH A O   
2521 O O   . HOH F .   ? 0.4781 0.3934 0.4607 -0.0057 0.0960  -0.0249 158 HOH A O   
2522 O O   . HOH F .   ? 0.2321 0.2346 0.2286 -0.0228 -0.0294 -0.0157 160 HOH A O   
2523 O O   . HOH F .   ? 0.4262 0.4500 0.3152 -0.0050 0.0072  0.0029  161 HOH A O   
2524 O O   . HOH F .   ? 0.1759 0.2160 0.1726 -0.0035 -0.0143 -0.0021 162 HOH A O   
2525 O O   . HOH F .   ? 0.4048 0.2957 0.3954 -0.1073 0.1357  -0.1050 163 HOH A O   
2526 O O   . HOH F .   ? 0.2458 0.2780 0.2984 -0.0839 0.0558  -0.0833 164 HOH A O   
2527 O O   . HOH F .   ? 0.1195 0.1507 0.1879 -0.0408 0.0580  -0.0494 165 HOH A O   
2528 O O   . HOH F .   ? 0.4809 0.3048 0.4026 0.0035  0.1288  -0.0064 166 HOH A O   
2529 O O   . HOH F .   ? 0.1732 0.2341 0.1428 -0.0068 -0.0184 -0.0060 167 HOH A O   
2530 O O   . HOH F .   ? 0.2363 0.2673 0.2464 -0.0005 -0.0120 -0.0050 168 HOH A O   
2531 O O   . HOH F .   ? 0.4150 0.4364 0.3065 -0.0273 0.0140  -0.0267 169 HOH A O   
2532 O O   . HOH F .   ? 0.3632 0.4590 0.3101 -0.0798 -0.0137 -0.0864 170 HOH A O   
2533 O O   . HOH F .   ? 0.2360 0.2524 0.2624 -0.0709 -0.0392 -0.0353 171 HOH A O   
2534 O O   . HOH F .   ? 0.3367 0.6552 0.4032 -0.0279 -0.0904 -0.0434 172 HOH A O   
2535 O O   . HOH F .   ? 0.2173 0.4339 0.4531 -0.0522 -0.0314 0.0043  173 HOH A O   
2536 O O   . HOH F .   ? 0.3604 0.3088 0.3333 -0.0182 0.0845  -0.0319 175 HOH A O   
2537 O O   . HOH F .   ? 0.1593 0.1974 0.2279 -0.0255 0.0492  -0.0396 176 HOH A O   
2538 O O   . HOH F .   ? 0.1703 0.1556 0.1518 0.0017  0.0086  0.0195  177 HOH A O   
2539 O O   . HOH F .   ? 0.1982 0.1807 0.1684 -0.0166 0.0688  -0.0126 178 HOH A O   
2540 O O   . HOH F .   ? 0.3825 0.3886 0.4856 0.0486  0.1272  0.0315  179 HOH A O   
2541 O O   . HOH F .   ? 0.3365 0.2707 0.3239 -0.0130 0.0781  -0.0287 180 HOH A O   
2542 O O   . HOH F .   ? 0.1540 0.2159 0.1430 -0.0051 -0.0199 -0.0062 182 HOH A O   
2543 O O   . HOH F .   ? 0.2698 0.4542 0.2981 0.0029  -0.0535 -0.0113 184 HOH A O   
2544 O O   . HOH F .   ? 0.1516 0.4422 0.3318 -0.0769 -0.0230 -0.0821 186 HOH A O   
2545 O O   . HOH F .   ? 0.2567 0.2602 0.1884 -0.0187 0.0307  -0.0103 187 HOH A O   
2546 O O   . HOH F .   ? 0.2612 0.1967 0.1979 -0.0074 0.0021  -0.0222 188 HOH A O   
2547 O O   . HOH F .   ? 0.2564 0.2190 0.2392 -0.0239 0.0608  -0.0351 190 HOH A O   
2548 O O   . HOH F .   ? 0.4274 0.3860 0.4079 -0.0866 0.0753  -0.0922 192 HOH A O   
2549 O O   . HOH F .   ? 0.2310 0.3417 0.3355 -0.0167 -0.0361 0.0062  194 HOH A O   
2550 O O   . HOH F .   ? 0.8751 0.6796 0.7059 0.0556  0.0977  0.0351  196 HOH A O   
2551 O O   . HOH F .   ? 0.4886 0.4315 0.4937 0.0234  0.0738  0.0045  197 HOH A O   
2552 O O   . HOH F .   ? 0.5028 0.5246 0.4157 -0.0277 -0.0394 -0.0586 198 HOH A O   
2553 O O   . HOH F .   ? 0.5826 0.5702 0.5611 -0.0382 -0.0368 -0.0268 200 HOH A O   
2554 O O   . HOH F .   ? 0.1479 0.3003 0.3429 0.0047  0.0195  0.0303  201 HOH A O   
2555 O O   . HOH F .   ? 0.3855 0.5977 0.4670 -0.0468 -0.0398 -0.0567 202 HOH A O   
2556 O O   . HOH F .   ? 0.4778 0.4619 0.3780 -0.0463 0.0461  -0.0537 205 HOH A O   
2557 O O   . HOH F .   ? 0.2176 0.2544 0.2548 0.0340  -0.0019 0.0260  207 HOH A O   
2558 O O   . HOH F .   ? 0.1068 0.2945 0.2749 -0.0664 0.0278  -0.0716 208 HOH A O   
2559 O O   . HOH F .   ? 0.1235 0.3268 0.2303 -0.0476 -0.0243 -0.0575 209 HOH A O   
2560 O O   . HOH F .   ? 0.2141 0.1735 0.2143 -0.0778 -0.0168 -0.0411 210 HOH A O   
2561 O O   . HOH F .   ? 0.4870 0.4682 0.4837 -0.0088 -0.0028 -0.0006 211 HOH A O   
2562 O O   . HOH F .   ? 0.5285 0.4982 0.5434 0.0027  0.1208  0.0006  212 HOH A O   
2563 O O   . HOH F .   ? 0.4652 0.4830 0.4207 0.0449  -0.0015 0.0468  214 HOH A O   
2564 O O   . HOH F .   ? 0.3239 0.3514 0.4197 -0.0381 0.0726  0.0191  215 HOH A O   
2565 O O   . HOH F .   ? 0.4746 0.5691 0.4381 0.0058  -0.0328 0.0020  217 HOH A O   
2566 O O   . HOH F .   ? 0.3704 0.2923 0.3340 -0.0037 0.0675  -0.0237 218 HOH A O   
2567 O O   . HOH F .   ? 0.3963 0.3896 0.4127 -0.0157 0.0887  0.0161  219 HOH A O   
2568 O O   . HOH F .   ? 0.2949 0.3039 0.2992 -0.0061 -0.0100 -0.0059 220 HOH A O   
2569 O O   . HOH F .   ? 0.3013 0.2639 0.2155 0.0079  -0.0266 -0.0034 221 HOH A O   
2570 O O   . HOH F .   ? 0.3392 0.2484 0.1887 -0.0409 0.1138  -0.0560 222 HOH A O   
2571 O O   . HOH F .   ? 0.3377 0.2590 0.2368 0.0106  0.0070  -0.0061 223 HOH A O   
2572 O O   . HOH F .   ? 0.5276 0.6234 0.5894 -0.1297 0.0384  -0.1241 224 HOH A O   
2573 O O   . HOH F .   ? 0.4219 0.3613 0.4054 -0.0142 0.0818  -0.0300 225 HOH A O   
2574 O O   . HOH F .   ? 0.2808 0.1972 0.2284 -0.0024 0.0559  -0.0201 226 HOH A O   
2575 O O   . HOH F .   ? 0.4845 0.4835 0.5775 -0.0828 0.0342  -0.0098 227 HOH A O   
2576 O O   . HOH F .   ? 0.5758 0.9099 0.6189 -0.0527 -0.1007 -0.0654 228 HOH A O   
2577 O O   . HOH F .   ? 0.3063 0.2702 0.2544 0.0295  0.0020  0.0157  230 HOH A O   
2578 O O   . HOH F .   ? 0.3756 0.2190 0.3266 0.0132  0.1250  -0.0058 232 HOH A O   
2579 O O   . HOH F .   ? 0.1393 0.3183 0.2715 -0.0138 -0.0018 -0.0324 233 HOH A O   
2580 O O   . HOH F .   ? 0.6254 0.5541 0.6419 -0.0507 0.1102  -0.0518 234 HOH A O   
2581 O O   . HOH F .   ? 0.3060 0.2469 0.2900 0.0184  0.0517  0.0034  235 HOH A O   
2582 O O   . HOH F .   ? 0.3175 0.1812 0.2545 0.0282  0.0951  0.0107  236 HOH A O   
2583 O O   . HOH F .   ? 0.2398 0.4937 0.3507 -0.0850 -0.0374 -0.0892 237 HOH A O   
2584 O O   . HOH F .   ? 0.3665 0.4286 0.4471 0.0461  0.0143  0.0374  239 HOH A O   
2585 O O   . HOH F .   ? 0.3939 0.3518 0.3963 -0.0018 0.0735  -0.0159 240 HOH A O   
2586 O O   . HOH F .   ? 0.1856 0.4773 0.4107 -0.0560 0.0015  -0.0659 241 HOH A O   
2587 O O   . HOH F .   ? 0.2434 0.4541 0.4538 0.0171  -0.0256 0.0384  242 HOH A O   
2588 O O   . HOH F .   ? 0.2368 0.1528 0.2011 -0.0006 0.1495  -0.0184 243 HOH A O   
2589 O O   . HOH F .   ? 0.1228 0.3849 0.3547 -0.1102 0.0335  -0.1045 246 HOH A O   
