data_3G2U
# 
_entry.id   3G2U 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3G2U         
RCSB  RCSB051352   
WWPDB D_1000051352 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3G2S . unspecified 
PDB 3G2T . unspecified 
PDB 3G2V . unspecified 
PDB 3G2W . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3G2U 
_pdbx_database_status.recvd_initial_deposition_date   2009-02-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Cramer, J.F.'     1 
'Behrens, M.A.'    2 
'Gustafsen, C.'    3 
'Oliveira, C.L.P.' 4 
'Pedersen, J.S.'   5 
'Madsen, P.'       6 
'Petersen, C.M.'   7 
'Thirup, S.S.'     8 
# 
_citation.id                        primary 
_citation.title                     'GGA autoinhibition revisited' 
_citation.journal_abbrev            Traffic 
_citation.journal_volume            11 
_citation.page_first                259 
_citation.page_last                 273 
_citation.year                      2010 
_citation.journal_id_ASTM           ? 
_citation.country                   DK 
_citation.journal_id_ISSN           1398-9219 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20015111 
_citation.pdbx_database_id_DOI      10.1111/j.1600-0854.2009.01017.x 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Cramer, J.F.'     1 
primary 'Gustafsen, C.'    2 
primary 'Behrens, M.A.'    3 
primary 'Oliveira, C.L.P.' 4 
primary 'Pedersen, J.S.'   5 
primary 'Madsen, P.'       6 
primary 'Petersen, C.M.'   7 
primary 'Thirup, S.S.'     8 
# 
_cell.entry_id           3G2U 
_cell.length_a           48.486 
_cell.length_b           72.728 
_cell.length_c           103.767 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3G2U 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ADP-ribosylation factor-binding protein GGA1' 16958.564 2   ? ? 'VHS Domain (N-terminal domain)' ? 
2 polymer     syn 'C-terminal fragment of Sortilin'              1495.438  2   ? ? ?                                ? 
3 non-polymer syn 'IODIDE ION'                                   126.904   5   ? ? ?                                ? 
4 water       nat water                                          18.015    147 ? ? ?                                ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Golgi-localized, gamma ear-containing, ARF-binding protein 1, Gamma-adaptin-related protein 1' 
2 'neurotensin receptor 3, NTS3, NTR3, NT3'                                                       
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSMEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQEWEAIQALTVLETCMKSCG
KRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLYSWTVGLPEEVKIAEAYQMLKKQGIVKS
;
;GSMEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQEWEAIQALTVLETCMKSCG
KRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLYSWTVGLPEEVKIAEAYQMLKKQGIVKS
;
A,B ? 
2 'polypeptide(L)' no no SGYHDDSDEDLLE SGYHDDSDEDLLE C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   MET n 
1 4   GLU n 
1 5   PRO n 
1 6   ALA n 
1 7   MET n 
1 8   GLU n 
1 9   PRO n 
1 10  GLU n 
1 11  THR n 
1 12  LEU n 
1 13  GLU n 
1 14  ALA n 
1 15  ARG n 
1 16  ILE n 
1 17  ASN n 
1 18  ARG n 
1 19  ALA n 
1 20  THR n 
1 21  ASN n 
1 22  PRO n 
1 23  LEU n 
1 24  ASN n 
1 25  LYS n 
1 26  GLU n 
1 27  LEU n 
1 28  ASP n 
1 29  TRP n 
1 30  ALA n 
1 31  SER n 
1 32  ILE n 
1 33  ASN n 
1 34  GLY n 
1 35  PHE n 
1 36  CYS n 
1 37  GLU n 
1 38  GLN n 
1 39  LEU n 
1 40  ASN n 
1 41  GLU n 
1 42  ASP n 
1 43  PHE n 
1 44  GLU n 
1 45  GLY n 
1 46  PRO n 
1 47  PRO n 
1 48  LEU n 
1 49  ALA n 
1 50  THR n 
1 51  ARG n 
1 52  LEU n 
1 53  LEU n 
1 54  ALA n 
1 55  HIS n 
1 56  LYS n 
1 57  ILE n 
1 58  GLN n 
1 59  SER n 
1 60  PRO n 
1 61  GLN n 
1 62  GLU n 
1 63  TRP n 
1 64  GLU n 
1 65  ALA n 
1 66  ILE n 
1 67  GLN n 
1 68  ALA n 
1 69  LEU n 
1 70  THR n 
1 71  VAL n 
1 72  LEU n 
1 73  GLU n 
1 74  THR n 
1 75  CYS n 
1 76  MET n 
1 77  LYS n 
1 78  SER n 
1 79  CYS n 
1 80  GLY n 
1 81  LYS n 
1 82  ARG n 
1 83  PHE n 
1 84  HIS n 
1 85  ASP n 
1 86  GLU n 
1 87  VAL n 
1 88  GLY n 
1 89  LYS n 
1 90  PHE n 
1 91  ARG n 
1 92  PHE n 
1 93  LEU n 
1 94  ASN n 
1 95  GLU n 
1 96  LEU n 
1 97  ILE n 
1 98  LYS n 
1 99  VAL n 
1 100 VAL n 
1 101 SER n 
1 102 PRO n 
1 103 LYS n 
1 104 TYR n 
1 105 LEU n 
1 106 GLY n 
1 107 SER n 
1 108 ARG n 
1 109 THR n 
1 110 SER n 
1 111 GLU n 
1 112 LYS n 
1 113 VAL n 
1 114 LYS n 
1 115 ASN n 
1 116 LYS n 
1 117 ILE n 
1 118 LEU n 
1 119 GLU n 
1 120 LEU n 
1 121 LEU n 
1 122 TYR n 
1 123 SER n 
1 124 TRP n 
1 125 THR n 
1 126 VAL n 
1 127 GLY n 
1 128 LEU n 
1 129 PRO n 
1 130 GLU n 
1 131 GLU n 
1 132 VAL n 
1 133 LYS n 
1 134 ILE n 
1 135 ALA n 
1 136 GLU n 
1 137 ALA n 
1 138 TYR n 
1 139 GLN n 
1 140 MET n 
1 141 LEU n 
1 142 LYS n 
1 143 LYS n 
1 144 GLN n 
1 145 GLY n 
1 146 ILE n 
1 147 VAL n 
1 148 LYS n 
1 149 SER n 
2 1   SER n 
2 2   GLY n 
2 3   TYR n 
2 4   HIS n 
2 5   ASP n 
2 6   ASP n 
2 7   SER n 
2 8   ASP n 
2 9   GLU n 
2 10  ASP n 
2 11  LEU n 
2 12  LEU n 
2 13  GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3) CodonPlus-RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX4T-1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'The peptide was chemically synthesized.' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP GGA1_HUMAN Q9UJY5 1 
;MEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQEWEAIQALTVLETCMKSCGKR
FHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLYSWTVGLPEEVKIAEAYQMLKKQGIVKS
;
1   ? 
2 UNP SORT_HUMAN Q99523 2 SGYHDDSDEDLLE 819 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3G2U A 3 ? 149 ? Q9UJY5 1   ? 147 ? 1 147 
2 1 3G2U B 3 ? 149 ? Q9UJY5 1   ? 147 ? 1 147 
3 2 3G2U C 1 ? 13  ? Q99523 819 ? 831 ? 1 13  
4 2 3G2U D 1 ? 13  ? Q99523 819 ? 831 ? 1 13  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3G2U GLY A 1 ? UNP Q9UJY5 ? ? 'EXPRESSION TAG' -1 1 
1 3G2U SER A 2 ? UNP Q9UJY5 ? ? 'EXPRESSION TAG' 0  2 
2 3G2U GLY B 1 ? UNP Q9UJY5 ? ? 'EXPRESSION TAG' -1 3 
2 3G2U SER B 2 ? UNP Q9UJY5 ? ? 'EXPRESSION TAG' 0  4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
IOD non-polymer         . 'IODIDE ION'    ? 'I -1'           126.904 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3G2U 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.48 
_exptl_crystal.density_percent_sol   50.37 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    
'15%(w/v) PEG 5000 mmE, 0.2M NH4I, 0.3M 1,6-hexanediol, 0.1M MES-NaOH, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 292K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 345 mm plate' 
_diffrn_detector.pdbx_collection_date   2007-03-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si [111], horizontally focussing' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.8423 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'EMBL/DESY, HAMBURG BEAMLINE BW7B' 
_diffrn_source.pdbx_synchrotron_site       'EMBL/DESY, Hamburg' 
_diffrn_source.pdbx_synchrotron_beamline   BW7B 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.8423 
# 
_reflns.entry_id                     3G2U 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   -3.0 
_reflns.d_resolution_low             43.5 
_reflns.d_resolution_high            2.3 
_reflns.number_obs                   16683 
_reflns.number_all                   16852 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            0.081 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15.3 
_reflns.B_iso_Wilson_estimate        34.100 
_reflns.pdbx_redundancy              5.66 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.3 
_reflns_shell.d_res_low              2.4 
_reflns_shell.percent_possible_all   99.6 
_reflns_shell.Rmerge_I_obs           0.349 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.4 
_reflns_shell.pdbx_redundancy        5.17 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2428 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3G2U 
_refine.ls_number_reflns_obs                     16629 
_refine.ls_number_reflns_all                     16852 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             37.601 
_refine.ls_d_res_high                            2.301 
_refine.ls_percent_reflns_obs                    98.400 
_refine.ls_R_factor_obs                          0.201 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.199 
_refine.ls_R_factor_R_free                       0.246 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.030 
_refine.ls_number_reflns_R_free                  836 
_refine.ls_number_reflns_R_work                  15793 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.correlation_coeff_Fo_to_Fc               0.946 
_refine.correlation_coeff_Fo_to_Fc_free          0.934 
_refine.B_iso_mean                               41.418 
_refine.aniso_B[1][1]                            3.895 
_refine.aniso_B[2][2]                            0.182 
_refine.aniso_B[3][3]                            -4.077 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.319 
_refine.solvent_model_param_bsol                 36.790 
_refine.pdbx_solvent_vdw_probe_radii             1.110 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.900 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1JWF 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.302 
_refine.pdbx_overall_ESU_R_Free                  0.227 
_refine.overall_SU_ML                            0.150 
_refine.overall_SU_B                             11.791 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.overall_FOM_work_R_set                   0.836 
_refine.B_iso_max                                135.78 
_refine.B_iso_min                                12.05 
_refine.pdbx_overall_phase_error                 22.950 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            0.50 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2366 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         5 
_refine_hist.number_atoms_solvent             147 
_refine_hist.number_atoms_total               2518 
_refine_hist.d_res_high                       2.301 
_refine_hist.d_res_low                        37.601 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           2411 0.009  ? ? 'X-RAY DIFFRACTION' ? 
f_angle_d          3246 0.986  ? ? 'X-RAY DIFFRACTION' ? 
f_chiral_restr     364  0.081  ? ? 'X-RAY DIFFRACTION' ? 
f_plane_restr      414  0.017  ? ? 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 922  22.253 ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.redundancy_reflns_obs 
2.300 2.445  6 99.000  2586 . 0.214 0.286 . 139 . 2725 . 'X-RAY DIFFRACTION' . 
2.445 2.633  6 100.000 2600 . 0.208 0.271 . 148 . 2748 . 'X-RAY DIFFRACTION' . 
2.633 2.898  6 99.000  2630 . 0.203 0.262 . 139 . 2769 . 'X-RAY DIFFRACTION' . 
2.898 3.318  6 99.000  2612 . 0.202 0.289 . 148 . 2760 . 'X-RAY DIFFRACTION' . 
3.318 4.179  6 98.000  2641 . 0.179 0.227 . 131 . 2772 . 'X-RAY DIFFRACTION' . 
4.179 37.606 6 96.000  2724 . 0.196 0.196 . 131 . 2855 . 'X-RAY DIFFRACTION' . 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
# 
_struct.entry_id                  3G2U 
_struct.title                     'VHS Domain of human GGA1 complexed with Sotilin C-terminal Peptide' 
_struct.pdbx_descriptor           
'Golgi-localized, gamma ear-containing, ARF-binding protein 1, Gamma-adaptin related protein 1, C-terminal fragment of Sortilin' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3G2U 
_struct_keywords.pdbx_keywords   'PROTEIN TRANSPORT' 
_struct_keywords.text            
'ADP-ribosylation factor binding protein GGA1, VHS, acidic-cluster dileucine signal, Sortilin, PROTEIN TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
M N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 11  ? THR A 20  ? THR A 9   THR A 18  1 ? 10 
HELX_P HELX_P2  2  ASP A 28  ? ASP A 42  ? ASP A 26  ASP A 40  1 ? 15 
HELX_P HELX_P3  3  GLU A 44  ? GLN A 58  ? GLU A 42  GLN A 56  1 ? 15 
HELX_P HELX_P4  4  GLN A 61  ? CYS A 79  ? GLN A 59  CYS A 77  1 ? 19 
HELX_P HELX_P5  5  LYS A 81  ? GLY A 88  ? LYS A 79  GLY A 86  1 ? 8  
HELX_P HELX_P6  6  LYS A 89  ? SER A 101 ? LYS A 87  SER A 99  1 ? 13 
HELX_P HELX_P7  7  LEU A 105 ? THR A 109 ? LEU A 103 THR A 107 5 ? 5  
HELX_P HELX_P8  8  SER A 110 ? LEU A 128 ? SER A 108 LEU A 126 1 ? 19 
HELX_P HELX_P9  9  GLU A 131 ? GLN A 144 ? GLU A 129 GLN A 142 1 ? 14 
HELX_P HELX_P10 10 THR B 11  ? THR B 20  ? THR B 9   THR B 18  1 ? 10 
HELX_P HELX_P11 11 ASP B 28  ? ASP B 42  ? ASP B 26  ASP B 40  1 ? 15 
HELX_P HELX_P12 12 GLU B 44  ? GLN B 58  ? GLU B 42  GLN B 56  1 ? 15 
HELX_P HELX_P13 13 GLN B 61  ? LYS B 77  ? GLN B 59  LYS B 75  1 ? 17 
HELX_P HELX_P14 14 GLY B 80  ? GLY B 88  ? GLY B 78  GLY B 86  1 ? 9  
HELX_P HELX_P15 15 LYS B 89  ? SER B 101 ? LYS B 87  SER B 99  1 ? 13 
HELX_P HELX_P16 16 SER B 110 ? LEU B 128 ? SER B 108 LEU B 126 1 ? 19 
HELX_P HELX_P17 17 GLU B 131 ? GLN B 144 ? GLU B 129 GLN B 142 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 36 SG ? ? ? 1_555 A CYS 75 SG ? ? A CYS 34 A CYS 73 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf2 disulf ? ? A CYS 79 SG ? ? ? 1_555 B CYS 79 SG ? ? A CYS 77 B CYS 77 2_555 ? ? ? ? ? ? ? 2.087 ? 
disulf3 disulf ? ? B CYS 36 SG ? ? ? 1_555 B CYS 75 SG ? ? B CYS 34 B CYS 73 1_555 ? ? ? ? ? ? ? 2.047 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE IOD A 148' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE IOD A 149' 
AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE IOD A 150' 
AC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE IOD A 151' 
AC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE IOD B 148' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2 LEU A 52  ? LEU A 50  . ? 1_555 ? 
2  AC1 2 GLN B 61  ? GLN B 59  . ? 1_555 ? 
3  AC2 3 PRO A 60  ? PRO A 58  . ? 1_555 ? 
4  AC2 3 GLN A 61  ? GLN A 59  . ? 1_555 ? 
5  AC2 3 LEU B 52  ? LEU B 50  . ? 1_555 ? 
6  AC3 2 ASN A 40  ? ASN A 38  . ? 1_555 ? 
7  AC3 2 GLY A 80  ? GLY A 78  . ? 1_555 ? 
8  AC4 3 TRP A 29  ? TRP A 27  . ? 4_445 ? 
9  AC4 3 GLN A 139 ? GLN A 137 . ? 1_555 ? 
10 AC4 3 LYS A 142 ? LYS A 140 . ? 1_555 ? 
11 AC5 2 GLU B 62  ? GLU B 60  . ? 1_555 ? 
12 AC5 2 LYS B 112 ? LYS B 110 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3G2U 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3G2U 
_atom_sites.fract_transf_matrix[1][1]   0.020625 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013750 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009637 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
I 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A 1 9   ? 8.646   14.349  0.544   1.00 89.61  ? 7   PRO A N   1 
ATOM   2    C CA  . PRO A 1 9   ? 9.510   13.173  0.401   1.00 85.25  ? 7   PRO A CA  1 
ATOM   3    C C   . PRO A 1 9   ? 9.669   12.718  -1.056  1.00 82.41  ? 7   PRO A C   1 
ATOM   4    O O   . PRO A 1 9   ? 9.170   13.379  -1.975  1.00 85.11  ? 7   PRO A O   1 
ATOM   5    C CB  . PRO A 1 9   ? 8.789   12.098  1.230   1.00 82.95  ? 7   PRO A CB  1 
ATOM   6    C CG  . PRO A 1 9   ? 7.409   12.628  1.478   1.00 84.87  ? 7   PRO A CG  1 
ATOM   7    C CD  . PRO A 1 9   ? 7.546   14.116  1.494   1.00 89.88  ? 7   PRO A CD  1 
ATOM   8    N N   . GLU A 1 10  ? 10.448  11.658  -1.259  1.00 64.70  ? 8   GLU A N   1 
ATOM   9    C CA  . GLU A 1 10  ? 10.599  11.033  -2.573  1.00 60.09  ? 8   GLU A CA  1 
ATOM   10   C C   . GLU A 1 10  ? 9.456   10.061  -2.845  1.00 55.70  ? 8   GLU A C   1 
ATOM   11   O O   . GLU A 1 10  ? 9.006   9.343   -1.939  1.00 54.63  ? 8   GLU A O   1 
ATOM   12   C CB  . GLU A 1 10  ? 11.939  10.292  -2.661  1.00 57.48  ? 8   GLU A CB  1 
ATOM   13   C CG  . GLU A 1 10  ? 13.141  11.198  -2.908  1.00 66.47  ? 8   GLU A CG  1 
ATOM   14   C CD  . GLU A 1 10  ? 14.372  10.790  -2.107  1.00 71.95  ? 8   GLU A CD  1 
ATOM   15   O OE1 . GLU A 1 10  ? 15.261  10.124  -2.680  1.00 71.95  ? 8   GLU A OE1 1 
ATOM   16   O OE2 . GLU A 1 10  ? 14.488  11.199  -0.927  1.00 79.55  ? 8   GLU A OE2 1 
ATOM   17   N N   . THR A 1 11  ? 9.009   10.022  -4.100  1.00 48.20  ? 9   THR A N   1 
ATOM   18   C CA  . THR A 1 11  ? 7.913   9.147   -4.499  1.00 40.92  ? 9   THR A CA  1 
ATOM   19   C C   . THR A 1 11  ? 8.351   7.682   -4.520  1.00 36.38  ? 9   THR A C   1 
ATOM   20   O O   . THR A 1 11  ? 9.542   7.373   -4.520  1.00 33.03  ? 9   THR A O   1 
ATOM   21   C CB  . THR A 1 11  ? 7.370   9.523   -5.879  1.00 40.84  ? 9   THR A CB  1 
ATOM   22   O OG1 . THR A 1 11  ? 8.375   9.250   -6.850  1.00 36.72  ? 9   THR A OG1 1 
ATOM   23   C CG2 . THR A 1 11  ? 7.000   11.014  -5.941  1.00 43.74  ? 9   THR A CG2 1 
ATOM   24   N N   . LEU A 1 12  ? 7.374   6.790   -4.426  1.00 38.84  ? 10  LEU A N   1 
ATOM   25   C CA  . LEU A 1 12  ? 7.607   5.365   -4.580  1.00 37.22  ? 10  LEU A CA  1 
ATOM   26   C C   . LEU A 1 12  ? 8.390   5.010   -5.856  1.00 34.45  ? 10  LEU A C   1 
ATOM   27   O O   . LEU A 1 12  ? 9.329   4.206   -5.810  1.00 30.93  ? 10  LEU A O   1 
ATOM   28   C CB  . LEU A 1 12  ? 6.272   4.609   -4.522  1.00 38.72  ? 10  LEU A CB  1 
ATOM   29   C CG  . LEU A 1 12  ? 5.986   3.731   -3.294  1.00 38.30  ? 10  LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 12  ? 6.725   4.214   -2.079  1.00 36.28  ? 10  LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 12  ? 4.496   3.596   -2.997  1.00 37.34  ? 10  LEU A CD2 1 
ATOM   32   N N   . GLU A 1 13  ? 8.056   5.667   -6.966  1.00 31.07  ? 11  GLU A N   1 
ATOM   33   C CA  . GLU A 1 13  ? 8.740   5.440   -8.250  1.00 29.49  ? 11  GLU A CA  1 
ATOM   34   C C   . GLU A 1 13  ? 10.221  5.763   -8.128  1.00 31.30  ? 11  GLU A C   1 
ATOM   35   O O   . GLU A 1 13  ? 11.070  5.036   -8.643  1.00 29.08  ? 11  GLU A O   1 
ATOM   36   C CB  . GLU A 1 13  ? 8.135   6.330   -9.347  1.00 32.04  ? 11  GLU A CB  1 
ATOM   37   C CG  . GLU A 1 13  ? 6.758   5.882   -9.820  1.00 33.18  ? 11  GLU A CG  1 
ATOM   38   C CD  . GLU A 1 13  ? 5.636   6.315   -8.885  1.00 42.82  ? 11  GLU A CD  1 
ATOM   39   O OE1 . GLU A 1 13  ? 4.461   6.011   -9.199  1.00 41.87  ? 11  GLU A OE1 1 
ATOM   40   O OE2 . GLU A 1 13  ? 5.917   6.996   -7.865  1.00 36.50  ? 11  GLU A OE2 1 
ATOM   41   N N   . ALA A 1 14  ? 10.502  6.949   -7.588  1.00 37.67  ? 12  ALA A N   1 
ATOM   42   C CA  . ALA A 1 14  ? 11.855  7.465   -7.492  1.00 39.03  ? 12  ALA A CA  1 
ATOM   43   C C   . ALA A 1 14  ? 12.654  6.563   -6.566  1.00 39.46  ? 12  ALA A C   1 
ATOM   44   O O   . ALA A 1 14  ? 13.799  6.206   -6.847  1.00 42.08  ? 12  ALA A O   1 
ATOM   45   C CB  . ALA A 1 14  ? 11.826  8.895   -6.945  1.00 43.42  ? 12  ALA A CB  1 
ATOM   46   N N   . ARG A 1 15  ? 12.007  6.155   -5.484  1.00 35.31  ? 13  ARG A N   1 
ATOM   47   C CA  . ARG A 1 15  ? 12.558  5.178   -4.560  1.00 35.45  ? 13  ARG A CA  1 
ATOM   48   C C   . ARG A 1 15  ? 12.893  3.852   -5.239  1.00 31.16  ? 13  ARG A C   1 
ATOM   49   O O   . ARG A 1 15  ? 14.017  3.361   -5.131  1.00 30.59  ? 13  ARG A O   1 
ATOM   50   C CB  . ARG A 1 15  ? 11.555  4.931   -3.440  1.00 36.35  ? 13  ARG A CB  1 
ATOM   51   C CG  . ARG A 1 15  ? 12.071  5.231   -2.063  1.00 45.37  ? 13  ARG A CG  1 
ATOM   52   C CD  . ARG A 1 15  ? 12.525  6.655   -1.932  1.00 45.48  ? 13  ARG A CD  1 
ATOM   53   N NE  . ARG A 1 15  ? 13.326  6.851   -0.724  1.00 41.86  ? 13  ARG A NE  1 
ATOM   54   C CZ  . ARG A 1 15  ? 12.976  7.646   0.284   1.00 51.77  ? 13  ARG A CZ  1 
ATOM   55   N NH1 . ARG A 1 15  ? 13.843  7.884   1.268   1.00 36.16  ? 13  ARG A NH1 1 
ATOM   56   N NH2 . ARG A 1 15  ? 11.758  8.206   0.308   1.00 49.33  ? 13  ARG A NH2 1 
ATOM   57   N N   . ILE A 1 16  ? 11.877  3.215   -5.816  1.00 31.59  ? 14  ILE A N   1 
ATOM   58   C CA  . ILE A 1 16  ? 12.047  1.893   -6.422  1.00 29.20  ? 14  ILE A CA  1 
ATOM   59   C C   . ILE A 1 16  ? 13.059  1.901   -7.570  1.00 28.91  ? 14  ILE A C   1 
ATOM   60   O O   . ILE A 1 16  ? 13.842  0.959   -7.721  1.00 30.22  ? 14  ILE A O   1 
ATOM   61   C CB  . ILE A 1 16  ? 10.681  1.258   -6.867  1.00 30.94  ? 14  ILE A CB  1 
ATOM   62   C CG1 . ILE A 1 16  ? 10.761  -0.280  -6.878  1.00 23.81  ? 14  ILE A CG1 1 
ATOM   63   C CG2 . ILE A 1 16  ? 10.209  1.816   -8.229  1.00 25.19  ? 14  ILE A CG2 1 
ATOM   64   C CD1 . ILE A 1 16  ? 11.438  -0.851  -5.643  1.00 35.47  ? 14  ILE A CD1 1 
ATOM   65   N N   . ASN A 1 17  ? 13.055  2.967   -8.366  1.00 25.89  ? 15  ASN A N   1 
ATOM   66   C CA  . ASN A 1 17  ? 14.014  3.106   -9.458  1.00 24.95  ? 15  ASN A CA  1 
ATOM   67   C C   . ASN A 1 17  ? 15.470  3.158   -9.001  1.00 26.31  ? 15  ASN A C   1 
ATOM   68   O O   . ASN A 1 17  ? 16.337  2.591   -9.662  1.00 25.08  ? 15  ASN A O   1 
ATOM   69   C CB  . ASN A 1 17  ? 13.689  4.330   -10.324 1.00 25.30  ? 15  ASN A CB  1 
ATOM   70   C CG  . ASN A 1 17  ? 12.373  4.183   -11.091 1.00 28.33  ? 15  ASN A CG  1 
ATOM   71   O OD1 . ASN A 1 17  ? 11.782  3.100   -11.148 1.00 25.80  ? 15  ASN A OD1 1 
ATOM   72   N ND2 . ASN A 1 17  ? 11.913  5.281   -11.689 1.00 28.73  ? 15  ASN A ND2 1 
ATOM   73   N N   . ARG A 1 18  ? 15.748  3.906   -7.924  1.00 29.55  ? 16  ARG A N   1 
ATOM   74   C CA  . ARG A 1 18  ? 17.069  3.894   -7.280  1.00 29.22  ? 16  ARG A CA  1 
ATOM   75   C C   . ARG A 1 18  ? 17.394  2.534   -6.657  1.00 29.05  ? 16  ARG A C   1 
ATOM   76   O O   . ARG A 1 18  ? 18.529  2.041   -6.756  1.00 27.62  ? 16  ARG A O   1 
ATOM   77   C CB  . ARG A 1 18  ? 17.150  4.968   -6.193  1.00 32.45  ? 16  ARG A CB  1 
ATOM   78   C CG  . ARG A 1 18  ? 18.223  6.024   -6.422  1.00 47.51  ? 16  ARG A CG  1 
ATOM   79   C CD  . ARG A 1 18  ? 18.177  7.113   -5.346  1.00 62.66  ? 16  ARG A CD  1 
ATOM   80   N NE  . ARG A 1 18  ? 16.984  7.962   -5.445  1.00 67.43  ? 16  ARG A NE  1 
ATOM   81   C CZ  . ARG A 1 18  ? 16.072  8.109   -4.482  1.00 70.10  ? 16  ARG A CZ  1 
ATOM   82   N NH1 . ARG A 1 18  ? 15.060  8.957   -4.656  1.00 63.54  ? 16  ARG A NH1 1 
ATOM   83   N NH2 . ARG A 1 18  ? 16.153  7.399   -3.353  1.00 62.46  ? 16  ARG A NH2 1 
ATOM   84   N N   . ALA A 1 19  ? 16.410  1.968   -5.957  1.00 24.50  ? 17  ALA A N   1 
ATOM   85   C CA  . ALA A 1 19  ? 16.605  0.762   -5.170  1.00 23.17  ? 17  ALA A CA  1 
ATOM   86   C C   . ALA A 1 19  ? 16.853  -0.478  -6.031  1.00 25.39  ? 17  ALA A C   1 
ATOM   87   O O   . ALA A 1 19  ? 17.274  -1.510  -5.509  1.00 26.77  ? 17  ALA A O   1 
ATOM   88   C CB  . ALA A 1 19  ? 15.417  0.533   -4.278  1.00 20.25  ? 17  ALA A CB  1 
ATOM   89   N N   . THR A 1 20  ? 16.489  -0.409  -7.313  1.00 24.61  ? 18  THR A N   1 
ATOM   90   C CA  . THR A 1 20  ? 16.588  -1.551  -8.228  1.00 24.61  ? 18  THR A CA  1 
ATOM   91   C C   . THR A 1 20  ? 17.395  -1.215  -9.488  1.00 27.35  ? 18  THR A C   1 
ATOM   92   O O   . THR A 1 20  ? 17.479  -2.028  -10.423 1.00 27.53  ? 18  THR A O   1 
ATOM   93   C CB  . THR A 1 20  ? 15.185  -2.041  -8.693  1.00 24.12  ? 18  THR A CB  1 
ATOM   94   O OG1 . THR A 1 20  ? 14.522  -0.980  -9.412  1.00 30.02  ? 18  THR A OG1 1 
ATOM   95   C CG2 . THR A 1 20  ? 14.327  -2.456  -7.494  1.00 18.84  ? 18  THR A CG2 1 
ATOM   96   N N   . ASN A 1 21  ? 17.968  -0.018  -9.531  1.00 26.99  ? 19  ASN A N   1 
ATOM   97   C CA  . ASN A 1 21  ? 18.847  0.347   -10.642 1.00 30.74  ? 19  ASN A CA  1 
ATOM   98   C C   . ASN A 1 21  ? 19.835  -0.761  -10.997 1.00 31.90  ? 19  ASN A C   1 
ATOM   99   O O   . ASN A 1 21  ? 20.620  -1.208  -10.151 1.00 32.54  ? 19  ASN A O   1 
ATOM   100  C CB  . ASN A 1 21  ? 19.589  1.662   -10.362 1.00 31.11  ? 19  ASN A CB  1 
ATOM   101  C CG  . ASN A 1 21  ? 20.156  2.303   -11.643 1.00 39.64  ? 19  ASN A CG  1 
ATOM   102  O OD1 . ASN A 1 21  ? 20.826  1.649   -12.448 1.00 28.30  ? 19  ASN A OD1 1 
ATOM   103  N ND2 . ASN A 1 21  ? 19.879  3.581   -11.828 1.00 37.19  ? 19  ASN A ND2 1 