2590 O O   . HOH F .   ? 0.5473 0.5241 0.5536 -0.0191 0.1019  0.0257  248 HOH A O   
2591 O O   . HOH F .   ? 0.6717 0.6711 0.7236 0.0248  0.0642  0.0129  249 HOH A O   
2592 O O   . HOH F .   ? 0.4902 0.4870 0.3658 -0.0677 0.0358  -0.0782 250 HOH A O   
2593 O O   . HOH F .   ? 0.6560 0.5450 0.5700 -0.0833 0.1151  -0.1010 252 HOH A O   
2594 O O   . HOH F .   ? 0.1720 0.1009 0.1522 -0.0185 0.0647  -0.0276 253 HOH A O   
2595 O O   . HOH F .   ? 0.3886 0.2959 0.3524 -0.0762 0.1041  -0.0858 255 HOH A O   
2596 O O   . HOH F .   ? 0.3173 0.3362 0.3914 0.0067  0.0933  0.0138  256 HOH A O   
2597 O O   . HOH F .   ? 0.1607 0.3722 0.2813 -0.0262 -0.0247 -0.0409 259 HOH A O   
2598 O O   . HOH F .   ? 0.2553 0.2014 0.1725 0.0146  -0.0056 0.0007  260 HOH A O   
2599 O O   . HOH F .   ? 0.2041 0.3866 0.2995 0.0027  -0.0277 -0.0167 261 HOH A O   
2600 O O   . HOH F .   ? 0.4182 0.2752 0.3726 -0.0190 0.1195  -0.0259 262 HOH A O   
2601 O O   . HOH F .   ? 0.1129 0.2901 0.3425 -0.0085 0.0231  0.0290  263 HOH A O   
2602 O O   . HOH F .   ? 0.6133 0.6134 0.5606 0.0487  -0.0235 0.0335  264 HOH A O   
2603 O O   . HOH F .   ? 0.4461 0.4149 0.3584 0.0302  -0.0231 0.0158  265 HOH A O   
2604 O O   . HOH F .   ? 0.3498 0.2611 0.3108 -0.0234 0.1054  -0.0433 267 HOH A O   
2605 O O   . HOH F .   ? 0.2169 0.1593 0.2145 -0.0268 0.0212  0.0052  268 HOH A O   
2606 O O   . HOH F .   ? 0.5681 0.6522 0.5822 -0.0287 -0.0798 -0.0131 269 HOH A O   
2607 O O   . HOH F .   ? 0.2301 0.1961 0.2037 -0.0208 -0.0157 -0.0203 271 HOH A O   
2608 O O   . HOH F .   ? 0.4452 0.6528 0.5109 -0.0717 -0.0378 -0.0779 272 HOH A O   
2609 O O   . HOH F .   ? 0.2163 0.3198 0.3172 -0.0358 -0.0405 -0.0044 275 HOH A O   
2610 O O   . HOH F .   ? 0.5399 0.4859 0.4715 -0.0533 0.0748  -0.0673 276 HOH A O   
2611 O O   . HOH F .   ? 0.4287 0.3738 0.4483 -0.1159 0.1129  -0.1100 277 HOH A O   
2612 O O   . HOH F .   ? 0.3648 0.2838 0.3485 -0.0016 0.0805  -0.0177 278 HOH A O   
2613 O O   . HOH F .   ? 0.2095 0.2182 0.2623 -0.0273 0.0703  0.0193  280 HOH A O   
2614 O O   . HOH F .   ? 0.2447 0.4174 0.3920 -0.1371 0.0406  -0.1262 283 HOH A O   
2615 O O   . HOH F .   ? 0.4318 0.4263 0.4788 0.0423  0.0579  0.0252  284 HOH A O   
2616 O O   . HOH F .   ? 0.3269 0.2820 0.3144 -0.0052 0.0094  0.0062  286 HOH A O   
2617 O O   . HOH F .   ? 0.1889 0.2222 0.2136 -0.0093 -0.0009 -0.0206 287 HOH A O   
2618 O O   . HOH F .   ? 0.6172 0.7303 0.5469 -0.0311 -0.0367 -0.0370 288 HOH A O   
2619 O O   . HOH F .   ? 0.3737 0.3403 0.3261 -0.0133 0.0959  0.0023  290 HOH A O   
2620 O O   . HOH F .   ? 0.3287 0.4107 0.4864 -0.0276 0.0711  0.0214  291 HOH A O   
2621 O O   . HOH F .   ? 0.4299 0.5826 0.5809 -0.0357 -0.0420 0.0022  293 HOH A O   
2622 O O   . HOH F .   ? 0.4580 0.4454 0.4554 -0.0020 -0.0040 -0.0039 294 HOH A O   
2623 O O   . HOH F .   ? 0.5387 0.4983 0.5139 0.0398  0.0278  0.0234  298 HOH A O   
2624 O O   . HOH F .   ? 0.4505 0.2347 0.3486 0.0577  0.1482  0.0347  300 HOH A O   
2625 O O   . HOH F .   ? 0.2763 0.3547 0.3688 -0.0171 0.0356  -0.0347 302 HOH A O   
2626 O O   . HOH F .   ? 0.2013 0.4594 0.3382 -0.0671 -0.0314 -0.0743 305 HOH A O   
2627 O O   . HOH F .   ? 0.2665 0.2270 0.2519 -0.0043 0.0165  0.0176  313 HOH A O   
2628 O O   . HOH F .   ? 0.1618 0.3267 0.3031 -0.0274 0.0156  -0.0429 314 HOH A O   
2629 O O   . HOH F .   ? 0.4026 0.2378 0.3279 -0.0033 0.1245  -0.0119 316 HOH A O   
2630 O O   . HOH F .   ? 0.2470 0.3588 0.3178 0.0059  -0.0094 -0.0131 317 HOH A O   
2631 O O   . HOH F .   ? 0.3060 0.2333 0.3084 -0.0676 0.0124  -0.0264 322 HOH A O   
2632 O O   . HOH F .   ? 0.2978 0.4138 0.3903 -0.0042 -0.0458 0.0117  324 HOH A O   
2633 O O   . HOH F .   ? 0.2916 0.2476 0.2557 -0.0054 0.0073  -0.0198 325 HOH A O   
2634 O O   . HOH F .   ? 0.4632 0.4420 0.3705 0.0176  -0.0393 0.0058  328 HOH A O   
2635 O O   . HOH F .   ? 0.2380 0.3375 0.4000 0.0162  0.0602  0.0312  329 HOH A O   
2636 O O   . HOH F .   ? 0.2062 0.2421 0.2085 0.0031  -0.0137 0.0016  330 HOH A O   
2637 O O   . HOH F .   ? 0.3353 0.3111 0.3018 -0.0138 0.0858  0.0111  332 HOH A O   
2638 O O   . HOH F .   ? 0.2258 0.2606 0.2788 0.0342  0.0147  0.0257  334 HOH A O   
2639 O O   . HOH F .   ? 0.1429 0.3925 0.3477 -0.0820 0.0172  -0.0842 338 HOH A O   
2640 O O   . HOH F .   ? 0.3296 0.2457 0.3223 -0.0360 0.0970  -0.0407 339 HOH A O   
2641 O O   . HOH F .   ? 0.4597 0.4153 0.3718 -0.0168 0.0923  -0.0079 340 HOH A O   
2642 O O   . HOH F .   ? 0.3647 0.3119 0.3254 -0.0329 0.0759  -0.0465 341 HOH A O   
2643 O O   . HOH F .   ? 0.3544 0.2681 0.3307 -0.0247 0.0886  -0.0394 343 HOH A O   
2644 O O   . HOH F .   ? 0.4849 0.4769 0.3692 -0.0198 0.0389  -0.0135 344 HOH A O   
2645 O O   . HOH F .   ? 0.3023 0.3378 0.2051 -0.0174 0.0017  -0.0145 345 HOH A O   
2646 O O   . HOH F .   ? 0.3248 0.3029 0.3156 -0.0096 0.0921  -0.0041 347 HOH A O   
2647 O O   . HOH F .   ? 0.2968 0.3671 0.3504 0.0466  -0.0162 0.0385  348 HOH A O   
2648 O O   . HOH F .   ? 0.3691 0.3780 0.3550 -0.0099 -0.0339 -0.0088 350 HOH A O   
2649 O O   . HOH G .   ? 0.2271 0.3406 0.4169 0.0314  0.0071  0.0028  149 HOH B O   
2650 O O   . HOH G .   ? 0.5646 0.3402 0.2590 -0.0484 0.0783  -0.0493 150 HOH B O   
2651 O O   . HOH G .   ? 0.4178 0.2747 0.2552 0.0515  -0.0395 0.0536  151 HOH B O   
2652 O O   . HOH G .   ? 0.5615 0.7501 0.4928 0.0415  -0.0134 -0.0135 152 HOH B O   
2653 O O   . HOH G .   ? 0.3614 0.5269 0.2954 0.0282  -0.0148 -0.0199 153 HOH B O   
2654 O O   . HOH G .   ? 0.4351 0.3162 0.4504 -0.0497 0.1499  -0.0332 155 HOH B O   
2655 O O   . HOH G .   ? 0.2932 0.1303 0.2068 0.0016  0.0811  0.0001  159 HOH B O   
2656 O O   . HOH G .   ? 0.3565 0.3698 0.3281 0.0089  0.0529  -0.0260 160 HOH B O   
2657 O O   . HOH G .   ? 0.4720 0.3718 0.5021 0.0572  0.1020  0.0442  161 HOH B O   
2658 O O   . HOH G .   ? 0.3728 0.4081 0.3745 0.0163  -0.0576 -0.0029 162 HOH B O   
2659 O O   . HOH G .   ? 0.5774 0.3786 0.3797 -0.0795 0.0803  -0.0899 163 HOH B O   
2660 O O   . HOH G .   ? 0.5680 0.4296 0.4468 -0.0929 0.0458  -0.0916 164 HOH B O   
2661 O O   . HOH G .   ? 0.6586 0.5979 0.6445 0.0656  0.0478  0.0654  165 HOH B O   
2662 O O   . HOH G .   ? 0.3015 0.3199 0.2835 0.0072  0.0155  -0.0334 166 HOH B O   
2663 O O   . HOH G .   ? 0.7506 0.4735 0.3100 -0.0764 0.0094  -0.0608 167 HOH B O   
2664 O O   . HOH G .   ? 0.3797 0.5622 0.5902 0.0015  -0.0858 -0.0171 168 HOH B O   
2665 O O   . HOH G .   ? 0.6887 0.5262 0.4256 -0.0667 0.0012  -0.0643 169 HOH B O   
2666 O O   . HOH G .   ? 0.4361 0.4275 0.2743 0.0078  -0.0286 -0.0059 170 HOH B O   
2667 O O   . HOH G .   ? 0.4305 0.2832 0.3276 0.0466  0.0995  0.0753  171 HOH B O   
2668 O O   . HOH G .   ? 0.8455 0.6293 0.5150 0.0177  -0.0472 0.0452  172 HOH B O   
2669 O O   . HOH G .   ? 0.1831 0.2201 0.1765 -0.0016 -0.0447 -0.0166 174 HOH B O   
2670 O O   . HOH G .   ? 0.3296 0.4364 0.4742 0.0172  -0.0321 -0.0142 175 HOH B O   
2671 O O   . HOH G .   ? 0.5882 0.5903 0.6374 -0.0391 0.0553  -0.0327 176 HOH B O   
2672 O O   . HOH G .   ? 0.7974 0.5962 0.6247 -0.0293 0.1726  -0.0393 177 HOH B O   
2673 O O   . HOH G .   ? 0.4980 0.4330 0.2610 0.0048  0.0076  -0.0049 178 HOH B O   
2674 O O   . HOH G .   ? 0.4496 0.3334 0.3832 -0.0374 0.0870  -0.0502 179 HOH B O   
2675 O O   . HOH G .   ? 0.3790 0.3546 0.5937 -0.0505 0.2077  -0.0475 180 HOH B O   
2676 O O   . HOH G .   ? 0.2606 0.2084 0.3109 -0.0565 0.0735  -0.0662 181 HOH B O   
2677 O O   . HOH G .   ? 0.1475 0.2578 0.2379 -0.0394 -0.0608 -0.0589 183 HOH B O   
2678 O O   . HOH G .   ? 0.6618 0.5809 0.4518 0.0268  0.0272  0.0379  184 HOH B O   
2679 O O   . HOH G .   ? 0.1622 0.2038 0.1719 0.0119  -0.0172 -0.0136 185 HOH B O   
2680 O O   . HOH G .   ? 0.3416 0.3762 0.3374 0.0119  0.0224  -0.0246 186 HOH B O   
2681 O O   . HOH G .   ? 0.3319 0.4486 0.4857 -0.0447 -0.0300 -0.0611 187 HOH B O   
2682 O O   . HOH G .   ? 0.4919 0.2897 0.3462 -0.0317 0.1953  -0.0317 188 HOH B O   
2683 O O   . HOH G .   ? 0.2103 0.1778 0.2131 -0.0192 0.0488  -0.0345 189 HOH B O   
2684 O O   . HOH G .   ? 0.3546 0.4465 0.4867 -0.0521 -0.0341 -0.0508 190 HOH B O   
2685 O O   . HOH G .   ? 0.2266 0.2524 0.2358 0.0213  -0.0039 -0.0129 193 HOH B O   
2686 O O   . HOH G .   ? 0.9222 0.6717 0.4880 0.0212  -0.1391 0.0661  194 HOH B O   
2687 O O   . HOH G .   ? 0.2593 0.2012 0.3113 0.0482  0.0895  0.0239  195 HOH B O   
2688 O O   . HOH G .   ? 0.6669 0.6691 0.5158 0.0000  -0.0385 -0.0182 196 HOH B O   
2689 O O   . HOH G .   ? 0.6315 0.6258 0.5318 -0.0346 -0.1160 -0.0287 197 HOH B O   
2690 O O   . HOH G .   ? 0.3815 0.3376 0.2171 0.0009  0.0418  -0.0247 199 HOH B O   
2691 O O   . HOH G .   ? 0.5533 0.3170 0.4058 0.0370  0.0683  0.0415  200 HOH B O   
2692 O O   . HOH G .   ? 0.2688 0.3013 0.2735 0.0149  0.0118  -0.0235 201 HOH B O   
2693 O O   . HOH G .   ? 0.2663 0.2027 0.2678 -0.0272 0.0680  -0.0378 203 HOH B O   
2694 O O   . HOH G .   ? 0.2923 0.2099 0.2172 -0.0358 0.0552  -0.0476 204 HOH B O   
2695 O O   . HOH G .   ? 0.1887 0.2239 0.1852 0.0088  -0.0355 -0.0113 206 HOH B O   
2696 O O   . HOH G .   ? 0.2986 0.3329 0.3391 0.0321  -0.0118 -0.0064 207 HOH B O   
2697 O O   . HOH G .   ? 0.5657 0.5772 0.5250 0.0620  -0.0340 0.0602  208 HOH B O   
2698 O O   . HOH G .   ? 0.5100 0.4271 0.2619 0.0170  0.0151  0.0211  209 HOH B O   
2699 O O   . HOH G .   ? 0.3759 0.2926 0.3608 -0.0037 0.0899  -0.0164 210 HOH B O   
2700 O O   . HOH G .   ? 0.1641 0.2272 0.2161 0.0113  0.0023  -0.0186 213 HOH B O   
2701 O O   . HOH G .   ? 0.2549 0.1510 0.2483 -0.0197 0.1111  -0.0100 216 HOH B O   
2702 O O   . HOH G .   ? 0.6289 0.5082 0.4038 -0.0806 -0.0470 -0.0721 221 HOH B O   
2703 O O   . HOH G .   ? 0.6259 0.3898 0.3240 -0.0733 0.0732  -0.0800 222 HOH B O   
2704 O O   . HOH G .   ? 0.3596 0.3506 0.5769 -0.0297 0.1985  -0.0407 223 HOH B O   
2705 O O   . HOH G .   ? 0.4873 0.5122 0.5717 0.0694  0.0164  0.0488  226 HOH B O   
2706 O O   . HOH G .   ? 0.1946 0.2359 0.2145 0.0181  -0.0076 -0.0140 231 HOH B O   
2707 O O   . HOH G .   ? 0.5019 0.6322 0.7072 -0.0245 -0.0038 -0.0420 232 HOH B O   
2708 O O   . HOH G .   ? 0.6168 0.5583 0.4546 0.0037  0.0699  -0.0135 233 HOH B O   
2709 O O   . HOH G .   ? 0.6918 0.7776 0.6615 0.0187  -0.1083 0.0084  235 HOH B O   
2710 O O   . HOH G .   ? 0.4730 0.3844 0.2299 0.0020  0.0484  -0.0094 236 HOH B O   
2711 O O   . HOH G .   ? 0.5665 0.4044 0.4846 -0.0030 0.1629  0.0413  238 HOH B O   
2712 O O   . HOH G .   ? 0.2744 0.4128 0.5052 0.0444  -0.0135 0.0150  239 HOH B O   
2713 O O   . HOH G .   ? 0.5329 0.4224 0.4980 -0.0243 0.0984  -0.0350 240 HOH B O   
2714 O O   . HOH G .   ? 0.4553 0.4364 0.3889 0.0372  -0.1058 0.0296  241 HOH B O   
2715 O O   . HOH G .   ? 0.5835 0.4533 0.5818 -0.0465 0.1332  -0.0330 242 HOH B O   
2716 O O   . HOH G .   ? 0.3861 0.4416 0.4033 0.0456  -0.0327 0.0319  243 HOH B O   
2717 O O   . HOH G .   ? 0.1532 0.2200 0.2204 0.0067  0.0184  -0.0211 244 HOH B O   
2718 O O   . HOH G .   ? 0.2776 0.2101 0.2820 -0.0316 0.0879  -0.0238 245 HOH B O   
2719 O O   . HOH G .   ? 0.8579 0.5370 0.5556 -0.0378 0.1960  -0.0001 246 HOH B O   
2720 O O   . HOH G .   ? 0.3782 0.4312 0.3543 -0.0004 -0.0243 -0.0267 247 HOH B O   
2721 O O   . HOH G .   ? 0.2584 0.1806 0.1942 -0.0089 0.0905  -0.0299 251 HOH B O   
2722 O O   . HOH G .   ? 0.4735 0.3895 0.4617 -0.0126 0.1423  -0.0296 256 HOH B O   
2723 O O   . HOH G .   ? 0.4390 0.5049 0.4199 -0.0303 -0.0623 -0.0548 257 HOH B O   
2724 O O   . HOH G .   ? 0.2262 0.3125 0.2890 0.0462  -0.0492 0.0293  258 HOH B O   
2725 O O   . HOH G .   ? 0.3362 0.3122 0.4216 0.0325  0.1016  -0.0042 259 HOH B O   
2726 O O   . HOH G .   ? 0.4479 0.4495 0.5090 0.0521  0.0431  0.0301  261 HOH B O   
2727 O O   . HOH G .   ? 0.3391 0.3841 0.5002 -0.0058 0.0924  -0.0269 262 HOH B O   
2728 O O   . HOH G .   ? 0.7163 0.6998 0.5986 -0.0075 0.0170  -0.0469 265 HOH B O   