ATOM   104  N N   . PRO A 1 22  ? 19.768  -1.255  -12.243 1.00 33.03  ? 20  PRO A N   1 
ATOM   105  C CA  . PRO A 1 22  ? 20.755  -2.247  -12.638 1.00 32.26  ? 20  PRO A CA  1 
ATOM   106  C C   . PRO A 1 22  ? 22.205  -1.722  -12.645 1.00 33.46  ? 20  PRO A C   1 
ATOM   107  O O   . PRO A 1 22  ? 23.145  -2.514  -12.746 1.00 31.42  ? 20  PRO A O   1 
ATOM   108  C CB  . PRO A 1 22  ? 20.294  -2.662  -14.039 1.00 33.14  ? 20  PRO A CB  1 
ATOM   109  C CG  . PRO A 1 22  ? 19.355  -1.573  -14.487 1.00 32.56  ? 20  PRO A CG  1 
ATOM   110  C CD  . PRO A 1 22  ? 18.700  -1.103  -13.246 1.00 30.04  ? 20  PRO A CD  1 
ATOM   111  N N   . LEU A 1 23  ? 22.385  -0.429  -12.393 1.00 34.80  ? 21  LEU A N   1 
ATOM   112  C CA  . LEU A 1 23  ? 23.726  0.136   -12.289 1.00 39.27  ? 21  LEU A CA  1 
ATOM   113  C C   . LEU A 1 23  ? 24.338  0.007   -10.891 1.00 40.32  ? 21  LEU A C   1 
ATOM   114  O O   . LEU A 1 23  ? 25.538  0.209   -10.720 1.00 42.60  ? 21  LEU A O   1 
ATOM   115  C CB  . LEU A 1 23  ? 23.754  1.590   -12.765 1.00 40.75  ? 21  LEU A CB  1 
ATOM   116  C CG  . LEU A 1 23  ? 23.796  1.822   -14.282 1.00 47.27  ? 21  LEU A CG  1 
ATOM   117  C CD1 . LEU A 1 23  ? 23.844  3.309   -14.622 1.00 39.43  ? 21  LEU A CD1 1 
ATOM   118  C CD2 . LEU A 1 23  ? 24.967  1.083   -14.938 1.00 44.64  ? 21  LEU A CD2 1 
ATOM   119  N N   . ASN A 1 24  ? 23.542  -0.424  -9.914  1.00 38.70  ? 22  ASN A N   1 
ATOM   120  C CA  . ASN A 1 24  ? 24.024  -0.518  -8.543  1.00 38.34  ? 22  ASN A CA  1 
ATOM   121  C C   . ASN A 1 24  ? 25.153  -1.539  -8.396  1.00 40.80  ? 22  ASN A C   1 
ATOM   122  O O   . ASN A 1 24  ? 25.048  -2.673  -8.876  1.00 39.20  ? 22  ASN A O   1 
ATOM   123  C CB  . ASN A 1 24  ? 22.874  -0.849  -7.587  1.00 36.48  ? 22  ASN A CB  1 
ATOM   124  C CG  . ASN A 1 24  ? 21.909  0.316   -7.399  1.00 35.30  ? 22  ASN A CG  1 
ATOM   125  O OD1 . ASN A 1 24  ? 22.220  1.463   -7.726  1.00 31.56  ? 22  ASN A OD1 1 
ATOM   126  N ND2 . ASN A 1 24  ? 20.748  0.028   -6.823  1.00 31.80  ? 22  ASN A ND2 1 
ATOM   127  N N   . LYS A 1 25  ? 26.259  -1.110  -7.790  1.00 46.71  ? 23  LYS A N   1 
ATOM   128  C CA  . LYS A 1 25  ? 27.367  -2.020  -7.480  1.00 49.29  ? 23  LYS A CA  1 
ATOM   129  C C   . LYS A 1 25  ? 27.087  -2.842  -6.216  1.00 48.73  ? 23  LYS A C   1 
ATOM   130  O O   . LYS A 1 25  ? 27.773  -3.825  -5.935  1.00 49.87  ? 23  LYS A O   1 
ATOM   131  C CB  . LYS A 1 25  ? 28.670  -1.234  -7.302  1.00 51.55  ? 23  LYS A CB  1 
ATOM   132  C CG  . LYS A 1 25  ? 28.872  -0.118  -8.313  1.00 56.98  ? 23  LYS A CG  1 
ATOM   133  C CD  . LYS A 1 25  ? 29.965  -0.463  -9.318  1.00 70.79  ? 23  LYS A CD  1 
ATOM   134  C CE  . LYS A 1 25  ? 29.480  -1.514  -10.322 1.00 74.52  ? 23  LYS A CE  1 
ATOM   135  N NZ  . LYS A 1 25  ? 30.609  -2.198  -11.016 1.00 77.60  ? 23  LYS A NZ  1 
ATOM   136  N N   . GLU A 1 26  ? 26.203  -2.323  -5.369  1.00 43.76  ? 24  GLU A N   1 
ATOM   137  C CA  . GLU A 1 26  ? 25.826  -3.004  -4.141  1.00 41.80  ? 24  GLU A CA  1 
ATOM   138  C C   . GLU A 1 26  ? 24.405  -2.588  -3.755  1.00 38.84  ? 24  GLU A C   1 
ATOM   139  O O   . GLU A 1 26  ? 23.833  -1.688  -4.379  1.00 36.22  ? 24  GLU A O   1 
ATOM   140  C CB  . GLU A 1 26  ? 26.829  -2.697  -3.015  1.00 40.88  ? 24  GLU A CB  1 
ATOM   141  C CG  . GLU A 1 26  ? 26.919  -1.220  -2.648  1.00 53.09  ? 24  GLU A CG  1 
ATOM   142  C CD  . GLU A 1 26  ? 27.771  -0.956  -1.412  1.00 67.34  ? 24  GLU A CD  1 
ATOM   143  O OE1 . GLU A 1 26  ? 27.240  -0.407  -0.417  1.00 67.68  ? 24  GLU A OE1 1 
ATOM   144  O OE2 . GLU A 1 26  ? 28.996  -1.202  -1.472  1.00 76.18  ? 24  GLU A OE2 1 
ATOM   145  N N   . LEU A 1 27  ? 23.827  -3.265  -2.760  1.00 30.72  ? 25  LEU A N   1 
ATOM   146  C CA  . LEU A 1 27  ? 22.469  -2.966  -2.336  1.00 30.80  ? 25  LEU A CA  1 
ATOM   147  C C   . LEU A 1 27  ? 22.390  -1.570  -1.711  1.00 32.52  ? 25  LEU A C   1 
ATOM   148  O O   . LEU A 1 27  ? 23.319  -1.130  -1.027  1.00 30.11  ? 25  LEU A O   1 
ATOM   149  C CB  . LEU A 1 27  ? 21.937  -4.028  -1.368  1.00 29.66  ? 25  LEU A CB  1 
ATOM   150  C CG  . LEU A 1 27  ? 21.793  -5.464  -1.897  1.00 32.29  ? 25  LEU A CG  1 
ATOM   151  C CD1 . LEU A 1 27  ? 21.632  -6.487  -0.733  1.00 27.49  ? 25  LEU A CD1 1 
ATOM   152  C CD2 . LEU A 1 27  ? 20.623  -5.563  -2.863  1.00 31.64  ? 25  LEU A CD2 1 
ATOM   153  N N   . ASP A 1 28  ? 21.320  -0.845  -2.027  1.00 29.90  ? 26  ASP A N   1 
ATOM   154  C CA  . ASP A 1 28  ? 21.199  0.564   -1.653  1.00 29.11  ? 26  ASP A CA  1 
ATOM   155  C C   . ASP A 1 28  ? 20.122  0.710   -0.562  1.00 30.91  ? 26  ASP A C   1 
ATOM   156  O O   . ASP A 1 28  ? 18.925  0.767   -0.862  1.00 31.92  ? 26  ASP A O   1 
ATOM   157  C CB  . ASP A 1 28  ? 20.844  1.380   -2.900  1.00 31.53  ? 26  ASP A CB  1 
ATOM   158  C CG  . ASP A 1 28  ? 20.428  2.807   -2.584  1.00 36.08  ? 26  ASP A CG  1 
ATOM   159  O OD1 . ASP A 1 28  ? 20.784  3.319   -1.506  1.00 35.99  ? 26  ASP A OD1 1 
ATOM   160  O OD2 . ASP A 1 28  ? 19.905  3.473   -3.501  1.00 40.84  ? 26  ASP A OD2 1 
ATOM   161  N N   . TRP A 1 29  ? 20.525  0.528   0.695   1.00 31.11  ? 27  TRP A N   1 
ATOM   162  C CA  . TRP A 1 29  ? 19.560  0.381   1.782   1.00 32.04  ? 27  TRP A CA  1 
ATOM   163  C C   . TRP A 1 29  ? 18.769  1.659   2.081   1.00 32.44  ? 27  TRP A C   1 
ATOM   164  O O   . TRP A 1 29  ? 17.615  1.588   2.492   1.00 33.44  ? 27  TRP A O   1 
ATOM   165  C CB  . TRP A 1 29  ? 20.239  -0.130  3.052   1.00 32.53  ? 27  TRP A CB  1 
ATOM   166  C CG  . TRP A 1 29  ? 20.712  -1.536  2.907   1.00 33.48  ? 27  TRP A CG  1 
ATOM   167  C CD1 . TRP A 1 29  ? 22.009  -1.961  2.782   1.00 28.64  ? 27  TRP A CD1 1 
ATOM   168  C CD2 . TRP A 1 29  ? 19.891  -2.699  2.794   1.00 28.95  ? 27  TRP A CD2 1 
ATOM   169  N NE1 . TRP A 1 29  ? 22.039  -3.317  2.581   1.00 35.83  ? 27  TRP A NE1 1 
ATOM   170  C CE2 . TRP A 1 29  ? 20.755  -3.798  2.583   1.00 27.42  ? 27  TRP A CE2 1 
ATOM   171  C CE3 . TRP A 1 29  ? 18.519  -2.938  2.964   1.00 26.92  ? 27  TRP A CE3 1 
ATOM   172  C CZ2 . TRP A 1 29  ? 20.290  -5.110  2.519   1.00 26.49  ? 27  TRP A CZ2 1 
ATOM   173  C CZ3 . TRP A 1 29  ? 18.052  -4.229  2.817   1.00 28.56  ? 27  TRP A CZ3 1 
ATOM   174  C CH2 . TRP A 1 29  ? 18.937  -5.308  2.641   1.00 23.21  ? 27  TRP A CH2 1 
ATOM   175  N N   . ALA A 1 30  ? 19.408  2.816   1.942   1.00 28.57  ? 28  ALA A N   1 
ATOM   176  C CA  . ALA A 1 30  ? 18.688  4.090   1.922   1.00 31.75  ? 28  ALA A CA  1 
ATOM   177  C C   . ALA A 1 30  ? 17.432  4.008   1.039   1.00 30.59  ? 28  ALA A C   1 
ATOM   178  O O   . ALA A 1 30  ? 16.313  4.231   1.504   1.00 31.75  ? 28  ALA A O   1 
ATOM   179  C CB  . ALA A 1 30  ? 19.605  5.218   1.453   1.00 29.74  ? 28  ALA A CB  1 
ATOM   180  N N   . SER A 1 31  ? 17.614  3.568   -0.203  1.00 38.14  ? 29  SER A N   1 
ATOM   181  C CA  . SER A 1 31  ? 16.523  3.517   -1.170  1.00 36.79  ? 29  SER A CA  1 
ATOM   182  C C   . SER A 1 31  ? 15.523  2.390   -0.903  1.00 35.83  ? 29  SER A C   1 
ATOM   183  O O   . SER A 1 31  ? 14.295  2.590   -0.976  1.00 35.52  ? 29  SER A O   1 
ATOM   184  C CB  . SER A 1 31  ? 17.086  3.409   -2.577  1.00 36.48  ? 29  SER A CB  1 
ATOM   185  O OG  . SER A 1 31  ? 17.668  4.647   -2.966  1.00 46.21  ? 29  SER A OG  1 
ATOM   186  N N   . ILE A 1 32  ? 16.055  1.221   -0.563  1.00 29.33  ? 30  ILE A N   1 
ATOM   187  C CA  . ILE A 1 32  ? 15.251  0.051   -0.239  1.00 25.96  ? 30  ILE A CA  1 
ATOM   188  C C   . ILE A 1 32  ? 14.395  0.315   1.004   1.00 28.26  ? 30  ILE A C   1 
ATOM   189  O O   . ILE A 1 32  ? 13.186  0.104   0.998   1.00 26.90  ? 30  ILE A O   1 
ATOM   190  C CB  . ILE A 1 32  ? 16.159  -1.172  0.051   1.00 25.22  ? 30  ILE A CB  1 
ATOM   191  C CG1 . ILE A 1 32  ? 17.020  -1.526  -1.166  1.00 22.83  ? 30  ILE A CG1 1 
ATOM   192  C CG2 . ILE A 1 32  ? 15.332  -2.370  0.515   1.00 23.32  ? 30  ILE A CG2 1 
ATOM   193  C CD1 . ILE A 1 32  ? 18.014  -2.639  -0.901  1.00 18.78  ? 30  ILE A CD1 1 
ATOM   194  N N   . ASN A 1 33  ? 15.033  0.715   2.096   1.00 30.66  ? 31  ASN A N   1 
ATOM   195  C CA  . ASN A 1 33  ? 14.291  0.982   3.324   1.00 32.90  ? 31  ASN A CA  1 
ATOM   196  C C   . ASN A 1 33  ? 13.427  2.255   3.259   1.00 32.09  ? 31  ASN A C   1 
ATOM   197  O O   . ASN A 1 33  ? 12.325  2.294   3.812   1.00 29.42  ? 31  ASN A O   1 
ATOM   198  C CB  . ASN A 1 33  ? 15.228  0.992   4.531   1.00 30.00  ? 31  ASN A CB  1 
ATOM   199  C CG  . ASN A 1 33  ? 15.504  -0.416  5.067   1.00 38.85  ? 31  ASN A CG  1 
ATOM   200  O OD1 . ASN A 1 33  ? 14.607  -1.264  5.109   1.00 34.45  ? 31  ASN A OD1 1 
ATOM   201  N ND2 . ASN A 1 33  ? 16.728  -0.642  5.544   1.00 33.75  ? 31  ASN A ND2 1 
ATOM   202  N N   . GLY A 1 34  ? 13.871  3.233   2.472   1.00 29.12  ? 32  GLY A N   1 
ATOM   203  C CA  . GLY A 1 34  ? 13.056  4.405   2.194   1.00 29.55  ? 32  GLY A CA  1 
ATOM   204  C C   . GLY A 1 34  ? 11.782  4.090   1.429   1.00 30.52  ? 32  GLY A C   1 
ATOM   205  O O   . GLY A 1 34  ? 10.747  4.712   1.668   1.00 32.99  ? 32  GLY A O   1 
ATOM   206  N N   . PHE A 1 35  ? 11.865  3.170   0.469   1.00 27.28  ? 33  PHE A N   1 
ATOM   207  C CA  . PHE A 1 35  ? 10.675  2.666   -0.224  1.00 27.49  ? 33  PHE A CA  1 
ATOM   208  C C   . PHE A 1 35  ? 9.635   2.122   0.765   1.00 27.85  ? 33  PHE A C   1 
ATOM   209  O O   . PHE A 1 35  ? 8.448   2.431   0.665   1.00 32.05  ? 33  PHE A O   1 
ATOM   210  C CB  . PHE A 1 35  ? 11.068  1.591   -1.267  1.00 22.23  ? 33  PHE A CB  1 
ATOM   211  C CG  . PHE A 1 35  ? 9.890   0.980   -2.003  1.00 25.01  ? 33  PHE A CG  1 
ATOM   212  C CD1 . PHE A 1 35  ? 9.325   -0.217  -1.573  1.00 24.96  ? 33  PHE A CD1 1 
ATOM   213  C CD2 . PHE A 1 35  ? 9.460   1.509   -3.218  1.00 25.82  ? 33  PHE A CD2 1 
ATOM   214  C CE1 . PHE A 1 35  ? 8.277   -0.821  -2.292  1.00 20.94  ? 33  PHE A CE1 1 
ATOM   215  C CE2 . PHE A 1 35  ? 8.447   0.883   -3.962  1.00 24.09  ? 33  PHE A CE2 1 
ATOM   216  C CZ  . PHE A 1 35  ? 7.885   -0.305  -3.511  1.00 20.29  ? 33  PHE A CZ  1 
ATOM   217  N N   . CYS A 1 36  ? 10.060  1.237   1.657   1.00 27.60  ? 34  CYS A N   1 
ATOM   218  C CA  . CYS A 1 36  ? 9.162   0.653   2.657   1.00 27.43  ? 34  CYS A CA  1 
ATOM   219  C C   . CYS A 1 36  ? 8.553   1.735   3.565   1.00 29.98  ? 34  CYS A C   1 
ATOM   220  O O   . CYS A 1 36  ? 7.388   1.658   3.949   1.00 27.66  ? 34  CYS A O   1 
ATOM   221  C CB  . CYS A 1 36  ? 9.915   -0.343  3.549   1.00 23.89  ? 34  CYS A CB  1 
ATOM   222  S SG  . CYS A 1 36  ? 10.799  -1.698  2.754   1.00 27.79  ? 34  CYS A SG  1 
ATOM   223  N N   . GLU A 1 37  ? 9.407   2.612   4.077   1.00 28.50  ? 35  GLU A N   1 
ATOM   224  C CA  . GLU A 1 37  ? 8.959   3.751   4.868   1.00 33.40  ? 35  GLU A CA  1 
ATOM   225  C C   . GLU A 1 37  ? 7.870   4.560   4.150   1.00 35.56  ? 35  GLU A C   1 
ATOM   226  O O   . GLU A 1 37  ? 6.919   5.061   4.776   1.00 38.54  ? 35  GLU A O   1 
ATOM   227  C CB  . GLU A 1 37  ? 10.157  4.643   5.188   1.00 34.50  ? 35  GLU A CB  1 
ATOM   228  C CG  . GLU A 1 37  ? 9.870   5.794   6.130   1.00 52.32  ? 35  GLU A CG  1 
ATOM   229  C CD  . GLU A 1 37  ? 9.974   7.161   5.453   1.00 71.31  ? 35  GLU A CD  1 
ATOM   230  O OE1 . GLU A 1 37  ? 9.502   8.156   6.057   1.00 71.92  ? 35  GLU A OE1 1 
ATOM   231  O OE2 . GLU A 1 37  ? 10.512  7.238   4.318   1.00 76.21  ? 35  GLU A OE2 1 
ATOM   232  N N   . GLN A 1 38  ? 8.017   4.698   2.837   1.00 33.81  ? 36  GLN A N   1 
ATOM   233  C CA  . GLN A 1 38  ? 7.186   5.613   2.068   1.00 36.09  ? 36  GLN A CA  1 
ATOM   234  C C   . GLN A 1 38  ? 5.823   5.004   1.746   1.00 34.50  ? 36  GLN A C   1 
ATOM   235  O O   . GLN A 1 38  ? 4.811   5.691   1.823   1.00 34.78  ? 36  GLN A O   1 
ATOM   236  C CB  . GLN A 1 38  ? 7.905   6.056   0.787   1.00 37.49  ? 36  GLN A CB  1 
ATOM   237  C CG  . GLN A 1 38  ? 7.196   7.152   0.008   1.00 39.10  ? 36  GLN A CG  1 
ATOM   238  C CD  . GLN A 1 38  ? 6.819   8.336   0.879   1.00 45.00  ? 36  GLN A CD  1 
ATOM   239  O OE1 . GLN A 1 38  ? 5.653   8.719   0.949   1.00 51.76  ? 36  GLN A OE1 1 
ATOM   240  N NE2 . GLN A 1 38  ? 7.817   8.972   1.480   1.00 43.23  ? 36  GLN A NE2 1 
ATOM   241  N N   . LEU A 1 39  ? 5.783   3.690   1.538   1.00 33.40  ? 37  LEU A N   1 
ATOM   242  C CA  . LEU A 1 39  ? 4.524   3.006   1.205   1.00 33.41  ? 37  LEU A CA  1 
ATOM   243  C C   . LEU A 1 39  ? 3.658   2.868   2.459   1.00 35.74  ? 37  LEU A C   1 
ATOM   244  O O   . LEU A 1 39  ? 2.426   2.892   2.400   1.00 33.42  ? 37  LEU A O   1 
ATOM   245  C CB  . LEU A 1 39  ? 4.804   1.625   0.594   1.00 28.98  ? 37  LEU A CB  1 
ATOM   246  C CG  . LEU A 1 39  ? 5.375   0.523   1.499   1.00 29.39  ? 37  LEU A CG  1 
ATOM   247  C CD1 . LEU A 1 39  ? 4.264   -0.165  2.290   1.00 30.39  ? 37  LEU A CD1 1 
ATOM   248  C CD2 . LEU A 1 39  ? 6.182   -0.497  0.689   1.00 25.42  ? 37  LEU A CD2 1 
ATOM   249  N N   . ASN A 1 40  ? 4.334   2.796   3.598   1.00 36.81  ? 38  ASN A N   1 
ATOM   250  C CA  . ASN A 1 40  ? 3.692   2.746   4.898   1.00 40.28  ? 38  ASN A CA  1 
ATOM   251  C C   . ASN A 1 40  ? 3.096   4.101   5.295   1.00 45.31  ? 38  ASN A C   1 
ATOM   252  O O   . ASN A 1 40  ? 2.078   4.167   5.978   1.00 46.69  ? 38  ASN A O   1 
ATOM   253  C CB  . ASN A 1 40  ? 4.712   2.260   5.945   1.00 37.04  ? 38  ASN A CB  1 
ATOM   254  C CG  . ASN A 1 40  ? 4.237   2.467   7.373   1.00 38.35  ? 38  ASN A CG  1 
ATOM   255  O OD1 . ASN A 1 40  ? 3.425   1.695   7.890   1.00 34.06  ? 38  ASN A OD1 1 
ATOM   256  N ND2 . ASN A 1 40  ? 4.694   3.546   7.992   1.00 33.52  ? 38  ASN A ND2 1 
ATOM   257  N N   . GLU A 1 41  ? 3.712   5.175   4.812   1.00 49.16  ? 39  GLU A N   1 
ATOM   258  C CA  . GLU A 1 41  ? 3.252   6.537   5.085   1.00 53.62  ? 39  GLU A CA  1 
ATOM   259  C C   . GLU A 1 41  ? 2.037   6.923   4.240   1.00 55.91  ? 39  GLU A C   1 
ATOM   260  O O   . GLU A 1 41  ? 1.114   7.578   4.721   1.00 57.59  ? 39  GLU A O   1 
ATOM   261  C CB  . GLU A 1 41  ? 4.392   7.526   4.848   1.00 50.99  ? 39  GLU A CB  1 
ATOM   262  C CG  . GLU A 1 41  ? 3.943   8.967   4.746   1.00 61.58  ? 39  GLU A CG  1 
ATOM   263  C CD  . GLU A 1 41  ? 5.099   9.940   4.840   1.00 66.86  ? 39  GLU A CD  1 
ATOM   264  O OE1 . GLU A 1 41  ? 5.153   10.889  4.028   1.00 75.80  ? 39  GLU A OE1 1 
ATOM   265  O OE2 . GLU A 1 41  ? 5.970   9.742   5.710   1.00 69.71  ? 39  GLU A OE2 1 
ATOM   266  N N   . ASP A 1 42  ? 2.024   6.478   2.989   1.00 55.98  ? 40  ASP A N   1 
ATOM   267  C CA  . ASP A 1 42  ? 1.018   6.914   2.032   1.00 59.93  ? 40  ASP A CA  1 
ATOM   268  C C   . ASP A 1 42  ? -0.249  6.058   2.080   1.00 61.37  ? 40  ASP A C   1 
ATOM   269  O O   . ASP A 1 42  ? -0.182  4.840   2.261   1.00 59.10  ? 40  ASP A O   1 
ATOM   270  C CB  . ASP A 1 42  ? 1.614   6.949   0.625   1.00 58.21  ? 40  ASP A CB  1 
ATOM   271  C CG  . ASP A 1 42  ? 2.646   8.057   0.456   1.00 60.92  ? 40  ASP A CG  1 
ATOM   272  O OD1 . ASP A 1 42  ? 3.479   7.966   -0.473  1.00 58.18  ? 40  ASP A OD1 1 
ATOM   273  O OD2 . ASP A 1 42  ? 2.592   9.046   1.221   1.00 62.52  ? 40  ASP A OD2 1 
ATOM   274  N N   . PHE A 1 43  ? -1.394  6.734   2.083   1.00 74.32  ? 41  PHE A N   1 
ATOM   275  C CA  . PHE A 1 43  ? -2.709  6.100   1.991   1.00 77.09  ? 41  PHE A CA  1 
ATOM   276  C C   . PHE A 1 43  ? -2.789  4.972   0.960   1.00 72.01  ? 41  PHE A C   1 
ATOM   277  O O   . PHE A 1 43  ? -3.266  3.873   1.259   1.00 71.20  ? 41  PHE A O   1 
ATOM   278  C CB  . PHE A 1 43  ? -3.763  7.165   1.663   1.00 83.52  ? 41  PHE A CB  1 
ATOM   279  C CG  . PHE A 1 43  ? -4.891  7.224   2.651   1.00 90.56  ? 41  PHE A CG  1 
ATOM   280  C CD1 . PHE A 1 43  ? -5.597  8.405   2.845   1.00 99.85  ? 41  PHE A CD1 1 
ATOM   281  C CD2 . PHE A 1 43  ? -5.234  6.104   3.400   1.00 92.56  ? 41  PHE A CD2 1 
ATOM   282  C CE1 . PHE A 1 43  ? -6.619  8.477   3.781   1.00 102.22 ? 41  PHE A CE1 1 
ATOM   283  C CE2 . PHE A 1 43  ? -6.246  6.169   4.344   1.00 97.54  ? 41  PHE A CE2 1 
ATOM   284  C CZ  . PHE A 1 43  ? -6.934  7.361   4.543   1.00 99.37  ? 41  PHE A CZ  1 
ATOM   285  N N   . GLU A 1 44  ? -2.521  5.315   -0.294  1.00 72.54  ? 42  GLU A N   1 
ATOM   286  C CA  . GLU A 1 44  ? -2.516  4.322   -1.361  1.00 69.60  ? 42  GLU A CA  1 
ATOM   287  C C   . GLU A 1 44  ? -1.097  3.905   -1.695  1.00 63.59  ? 42  GLU A C   1 
ATOM   288  O O   . GLU A 1 44  ? -0.810  3.505   -2.822  1.00 62.75  ? 42  GLU A O   1 
ATOM   289  C CB  . GLU A 1 44  ? -3.224  4.855   -2.606  1.00 72.97  ? 42  GLU A CB  1 
ATOM   290  C CG  . GLU A 1 44  ? -4.642  4.321   -2.786  1.00 78.13  ? 42  GLU A CG  1 
ATOM   291  C CD  . GLU A 1 44  ? -5.645  5.427   -3.066  1.00 89.85  ? 42  GLU A CD  1 
ATOM   292  O OE1 . GLU A 1 44  ? -5.783  6.341   -2.221  1.00 91.87  ? 42  GLU A OE1 1 
ATOM   293  O OE2 . GLU A 1 44  ? -6.296  5.381   -4.133  1.00 94.73  ? 42  GLU A OE2 1 
ATOM   294  N N   . GLY A 1 45  ? -0.210  4.052   -0.712  1.00 48.77  ? 43  GLY A N   1 
ATOM   295  C CA  . GLY A 1 45  ? 1.135   3.492   -0.763  1.00 43.48  ? 43  GLY A CA  1 
ATOM   296  C C   . GLY A 1 45  ? 1.208   2.033   -1.184  1.00 38.64  ? 43  GLY A C   1 
ATOM   297  O O   . GLY A 1 45  ? 1.951   1.695   -2.105  1.00 35.47  ? 43  GLY A O   1 
ATOM   298  N N   . PRO A 1 46  ? 0.562   1.140   -0.412  1.00 37.99  ? 44  PRO A N   1 
ATOM   299  C CA  . PRO A 1 46  ? 0.766   -0.308  -0.576  1.00 34.41  ? 44  PRO A CA  1 
ATOM   300  C C   . PRO A 1 46  ? 0.343   -0.867  -1.939  1.00 33.48  ? 44  PRO A C   1 
ATOM   301  O O   . PRO A 1 46  ? 0.988   -1.781  -2.444  1.00 31.62  ? 44  PRO A O   1 
ATOM   302  C CB  . PRO A 1 46  ? -0.078  -0.916  0.555   1.00 34.46  ? 44  PRO A CB  1 
ATOM   303  C CG  . PRO A 1 46  ? -0.105  0.172   1.624   1.00 34.57  ? 44  PRO A CG  1 
ATOM   304  C CD  . PRO A 1 46  ? -0.176  1.461   0.828   1.00 39.21  ? 44  PRO A CD  1 
ATOM   305  N N   . PRO A 1 47  ? -0.803  -0.414  -2.472  1.00 41.05  ? 45  PRO A N   1 
ATOM   306  C CA  . PRO A 1 47  ? -1.237  -0.905  -3.776  1.00 40.65  ? 45  PRO A CA  1 
ATOM   307  C C   . PRO A 1 47  ? -0.339  -0.423  -4.914  1.00 39.17  ? 45  PRO A C   1 
ATOM   308  O O   . PRO A 1 47  ? -0.136  -1.148  -5.882  1.00 38.43  ? 45  PRO A O   1 
ATOM   309  C CB  . PRO A 1 47  ? -2.648  -0.318  -3.928  1.00 44.73  ? 45  PRO A CB  1 
ATOM   310  C CG  . PRO A 1 47  ? -3.089  0.013   -2.542  1.00 45.32  ? 45  PRO A CG  1 
ATOM   311  C CD  . PRO A 1 47  ? -1.842  0.397   -1.810  1.00 44.85  ? 45  PRO A CD  1 
ATOM   312  N N   . LEU A 1 48  ? 0.140   0.813   -4.830  1.00 36.00  ? 46  LEU A N   1 
ATOM   313  C CA  . LEU A 1 48  ? 1.105   1.314   -5.809  1.00 35.79  ? 46  LEU A CA  1 
ATOM   314  C C   . LEU A 1 48  ? 2.422   0.535   -5.749  1.00 33.62  ? 46  LEU A C   1 
ATOM   315  O O   . LEU A 1 48  ? 2.966   0.147   -6.782  1.00 31.47  ? 46  LEU A O   1 
ATOM   316  C CB  . LEU A 1 48  ? 1.369   2.806   -5.594  1.00 38.25  ? 46  LEU A CB  1 
ATOM   317  C CG  . LEU A 1 48  ? 2.463   3.455   -6.456  1.00 43.65  ? 46  LEU A CG  1 
ATOM   318  C CD1 . LEU A 1 48  ? 2.161   3.301   -7.959  1.00 39.69  ? 46  LEU A CD1 1 
ATOM   319  C CD2 . LEU A 1 48  ? 2.633   4.939   -6.092  1.00 40.80  ? 46  LEU A CD2 1 
ATOM   320  N N   . ALA A 1 49  ? 2.916   0.310   -4.529  1.00 28.74  ? 47  ALA A N   1 
ATOM   321  C CA  . ALA A 1 49  ? 4.188   -0.376  -4.289  1.00 28.51  ? 47  ALA A CA  1 
ATOM   322  C C   . ALA A 1 49  ? 4.196   -1.756  -4.926  1.00 26.62  ? 47  ALA A C   1 
ATOM   323  O O   . ALA A 1 49  ? 5.163   -2.194  -5.549  1.00 27.66  ? 47  ALA A O   1 
ATOM   324  C CB  . ALA A 1 49  ? 4.425   -0.491  -2.786  1.00 28.31  ? 47  ALA A CB  1 
ATOM   325  N N   . THR A 1 50  ? 3.094   -2.446  -4.729  1.00 31.28  ? 48  THR A N   1 
ATOM   326  C CA  . THR A 1 50  ? 2.890   -3.780  -5.227  1.00 30.51  ? 48  THR A CA  1 
ATOM   327  C C   . THR A 1 50  ? 2.848   -3.800  -6.779  1.00 30.03  ? 48  THR A C   1 
ATOM   328  O O   . THR A 1 50  ? 3.488   -4.647  -7.429  1.00 29.89  ? 48  THR A O   1 
ATOM   329  C CB  . THR A 1 50  ? 1.603   -4.330  -4.533  1.00 31.29  ? 48  THR A CB  1 
ATOM   330  O OG1 . THR A 1 50  ? 1.870   -5.559  -3.855  1.00 38.91  ? 48  THR A OG1 1 
ATOM   331  C CG2 . THR A 1 50  ? 0.419   -4.431  -5.452  1.00 32.58  ? 48  THR A CG2 1 
ATOM   332  N N   . ARG A 1 51  ? 2.214   -2.797  -7.381  1.00 28.34  ? 49  ARG A N   1 
ATOM   333  C CA  . ARG A 1 51  ? 2.236   -2.653  -8.847  1.00 29.64  ? 49  ARG A CA  1 
ATOM   334  C C   . ARG A 1 51  ? 3.671   -2.398  -9.361  1.00 29.60  ? 49  ARG A C   1 
ATOM   335  O O   . ARG A 1 51  ? 4.109   -3.034  -10.304 1.00 28.17  ? 49  ARG A O   1 
ATOM   336  C CB  . ARG A 1 51  ? 1.301   -1.513  -9.285  1.00 30.86  ? 49  ARG A CB  1 
ATOM   337  C CG  . ARG A 1 51  ? 0.497   -1.763  -10.560 1.00 40.47  ? 49  ARG A CG  1 
ATOM   338  C CD  . ARG A 1 51  ? -0.862  -1.038  -10.530 1.00 63.50  ? 49  ARG A CD  1 
ATOM   339  N NE  . ARG A 1 51  ? -0.758  0.365   -10.105 1.00 73.58  ? 49  ARG A NE  1 
ATOM   340  C CZ  . ARG A 1 51  ? -1.313  0.871   -9.000  1.00 77.76  ? 49  ARG A CZ  1 
ATOM   341  N NH1 . ARG A 1 51  ? -1.161  2.158   -8.705  1.00 75.41  ? 49  ARG A NH1 1 
ATOM   342  N NH2 . ARG A 1 51  ? -2.036  0.103   -8.192  1.00 75.26  ? 49  ARG A NH2 1 
ATOM   343  N N   . LEU A 1 52  ? 4.416   -1.507  -8.705  1.00 28.34  ? 50  LEU A N   1 
ATOM   344  C CA  . LEU A 1 52  ? 5.760   -1.156  -9.163  1.00 27.63  ? 50  LEU A CA  1 
ATOM   345  C C   . LEU A 1 52  ? 6.711   -2.332  -8.985  1.00 26.37  ? 50  LEU A C   1 
ATOM   346  O O   . LEU A 1 52  ? 7.568   -2.586  -9.829  1.00 24.04  ? 50  LEU A O   1 
ATOM   347  C CB  . LEU A 1 52  ? 6.309   0.082   -8.428  1.00 25.40  ? 50  LEU A CB  1 
ATOM   348  C CG  . LEU A 1 52  ? 5.535   1.412   -8.465  1.00 29.95  ? 50  LEU A CG  1 
ATOM   349  C CD1 . LEU A 1 52  ? 6.083   2.386   -7.449  1.00 23.41  ? 50  LEU A CD1 1 
ATOM   350  C CD2 . LEU A 1 52  ? 5.519   2.068   -9.843  1.00 30.33  ? 50  LEU A CD2 1 
ATOM   351  N N   . LEU A 1 53  ? 6.545   -3.054  -7.884  1.00 29.29  ? 51  LEU A N   1 
ATOM   352  C CA  . LEU A 1 53  ? 7.375   -4.223  -7.587  1.00 27.48  ? 51  LEU A CA  1 
ATOM   353  C C   . LEU A 1 53  ? 7.208   -5.362  -8.610  1.00 26.29  ? 51  LEU A C   1 
ATOM   354  O O   . LEU A 1 53  ? 8.191   -5.935  -9.074  1.00 24.08  ? 51  LEU A O   1 
ATOM   355  C CB  . LEU A 1 53  ? 7.112   -4.719  -6.153  1.00 27.31  ? 51  LEU A CB  1 
ATOM   356  C CG  . LEU A 1 53  ? 7.845   -3.965  -5.029  1.00 29.53  ? 51  LEU A CG  1 
ATOM   357  C CD1 . LEU A 1 53  ? 7.230   -4.247  -3.650  1.00 26.39  ? 51  LEU A CD1 1 
ATOM   358  C CD2 . LEU A 1 53  ? 9.359   -4.256  -5.035  1.00 18.61  ? 51  LEU A CD2 1 
ATOM   359  N N   . ALA A 1 54  ? 5.962   -5.715  -8.912  1.00 25.82  ? 52  ALA A N   1 
ATOM   360  C CA  . ALA A 1 54  ? 5.662   -6.777  -9.875  1.00 24.86  ? 52  ALA A CA  1 
ATOM   361  C C   . ALA A 1 54  ? 6.399   -6.542  -11.193 1.00 26.15  ? 52  ALA A C   1 
ATOM   362  O O   . ALA A 1 54  ? 7.029   -7.452  -11.727 1.00 28.44  ? 52  ALA A O   1 
ATOM   363  C CB  . ALA A 1 54  ? 4.135   -6.874  -10.121 1.00 27.12  ? 52  ALA A CB  1 
ATOM   364  N N   . HIS A 1 55  ? 6.324   -5.318  -11.710 1.00 28.07  ? 53  HIS A N   1 
ATOM   365  C CA  . HIS A 1 55  ? 6.973   -4.995  -12.979 1.00 28.27  ? 53  HIS A CA  1 
ATOM   366  C C   . HIS A 1 55  ? 8.483   -5.191  -12.907 1.00 26.79  ? 53  HIS A C   1 
ATOM   367  O O   . HIS A 1 55  ? 9.054   -5.849  -13.774 1.00 26.48  ? 53  HIS A O   1 
ATOM   368  C CB  . HIS A 1 55  ? 6.617   -3.573  -13.465 1.00 29.50  ? 53  HIS A CB  1 
ATOM   369  C CG  . HIS A 1 55  ? 7.213   -3.224  -14.801 1.00 32.63  ? 53  HIS A CG  1 
ATOM   370  N ND1 . HIS A 1 55  ? 8.250   -2.321  -14.948 1.00 30.71  ? 53  HIS A ND1 1 
ATOM   371  C CD2 . HIS A 1 55  ? 6.962   -3.707  -16.042 1.00 29.59  ? 53  HIS A CD2 1 
ATOM   372  C CE1 . HIS A 1 55  ? 8.591   -2.247  -16.223 1.00 31.23  ? 53  HIS A CE1 1 
ATOM   373  N NE2 . HIS A 1 55  ? 7.865   -3.120  -16.897 1.00 32.83  ? 53  HIS A NE2 1 
ATOM   374  N N   . LYS A 1 56  ? 9.115   -4.651  -11.860 1.00 21.60  ? 54  LYS A N   1 
ATOM   375  C CA  . LYS A 1 56  ? 10.571  -4.743  -11.681 1.00 24.78  ? 54  LYS A CA  1 
ATOM   376  C C   . LYS A 1 56  ? 11.015  -6.200  -11.589 1.00 25.72  ? 54  LYS A C   1 
ATOM   377  O O   . LYS A 1 56  ? 12.091  -6.591  -12.100 1.00 25.59  ? 54  LYS A O   1 
ATOM   378  C CB  . LYS A 1 56  ? 11.007  -4.016  -10.398 1.00 26.66  ? 54  LYS A CB  1 
ATOM   379  C CG  . LYS A 1 56  ? 10.807  -2.496  -10.414 1.00 28.83  ? 54  LYS A CG  1 
ATOM   380  C CD  . LYS A 1 56  ? 11.510  -1.831  -11.605 1.00 24.62  ? 54  LYS A CD  1 
ATOM   381  C CE  . LYS A 1 56  ? 11.540  -0.312  -11.444 1.00 32.81  ? 54  LYS A CE  1 
ATOM   382  N NZ  . LYS A 1 56  ? 12.588  0.329   -12.282 1.00 31.93  ? 54  LYS A NZ  1 
ATOM   383  N N   . ILE A 1 57  ? 10.204  -6.981  -10.878 1.00 22.74  ? 55  ILE A N   1 
ATOM   384  C CA  . ILE A 1 57  ? 10.504  -8.369  -10.593 1.00 22.00  ? 55  ILE A CA  1 
ATOM   385  C C   . ILE A 1 57  ? 10.432  -9.212  -11.871 1.00 21.84  ? 55  ILE A C   1 
ATOM   386  O O   . ILE A 1 57  ? 11.065  -10.272 -11.973 1.00 16.72  ? 55  ILE A O   1 
ATOM   387  C CB  . ILE A 1 57  ? 9.530   -8.937  -9.523  1.00 22.18  ? 55  ILE A CB  1 
ATOM   388  C CG1 . ILE A 1 57  ? 9.905   -8.424  -8.129  1.00 20.90  ? 55  ILE A CG1 1 
ATOM   389  C CG2 . ILE A 1 57  ? 9.563   -10.472 -9.504  1.00 21.89  ? 55  ILE A CG2 1 
ATOM   390  C CD1 . ILE A 1 57  ? 8.814   -8.692  -7.090  1.00 17.61  ? 55  ILE A CD1 1 
ATOM   391  N N   . GLN A 1 58  ? 9.667   -8.724  -12.845 1.00 25.59  ? 56  GLN A N   1 
ATOM   392  C CA  . GLN A 1 58  ? 9.519   -9.410  -14.131 1.00 26.83  ? 56  GLN A CA  1 
ATOM   393  C C   . GLN A 1 58  ? 10.526  -8.942  -15.172 1.00 26.31  ? 56  GLN A C   1 
ATOM   394  O O   . GLN A 1 58  ? 10.437  -9.311  -16.344 1.00 26.17  ? 56  GLN A O   1 
ATOM   395  C CB  . GLN A 1 58  ? 8.092   -9.251  -14.655 1.00 28.13  ? 56  GLN A CB  1 
ATOM   396  C CG  . GLN A 1 58  ? 7.059   -9.959  -13.776 1.00 30.22  ? 56  GLN A CG  1 
ATOM   397  C CD  . GLN A 1 58  ? 5.644   -9.813  -14.293 1.00 38.91  ? 56  GLN A CD  1 
ATOM   398  O OE1 . GLN A 1 58  ? 4.718   -10.482 -13.814 1.00 40.69  ? 56  GLN A OE1 1 
ATOM   399  N NE2 . GLN A 1 58  ? 5.460   -8.913  -15.251 1.00 36.00  ? 56  GLN A NE2 1 
ATOM   400  N N   . SER A 1 59  ? 11.481  -8.122  -14.743 1.00 26.42  ? 57  SER A N   1 
ATOM   401  C CA  . SER A 1 59  ? 12.522  -7.612  -15.635 1.00 26.29  ? 57  SER A CA  1 
ATOM   402  C C   . SER A 1 59  ? 13.405  -8.729  -16.191 1.00 28.03  ? 57  SER A C   1 
ATOM   403  O O   . SER A 1 59  ? 13.858  -9.589  -15.436 1.00 29.36  ? 57  SER A O   1 
ATOM   404  C CB  . SER A 1 59  ? 13.393  -6.592  -14.912 1.00 24.75  ? 57  SER A CB  1 
ATOM   405  O OG  . SER A 1 59  ? 14.311  -5.983  -15.804 1.00 30.13  ? 57  SER A OG  1 
ATOM   406  N N   . PRO A 1 60  ? 13.723  -8.656  -17.499 1.00 28.66  ? 58  PRO A N   1 
ATOM   407  C CA  . PRO A 1 60  ? 14.710  -9.516  -18.150 1.00 30.14  ? 58  PRO A CA  1 
ATOM   408  C C   . PRO A 1 60  ? 16.111  -9.239  -17.648 1.00 28.41  ? 58  PRO A C   1 
ATOM   409  O O   . PRO A 1 60  ? 17.040  -9.961  -17.991 1.00 29.85  ? 58  PRO A O   1 
ATOM   410  C CB  . PRO A 1 60  ? 14.621  -9.125  -19.637 1.00 29.27  ? 58  PRO A CB  1 
ATOM   411  C CG  . PRO A 1 60  ? 13.451  -8.231  -19.758 1.00 31.53  ? 58  PRO A CG  1 
ATOM   412  C CD  . PRO A 1 60  ? 13.153  -7.663  -18.424 1.00 24.02  ? 58  PRO A CD  1 
ATOM   413  N N   . GLN A 1 61  ? 16.294  -8.089  -17.023 1.00 27.30  ? 59  GLN A N   1 
ATOM   414  C CA  . GLN A 1 61  ? 17.573  -7.777  -16.428 1.00 29.24  ? 59  GLN A CA  1 
ATOM   415  C C   . GLN A 1 61  ? 17.654  -8.295  -14.987 1.00 28.68  ? 59  GLN A C   1 
ATOM   416  O O   . GLN A 1 61  ? 16.973  -7.792  -14.085 1.00 28.22  ? 59  GLN A O   1 
ATOM   417  C CB  . GLN A 1 61  ? 17.848  -6.276  -16.515 1.00 31.96  ? 59  GLN A CB  1 
ATOM   418  C CG  . GLN A 1 61  ? 17.642  -5.684  -17.934 1.00 30.59  ? 59  GLN A CG  1 
ATOM   419  C CD  . GLN A 1 61  ? 17.972  -4.197  -17.999 1.00 31.29  ? 59  GLN A CD  1 
ATOM   420  O OE1 . GLN A 1 61  ? 18.995  -3.752  -17.470 1.00 36.68  ? 59  GLN A OE1 1 
ATOM   421  N NE2 . GLN A 1 61  ? 17.195  -3.457  -18.779 1.00 39.81  ? 59  GLN A NE2 1 
ATOM   422  N N   . GLU A 1 62  ? 18.453  -9.339  -14.794 1.00 27.86  ? 60  GLU A N   1 
ATOM   423  C CA  . GLU A 1 62  ? 18.399  -10.136 -13.578 1.00 26.96  ? 60  GLU A CA  1 
ATOM   424  C C   . GLU A 1 62  ? 18.638  -9.315  -12.299 1.00 29.22  ? 60  GLU A C   1 
ATOM   425  O O   . GLU A 1 62  ? 18.007  -9.571  -11.251 1.00 27.14  ? 60  GLU A O   1 
ATOM   426  C CB  . GLU A 1 62  ? 19.417  -11.270 -13.660 1.00 29.01  ? 60  GLU A CB  1 
ATOM   427  C CG  . GLU A 1 62  ? 19.041  -12.488 -12.817 1.00 35.94  ? 60  GLU A CG  1 
ATOM   428  C CD  . GLU A 1 62  ? 20.242  -13.231 -12.318 1.00 41.79  ? 60  GLU A CD  1 
ATOM   429  O OE1 . GLU A 1 62  ? 21.157  -12.566 -11.786 1.00 53.54  ? 60  GLU A OE1 1 
ATOM   430  O OE2 . GLU A 1 62  ? 20.304  -14.462 -12.519 1.00 43.13  ? 60  GLU A OE2 1 
ATOM   431  N N   . TRP A 1 63  ? 19.555  -8.346  -12.380 1.00 25.98  ? 61  TRP A N   1 
ATOM   432  C CA  . TRP A 1 63  ? 20.018  -7.607  -11.196 1.00 27.32  ? 61  TRP A CA  1 
ATOM   433  C C   . TRP A 1 63  ? 18.968  -6.575  -10.752 1.00 27.32  ? 61  TRP A C   1 
ATOM   434  O O   . TRP A 1 63  ? 18.726  -6.385  -9.555  1.00 23.35  ? 61  TRP A O   1 
ATOM   435  C CB  . TRP A 1 63  ? 21.365  -6.934  -11.490 1.00 27.66  ? 61  TRP A CB  1 
ATOM   436  C CG  . TRP A 1 63  ? 21.938  -6.127  -10.352 1.00 33.71  ? 61  TRP A CG  1 
ATOM   437  C CD1 . TRP A 1 63  ? 22.470  -4.874  -10.434 1.00 27.93  ? 61  TRP A CD1 1 
ATOM   438  C CD2 . TRP A 1 63  ? 22.011  -6.504  -8.959  1.00 32.27  ? 61  TRP A CD2 1 
ATOM   439  N NE1 . TRP A 1 63  ? 22.853  -4.439  -9.194  1.00 30.09  ? 61  TRP A NE1 1 
ATOM   440  C CE2 . TRP A 1 63  ? 22.610  -5.423  -8.271  1.00 29.04  ? 61  TRP A CE2 1 
ATOM   441  C CE3 . TRP A 1 63  ? 21.699  -7.673  -8.245  1.00 27.27  ? 61  TRP A CE3 1 
ATOM   442  C CZ2 . TRP A 1 63  ? 22.924  -5.477  -6.903  1.00 27.62  ? 61  TRP A CZ2 1 
ATOM   443  C CZ3 . TRP A 1 63  ? 21.994  -7.722  -6.877  1.00 29.71  ? 61  TRP A CZ3 1 
ATOM   444  C CH2 . TRP A 1 63  ? 22.589  -6.623  -6.220  1.00 31.20  ? 61  TRP A CH2 1 
ATOM   445  N N   . GLU A 1 64  ? 18.233  -6.038  -11.726 1.00 25.03  ? 62  GLU A N   1 
ATOM   446  C CA  . GLU A 1 64  ? 17.003  -5.313  -11.432 1.00 23.08  ? 62  GLU A CA  1 
ATOM   447  C C   . GLU A 1 64  ? 15.982  -6.189  -10.698 1.00 23.35  ? 62  GLU A C   1 
ATOM   448  O O   . GLU A 1 64  ? 15.307  -5.707  -9.784  1.00 23.68  ? 62  GLU A O   1 
ATOM   449  C CB  . GLU A 1 64  ? 16.386  -4.774  -12.723 1.00 20.32  ? 62  GLU A CB  1 
ATOM   450  C CG  . GLU A 1 64  ? 15.217  -3.815  -12.534 1.00 19.72  ? 62  GLU A CG  1 
ATOM   451  C CD  . GLU A 1 64  ? 14.951  -2.967  -13.787 1.00 26.45  ? 62  GLU A CD  1 
ATOM   452  O OE1 . GLU A 1 64  ? 15.026  -1.735  -13.704 1.00 32.02  ? 62  GLU A OE1 1 
ATOM   453  O OE2 . GLU A 1 64  ? 14.779  -3.533  -14.879 1.00 21.79  ? 62  GLU A OE2 1 
ATOM   454  N N   . ALA A 1 65  ? 15.702  -7.372  -11.257 1.00 20.21  ? 63  ALA A N   1 
ATOM   455  C CA  . ALA A 1 65  ? 14.712  -8.281  -10.689 1.00 19.04  ? 63  ALA A CA  1 
ATOM   456  C C   . ALA A 1 65  ? 15.124  -8.772  -9.290  1.00 19.62  ? 63  ALA A C   1 
ATOM   457  O O   . ALA A 1 65  ? 14.334  -8.698  -8.359  1.00 22.95  ? 63  ALA A O   1 
ATOM   458  C CB  . ALA A 1 65  ? 14.461  -9.470  -11.627 1.00 17.31  ? 63  ALA A CB  1 
ATOM   459  N N   . ILE A 1 66  ? 16.408  -9.072  -9.112  1.00 25.14  ? 64  ILE A N   1 
ATOM   460  C CA  . ILE A 1 66  ? 16.927  -9.569  -7.835  1.00 26.23  ? 64  ILE A CA  1 
ATOM   461  C C   . ILE A 1 66  ? 16.872  -8.512  -6.741  1.00 26.70  ? 64  ILE A C   1 
ATOM   462  O O   . ILE A 1 66  ? 16.485  -8.801  -5.608  1.00 27.62  ? 64  ILE A O   1 
ATOM   463  C CB  . ILE A 1 66  ? 18.388  -10.098 -7.982  1.00 27.65  ? 64  ILE A CB  1 
ATOM   464  C CG1 . ILE A 1 66  ? 18.377  -11.480 -8.643  1.00 27.30  ? 64  ILE A CG1 1 
ATOM   465  C CG2 . ILE A 1 66  ? 19.104  -10.147 -6.628  1.00 24.07  ? 64  ILE A CG2 1 
ATOM   466  C CD1 . ILE A 1 66  ? 17.572  -12.520 -7.877  1.00 36.22  ? 64  ILE A CD1 1 
ATOM   467  N N   . GLN A 1 67  ? 17.235  -7.282  -7.096  1.00 24.99  ? 65  GLN A N   1 
ATOM   468  C CA  . GLN A 1 67  ? 17.105  -6.151  -6.187  1.00 24.15  ? 65  GLN A CA  1 
ATOM   469  C C   . GLN A 1 67  ? 15.647  -5.894  -5.790  1.00 24.07  ? 65  GLN A C   1 
ATOM   470  O O   . GLN A 1 67  ? 15.357  -5.486  -4.667  1.00 24.47  ? 65  GLN A O   1 
ATOM   471  C CB  . GLN A 1 67  ? 17.723  -4.891  -6.806  1.00 25.13  ? 65  GLN A CB  1 
ATOM   472  C CG  . GLN A 1 67  ? 19.247  -4.871  -6.765  1.00 23.51  ? 65  GLN A CG  1 
ATOM   473  C CD  . GLN A 1 67  ? 19.840  -3.580  -7.331  1.00 28.18  ? 65  GLN A CD  1 
ATOM   474  O OE1 . GLN A 1 67  ? 20.464  -2.805  -6.604  1.00 33.09  ? 65  GLN A OE1 1 
ATOM   475  N NE2 . GLN A 1 67  ? 19.697  -3.377  -8.644  1.00 23.46  ? 65  GLN A NE2 1 
ATOM   476  N N   . ALA A 1 68  ? 14.753  -6.014  -6.758  1.00 24.88  ? 66  ALA A N   1 
ATOM   477  C CA  . ALA A 1 68  ? 13.336  -5.805  -6.512  1.00 23.86  ? 66  ALA A CA  1 
ATOM   478  C C   . ALA A 1 68  ? 12.784  -6.814  -5.504  1.00 23.57  ? 66  ALA A C   1 
ATOM   479  O O   . ALA A 1 68  ? 11.922  -6.472  -4.702  1.00 23.40  ? 66  ALA A O   1 
ATOM   480  C CB  . ALA A 1 68  ? 12.565  -5.889  -7.809  1.00 20.93  ? 66  ALA A CB  1 
ATOM   481  N N   . LEU A 1 69  ? 13.171  -8.081  -5.658  1.00 22.80  ? 67  LEU A N   1 
ATOM   482  C CA  . LEU A 1 69  ? 12.828  -9.112  -4.688  1.00 23.28  ? 67  LEU A CA  1 
ATOM   483  C C   . LEU A 1 69  ? 13.361  -8.828  -3.289  1.00 24.28  ? 67  LEU A C   1 
ATOM   484  O O   . LEU A 1 69  ? 12.799  -9.322  -2.322  1.00 21.99  ? 67  LEU A O   1 
ATOM   485  C CB  . LEU A 1 69  ? 13.309  -10.487 -5.151  1.00 18.15  ? 67  LEU A CB  1 
ATOM   486  C CG  . LEU A 1 69  ? 12.531  -11.028 -6.345  1.00 25.81  ? 67  LEU A CG  1 
ATOM   487  C CD1 . LEU A 1 69  ? 13.280  -12.171 -7.012  1.00 21.48  ? 67  LEU A CD1 1 
ATOM   488  C CD2 . LEU A 1 69  ? 11.088  -11.418 -5.970  1.00 16.82  ? 67  LEU A CD2 1 
ATOM   489  N N   . THR A 1 70  ? 14.543  -8.207  -3.215  1.00 25.74  ? 68  THR A N   1 
ATOM   490  C CA  . THR A 1 70  ? 15.168  -7.827  -1.957  1.00 26.34  ? 68  THR A CA  1 
ATOM   491  C C   . THR A 1 70  ? 14.339  -6.740  -1.272  1.00 28.58  ? 68  THR A C   1 
ATOM   492  O O   . THR A 1 70  ? 14.185  -6.741  -0.041  1.00 27.22  ? 68  THR A O   1 
ATOM   493  C CB  . THR A 1 70  ? 16.623  -7.299  -2.181  1.00 30.22  ? 68  THR A CB  1 
ATOM   494  O OG1 . THR A 1 70  ? 17.488  -8.393  -2.501  1.00 33.28  ? 68  THR A OG1 1 
ATOM   495  C CG2 . THR A 1 70  ? 17.170  -6.596  -0.927  1.00 24.87  ? 68  THR A CG2 1 
ATOM   496  N N   . VAL A 1 71  ? 13.839  -5.802  -2.073  1.00 23.95  ? 69  VAL A N   1 
ATOM   497  C CA  . VAL A 1 71  ? 12.874  -4.806  -1.603  1.00 25.22  ? 69  VAL A CA  1 
ATOM   498  C C   . VAL A 1 71  ? 11.594  -5.464  -1.095  1.00 24.61  ? 69  VAL A C   1 
ATOM   499  O O   . VAL A 1 71  ? 11.113  -5.155  0.001   1.00 25.11  ? 69  VAL A O   1 
ATOM   500  C CB  . VAL A 1 71  ? 12.501  -3.801  -2.725  1.00 23.91  ? 69  VAL A CB  1 
ATOM   501  C CG1 . VAL A 1 71  ? 11.388  -2.864  -2.255  1.00 24.11  ? 69  VAL A CG1 1 
ATOM   502  C CG2 . VAL A 1 71  ? 13.733  -3.001  -3.177  1.00 24.28  ? 69  VAL A CG2 1 
ATOM   503  N N   . LEU A 1 72  ? 10.993  -6.304  -1.934  1.00 22.02  ? 70  LEU A N   1 
ATOM   504  C CA  . LEU A 1 72  ? 9.836   -7.087  -1.523  1.00 21.26  ? 70  LEU A CA  1 
ATOM   505  C C   . LEU A 1 72  ? 10.031  -7.792  -0.165  1.00 21.69  ? 70  LEU A C   1 
ATOM   506  O O   . LEU A 1 72  ? 9.239   -7.602  0.773   1.00 21.78  ? 70  LEU A O   1 
ATOM   507  C CB  . LEU A 1 72  ? 9.489   -8.099  -2.614  1.00 21.89  ? 70  LEU A CB  1 
ATOM   508  C CG  . LEU A 1 72  ? 8.308   -9.033  -2.336  1.00 18.79  ? 70  LEU A CG  1 
ATOM   509  C CD1 . LEU A 1 72  ? 6.984   -8.273  -1.992  1.00 12.90  ? 70  LEU A CD1 1 
ATOM   510  C CD2 . LEU A 1 72  ? 8.164   -9.948  -3.519  1.00 12.05  ? 70  LEU A CD2 1 
ATOM   511  N N   . GLU A 1 73  ? 11.066  -8.625  -0.087  1.00 19.69  ? 71  GLU A N   1 
ATOM   512  C CA  . GLU A 1 73  ? 11.476  -9.270  1.149   1.00 23.05  ? 71  GLU A CA  1 
ATOM   513  C C   . GLU A 1 73  ? 11.598  -8.311  2.353   1.00 25.54  ? 71  GLU A C   1 
ATOM   514  O O   . GLU A 1 73  ? 11.061  -8.580  3.439   1.00 25.21  ? 71  GLU A O   1 
ATOM   515  C CB  . GLU A 1 73  ? 12.792  -10.023 0.947   1.00 20.66  ? 71  GLU A CB  1 
ATOM   516  C CG  . GLU A 1 73  ? 13.230  -10.791 2.185   1.00 27.30  ? 71  GLU A CG  1 
ATOM   517  C CD  . GLU A 1 73  ? 14.418  -11.719 1.937   1.00 40.37  ? 71  GLU A CD  1 
ATOM   518  O OE1 . GLU A 1 73  ? 15.305  -11.376 1.124   1.00 39.00  ? 71  GLU A OE1 1 
ATOM   519  O OE2 . GLU A 1 73  ? 14.516  -12.744 2.645   1.00 48.21  ? 71  GLU A OE2 1 
ATOM   520  N N   . THR A 1 74  ? 12.354  -7.236  2.170   1.00 23.54  ? 72  THR A N   1 
ATOM   521  C CA  . THR A 1 74  ? 12.584  -6.255  3.223   1.00 24.51  ? 72  THR A CA  1 
ATOM   522  C C   . THR A 1 74  ? 11.295  -5.688  3.805   1.00 26.73  ? 72  THR A C   1 
ATOM   523  O O   . THR A 1 74  ? 11.139  -5.624  5.028   1.00 29.87  ? 72  THR A O   1 
ATOM   524  C CB  . THR A 1 74  ? 13.473  -5.099  2.719   1.00 26.02  ? 72  THR A CB  1 
ATOM   525  O OG1 . THR A 1 74  ? 14.712  -5.641  2.250   1.00 22.47  ? 72  THR A OG1 1 
ATOM   526  C CG2 . THR A 1 74  ? 13.741  -4.080  3.848   1.00 25.20  ? 72  THR A CG2 1 
ATOM   527  N N   . CYS A 1 75  ? 10.404  -5.223  2.929   1.00 25.32  ? 73  CYS A N   1 
ATOM   528  C CA  . CYS A 1 75  ? 9.171   -4.567  3.355   1.00 24.69  ? 73  CYS A CA  1 
ATOM   529  C C   . CYS A 1 75  ? 8.156   -5.572  3.895   1.00 24.51  ? 73  CYS A C   1 
ATOM   530  O O   . CYS A 1 75  ? 7.204   -5.195  4.590   1.00 23.77  ? 73  CYS A O   1 
ATOM   531  C CB  . CYS A 1 75  ? 8.523   -3.778  2.197   1.00 22.17  ? 73  CYS A CB  1 
ATOM   532  S SG  . CYS A 1 75  ? 9.500   -2.459  1.380   1.00 27.63  ? 73  CYS A SG  1 
ATOM   533  N N   . MET A 1 76  ? 8.242   -6.818  3.444   1.00 25.80  ? 74  MET A N   1 
ATOM   534  C CA  . MET A 1 76  ? 7.345   -7.835  3.987   1.00 24.52  ? 74  MET A CA  1 
ATOM   535  C C   . MET A 1 76  ? 7.713   -8.090  5.451   1.00 28.54  ? 74  MET A C   1 
ATOM   536  O O   . MET A 1 76  ? 6.842   -8.170  6.323   1.00 30.02  ? 74  MET A O   1 
ATOM   537  C CB  . MET A 1 76  ? 7.437   -9.127  3.169   1.00 25.52  ? 74  MET A CB  1 
ATOM   538  C CG  . MET A 1 76  ? 6.559   -9.160  1.897   1.00 25.07  ? 74  MET A CG  1 
ATOM   539  S SD  . MET A 1 76  ? 4.780   -9.002  2.211   1.00 27.10  ? 74  MET A SD  1 
ATOM   540  C CE  . MET A 1 76  ? 4.313   -10.702 2.526   1.00 17.66  ? 74  MET A CE  1 
ATOM   541  N N   . LYS A 1 77  ? 9.011   -8.104  5.736   1.00 30.30  ? 75  LYS A N   1 
ATOM   542  C CA  . LYS A 1 77  ? 9.485   -8.235  7.111   1.00 33.32  ? 75  LYS A CA  1 
ATOM   543  C C   . LYS A 1 77  ? 9.164   -7.022  7.993   1.00 33.98  ? 75  LYS A C   1 
ATOM   544  O O   . LYS A 1 77  ? 8.812   -7.182  9.156   1.00 35.79  ? 75  LYS A O   1 
ATOM   545  C CB  . LYS A 1 77  ? 10.987  -8.531  7.137   1.00 33.23  ? 75  LYS A CB  1 
ATOM   546  C CG  . LYS A 1 77  ? 11.337  -9.919  6.615   1.00 38.34  ? 75  LYS A CG  1 
ATOM   547  C CD  . LYS A 1 77  ? 12.846  -10.144 6.588   1.00 49.86  ? 75  LYS A CD  1 
ATOM   548  C CE  . LYS A 1 77  ? 13.192  -11.491 5.950   1.00 57.79  ? 75  LYS A CE  1 
ATOM   549  N NZ  . LYS A 1 77  ? 14.667  -11.725 5.846   1.00 60.05  ? 75  LYS A NZ  1 
ATOM   550  N N   . SER A 1 78  ? 9.268   -5.815  7.444   1.00 27.47  ? 76  SER A N   1 
ATOM   551  C CA  . SER A 1 78  ? 9.216   -4.609  8.274   1.00 30.89  ? 76  SER A CA  1 
ATOM   552  C C   . SER A 1 78  ? 7.834   -3.977  8.381   1.00 32.85  ? 76  SER A C   1 
ATOM   553  O O   . SER A 1 78  ? 7.509   -3.357  9.387   1.00 33.15  ? 76  SER A O   1 
ATOM   554  C CB  . SER A 1 78  ? 10.255  -3.568  7.829   1.00 29.91  ? 76  SER A CB  1 
ATOM   555  O OG  . SER A 1 78  ? 10.089  -3.202  6.468   1.00 33.45  ? 76  SER A OG  1 
ATOM   556  N N   . CYS A 1 79  ? 7.036   -4.083  7.325   1.00 34.01  ? 77  CYS A N   1 
ATOM   557  C CA  . CYS A 1 79  ? 5.766   -3.371  7.282   1.00 34.90  ? 77  CYS A CA  1 
ATOM   558  C C   . CYS A 1 79  ? 4.617   -4.185  7.867   1.00 34.14  ? 77  CYS A C   1 
ATOM   559  O O   . CYS A 1 79  ? 4.826   -5.261  8.415   1.00 31.56  ? 77  CYS A O   1 
ATOM   560  C CB  . CYS A 1 79  ? 5.453   -2.901  5.855   1.00 34.66  ? 77  CYS A CB  1 
ATOM   561  S SG  . CYS A 1 79  ? 6.376   -1.416  5.302   1.00 38.62  ? 77  CYS A SG  1 
ATOM   562  N N   . GLY A 1 80  ? 3.404   -3.667  7.716   1.00 54.98  ? 78  GLY A N   1 
ATOM   563  C CA  . GLY A 1 80  ? 2.346   -4.314  6.921   1.00 58.48  ? 78  GLY A CA  1 
ATOM   564  C C   . GLY A 1 80  ? 1.423   -4.648  8.048   1.00 60.26  ? 78  GLY A C   1 
ATOM   565  O O   . GLY A 1 80  ? 1.933   -4.736  9.156   1.00 64.37  ? 78  GLY A O   1 
ATOM   566  N N   . LYS A 1 81  ? 0.141   -4.333  7.894   1.00 42.25  ? 79  LYS A N   1 
ATOM   567  C CA  . LYS A 1 81  ? -0.887  -5.287  7.519   1.00 40.93  ? 79  LYS A CA  1 
ATOM   568  C C   . LYS A 1 81  ? -1.454  -4.878  6.167   1.00 38.27  ? 79  LYS A C   1 
ATOM   569  O O   . LYS A 1 81  ? -1.799  -5.729  5.345   1.00 34.39  ? 79  LYS A O   1 
ATOM   570  C CB  . LYS A 1 81  ? -2.010  -5.288  8.561   1.00 42.76  ? 79  LYS A CB  1 
ATOM   571  C CG  . LYS A 1 81  ? -3.205  -6.162  8.200   1.00 48.11  ? 79  LYS A CG  1 
ATOM   572  C CD  . LYS A 1 81  ? -4.452  -5.743  8.969   1.00 56.91  ? 79  LYS A CD  1 
ATOM   573  C CE  . LYS A 1 81  ? -5.450  -6.896  9.110   1.00 62.17  ? 79  LYS A CE  1 
ATOM   574  N NZ  . LYS A 1 81  ? -6.491  -6.894  8.039   1.00 52.85  ? 79  LYS A NZ  1 
ATOM   575  N N   . ARG A 1 82  ? -1.504  -3.570  5.929   1.00 38.66  ? 80  ARG A N   1 
ATOM   576  C CA  . ARG A 1 82  ? -1.882  -3.045  4.623   1.00 40.51  ? 80  ARG A CA  1 
ATOM   577  C C   . ARG A 1 82  ? -0.988  -3.595  3.527   1.00 38.51  ? 80  ARG A C   1 
ATOM   578  O O   . ARG A 1 82  ? -1.477  -4.147  2.543   1.00 39.10  ? 80  ARG A O   1 
ATOM   579  C CB  . ARG A 1 82  ? -1.861  -1.516  4.616   1.00 41.21  ? 80  ARG A CB  1 
ATOM   580  C CG  . ARG A 1 82  ? -3.057  -0.898  5.329   1.00 50.48  ? 80  ARG A CG  1 
ATOM   581  C CD  . ARG A 1 82  ? -3.005  0.620   5.318   1.00 57.59  ? 80  ARG A CD  1 
ATOM   582  N NE  . ARG A 1 82  ? -1.666  1.134   5.589   1.00 55.94  ? 80  ARG A NE  1 
ATOM   583  C CZ  . ARG A 1 82  ? -1.041  2.023   4.824   1.00 59.92  ? 80  ARG A CZ  1 
ATOM   584  N NH1 . ARG A 1 82  ? -1.631  2.498   3.736   1.00 65.07  ? 80  ARG A NH1 1 
ATOM   585  N NH2 . ARG A 1 82  ? 0.176   2.432   5.141   1.00 64.64  ? 80  ARG A NH2 1 
ATOM   586  N N   . PHE A 1 83  ? 0.316   -3.612  3.783   1.00 35.64  ? 81  PHE A N   1 
ATOM   587  C CA  . PHE A 1 83  ? 1.239   -4.145  2.804   1.00 31.52  ? 81  PHE A CA  1 
ATOM   588  C C   . PHE A 1 83  ? 1.134   -5.668  2.659   1.00 31.17  ? 81  PHE A C   1 
ATOM   589  O O   . PHE A 1 83  ? 1.118   -6.195  1.535   1.00 29.91  ? 81  PHE A O   1 
ATOM   590  C CB  . PHE A 1 83  ? 2.668   -3.738  3.116   1.00 29.79  ? 81  PHE A CB  1 
ATOM   591  C CG  . PHE A 1 83  ? 3.634   -4.078  2.015   1.00 26.69  ? 81  PHE A CG  1 
ATOM   592  C CD1 . PHE A 1 83  ? 3.448   -3.567  0.733   1.00 24.56  ? 81  PHE A CD1 1 
ATOM   593  C CD2 . PHE A 1 83  ? 4.642   -5.003  2.225   1.00 17.86  ? 81  PHE A CD2 1 
ATOM   594  C CE1 . PHE A 1 83  ? 4.316   -3.895  -0.295  1.00 25.33  ? 81  PHE A CE1 1 
ATOM   595  C CE2 . PHE A 1 83  ? 5.537   -5.317  1.210   1.00 23.21  ? 81  PHE A CE2 1 
ATOM   596  C CZ  . PHE A 1 83  ? 5.375   -4.758  -0.057  1.00 19.81  ? 81  PHE A CZ  1 
ATOM   597  N N   . HIS A 1 84  ? 1.157   -6.371  3.790   1.00 29.20  ? 82  HIS A N   1 
ATOM   598  C CA  . HIS A 1 84  ? 0.893   -7.809  3.823   1.00 26.59  ? 82  HIS A CA  1 
ATOM   599  C C   . HIS A 1 84  ? -0.362  -8.254  3.058   1.00 26.55  ? 82  HIS A C   1 
ATOM   600  O O   . HIS A 1 84  ? -0.323  -9.225  2.309   1.00 26.64  ? 82  HIS A O   1 
ATOM   601  C CB  . HIS A 1 84  ? 0.870   -8.312  5.270   1.00 28.58  ? 82  HIS A CB  1 
ATOM   602  C CG  . HIS A 1 84  ? 2.198   -8.205  5.960   1.00 26.17  ? 82  HIS A CG  1 
ATOM   603  N ND1 . HIS A 1 84  ? 2.316   -8.047  7.324   1.00 26.24  ? 82  HIS A ND1 1 
ATOM   604  C CD2 . HIS A 1 84  ? 3.455   -8.117  5.462   1.00 21.79  ? 82  HIS A CD2 1 
ATOM   605  C CE1 . HIS A 1 84  ? 3.591   -7.893  7.640   1.00 26.91  ? 82  HIS A CE1 1 
ATOM   606  N NE2 . HIS A 1 84  ? 4.305   -7.944  6.528   1.00 27.13  ? 82  HIS A NE2 1 
ATOM   607  N N   . ASP A 1 85  ? -1.428  -7.463  3.140   1.00 32.31  ? 83  ASP A N   1 
ATOM   608  C CA  . ASP A 1 85  ? -2.684  -7.776  2.464   1.00 32.59  ? 83  ASP A CA  1 
ATOM   609  C C   . ASP A 1 85  ? -2.599  -7.557  0.952   1.00 33.06  ? 83  ASP A C   1 
ATOM   610  O O   . ASP A 1 85  ? -3.252  -8.268  0.171   1.00 35.03  ? 83  ASP A O   1 
ATOM   611  C CB  . ASP A 1 85  ? -3.822  -6.921  3.032   1.00 37.45  ? 83  ASP A CB  1 
ATOM   612  C CG  . ASP A 1 85  ? -4.208  -7.308  4.460   1.00 40.07  ? 83  ASP A CG  1 
ATOM   613  O OD1 . ASP A 1 85  ? -4.895  -6.499  5.117   1.00 45.70  ? 83  ASP A OD1 1 
ATOM   614  O OD2 . ASP A 1 85  ? -3.875  -8.425  4.909   1.00 44.37  ? 83  ASP A OD2 1 
ATOM   615  N N   . GLU A 1 86  ? -1.908  -6.497  0.539   1.00 33.25  ? 84  GLU A N   1 
ATOM   616  C CA  . GLU A 1 86  ? -1.748  -6.233  -0.886  1.00 34.61  ? 84  GLU A CA  1 
ATOM   617  C C   . GLU A 1 86  ? -0.955  -7.360  -1.557  1.00 32.75  ? 84  GLU A C   1 
ATOM   618  O O   . GLU A 1 86  ? -1.288  -7.801  -2.664  1.00 32.80  ? 84  GLU A O   1 
ATOM   619  C CB  . GLU A 1 86  ? -1.082  -4.880  -1.126  1.00 33.78  ? 84  GLU A CB  1 
ATOM   620  C CG  . GLU A 1 86  ? -2.033  -3.724  -1.220  1.00 43.16  ? 84  GLU A CG  1 
ATOM   621  C CD  . GLU A 1 86  ? -3.265  -4.044  -2.037  1.00 52.29  ? 84  GLU A CD  1 
ATOM   622  O OE1 . GLU A 1 86  ? -3.136  -4.230  -3.266  1.00 53.37  ? 84  GLU A OE1 1 
ATOM   623  O OE2 . GLU A 1 86  ? -4.366  -4.113  -1.445  1.00 53.65  ? 84  GLU A OE2 1 
ATOM   624  N N   . VAL A 1 87  ? 0.062   -7.853  -0.858  1.00 27.03  ? 85  VAL A N   1 
ATOM   625  C CA  . VAL A 1 87  ? 0.913   -8.899  -1.392  1.00 26.33  ? 85  VAL A CA  1 
ATOM   626  C C   . VAL A 1 87  ? 0.196   -10.255 -1.344  1.00 28.65  ? 85  VAL A C   1 
ATOM   627  O O   . VAL A 1 87  ? 0.345   -11.074 -2.255  1.00 27.45  ? 85  VAL A O   1 
ATOM   628  C CB  . VAL A 1 87  ? 2.277   -8.941  -0.664  1.00 25.34  ? 85  VAL A CB  1 
ATOM   629  C CG1 . VAL A 1 87  ? 3.077   -10.186 -1.034  1.00 18.12  ? 85  VAL A CG1 1 
ATOM   630  C CG2 . VAL A 1 87  ? 3.064   -7.691  -0.972  1.00 19.02  ? 85  VAL A CG2 1 
ATOM   631  N N   . GLY A 1 88  ? -0.722  -10.395 -0.395  1.00 27.04  ? 86  GLY A N   1 
ATOM   632  C CA  . GLY A 1 88  ? -1.526  -11.608 -0.270  1.00 28.25  ? 86  GLY A CA  1 
ATOM   633  C C   . GLY A 1 88  ? -2.810  -11.573 -1.092  1.00 32.81  ? 86  GLY A C   1 
ATOM   634  O O   . GLY A 1 88  ? -3.790  -12.227 -0.751  1.00 31.46  ? 86  GLY A O   1 
ATOM   635  N N   . LYS A 1 89  ? -2.791  -10.836 -2.201  1.00 33.73  ? 87  LYS A N   1 