2729 O O   . HOH G .   ? 0.2598 0.1662 0.2841 0.0314  0.1097  0.0096  266 HOH B O   
2730 O O   . HOH G .   ? 0.5593 0.5219 0.7544 -0.0846 0.1691  -0.0654 267 HOH B O   
2731 O O   . HOH G .   ? 0.5026 0.5463 0.6085 0.0973  -0.0263 0.0816  268 HOH B O   
2732 O O   . HOH G .   ? 0.2318 0.1996 0.2387 -0.0259 0.0425  -0.0498 270 HOH B O   
2733 O O   . HOH G .   ? 0.3386 0.2742 0.2999 0.0479  -0.0097 0.0218  273 HOH B O   
2734 O O   . HOH G .   ? 0.3286 0.1486 0.2278 -0.0103 0.1011  -0.0005 274 HOH B O   
2735 O O   . HOH G .   ? 0.3025 0.3541 0.4157 0.0017  0.0547  -0.0211 278 HOH B O   
2736 O O   . HOH G .   ? 0.2581 0.2979 0.2696 -0.0499 -0.0649 -0.0487 279 HOH B O   
2737 O O   . HOH G .   ? 0.6080 0.4623 0.5442 -0.0230 0.1846  -0.0337 280 HOH B O   
2738 O O   . HOH G .   ? 0.2105 0.2976 0.2714 -0.0541 -0.0571 -0.0750 281 HOH B O   
2739 O O   . HOH G .   ? 0.3405 0.2588 0.1115 -0.0065 0.0496  -0.0335 282 HOH B O   
2740 O O   . HOH G .   ? 0.8713 0.4587 0.4281 -0.0182 0.1503  0.0426  283 HOH B O   
2741 O O   . HOH G .   ? 0.6743 0.5036 0.3602 -0.0360 -0.0340 -0.0219 285 HOH B O   
2742 O O   . HOH G .   ? 0.7866 0.5552 0.4651 -0.0670 0.0583  -0.0689 286 HOH B O   
2743 O O   . HOH G .   ? 0.2874 0.2009 0.2683 -0.0176 0.0671  -0.0333 289 HOH B O   
2744 O O   . HOH G .   ? 0.5311 0.5540 0.5312 0.0327  -0.0768 0.0133  291 HOH B O   
2745 O O   . HOH G .   ? 0.4462 0.3351 0.3708 -0.0569 0.0679  -0.0628 292 HOH B O   
2746 O O   . HOH G .   ? 0.8192 0.6426 0.8158 -0.0560 0.2384  -0.0308 293 HOH B O   
2747 O O   . HOH G .   ? 0.2477 0.2051 0.2547 -0.0212 0.0775  -0.0146 295 HOH B O   
2748 O O   . HOH G .   ? 0.2218 0.1847 0.2803 -0.0319 0.1132  -0.0334 297 HOH B O   
2749 O O   . HOH G .   ? 0.2414 0.1764 0.2317 -0.0093 0.0939  0.0029  299 HOH B O   
2750 O O   . HOH G .   ? 0.3800 0.3136 0.4395 0.0668  0.0855  0.0467  300 HOH B O   
2751 O O   . HOH G .   ? 0.2573 0.2936 0.2197 0.0389  -0.0341 0.0293  301 HOH B O   
2752 O O   . HOH G .   ? 0.3251 0.3115 0.2072 0.0014  0.0254  -0.0298 304 HOH B O   
2753 O O   . HOH G .   ? 0.3652 0.1964 0.2531 0.0282  0.1299  0.0664  306 HOH B O   
2754 O O   . HOH G .   ? 0.5493 0.4030 0.3205 0.0300  -0.0630 0.0430  308 HOH B O   
2755 O O   . HOH G .   ? 0.3325 0.2637 0.3153 0.0001  0.1089  -0.0278 309 HOH B O   
2756 O O   . HOH G .   ? 0.1983 0.2599 0.2089 -0.0031 -0.0182 -0.0291 310 HOH B O   
2757 O O   . HOH G .   ? 0.2824 0.2301 0.3006 -0.0378 0.0603  -0.0551 311 HOH B O   
2758 O O   . HOH G .   ? 0.2976 0.2816 0.2515 -0.0481 -0.0140 -0.0504 312 HOH B O   
2759 O O   . HOH G .   ? 0.3021 0.2459 0.2861 -0.0102 0.0476  -0.0337 318 HOH B O   
2760 O O   . HOH G .   ? 0.4487 0.2199 0.1955 -0.0311 0.1367  -0.0214 320 HOH B O   
2761 O O   . HOH G .   ? 0.4737 0.4266 0.4035 0.0840  -0.0129 0.0940  321 HOH B O   
2762 O O   . HOH G .   ? 0.3064 0.3066 0.2512 -0.0455 -0.0555 -0.0456 327 HOH B O   
2763 O O   . HOH G .   ? 0.4762 0.4199 0.4556 -0.0051 0.0932  0.0089  331 HOH B O   
2764 O O   . HOH G .   ? 0.2784 0.2888 0.2623 0.0053  0.0710  -0.0197 333 HOH B O   
2765 O O   . HOH G .   ? 0.4071 0.3235 0.3353 0.0618  -0.0469 0.0463  335 HOH B O   
2766 O O   . HOH G .   ? 0.4676 0.2960 0.2432 0.0359  -0.0319 0.0488  336 HOH B O   
2767 O O   . HOH G .   ? 0.4854 0.2651 0.2773 -0.0168 0.1153  0.0072  337 HOH B O   
2768 O O   . HOH G .   ? 0.3435 0.3211 0.3804 -0.0357 0.0766  -0.0249 342 HOH B O   
2769 O O   . HOH G .   ? 0.3753 0.2788 0.3722 0.0094  0.1067  -0.0122 346 HOH B O   
2770 O O   . HOH G .   ? 0.2350 0.2864 0.2808 0.0091  0.0382  -0.0220 349 HOH B O   
2771 O O   . HOH H .   ? 0.2817 0.3645 0.4286 -0.0060 -0.0186 -0.0059 151 HOH C O   
2772 O O   . HOH H .   ? 0.4173 0.3837 0.3095 -0.0362 -0.0719 0.0592  157 HOH C O   
2773 O O   . HOH H .   ? 0.5659 0.4980 0.3795 -0.0168 -0.0411 0.0248  182 HOH C O   
2774 O O   . HOH H .   ? 0.2362 0.2452 0.1760 -0.0109 0.0175  0.0295  247 HOH C O   
2775 O O   . HOH H .   ? 0.2251 0.2722 0.2389 -0.0121 0.0273  0.0310  257 HOH C O   
2776 O O   . HOH H .   ? 0.5918 0.4483 0.3282 -0.0284 -0.1431 0.0529  263 HOH C O   
2777 O O   . HOH H .   ? 0.3555 0.3638 0.3105 -0.0367 -0.0415 0.0492  303 HOH C O   
2778 O O   . HOH H .   ? 0.4028 0.3896 0.3043 -0.0233 -0.0260 0.0390  307 HOH C O   
2779 O O   . HOH H .   ? 0.3382 0.3196 0.2289 -0.0186 -0.0184 0.0273  319 HOH C O   
2780 O O   . HOH I .   ? 0.4758 0.7447 0.4596 0.0196  -0.0276 0.0014  231 HOH D O   
2781 O O   . HOH I .   ? 0.3934 0.5304 0.3630 0.0024  -0.0081 -0.0100 245 HOH D O   
2782 O O   . HOH I .   ? 0.1623 0.3059 0.1702 0.0192  0.0146  0.0282  296 HOH D O   
2783 O O   . HOH I .   ? 0.2224 0.3139 0.1977 -0.0085 -0.0012 -0.0078 315 HOH D O   
2784 O O   . HOH I .   ? 0.1621 0.2063 0.1652 0.0243  0.0278  0.0351  323 HOH D O   
2785 O O   . HOH I .   ? 0.2286 0.2878 0.2292 0.0102  0.0211  0.0278  326 HOH D O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -1  ?   ?   ?   A . n 
A 1 2   SER 2   0   ?   ?   ?   A . n 
A 1 3   MET 3   1   ?   ?   ?   A . n 
A 1 4   GLU 4   2   2   GLU GLU A . n 
A 1 5   PRO 5   3   3   PRO PRO A . n 
A 1 6   ALA 6   4   4   ALA ALA A . n 
A 1 7   MET 7   5   5   MET MET A . n 
A 1 8   GLU 8   6   6   GLU GLU A . n 
A 1 9   PRO 9   7   7   PRO PRO A . n 
A 1 10  GLU 10  8   8   GLU GLU A . n 
A 1 11  THR 11  9   9   THR THR A . n 
A 1 12  LEU 12  10  10  LEU LEU A . n 
A 1 13  GLU 13  11  11  GLU GLU A . n 
A 1 14  ALA 14  12  12  ALA ALA A . n 
A 1 15  ARG 15  13  13  ARG ARG A . n 
A 1 16  ILE 16  14  14  ILE ILE A . n 
A 1 17  ASN 17  15  15  ASN ASN A . n 
A 1 18  ARG 18  16  16  ARG ARG A . n 
A 1 19  ALA 19  17  17  ALA ALA A . n 
A 1 20  THR 20  18  18  THR THR A . n 
A 1 21  ASN 21  19  19  ASN ASN A . n 
A 1 22  PRO 22  20  20  PRO PRO A . n 
A 1 23  LEU 23  21  21  LEU LEU A . n 
A 1 24  ASN 24  22  22  ASN ASN A . n 
A 1 25  LYS 25  23  23  LYS LYS A . n 
A 1 26  GLU 26  24  24  GLU GLU A . n 
A 1 27  LEU 27  25  25  LEU LEU A . n 