ATOM   636  C CA  . LYS A 1 89  ? -3.832  -10.945 -3.210  1.00 32.94  ? 87  LYS A CA  1 
ATOM   637  C C   . LYS A 1 89  ? -3.278  -11.596 -4.465  1.00 31.02  ? 87  LYS A C   1 
ATOM   638  O O   . LYS A 1 89  ? -2.121  -11.373 -4.824  1.00 30.94  ? 87  LYS A O   1 
ATOM   639  C CB  . LYS A 1 89  ? -4.386  -9.568  -3.552  1.00 33.24  ? 87  LYS A CB  1 
ATOM   640  C CG  . LYS A 1 89  ? -5.170  -8.926  -2.430  1.00 37.40  ? 87  LYS A CG  1 
ATOM   641  C CD  . LYS A 1 89  ? -5.567  -7.508  -2.791  1.00 40.69  ? 87  LYS A CD  1 
ATOM   642  C CE  . LYS A 1 89  ? -6.158  -6.782  -1.590  1.00 51.63  ? 87  LYS A CE  1 
ATOM   643  N NZ  . LYS A 1 89  ? -6.948  -5.593  -2.025  1.00 58.83  ? 87  LYS A NZ  1 
ATOM   644  N N   . PHE A 1 90  ? -4.121  -12.361 -5.153  1.00 32.05  ? 88  PHE A N   1 
ATOM   645  C CA  . PHE A 1 90  ? -3.753  -13.012 -6.417  1.00 29.30  ? 88  PHE A CA  1 
ATOM   646  C C   . PHE A 1 90  ? -3.322  -11.999 -7.475  1.00 31.16  ? 88  PHE A C   1 
ATOM   647  O O   . PHE A 1 90  ? -2.480  -12.290 -8.325  1.00 32.53  ? 88  PHE A O   1 
ATOM   648  C CB  . PHE A 1 90  ? -4.922  -13.855 -6.946  1.00 31.17  ? 88  PHE A CB  1 
ATOM   649  C CG  . PHE A 1 90  ? -5.311  -14.994 -6.040  1.00 29.00  ? 88  PHE A CG  1 
ATOM   650  C CD1 . PHE A 1 90  ? -4.338  -15.810 -5.470  1.00 32.06  ? 88  PHE A CD1 1 
ATOM   651  C CD2 . PHE A 1 90  ? -6.634  -15.198 -5.692  1.00 32.91  ? 88  PHE A CD2 1 
ATOM   652  C CE1 . PHE A 1 90  ? -4.692  -16.858 -4.629  1.00 28.09  ? 88  PHE A CE1 1 
ATOM   653  C CE2 . PHE A 1 90  ? -6.989  -16.216 -4.815  1.00 36.10  ? 88  PHE A CE2 1 
ATOM   654  C CZ  . PHE A 1 90  ? -6.010  -17.004 -4.239  1.00 29.21  ? 88  PHE A CZ  1 
ATOM   655  N N   . ARG A 1 91  ? -3.895  -10.805 -7.402  1.00 32.91  ? 89  ARG A N   1 
ATOM   656  C CA  . ARG A 1 91  ? -3.489  -9.689  -8.232  1.00 35.93  ? 89  ARG A CA  1 
ATOM   657  C C   . ARG A 1 91  ? -1.978  -9.485  -8.230  1.00 34.42  ? 89  ARG A C   1 
ATOM   658  O O   . ARG A 1 91  ? -1.401  -9.072  -9.234  1.00 33.60  ? 89  ARG A O   1 
ATOM   659  C CB  . ARG A 1 91  ? -4.190  -8.416  -7.762  1.00 39.13  ? 89  ARG A CB  1 
ATOM   660  C CG  . ARG A 1 91  ? -4.018  -7.234  -8.696  1.00 46.29  ? 89  ARG A CG  1 
ATOM   661  C CD  . ARG A 1 91  ? -4.816  -6.024  -8.215  1.00 52.06  ? 89  ARG A CD  1 
ATOM   662  N NE  . ARG A 1 91  ? -6.222  -6.158  -8.571  1.00 59.71  ? 89  ARG A NE  1 
ATOM   663  C CZ  . ARG A 1 91  ? -7.229  -6.047  -7.710  1.00 70.85  ? 89  ARG A CZ  1 
ATOM   664  N NH1 . ARG A 1 91  ? -6.992  -5.748  -6.433  1.00 68.64  ? 89  ARG A NH1 1 
ATOM   665  N NH2 . ARG A 1 91  ? -8.476  -6.246  -8.128  1.00 69.48  ? 89  ARG A NH2 1 
ATOM   666  N N   . PHE A 1 92  ? -1.361  -9.662  -7.063  1.00 32.64  ? 90  PHE A N   1 
ATOM   667  C CA  . PHE A 1 92  ? 0.092   -9.644  -6.946  1.00 27.76  ? 90  PHE A CA  1 
ATOM   668  C C   . PHE A 1 92  ? 0.746   -11.015 -7.138  1.00 26.63  ? 90  PHE A C   1 
ATOM   669  O O   . PHE A 1 92  ? 1.745   -11.135 -7.845  1.00 28.14  ? 90  PHE A O   1 
ATOM   670  C CB  . PHE A 1 92  ? 0.514   -9.057  -5.597  1.00 26.71  ? 90  PHE A CB  1 
ATOM   671  C CG  . PHE A 1 92  ? 1.994   -8.896  -5.456  1.00 28.66  ? 90  PHE A CG  1 
ATOM   672  C CD1 . PHE A 1 92  ? 2.667   -7.925  -6.194  1.00 24.98  ? 90  PHE A CD1 1 
ATOM   673  C CD2 . PHE A 1 92  ? 2.742   -9.829  -4.732  1.00 23.81  ? 90  PHE A CD2 1 
ATOM   674  C CE1 . PHE A 1 92  ? 4.067   -7.840  -6.156  1.00 22.11  ? 90  PHE A CE1 1 
ATOM   675  C CE2 . PHE A 1 92  ? 4.120   -9.689  -4.617  1.00 17.88  ? 90  PHE A CE2 1 
ATOM   676  C CZ  . PHE A 1 92  ? 4.790   -8.758  -5.414  1.00 20.17  ? 90  PHE A CZ  1 
ATOM   677  N N   . LEU A 1 93  ? 0.256   -12.015 -6.415  1.00 25.48  ? 91  LEU A N   1 
ATOM   678  C CA  . LEU A 1 93  ? 0.833   -13.360 -6.435  1.00 25.63  ? 91  LEU A CA  1 
ATOM   679  C C   . LEU A 1 93  ? 0.884   -13.963 -7.845  1.00 27.48  ? 91  LEU A C   1 
ATOM   680  O O   . LEU A 1 93  ? 1.769   -14.784 -8.146  1.00 24.46  ? 91  LEU A O   1 
ATOM   681  C CB  . LEU A 1 93  ? -0.009  -14.288 -5.559  1.00 29.13  ? 91  LEU A CB  1 
ATOM   682  C CG  . LEU A 1 93  ? 0.198   -14.495 -4.061  1.00 28.39  ? 91  LEU A CG  1 
ATOM   683  C CD1 . LEU A 1 93  ? 1.467   -13.902 -3.463  1.00 23.38  ? 91  LEU A CD1 1 
ATOM   684  C CD2 . LEU A 1 93  ? -1.037  -14.108 -3.297  1.00 22.50  ? 91  LEU A CD2 1 
ATOM   685  N N   . ASN A 1 94  ? -0.148  -13.686 -8.648  1.00 27.33  ? 92  ASN A N   1 
ATOM   686  C CA  . ASN A 1 94  ? -0.152  -14.101 -10.059 1.00 28.00  ? 92  ASN A CA  1 
ATOM   687  C C   . ASN A 1 94  ? 1.084   -13.641 -10.827 1.00 26.28  ? 92  ASN A C   1 
ATOM   688  O O   . ASN A 1 94  ? 1.512   -14.310 -11.763 1.00 26.13  ? 92  ASN A O   1 
ATOM   689  C CB  . ASN A 1 94  ? -1.418  -13.630 -10.795 1.00 29.01  ? 92  ASN A CB  1 
ATOM   690  C CG  . ASN A 1 94  ? -2.660  -14.415 -10.398 1.00 29.84  ? 92  ASN A CG  1 
ATOM   691  O OD1 . ASN A 1 94  ? -2.580  -15.413 -9.678  1.00 30.07  ? 92  ASN A OD1 1 
ATOM   692  N ND2 . ASN A 1 94  ? -3.818  -13.908 -10.783 1.00 30.50  ? 92  ASN A ND2 1 
ATOM   693  N N   . GLU A 1 95  ? 1.558   -12.435 -10.531 1.00 24.24  ? 93  GLU A N   1 
ATOM   694  C CA  . GLU A 1 95  ? 2.742   -11.916 -11.195 1.00 24.91  ? 93  GLU A CA  1 
ATOM   695  C C   . GLU A 1 95  ? 4.009   -12.726 -10.821 1.00 25.69  ? 93  GLU A C   1 
ATOM   696  O O   . GLU A 1 95  ? 4.896   -12.948 -11.661 1.00 26.85  ? 93  GLU A O   1 
ATOM   697  C CB  . GLU A 1 95  ? 2.931   -10.418 -10.885 1.00 23.77  ? 93  GLU A CB  1 
ATOM   698  C CG  . GLU A 1 95  ? 1.716   -9.532  -11.202 1.00 29.39  ? 93  GLU A CG  1 
ATOM   699  C CD  . GLU A 1 95  ? 1.241   -9.648  -12.662 1.00 40.91  ? 93  GLU A CD  1 
ATOM   700  O OE1 . GLU A 1 95  ? 0.054   -9.970  -12.889 1.00 49.24  ? 93  GLU A OE1 1 
ATOM   701  O OE2 . GLU A 1 95  ? 2.086   -9.604  -13.575 1.00 36.83  ? 93  GLU A OE2 1 
ATOM   702  N N   . LEU A 1 96  ? 4.040   -13.238 -9.595  1.00 20.78  ? 94  LEU A N   1 
ATOM   703  C CA  . LEU A 1 96  ? 5.098   -14.143 -9.153  1.00 21.01  ? 94  LEU A CA  1 
ATOM   704  C C   . LEU A 1 96  ? 4.994   -15.505 -9.829  1.00 20.35  ? 94  LEU A C   1 
ATOM   705  O O   . LEU A 1 96  ? 6.002   -16.138 -10.114 1.00 23.33  ? 94  LEU A O   1 
ATOM   706  C CB  . LEU A 1 96  ? 5.036   -14.306 -7.626  1.00 16.44  ? 94  LEU A CB  1 
ATOM   707  C CG  . LEU A 1 96  ? 5.171   -13.001 -6.837  1.00 22.01  ? 94  LEU A CG  1 
ATOM   708  C CD1 . LEU A 1 96  ? 5.070   -13.236 -5.310  1.00 18.38  ? 94  LEU A CD1 1 
ATOM   709  C CD2 . LEU A 1 96  ? 6.501   -12.321 -7.211  1.00 14.64  ? 94  LEU A CD2 1 
ATOM   710  N N   . ILE A 1 97  ? 3.774   -16.033 -9.865  1.00 24.57  ? 95  ILE A N   1 
ATOM   711  C CA  . ILE A 1 97  ? 3.478   -17.304 -10.499 1.00 24.34  ? 95  ILE A CA  1 
ATOM   712  C C   . ILE A 1 97  ? 3.884   -17.270 -11.966 1.00 27.77  ? 95  ILE A C   1 
ATOM   713  O O   . ILE A 1 97  ? 4.510   -18.200 -12.460 1.00 30.66  ? 95  ILE A O   1 
ATOM   714  C CB  . ILE A 1 97  ? 1.973   -17.651 -10.379 1.00 26.31  ? 95  ILE A CB  1 
ATOM   715  C CG1 . ILE A 1 97  ? 1.636   -18.096 -8.953  1.00 24.80  ? 95  ILE A CG1 1 
ATOM   716  C CG2 . ILE A 1 97  ? 1.565   -18.743 -11.388 1.00 19.29  ? 95  ILE A CG2 1 
ATOM   717  C CD1 . ILE A 1 97  ? 0.175   -18.183 -8.699  1.00 20.61  ? 95  ILE A CD1 1 
ATOM   718  N N   . LYS A 1 98  ? 3.613   -16.152 -12.632 1.00 27.91  ? 96  LYS A N   1 
ATOM   719  C CA  . LYS A 1 98  ? 4.085   -15.956 -14.003 1.00 27.69  ? 96  LYS A CA  1 
ATOM   720  C C   . LYS A 1 98  ? 5.592   -16.126 -14.142 1.00 26.73  ? 96  LYS A C   1 
ATOM   721  O O   . LYS A 1 98  ? 6.072   -16.663 -15.130 1.00 28.40  ? 96  LYS A O   1 
ATOM   722  C CB  . LYS A 1 98  ? 3.677   -14.580 -14.513 1.00 26.07  ? 96  LYS A CB  1 
ATOM   723  C CG  . LYS A 1 98  ? 2.244   -14.490 -14.962 1.00 25.32  ? 96  LYS A CG  1 
ATOM   724  C CD  . LYS A 1 98  ? 1.899   -13.049 -15.244 1.00 30.00  ? 96  LYS A CD  1 
ATOM   725  C CE  . LYS A 1 98  ? 0.441   -12.889 -15.626 1.00 31.42  ? 96  LYS A CE  1 
ATOM   726  N NZ  . LYS A 1 98  ? 0.053   -11.454 -15.592 1.00 33.98  ? 96  LYS A NZ  1 
ATOM   727  N N   . VAL A 1 99  ? 6.337   -15.594 -13.181 1.00 26.51  ? 97  VAL A N   1 
ATOM   728  C CA  . VAL A 1 99  ? 7.799   -15.675 -13.190 1.00 25.38  ? 97  VAL A CA  1 
ATOM   729  C C   . VAL A 1 99  ? 8.359   -17.086 -12.993 1.00 23.45  ? 97  VAL A C   1 
ATOM   730  O O   . VAL A 1 99  ? 9.368   -17.442 -13.589 1.00 23.57  ? 97  VAL A O   1 
ATOM   731  C CB  . VAL A 1 99  ? 8.416   -14.706 -12.148 1.00 24.02  ? 97  VAL A CB  1 
ATOM   732  C CG1 . VAL A 1 99  ? 9.949   -14.837 -12.126 1.00 25.63  ? 97  VAL A CG1 1 
ATOM   733  C CG2 . VAL A 1 99  ? 7.991   -13.279 -12.453 1.00 18.45  ? 97  VAL A CG2 1 
ATOM   734  N N   . VAL A 1 100 ? 7.719   -17.884 -12.148 1.00 26.31  ? 98  VAL A N   1 
ATOM   735  C CA  . VAL A 1 100 ? 8.298   -19.173 -11.757 1.00 28.51  ? 98  VAL A CA  1 
ATOM   736  C C   . VAL A 1 100 ? 7.801   -20.352 -12.585 1.00 29.86  ? 98  VAL A C   1 
ATOM   737  O O   . VAL A 1 100 ? 8.307   -21.455 -12.451 1.00 32.94  ? 98  VAL A O   1 
ATOM   738  C CB  . VAL A 1 100 ? 8.121   -19.494 -10.253 1.00 27.69  ? 98  VAL A CB  1 
ATOM   739  C CG1 . VAL A 1 100 ? 8.801   -18.431 -9.388  1.00 28.54  ? 98  VAL A CG1 1 
ATOM   740  C CG2 . VAL A 1 100 ? 6.648   -19.663 -9.893  1.00 24.91  ? 98  VAL A CG2 1 
ATOM   741  N N   . SER A 1 101 ? 6.782   -20.125 -13.399 1.00 30.66  ? 99  SER A N   1 
ATOM   742  C CA  . SER A 1 101 ? 6.074   -21.216 -14.063 1.00 33.64  ? 99  SER A CA  1 
ATOM   743  C C   . SER A 1 101 ? 6.408   -21.287 -15.564 1.00 35.18  ? 99  SER A C   1 
ATOM   744  O O   . SER A 1 101 ? 6.430   -20.263 -16.238 1.00 31.40  ? 99  SER A O   1 
ATOM   745  C CB  . SER A 1 101 ? 4.573   -21.069 -13.840 1.00 33.10  ? 99  SER A CB  1 
ATOM   746  O OG  . SER A 1 101 ? 3.846   -21.948 -14.680 1.00 43.21  ? 99  SER A OG  1 
ATOM   747  N N   . PRO A 1 102 ? 6.854   -22.470 -16.030 1.00 39.42  ? 100 PRO A N   1 
ATOM   748  C CA  . PRO A 1 102 ? 7.191   -22.784 -17.436 1.00 42.30  ? 100 PRO A CA  1 
ATOM   749  C C   . PRO A 1 102 ? 6.095   -22.374 -18.415 1.00 45.33  ? 100 PRO A C   1 
ATOM   750  O O   . PRO A 1 102 ? 6.392   -21.950 -19.533 1.00 46.60  ? 100 PRO A O   1 
ATOM   751  C CB  . PRO A 1 102 ? 7.296   -24.312 -17.438 1.00 41.19  ? 100 PRO A CB  1 
ATOM   752  C CG  . PRO A 1 102 ? 7.699   -24.664 -16.045 1.00 45.19  ? 100 PRO A CG  1 
ATOM   753  C CD  . PRO A 1 102 ? 7.106   -23.613 -15.129 1.00 36.33  ? 100 PRO A CD  1 
ATOM   754  N N   . LYS A 1 103 ? 4.851   -22.686 -18.061 1.00 53.50  ? 101 LYS A N   1 
ATOM   755  C CA  . LYS A 1 103 ? 3.673   -22.186 -18.769 1.00 55.18  ? 101 LYS A CA  1 
ATOM   756  C C   . LYS A 1 103 ? 3.783   -20.715 -19.177 1.00 54.34  ? 101 LYS A C   1 
ATOM   757  O O   . LYS A 1 103 ? 3.200   -20.309 -20.181 1.00 55.74  ? 101 LYS A O   1 
ATOM   758  C CB  . LYS A 1 103 ? 2.424   -22.391 -17.910 1.00 56.63  ? 101 LYS A CB  1 
ATOM   759  C CG  . LYS A 1 103 ? 1.342   -23.240 -18.552 1.00 67.68  ? 101 LYS A CG  1 
ATOM   760  C CD  . LYS A 1 103 ? 0.580   -24.042 -17.498 1.00 74.83  ? 101 LYS A CD  1 
ATOM   761  C CE  . LYS A 1 103 ? -0.816  -23.474 -17.271 1.00 83.70  ? 101 LYS A CE  1 
ATOM   762  N NZ  . LYS A 1 103 ? -1.772  -23.822 -18.372 1.00 83.64  ? 101 LYS A NZ  1 
ATOM   763  N N   . TYR A 1 104 ? 4.404   -19.898 -18.324 1.00 47.98  ? 102 TYR A N   1 
ATOM   764  C CA  . TYR A 1 104 ? 4.500   -18.456 -18.560 1.00 46.67  ? 102 TYR A CA  1 
ATOM   765  C C   . TYR A 1 104 ? 5.928   -17.943 -18.806 1.00 43.51  ? 102 TYR A C   1 
ATOM   766  O O   . TYR A 1 104 ? 6.409   -17.980 -19.932 1.00 45.24  ? 102 TYR A O   1 
ATOM   767  C CB  . TYR A 1 104 ? 3.793   -17.665 -17.453 1.00 44.96  ? 102 TYR A CB  1 
ATOM   768  C CG  . TYR A 1 104 ? 2.414   -18.191 -17.158 1.00 47.28  ? 102 TYR A CG  1 
ATOM   769  C CD1 . TYR A 1 104 ? 2.205   -19.080 -16.112 1.00 52.76  ? 102 TYR A CD1 1 
ATOM   770  C CD2 . TYR A 1 104 ? 1.370   -17.974 -18.047 1.00 55.64  ? 102 TYR A CD2 1 
ATOM   771  C CE1 . TYR A 1 104 ? 0.975   -19.684 -15.917 1.00 49.05  ? 102 TYR A CE1 1 
ATOM   772  C CE2 . TYR A 1 104 ? 0.124   -18.558 -17.851 1.00 54.60  ? 102 TYR A CE2 1 
ATOM   773  C CZ  . TYR A 1 104 ? -0.063  -19.419 -16.787 1.00 53.42  ? 102 TYR A CZ  1 
ATOM   774  O OH  . TYR A 1 104 ? -1.294  -20.010 -16.587 1.00 58.09  ? 102 TYR A OH  1 
ATOM   775  N N   . LEU A 1 105 ? 6.521   -17.297 -17.810 1.00 34.88  ? 103 LEU A N   1 
ATOM   776  C CA  . LEU A 1 105 ? 7.818   -16.661 -18.008 1.00 33.93  ? 103 LEU A CA  1 
ATOM   777  C C   . LEU A 1 105 ? 8.957   -17.575 -17.564 1.00 32.51  ? 103 LEU A C   1 
ATOM   778  O O   . LEU A 1 105 ? 10.127  -17.233 -17.716 1.00 32.94  ? 103 LEU A O   1 
ATOM   779  C CB  . LEU A 1 105 ? 7.912   -15.322 -17.270 1.00 30.83  ? 103 LEU A CB  1 
ATOM   780  C CG  . LEU A 1 105 ? 6.864   -14.238 -17.542 1.00 42.51  ? 103 LEU A CG  1 
ATOM   781  C CD1 . LEU A 1 105 ? 7.167   -12.970 -16.706 1.00 31.99  ? 103 LEU A CD1 1 
ATOM   782  C CD2 . LEU A 1 105 ? 6.749   -13.902 -19.048 1.00 36.76  ? 103 LEU A CD2 1 
ATOM   783  N N   . GLY A 1 106 ? 8.613   -18.689 -16.933 1.00 30.30  ? 104 GLY A N   1 
ATOM   784  C CA  . GLY A 1 106 ? 9.595   -19.492 -16.228 1.00 32.30  ? 104 GLY A CA  1 
ATOM   785  C C   . GLY A 1 106 ? 10.793  -19.846 -17.085 1.00 35.97  ? 104 GLY A C   1 
ATOM   786  O O   . GLY A 1 106 ? 11.925  -19.849 -16.599 1.00 36.05  ? 104 GLY A O   1 
ATOM   787  N N   . SER A 1 107 ? 10.542  -20.120 -18.367 1.00 36.59  ? 105 SER A N   1 
ATOM   788  C CA  . SER A 1 107 ? 11.563  -20.621 -19.299 1.00 39.76  ? 105 SER A CA  1 
ATOM   789  C C   . SER A 1 107 ? 12.681  -19.633 -19.608 1.00 38.72  ? 105 SER A C   1 
ATOM   790  O O   . SER A 1 107 ? 13.769  -20.033 -19.995 1.00 38.85  ? 105 SER A O   1 
ATOM   791  C CB  . SER A 1 107 ? 10.918  -21.047 -20.620 1.00 41.18  ? 105 SER A CB  1 
ATOM   792  O OG  . SER A 1 107 ? 10.406  -22.358 -20.507 1.00 53.40  ? 105 SER A OG  1 
ATOM   793  N N   . ARG A 1 108 ? 12.392  -18.340 -19.537 1.00 48.87  ? 106 ARG A N   1 
ATOM   794  C CA  . ARG A 1 108 ? 13.437  -17.345 -19.756 1.00 51.98  ? 106 ARG A CA  1 
ATOM   795  C C   . ARG A 1 108 ? 13.914  -16.588 -18.510 1.00 50.01  ? 106 ARG A C   1 
ATOM   796  O O   . ARG A 1 108 ? 14.675  -15.633 -18.626 1.00 52.36  ? 106 ARG A O   1 
ATOM   797  C CB  . ARG A 1 108 ? 13.032  -16.370 -20.853 1.00 55.66  ? 106 ARG A CB  1 
ATOM   798  C CG  . ARG A 1 108 ? 11.695  -15.692 -20.622 1.00 59.87  ? 106 ARG A CG  1 
ATOM   799  C CD  . ARG A 1 108 ? 11.442  -14.674 -21.721 1.00 66.83  ? 106 ARG A CD  1 
ATOM   800  N NE  . ARG A 1 108 ? 10.105  -14.094 -21.646 1.00 69.67  ? 106 ARG A NE  1 
ATOM   801  C CZ  . ARG A 1 108 ? 8.993   -14.734 -21.994 1.00 72.45  ? 106 ARG A CZ  1 
ATOM   802  N NH1 . ARG A 1 108 ? 9.041   -16.012 -22.369 1.00 65.39  ? 106 ARG A NH1 1 
ATOM   803  N NH2 . ARG A 1 108 ? 7.831   -14.092 -21.970 1.00 68.94  ? 106 ARG A NH2 1 
ATOM   804  N N   . THR A 1 109 ? 13.519  -17.059 -17.329 1.00 40.77  ? 107 THR A N   1 
ATOM   805  C CA  . THR A 1 109 ? 13.983  -16.500 -16.056 1.00 36.67  ? 107 THR A CA  1 
ATOM   806  C C   . THR A 1 109 ? 15.050  -17.409 -15.462 1.00 34.63  ? 107 THR A C   1 
ATOM   807  O O   . THR A 1 109 ? 14.901  -18.628 -15.485 1.00 35.38  ? 107 THR A O   1 
ATOM   808  C CB  . THR A 1 109 ? 12.812  -16.423 -15.051 1.00 35.78  ? 107 THR A CB  1 
ATOM   809  O OG1 . THR A 1 109 ? 11.673  -15.852 -15.701 1.00 34.60  ? 107 THR A OG1 1 
ATOM   810  C CG2 . THR A 1 109 ? 13.180  -15.587 -13.835 1.00 31.43  ? 107 THR A CG2 1 
ATOM   811  N N   . SER A 1 110 ? 16.063  -16.821 -14.831 1.00 32.36  ? 108 SER A N   1 
ATOM   812  C CA  . SER A 1 110 ? 17.076  -17.614 -14.129 1.00 31.88  ? 108 SER A CA  1 
ATOM   813  C C   . SER A 1 110 ? 16.503  -18.473 -12.990 1.00 32.28  ? 108 SER A C   1 
ATOM   814  O O   . SER A 1 110 ? 15.522  -18.102 -12.327 1.00 30.55  ? 108 SER A O   1 
ATOM   815  C CB  . SER A 1 110 ? 18.222  -16.727 -13.616 1.00 31.28  ? 108 SER A CB  1 
ATOM   816  O OG  . SER A 1 110 ? 17.791  -15.835 -12.594 1.00 28.27  ? 108 SER A OG  1 
ATOM   817  N N   . GLU A 1 111 ? 17.182  -19.580 -12.726 1.00 34.86  ? 109 GLU A N   1 
ATOM   818  C CA  . GLU A 1 111 ? 16.991  -20.370 -11.510 1.00 36.08  ? 109 GLU A CA  1 
ATOM   819  C C   . GLU A 1 111 ? 17.100  -19.533 -10.231 1.00 34.19  ? 109 GLU A C   1 
ATOM   820  O O   . GLU A 1 111 ? 16.377  -19.766 -9.264  1.00 33.89  ? 109 GLU A O   1 
ATOM   821  C CB  . GLU A 1 111 ? 18.012  -21.507 -11.472 1.00 37.28  ? 109 GLU A CB  1 
ATOM   822  C CG  . GLU A 1 111 ? 17.439  -22.891 -11.756 1.00 51.95  ? 109 GLU A CG  1 
ATOM   823  C CD  . GLU A 1 111 ? 16.566  -22.918 -12.991 1.00 63.51  ? 109 GLU A CD  1 
ATOM   824  O OE1 . GLU A 1 111 ? 17.029  -22.453 -14.053 1.00 69.86  ? 109 GLU A OE1 1 
ATOM   825  O OE2 . GLU A 1 111 ? 15.402  -23.364 -12.892 1.00 72.01  ? 109 GLU A OE2 1 
ATOM   826  N N   . LYS A 1 112 ? 18.053  -18.605 -10.210 1.00 36.36  ? 110 LYS A N   1 
ATOM   827  C CA  . LYS A 1 112 ? 18.266  -17.741 -9.057  1.00 33.29  ? 110 LYS A CA  1 
ATOM   828  C C   . LYS A 1 112 ? 17.005  -16.953 -8.696  1.00 31.03  ? 110 LYS A C   1 
ATOM   829  O O   . LYS A 1 112 ? 16.532  -17.008 -7.565  1.00 29.75  ? 110 LYS A O   1 
ATOM   830  C CB  . LYS A 1 112 ? 19.443  -16.793 -9.311  1.00 33.10  ? 110 LYS A CB  1 
ATOM   831  C CG  . LYS A 1 112 ? 19.687  -15.790 -8.176  1.00 38.19  ? 110 LYS A CG  1 
ATOM   832  C CD  . LYS A 1 112 ? 20.730  -14.738 -8.557  1.00 43.81  ? 110 LYS A CD  1 
ATOM   833  C CE  . LYS A 1 112 ? 21.543  -14.329 -7.343  1.00 49.91  ? 110 LYS A CE  1 
ATOM   834  N NZ  . LYS A 1 112 ? 22.308  -13.066 -7.536  1.00 56.04  ? 110 LYS A NZ  1 
ATOM   835  N N   . VAL A 1 113 ? 16.410  -16.306 -9.697  1.00 30.61  ? 111 VAL A N   1 
ATOM   836  C CA  . VAL A 1 113 ? 15.225  -15.487 -9.494  1.00 28.09  ? 111 VAL A CA  1 
ATOM   837  C C   . VAL A 1 113 ? 14.006  -16.324 -9.086  1.00 28.39  ? 111 VAL A C   1 
ATOM   838  O O   . VAL A 1 113 ? 13.285  -15.983 -8.147  1.00 26.80  ? 111 VAL A O   1 
ATOM   839  C CB  . VAL A 1 113 ? 14.893  -14.682 -10.767 1.00 28.66  ? 111 VAL A CB  1 
ATOM   840  C CG1 . VAL A 1 113 ? 13.442  -14.202 -10.742 1.00 21.73  ? 111 VAL A CG1 1 
ATOM   841  C CG2 . VAL A 1 113 ? 15.854  -13.514 -10.920 1.00 27.49  ? 111 VAL A CG2 1 
ATOM   842  N N   . LYS A 1 114 ? 13.819  -17.450 -9.760  1.00 23.17  ? 112 LYS A N   1 
ATOM   843  C CA  . LYS A 1 114 ? 12.699  -18.322 -9.470  1.00 24.49  ? 112 LYS A CA  1 
ATOM   844  C C   . LYS A 1 114 ? 12.848  -19.020 -8.109  1.00 25.60  ? 112 LYS A C   1 
ATOM   845  O O   . LYS A 1 114 ? 11.889  -19.118 -7.350  1.00 26.40  ? 112 LYS A O   1 
ATOM   846  C CB  . LYS A 1 114 ? 12.530  -19.346 -10.591 1.00 20.86  ? 112 LYS A CB  1 
ATOM   847  C CG  . LYS A 1 114 ? 12.255  -18.717 -11.938 1.00 19.64  ? 112 LYS A CG  1 
ATOM   848  C CD  . LYS A 1 114 ? 12.083  -19.780 -13.035 1.00 25.01  ? 112 LYS A CD  1 
ATOM   849  C CE  . LYS A 1 114 ? 13.393  -20.500 -13.278 1.00 30.10  ? 112 LYS A CE  1 
ATOM   850  N NZ  . LYS A 1 114 ? 13.346  -21.330 -14.499 1.00 40.19  ? 112 LYS A NZ  1 
ATOM   851  N N   . ASN A 1 115 ? 14.053  -19.470 -7.782  1.00 25.39  ? 113 ASN A N   1 
ATOM   852  C CA  . ASN A 1 115 ? 14.287  -20.081 -6.480  1.00 24.22  ? 113 ASN A CA  1 
ATOM   853  C C   . ASN A 1 115 ? 14.102  -19.050 -5.350  1.00 23.67  ? 113 ASN A C   1 
ATOM   854  O O   . ASN A 1 115 ? 13.582  -19.368 -4.288  1.00 25.41  ? 113 ASN A O   1 
ATOM   855  C CB  . ASN A 1 115 ? 15.687  -20.713 -6.417  1.00 25.91  ? 113 ASN A CB  1 
ATOM   856  C CG  . ASN A 1 115 ? 15.794  -22.038 -7.207  1.00 30.36  ? 113 ASN A CG  1 
ATOM   857  O OD1 . ASN A 1 115 ? 16.876  -22.627 -7.304  1.00 32.34  ? 113 ASN A OD1 1 
ATOM   858  N ND2 . ASN A 1 115 ? 14.713  -22.438 -7.853  1.00 22.81  ? 113 ASN A ND2 1 
ATOM   859  N N   . LYS A 1 116 ? 14.476  -17.800 -5.606  1.00 25.75  ? 114 LYS A N   1 
ATOM   860  C CA  . LYS A 1 116 ? 14.315  -16.743 -4.614  1.00 25.38  ? 114 LYS A CA  1 
ATOM   861  C C   . LYS A 1 116 ? 12.840  -16.524 -4.313  1.00 24.60  ? 114 LYS A C   1 
ATOM   862  O O   . LYS A 1 116 ? 12.430  -16.501 -3.160  1.00 24.38  ? 114 LYS A O   1 
ATOM   863  C CB  . LYS A 1 116 ? 14.960  -15.438 -5.095  1.00 24.30  ? 114 LYS A CB  1 
ATOM   864  C CG  . LYS A 1 116 ? 14.909  -14.302 -4.077  1.00 27.85  ? 114 LYS A CG  1 
ATOM   865  C CD  . LYS A 1 116 ? 15.392  -14.772 -2.705  1.00 40.99  ? 114 LYS A CD  1 
ATOM   866  C CE  . LYS A 1 116 ? 15.758  -13.608 -1.784  1.00 44.71  ? 114 LYS A CE  1 
ATOM   867  N NZ  . LYS A 1 116 ? 16.542  -14.089 -0.609  1.00 48.34  ? 114 LYS A NZ  1 
ATOM   868  N N   . ILE A 1 117 ? 12.036  -16.454 -5.364  1.00 25.04  ? 115 ILE A N   1 
ATOM   869  C CA  . ILE A 1 117 ? 10.599  -16.287 -5.219  1.00 25.51  ? 115 ILE A CA  1 
ATOM   870  C C   . ILE A 1 117 ? 9.960   -17.430 -4.451  1.00 23.72  ? 115 ILE A C   1 
ATOM   871  O O   . ILE A 1 117 ? 9.118   -17.191 -3.594  1.00 24.73  ? 115 ILE A O   1 
ATOM   872  C CB  . ILE A 1 117 ? 9.902   -16.159 -6.600  1.00 24.81  ? 115 ILE A CB  1 
ATOM   873  C CG1 . ILE A 1 117 ? 10.260  -14.814 -7.232  1.00 24.60  ? 115 ILE A CG1 1 
ATOM   874  C CG2 . ILE A 1 117 ? 8.381   -16.309 -6.457  1.00 18.33  ? 115 ILE A CG2 1 
ATOM   875  C CD1 . ILE A 1 117 ? 9.857   -14.684 -8.701  1.00 22.95  ? 115 ILE A CD1 1 
ATOM   876  N N   . LEU A 1 118 ? 10.284  -18.663 -4.836  1.00 24.88  ? 116 LEU A N   1 
ATOM   877  C CA  . LEU A 1 118 ? 9.771   -19.864 -4.160  1.00 29.19  ? 116 LEU A CA  1 
ATOM   878  C C   . LEU A 1 118 ? 10.121  -19.880 -2.677  1.00 28.30  ? 116 LEU A C   1 
ATOM   879  O O   . LEU A 1 118 ? 9.306   -20.250 -1.836  1.00 31.06  ? 116 LEU A O   1 
ATOM   880  C CB  . LEU A 1 118 ? 10.291  -21.144 -4.840  1.00 31.37  ? 116 LEU A CB  1 
ATOM   881  C CG  . LEU A 1 118 ? 9.723   -21.376 -6.244  1.00 32.94  ? 116 LEU A CG  1 
ATOM   882  C CD1 . LEU A 1 118 ? 10.516  -22.424 -7.012  1.00 36.91  ? 116 LEU A CD1 1 
ATOM   883  C CD2 . LEU A 1 118 ? 8.242   -21.755 -6.169  1.00 35.53  ? 116 LEU A CD2 1 
ATOM   884  N N   . GLU A 1 119 ? 11.331  -19.446 -2.367  1.00 30.02  ? 117 GLU A N   1 
ATOM   885  C CA  . GLU A 1 119 ? 11.782  -19.314 -1.000  1.00 28.42  ? 117 GLU A CA  1 
ATOM   886  C C   . GLU A 1 119 ? 10.919  -18.306 -0.235  1.00 31.47  ? 117 GLU A C   1 
ATOM   887  O O   . GLU A 1 119 ? 10.514  -18.548 0.931   1.00 28.53  ? 117 GLU A O   1 
ATOM   888  C CB  . GLU A 1 119 ? 13.228  -18.838 -1.017  1.00 30.06  ? 117 GLU A CB  1 
ATOM   889  C CG  . GLU A 1 119 ? 14.143  -19.592 -0.106  1.00 39.87  ? 117 GLU A CG  1 
ATOM   890  C CD  . GLU A 1 119 ? 14.346  -18.899 1.225   1.00 53.73  ? 117 GLU A CD  1 
ATOM   891  O OE1 . GLU A 1 119 ? 13.794  -19.415 2.232   1.00 65.12  ? 117 GLU A OE1 1 
ATOM   892  O OE2 . GLU A 1 119 ? 15.190  -17.966 1.292   1.00 42.74  ? 117 GLU A OE2 1 
ATOM   893  N N   . LEU A 1 120 ? 10.765  -17.123 -0.830  1.00 23.30  ? 118 LEU A N   1 
ATOM   894  C CA  . LEU A 1 120 ? 9.970   -16.077 -0.219  1.00 22.74  ? 118 LEU A CA  1 
ATOM   895  C C   . LEU A 1 120 ? 8.537   -16.505 0.087   1.00 24.19  ? 118 LEU A C   1 
ATOM   896  O O   . LEU A 1 120 ? 8.069   -16.301 1.209   1.00 25.64  ? 118 LEU A O   1 
ATOM   897  C CB  . LEU A 1 120 ? 9.972   -14.835 -1.089  1.00 19.17  ? 118 LEU A CB  1 
ATOM   898  C CG  . LEU A 1 120 ? 11.299  -14.092 -1.097  1.00 26.45  ? 118 LEU A CG  1 
ATOM   899  C CD1 . LEU A 1 120 ? 11.228  -12.879 -2.052  1.00 26.81  ? 118 LEU A CD1 1 
ATOM   900  C CD2 . LEU A 1 120 ? 11.616  -13.662 0.336   1.00 24.36  ? 118 LEU A CD2 1 
ATOM   901  N N   . LEU A 1 121 ? 7.841   -17.075 -0.908  1.00 22.19  ? 119 LEU A N   1 