A 1 28  ASP 28  26  26  ASP ASP A . n 
A 1 29  TRP 29  27  27  TRP TRP A . n 
A 1 30  ALA 30  28  28  ALA ALA A . n 
A 1 31  SER 31  29  29  SER SER A . n 
A 1 32  ILE 32  30  30  ILE ILE A . n 
A 1 33  ASN 33  31  31  ASN ASN A . n 
A 1 34  GLY 34  32  32  GLY GLY A . n 
A 1 35  PHE 35  33  33  PHE PHE A . n 
A 1 36  CYS 36  34  34  CYS CYS A . n 
A 1 37  GLU 37  35  35  GLU GLU A . n 
A 1 38  GLN 38  36  36  GLN GLN A . n 
A 1 39  LEU 39  37  37  LEU LEU A . n 
A 1 40  ASN 40  38  38  ASN ASN A . n 
A 1 41  GLU 41  39  39  GLU GLU A . n 
A 1 42  ASP 42  40  40  ASP ASP A . n 
A 1 43  PHE 43  41  41  PHE PHE A . n 
A 1 44  GLU 44  42  42  GLU GLU A . n 
A 1 45  GLY 45  43  43  GLY GLY A . n 
A 1 46  PRO 46  44  44  PRO PRO A . n 
A 1 47  PRO 47  45  45  PRO PRO A . n 
A 1 48  LEU 48  46  46  LEU LEU A . n 
A 1 49  ALA 49  47  47  ALA ALA A . n 
A 1 50  THR 50  48  48  THR THR A . n 
A 1 51  ARG 51  49  49  ARG ARG A . n 
A 1 52  LEU 52  50  50  LEU LEU A . n 
A 1 53  LEU 53  51  51  LEU LEU A . n 
A 1 54  ALA 54  52  52  ALA ALA A . n 
A 1 55  HIS 55  53  53  HIS HIS A . n 
A 1 56  LYS 56  54  54  LYS LYS A . n 
A 1 57  ILE 57  55  55  ILE ILE A . n 
A 1 58  GLN 58  56  56  GLN GLN A . n 
A 1 59  SER 59  57  57  SER SER A . n 
A 1 60  PRO 60  58  58  PRO PRO A . n 
A 1 61  GLN 61  59  59  GLN GLN A . n 
A 1 62  GLU 62  60  60  GLU GLU A . n 
A 1 63  TRP 63  61  61  TRP TRP A . n 
A 1 64  GLU 64  62  62  GLU GLU A . n 
A 1 65  ALA 65  63  63  ALA ALA A . n 
A 1 66  ILE 66  64  64  ILE ILE A . n 
A 1 67  GLN 67  65  65  GLN GLN A . n 
A 1 68  ALA 68  66  66  ALA ALA A . n 
A 1 69  LEU 69  67  67  LEU LEU A . n 
A 1 70  THR 70  68  68  THR THR A . n 
A 1 71  VAL 71  69  69  VAL VAL A . n 
A 1 72  LEU 72  70  70  LEU LEU A . n 
A 1 73  GLU 73  71  71  GLU GLU A . n 
A 1 74  THR 74  72  72  THR THR A . n 
A 1 75  CYS 75  73  73  CYS CYS A . n 
A 1 76  MET 76  74  74  MET MET A . n 
A 1 77  LYS 77  75  75  LYS LYS A . n 
A 1 78  SER 78  76  76  SER SER A . n 
A 1 79  CYS 79  77  77  CYS CYS A . n 
A 1 80  GLY 80  78  78  GLY GLY A . n 
A 1 81  LYS 81  79  79  LYS LYS A . n 
A 1 82  ARG 82  80  80  ARG ARG A . n 
A 1 83  PHE 83  81  81  PHE PHE A . n 
A 1 84  HIS 84  82  82  HIS HIS A . n 
A 1 85  ASP 85  83  83  ASP ASP A . n 
A 1 86  GLU 86  84  84  GLU GLU A . n 
A 1 87  VAL 87  85  85  VAL VAL A . n 
A 1 88  GLY 88  86  86  GLY GLY A . n 
A 1 89  LYS 89  87  87  LYS LYS A . n 
A 1 90  PHE 90  88  88  PHE PHE A . n 
A 1 91  ARG 91  89  89  ARG ARG A . n 
A 1 92  PHE 92  90  90  PHE PHE A . n 
A 1 93  LEU 93  91  91  LEU LEU A . n 
A 1 94  ASN 94  92  92  ASN ASN A . n 
A 1 95  GLU 95  93  93  GLU GLU A . n 
A 1 96  LEU 96  94  94  LEU LEU A . n 
A 1 97  ILE 97  95  95  ILE ILE A . n 
A 1 98  LYS 98  96  96  LYS LYS A . n 
A 1 99  VAL 99  97  97  VAL VAL A . n 
A 1 100 VAL 100 98  98  VAL VAL A . n 
A 1 101 SER 101 99  99  SER SER A . n 
A 1 102 PRO 102 100 100 PRO PRO A . n 
A 1 103 LYS 103 101 101 LYS LYS A . n 
A 1 104 TYR 104 102 102 TYR TYR A . n 
A 1 105 LEU 105 103 103 LEU LEU A . n 
A 1 106 GLY 106 104 104 GLY GLY A . n 
A 1 107 SER 107 105 105 SER SER A . n 
A 1 108 ARG 108 106 106 ARG ARG A . n 
A 1 109 THR 109 107 107 THR THR A . n 
A 1 110 SER 110 108 108 SER SER A . n 
A 1 111 GLU 111 109 109 GLU GLU A . n 
A 1 112 LYS 112 110 110 LYS LYS A . n 
A 1 113 VAL 113 111 111 VAL VAL A . n 
A 1 114 LYS 114 112 112 LYS LYS A . n 
A 1 115 ASN 115 113 113 ASN ASN A . n 
A 1 116 LYS 116 114 114 LYS LYS A . n 
A 1 117 ILE 117 115 115 ILE ILE A . n 
A 1 118 LEU 118 116 116 LEU LEU A . n 
A 1 119 GLU 119 117 117 GLU GLU A . n 
A 1 120 LEU 120 118 118 LEU LEU A . n 
A 1 121 LEU 121 119 119 LEU LEU A . n 
A 1 122 TYR 122 120 120 TYR TYR A . n 
A 1 123 SER 123 121 121 SER SER A . n 
A 1 124 TRP 124 122 122 TRP TRP A . n 
A 1 125 THR 125 123 123 THR THR A . n 
A 1 126 VAL 126 124 124 VAL VAL A . n 
A 1 127 GLY 127 125 125 GLY GLY A . n 
A 1 128 LEU 128 126 126 LEU LEU A . n 
A 1 129 PRO 129 127 127 PRO PRO A . n 
A 1 130 GLU 130 128 128 GLU GLU A . n 
A 1 131 GLU 131 129 129 GLU GLU A . n 
A 1 132 VAL 132 130 130 VAL VAL A . n 
A 1 133 LYS 133 131 131 LYS LYS A . n 
A 1 134 ILE 134 132 132 ILE ILE A . n 
A 1 135 ALA 135 133 133 ALA ALA A . n 
A 1 136 GLU 136 134 134 GLU GLU A . n 
A 1 137 ALA 137 135 135 ALA ALA A . n 
A 1 138 TYR 138 136 136 TYR TYR A . n 
A 1 139 GLN 139 137 137 GLN GLN A . n 
A 1 140 MET 140 138 138 MET MET A . n 
A 1 141 LEU 141 139 139 LEU LEU A . n 
A 1 142 LYS 142 140 140 LYS LYS A . n 
A 1 143 LYS 143 141 141 LYS LYS A . n 
A 1 144 GLN 144 142 142 GLN GLN A . n 
A 1 145 GLY 145 143 143 GLY GLY A . n 
A 1 146 ILE 146 144 144 ILE ILE A . n 
A 1 147 VAL 147 145 145 VAL VAL A . n 
A 1 148 LYS 148 146 146 LYS LYS A . n 
A 1 149 SER 149 147 147 SER SER A . n 
B 1 1   GLY 1   -1  ?   ?   ?   B . n 
B 1 2   SER 2   0   ?   ?   ?   B . n 
B 1 3   MET 3   1   ?   ?   ?   B . n 
B 1 4   GLU 4   2   ?   ?   ?   B . n 
B 1 5   PRO 5   3   ?   ?   ?   B . n 
B 1 6   ALA 6   4   ?   ?   ?   B . n 
B 1 7   MET 7   5   ?   ?   ?   B . n 
B 1 8   GLU 8   6   6   GLU GLU B . n 
B 1 9   PRO 9   7   7   PRO PRO B . n 
B 1 10  GLU 10  8   8   GLU GLU B . n 
B 1 11  THR 11  9   9   THR THR B . n 
B 1 12  LEU 12  10  10  LEU LEU B . n 
B 1 13  GLU 13  11  11  GLU GLU B . n 
B 1 14  ALA 14  12  12  ALA ALA B . n 
B 1 15  ARG 15  13  13  ARG ARG B . n 
B 1 16  ILE 16  14  14  ILE ILE B . n 
B 1 17  ASN 17  15  15  ASN ASN B . n 
B 1 18  ARG 18  16  16  ARG ARG B . n 
B 1 19  ALA 19  17  17  ALA ALA B . n 
B 1 20  THR 20  18  18  THR THR B . n 
B 1 21  ASN 21  19  19  ASN ASN B . n 
B 1 22  PRO 22  20  20  PRO PRO B . n 
B 1 23  LEU 23  21  21  LEU LEU B . n 
B 1 24  ASN 24  22  22  ASN ASN B . n 
B 1 25  LYS 25  23  23  LYS LYS B . n 
B 1 26  GLU 26  24  24  GLU GLU B . n 
B 1 27  LEU 27  25  25  LEU LEU B . n 
B 1 28  ASP 28  26  26  ASP ASP B . n 
B 1 29  TRP 29  27  27  TRP TRP B . n 
B 1 30  ALA 30  28  28  ALA ALA B . n 
B 1 31  SER 31  29  29  SER SER B . n 
B 1 32  ILE 32  30  30  ILE ILE B . n 
B 1 33  ASN 33  31  31  ASN ASN B . n 
B 1 34  GLY 34  32  32  GLY GLY B . n 
B 1 35  PHE 35  33  33  PHE PHE B . n 
B 1 36  CYS 36  34  34  CYS CYS B . n 
B 1 37  GLU 37  35  35  GLU GLU B . n 
B 1 38  GLN 38  36  36  GLN GLN B . n 
B 1 39  LEU 39  37  37  LEU LEU B . n 
B 1 40  ASN 40  38  38  ASN ASN B . n 
B 1 41  GLU 41  39  39  GLU GLU B . n 
B 1 42  ASP 42  40  40  ASP ASP B . n 
B 1 43  PHE 43  41  41  PHE PHE B . n 
B 1 44  GLU 44  42  42  GLU GLU B . n 
B 1 45  GLY 45  43  43  GLY GLY B . n 
B 1 46  PRO 46  44  44  PRO PRO B . n 
B 1 47  PRO 47  45  45  PRO PRO B . n 
B 1 48  LEU 48  46  46  LEU LEU B . n 
B 1 49  ALA 49  47  47  ALA ALA B . n 
B 1 50  THR 50  48  48  THR THR B . n 
B 1 51  ARG 51  49  49  ARG ARG B . n 
B 1 52  LEU 52  50  50  LEU LEU B . n 
B 1 53  LEU 53  51  51  LEU LEU B . n 
B 1 54  ALA 54  52  52  ALA ALA B . n 
B 1 55  HIS 55  53  53  HIS HIS B . n 
B 1 56  LYS 56  54  54  LYS LYS B . n 
B 1 57  ILE 57  55  55  ILE ILE B . n 
B 1 58  GLN 58  56  56  GLN GLN B . n 
B 1 59  SER 59  57  57  SER SER B . n 
B 1 60  PRO 60  58  58  PRO PRO B . n 
B 1 61  GLN 61  59  59  GLN GLN B . n 
B 1 62  GLU 62  60  60  GLU GLU B . n 
B 1 63  TRP 63  61  61  TRP TRP B . n 
B 1 64  GLU 64  62  62  GLU GLU B . n 
B 1 65  ALA 65  63  63  ALA ALA B . n 
B 1 66  ILE 66  64  64  ILE ILE B . n 
B 1 67  GLN 67  65  65  GLN GLN B . n 
B 1 68  ALA 68  66  66  ALA ALA B . n 
B 1 69  LEU 69  67  67  LEU LEU B . n 
B 1 70  THR 70  68  68  THR THR B . n 
B 1 71  VAL 71  69  69  VAL VAL B . n 
B 1 72  LEU 72  70  70  LEU LEU B . n 
B 1 73  GLU 73  71  71  GLU GLU B . n 
B 1 74  THR 74  72  72  THR THR B . n 
B 1 75  CYS 75  73  73  CYS CYS B . n 
B 1 76  MET 76  74  74  MET MET B . n 
B 1 77  LYS 77  75  75  LYS LYS B . n 
B 1 78  SER 78  76  76  SER SER B . n 
B 1 79  CYS 79  77  77  CYS CYS B . n 
B 1 80  GLY 80  78  78  GLY GLY B . n 
B 1 81  LYS 81  79  79  LYS LYS B . n 
B 1 82  ARG 82  80  80  ARG ARG B . n 
B 1 83  PHE 83  81  81  PHE PHE B . n 
B 1 84  HIS 84  82  82  HIS HIS B . n 
B 1 85  ASP 85  83  83  ASP ASP B . n 
B 1 86  GLU 86  84  84  GLU GLU B . n 
B 1 87  VAL 87  85  85  VAL VAL B . n 
B 1 88  GLY 88  86  86  GLY GLY B . n 
B 1 89  LYS 89  87  87  LYS LYS B . n 
B 1 90  PHE 90  88  88  PHE PHE B . n 
B 1 91  ARG 91  89  89  ARG ARG B . n 
B 1 92  PHE 92  90  90  PHE PHE B . n 
B 1 93  LEU 93  91  91  LEU LEU B . n 
B 1 94  ASN 94  92  92  ASN ASN B . n 
B 1 95  GLU 95  93  93  GLU GLU B . n 
B 1 96  LEU 96  94  94  LEU LEU B . n 
B 1 97  ILE 97  95  95  ILE ILE B . n 
B 1 98  LYS 98  96  96  LYS LYS B . n 
B 1 99  VAL 99  97  97  VAL VAL B . n 
B 1 100 VAL 100 98  98  VAL VAL B . n 
B 1 101 SER 101 99  99  SER SER B . n 
B 1 102 PRO 102 100 100 PRO PRO B . n 
B 1 103 LYS 103 101 101 LYS LYS B . n 
B 1 104 TYR 104 102 102 TYR TYR B . n 
B 1 105 LEU 105 103 103 LEU LEU B . n 
B 1 106 GLY 106 104 104 GLY GLY B . n 
B 1 107 SER 107 105 105 SER SER B . n 
B 1 108 ARG 108 106 106 ARG ARG B . n 
B 1 109 THR 109 107 107 THR THR B . n 
B 1 110 SER 110 108 108 SER SER B . n 
B 1 111 GLU 111 109 109 GLU GLU B . n 
B 1 112 LYS 112 110 110 LYS LYS B . n 
B 1 113 VAL 113 111 111 VAL VAL B . n 
B 1 114 LYS 114 112 112 LYS LYS B . n 
B 1 115 ASN 115 113 113 ASN ASN B . n 
B 1 116 LYS 116 114 114 LYS LYS B . n 
B 1 117 ILE 117 115 115 ILE ILE B . n 
B 1 118 LEU 118 116 116 LEU LEU B . n 
B 1 119 GLU 119 117 117 GLU GLU B . n 
B 1 120 LEU 120 118 118 LEU LEU B . n 
B 1 121 LEU 121 119 119 LEU LEU B . n 
B 1 122 TYR 122 120 120 TYR TYR B . n 
B 1 123 SER 123 121 121 SER SER B . n 
B 1 124 TRP 124 122 122 TRP TRP B . n 
B 1 125 THR 125 123 123 THR THR B . n 
B 1 126 VAL 126 124 124 VAL VAL B . n 
B 1 127 GLY 127 125 125 GLY GLY B . n 
B 1 128 LEU 128 126 126 LEU LEU B . n 
B 1 129 PRO 129 127 127 PRO PRO B . n 
B 1 130 GLU 130 128 128 GLU GLU B . n 
B 1 131 GLU 131 129 129 GLU GLU B . n 
B 1 132 VAL 132 130 130 VAL VAL B . n 
B 1 133 LYS 133 131 131 LYS LYS B . n 
B 1 134 ILE 134 132 132 ILE ILE B . n 
B 1 135 ALA 135 133 133 ALA ALA B . n 
B 1 136 GLU 136 134 134 GLU GLU B . n 
B 1 137 ALA 137 135 135 ALA ALA B . n 
B 1 138 TYR 138 136 136 TYR TYR B . n 
B 1 139 GLN 139 137 137 GLN GLN B . n 
B 1 140 MET 140 138 138 MET MET B . n 
B 1 141 LEU 141 139 139 LEU LEU B . n 
B 1 142 LYS 142 140 140 LYS LYS B . n 
B 1 143 LYS 143 141 141 LYS LYS B . n 
B 1 144 GLN 144 142 142 GLN GLN B . n 
B 1 145 GLY 145 143 143 GLY GLY B . n 
B 1 146 ILE 146 144 144 ILE ILE B . n 
B 1 147 VAL 147 145 145 VAL VAL B . n 
B 1 148 LYS 148 146 146 LYS LYS B . n 
B 1 149 SER 149 147 ?   ?   ?   B . n 
C 2 1   ILE 1   1   ?   ?   ?   C . n 
C 2 2   THR 2   2   ?   ?   ?   C . n 
C 2 3   GLY 3   3   3   GLY GLY C . n 
C 2 4   PHE 4   4   4   PHE PHE C . n 
C 2 5   SER 5   5   5   SER SER C . n 
C 2 6   ASP 6   6   6   ASP ASP C . n 
C 2 7   ASP 7   7   7   ASP ASP C . n 
C 2 8   VAL 8   8   8   VAL VAL C . n 
C 2 9   PRO 9   9   9   PRO PRO C . n 
C 2 10  MET 10  10  10  MET MET C . n 
C 2 11  VAL 11  11  11  VAL VAL C . n 
C 2 12  ILE 12  12  12  ILE ILE C . n 
C 2 13  ALA 13  13  13  ALA ALA C . n 
D 2 1   ILE 1   1   ?   ?   ?   D . n 
D 2 2   THR 2   2   ?   ?   ?   D . n 
D 2 3   GLY 3   3   3   GLY GLY D . n 
D 2 4   PHE 4   4   4   PHE PHE D . n 
D 2 5   SER 5   5   5   SER SER D . n 
D 2 6   ASP 6   6   6   ASP ASP D . n 
D 2 7   ASP 7   7   7   ASP ASP D . n 
D 2 8   VAL 8   8   8   VAL VAL D . n 
D 2 9   PRO 9   9   9   PRO PRO D . n 
D 2 10  MET 10  10  10  MET MET D . n 
D 2 11  VAL 11  11  11  VAL VAL D . n 
D 2 12  ILE 12  12  12  ILE ILE D . n 
D 2 13  ALA 13  13  13  ALA ALA D . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,F,H   
2 1 B,D,E,G,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1200 ? 
1 MORE         -5   ? 
1 'SSA (A^2)'  9000 ? 
2 'ABSA (A^2)' 1120 ? 