ATOM   902  C CA  . LEU A 1 121 ? 6.470   -17.570 -0.705  1.00 26.08  ? 119 LEU A CA  1 
ATOM   903  C C   . LEU A 1 121 ? 6.361   -18.564 0.483   1.00 29.13  ? 119 LEU A C   1 
ATOM   904  O O   . LEU A 1 121 ? 5.506   -18.403 1.360   1.00 30.63  ? 119 LEU A O   1 
ATOM   905  C CB  . LEU A 1 121 ? 5.901   -18.226 -1.972  1.00 21.51  ? 119 LEU A CB  1 
ATOM   906  C CG  . LEU A 1 121 ? 5.709   -17.383 -3.226  1.00 25.05  ? 119 LEU A CG  1 
ATOM   907  C CD1 . LEU A 1 121 ? 5.533   -18.298 -4.426  1.00 23.45  ? 119 LEU A CD1 1 
ATOM   908  C CD2 . LEU A 1 121 ? 4.535   -16.405 -3.096  1.00 20.49  ? 119 LEU A CD2 1 
ATOM   909  N N   . TYR A 1 122 ? 7.235   -19.569 0.504   1.00 27.20  ? 120 TYR A N   1 
ATOM   910  C CA  . TYR A 1 122 ? 7.372   -20.451 1.658   1.00 29.50  ? 120 TYR A CA  1 
ATOM   911  C C   . TYR A 1 122 ? 7.492   -19.701 2.994   1.00 28.88  ? 120 TYR A C   1 
ATOM   912  O O   . TYR A 1 122 ? 6.726   -19.946 3.926   1.00 30.98  ? 120 TYR A O   1 
ATOM   913  C CB  . TYR A 1 122 ? 8.554   -21.412 1.477   1.00 29.74  ? 120 TYR A CB  1 
ATOM   914  C CG  . TYR A 1 122 ? 8.633   -22.418 2.592   1.00 38.19  ? 120 TYR A CG  1 
ATOM   915  C CD1 . TYR A 1 122 ? 7.579   -23.299 2.822   1.00 36.62  ? 120 TYR A CD1 1 
ATOM   916  C CD2 . TYR A 1 122 ? 9.622   -22.317 3.560   1.00 39.26  ? 120 TYR A CD2 1 
ATOM   917  C CE1 . TYR A 1 122 ? 7.554   -24.108 3.944   1.00 42.65  ? 120 TYR A CE1 1 
ATOM   918  C CE2 . TYR A 1 122 ? 9.575   -23.081 4.715   1.00 46.70  ? 120 TYR A CE2 1 
ATOM   919  C CZ  . TYR A 1 122 ? 8.545   -23.981 4.901   1.00 43.28  ? 120 TYR A CZ  1 
ATOM   920  O OH  . TYR A 1 122 ? 8.511   -24.750 6.056   1.00 49.25  ? 120 TYR A OH  1 
ATOM   921  N N   . SER A 1 123 ? 8.492   -18.835 3.099   1.00 25.12  ? 121 SER A N   1 
ATOM   922  C CA  . SER A 1 123 ? 8.703   -18.059 4.302   1.00 28.39  ? 121 SER A CA  1 
ATOM   923  C C   . SER A 1 123 ? 7.434   -17.327 4.750   1.00 28.45  ? 121 SER A C   1 
ATOM   924  O O   . SER A 1 123 ? 7.159   -17.263 5.943   1.00 28.05  ? 121 SER A O   1 
ATOM   925  C CB  . SER A 1 123 ? 9.866   -17.069 4.117   1.00 27.11  ? 121 SER A CB  1 
ATOM   926  O OG  . SER A 1 123 ? 9.446   -15.910 3.403   1.00 32.47  ? 121 SER A OG  1 
ATOM   927  N N   . TRP A 1 124 ? 6.642   -16.840 3.790   1.00 25.89  ? 122 TRP A N   1 
ATOM   928  C CA  . TRP A 1 124 ? 5.361   -16.188 4.083   1.00 25.40  ? 122 TRP A CA  1 
ATOM   929  C C   . TRP A 1 124 ? 4.252   -17.115 4.570   1.00 26.95  ? 122 TRP A C   1 
ATOM   930  O O   . TRP A 1 124 ? 3.500   -16.744 5.467   1.00 29.79  ? 122 TRP A O   1 
ATOM   931  C CB  . TRP A 1 124 ? 4.861   -15.334 2.911   1.00 22.43  ? 122 TRP A CB  1 
ATOM   932  C CG  . TRP A 1 124 ? 5.845   -14.299 2.456   1.00 18.43  ? 122 TRP A CG  1 
ATOM   933  C CD1 . TRP A 1 124 ? 6.810   -13.697 3.215   1.00 19.90  ? 122 TRP A CD1 1 
ATOM   934  C CD2 . TRP A 1 124 ? 5.992   -13.771 1.130   1.00 20.76  ? 122 TRP A CD2 1 
ATOM   935  N NE1 . TRP A 1 124 ? 7.519   -12.802 2.456   1.00 26.51  ? 122 TRP A NE1 1 
ATOM   936  C CE2 . TRP A 1 124 ? 7.077   -12.867 1.158   1.00 25.16  ? 122 TRP A CE2 1 
ATOM   937  C CE3 . TRP A 1 124 ? 5.324   -13.986 -0.085  1.00 21.74  ? 122 TRP A CE3 1 
ATOM   938  C CZ2 . TRP A 1 124 ? 7.468   -12.127 0.030   1.00 21.15  ? 122 TRP A CZ2 1 
ATOM   939  C CZ3 . TRP A 1 124 ? 5.769   -13.318 -1.219  1.00 21.30  ? 122 TRP A CZ3 1 
ATOM   940  C CH2 . TRP A 1 124 ? 6.797   -12.364 -1.144  1.00 19.81  ? 122 TRP A CH2 1 
ATOM   941  N N   . THR A 1 125 ? 4.106   -18.290 3.965   1.00 26.74  ? 123 THR A N   1 
ATOM   942  C CA  . THR A 1 125 ? 3.076   -19.237 4.430   1.00 30.00  ? 123 THR A CA  1 
ATOM   943  C C   . THR A 1 125 ? 3.269   -19.597 5.903   1.00 30.60  ? 123 THR A C   1 
ATOM   944  O O   . THR A 1 125 ? 2.380   -20.154 6.537   1.00 33.98  ? 123 THR A O   1 
ATOM   945  C CB  . THR A 1 125 ? 3.046   -20.541 3.601   1.00 29.24  ? 123 THR A CB  1 
ATOM   946  O OG1 . THR A 1 125 ? 4.200   -21.326 3.918   1.00 35.99  ? 123 THR A OG1 1 
ATOM   947  C CG2 . THR A 1 125 ? 3.044   -20.228 2.103   1.00 27.00  ? 123 THR A CG2 1 
ATOM   948  N N   . VAL A 1 126 ? 4.448   -19.302 6.427   1.00 34.54  ? 124 VAL A N   1 
ATOM   949  C CA  . VAL A 1 126 ? 4.815   -19.677 7.791   1.00 36.62  ? 124 VAL A CA  1 
ATOM   950  C C   . VAL A 1 126 ? 4.716   -18.446 8.707   1.00 36.31  ? 124 VAL A C   1 
ATOM   951  O O   . VAL A 1 126 ? 4.124   -18.511 9.772   1.00 38.78  ? 124 VAL A O   1 
ATOM   952  C CB  . VAL A 1 126 ? 6.273   -20.212 7.841   1.00 40.34  ? 124 VAL A CB  1 
ATOM   953  C CG1 . VAL A 1 126 ? 6.728   -20.425 9.294   1.00 43.40  ? 124 VAL A CG1 1 
ATOM   954  C CG2 . VAL A 1 126 ? 6.419   -21.483 7.012   1.00 38.88  ? 124 VAL A CG2 1 
ATOM   955  N N   . GLY A 1 127 ? 5.245   -17.312 8.254   1.00 28.24  ? 125 GLY A N   1 
ATOM   956  C CA  . GLY A 1 127 ? 5.286   -16.108 9.075   1.00 27.17  ? 125 GLY A CA  1 
ATOM   957  C C   . GLY A 1 127 ? 3.988   -15.324 9.022   1.00 31.36  ? 125 GLY A C   1 
ATOM   958  O O   . GLY A 1 127 ? 3.718   -14.504 9.903   1.00 33.62  ? 125 GLY A O   1 
ATOM   959  N N   . LEU A 1 128 ? 3.219   -15.520 7.952   1.00 29.58  ? 126 LEU A N   1 
ATOM   960  C CA  . LEU A 1 128 ? 1.949   -14.818 7.767   1.00 30.44  ? 126 LEU A CA  1 
ATOM   961  C C   . LEU A 1 128 ? 0.808   -15.771 7.409   1.00 31.89  ? 126 LEU A C   1 
ATOM   962  O O   . LEU A 1 128 ? 0.271   -15.723 6.291   1.00 31.26  ? 126 LEU A O   1 
ATOM   963  C CB  . LEU A 1 128 ? 2.079   -13.725 6.698   1.00 30.01  ? 126 LEU A CB  1 
ATOM   964  C CG  . LEU A 1 128 ? 3.226   -12.728 6.874   1.00 31.55  ? 126 LEU A CG  1 
ATOM   965  C CD1 . LEU A 1 128 ? 3.393   -11.930 5.609   1.00 27.68  ? 126 LEU A CD1 1 
ATOM   966  C CD2 . LEU A 1 128 ? 3.004   -11.806 8.098   1.00 33.44  ? 126 LEU A CD2 1 
ATOM   967  N N   . PRO A 1 129 ? 0.412   -16.619 8.370   1.00 33.35  ? 127 PRO A N   1 
ATOM   968  C CA  . PRO A 1 129 ? -0.558  -17.686 8.122   1.00 34.92  ? 127 PRO A CA  1 
ATOM   969  C C   . PRO A 1 129 ? -1.967  -17.177 7.804   1.00 36.70  ? 127 PRO A C   1 
ATOM   970  O O   . PRO A 1 129 ? -2.733  -17.865 7.119   1.00 37.08  ? 127 PRO A O   1 
ATOM   971  C CB  . PRO A 1 129 ? -0.559  -18.475 9.434   1.00 37.30  ? 127 PRO A CB  1 
ATOM   972  C CG  . PRO A 1 129 ? 0.011   -17.546 10.456  1.00 35.22  ? 127 PRO A CG  1 
ATOM   973  C CD  . PRO A 1 129 ? 0.981   -16.686 9.729   1.00 32.97  ? 127 PRO A CD  1 
ATOM   974  N N   . GLU A 1 130 ? -2.294  -15.970 8.260   1.00 38.20  ? 128 GLU A N   1 
ATOM   975  C CA  . GLU A 1 130 ? -3.609  -15.400 7.982   1.00 40.42  ? 128 GLU A CA  1 
ATOM   976  C C   . GLU A 1 130 ? -3.800  -15.024 6.510   1.00 37.58  ? 128 GLU A C   1 
ATOM   977  O O   . GLU A 1 130 ? -4.920  -14.759 6.088   1.00 39.57  ? 128 GLU A O   1 
ATOM   978  C CB  . GLU A 1 130 ? -3.877  -14.176 8.860   1.00 41.13  ? 128 GLU A CB  1 
ATOM   979  C CG  . GLU A 1 130 ? -2.814  -13.917 9.900   1.00 54.30  ? 128 GLU A CG  1 
ATOM   980  C CD  . GLU A 1 130 ? -1.591  -13.233 9.336   1.00 47.65  ? 128 GLU A CD  1 
ATOM   981  O OE1 . GLU A 1 130 ? -0.479  -13.613 9.734   1.00 38.07  ? 128 GLU A OE1 1 
ATOM   982  O OE2 . GLU A 1 130 ? -1.746  -12.257 8.577   1.00 58.91  ? 128 GLU A OE2 1 
ATOM   983  N N   . GLU A 1 131 ? -2.699  -14.833 5.788   1.00 33.42  ? 129 GLU A N   1 
ATOM   984  C CA  . GLU A 1 131 ? -2.760  -14.464 4.378   1.00 30.23  ? 129 GLU A CA  1 
ATOM   985  C C   . GLU A 1 131 ? -2.938  -15.729 3.563   1.00 30.25  ? 129 GLU A C   1 
ATOM   986  O O   . GLU A 1 131 ? -1.976  -16.299 3.052   1.00 27.01  ? 129 GLU A O   1 
ATOM   987  C CB  . GLU A 1 131 ? -1.490  -13.738 3.939   1.00 26.07  ? 129 GLU A CB  1 
ATOM   988  C CG  . GLU A 1 131 ? -1.177  -12.459 4.718   1.00 28.45  ? 129 GLU A CG  1 
ATOM   989  C CD  . GLU A 1 131 ? -2.111  -11.319 4.363   1.00 36.04  ? 129 GLU A CD  1 
ATOM   990  O OE1 . GLU A 1 131 ? -2.096  -10.278 5.065   1.00 34.63  ? 129 GLU A OE1 1 
ATOM   991  O OE2 . GLU A 1 131 ? -2.891  -11.478 3.400   1.00 32.67  ? 129 GLU A OE2 1 
ATOM   992  N N   . VAL A 1 132 ? -4.149  -16.263 3.617   1.00 31.48  ? 130 VAL A N   1 
ATOM   993  C CA  . VAL A 1 132 ? -4.414  -17.617 3.150   1.00 31.14  ? 130 VAL A CA  1 
ATOM   994  C C   . VAL A 1 132 ? -4.215  -17.810 1.632   1.00 32.26  ? 130 VAL A C   1 
ATOM   995  O O   . VAL A 1 132 ? -3.947  -18.928 1.182   1.00 31.30  ? 130 VAL A O   1 
ATOM   996  C CB  . VAL A 1 132 ? -5.814  -18.083 3.591   1.00 30.15  ? 130 VAL A CB  1 
ATOM   997  C CG1 . VAL A 1 132 ? -5.910  -18.048 5.099   1.00 27.62  ? 130 VAL A CG1 1 
ATOM   998  C CG2 . VAL A 1 132 ? -6.880  -17.200 2.977   1.00 26.95  ? 130 VAL A CG2 1 
ATOM   999  N N   . LYS A 1 133 ? -4.216  -16.704 0.881   1.00 31.92  ? 131 LYS A N   1 
ATOM   1000 C CA  . LYS A 1 133 ? -4.049  -16.738 -0.575  1.00 31.40  ? 131 LYS A CA  1 
ATOM   1001 C C   . LYS A 1 133 ? -2.606  -17.006 -0.989  1.00 30.32  ? 131 LYS A C   1 
ATOM   1002 O O   . LYS A 1 133 ? -2.355  -17.725 -1.964  1.00 28.82  ? 131 LYS A O   1 
ATOM   1003 C CB  . LYS A 1 133 ? -4.534  -15.436 -1.221  1.00 32.94  ? 131 LYS A CB  1 
ATOM   1004 C CG  . LYS A 1 133 ? -6.013  -15.154 -1.035  1.00 32.44  ? 131 LYS A CG  1 
ATOM   1005 C CD  . LYS A 1 133 ? -6.430  -13.946 -1.842  1.00 34.32  ? 131 LYS A CD  1 
ATOM   1006 C CE  . LYS A 1 133 ? -7.935  -13.777 -1.854  1.00 33.07  ? 131 LYS A CE  1 
ATOM   1007 N NZ  . LYS A 1 133 ? -8.344  -12.565 -2.627  1.00 36.55  ? 131 LYS A NZ  1 
ATOM   1008 N N   . ILE A 1 134 ? -1.657  -16.485 -0.215  1.00 30.91  ? 132 ILE A N   1 
ATOM   1009 C CA  . ILE A 1 134 ? -0.261  -16.864 -0.394  1.00 30.57  ? 132 ILE A CA  1 
ATOM   1010 C C   . ILE A 1 134 ? -0.071  -18.380 -0.259  1.00 32.38  ? 132 ILE A C   1 
ATOM   1011 O O   . ILE A 1 134 ? 0.665   -18.988 -1.035  1.00 31.15  ? 132 ILE A O   1 
ATOM   1012 C CB  . ILE A 1 134 ? 0.687   -16.125 0.579   1.00 31.78  ? 132 ILE A CB  1 
ATOM   1013 C CG1 . ILE A 1 134 ? 0.393   -14.615 0.594   1.00 28.36  ? 132 ILE A CG1 1 
ATOM   1014 C CG2 . ILE A 1 134 ? 2.145   -16.402 0.206   1.00 26.72  ? 132 ILE A CG2 1 
ATOM   1015 C CD1 . ILE A 1 134 ? 1.314   -13.786 1.536   1.00 20.47  ? 132 ILE A CD1 1 
ATOM   1016 N N   . ALA A 1 135 ? -0.689  -18.973 0.763   1.00 30.03  ? 133 ALA A N   1 
ATOM   1017 C CA  . ALA A 1 135 ? -0.632  -20.419 0.951   1.00 31.56  ? 133 ALA A CA  1 
ATOM   1018 C C   . ALA A 1 135 ? -1.330  -21.182 -0.192  1.00 32.52  ? 133 ALA A C   1 
ATOM   1019 O O   . ALA A 1 135 ? -0.870  -22.246 -0.611  1.00 30.69  ? 133 ALA A O   1 
ATOM   1020 C CB  . ALA A 1 135 ? -1.219  -20.812 2.319   1.00 31.16  ? 133 ALA A CB  1 
ATOM   1021 N N   . GLU A 1 136 ? -2.404  -20.601 -0.724  1.00 33.20  ? 134 GLU A N   1 
ATOM   1022 C CA  . GLU A 1 136 ? -3.111  -21.181 -1.857  1.00 34.21  ? 134 GLU A CA  1 
ATOM   1023 C C   . GLU A 1 136 ? -2.199  -21.210 -3.074  1.00 34.40  ? 134 GLU A C   1 
ATOM   1024 O O   . GLU A 1 136 ? -2.055  -22.245 -3.736  1.00 36.25  ? 134 GLU A O   1 
ATOM   1025 C CB  . GLU A 1 136 ? -4.369  -20.367 -2.163  1.00 34.12  ? 134 GLU A CB  1 
ATOM   1026 C CG  . GLU A 1 136 ? -5.598  -21.184 -2.380  1.00 35.83  ? 134 GLU A CG  1 
ATOM   1027 C CD  . GLU A 1 136 ? -6.789  -20.352 -2.809  1.00 44.93  ? 134 GLU A CD  1 
ATOM   1028 O OE1 . GLU A 1 136 ? -7.335  -19.592 -1.966  1.00 40.36  ? 134 GLU A OE1 1 
ATOM   1029 O OE2 . GLU A 1 136 ? -7.280  -20.592 -3.936  1.00 42.12  ? 134 GLU A OE2 1 
ATOM   1030 N N   . ALA A 1 137 ? -1.546  -20.081 -3.332  1.00 30.41  ? 135 ALA A N   1 
ATOM   1031 C CA  . ALA A 1 137 ? -0.621  -19.941 -4.456  1.00 30.03  ? 135 ALA A CA  1 
ATOM   1032 C C   . ALA A 1 137 ? 0.587   -20.872 -4.345  1.00 31.00  ? 135 ALA A C   1 
ATOM   1033 O O   . ALA A 1 137 ? 0.930   -21.560 -5.302  1.00 31.38  ? 135 ALA A O   1 
ATOM   1034 C CB  . ALA A 1 137 ? -0.164  -18.492 -4.591  1.00 26.51  ? 135 ALA A CB  1 
ATOM   1035 N N   . TYR A 1 138 ? 1.118   -21.011 -3.133  1.00 37.33  ? 136 TYR A N   1 
ATOM   1036 C CA  . TYR A 1 138 ? 2.211   -21.951 -2.852  1.00 37.08  ? 136 TYR A CA  1 
ATOM   1037 C C   . TYR A 1 138 ? 1.832   -23.429 -3.020  1.00 37.59  ? 136 TYR A C   1 
ATOM   1038 O O   . TYR A 1 138 ? 2.512   -24.173 -3.730  1.00 35.69  ? 136 TYR A O   1 
ATOM   1039 C CB  . TYR A 1 138 ? 2.792   -21.707 -1.453  1.00 35.11  ? 136 TYR A CB  1 
ATOM   1040 C CG  . TYR A 1 138 ? 4.060   -22.484 -1.181  1.00 36.77  ? 136 TYR A CG  1 
ATOM   1041 C CD1 . TYR A 1 138 ? 5.282   -22.055 -1.679  1.00 33.11  ? 136 TYR A CD1 1 
ATOM   1042 C CD2 . TYR A 1 138 ? 4.040   -23.636 -0.403  1.00 38.18  ? 136 TYR A CD2 1 
ATOM   1043 C CE1 . TYR A 1 138 ? 6.445   -22.756 -1.419  1.00 30.36  ? 136 TYR A CE1 1 
ATOM   1044 C CE2 . TYR A 1 138 ? 5.190   -24.364 -0.181  1.00 33.26  ? 136 TYR A CE2 1 
ATOM   1045 C CZ  . TYR A 1 138 ? 6.391   -23.919 -0.696  1.00 31.76  ? 136 TYR A CZ  1 
ATOM   1046 O OH  . TYR A 1 138 ? 7.543   -24.635 -0.470  1.00 36.09  ? 136 TYR A OH  1 
ATOM   1047 N N   . GLN A 1 139 ? 0.759   -23.864 -2.364  1.00 36.94  ? 137 GLN A N   1 
ATOM   1048 C CA  . GLN A 1 139 ? 0.272   -25.228 -2.580  1.00 40.43  ? 137 GLN A CA  1 
ATOM   1049 C C   . GLN A 1 139 ? -0.085  -25.547 -4.038  1.00 41.69  ? 137 GLN A C   1 
ATOM   1050 O O   . GLN A 1 139 ? 0.207   -26.641 -4.518  1.00 42.68  ? 137 GLN A O   1 
ATOM   1051 C CB  . GLN A 1 139 ? -0.834  -25.622 -1.591  1.00 42.15  ? 137 GLN A CB  1 
ATOM   1052 C CG  . GLN A 1 139 ? -2.067  -26.302 -2.199  1.00 47.63  ? 137 GLN A CG  1 
ATOM   1053 C CD  . GLN A 1 139 ? -1.891  -27.801 -2.499  1.00 58.52  ? 137 GLN A CD  1 
ATOM   1054 O OE1 . GLN A 1 139 ? -0.832  -28.395 -2.250  1.00 54.02  ? 137 GLN A OE1 1 
ATOM   1055 N NE2 . GLN A 1 139 ? -2.930  -28.403 -3.089  1.00 57.75  ? 137 GLN A NE2 1 
ATOM   1056 N N   . MET A 1 140 ? -0.541  -24.554 -4.795  1.00 39.62  ? 138 MET A N   1 
ATOM   1057 C CA  . MET A 1 140 ? -0.798  -24.807 -6.214  1.00 41.93  ? 138 MET A CA  1 
ATOM   1058 C C   . MET A 1 140 ? 0.499   -25.086 -6.992  1.00 41.18  ? 138 MET A C   1 
ATOM   1059 O O   . MET A 1 140 ? 0.573   -26.051 -7.751  1.00 44.25  ? 138 MET A O   1 
ATOM   1060 C CB  . MET A 1 140 ? -1.586  -23.672 -6.867  1.00 40.59  ? 138 MET A CB  1 
ATOM   1061 C CG  . MET A 1 140 ? -1.867  -23.921 -8.331  1.00 38.88  ? 138 MET A CG  1 
ATOM   1062 S SD  . MET A 1 140 ? -1.839  -22.461 -9.369  1.00 40.92  ? 138 MET A SD  1 
ATOM   1063 C CE  . MET A 1 140 ? -0.128  -21.941 -9.248  1.00 30.36  ? 138 MET A CE  1 
ATOM   1064 N N   . LEU A 1 141 ? 1.539   -24.306 -6.720  1.00 33.39  ? 139 LEU A N   1 
ATOM   1065 C CA  . LEU A 1 141 ? 2.842   -24.511 -7.343  1.00 34.31  ? 139 LEU A CA  1 
ATOM   1066 C C   . LEU A 1 141 ? 3.465   -25.838 -6.921  1.00 36.10  ? 139 LEU A C   1 
ATOM   1067 O O   . LEU A 1 141 ? 4.035   -26.550 -7.742  1.00 40.21  ? 139 LEU A O   1 
ATOM   1068 C CB  . LEU A 1 141 ? 3.797   -23.362 -7.007  1.00 32.60  ? 139 LEU A CB  1 
ATOM   1069 C CG  . LEU A 1 141 ? 3.495   -21.963 -7.550  1.00 28.57  ? 139 LEU A CG  1 
ATOM   1070 C CD1 . LEU A 1 141 ? 4.333   -20.913 -6.795  1.00 30.23  ? 139 LEU A CD1 1 
ATOM   1071 C CD2 . LEU A 1 141 ? 3.771   -21.888 -9.045  1.00 22.12  ? 139 LEU A CD2 1 
ATOM   1072 N N   . LYS A 1 142 ? 3.319   -26.188 -5.650  1.00 36.90  ? 140 LYS A N   1 
ATOM   1073 C CA  . LYS A 1 142 ? 3.747   -27.493 -5.161  1.00 37.39  ? 140 LYS A CA  1 
ATOM   1074 C C   . LYS A 1 142 ? 3.035   -28.662 -5.860  1.00 40.01  ? 140 LYS A C   1 
ATOM   1075 O O   . LYS A 1 142 ? 3.685   -29.593 -6.335  1.00 40.16  ? 140 LYS A O   1 
ATOM   1076 C CB  . LYS A 1 142 ? 3.557   -27.577 -3.646  1.00 36.75  ? 140 LYS A CB  1 
ATOM   1077 C CG  . LYS A 1 142 ? 4.358   -28.677 -2.983  1.00 42.54  ? 140 LYS A CG  1 
ATOM   1078 C CD  . LYS A 1 142 ? 3.661   -29.178 -1.739  1.00 47.26  ? 140 LYS A CD  1 
ATOM   1079 C CE  . LYS A 1 142 ? 4.343   -28.667 -0.479  1.00 54.35  ? 140 LYS A CE  1 
ATOM   1080 N NZ  . LYS A 1 142 ? 5.407   -29.606 -0.030  1.00 55.10  ? 140 LYS A NZ  1 
ATOM   1081 N N   . LYS A 1 143 ? 1.703   -28.618 -5.908  1.00 39.52  ? 141 LYS A N   1 
ATOM   1082 C CA  . LYS A 1 143 ? 0.931   -29.657 -6.568  1.00 41.04  ? 141 LYS A CA  1 
ATOM   1083 C C   . LYS A 1 143 ? 1.323   -29.869 -8.033  1.00 43.38  ? 141 LYS A C   1 
ATOM   1084 O O   . LYS A 1 143 ? 1.267   -30.992 -8.529  1.00 45.90  ? 141 LYS A O   1 
ATOM   1085 C CB  . LYS A 1 143 ? -0.569  -29.390 -6.445  1.00 41.40  ? 141 LYS A CB  1 
ATOM   1086 C CG  . LYS A 1 143 ? -1.383  -30.651 -6.362  1.00 39.30  ? 141 LYS A CG  1 
ATOM   1087 C CD  . LYS A 1 143 ? -2.787  -30.385 -5.908  1.00 40.47  ? 141 LYS A CD  1 
ATOM   1088 C CE  . LYS A 1 143 ? -3.619  -31.635 -6.031  1.00 36.92  ? 141 LYS A CE  1 
ATOM   1089 N NZ  . LYS A 1 143 ? -5.045  -31.318 -6.252  1.00 37.41  ? 141 LYS A NZ  1 
ATOM   1090 N N   . GLN A 1 144 ? 1.770   -28.805 -8.698  1.00 48.36  ? 142 GLN A N   1 
ATOM   1091 C CA  . GLN A 1 144 ? 2.284   -28.886 -10.071 1.00 51.04  ? 142 GLN A CA  1 
ATOM   1092 C C   . GLN A 1 144 ? 3.747   -29.340 -10.126 1.00 50.24  ? 142 GLN A C   1 
ATOM   1093 O O   . GLN A 1 144 ? 4.305   -29.506 -11.206 1.00 48.23  ? 142 GLN A O   1 
ATOM   1094 C CB  . GLN A 1 144 ? 2.137   -27.531 -10.795 1.00 49.67  ? 142 GLN A CB  1 
ATOM   1095 C CG  . GLN A 1 144 ? 0.690   -27.064 -10.967 1.00 49.65  ? 142 GLN A CG  1 
ATOM   1096 C CD  . GLN A 1 144 ? 0.586   -25.596 -11.362 1.00 50.22  ? 142 GLN A CD  1 
ATOM   1097 O OE1 . GLN A 1 144 ? 1.502   -24.803 -11.112 1.00 38.89  ? 142 GLN A OE1 1 
ATOM   1098 N NE2 . GLN A 1 144 ? -0.529  -25.231 -11.994 1.00 53.86  ? 142 GLN A NE2 1 
ATOM   1099 N N   . GLY A 1 145 ? 4.388   -29.441 -8.965  1.00 46.64  ? 143 GLY A N   1 
ATOM   1100 C CA  . GLY A 1 145 ? 5.776   -29.885 -8.912  1.00 49.52  ? 143 GLY A CA  1 
ATOM   1101 C C   . GLY A 1 145 ? 6.767   -28.799 -9.284  1.00 50.89  ? 143 GLY A C   1 
ATOM   1102 O O   . GLY A 1 145 ? 7.934   -29.083 -9.579  1.00 51.44  ? 143 GLY A O   1 
ATOM   1103 N N   . ILE A 1 146 ? 6.305   -27.550 -9.264  1.00 44.94  ? 144 ILE A N   1 
ATOM   1104 C CA  . ILE A 1 146 ? 7.191   -26.408 -9.362  1.00 44.03  ? 144 ILE A CA  1 
ATOM   1105 C C   . ILE A 1 146 ? 7.935   -26.198 -8.046  1.00 45.11  ? 144 ILE A C   1 
ATOM   1106 O O   . ILE A 1 146 ? 9.163   -26.246 -8.000  1.00 43.83  ? 144 ILE A O   1 
ATOM   1107 C CB  . ILE A 1 146 ? 6.419   -25.131 -9.770  1.00 42.66  ? 144 ILE A CB  1 
ATOM   1108 C CG1 . ILE A 1 146 ? 5.813   -25.308 -11.168 1.00 42.88  ? 144 ILE A CG1 1 
ATOM   1109 C CG2 . ILE A 1 146 ? 7.325   -23.909 -9.721  1.00 37.46  ? 144 ILE A CG2 1 
ATOM   1110 C CD1 . ILE A 1 146 ? 5.113   -24.069 -11.709 1.00 37.49  ? 144 ILE A CD1 1 
ATOM   1111 N N   . VAL A 1 147 ? 7.186   -26.043 -6.962  1.00 55.76  ? 145 VAL A N   1 
ATOM   1112 C CA  . VAL A 1 147 ? 7.728   -26.287 -5.619  1.00 57.58  ? 145 VAL A CA  1 
ATOM   1113 C C   . VAL A 1 147 ? 8.149   -27.754 -5.450  1.00 61.92  ? 145 VAL A C   1 
ATOM   1114 O O   . VAL A 1 147 ? 7.298   -28.647 -5.442  1.00 63.97  ? 145 VAL A O   1 
ATOM   1115 C CB  . VAL A 1 147 ? 6.714   -25.878 -4.508  1.00 54.62  ? 145 VAL A CB  1 
ATOM   1116 C CG1 . VAL A 1 147 ? 7.136   -26.434 -3.147  1.00 52.06  ? 145 VAL A CG1 1 
ATOM   1117 C CG2 . VAL A 1 147 ? 6.583   -24.369 -4.456  1.00 48.54  ? 145 VAL A CG2 1 
ATOM   1118 N N   . LYS A 1 148 ? 9.446   -28.020 -5.473  1.00 95.55  ? 146 LYS A N   1 
ATOM   1119 C CA  . LYS A 1 148 ? 10.371  -27.212 -6.272  1.00 94.70  ? 146 LYS A CA  1 
ATOM   1120 C C   . LYS A 1 148 ? 10.893  -27.885 -7.533  1.00 95.82  ? 146 LYS A C   1 
ATOM   1121 O O   . LYS A 1 148 ? 11.320  -29.035 -7.511  1.00 135.78 ? 146 LYS A O   1 
ATOM   1122 C CB  . LYS A 1 148 ? 11.529  -26.692 -5.409  1.00 94.53  ? 146 LYS A CB  1 
ATOM   1123 C CG  . LYS A 1 148 ? 11.133  -26.357 -4.006  1.00 94.13  ? 146 LYS A CG  1 
ATOM   1124 C CD  . LYS A 1 148 ? 11.436  -24.939 -3.702  1.00 92.58  ? 146 LYS A CD  1 
ATOM   1125 C CE  . LYS A 1 148 ? 10.444  -24.360 -2.767  1.00 91.78  ? 146 LYS A CE  1 
ATOM   1126 N NZ  . LYS A 1 148 ? 11.021  -23.645 -1.614  1.00 91.56  ? 146 LYS A NZ  1 
ATOM   1127 N N   . PRO B 1 9   ? 31.767  -0.796  -27.642 1.00 110.12 ? 7   PRO B N   1 
ATOM   1128 C CA  . PRO B 1 9   ? 30.566  -0.006  -27.378 1.00 105.97 ? 7   PRO B CA  1 
ATOM   1129 C C   . PRO B 1 9   ? 29.775  -0.590  -26.210 1.00 102.64 ? 7   PRO B C   1 
ATOM   1130 O O   . PRO B 1 9   ? 30.331  -1.348  -25.410 1.00 105.07 ? 7   PRO B O   1 
ATOM   1131 C CB  . PRO B 1 9   ? 29.769  -0.127  -28.685 1.00 105.68 ? 7   PRO B CB  1 
ATOM   1132 C CG  . PRO B 1 9   ? 30.300  -1.359  -29.352 1.00 107.80 ? 7   PRO B CG  1 
ATOM   1133 C CD  . PRO B 1 9   ? 31.753  -1.394  -28.987 1.00 112.18 ? 7   PRO B CD  1 
ATOM   1134 N N   . GLU B 1 10  ? 28.511  -0.196  -26.075 1.00 83.29  ? 8   GLU B N   1 
ATOM   1135 C CA  . GLU B 1 10  ? 27.747  -0.519  -24.872 1.00 78.06  ? 8   GLU B CA  1 
ATOM   1136 C C   . GLU B 1 10  ? 26.584  -1.456  -25.159 1.00 72.55  ? 8   GLU B C   1 
ATOM   1137 O O   . GLU B 1 10  ? 25.982  -1.404  -26.238 1.00 71.51  ? 8   GLU B O   1 
ATOM   1138 C CB  . GLU B 1 10  ? 27.230  0.747   -24.194 1.00 77.66  ? 8   GLU B CB  1 
ATOM   1139 C CG  . GLU B 1 10  ? 27.300  0.709   -22.691 1.00 81.45  ? 8   GLU B CG  1 
ATOM   1140 C CD  . GLU B 1 10  ? 27.194  2.092   -22.094 1.00 92.78  ? 8   GLU B CD  1 
ATOM   1141 O OE1 . GLU B 1 10  ? 26.908  3.032   -22.869 1.00 96.87  ? 8   GLU B OE1 1 
ATOM   1142 O OE2 . GLU B 1 10  ? 27.510  2.258   -20.891 1.00 92.03  ? 8   GLU B OE2 1 
ATOM   1143 N N   . THR B 1 11  ? 26.166  -2.180  -24.122 1.00 50.23  ? 9   THR B N   1 
ATOM   1144 C CA  . THR B 1 11  ? 25.159  -3.221  -24.257 1.00 42.08  ? 9   THR B CA  1 
ATOM   1145 C C   . THR B 1 11  ? 23.791  -2.618  -24.536 1.00 38.07  ? 9   THR B C   1 
ATOM   1146 O O   . THR B 1 11  ? 23.524  -1.466  -24.187 1.00 35.99  ? 9   THR B O   1 
ATOM   1147 C CB  . THR B 1 11  ? 25.080  -4.092  -22.987 1.00 44.62  ? 9   THR B CB  1 
ATOM   1148 O OG1 . THR B 1 11  ? 24.553  -3.317  -21.899 1.00 41.02  ? 9   THR B OG1 1 
ATOM   1149 C CG2 . THR B 1 11  ? 26.458  -4.629  -22.609 1.00 45.25  ? 9   THR B CG2 1 
ATOM   1150 N N   . LEU B 1 12  ? 22.914  -3.408  -25.144 1.00 38.28  ? 10  LEU B N   1 
ATOM   1151 C CA  . LEU B 1 12  ? 21.556  -2.963  -25.427 1.00 35.76  ? 10  LEU B CA  1 
ATOM   1152 C C   . LEU B 1 12  ? 20.848  -2.557  -24.118 1.00 33.49  ? 10  LEU B C   1 
ATOM   1153 O O   . LEU B 1 12  ? 20.059  -1.617  -24.098 1.00 28.45  ? 10  LEU B O   1 
ATOM   1154 C CB  . LEU B 1 12  ? 20.778  -4.090  -26.121 1.00 37.28  ? 10  LEU B CB  1 
ATOM   1155 C CG  . LEU B 1 12  ? 20.467  -4.040  -27.621 1.00 39.18  ? 10  LEU B CG  1 
ATOM   1156 C CD1 . LEU B 1 12  ? 21.387  -3.115  -28.392 1.00 42.86  ? 10  LEU B CD1 1 
ATOM   1157 C CD2 . LEU B 1 12  ? 20.443  -5.427  -28.238 1.00 39.10  ? 10  LEU B CD2 1 
ATOM   1158 N N   . GLU B 1 13  ? 21.148  -3.279  -23.036 1.00 33.07  ? 11  GLU B N   1 
ATOM   1159 C CA  . GLU B 1 13  ? 20.582  -3.008  -21.713 1.00 30.88  ? 11  GLU B CA  1 
ATOM   1160 C C   . GLU B 1 13  ? 20.893  -1.594  -21.250 1.00 31.61  ? 11  GLU B C   1 
ATOM   1161 O O   . GLU B 1 13  ? 19.983  -0.820  -20.967 1.00 31.18  ? 11  GLU B O   1 
ATOM   1162 C CB  . GLU B 1 13  ? 21.121  -4.015  -20.684 1.00 33.32  ? 11  GLU B CB  1 
ATOM   1163 C CG  . GLU B 1 13  ? 20.427  -5.370  -20.730 1.00 31.89  ? 11  GLU B CG  1 
ATOM   1164 C CD  . GLU B 1 13  ? 21.116  -6.342  -21.660 1.00 38.62  ? 11  GLU B CD  1 
ATOM   1165 O OE1 . GLU B 1 13  ? 20.702  -7.515  -21.704 1.00 44.20  ? 11  GLU B OE1 1 
ATOM   1166 O OE2 . GLU B 1 13  ? 22.088  -5.941  -22.333 1.00 40.34  ? 11  GLU B OE2 1 
ATOM   1167 N N   . ALA B 1 14  ? 22.174  -1.237  -21.261 1.00 35.38  ? 12  ALA B N   1 
ATOM   1168 C CA  . ALA B 1 14  ? 22.606  0.105   -20.874 1.00 37.39  ? 12  ALA B CA  1 
ATOM   1169 C C   . ALA B 1 14  ? 22.044  1.195   -21.778 1.00 37.83  ? 12  ALA B C   1 
ATOM   1170 O O   . ALA B 1 14  ? 21.586  2.224   -21.284 1.00 40.31  ? 12  ALA B O   1 
ATOM   1171 C CB  . ALA B 1 14  ? 24.134  0.189   -20.804 1.00 39.02  ? 12  ALA B CB  1 
ATOM   1172 N N   . ARG B 1 15  ? 21.952  0.916   -23.078 1.00 33.78  ? 13  ARG B N   1 
ATOM   1173 C CA  . ARG B 1 15  ? 21.345  1.861   -24.013 1.00 33.92  ? 13  ARG B CA  1 
ATOM   1174 C C   . ARG B 1 15  ? 19.858  2.094   -23.763 1.00 31.40  ? 13  ARG B C   1 
ATOM   1175 O O   . ARG B 1 15  ? 19.423  3.243   -23.701 1.00 30.81  ? 13  ARG B O   1 
ATOM   1176 C CB  . ARG B 1 15  ? 21.606  1.459   -25.476 1.00 34.30  ? 13  ARG B CB  1 
ATOM   1177 C CG  . ARG B 1 15  ? 22.959  0.800   -25.705 1.00 41.67  ? 13  ARG B CG  1 
ATOM   1178 C CD  . ARG B 1 15  ? 23.346  0.756   -27.178 1.00 47.66  ? 13  ARG B CD  1 
ATOM   1179 N NE  . ARG B 1 15  ? 23.688  2.091   -27.648 1.00 56.07  ? 13  ARG B NE  1 
ATOM   1180 C CZ  . ARG B 1 15  ? 24.908  2.481   -27.997 1.00 54.03  ? 13  ARG B CZ  1 
ATOM   1181 N NH1 . ARG B 1 15  ? 25.120  3.754   -28.292 1.00 53.20  ? 13  ARG B NH1 1 
ATOM   1182 N NH2 . ARG B 1 15  ? 25.887  1.595   -28.135 1.00 51.44  ? 13  ARG B NH2 1 
ATOM   1183 N N   . ILE B 1 16  ? 19.083  1.013   -23.624 1.00 29.88  ? 14  ILE B N   1 
ATOM   1184 C CA  . ILE B 1 16  ? 17.618  1.113   -23.429 1.00 25.80  ? 14  ILE B CA  1 
ATOM   1185 C C   . ILE B 1 16  ? 17.274  1.753   -22.075 1.00 25.43  ? 14  ILE B C   1 
ATOM   1186 O O   . ILE B 1 16  ? 16.294  2.496   -21.950 1.00 25.15  ? 14  ILE B O   1 
ATOM   1187 C CB  . ILE B 1 16  ? 16.902  -0.282  -23.577 1.00 26.48  ? 14  ILE B CB  1 
ATOM   1188 C CG1 . ILE B 1 16  ? 15.389  -0.133  -23.826 1.00 24.00  ? 14  ILE B CG1 1 
ATOM   1189 C CG2 . ILE B 1 16  ? 17.109  -1.176  -22.311 1.00 17.25  ? 14  ILE B CG2 1 
ATOM   1190 C CD1 . ILE B 1 16  ? 15.002  0.727   -25.014 1.00 27.94  ? 14  ILE B CD1 1 
ATOM   1191 N N   . ASN B 1 17  ? 18.097  1.482   -21.064 1.00 27.70  ? 15  ASN B N   1 
ATOM   1192 C CA  . ASN B 1 17  ? 17.867  2.048   -19.741 1.00 27.75  ? 15  ASN B CA  1 
ATOM   1193 C C   . ASN B 1 17  ? 18.071  3.559   -19.793 1.00 28.62  ? 15  ASN B C   1 
ATOM   1194 O O   . ASN B 1 17  ? 17.324  4.315   -19.182 1.00 28.85  ? 15  ASN B O   1 
ATOM   1195 C CB  . ASN B 1 17  ? 18.800  1.416   -18.696 1.00 26.75  ? 15  ASN B CB  1 
ATOM   1196 C CG  . ASN B 1 17  ? 18.462  -0.029  -18.412 1.00 23.76  ? 15  ASN B CG  1 
ATOM   1197 O OD1 . ASN B 1 17  ? 17.408  -0.520  -18.808 1.00 28.84  ? 15  ASN B OD1 1 
ATOM   1198 N ND2 . ASN B 1 17  ? 19.381  -0.738  -17.765 1.00 24.04  ? 15  ASN B ND2 1 
ATOM   1199 N N   . ARG B 1 18  ? 19.095  3.985   -20.524 1.00 30.55  ? 16  ARG B N   1 
ATOM   1200 C CA  . ARG B 1 18  ? 19.324  5.395   -20.804 1.00 32.28  ? 16  ARG B CA  1 
ATOM   1201 C C   . ARG B 1 18  ? 18.223  5.992   -21.681 1.00 30.97  ? 16  ARG B C   1 
ATOM   1202 O O   . ARG B 1 18  ? 17.740  7.100   -21.431 1.00 32.10  ? 16  ARG B O   1 
ATOM   1203 C CB  . ARG B 1 18  ? 20.679  5.563   -21.483 1.00 36.48  ? 16  ARG B CB  1 
ATOM   1204 C CG  . ARG B 1 18  ? 21.636  6.485   -20.743 1.00 48.97  ? 16  ARG B CG  1 
ATOM   1205 C CD  . ARG B 1 18  ? 22.883  6.753   -21.581 1.00 63.35  ? 16  ARG B CD  1 
ATOM   1206 N NE  . ARG B 1 18  ? 23.776  5.597   -21.576 1.00 66.95  ? 16  ARG B NE  1 
ATOM   1207 C CZ  . ARG B 1 18  ? 24.066  4.858   -22.644 1.00 66.54  ? 16  ARG B CZ  1 
ATOM   1208 N NH1 . ARG B 1 18  ? 24.844  3.793   -22.508 1.00 61.18  ? 16  ARG B NH1 1 
ATOM   1209 N NH2 . ARG B 1 18  ? 23.632  5.209   -23.853 1.00 64.54  ? 16  ARG B NH2 1 
ATOM   1210 N N   . ALA B 1 19  ? 17.873  5.288   -22.749 1.00 28.53  ? 17  ALA B N   1 
ATOM   1211 C CA  . ALA B 1 19  ? 16.906  5.806   -23.724 1.00 28.66  ? 17  ALA B CA  1 
ATOM   1212 C C   . ALA B 1 19  ? 15.482  5.940   -23.159 1.00 28.07  ? 17  ALA B C   1 
ATOM   1213 O O   . ALA B 1 19  ? 14.660  6.691   -23.694 1.00 29.76  ? 17  ALA B O   1 
ATOM   1214 C CB  . ALA B 1 19  ? 16.915  4.938   -24.993 1.00 25.67  ? 17  ALA B CB  1 
ATOM   1215 N N   . THR B 1 20  ? 15.195  5.212   -22.080 1.00 27.48  ? 18  THR B N   1 
ATOM   1216 C CA  . THR B 1 20  ? 13.845  5.145   -21.526 1.00 24.54  ? 18  THR B CA  1 
ATOM   1217 C C   . THR B 1 20  ? 13.815  5.570   -20.042 1.00 27.21  ? 18  THR B C   1 
ATOM   1218 O O   . THR B 1 20  ? 12.830  5.360   -19.324 1.00 25.87  ? 18  THR B O   1 
ATOM   1219 C CB  . THR B 1 20  ? 13.223  3.722   -21.710 1.00 27.66  ? 18  THR B CB  1 
ATOM   1220 O OG1 . THR B 1 20  ? 13.919  2.775   -20.884 1.00 23.57  ? 18  THR B OG1 1 
ATOM   1221 C CG2 . THR B 1 20  ? 13.299  3.267   -23.191 1.00 20.14  ? 18  THR B CG2 1 
ATOM   1222 N N   . ASN B 1 21  ? 14.910  6.153   -19.582 1.00 27.60  ? 19  ASN B N   1 
ATOM   1223 C CA  . ASN B 1 21  ? 15.001  6.607   -18.206 1.00 31.75  ? 19  ASN B CA  1 
ATOM   1224 C C   . ASN B 1 21  ? 13.889  7.580   -17.812 1.00 34.52  ? 19  ASN B C   1 
ATOM   1225 O O   . ASN B 1 21  ? 13.865  8.716   -18.282 1.00 35.65  ? 19  ASN B O   1 
ATOM   1226 C CB  . ASN B 1 21  ? 16.366  7.236   -17.950 1.00 31.80  ? 19  ASN B CB  1 
ATOM   1227 C CG  . ASN B 1 21  ? 16.730  7.262   -16.485 1.00 36.72  ? 19  ASN B CG  1 
ATOM   1228 O OD1 . ASN B 1 21  ? 16.008  7.831   -15.659 1.00 35.94  ? 19  ASN B OD1 1 
ATOM   1229 N ND2 . ASN B 1 21  ? 17.917  6.759   -16.172 1.00 44.29  ? 19  ASN B ND2 1 
ATOM   1230 N N   . PRO B 1 22  ? 13.067  7.194   -16.816 1.00 37.38  ? 20  PRO B N   1 
ATOM   1231 C CA  . PRO B 1 22  ? 11.937  8.033   -16.400 1.00 38.11  ? 20  PRO B CA  1 
ATOM   1232 C C   . PRO B 1 22  ? 12.386  9.334   -15.752 1.00 39.25  ? 20  PRO B C   1 
ATOM   1233 O O   . PRO B 1 22  ? 11.566  10.232  -15.537 1.00 38.50  ? 20  PRO B O   1 
ATOM   1234 C CB  . PRO B 1 22  ? 11.199  7.157   -15.380 1.00 38.18  ? 20  PRO B CB  1 
ATOM   1235 C CG  . PRO B 1 22  ? 12.229  6.192   -14.889 1.00 32.51  ? 20  PRO B CG  1 
ATOM   1236 C CD  . PRO B 1 22  ? 13.178  5.959   -16.017 1.00 31.94  ? 20  PRO B CD  1 
ATOM   1237 N N   . LEU B 1 23  ? 13.692  9.452   -15.511 1.00 40.51  ? 21  LEU B N   1 
ATOM   1238 C CA  . LEU B 1 23  ? 14.290  10.712  -15.076 1.00 42.79  ? 21  LEU B CA  1 
ATOM   1239 C C   . LEU B 1 23  ? 14.530  11.689  -16.237 1.00 44.46  ? 21  LEU B C   1 
ATOM   1240 O O   . LEU B 1 23  ? 14.747  12.875  -16.004 1.00 47.62  ? 21  LEU B O   1 
ATOM   1241 C CB  . LEU B 1 23  ? 15.604  10.468  -14.311 1.00 44.09  ? 21  LEU B CB  1 
ATOM   1242 C CG  . LEU B 1 23  ? 15.605  10.053  -12.832 1.00 47.55  ? 21  LEU B CG  1 
ATOM   1243 C CD1 . LEU B 1 23  ? 17.015  9.657   -12.373 1.00 43.01  ? 21  LEU B CD1 1 
ATOM   1244 C CD2 . LEU B 1 23  ? 15.032  11.136  -11.917 1.00 47.42  ? 21  LEU B CD2 1 
ATOM   1245 N N   . ASN B 1 24  ? 14.460  11.209  -17.483 1.00 43.26  ? 22  ASN B N   1 
ATOM   1246 C CA  . ASN B 1 24  ? 14.745  12.068  -18.637 1.00 42.20  ? 22  ASN B CA  1 
ATOM   1247 C C   . ASN B 1 24  ? 13.777  13.243  -18.690 1.00 45.39  ? 22  ASN B C   1 
ATOM   1248 O O   . ASN B 1 24  ? 12.568  13.045  -18.729 1.00 45.35  ? 22  ASN B O   1 
ATOM   1249 C CB  . ASN B 1 24  ? 14.660  11.284  -19.955 1.00 40.51  ? 22  ASN B CB  1 
ATOM   1250 C CG  . ASN B 1 24  ? 15.902  10.449  -20.229 1.00 38.96  ? 22  ASN B CG  1 
ATOM   1251 O OD1 . ASN B 1 24  ? 16.893  10.532  -19.510 1.00 34.58  ? 22  ASN B OD1 1 
ATOM   1252 N ND2 . ASN B 1 24  ? 15.807  9.561   -21.209 1.00 35.30  ? 22  ASN B ND2 1 
ATOM   1253 N N   . LYS B 1 25  ? 14.310  14.447  -18.851 1.00 49.44  ? 23  LYS B N   1 
ATOM   1254 C CA  . LYS B 1 25  ? 13.473  15.631  -19.022 1.00 53.69  ? 23  LYS B CA  1 
ATOM   1255 C C   . LYS B 1 25  ? 12.988  15.773  -20.454 1.00 53.20  ? 23  LYS B C   1 
ATOM   1256 O O   . LYS B 1 25  ? 11.931  16.345  -20.704 1.00 55.18  ? 23  LYS B O   1 
ATOM   1257 C CB  . LYS B 1 25  ? 14.218  16.898  -18.583 1.00 57.91  ? 23  LYS B CB  1 
ATOM   1258 C CG  . LYS B 1 25  ? 14.483  16.969  -17.082 1.00 62.13  ? 23  LYS B CG  1 
ATOM   1259 C CD  . LYS B 1 25  ? 13.870  18.222  -16.475 1.00 74.08  ? 23  LYS B CD  1 
ATOM   1260 C CE  . LYS B 1 25  ? 13.869  18.171  -14.945 1.00 76.61  ? 23  LYS B CE  1 
ATOM   1261 N NZ  . LYS B 1 25  ? 13.634  19.527  -14.350 1.00 77.20  ? 23  LYS B NZ  1 
ATOM   1262 N N   . GLU B 1 26  ? 13.755  15.231  -21.392 1.00 53.44  ? 24  GLU B N   1 
ATOM   1263 C CA  . GLU B 1 26  ? 13.310  15.137  -22.777 1.00 52.25  ? 24  GLU B CA  1 
ATOM   1264 C C   . GLU B 1 26  ? 13.828  13.862  -23.432 1.00 48.45  ? 24  GLU B C   1 
ATOM   1265 O O   . GLU B 1 26  ? 14.737  13.208  -22.908 1.00 46.52  ? 24  GLU B O   1 
ATOM   1266 C CB  . GLU B 1 26  ? 13.754  16.372  -23.573 1.00 55.37  ? 24  GLU B CB  1 
ATOM   1267 C CG  . GLU B 1 26  ? 15.200  16.768  -23.355 1.00 59.04  ? 24  GLU B CG  1 
ATOM   1268 C CD  . GLU B 1 26  ? 15.713  17.717  -24.421 1.00 74.57  ? 24  GLU B CD  1 
ATOM   1269 O OE1 . GLU B 1 26  ? 15.041  17.877  -25.467 1.00 76.19  ? 24  GLU B OE1 1 
ATOM   1270 O OE2 . GLU B 1 26  ? 16.814  18.273  -24.232 1.00 77.47  ? 24  GLU B OE2 1 
ATOM   1271 N N   . LEU B 1 27  ? 13.236  13.505  -24.568 1.00 42.46  ? 25  LEU B N   1 
ATOM   1272 C CA  . LEU B 1 27  ? 13.733  12.403  -25.378 1.00 40.29  ? 25  LEU B CA  1 
ATOM   1273 C C   . LEU B 1 27  ? 15.244  12.480  -25.589 1.00 41.05  ? 25  LEU B C   1 
ATOM   1274 O O   . LEU B 1 27  ? 15.813  13.556  -25.807 1.00 39.19  ? 25  LEU B O   1 
ATOM   1275 C CB  . LEU B 1 27  ? 13.000  12.329  -26.720 1.00 38.76  ? 25  LEU B CB  1 
ATOM   1276 C CG  . LEU B 1 27  ? 11.489  12.053  -26.685 1.00 43.65  ? 25  LEU B CG  1 
ATOM   1277 C CD1 . LEU B 1 27  ? 10.850  12.342  -28.039 1.00 39.22  ? 25  LEU B CD1 1 
ATOM   1278 C CD2 . LEU B 1 27  ? 11.191  10.630  -26.255 1.00 41.06  ? 25  LEU B CD2 1 
ATOM   1279 N N   . ASP B 1 28  ? 15.894  11.330  -25.468 1.00 39.62  ? 26  ASP B N   1 
ATOM   1280 C CA  . ASP B 1 28  ? 17.346  11.249  -25.503 1.00 40.41  ? 26  ASP B CA  1 
ATOM   1281 C C   . ASP B 1 28  ? 17.768  10.566  -26.812 1.00 40.38  ? 26  ASP B C   1 
ATOM   1282 O O   . ASP B 1 28  ? 17.956  9.348   -26.856 1.00 38.71  ? 26  ASP B O   1 
ATOM   1283 C CB  . ASP B 1 28  ? 17.829  10.458  -24.285 1.00 40.60  ? 26  ASP B CB  1 
ATOM   1284 C CG  . ASP B 1 28  ? 19.325  10.256  -24.275 1.00 49.04  ? 26  ASP B CG  1 
ATOM   1285 O OD1 . ASP B 1 28  ? 19.989  10.742  -25.218 1.00 49.26  ? 26  ASP B OD1 1 
ATOM   1286 O OD2 . ASP B 1 28  ? 19.819  9.534   -23.374 1.00 53.00  ? 26  ASP B OD2 1 
ATOM   1287 N N   . TRP B 1 29  ? 17.797  11.349  -27.891 1.00 38.27  ? 27  TRP B N   1 
ATOM   1288 C CA  . TRP B 1 29  ? 17.960  10.839  -29.249 1.00 38.14  ? 27  TRP B CA  1 
ATOM   1289 C C   . TRP B 1 29  ? 19.289  10.141  -29.517 1.00 38.87  ? 27  TRP B C   1 
ATOM   1290 O O   . TRP B 1 29  ? 19.352  9.220   -30.328 1.00 40.67  ? 27  TRP B O   1 
ATOM   1291 C CB  . TRP B 1 29  ? 17.743  11.966  -30.260 1.00 40.39  ? 27  TRP B CB  1 
ATOM   1292 C CG  . TRP B 1 29  ? 16.296  12.327  -30.422 1.00 41.45  ? 27  TRP B CG  1 
ATOM   1293 C CD1 . TRP B 1 29  ? 15.682  13.473  -29.991 1.00 41.21  ? 27  TRP B CD1 1 
ATOM   1294 C CD2 . TRP B 1 29  ? 15.258  11.495  -30.961 1.00 37.73  ? 27  TRP B CD2 1 
ATOM   1295 N NE1 . TRP B 1 29  ? 14.335  13.415  -30.257 1.00 41.09  ? 27  TRP B NE1 1 
ATOM   1296 C CE2 . TRP B 1 29  ? 14.045  12.208  -30.839 1.00 36.03  ? 27  TRP B CE2 1 
ATOM   1297 C CE3 . TRP B 1 29  ? 15.241  10.232  -31.571 1.00 37.28  ? 27  TRP B CE3 1 
ATOM   1298 C CZ2 . TRP B 1 29  ? 12.837  11.726  -31.356 1.00 34.39  ? 27  TRP B CZ2 1 
ATOM   1299 C CZ3 . TRP B 1 29  ? 14.024  9.728   -32.032 1.00 31.57  ? 27  TRP B CZ3 1 
ATOM   1300 C CH2 . TRP B 1 29  ? 12.848  10.487  -31.945 1.00 31.54  ? 27  TRP B CH2 1 
ATOM   1301 N N   . ALA B 1 30  ? 20.360  10.648  -28.923 1.00 44.96  ? 28  ALA B N   1 
ATOM   1302 C CA  . ALA B 1 30  ? 21.612  9.890   -28.801 1.00 48.34  ? 28  ALA B CA  1 
ATOM   1303 C C   . ALA B 1 30  ? 21.394  8.425   -28.397 1.00 44.97  ? 28  ALA B C   1 
ATOM   1304 O O   . ALA B 1 30  ? 21.602  7.518   -29.202 1.00 48.05  ? 28  ALA B O   1 
ATOM   1305 C CB  . ALA B 1 30  ? 22.574  10.590  -27.825 1.00 46.43  ? 28  ALA B CB  1 
ATOM   1306 N N   . SER B 1 31  ? 20.880  8.206   -27.192 1.00 44.45  ? 29  SER B N   1 
ATOM   1307 C CA  . SER B 1 31  ? 20.629  6.855   -26.704 1.00 43.32  ? 29  SER B CA  1 
ATOM   1308 C C   . SER B 1 31  ? 19.634  6.059   -27.560 1.00 41.06  ? 29  SER B C   1 
ATOM   1309 O O   . SER B 1 31  ? 19.832  4.862   -27.796 1.00 38.91  ? 29  SER B O   1 
ATOM   1310 C CB  . SER B 1 31  ? 20.187  6.882   -25.240 1.00 44.40  ? 29  SER B CB  1 
ATOM   1311 O OG  . SER B 1 31  ? 21.130  7.577   -24.442 1.00 50.87  ? 29  SER B OG  1 
ATOM   1312 N N   . ILE B 1 32  ? 18.587  6.732   -28.043 1.00 36.93  ? 30  ILE B N   1 
ATOM   1313 C CA  . ILE B 1 32  ? 17.520  6.068   -28.801 1.00 33.88  ? 30  ILE B CA  1 
ATOM   1314 C C   . ILE B 1 32  ? 18.055  5.496   -30.119 1.00 36.69  ? 30  ILE B C   1 
ATOM   1315 O O   . ILE B 1 32  ? 17.884  4.307   -30.416 1.00 33.70  ? 30  ILE B O   1 
ATOM   1316 C CB  . ILE B 1 32  ? 16.385  7.039   -29.120 1.00 32.90  ? 30  ILE B CB  1 
ATOM   1317 C CG1 . ILE B 1 32  ? 15.643  7.434   -27.848 1.00 29.60  ? 30  ILE B CG1 1 
ATOM   1318 C CG2 . ILE B 1 32  ? 15.456  6.463   -30.186 1.00 23.88  ? 30  ILE B CG2 1 
ATOM   1319 C CD1 . ILE B 1 32  ? 14.659  8.569   -28.052 1.00 30.59  ? 30  ILE B CD1 1 
ATOM   1320 N N   . ASN B 1 33  ? 18.819  6.329   -30.822 1.00 37.15  ? 31  ASN B N   1 
ATOM   1321 C CA  . ASN B 1 33  ? 19.409  5.983   -32.101 1.00 38.82  ? 31  ASN B CA  1 
ATOM   1322 C C   . ASN B 1 33  ? 20.587  5.030   -31.945 1.00 37.74  ? 31  ASN B C   1 
ATOM   1323 O O   . ASN B 1 33  ? 20.745  4.096   -32.727 1.00 36.46  ? 31  ASN B O   1 
ATOM   1324 C CB  . ASN B 1 33  ? 19.853  7.262   -32.827 1.00 41.66  ? 31  ASN B CB  1 
ATOM   1325 C CG  . ASN B 1 33  ? 18.676  8.060   -33.370 1.00 42.51  ? 31  ASN B CG  1 
ATOM   1326 O OD1 . ASN B 1 33  ? 18.613  9.279   -33.226 1.00 51.28  ? 31  ASN B OD1 1 
ATOM   1327 N ND2 . ASN B 1 33  ? 17.731  7.366   -33.983 1.00 45.17  ? 31  ASN B ND2 1 
ATOM   1328 N N   . GLY B 1 34  ? 21.389  5.254   -30.909 1.00 39.75  ? 32  GLY B N   1 
ATOM   1329 C CA  . GLY B 1 34  ? 22.422  4.297   -30.516 1.00 40.04  ? 32  GLY B CA  1 
ATOM   1330 C C   . GLY B 1 34  ? 21.873  2.896   -30.312 1.00 38.59  ? 32  GLY B C   1 
ATOM   1331 O O   . GLY B 1 34  ? 22.483  1.910   -30.733 1.00 41.99  ? 32  GLY B O   1 
ATOM   1332 N N   . PHE B 1 35  ? 20.703  2.805   -29.691 1.00 32.12  ? 33  PHE B N   1 
ATOM   1333 C CA  . PHE B 1 35  ? 20.088  1.506   -29.431 1.00 32.59  ? 33  PHE B CA  1 
ATOM   1334 C C   . PHE B 1 35  ? 19.715  0.819   -30.749 1.00 33.29  ? 33  PHE B C   1 
ATOM   1335 O O   . PHE B 1 35  ? 20.031  -0.358  -30.962 1.00 34.07  ? 33  PHE B O   1 
ATOM   1336 C CB  . PHE B 1 35  ? 18.854  1.667   -28.541 1.00 29.30  ? 33  PHE B CB  1 
ATOM   1337 C CG  . PHE B 1 35  ? 18.119  0.377   -28.275 1.00 32.23  ? 33  PHE B CG  1 
ATOM   1338 C CD1 . PHE B 1 35  ? 17.085  -0.029  -29.107 1.00 24.57  ? 33  PHE B CD1 1 
ATOM   1339 C CD2 . PHE B 1 35  ? 18.423  -0.397  -27.155 1.00 24.91  ? 33  PHE B CD2 1 
ATOM   1340 C CE1 . PHE B 1 35  ? 16.368  -1.178  -28.840 1.00 21.41  ? 33  PHE B CE1 1 
ATOM   1341 C CE2 . PHE B 1 35  ? 17.749  -1.591  -26.913 1.00 27.62  ? 33  PHE B CE2 1 
ATOM   1342 C CZ  . PHE B 1 35  ? 16.737  -1.994  -27.767 1.00 26.34  ? 33  PHE B CZ  1 
ATOM   1343 N N   . CYS B 1 36  ? 19.122  1.585   -31.664 1.00 35.06  ? 34  CYS B N   1 
ATOM   1344 C CA  . CYS B 1 36  ? 18.645  1.029   -32.928 1.00 34.11  ? 34  CYS B CA  1 
ATOM   1345 C C   . CYS B 1 36  ? 19.810  0.593   -33.799 1.00 35.91  ? 34  CYS B C   1 
ATOM   1346 O O   . CYS B 1 36  ? 19.709  -0.383  -34.536 1.00 35.79  ? 34  CYS B O   1 
ATOM   1347 C CB  . CYS B 1 36  ? 17.794  2.048   -33.682 1.00 33.19  ? 34  CYS B CB  1 
ATOM   1348 S SG  . CYS B 1 36  ? 16.258  2.529   -32.851 1.00 41.46  ? 34  CYS B SG  1 
ATOM   1349 N N   . GLU B 1 37  ? 20.897  1.354   -33.748 1.00 46.21  ? 35  GLU B N   1 
ATOM   1350 C CA  . GLU B 1 37  ? 22.122  0.978   -34.437 1.00 51.73  ? 35  GLU B CA  1 
ATOM   1351 C C   . GLU B 1 37  ? 22.724  -0.279  -33.818 1.00 51.90  ? 35  GLU B C   1 
ATOM   1352 O O   . GLU B 1 37  ? 23.213  -1.159  -34.524 1.00 55.50  ? 35  GLU B O   1 
ATOM   1353 C CB  . GLU B 1 37  ? 23.134  2.127   -34.400 1.00 54.36  ? 35  GLU B CB  1 
ATOM   1354 C CG  . GLU B 1 37  ? 22.778  3.277   -35.329 1.00 66.84  ? 35  GLU B CG  1 
ATOM   1355 C CD  . GLU B 1 37  ? 23.524  4.561   -34.998 1.00 81.68  ? 35  GLU B CD  1 
ATOM   1356 O OE1 . GLU B 1 37  ? 23.363  5.548   -35.751 1.00 85.41  ? 35  GLU B OE1 1 
ATOM   1357 O OE2 . GLU B 1 37  ? 24.239  4.593   -33.968 1.00 86.00  ? 35  GLU B OE2 1 
ATOM   1358 N N   . GLN B 1 38  ? 22.712  -0.357  -32.494 1.00 43.21  ? 36  GLN B N   1 
ATOM   1359 C CA  . GLN B 1 38  ? 23.457  -1.407  -31.830 1.00 44.92  ? 36  GLN B CA  1 
ATOM   1360 C C   . GLN B 1 38  ? 22.806  -2.773  -32.047 1.00 42.43  ? 36  GLN B C   1 
ATOM   1361 O O   . GLN B 1 38  ? 23.493  -3.755  -32.323 1.00 43.33  ? 36  GLN B O   1 
ATOM   1362 C CB  . GLN B 1 38  ? 23.625  -1.092  -30.347 1.00 46.27  ? 36  GLN B CB  1 
ATOM   1363 C CG  . GLN B 1 38  ? 23.879  -2.308  -29.473 1.00 53.55  ? 36  GLN B CG  1 
ATOM   1364 C CD  . GLN B 1 38  ? 25.343  -2.479  -29.110 1.00 62.06  ? 36  GLN B CD  1 
ATOM   1365 O OE1 . GLN B 1 38  ? 25.667  -2.970  -28.031 1.00 65.08  ? 36  GLN B OE1 1 
ATOM   1366 N NE2 . GLN B 1 38  ? 26.232  -2.040  -29.993 1.00 61.02  ? 36  GLN B NE2 1 
ATOM   1367 N N   . LEU B 1 39  ? 21.476  -2.806  -32.063 1.00 38.17  ? 37  LEU B N   1 
ATOM   1368 C CA  . LEU B 1 39  ? 20.757  -4.073  -32.211 1.00 37.89  ? 37  LEU B CA  1 
ATOM   1369 C C   . LEU B 1 39  ? 21.022  -4.771  -33.548 1.00 41.23  ? 37  LEU B C   1 
ATOM   1370 O O   . LEU B 1 39  ? 20.998  -6.004  -33.626 1.00 40.97  ? 37  LEU B O   1 
ATOM   1371 C CB  . LEU B 1 39  ? 19.261  -3.901  -31.962 1.00 30.86  ? 37  LEU B CB  1 
ATOM   1372 C CG  . LEU B 1 39  ? 18.401  -3.111  -32.955 1.00 32.61  ? 37  LEU B CG  1 
ATOM   1373 C CD1 . LEU B 1 39  ? 17.952  -3.967  -34.155 1.00 33.28  ? 37  LEU B CD1 1 
ATOM   1374 C CD2 . LEU B 1 39  ? 17.195  -2.515  -32.239 1.00 25.74  ? 37  LEU B CD2 1 
ATOM   1375 N N   . ASN B 1 40  ? 21.405  -3.993  -34.559 1.00 60.97  ? 38  ASN B N   1 
ATOM   1376 C CA  . ASN B 1 40  ? 21.605  -4.529  -35.907 1.00 65.70  ? 38  ASN B CA  1 
ATOM   1377 C C   . ASN B 1 40  ? 23.024  -5.010  -36.158 1.00 70.69  ? 38  ASN B C   1 
ATOM   1378 O O   . ASN B 1 40  ? 23.283  -5.726  -37.128 1.00 72.52  ? 38  ASN B O   1 
ATOM   1379 C CB  . ASN B 1 40  ? 21.193  -3.514  -36.975 1.00 65.06  ? 38  ASN B CB  1 
ATOM   1380 C CG  . ASN B 1 40  ? 19.777  -3.741  -37.469 1.00 71.23  ? 38  ASN B CG  1 
ATOM   1381 O OD1 . ASN B 1 40  ? 18.892  -2.905  -37.252 1.00 78.63  ? 38  ASN B OD1 1 
ATOM   1382 N ND2 . ASN B 1 40  ? 19.517  -4.945  -37.979 1.00 70.67  ? 38  ASN B ND2 1 
ATOM   1383 N N   . GLU B 1 41  ? 23.944  -4.614  -35.285 1.00 72.27  ? 39  GLU B N   1 
ATOM   1384 C CA  . GLU B 1 41  ? 25.339  -4.998  -35.443 1.00 76.88  ? 39  GLU B CA  1 
ATOM   1385 C C   . GLU B 1 41  ? 25.608  -6.369  -34.817 1.00 78.91  ? 39  GLU B C   1 
ATOM   1386 O O   . GLU B 1 41  ? 26.391  -7.156  -35.353 1.00 80.18  ? 39  GLU B O   1 
ATOM   1387 C CB  . GLU B 1 41  ? 26.285  -3.914  -34.896 1.00 78.50  ? 39  GLU B CB  1 
ATOM   1388 C CG  . GLU B 1 41  ? 26.513  -3.944  -33.390 1.00 80.12  ? 39  GLU B CG  1 
ATOM   1389 C CD  . GLU B 1 41  ? 27.856  -3.342  -32.989 1.00 89.52  ? 39  GLU B CD  1 
ATOM   1390 O OE1 . GLU B 1 41  ? 28.091  -3.138  -31.774 1.00 89.67  ? 39  GLU B OE1 1 
ATOM   1391 O OE2 . GLU B 1 41  ? 28.698  -3.123  -33.887 1.00 93.48  ? 39  GLU B OE2 1 
ATOM   1392 N N   . ASP B 1 42  ? 24.802  -6.726  -33.819 1.00 80.86  ? 40  ASP B N   1 
ATOM   1393 C CA  . ASP B 1 42  ? 24.820  -8.081  -33.258 1.00 84.55  ? 40  ASP B CA  1 
ATOM   1394 C C   . ASP B 1 42  ? 23.860  -9.017  -33.998 1.00 84.73  ? 40  ASP B C   1 
ATOM   1395 O O   . ASP B 1 42  ? 22.742  -8.622  -34.350 1.00 80.94  ? 40  ASP B O   1 
ATOM   1396 C CB  . ASP B 1 42  ? 24.453  -8.070  -31.763 1.00 85.80  ? 40  ASP B CB  1 
ATOM   1397 C CG  . ASP B 1 42  ? 24.808  -6.760  -31.072 1.00 87.87  ? 40  ASP B CG  1 
ATOM   1398 O OD1 . ASP B 1 42  ? 24.015  -6.322  -30.208 1.00 85.47  ? 40  ASP B OD1 1 
ATOM   1399 O OD2 . ASP B 1 42  ? 25.927  -6.242  -31.298 1.00 94.43  ? 40  ASP B OD2 1 
ATOM   1400 N N   . PHE B 1 43  ? 24.240  -10.289 -34.116 1.00 85.88  ? 41  PHE B N   1 
ATOM   1401 C CA  . PHE B 1 43  ? 23.323  -11.292 -34.667 1.00 87.14  ? 41  PHE B CA  1 
ATOM   1402 C C   . PHE B 1 43  ? 22.172  -11.607 -33.715 1.00 82.57  ? 41  PHE B C   1 
ATOM   1403 O O   . PHE B 1 43  ? 21.050  -11.876 -34.146 1.00 81.10  ? 41  PHE B O   1 
ATOM   1404 C CB  . PHE B 1 43  ? 24.044  -12.587 -35.049 1.00 93.03  ? 41  PHE B CB  1 
ATOM   1405 C CG  . PHE B 1 43  ? 23.115  -13.668 -35.549 1.00 100.01 ? 41  PHE B CG  1 
ATOM   1406 C CD1 . PHE B 1 43  ? 22.786  -14.750 -34.740 1.00 103.10 ? 41  PHE B CD1 1 
ATOM   1407 C CD2 . PHE B 1 43  ? 22.454  -13.524 -36.769 1.00 103.18 ? 41  PHE B CD2 1 
ATOM   1408 C CE1 . PHE B 1 43  ? 21.857  -15.696 -35.159 1.00 103.35 ? 41  PHE B CE1 1 
ATOM   1409 C CE2 . PHE B 1 43  ? 21.533  -14.471 -37.200 1.00 102.67 ? 41  PHE B CE2 1 
ATOM   1410 C CZ  . PHE B 1 43  ? 21.234  -15.559 -36.394 1.00 101.13 ? 41  PHE B CZ  1 
ATOM   1411 N N   . GLU B 1 44  ? 22.478  -11.648 -32.425 1.00 65.86  ? 42  GLU B N   1 
ATOM   1412 C CA  . GLU B 1 44  ? 21.460  -11.865 -31.410 1.00 62.06  ? 42  GLU B CA  1 
ATOM   1413 C C   . GLU B 1 44  ? 20.810  -10.550 -30.993 1.00 56.09  ? 42  GLU B C   1 
ATOM   1414 O O   . GLU B 1 44  ? 19.802  -10.544 -30.299 1.00 54.29  ? 42  GLU B O   1 
ATOM   1415 C CB  . GLU B 1 44  ? 22.062  -12.586 -30.199 1.00 64.22  ? 42  GLU B CB  1 
ATOM   1416 C CG  . GLU B 1 44  ? 22.088  -14.110 -30.337 1.00 71.13  ? 42  GLU B CG  1 
ATOM   1417 C CD  . GLU B 1 44  ? 20.712  -14.702 -30.648 1.00 76.50  ? 42  GLU B CD  1 
ATOM   1418 O OE1 . GLU B 1 44  ? 19.836  -14.697 -29.752 1.00 73.25  ? 42  GLU B OE1 1 
ATOM   1419 O OE2 . GLU B 1 44  ? 20.503  -15.164 -31.792 1.00 75.22  ? 42  GLU B OE2 1 
ATOM   1420 N N   . GLY B 1 45  ? 21.337  -9.448  -31.522 1.00 50.31  ? 43  GLY B N   1 
ATOM   1421 C CA  . GLY B 1 45  ? 20.758  -8.124  -31.341 1.00 44.60  ? 43  GLY B CA  1 
ATOM   1422 C C   . GLY B 1 45  ? 19.243  -8.065  -31.327 1.00 40.14  ? 43  GLY B C   1 
ATOM   1423 O O   . GLY B 1 45  ? 18.656  -7.659  -30.327 1.00 35.66  ? 43  GLY B O   1 
ATOM   1424 N N   . PRO B 1 46  ? 18.612  -8.314  -32.490 1.00 43.91  ? 44  PRO B N   1 
ATOM   1425 C CA  . PRO B 1 46  ? 17.194  -7.985  -32.658 1.00 41.39  ? 44  PRO B CA  1 
ATOM   1426 C C   . PRO B 1 46  ? 16.239  -8.663  -31.663 1.00 39.26  ? 44  PRO B C   1 
ATOM   1427 O O   . PRO B 1 46  ? 15.228  -8.059  -31.293 1.00 38.08  ? 44  PRO B O   1 
ATOM   1428 C CB  . PRO B 1 46  ? 16.906  -8.408  -34.104 1.00 40.86  ? 44  PRO B CB  1 
ATOM   1429 C CG  . PRO B 1 46  ? 18.224  -8.220  -34.801 1.00 40.98  ? 44  PRO B CG  1 
ATOM   1430 C CD  . PRO B 1 46  ? 19.252  -8.647  -33.778 1.00 45.14  ? 44  PRO B CD  1 
ATOM   1431 N N   . PRO B 1 47  ? 16.488  -9.944  -31.323 1.00 37.44  ? 45  PRO B N   1 
ATOM   1432 C CA  . PRO B 1 47  ? 15.564  -10.619 -30.393 1.00 36.53  ? 45  PRO B CA  1 
ATOM   1433 C C   . PRO B 1 47  ? 15.764  -10.228 -28.921 1.00 35.04  ? 45  PRO B C   1 