2 MORE         -4   ? 
2 'SSA (A^2)'  8120 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-12-15 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2014-02-05 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Database references'       
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 12.3843 -10.9475 -25.5608 0.0631 0.0808 0.0699 -0.0208 0.0038  -0.0233 0.9921 1.3826 1.4631  -0.0796 -0.9057 -0.0615 
-0.1067 -0.0178 0.0871  0.1219  -0.0712 -0.0165 -0.0439 0.1020  -0.0692 'X-RAY DIFFRACTION' 
2 ? refined 5.9378  7.3497   -9.8610  0.0884 0.0960 0.0625 0.0018  0.0180  -0.0176 1.1795 2.9808 1.2284  0.2545  -0.7160 0.0510  
0.0546  -0.0357 -0.0009 -0.0073 0.0181  0.1565  0.2829  0.0072  0.0013  'X-RAY DIFFRACTION' 
3 ? refined 15.7936 3.0211   -37.2976 0.1689 0.1767 0.1072 -0.0241 -0.0188 0.0307  0.2878 1.9141 -0.3852 -0.2980 -0.4327 -0.2530 
0.0714  -0.0130 -0.0639 0.2230  0.0972  0.0033  -0.4611 0.1604  0.0576  'X-RAY DIFFRACTION' 
4 ? refined 20.6519 12.4015  -13.4341 0.1312 0.2734 0.1064 0.0224  0.0029  0.0048  0.0364 0.3760 -0.1467 -0.0374 -0.1825 0.2269  
-0.0662 0.0301  -0.1297 -0.2334 0.1806  -0.1022 0.1534  -0.2656 0.2719  'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.pdbx_refine_id 
1 1 ? ? ? ? ? ? ? ? ? 'chain A' 'X-RAY DIFFRACTION' 
2 2 ? ? ? ? ? ? ? ? ? 'chain B' 'X-RAY DIFFRACTION' 
3 3 ? ? ? ? ? ? ? ? ? 'chain C' 'X-RAY DIFFRACTION' 
4 4 ? ? ? ? ? ? ? ? ? 'chain D' 'X-RAY DIFFRACTION' 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
PHENIX      ?     ?               package 'Paul D. Adams' PDAdams@lbl.gov       refinement        http://www.phenix-online.org/ 
C++ ? 1 
PDB_EXTRACT 3.006 'June 11, 2008' package PDB             help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 2 
XDS         .     ?               ?       ?               ?                     'data scaling'    ? ?   ? 3 
XDS         .     ?               ?       ?               ?                     'data reduction'  ? ?   ? 4 
XSCALE      .     ?               ?       ?               ?                     'data scaling'    ? ?   ? 5 
PHASER      .     ?               ?       ?               ?                     phasing           ? ?   ? 6 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             O 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_1              7 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             C 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              7 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             N 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             GLU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              8 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                133.41 
_pdbx_validate_rmsd_angle.angle_target_value         122.70 
_pdbx_validate_rmsd_angle.angle_deviation            10.71 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.60 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR A 102 ? ? -124.61 -99.98  
2 1 GLU B 39  ? ? -172.69 84.98   
3 1 ASP B 40  ? ? 171.59  172.83  
4 1 TYR B 102 ? ? -121.07 -101.62 
5 1 PHE D 4   ? ? -49.31  9.26    
6 1 ASP D 6   ? ? -8.48   135.18  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 GLY D 3 ? ? PHE D 4 ? ? 74.88  
2 1 SER D 5 ? ? ASP D 6 ? ? 149.06 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -1  ? A GLY 1   
2  1 Y 1 A SER 0   ? A SER 2   
3  1 Y 1 A MET 1   ? A MET 3   
4  1 Y 1 B GLY -1  ? B GLY 1   
5  1 Y 1 B SER 0   ? B SER 2   
6  1 Y 1 B MET 1   ? B MET 3   
7  1 Y 1 B GLU 2   ? B GLU 4   
8  1 Y 1 B PRO 3   ? B PRO 5   
9  1 Y 1 B ALA 4   ? B ALA 6   
10 1 Y 1 B MET 5   ? B MET 7   
11 1 Y 1 B SER 147 ? B SER 149 
12 1 Y 1 C ILE 1   ? C ILE 1   
13 1 Y 1 C THR 2   ? C THR 2   
14 1 Y 1 D ILE 1   ? D ILE 1   
15 1 Y 1 D THR 2   ? D THR 2   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 HEXANE-1,6-DIOL HEZ 
4 water           HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HEZ 1   148 148 HEZ HEZ B . 
F 4 HOH 1   148 148 HOH HOH A . 
F 4 HOH 2   149 149 HOH HOH A . 
F 4 HOH 3   150 150 HOH HOH A . 
F 4 HOH 4   151 151 HOH HOH A . 
F 4 HOH 5   152 152 HOH HOH A . 
F 4 HOH 6   153 153 HOH HOH A . 
F 4 HOH 7   154 154 HOH HOH A . 
F 4 HOH 8   155 155 HOH HOH A . 
F 4 HOH 9   156 156 HOH HOH A . 
F 4 HOH 10  157 157 HOH HOH A . 
F 4 HOH 11  158 158 HOH HOH A . 
F 4 HOH 12  160 160 HOH HOH A . 
F 4 HOH 13  161 161 HOH HOH A . 
F 4 HOH 14  162 162 HOH HOH A . 
F 4 HOH 15  163 163 HOH HOH A . 
F 4 HOH 16  164 164 HOH HOH A . 
F 4 HOH 17  165 165 HOH HOH A . 
F 4 HOH 18  166 166 HOH HOH A . 
F 4 HOH 19  167 167 HOH HOH A . 
F 4 HOH 20  168 168 HOH HOH A . 
F 4 HOH 21  169 169 HOH HOH A . 
F 4 HOH 22  170 170 HOH HOH A . 
F 4 HOH 23  171 171 HOH HOH A . 
F 4 HOH 24  172 172 HOH HOH A . 
F 4 HOH 25  173 173 HOH HOH A . 
F 4 HOH 26  175 175 HOH HOH A . 
F 4 HOH 27  176 176 HOH HOH A . 
F 4 HOH 28  177 177 HOH HOH A . 
F 4 HOH 29  178 178 HOH HOH A . 
F 4 HOH 30  179 179 HOH HOH A . 
F 4 HOH 31  180 180 HOH HOH A . 
F 4 HOH 32  182 182 HOH HOH A . 
F 4 HOH 33  184 184 HOH HOH A . 
F 4 HOH 34  186 186 HOH HOH A . 
F 4 HOH 35  187 187 HOH HOH A . 
F 4 HOH 36  188 188 HOH HOH A . 
F 4 HOH 37  190 190 HOH HOH A . 
F 4 HOH 38  192 192 HOH HOH A . 
F 4 HOH 39  194 194 HOH HOH A . 
F 4 HOH 40  196 196 HOH HOH A . 
F 4 HOH 41  197 197 HOH HOH A . 
F 4 HOH 42  198 198 HOH HOH A . 
F 4 HOH 43  200 200 HOH HOH A . 
F 4 HOH 44  201 201 HOH HOH A . 
F 4 HOH 45  202 202 HOH HOH A . 
F 4 HOH 46  205 205 HOH HOH A . 
F 4 HOH 47  207 207 HOH HOH A . 
F 4 HOH 48  208 208 HOH HOH A . 
F 4 HOH 49  209 209 HOH HOH A . 
F 4 HOH 50  210 210 HOH HOH A . 
F 4 HOH 51  211 211 HOH HOH A . 
F 4 HOH 52  212 212 HOH HOH A . 
F 4 HOH 53  214 214 HOH HOH A . 
F 4 HOH 54  215 215 HOH HOH A . 
F 4 HOH 55  217 217 HOH HOH A . 
F 4 HOH 56  218 218 HOH HOH A . 
F 4 HOH 57  219 219 HOH HOH A . 
F 4 HOH 58  220 220 HOH HOH A . 
F 4 HOH 59  221 221 HOH HOH A . 
F 4 HOH 60  222 222 HOH HOH A . 
F 4 HOH 61  223 223 HOH HOH A . 
F 4 HOH 62  224 224 HOH HOH A . 
F 4 HOH 63  225 225 HOH HOH A . 
F 4 HOH 64  226 226 HOH HOH A . 
F 4 HOH 65  227 227 HOH HOH A . 
F 4 HOH 66  228 228 HOH HOH A . 
F 4 HOH 67  230 230 HOH HOH A . 
F 4 HOH 68  232 232 HOH HOH A . 
F 4 HOH 69  233 233 HOH HOH A . 
F 4 HOH 70  234 234 HOH HOH A . 
F 4 HOH 71  235 235 HOH HOH A . 
F 4 HOH 72  236 236 HOH HOH A . 
F 4 HOH 73  237 237 HOH HOH A . 
F 4 HOH 74  239 239 HOH HOH A . 
F 4 HOH 75  240 240 HOH HOH A . 
F 4 HOH 76  241 241 HOH HOH A . 
F 4 HOH 77  242 242 HOH HOH A . 
F 4 HOH 78  243 243 HOH HOH A . 
F 4 HOH 79  246 246 HOH HOH A . 
F 4 HOH 80  248 248 HOH HOH A . 
F 4 HOH 81  249 249 HOH HOH A . 
F 4 HOH 82  250 250 HOH HOH A . 
F 4 HOH 83  252 252 HOH HOH A . 
F 4 HOH 84  253 253 HOH HOH A . 
F 4 HOH 85  255 255 HOH HOH A . 
F 4 HOH 86  256 256 HOH HOH A . 
F 4 HOH 87  259 259 HOH HOH A . 
F 4 HOH 88  260 260 HOH HOH A . 
F 4 HOH 89  261 261 HOH HOH A . 
F 4 HOH 90  262 262 HOH HOH A . 
F 4 HOH 91  263 263 HOH HOH A . 
F 4 HOH 92  264 264 HOH HOH A . 
F 4 HOH 93  265 265 HOH HOH A . 
F 4 HOH 94  267 267 HOH HOH A . 
F 4 HOH 95  268 268 HOH HOH A . 
F 4 HOH 96  269 269 HOH HOH A . 
F 4 HOH 97  271 271 HOH HOH A . 
F 4 HOH 98  272 272 HOH HOH A . 
F 4 HOH 99  275 275 HOH HOH A . 
F 4 HOH 100 276 276 HOH HOH A . 
F 4 HOH 101 277 277 HOH HOH A . 
F 4 HOH 102 278 278 HOH HOH A . 
F 4 HOH 103 280 280 HOH HOH A . 
F 4 HOH 104 283 283 HOH HOH A . 
F 4 HOH 105 284 284 HOH HOH A . 
F 4 HOH 106 286 286 HOH HOH A . 
F 4 HOH 107 287 287 HOH HOH A . 
F 4 HOH 108 288 288 HOH HOH A . 