ATOM   1434 O O   . PRO B 1 47  ? 14.815  -10.259 -28.143 1.00 33.04  ? 45  PRO B O   1 
ATOM   1435 C CB  . PRO B 1 47  ? 15.835  -12.121 -30.614 1.00 39.34  ? 45  PRO B CB  1 
ATOM   1436 C CG  . PRO B 1 47  ? 17.162  -12.205 -31.332 1.00 41.55  ? 45  PRO B CG  1 
ATOM   1437 C CD  . PRO B 1 47  ? 17.400  -10.880 -32.015 1.00 38.13  ? 45  PRO B CD  1 
ATOM   1438 N N   . LEU B 1 48  ? 16.985  -9.853  -28.554 1.00 34.93  ? 46  LEU B N   1 
ATOM   1439 C CA  . LEU B 1 48  ? 17.245  -9.227  -27.267 1.00 33.58  ? 46  LEU B CA  1 
ATOM   1440 C C   . LEU B 1 48  ? 16.524  -7.886  -27.141 1.00 32.03  ? 46  LEU B C   1 
ATOM   1441 O O   . LEU B 1 48  ? 15.831  -7.636  -26.147 1.00 30.91  ? 46  LEU B O   1 
ATOM   1442 C CB  . LEU B 1 48  ? 18.753  -9.066  -27.033 1.00 33.50  ? 46  LEU B CB  1 
ATOM   1443 C CG  . LEU B 1 48  ? 19.228  -8.367  -25.743 1.00 37.94  ? 46  LEU B CG  1 
ATOM   1444 C CD1 . LEU B 1 48  ? 18.615  -8.986  -24.475 1.00 37.45  ? 46  LEU B CD1 1 
ATOM   1445 C CD2 . LEU B 1 48  ? 20.755  -8.376  -25.637 1.00 38.57  ? 46  LEU B CD2 1 
ATOM   1446 N N   . ALA B 1 49  ? 16.622  -7.073  -28.187 1.00 25.49  ? 47  ALA B N   1 
ATOM   1447 C CA  . ALA B 1 49  ? 16.120  -5.695  -28.179 1.00 28.98  ? 47  ALA B CA  1 
ATOM   1448 C C   . ALA B 1 49  ? 14.603  -5.688  -28.041 1.00 26.09  ? 47  ALA B C   1 
ATOM   1449 O O   . ALA B 1 49  ? 14.026  -4.930  -27.267 1.00 27.04  ? 47  ALA B O   1 
ATOM   1450 C CB  . ALA B 1 49  ? 16.538  -4.967  -29.492 1.00 25.35  ? 47  ALA B CB  1 
ATOM   1451 N N   . THR B 1 50  ? 13.996  -6.668  -28.683 1.00 31.47  ? 48  THR B N   1 
ATOM   1452 C CA  . THR B 1 50  ? 12.559  -6.875  -28.671 1.00 31.98  ? 48  THR B CA  1 
ATOM   1453 C C   . THR B 1 50  ? 12.034  -7.364  -27.299 1.00 32.21  ? 48  THR B C   1 
ATOM   1454 O O   . THR B 1 50  ? 11.087  -6.796  -26.745 1.00 29.47  ? 48  THR B O   1 
ATOM   1455 C CB  . THR B 1 50  ? 12.223  -7.853  -29.817 1.00 34.06  ? 48  THR B CB  1 
ATOM   1456 O OG1 . THR B 1 50  ? 11.182  -7.312  -30.641 1.00 45.30  ? 48  THR B OG1 1 
ATOM   1457 C CG2 . THR B 1 50  ? 11.897  -9.226  -29.324 1.00 29.03  ? 48  THR B CG2 1 
ATOM   1458 N N   . ARG B 1 51  ? 12.797  -8.255  -26.673 1.00 28.43  ? 49  ARG B N   1 
ATOM   1459 C CA  . ARG B 1 51  ? 12.585  -8.666  -25.282 1.00 31.54  ? 49  ARG B CA  1 
ATOM   1460 C C   . ARG B 1 51  ? 12.683  -7.501  -24.286 1.00 30.48  ? 49  ARG B C   1 
ATOM   1461 O O   . ARG B 1 51  ? 11.861  -7.380  -23.372 1.00 28.10  ? 49  ARG B O   1 
ATOM   1462 C CB  . ARG B 1 51  ? 13.611  -9.754  -24.930 1.00 34.32  ? 49  ARG B CB  1 
ATOM   1463 C CG  . ARG B 1 51  ? 13.410  -10.437 -23.609 1.00 43.33  ? 49  ARG B CG  1 
ATOM   1464 C CD  . ARG B 1 51  ? 14.034  -11.825 -23.631 1.00 60.29  ? 49  ARG B CD  1 
ATOM   1465 N NE  . ARG B 1 51  ? 15.123  -11.957 -22.665 1.00 66.11  ? 49  ARG B NE  1 
ATOM   1466 C CZ  . ARG B 1 51  ? 14.959  -12.345 -21.405 1.00 71.20  ? 49  ARG B CZ  1 
ATOM   1467 N NH1 . ARG B 1 51  ? 16.000  -12.411 -20.585 1.00 74.36  ? 49  ARG B NH1 1 
ATOM   1468 N NH2 . ARG B 1 51  ? 13.743  -12.620 -20.947 1.00 72.58  ? 49  ARG B NH2 1 
ATOM   1469 N N   . LEU B 1 52  ? 13.712  -6.667  -24.447 1.00 30.49  ? 50  LEU B N   1 
ATOM   1470 C CA  . LEU B 1 52  ? 13.916  -5.507  -23.587 1.00 27.69  ? 50  LEU B CA  1 
ATOM   1471 C C   . LEU B 1 52  ? 12.797  -4.478  -23.763 1.00 28.07  ? 50  LEU B C   1 
ATOM   1472 O O   . LEU B 1 52  ? 12.312  -3.892  -22.797 1.00 26.95  ? 50  LEU B O   1 
ATOM   1473 C CB  . LEU B 1 52  ? 15.289  -4.871  -23.848 1.00 26.35  ? 50  LEU B CB  1 
ATOM   1474 C CG  . LEU B 1 52  ? 16.518  -5.776  -23.631 1.00 33.66  ? 50  LEU B CG  1 
ATOM   1475 C CD1 . LEU B 1 52  ? 17.859  -5.078  -23.955 1.00 21.05  ? 50  LEU B CD1 1 
ATOM   1476 C CD2 . LEU B 1 52  ? 16.549  -6.376  -22.213 1.00 26.91  ? 50  LEU B CD2 1 
ATOM   1477 N N   . LEU B 1 53  ? 12.343  -4.313  -24.999 1.00 30.08  ? 51  LEU B N   1 
ATOM   1478 C CA  . LEU B 1 53  ? 11.381  -3.268  -25.333 1.00 27.64  ? 51  LEU B CA  1 
ATOM   1479 C C   . LEU B 1 53  ? 10.018  -3.590  -24.733 1.00 27.44  ? 51  LEU B C   1 
ATOM   1480 O O   . LEU B 1 53  ? 9.332   -2.697  -24.217 1.00 26.52  ? 51  LEU B O   1 
ATOM   1481 C CB  . LEU B 1 53  ? 11.261  -3.127  -26.856 1.00 26.96  ? 51  LEU B CB  1 
ATOM   1482 C CG  . LEU B 1 53  ? 12.346  -2.315  -27.569 1.00 27.68  ? 51  LEU B CG  1 
ATOM   1483 C CD1 . LEU B 1 53  ? 12.323  -2.605  -29.065 1.00 25.44  ? 51  LEU B CD1 1 
ATOM   1484 C CD2 . LEU B 1 53  ? 12.139  -0.816  -27.323 1.00 19.81  ? 51  LEU B CD2 1 
ATOM   1485 N N   . ALA B 1 54  ? 9.562   -4.817  -24.983 1.00 25.00  ? 52  ALA B N   1 
ATOM   1486 C CA  . ALA B 1 54  ? 8.365   -5.374  -24.353 1.00 25.42  ? 52  ALA B CA  1 
ATOM   1487 C C   . ALA B 1 54  ? 8.257   -5.014  -22.871 1.00 26.07  ? 52  ALA B C   1 
ATOM   1488 O O   . ALA B 1 54  ? 7.260   -4.441  -22.453 1.00 31.26  ? 52  ALA B O   1 
ATOM   1489 C CB  . ALA B 1 54  ? 8.314   -6.901  -24.546 1.00 22.52  ? 52  ALA B CB  1 
ATOM   1490 N N   . HIS B 1 55  ? 9.268   -5.353  -22.069 1.00 31.16  ? 53  HIS B N   1 
ATOM   1491 C CA  . HIS B 1 55  ? 9.226   -5.031  -20.636 1.00 29.85  ? 53  HIS B CA  1 
ATOM   1492 C C   . HIS B 1 55  ? 9.021   -3.541  -20.369 1.00 29.71  ? 53  HIS B C   1 
ATOM   1493 O O   . HIS B 1 55  ? 8.189   -3.168  -19.532 1.00 30.91  ? 53  HIS B O   1 
ATOM   1494 C CB  . HIS B 1 55  ? 10.469  -5.527  -19.892 1.00 28.82  ? 53  HIS B CB  1 
ATOM   1495 C CG  . HIS B 1 55  ? 10.346  -5.439  -18.400 1.00 28.41  ? 53  HIS B CG  1 
ATOM   1496 N ND1 . HIS B 1 55  ? 11.131  -4.600  -17.634 1.00 27.58  ? 53  HIS B ND1 1 
ATOM   1497 C CD2 . HIS B 1 55  ? 9.461   -6.007  -17.545 1.00 27.57  ? 53  HIS B CD2 1 
ATOM   1498 C CE1 . HIS B 1 55  ? 10.775  -4.704  -16.365 1.00 29.18  ? 53  HIS B CE1 1 
ATOM   1499 N NE2 . HIS B 1 55  ? 9.773   -5.563  -16.282 1.00 32.04  ? 53  HIS B NE2 1 
ATOM   1500 N N   . LYS B 1 56  ? 9.842   -2.701  -20.999 1.00 25.39  ? 54  LYS B N   1 
ATOM   1501 C CA  . LYS B 1 56  ? 9.758   -1.248  -20.802 1.00 27.73  ? 54  LYS B CA  1 
ATOM   1502 C C   . LYS B 1 56  ? 8.380   -0.712  -21.192 1.00 28.30  ? 54  LYS B C   1 
ATOM   1503 O O   . LYS B 1 56  ? 7.855   0.200   -20.552 1.00 29.16  ? 54  LYS B O   1 
ATOM   1504 C CB  . LYS B 1 56  ? 10.850  -0.507  -21.594 1.00 24.95  ? 54  LYS B CB  1 
ATOM   1505 C CG  . LYS B 1 56  ? 12.255  -0.969  -21.283 1.00 29.56  ? 54  LYS B CG  1 
ATOM   1506 C CD  . LYS B 1 56  ? 12.752  -0.423  -19.942 1.00 25.45  ? 54  LYS B CD  1 
ATOM   1507 C CE  . LYS B 1 56  ? 14.251  -0.586  -19.824 1.00 26.02  ? 54  LYS B CE  1 
ATOM   1508 N NZ  . LYS B 1 56  ? 14.719  -0.368  -18.421 1.00 28.02  ? 54  LYS B NZ  1 
ATOM   1509 N N   . ILE B 1 57  ? 7.861   -1.204  -22.313 1.00 28.53  ? 55  ILE B N   1 
ATOM   1510 C CA  . ILE B 1 57  ? 6.593   -0.735  -22.854 1.00 28.70  ? 55  ILE B CA  1 
ATOM   1511 C C   . ILE B 1 57  ? 5.463   -1.036  -21.873 1.00 28.77  ? 55  ILE B C   1 
ATOM   1512 O O   . ILE B 1 57  ? 4.388   -0.423  -21.921 1.00 27.10  ? 55  ILE B O   1 
ATOM   1513 C CB  . ILE B 1 57  ? 6.287   -1.397  -24.230 1.00 28.75  ? 55  ILE B CB  1 
ATOM   1514 C CG1 . ILE B 1 57  ? 7.193   -0.814  -25.329 1.00 33.27  ? 55  ILE B CG1 1 
ATOM   1515 C CG2 . ILE B 1 57  ? 4.806   -1.227  -24.590 1.00 25.22  ? 55  ILE B CG2 1 
ATOM   1516 C CD1 . ILE B 1 57  ? 7.130   -1.563  -26.674 1.00 23.83  ? 55  ILE B CD1 1 
ATOM   1517 N N   . GLN B 1 58  ? 5.670   -2.077  -21.075 1.00 30.18  ? 56  GLN B N   1 
ATOM   1518 C CA  . GLN B 1 58  ? 4.666   -2.548  -20.137 1.00 31.05  ? 56  GLN B CA  1 
ATOM   1519 C C   . GLN B 1 58  ? 4.817   -1.899  -18.774 1.00 31.04  ? 56  GLN B C   1 
ATOM   1520 O O   . GLN B 1 58  ? 4.115   -2.266  -17.835 1.00 31.17  ? 56  GLN B O   1 
ATOM   1521 C CB  . GLN B 1 58  ? 4.732   -4.072  -19.997 1.00 33.59  ? 56  GLN B CB  1 
ATOM   1522 C CG  . GLN B 1 58  ? 4.316   -4.835  -21.248 1.00 35.91  ? 56  GLN B CG  1 
ATOM   1523 C CD  . GLN B 1 58  ? 4.400   -6.341  -21.070 1.00 42.01  ? 56  GLN B CD  1 
ATOM   1524 O OE1 . GLN B 1 58  ? 3.722   -7.096  -21.768 1.00 45.48  ? 56  GLN B OE1 1 
ATOM   1525 N NE2 . GLN B 1 58  ? 5.190   -6.782  -20.096 1.00 36.11  ? 56  GLN B NE2 1 
ATOM   1526 N N   . SER B 1 59  ? 5.721   -0.928  -18.660 1.00 31.86  ? 57  SER B N   1 
ATOM   1527 C CA  . SER B 1 59  ? 5.906   -0.217  -17.394 1.00 33.76  ? 57  SER B CA  1 
ATOM   1528 C C   . SER B 1 59  ? 4.645   0.511   -16.911 1.00 35.04  ? 57  SER B C   1 
ATOM   1529 O O   . SER B 1 59  ? 3.999   1.205   -17.686 1.00 35.77  ? 57  SER B O   1 
ATOM   1530 C CB  . SER B 1 59  ? 7.076   0.758   -17.469 1.00 30.44  ? 57  SER B CB  1 
ATOM   1531 O OG  . SER B 1 59  ? 7.139   1.532   -16.278 1.00 36.66  ? 57  SER B OG  1 
ATOM   1532 N N   . PRO B 1 60  ? 4.358   0.432   -15.598 1.00 38.07  ? 58  PRO B N   1 
ATOM   1533 C CA  . PRO B 1 60  ? 3.399   1.311   -14.920 1.00 39.25  ? 58  PRO B CA  1 
ATOM   1534 C C   . PRO B 1 60  ? 3.814   2.791   -14.923 1.00 39.20  ? 58  PRO B C   1 
ATOM   1535 O O   . PRO B 1 60  ? 3.026   3.650   -14.533 1.00 41.78  ? 58  PRO B O   1 
ATOM   1536 C CB  . PRO B 1 60  ? 3.382   0.786   -13.471 1.00 34.86  ? 58  PRO B CB  1 
ATOM   1537 C CG  . PRO B 1 60  ? 4.103   -0.486  -13.483 1.00 35.43  ? 58  PRO B CG  1 
ATOM   1538 C CD  . PRO B 1 60  ? 5.051   -0.447  -14.644 1.00 37.87  ? 58  PRO B CD  1 
ATOM   1539 N N   . GLN B 1 61  ? 5.075   3.077   -15.227 1.00 35.99  ? 59  GLN B N   1 
ATOM   1540 C CA  . GLN B 1 61  ? 5.521   4.464   -15.268 1.00 36.70  ? 59  GLN B CA  1 
ATOM   1541 C C   . GLN B 1 61  ? 5.405   5.025   -16.681 1.00 36.47  ? 59  GLN B C   1 
ATOM   1542 O O   . GLN B 1 61  ? 6.188   4.676   -17.565 1.00 35.19  ? 59  GLN B O   1 
ATOM   1543 C CB  . GLN B 1 61  ? 6.951   4.603   -14.727 1.00 37.59  ? 59  GLN B CB  1 
ATOM   1544 C CG  . GLN B 1 61  ? 7.099   4.250   -13.232 1.00 37.01  ? 59  GLN B CG  1 
ATOM   1545 C CD  . GLN B 1 61  ? 8.558   4.215   -12.772 1.00 36.31  ? 59  GLN B CD  1 
ATOM   1546 O OE1 . GLN B 1 61  ? 9.275   5.211   -12.863 1.00 37.83  ? 59  GLN B OE1 1 
ATOM   1547 N NE2 . GLN B 1 61  ? 8.985   3.077   -12.248 1.00 36.27  ? 59  GLN B NE2 1 
ATOM   1548 N N   . GLU B 1 62  ? 4.383   5.847   -16.904 1.00 36.09  ? 60  GLU B N   1 
ATOM   1549 C CA  . GLU B 1 62  ? 3.925   6.138   -18.250 1.00 36.89  ? 60  GLU B CA  1 
ATOM   1550 C C   . GLU B 1 62  ? 5.049   6.652   -19.144 1.00 35.60  ? 60  GLU B C   1 
ATOM   1551 O O   . GLU B 1 62  ? 5.211   6.189   -20.261 1.00 35.81  ? 60  GLU B O   1 
ATOM   1552 C CB  . GLU B 1 62  ? 2.767   7.136   -18.232 1.00 39.99  ? 60  GLU B CB  1 
ATOM   1553 C CG  . GLU B 1 62  ? 2.369   7.606   -19.618 1.00 45.33  ? 60  GLU B CG  1 
ATOM   1554 C CD  . GLU B 1 62  ? 1.241   8.624   -19.598 1.00 54.52  ? 60  GLU B CD  1 
ATOM   1555 O OE1 . GLU B 1 62  ? 1.445   9.710   -19.018 1.00 59.01  ? 60  GLU B OE1 1 
ATOM   1556 O OE2 . GLU B 1 62  ? 0.191   8.377   -20.238 1.00 52.51  ? 60  GLU B OE2 1 
ATOM   1557 N N   . TRP B 1 63  ? 5.881   7.533   -18.608 1.00 33.76  ? 61  TRP B N   1 
ATOM   1558 C CA  . TRP B 1 63  ? 6.935   8.187   -19.380 1.00 34.30  ? 61  TRP B CA  1 
ATOM   1559 C C   . TRP B 1 63  ? 8.068   7.217   -19.757 1.00 32.47  ? 61  TRP B C   1 
ATOM   1560 O O   . TRP B 1 63  ? 8.673   7.343   -20.815 1.00 30.38  ? 61  TRP B O   1 
ATOM   1561 C CB  . TRP B 1 63  ? 7.473   9.391   -18.596 1.00 32.57  ? 61  TRP B CB  1 
ATOM   1562 C CG  . TRP B 1 63  ? 8.682   10.059  -19.188 1.00 36.03  ? 61  TRP B CG  1 
ATOM   1563 C CD1 . TRP B 1 63  ? 9.827   10.406  -18.520 1.00 30.60  ? 61  TRP B CD1 1 
ATOM   1564 C CD2 . TRP B 1 63  ? 8.785   10.665  -20.495 1.00 38.05  ? 61  TRP B CD2 1 
ATOM   1565 N NE1 . TRP B 1 63  ? 10.632  11.177  -19.329 1.00 35.56  ? 61  TRP B NE1 1 
ATOM   1566 C CE2 . TRP B 1 63  ? 10.028  11.328  -20.552 1.00 33.21  ? 61  TRP B CE2 1 
ATOM   1567 C CE3 . TRP B 1 63  ? 7.944   10.711  -21.616 1.00 39.48  ? 61  TRP B CE3 1 
ATOM   1568 C CZ2 . TRP B 1 63  ? 10.465  12.003  -21.697 1.00 32.54  ? 61  TRP B CZ2 1 
ATOM   1569 C CZ3 . TRP B 1 63  ? 8.378   11.399  -22.751 1.00 34.94  ? 61  TRP B CZ3 1 
ATOM   1570 C CH2 . TRP B 1 63  ? 9.662   11.957  -22.805 1.00 32.90  ? 61  TRP B CH2 1 
ATOM   1571 N N   . GLU B 1 64  ? 8.284   6.204   -18.924 1.00 31.20  ? 62  GLU B N   1 
ATOM   1572 C CA  . GLU B 1 64  ? 9.129   5.073   -19.289 1.00 29.52  ? 62  GLU B CA  1 
ATOM   1573 C C   . GLU B 1 64  ? 8.598   4.311   -20.513 1.00 29.65  ? 62  GLU B C   1 
ATOM   1574 O O   . GLU B 1 64  ? 9.355   3.974   -21.420 1.00 30.94  ? 62  GLU B O   1 
ATOM   1575 C CB  . GLU B 1 64  ? 9.250   4.125   -18.095 1.00 26.48  ? 62  GLU B CB  1 
ATOM   1576 C CG  . GLU B 1 64  ? 10.147  2.932   -18.365 1.00 23.44  ? 62  GLU B CG  1 
ATOM   1577 C CD  . GLU B 1 64  ? 10.510  2.186   -17.100 1.00 26.72  ? 62  GLU B CD  1 
ATOM   1578 O OE1 . GLU B 1 64  ? 11.708  2.126   -16.769 1.00 23.96  ? 62  GLU B OE1 1 
ATOM   1579 O OE2 . GLU B 1 64  ? 9.582   1.809   -16.355 1.00 28.27  ? 62  GLU B OE2 1 
ATOM   1580 N N   . ALA B 1 65  ? 7.290   4.047   -20.521 1.00 31.91  ? 63  ALA B N   1 
ATOM   1581 C CA  . ALA B 1 65  ? 6.632   3.288   -21.581 1.00 31.31  ? 63  ALA B CA  1 
ATOM   1582 C C   . ALA B 1 65  ? 6.566   4.104   -22.874 1.00 31.10  ? 63  ALA B C   1 
ATOM   1583 O O   . ALA B 1 65  ? 6.706   3.565   -23.973 1.00 32.79  ? 63  ALA B O   1 
ATOM   1584 C CB  . ALA B 1 65  ? 5.220   2.886   -21.132 1.00 29.32  ? 63  ALA B CB  1 
ATOM   1585 N N   . ILE B 1 66  ? 6.301   5.400   -22.725 1.00 30.59  ? 64  ILE B N   1 
ATOM   1586 C CA  . ILE B 1 66  ? 6.224   6.336   -23.843 1.00 29.52  ? 64  ILE B CA  1 
ATOM   1587 C C   . ILE B 1 66  ? 7.556   6.460   -24.597 1.00 29.12  ? 64  ILE B C   1 
ATOM   1588 O O   . ILE B 1 66  ? 7.625   6.164   -25.781 1.00 31.58  ? 64  ILE B O   1 
ATOM   1589 C CB  . ILE B 1 66  ? 5.678   7.710   -23.380 1.00 29.99  ? 64  ILE B CB  1 
ATOM   1590 C CG1 . ILE B 1 66  ? 4.193   7.574   -23.019 1.00 36.63  ? 64  ILE B CG1 1 
ATOM   1591 C CG2 . ILE B 1 66  ? 5.864   8.813   -24.473 1.00 24.25  ? 64  ILE B CG2 1 
ATOM   1592 C CD1 . ILE B 1 66  ? 3.290   7.174   -24.201 1.00 39.86  ? 64  ILE B CD1 1 
ATOM   1593 N N   . GLN B 1 67  ? 8.639   6.685   -23.865 1.00 30.91  ? 65  GLN B N   1 
ATOM   1594 C CA  . GLN B 1 67  ? 9.979   6.669   -24.451 1.00 28.29  ? 65  GLN B CA  1 
ATOM   1595 C C   . GLN B 1 67  ? 10.335  5.378   -25.179 1.00 28.68  ? 65  GLN B C   1 
ATOM   1596 O O   . GLN B 1 67  ? 11.058  5.419   -26.177 1.00 29.49  ? 65  GLN B O   1 
ATOM   1597 C CB  . GLN B 1 67  ? 11.026  6.943   -23.377 1.00 28.32  ? 65  GLN B CB  1 
ATOM   1598 C CG  . GLN B 1 67  ? 10.990  8.341   -22.832 1.00 29.71  ? 65  GLN B CG  1 
ATOM   1599 C CD  . GLN B 1 67  ? 12.057  8.581   -21.804 1.00 30.36  ? 65  GLN B CD  1 
ATOM   1600 O OE1 . GLN B 1 67  ? 13.116  9.141   -22.103 1.00 35.21  ? 65  GLN B OE1 1 
ATOM   1601 N NE2 . GLN B 1 67  ? 11.755  8.236   -20.559 1.00 27.74  ? 65  GLN B NE2 1 
ATOM   1602 N N   . ALA B 1 68  ? 10.038  4.239   -24.551 1.00 28.18  ? 66  ALA B N   1 
ATOM   1603 C CA  . ALA B 1 68  ? 10.250  2.927   -25.177 1.00 27.71  ? 66  ALA B CA  1 
ATOM   1604 C C   . ALA B 1 68  ? 9.471   2.707   -26.490 1.00 27.61  ? 66  ALA B C   1 
ATOM   1605 O O   . ALA B 1 68  ? 9.960   2.031   -27.392 1.00 27.58  ? 66  ALA B O   1 
ATOM   1606 C CB  . ALA B 1 68  ? 9.955   1.804   -24.181 1.00 23.23  ? 66  ALA B CB  1 
ATOM   1607 N N   . LEU B 1 69  ? 8.225   3.182   -26.555 1.00 28.05  ? 67  LEU B N   1 
ATOM   1608 C CA  . LEU B 1 69  ? 7.438   3.069   -27.786 1.00 29.53  ? 67  LEU B CA  1 
ATOM   1609 C C   . LEU B 1 69  ? 7.980   3.999   -28.858 1.00 29.84  ? 67  LEU B C   1 
ATOM   1610 O O   . LEU B 1 69  ? 7.836   3.722   -30.043 1.00 27.56  ? 67  LEU B O   1 
ATOM   1611 C CB  . LEU B 1 69  ? 5.955   3.382   -27.544 1.00 29.84  ? 67  LEU B CB  1 
ATOM   1612 C CG  . LEU B 1 69  ? 5.102   2.316   -26.849 1.00 34.23  ? 67  LEU B CG  1 
ATOM   1613 C CD1 . LEU B 1 69  ? 3.860   2.952   -26.223 1.00 31.48  ? 67  LEU B CD1 1 
ATOM   1614 C CD2 . LEU B 1 69  ? 4.709   1.196   -27.806 1.00 25.86  ? 67  LEU B CD2 1 
ATOM   1615 N N   . THR B 1 70  ? 8.595   5.102   -28.433 1.00 28.02  ? 68  THR B N   1 
ATOM   1616 C CA  . THR B 1 70  ? 9.422   5.922   -29.318 1.00 29.41  ? 68  THR B CA  1 
ATOM   1617 C C   . THR B 1 70  ? 10.694  5.227   -29.822 1.00 29.79  ? 68  THR B C   1 
ATOM   1618 O O   . THR B 1 70  ? 11.092  5.420   -30.973 1.00 28.67  ? 68  THR B O   1 
ATOM   1619 C CB  . THR B 1 70  ? 9.799   7.260   -28.645 1.00 33.14  ? 68  THR B CB  1 
ATOM   1620 O OG1 . THR B 1 70  ? 8.615   7.882   -28.132 1.00 38.67  ? 68  THR B OG1 1 
ATOM   1621 C CG2 . THR B 1 70  ? 10.470  8.195   -29.633 1.00 30.77  ? 68  THR B CG2 1 
ATOM   1622 N N   . VAL B 1 71  ? 11.384  4.501   -28.941 1.00 26.39  ? 69  VAL B N   1 
ATOM   1623 C CA  . VAL B 1 71  ? 12.498  3.662   -29.379 1.00 26.85  ? 69  VAL B CA  1 
ATOM   1624 C C   . VAL B 1 71  ? 12.038  2.656   -30.437 1.00 25.44  ? 69  VAL B C   1 
ATOM   1625 O O   . VAL B 1 71  ? 12.654  2.533   -31.489 1.00 26.55  ? 69  VAL B O   1 
ATOM   1626 C CB  . VAL B 1 71  ? 13.173  2.867   -28.217 1.00 28.61  ? 69  VAL B CB  1 
ATOM   1627 C CG1 . VAL B 1 71  ? 14.227  1.925   -28.798 1.00 25.46  ? 69  VAL B CG1 1 
ATOM   1628 C CG2 . VAL B 1 71  ? 13.825  3.815   -27.190 1.00 21.96  ? 69  VAL B CG2 1 
ATOM   1629 N N   . LEU B 1 72  ? 11.020  1.869   -30.097 1.00 25.95  ? 70  LEU B N   1 
ATOM   1630 C CA  . LEU B 1 72  ? 10.401  0.924   -31.029 1.00 23.23  ? 70  LEU B CA  1 
ATOM   1631 C C   . LEU B 1 72  ? 10.048  1.575   -32.360 1.00 25.32  ? 70  LEU B C   1 
ATOM   1632 O O   . LEU B 1 72  ? 10.344  1.011   -33.422 1.00 23.76  ? 70  LEU B O   1 
ATOM   1633 C CB  . LEU B 1 72  ? 9.151   0.299   -30.410 1.00 21.87  ? 70  LEU B CB  1 
ATOM   1634 C CG  . LEU B 1 72  ? 8.322   -0.717  -31.209 1.00 26.73  ? 70  LEU B CG  1 
ATOM   1635 C CD1 . LEU B 1 72  ? 9.139   -1.966  -31.545 1.00 22.73  ? 70  LEU B CD1 1 
ATOM   1636 C CD2 . LEU B 1 72  ? 7.025   -1.080  -30.453 1.00 15.57  ? 70  LEU B CD2 1 
ATOM   1637 N N   . GLU B 1 73  ? 9.275   2.662   -32.298 1.00 27.54  ? 71  GLU B N   1 
ATOM   1638 C CA  . GLU B 1 73  ? 8.897   3.422   -33.506 1.00 32.00  ? 71  GLU B CA  1 
ATOM   1639 C C   . GLU B 1 73  ? 10.100  3.738   -34.396 1.00 32.50  ? 71  GLU B C   1 
ATOM   1640 O O   . GLU B 1 73  ? 10.061  3.518   -35.612 1.00 33.12  ? 71  GLU B O   1 
ATOM   1641 C CB  . GLU B 1 73  ? 8.182   4.731   -33.135 1.00 33.51  ? 71  GLU B CB  1 
ATOM   1642 C CG  . GLU B 1 73  ? 7.751   5.573   -34.364 1.00 38.61  ? 71  GLU B CG  1 
ATOM   1643 C CD  . GLU B 1 73  ? 7.024   6.863   -33.983 1.00 46.24  ? 71  GLU B CD  1 
ATOM   1644 O OE1 . GLU B 1 73  ? 7.042   7.249   -32.788 1.00 39.68  ? 71  GLU B OE1 1 
ATOM   1645 O OE2 . GLU B 1 73  ? 6.418   7.482   -34.881 1.00 47.19  ? 71  GLU B OE2 1 
ATOM   1646 N N   . THR B 1 74  ? 11.137  4.302   -33.774 1.00 32.07  ? 72  THR B N   1 
ATOM   1647 C CA  . THR B 1 74  ? 12.369  4.707   -34.445 1.00 33.46  ? 72  THR B CA  1 
ATOM   1648 C C   . THR B 1 74  ? 13.115  3.547   -35.113 1.00 35.04  ? 72  THR B C   1 
ATOM   1649 O O   . THR B 1 74  ? 13.610  3.688   -36.241 1.00 38.08  ? 72  THR B O   1 
ATOM   1650 C CB  . THR B 1 74  ? 13.321  5.445   -33.472 1.00 35.20  ? 72  THR B CB  1 
ATOM   1651 O OG1 . THR B 1 74  ? 12.618  6.515   -32.825 1.00 34.52  ? 72  THR B OG1 1 
ATOM   1652 C CG2 . THR B 1 74  ? 14.532  6.005   -34.208 1.00 34.11  ? 72  THR B CG2 1 
ATOM   1653 N N   . CYS B 1 75  ? 13.245  2.424   -34.411 1.00 28.16  ? 73  CYS B N   1 
ATOM   1654 C CA  . CYS B 1 75  ? 14.005  1.300   -34.940 1.00 27.91  ? 73  CYS B CA  1 
ATOM   1655 C C   . CYS B 1 75  ? 13.220  0.592   -36.058 1.00 27.59  ? 73  CYS B C   1 
ATOM   1656 O O   . CYS B 1 75  ? 13.803  0.046   -37.001 1.00 25.96  ? 73  CYS B O   1 
ATOM   1657 C CB  . CYS B 1 75  ? 14.327  0.279   -33.843 1.00 30.72  ? 73  CYS B CB  1 
ATOM   1658 S SG  . CYS B 1 75  ? 15.306  0.779   -32.380 1.00 29.91  ? 73  CYS B SG  1 
ATOM   1659 N N   . MET B 1 76  ? 11.908  0.486   -35.887 1.00 23.95  ? 74  MET B N   1 
ATOM   1660 C CA  . MET B 1 76  ? 11.077  0.003   -36.970 1.00 26.21  ? 74  MET B CA  1 
ATOM   1661 C C   . MET B 1 76  ? 11.199  0.867   -38.242 1.00 27.58  ? 74  MET B C   1 
ATOM   1662 O O   . MET B 1 76  ? 11.088  0.361   -39.352 1.00 27.44  ? 74  MET B O   1 
ATOM   1663 C CB  . MET B 1 76  ? 9.619   -0.131  -36.526 1.00 26.20  ? 74  MET B CB  1 
ATOM   1664 C CG  . MET B 1 76  ? 9.278   -1.418  -35.767 1.00 27.16  ? 74  MET B CG  1 
ATOM   1665 S SD  . MET B 1 76  ? 9.727   -2.949  -36.598 1.00 28.09  ? 74  MET B SD  1 
ATOM   1666 C CE  . MET B 1 76  ? 8.273   -3.155  -37.613 1.00 26.68  ? 74  MET B CE  1 
ATOM   1667 N N   . LYS B 1 77  ? 11.474  2.158   -38.084 1.00 31.58  ? 75  LYS B N   1 
ATOM   1668 C CA  . LYS B 1 77  ? 11.518  3.055   -39.238 1.00 35.37  ? 75  LYS B CA  1 
ATOM   1669 C C   . LYS B 1 77  ? 12.799  2.891   -40.048 1.00 36.14  ? 75  LYS B C   1 
ATOM   1670 O O   . LYS B 1 77  ? 12.956  3.482   -41.115 1.00 39.23  ? 75  LYS B O   1 
ATOM   1671 C CB  . LYS B 1 77  ? 11.345  4.512   -38.809 1.00 33.50  ? 75  LYS B CB  1 
ATOM   1672 C CG  . LYS B 1 77  ? 9.898   4.909   -38.658 1.00 37.00  ? 75  LYS B CG  1 
ATOM   1673 C CD  . LYS B 1 77  ? 9.757   6.407   -38.423 1.00 49.51  ? 75  LYS B CD  1 
ATOM   1674 C CE  . LYS B 1 77  ? 8.298   6.824   -38.537 1.00 52.13  ? 75  LYS B CE  1 
ATOM   1675 N NZ  . LYS B 1 77  ? 8.133   8.277   -38.308 1.00 60.89  ? 75  LYS B NZ  1 
ATOM   1676 N N   . SER B 1 78  ? 13.782  2.241   -39.455 1.00 33.59  ? 76  SER B N   1 
ATOM   1677 C CA  . SER B 1 78  ? 15.048  2.081   -40.124 1.00 38.08  ? 76  SER B CA  1 
ATOM   1678 C C   . SER B 1 78  ? 15.055  0.749   -40.864 1.00 40.51  ? 76  SER B C   1 
ATOM   1679 O O   . SER B 1 78  ? 14.145  -0.058  -40.730 1.00 39.26  ? 76  SER B O   1 
ATOM   1680 C CB  . SER B 1 78  ? 16.202  2.171   -39.122 1.00 40.12  ? 76  SER B CB  1 
ATOM   1681 O OG  . SER B 1 78  ? 17.042  1.043   -39.226 1.00 43.48  ? 76  SER B OG  1 
ATOM   1682 N N   . CYS B 1 79  ? 16.071  0.530   -41.678 1.00 45.01  ? 77  CYS B N   1 
ATOM   1683 C CA  . CYS B 1 79  ? 15.962  -0.418  -42.771 1.00 44.94  ? 77  CYS B CA  1 
ATOM   1684 C C   . CYS B 1 79  ? 15.837  -1.899  -42.442 1.00 43.86  ? 77  CYS B C   1 
ATOM   1685 O O   . CYS B 1 79  ? 15.204  -2.641  -43.201 1.00 42.56  ? 77  CYS B O   1 
ATOM   1686 C CB  . CYS B 1 79  ? 17.082  -0.205  -43.777 1.00 48.11  ? 77  CYS B CB  1 
ATOM   1687 S SG  . CYS B 1 79  ? 16.511  0.679   -45.176 1.00 51.42  ? 77  CYS B SG  1 
ATOM   1688 N N   . GLY B 1 80  ? 16.588  -2.349  -41.443 1.00 40.23  ? 78  GLY B N   1 
ATOM   1689 C CA  . GLY B 1 80  ? 16.844  -3.776  -41.237 1.00 44.12  ? 78  GLY B CA  1 
ATOM   1690 C C   . GLY B 1 80  ? 15.637  -4.692  -41.254 1.00 42.65  ? 78  GLY B C   1 
ATOM   1691 O O   . GLY B 1 80  ? 14.678  -4.468  -40.535 1.00 42.55  ? 78  GLY B O   1 
ATOM   1692 N N   . LYS B 1 81  ? 15.782  -5.826  -41.930 1.00 49.35  ? 79  LYS B N   1 
ATOM   1693 C CA  . LYS B 1 81  ? 14.702  -6.793  -42.076 1.00 48.22  ? 79  LYS B CA  1 
ATOM   1694 C C   . LYS B 1 81  ? 14.614  -7.748  -40.877 1.00 44.49  ? 79  LYS B C   1 
ATOM   1695 O O   . LYS B 1 81  ? 13.525  -8.167  -40.494 1.00 41.86  ? 79  LYS B O   1 
ATOM   1696 C CB  . LYS B 1 81  ? 14.880  -7.577  -43.378 1.00 47.76  ? 79  LYS B CB  1 
ATOM   1697 C CG  . LYS B 1 81  ? 14.442  -9.020  -43.299 1.00 55.42  ? 79  LYS B CG  1 
ATOM   1698 C CD  . LYS B 1 81  ? 13.231  -9.291  -44.181 1.00 59.81  ? 79  LYS B CD  1 
ATOM   1699 C CE  . LYS B 1 81  ? 13.416  -10.576 -44.986 1.00 63.35  ? 79  LYS B CE  1 