F 4 HOH 109 290 290 HOH HOH A . 
F 4 HOH 110 291 291 HOH HOH A . 
F 4 HOH 111 293 293 HOH HOH A . 
F 4 HOH 112 294 294 HOH HOH A . 
F 4 HOH 113 298 298 HOH HOH A . 
F 4 HOH 114 300 300 HOH HOH A . 
F 4 HOH 115 302 302 HOH HOH A . 
F 4 HOH 116 305 305 HOH HOH A . 
F 4 HOH 117 313 313 HOH HOH A . 
F 4 HOH 118 314 314 HOH HOH A . 
F 4 HOH 119 316 316 HOH HOH A . 
F 4 HOH 120 317 317 HOH HOH A . 
F 4 HOH 121 322 322 HOH HOH A . 
F 4 HOH 122 324 324 HOH HOH A . 
F 4 HOH 123 325 325 HOH HOH A . 
F 4 HOH 124 328 328 HOH HOH A . 
F 4 HOH 125 329 329 HOH HOH A . 
F 4 HOH 126 330 330 HOH HOH A . 
F 4 HOH 127 332 332 HOH HOH A . 
F 4 HOH 128 334 334 HOH HOH A . 
F 4 HOH 129 338 338 HOH HOH A . 
F 4 HOH 130 339 339 HOH HOH A . 
F 4 HOH 131 340 340 HOH HOH A . 
F 4 HOH 132 341 341 HOH HOH A . 
F 4 HOH 133 343 343 HOH HOH A . 
F 4 HOH 134 344 344 HOH HOH A . 
F 4 HOH 135 345 345 HOH HOH A . 
F 4 HOH 136 347 347 HOH HOH A . 
F 4 HOH 137 348 348 HOH HOH A . 
F 4 HOH 138 350 350 HOH HOH A . 
G 4 HOH 1   149 149 HOH HOH B . 
G 4 HOH 2   150 150 HOH HOH B . 
G 4 HOH 3   151 151 HOH HOH B . 
G 4 HOH 4   152 176 HOH HOH B . 
G 4 HOH 5   153 177 HOH HOH B . 
G 4 HOH 6   155 155 HOH HOH B . 
G 4 HOH 7   159 159 HOH HOH B . 
G 4 HOH 8   160 160 HOH HOH B . 
G 4 HOH 9   161 161 HOH HOH B . 
G 4 HOH 10  162 162 HOH HOH B . 
G 4 HOH 11  163 163 HOH HOH B . 
G 4 HOH 12  164 164 HOH HOH B . 
G 4 HOH 13  165 165 HOH HOH B . 
G 4 HOH 14  166 166 HOH HOH B . 
G 4 HOH 15  167 167 HOH HOH B . 
G 4 HOH 16  168 168 HOH HOH B . 
G 4 HOH 17  169 169 HOH HOH B . 
G 4 HOH 18  170 170 HOH HOH B . 
G 4 HOH 19  171 171 HOH HOH B . 
G 4 HOH 20  172 172 HOH HOH B . 
G 4 HOH 21  174 174 HOH HOH B . 
G 4 HOH 22  175 175 HOH HOH B . 
G 4 HOH 23  176 176 HOH HOH B . 
G 4 HOH 24  177 177 HOH HOH B . 
G 4 HOH 25  178 178 HOH HOH B . 
G 4 HOH 26  179 179 HOH HOH B . 
G 4 HOH 27  180 180 HOH HOH B . 
G 4 HOH 28  181 181 HOH HOH B . 
G 4 HOH 29  183 183 HOH HOH B . 
G 4 HOH 30  184 184 HOH HOH B . 
G 4 HOH 31  185 185 HOH HOH B . 
G 4 HOH 32  186 186 HOH HOH B . 
G 4 HOH 33  187 187 HOH HOH B . 
G 4 HOH 34  188 188 HOH HOH B . 
G 4 HOH 35  189 189 HOH HOH B . 
G 4 HOH 36  190 190 HOH HOH B . 
G 4 HOH 37  193 193 HOH HOH B . 
G 4 HOH 38  194 194 HOH HOH B . 
G 4 HOH 39  195 195 HOH HOH B . 
G 4 HOH 40  196 196 HOH HOH B . 
G 4 HOH 41  197 197 HOH HOH B . 
G 4 HOH 42  199 199 HOH HOH B . 
G 4 HOH 43  200 200 HOH HOH B . 
G 4 HOH 44  201 201 HOH HOH B . 
G 4 HOH 45  203 203 HOH HOH B . 
G 4 HOH 46  204 204 HOH HOH B . 
G 4 HOH 47  206 206 HOH HOH B . 
G 4 HOH 48  207 207 HOH HOH B . 
G 4 HOH 49  208 208 HOH HOH B . 
G 4 HOH 50  209 209 HOH HOH B . 
G 4 HOH 51  210 210 HOH HOH B . 
G 4 HOH 52  213 213 HOH HOH B . 
G 4 HOH 53  216 216 HOH HOH B . 
G 4 HOH 54  221 221 HOH HOH B . 
G 4 HOH 55  222 222 HOH HOH B . 
G 4 HOH 56  223 223 HOH HOH B . 
G 4 HOH 57  226 226 HOH HOH B . 
G 4 HOH 58  231 231 HOH HOH B . 
G 4 HOH 59  232 232 HOH HOH B . 
G 4 HOH 60  233 233 HOH HOH B . 
G 4 HOH 61  235 235 HOH HOH B . 
G 4 HOH 62  236 236 HOH HOH B . 
G 4 HOH 63  238 238 HOH HOH B . 
G 4 HOH 64  239 239 HOH HOH B . 
G 4 HOH 65  240 240 HOH HOH B . 
G 4 HOH 66  241 241 HOH HOH B . 
G 4 HOH 67  242 242 HOH HOH B . 
G 4 HOH 68  243 243 HOH HOH B . 
G 4 HOH 69  244 244 HOH HOH B . 
G 4 HOH 70  245 245 HOH HOH B . 
G 4 HOH 71  246 246 HOH HOH B . 
G 4 HOH 72  247 247 HOH HOH B . 
G 4 HOH 73  251 251 HOH HOH B . 
G 4 HOH 74  256 256 HOH HOH B . 
G 4 HOH 75  257 257 HOH HOH B . 
G 4 HOH 76  258 258 HOH HOH B . 
G 4 HOH 77  259 259 HOH HOH B . 
G 4 HOH 78  261 261 HOH HOH B . 
G 4 HOH 79  262 262 HOH HOH B . 
G 4 HOH 80  265 265 HOH HOH B . 
G 4 HOH 81  266 266 HOH HOH B . 
G 4 HOH 82  267 267 HOH HOH B . 
G 4 HOH 83  268 268 HOH HOH B . 
G 4 HOH 84  270 270 HOH HOH B . 
G 4 HOH 85  273 273 HOH HOH B . 
G 4 HOH 86  274 274 HOH HOH B . 
G 4 HOH 87  278 278 HOH HOH B . 
G 4 HOH 88  279 279 HOH HOH B . 
G 4 HOH 89  280 280 HOH HOH B . 
G 4 HOH 90  281 281 HOH HOH B . 
G 4 HOH 91  282 282 HOH HOH B . 
G 4 HOH 92  283 283 HOH HOH B . 
G 4 HOH 93  285 285 HOH HOH B . 
G 4 HOH 94  286 286 HOH HOH B . 
G 4 HOH 95  289 289 HOH HOH B . 
G 4 HOH 96  291 291 HOH HOH B . 
G 4 HOH 97  292 292 HOH HOH B . 
G 4 HOH 98  293 293 HOH HOH B . 
G 4 HOH 99  295 295 HOH HOH B . 
G 4 HOH 100 297 297 HOH HOH B . 
G 4 HOH 101 299 299 HOH HOH B . 
G 4 HOH 102 300 300 HOH HOH B . 
G 4 HOH 103 301 301 HOH HOH B . 
G 4 HOH 104 304 304 HOH HOH B . 
G 4 HOH 105 306 306 HOH HOH B . 
G 4 HOH 106 308 308 HOH HOH B . 
G 4 HOH 107 309 309 HOH HOH B . 
G 4 HOH 108 310 310 HOH HOH B . 
G 4 HOH 109 311 311 HOH HOH B . 
G 4 HOH 110 312 312 HOH HOH B . 
G 4 HOH 111 318 318 HOH HOH B . 
G 4 HOH 112 320 320 HOH HOH B . 
G 4 HOH 113 321 321 HOH HOH B . 
G 4 HOH 114 327 327 HOH HOH B . 
G 4 HOH 115 331 331 HOH HOH B . 
G 4 HOH 116 333 333 HOH HOH B . 
G 4 HOH 117 335 335 HOH HOH B . 
G 4 HOH 118 336 336 HOH HOH B . 
G 4 HOH 119 337 337 HOH HOH B . 
G 4 HOH 120 342 342 HOH HOH B . 
G 4 HOH 121 346 346 HOH HOH B . 
G 4 HOH 122 349 349 HOH HOH B . 
H 4 HOH 1   151 151 HOH HOH C . 
H 4 HOH 2   157 157 HOH HOH C . 
H 4 HOH 3   182 182 HOH HOH C . 
H 4 HOH 4   247 247 HOH HOH C . 
H 4 HOH 5   257 257 HOH HOH C . 
H 4 HOH 6   263 263 HOH HOH C . 
H 4 HOH 7   303 303 HOH HOH C . 
H 4 HOH 8   307 307 HOH HOH C . 
H 4 HOH 9   319 319 HOH HOH C . 
I 4 HOH 1   231 231 HOH HOH D . 
I 4 HOH 2   245 245 HOH HOH D . 
I 4 HOH 3   296 296 HOH HOH D . 
I 4 HOH 4   315 315 HOH HOH D . 
I 4 HOH 5   323 323 HOH HOH D . 
I 4 HOH 6   326 326 HOH HOH D . 
#