ATOM   1700 N NZ  . LYS B 1 81  ? 13.278  -11.807 -44.155 1.00 60.25  ? 79  LYS B NZ  1 
ATOM   1701 N N   . ARG B 1 82  ? 15.748  -8.017  -40.240 1.00 40.22  ? 80  ARG B N   1 
ATOM   1702 C CA  . ARG B 1 82  ? 15.760  -8.864  -39.040 1.00 41.80  ? 80  ARG B CA  1 
ATOM   1703 C C   . ARG B 1 82  ? 14.923  -8.295  -37.895 1.00 38.56  ? 80  ARG B C   1 
ATOM   1704 O O   . ARG B 1 82  ? 14.016  -8.957  -37.403 1.00 40.56  ? 80  ARG B O   1 
ATOM   1705 C CB  . ARG B 1 82  ? 17.193  -9.165  -38.587 1.00 42.96  ? 80  ARG B CB  1 
ATOM   1706 C CG  . ARG B 1 82  ? 17.964  -10.068 -39.560 1.00 51.64  ? 80  ARG B CG  1 
ATOM   1707 C CD  . ARG B 1 82  ? 19.296  -10.536 -38.990 1.00 59.70  ? 80  ARG B CD  1 
ATOM   1708 N NE  . ARG B 1 82  ? 20.030  -9.454  -38.338 1.00 66.05  ? 80  ARG B NE  1 
ATOM   1709 C CZ  . ARG B 1 82  ? 20.708  -9.584  -37.198 1.00 71.70  ? 80  ARG B CZ  1 
ATOM   1710 N NH1 . ARG B 1 82  ? 20.729  -10.752 -36.559 1.00 71.58  ? 80  ARG B NH1 1 
ATOM   1711 N NH2 . ARG B 1 82  ? 21.354  -8.542  -36.687 1.00 71.29  ? 80  ARG B NH2 1 
ATOM   1712 N N   . PHE B 1 83  ? 15.076  -7.004  -37.630 1.00 34.00  ? 81  PHE B N   1 
ATOM   1713 C CA  . PHE B 1 83  ? 14.254  -6.341  -36.636 1.00 31.33  ? 81  PHE B CA  1 
ATOM   1714 C C   . PHE B 1 83  ? 12.774  -6.245  -37.031 1.00 29.73  ? 81  PHE B C   1 
ATOM   1715 O O   . PHE B 1 83  ? 11.888  -6.536  -36.226 1.00 26.59  ? 81  PHE B O   1 
ATOM   1716 C CB  . PHE B 1 83  ? 14.833  -4.968  -36.267 1.00 30.26  ? 81  PHE B CB  1 
ATOM   1717 C CG  . PHE B 1 83  ? 14.113  -4.292  -35.126 1.00 32.35  ? 81  PHE B CG  1 
ATOM   1718 C CD1 . PHE B 1 83  ? 14.202  -4.800  -33.830 1.00 26.37  ? 81  PHE B CD1 1 
ATOM   1719 C CD2 . PHE B 1 83  ? 13.231  -3.250  -35.368 1.00 19.93  ? 81  PHE B CD2 1 
ATOM   1720 C CE1 . PHE B 1 83  ? 13.488  -4.218  -32.791 1.00 22.52  ? 81  PHE B CE1 1 
ATOM   1721 C CE2 . PHE B 1 83  ? 12.539  -2.636  -34.316 1.00 19.34  ? 81  PHE B CE2 1 
ATOM   1722 C CZ  . PHE B 1 83  ? 12.631  -3.152  -33.045 1.00 23.04  ? 81  PHE B CZ  1 
ATOM   1723 N N   . HIS B 1 84  ? 12.503  -5.943  -38.296 1.00 29.65  ? 82  HIS B N   1 
ATOM   1724 C CA  . HIS B 1 84  ? 11.131  -6.006  -38.777 1.00 27.96  ? 82  HIS B CA  1 
ATOM   1725 C C   . HIS B 1 84  ? 10.513  -7.384  -38.516 1.00 27.16  ? 82  HIS B C   1 
ATOM   1726 O O   . HIS B 1 84  ? 9.349   -7.479  -38.132 1.00 27.35  ? 82  HIS B O   1 
ATOM   1727 C CB  . HIS B 1 84  ? 11.040  -5.620  -40.260 1.00 27.95  ? 82  HIS B CB  1 
ATOM   1728 C CG  . HIS B 1 84  ? 11.351  -4.179  -40.534 1.00 23.34  ? 82  HIS B CG  1 
ATOM   1729 N ND1 . HIS B 1 84  ? 11.691  -3.716  -41.786 1.00 30.33  ? 82  HIS B ND1 1 
ATOM   1730 C CD2 . HIS B 1 84  ? 11.340  -3.092  -39.725 1.00 27.46  ? 82  HIS B CD2 1 
ATOM   1731 C CE1 . HIS B 1 84  ? 11.928  -2.417  -41.726 1.00 28.85  ? 82  HIS B CE1 1 
ATOM   1732 N NE2 . HIS B 1 84  ? 11.692  -2.009  -40.492 1.00 29.91  ? 82  HIS B NE2 1 
ATOM   1733 N N   . ASP B 1 85  ? 11.266  -8.441  -38.819 1.00 31.47  ? 83  ASP B N   1 
ATOM   1734 C CA  . ASP B 1 85  ? 10.820  -9.812  -38.592 1.00 32.92  ? 83  ASP B CA  1 
ATOM   1735 C C   . ASP B 1 85  ? 10.607  -10.152 -37.105 1.00 33.05  ? 83  ASP B C   1 
ATOM   1736 O O   . ASP B 1 85  ? 9.709   -10.928 -36.779 1.00 36.28  ? 83  ASP B O   1 
ATOM   1737 C CB  . ASP B 1 85  ? 11.788  -10.822 -39.214 1.00 32.46  ? 83  ASP B CB  1 
ATOM   1738 C CG  . ASP B 1 85  ? 11.790  -10.795 -40.743 1.00 41.05  ? 83  ASP B CG  1 
ATOM   1739 O OD1 . ASP B 1 85  ? 12.729  -11.390 -41.327 1.00 41.34  ? 83  ASP B OD1 1 
ATOM   1740 O OD2 . ASP B 1 85  ? 10.875  -10.198 -41.362 1.00 32.07  ? 83  ASP B OD2 1 
ATOM   1741 N N   . GLU B 1 86  ? 11.524  -9.728  -36.238 1.00 29.64  ? 84  GLU B N   1 
ATOM   1742 C CA  . GLU B 1 86  ? 11.383  -9.994  -34.801 1.00 30.37  ? 84  GLU B CA  1 
ATOM   1743 C C   . GLU B 1 86  ? 10.093  -9.379  -34.268 1.00 28.63  ? 84  GLU B C   1 
ATOM   1744 O O   . GLU B 1 86  ? 9.390   -9.985  -33.462 1.00 27.82  ? 84  GLU B O   1 
ATOM   1745 C CB  . GLU B 1 86  ? 12.576  -9.439  -34.011 1.00 29.26  ? 84  GLU B CB  1 
ATOM   1746 C CG  . GLU B 1 86  ? 13.788  -10.356 -33.935 1.00 38.89  ? 84  GLU B CG  1 
ATOM   1747 C CD  . GLU B 1 86  ? 13.466  -11.735 -33.381 1.00 44.54  ? 84  GLU B CD  1 
ATOM   1748 O OE1 . GLU B 1 86  ? 12.728  -11.831 -32.375 1.00 48.94  ? 84  GLU B OE1 1 
ATOM   1749 O OE2 . GLU B 1 86  ? 13.950  -12.730 -33.963 1.00 42.36  ? 84  GLU B OE2 1 
ATOM   1750 N N   . VAL B 1 87  ? 9.883   -8.109  -34.597 1.00 29.59  ? 85  VAL B N   1 
ATOM   1751 C CA  . VAL B 1 87  ? 8.694   -7.380  -34.177 1.00 27.78  ? 85  VAL B CA  1 
ATOM   1752 C C   . VAL B 1 87  ? 7.423   -7.968  -34.785 1.00 31.83  ? 85  VAL B C   1 
ATOM   1753 O O   . VAL B 1 87  ? 6.379   -8.002  -34.136 1.00 32.80  ? 85  VAL B O   1 
ATOM   1754 C CB  . VAL B 1 87  ? 8.802   -5.894  -34.552 1.00 27.96  ? 85  VAL B CB  1 
ATOM   1755 C CG1 . VAL B 1 87  ? 7.431   -5.212  -34.475 1.00 23.74  ? 85  VAL B CG1 1 
ATOM   1756 C CG2 . VAL B 1 87  ? 9.798   -5.193  -33.640 1.00 23.24  ? 85  VAL B CG2 1 
ATOM   1757 N N   . GLY B 1 88  ? 7.556   -8.582  -35.958 1.00 35.19  ? 86  GLY B N   1 
ATOM   1758 C CA  . GLY B 1 88  ? 6.421   -9.202  -36.618 1.00 35.20  ? 86  GLY B CA  1 
ATOM   1759 C C   . GLY B 1 88  ? 6.230   -10.654 -36.231 1.00 39.51  ? 86  GLY B C   1 
ATOM   1760 O O   . GLY B 1 88  ? 5.748   -11.452 -37.037 1.00 41.20  ? 86  GLY B O   1 
ATOM   1761 N N   . LYS B 1 89  ? 6.684   -11.014 -35.032 1.00 34.85  ? 87  LYS B N   1 
ATOM   1762 C CA  . LYS B 1 89  ? 6.303   -12.280 -34.400 1.00 35.71  ? 87  LYS B CA  1 
ATOM   1763 C C   . LYS B 1 89  ? 5.266   -12.015 -33.316 1.00 34.90  ? 87  LYS B C   1 
ATOM   1764 O O   . LYS B 1 89  ? 5.397   -11.062 -32.548 1.00 33.41  ? 87  LYS B O   1 
ATOM   1765 C CB  . LYS B 1 89  ? 7.527   -12.967 -33.766 1.00 35.66  ? 87  LYS B CB  1 
ATOM   1766 C CG  . LYS B 1 89  ? 8.509   -13.578 -34.773 1.00 39.56  ? 87  LYS B CG  1 
ATOM   1767 C CD  . LYS B 1 89  ? 9.866   -13.854 -34.129 1.00 37.66  ? 87  LYS B CD  1 
ATOM   1768 C CE  . LYS B 1 89  ? 10.822  -14.458 -35.141 1.00 48.41  ? 87  LYS B CE  1 
ATOM   1769 N NZ  . LYS B 1 89  ? 12.168  -14.775 -34.574 1.00 49.61  ? 87  LYS B NZ  1 
ATOM   1770 N N   . PHE B 1 90  ? 4.353   -12.967 -33.142 1.00 42.39  ? 88  PHE B N   1 
ATOM   1771 C CA  . PHE B 1 90  ? 3.454   -13.003 -31.991 1.00 41.05  ? 88  PHE B CA  1 
ATOM   1772 C C   . PHE B 1 90  ? 4.198   -12.935 -30.652 1.00 41.79  ? 88  PHE B C   1 
ATOM   1773 O O   . PHE B 1 90  ? 3.667   -12.416 -29.669 1.00 44.78  ? 88  PHE B O   1 
ATOM   1774 C CB  . PHE B 1 90  ? 2.576   -14.263 -32.041 1.00 44.53  ? 88  PHE B CB  1 
ATOM   1775 C CG  . PHE B 1 90  ? 1.636   -14.300 -33.217 1.00 45.20  ? 88  PHE B CG  1 
ATOM   1776 C CD1 . PHE B 1 90  ? 0.875   -13.189 -33.546 1.00 45.34  ? 88  PHE B CD1 1 
ATOM   1777 C CD2 . PHE B 1 90  ? 1.613   -15.397 -34.067 1.00 49.01  ? 88  PHE B CD2 1 
ATOM   1778 C CE1 . PHE B 1 90  ? 0.109   -13.171 -34.697 1.00 44.65  ? 88  PHE B CE1 1 
ATOM   1779 C CE2 . PHE B 1 90  ? 0.822   -15.399 -35.203 1.00 50.65  ? 88  PHE B CE2 1 
ATOM   1780 C CZ  . PHE B 1 90  ? 0.057   -14.292 -35.510 1.00 49.43  ? 88  PHE B CZ  1 
ATOM   1781 N N   . ARG B 1 91  ? 5.369   -13.557 -30.578 1.00 34.77  ? 89  ARG B N   1 
ATOM   1782 C CA  . ARG B 1 91  ? 6.170   -13.497 -29.365 1.00 36.87  ? 89  ARG B CA  1 
ATOM   1783 C C   . ARG B 1 91  ? 6.359   -12.053 -28.875 1.00 34.68  ? 89  ARG B C   1 
ATOM   1784 O O   . ARG B 1 91  ? 6.373   -11.786 -27.666 1.00 34.31  ? 89  ARG B O   1 
ATOM   1785 C CB  . ARG B 1 91  ? 7.528   -14.177 -29.582 1.00 37.71  ? 89  ARG B CB  1 
ATOM   1786 C CG  . ARG B 1 91  ? 8.561   -13.857 -28.500 1.00 42.20  ? 89  ARG B CG  1 
ATOM   1787 C CD  . ARG B 1 91  ? 9.766   -14.779 -28.581 1.00 52.09  ? 89  ARG B CD  1 
ATOM   1788 N NE  . ARG B 1 91  ? 9.376   -16.181 -28.696 1.00 52.64  ? 89  ARG B NE  1 
ATOM   1789 C CZ  . ARG B 1 91  ? 9.583   -16.928 -29.776 1.00 61.51  ? 89  ARG B CZ  1 
ATOM   1790 N NH1 . ARG B 1 91  ? 10.244  -16.431 -30.814 1.00 59.18  ? 89  ARG B NH1 1 
ATOM   1791 N NH2 . ARG B 1 91  ? 9.135   -18.176 -29.816 1.00 66.09  ? 89  ARG B NH2 1 
ATOM   1792 N N   . PHE B 1 92  ? 6.552   -11.133 -29.815 1.00 35.99  ? 90  PHE B N   1 
ATOM   1793 C CA  . PHE B 1 92  ? 6.520   -9.705  -29.505 1.00 33.14  ? 90  PHE B CA  1 
ATOM   1794 C C   . PHE B 1 92  ? 5.123   -9.091  -29.515 1.00 32.87  ? 90  PHE B C   1 
ATOM   1795 O O   . PHE B 1 92  ? 4.807   -8.257  -28.663 1.00 33.92  ? 90  PHE B O   1 
ATOM   1796 C CB  . PHE B 1 92  ? 7.445   -8.908  -30.431 1.00 32.91  ? 90  PHE B CB  1 
ATOM   1797 C CG  . PHE B 1 92  ? 7.572   -7.457  -30.049 1.00 28.57  ? 90  PHE B CG  1 
ATOM   1798 C CD1 . PHE B 1 92  ? 8.225   -7.095  -28.882 1.00 31.52  ? 90  PHE B CD1 1 
ATOM   1799 C CD2 . PHE B 1 92  ? 6.896   -6.481  -30.758 1.00 32.83  ? 90  PHE B CD2 1 
ATOM   1800 C CE1 . PHE B 1 92  ? 8.275   -5.778  -28.471 1.00 23.13  ? 90  PHE B CE1 1 
ATOM   1801 C CE2 . PHE B 1 92  ? 6.982   -5.149  -30.380 1.00 37.09  ? 90  PHE B CE2 1 
ATOM   1802 C CZ  . PHE B 1 92  ? 7.664   -4.799  -29.225 1.00 29.74  ? 90  PHE B CZ  1 
ATOM   1803 N N   . LEU B 1 93  ? 4.373   -9.350  -30.581 1.00 32.26  ? 91  LEU B N   1 
ATOM   1804 C CA  . LEU B 1 93  ? 3.068   -8.715  -30.788 1.00 33.56  ? 91  LEU B CA  1 
ATOM   1805 C C   . LEU B 1 93  ? 2.161   -8.961  -29.576 1.00 35.51  ? 91  LEU B C   1 
ATOM   1806 O O   . LEU B 1 93  ? 1.348   -8.110  -29.210 1.00 35.88  ? 91  LEU B O   1 
ATOM   1807 C CB  . LEU B 1 93  ? 2.397   -9.290  -32.044 1.00 34.12  ? 91  LEU B CB  1 
ATOM   1808 C CG  . LEU B 1 93  ? 2.483   -8.616  -33.416 1.00 35.55  ? 91  LEU B CG  1 
ATOM   1809 C CD1 . LEU B 1 93  ? 3.378   -7.379  -33.475 1.00 29.66  ? 91  LEU B CD1 1 
ATOM   1810 C CD2 . LEU B 1 93  ? 2.812   -9.612  -34.514 1.00 25.65  ? 91  LEU B CD2 1 
ATOM   1811 N N   . ASN B 1 94  ? 2.232   -10.172 -29.037 1.00 35.81  ? 92  ASN B N   1 
ATOM   1812 C CA  . ASN B 1 94  ? 1.427   -10.576 -27.880 1.00 37.90  ? 92  ASN B CA  1 
ATOM   1813 C C   . ASN B 1 94  ? 1.615   -9.665  -26.676 1.00 35.85  ? 92  ASN B C   1 
ATOM   1814 O O   . ASN B 1 94  ? 0.688   -9.460  -25.895 1.00 36.36  ? 92  ASN B O   1 
ATOM   1815 C CB  . ASN B 1 94  ? 1.739   -12.026 -27.492 1.00 34.65  ? 92  ASN B CB  1 
ATOM   1816 C CG  . ASN B 1 94  ? 1.126   -13.029 -28.456 1.00 39.55  ? 92  ASN B CG  1 
ATOM   1817 O OD1 . ASN B 1 94  ? 0.285   -12.672 -29.278 1.00 32.02  ? 92  ASN B OD1 1 
ATOM   1818 N ND2 . ASN B 1 94  ? 1.449   -14.308 -28.273 1.00 41.66  ? 92  ASN B ND2 1 
ATOM   1819 N N   . GLU B 1 95  ? 2.828   -9.137  -26.528 1.00 32.06  ? 93  GLU B N   1 
ATOM   1820 C CA  . GLU B 1 95  ? 3.172   -8.243  -25.421 1.00 30.90  ? 93  GLU B CA  1 
ATOM   1821 C C   . GLU B 1 95  ? 2.480   -6.885  -25.576 1.00 30.91  ? 93  GLU B C   1 
ATOM   1822 O O   . GLU B 1 95  ? 2.142   -6.228  -24.596 1.00 31.19  ? 93  GLU B O   1 
ATOM   1823 C CB  . GLU B 1 95  ? 4.700   -8.059  -25.344 1.00 30.03  ? 93  GLU B CB  1 
ATOM   1824 C CG  . GLU B 1 95  ? 5.486   -9.365  -25.249 1.00 27.57  ? 93  GLU B CG  1 
ATOM   1825 C CD  . GLU B 1 95  ? 5.178   -10.131 -23.969 1.00 37.07  ? 93  GLU B CD  1 
ATOM   1826 O OE1 . GLU B 1 95  ? 5.155   -11.379 -24.003 1.00 43.29  ? 93  GLU B OE1 1 
ATOM   1827 O OE2 . GLU B 1 95  ? 4.835   -9.484  -22.960 1.00 33.81  ? 93  GLU B OE2 1 
ATOM   1828 N N   . LEU B 1 96  ? 2.325   -6.448  -26.820 1.00 29.14  ? 94  LEU B N   1 
ATOM   1829 C CA  . LEU B 1 96  ? 1.660   -5.192  -27.107 1.00 29.84  ? 94  LEU B CA  1 
ATOM   1830 C C   . LEU B 1 96  ? 0.164   -5.367  -26.951 1.00 30.12  ? 94  LEU B C   1 
ATOM   1831 O O   . LEU B 1 96  ? -0.549  -4.431  -26.612 1.00 34.42  ? 94  LEU B O   1 
ATOM   1832 C CB  . LEU B 1 96  ? 1.991   -4.720  -28.527 1.00 28.95  ? 94  LEU B CB  1 
ATOM   1833 C CG  . LEU B 1 96  ? 3.426   -4.300  -28.852 1.00 30.71  ? 94  LEU B CG  1 
ATOM   1834 C CD1 . LEU B 1 96  ? 3.555   -3.941  -30.347 1.00 27.41  ? 94  LEU B CD1 1 
ATOM   1835 C CD2 . LEU B 1 96  ? 3.846   -3.114  -27.975 1.00 25.28  ? 94  LEU B CD2 1 
ATOM   1836 N N   . ILE B 1 97  ? -0.307  -6.567  -27.251 1.00 33.76  ? 95  ILE B N   1 
ATOM   1837 C CA  . ILE B 1 97  ? -1.712  -6.911  -27.090 1.00 36.82  ? 95  ILE B CA  1 
ATOM   1838 C C   . ILE B 1 97  ? -2.122  -6.892  -25.624 1.00 40.12  ? 95  ILE B C   1 
ATOM   1839 O O   . ILE B 1 97  ? -3.209  -6.422  -25.285 1.00 46.23  ? 95  ILE B O   1 
ATOM   1840 C CB  . ILE B 1 97  ? -2.015  -8.295  -27.703 1.00 38.26  ? 95  ILE B CB  1 
ATOM   1841 C CG1 . ILE B 1 97  ? -1.918  -8.235  -29.234 1.00 33.36  ? 95  ILE B CG1 1 
ATOM   1842 C CG2 . ILE B 1 97  ? -3.387  -8.800  -27.257 1.00 42.70  ? 95  ILE B CG2 1 
ATOM   1843 C CD1 . ILE B 1 97  ? -1.968  -9.605  -29.909 1.00 35.69  ? 95  ILE B CD1 1 
ATOM   1844 N N   . LYS B 1 98  ? -1.255  -7.393  -24.746 1.00 41.81  ? 96  LYS B N   1 
ATOM   1845 C CA  . LYS B 1 98  ? -1.524  -7.324  -23.304 1.00 41.08  ? 96  LYS B CA  1 
ATOM   1846 C C   . LYS B 1 98  ? -1.715  -5.883  -22.836 1.00 39.84  ? 96  LYS B C   1 
ATOM   1847 O O   . LYS B 1 98  ? -2.587  -5.599  -22.030 1.00 42.31  ? 96  LYS B O   1 
ATOM   1848 C CB  . LYS B 1 98  ? -0.411  -7.996  -22.496 1.00 36.68  ? 96  LYS B CB  1 
ATOM   1849 C CG  . LYS B 1 98  ? -0.290  -9.494  -22.708 1.00 37.12  ? 96  LYS B CG  1 
ATOM   1850 C CD  . LYS B 1 98  ? 1.034   -10.020 -22.149 1.00 39.29  ? 96  LYS B CD  1 
ATOM   1851 C CE  . LYS B 1 98  ? 1.195   -11.518 -22.385 1.00 45.67  ? 96  LYS B CE  1 
ATOM   1852 N NZ  . LYS B 1 98  ? 2.534   -12.034 -21.944 1.00 45.09  ? 96  LYS B NZ  1 
ATOM   1853 N N   . VAL B 1 99  ? -0.950  -4.963  -23.406 1.00 37.96  ? 97  VAL B N   1 
ATOM   1854 C CA  . VAL B 1 99  ? -1.022  -3.559  -23.011 1.00 36.72  ? 97  VAL B CA  1 
ATOM   1855 C C   . VAL B 1 99  ? -2.356  -2.889  -23.359 1.00 38.64  ? 97  VAL B C   1 
ATOM   1856 O O   . VAL B 1 99  ? -2.881  -2.091  -22.574 1.00 38.47  ? 97  VAL B O   1 
ATOM   1857 C CB  . VAL B 1 99  ? 0.154   -2.748  -23.587 1.00 34.51  ? 97  VAL B CB  1 
ATOM   1858 C CG1 . VAL B 1 99  ? 0.059   -1.304  -23.164 1.00 34.28  ? 97  VAL B CG1 1 
ATOM   1859 C CG2 . VAL B 1 99  ? 1.482   -3.337  -23.120 1.00 31.77  ? 97  VAL B CG2 1 
ATOM   1860 N N   . VAL B 1 100 ? -2.892  -3.204  -24.538 1.00 40.31  ? 98  VAL B N   1 
ATOM   1861 C CA  . VAL B 1 100 ? -4.068  -2.511  -25.059 1.00 41.19  ? 98  VAL B CA  1 
ATOM   1862 C C   . VAL B 1 100 ? -5.371  -3.206  -24.672 1.00 45.13  ? 98  VAL B C   1 
ATOM   1863 O O   . VAL B 1 100 ? -6.450  -2.615  -24.771 1.00 48.88  ? 98  VAL B O   1 
ATOM   1864 C CB  . VAL B 1 100 ? -4.014  -2.342  -26.594 1.00 40.71  ? 98  VAL B CB  1 
ATOM   1865 C CG1 . VAL B 1 100 ? -2.921  -1.374  -26.993 1.00 37.46  ? 98  VAL B CG1 1 
ATOM   1866 C CG2 . VAL B 1 100 ? -3.833  -3.681  -27.275 1.00 41.03  ? 98  VAL B CG2 1 
ATOM   1867 N N   . SER B 1 101 ? -5.276  -4.461  -24.238 1.00 51.33  ? 99  SER B N   1 
ATOM   1868 C CA  . SER B 1 101 ? -6.474  -5.266  -23.988 1.00 54.54  ? 99  SER B CA  1 
ATOM   1869 C C   . SER B 1 101 ? -6.957  -5.114  -22.549 1.00 57.50  ? 99  SER B C   1 
ATOM   1870 O O   . SER B 1 101 ? -6.163  -5.211  -21.603 1.00 53.79  ? 99  SER B O   1 
ATOM   1871 C CB  . SER B 1 101 ? -6.216  -6.743  -24.294 1.00 55.09  ? 99  SER B CB  1 
ATOM   1872 O OG  . SER B 1 101 ? -6.162  -6.983  -25.686 1.00 54.52  ? 99  SER B OG  1 
ATOM   1873 N N   . PRO B 1 102 ? -8.275  -4.935  -22.376 1.00 56.89  ? 100 PRO B N   1 
ATOM   1874 C CA  . PRO B 1 102 ? -8.889  -4.872  -21.056 1.00 61.50  ? 100 PRO B CA  1 
ATOM   1875 C C   . PRO B 1 102 ? -8.941  -6.258  -20.419 1.00 63.87  ? 100 PRO B C   1 
ATOM   1876 O O   . PRO B 1 102 ? -8.877  -6.385  -19.198 1.00 65.54  ? 100 PRO B O   1 
ATOM   1877 C CB  . PRO B 1 102 ? -10.312 -4.365  -21.344 1.00 64.24  ? 100 PRO B CB  1 
ATOM   1878 C CG  . PRO B 1 102 ? -10.405 -4.170  -22.822 1.00 63.55  ? 100 PRO B CG  1 
ATOM   1879 C CD  . PRO B 1 102 ? -9.275  -4.904  -23.451 1.00 59.87  ? 100 PRO B CD  1 
ATOM   1880 N N   . LYS B 1 103 ? -9.014  -7.284  -21.261 1.00 78.64  ? 101 LYS B N   1 
ATOM   1881 C CA  . LYS B 1 103 ? -8.741  -8.659  -20.859 1.00 79.78  ? 101 LYS B CA  1 
ATOM   1882 C C   . LYS B 1 103 ? -7.484  -8.775  -20.003 1.00 77.72  ? 101 LYS B C   1 
ATOM   1883 O O   . LYS B 1 103 ? -7.433  -9.585  -19.077 1.00 78.48  ? 101 LYS B O   1 
ATOM   1884 C CB  . LYS B 1 103 ? -8.604  -9.550  -22.096 1.00 79.68  ? 101 LYS B CB  1 
ATOM   1885 C CG  . LYS B 1 103 ? -8.906  -11.011 -21.836 1.00 86.58  ? 101 LYS B CG  1 
ATOM   1886 C CD  . LYS B 1 103 ? -8.551  -11.877 -23.033 1.00 94.17  ? 101 LYS B CD  1 
ATOM   1887 C CE  . LYS B 1 103 ? -8.870  -13.346 -22.768 1.00 103.38 ? 101 LYS B CE  1 
ATOM   1888 N NZ  . LYS B 1 103 ? -8.279  -13.847 -21.489 1.00 104.61 ? 101 LYS B NZ  1 
ATOM   1889 N N   . TYR B 1 104 ? -6.460  -7.994  -20.346 1.00 65.47  ? 102 TYR B N   1 
ATOM   1890 C CA  . TYR B 1 104 ? -5.147  -8.124  -19.725 1.00 62.13  ? 102 TYR B CA  1 
ATOM   1891 C C   . TYR B 1 104 ? -4.735  -6.869  -18.947 1.00 59.28  ? 102 TYR B C   1 
ATOM   1892 O O   . TYR B 1 104 ? -5.158  -6.675  -17.809 1.00 61.08  ? 102 TYR B O   1 
ATOM   1893 C CB  . TYR B 1 104 ? -4.097  -8.492  -20.775 1.00 62.22  ? 102 TYR B CB  1 
ATOM   1894 C CG  . TYR B 1 104 ? -4.406  -9.776  -21.515 1.00 65.75  ? 102 TYR B CG  1 
ATOM   1895 C CD1 . TYR B 1 104 ? -4.911  -9.750  -22.812 1.00 67.05  ? 102 TYR B CD1 1 
ATOM   1896 C CD2 . TYR B 1 104 ? -4.265  -11.014 -20.888 1.00 69.97  ? 102 TYR B CD2 1 
ATOM   1897 C CE1 . TYR B 1 104 ? -5.240  -10.923 -23.473 1.00 68.46  ? 102 TYR B CE1 1 
ATOM   1898 C CE2 . TYR B 1 104 ? -4.587  -12.190 -21.542 1.00 65.35  ? 102 TYR B CE2 1 
ATOM   1899 C CZ  . TYR B 1 104 ? -5.076  -12.140 -22.831 1.00 69.51  ? 102 TYR B CZ  1 
ATOM   1900 O OH  . TYR B 1 104 ? -5.429  -13.308 -23.473 1.00 73.36  ? 102 TYR B OH  1 
ATOM   1901 N N   . LEU B 1 105 ? -3.871  -6.048  -19.538 1.00 49.37  ? 103 LEU B N   1 
ATOM   1902 C CA  . LEU B 1 105 ? -3.321  -4.883  -18.844 1.00 46.95  ? 103 LEU B CA  1 
ATOM   1903 C C   . LEU B 1 105 ? -4.110  -3.617  -19.183 1.00 47.17  ? 103 LEU B C   1 
ATOM   1904 O O   . LEU B 1 105 ? -3.889  -2.560  -18.589 1.00 46.60  ? 103 LEU B O   1 
ATOM   1905 C CB  . LEU B 1 105 ? -1.848  -4.673  -19.212 1.00 44.59  ? 103 LEU B CB  1 
ATOM   1906 C CG  . LEU B 1 105 ? -0.755  -5.582  -18.643 1.00 48.73  ? 103 LEU B CG  1 
ATOM   1907 C CD1 . LEU B 1 105 ? 0.561   -5.252  -19.351 1.00 44.12  ? 103 LEU B CD1 1 
ATOM   1908 C CD2 . LEU B 1 105 ? -0.607  -5.397  -17.117 1.00 43.77  ? 103 LEU B CD2 1 
ATOM   1909 N N   . GLY B 1 106 ? -4.974  -3.710  -20.192 1.00 55.81  ? 104 GLY B N   1 
ATOM   1910 C CA  . GLY B 1 106 ? -5.642  -2.529  -20.741 1.00 57.83  ? 104 GLY B CA  1 
ATOM   1911 C C   . GLY B 1 106 ? -6.264  -1.627  -19.685 1.00 62.54  ? 104 GLY B C   1 
ATOM   1912 O O   . GLY B 1 106 ? -6.235  -0.396  -19.812 1.00 62.61  ? 104 GLY B O   1 
ATOM   1913 N N   . SER B 1 107 ? -6.831  -2.237  -18.644 1.00 54.32  ? 105 SER B N   1 
ATOM   1914 C CA  . SER B 1 107 ? -7.596  -1.499  -17.646 1.00 58.96  ? 105 SER B CA  1 
ATOM   1915 C C   . SER B 1 107 ? -6.720  -0.543  -16.849 1.00 57.68  ? 105 SER B C   1 
ATOM   1916 O O   . SER B 1 107 ? -7.206  0.460   -16.336 1.00 58.87  ? 105 SER B O   1 
ATOM   1917 C CB  . SER B 1 107 ? -8.318  -2.457  -16.696 1.00 62.21  ? 105 SER B CB  1 
ATOM   1918 O OG  . SER B 1 107 ? -8.878  -3.550  -17.404 1.00 69.13  ? 105 SER B OG  1 
ATOM   1919 N N   . ARG B 1 108 ? -5.415  -0.812  -16.824 1.00 68.31  ? 106 ARG B N   1 
ATOM   1920 C CA  . ARG B 1 108 ? -4.483  -0.039  -16.007 1.00 68.71  ? 106 ARG B CA  1 
ATOM   1921 C C   . ARG B 1 108 ? -3.609  0.909   -16.827 1.00 66.51  ? 106 ARG B C   1 
ATOM   1922 O O   . ARG B 1 108 ? -2.965  1.798   -16.273 1.00 68.79  ? 106 ARG B O   1 
ATOM   1923 C CB  . ARG B 1 108 ? -3.606  -0.969  -15.164 1.00 67.31  ? 106 ARG B CB  1 
ATOM   1924 C CG  . ARG B 1 108 ? -4.151  -1.216  -13.760 1.00 75.96  ? 106 ARG B CG  1 
ATOM   1925 C CD  . ARG B 1 108 ? -3.515  -2.438  -13.110 1.00 84.81  ? 106 ARG B CD  1 
ATOM   1926 N NE  . ARG B 1 108 ? -3.355  -3.556  -14.040 1.00 86.90  ? 106 ARG B NE  1 
ATOM   1927 C CZ  . ARG B 1 108 ? -4.341  -4.371  -14.409 1.00 88.20  ? 106 ARG B CZ  1 
ATOM   1928 N NH1 . ARG B 1 108 ? -5.576  -4.165  -13.967 1.00 90.57  ? 106 ARG B NH1 1 
ATOM   1929 N NH2 . ARG B 1 108 ? -4.102  -5.370  -15.249 1.00 85.40  ? 106 ARG B NH2 1 
ATOM   1930 N N   . THR B 1 109 ? -3.583  0.719   -18.142 1.00 54.24  ? 107 THR B N   1 
ATOM   1931 C CA  . THR B 1 109 ? -2.721  1.516   -19.022 1.00 49.15  ? 107 THR B CA  1 
ATOM   1932 C C   . THR B 1 109 ? -3.421  2.808   -19.443 1.00 48.44  ? 107 THR B C   1 
ATOM   1933 O O   . THR B 1 109 ? -4.630  2.813   -19.670 1.00 50.31  ? 107 THR B O   1 
ATOM   1934 C CB  . THR B 1 109 ? -2.353  0.726   -20.292 1.00 48.63  ? 107 THR B CB  1 
ATOM   1935 O OG1 . THR B 1 109 ? -2.112  -0.647  -19.956 1.00 46.19  ? 107 THR B OG1 1 
ATOM   1936 C CG2 . THR B 1 109 ? -1.107  1.316   -20.962 1.00 48.27  ? 107 THR B CG2 1 
ATOM   1937 N N   . SER B 1 110 ? -2.655  3.890   -19.577 1.00 49.95  ? 108 SER B N   1 
ATOM   1938 C CA  . SER B 1 110 ? -3.186  5.164   -20.081 1.00 50.57  ? 108 SER B CA  1 
ATOM   1939 C C   . SER B 1 110 ? -3.650  5.064   -21.530 1.00 51.66  ? 108 SER B C   1 
ATOM   1940 O O   . SER B 1 110 ? -3.134  4.258   -22.307 1.00 50.25  ? 108 SER B O   1 
ATOM   1941 C CB  . SER B 1 110 ? -2.153  6.291   -19.943 1.00 50.06  ? 108 SER B CB  1 
ATOM   1942 O OG  . SER B 1 110 ? -1.152  6.213   -20.948 1.00 44.92  ? 108 SER B OG  1 
ATOM   1943 N N   . GLU B 1 111 ? -4.640  5.877   -21.881 1.00 57.93  ? 109 GLU B N   1 
ATOM   1944 C CA  . GLU B 1 111 ? -5.085  6.000   -23.262 1.00 59.70  ? 109 GLU B CA  1 
ATOM   1945 C C   . GLU B 1 111 ? -3.936  6.418   -24.173 1.00 56.52  ? 109 GLU B C   1 
ATOM   1946 O O   . GLU B 1 111 ? -3.839  5.971   -25.316 1.00 56.25  ? 109 GLU B O   1 
ATOM   1947 C CB  . GLU B 1 111 ? -6.226  7.012   -23.363 1.00 62.94  ? 109 GLU B CB  1 
ATOM   1948 C CG  . GLU B 1 111 ? -7.279  6.645   -24.395 1.00 72.88  ? 109 GLU B CG  1 
ATOM   1949 C CD  . GLU B 1 111 ? -8.397  5.801   -23.807 1.00 85.80  ? 109 GLU B CD  1 
ATOM   1950 O OE1 . GLU B 1 111 ? -9.580  6.163   -24.013 1.00 89.24  ? 109 GLU B OE1 1 
ATOM   1951 O OE2 . GLU B 1 111 ? -8.092  4.820   -23.087 1.00 83.00  ? 109 GLU B OE2 1 
ATOM   1952 N N   . LYS B 1 112 ? -3.067  7.278   -23.652 1.00 52.46  ? 110 LYS B N   1 
ATOM   1953 C CA  . LYS B 1 112 ? -1.954  7.831   -24.415 1.00 49.51  ? 110 LYS B CA  1 
ATOM   1954 C C   . LYS B 1 112 ? -0.996  6.725   -24.858 1.00 45.73  ? 110 LYS B C   1 
ATOM   1955 O O   . LYS B 1 112 ? -0.657  6.627   -26.040 1.00 44.50  ? 110 LYS B O   1 
ATOM   1956 C CB  . LYS B 1 112 ? -1.223  8.887   -23.574 1.00 51.43  ? 110 LYS B CB  1 
ATOM   1957 C CG  . LYS B 1 112 ? 0.126   9.342   -24.123 1.00 52.80  ? 110 LYS B CG  1 
ATOM   1958 C CD  . LYS B 1 112 ? 0.522   10.688  -23.525 1.00 63.68  ? 110 LYS B CD  1 
ATOM   1959 C CE  . LYS B 1 112 ? 1.677   11.321  -24.290 1.00 66.40  ? 110 LYS B CE  1 
ATOM   1960 N NZ  . LYS B 1 112 ? 2.702   11.911  -23.372 1.00 67.71  ? 110 LYS B NZ  1 
ATOM   1961 N N   . VAL B 1 113 ? -0.662  5.833   -23.929 1.00 41.98  ? 111 VAL B N   1 
ATOM   1962 C CA  . VAL B 1 113 ? 0.136   4.652   -24.239 1.00 39.52  ? 111 VAL B CA  1 
ATOM   1963 C C   . VAL B 1 113 ? -0.573  3.670   -25.185 1.00 40.88  ? 111 VAL B C   1 
ATOM   1964 O O   . VAL B 1 113 ? 0.015   3.223   -26.182 1.00 39.39  ? 111 VAL B O   1 
ATOM   1965 C CB  . VAL B 1 113 ? 0.580   3.917   -22.954 1.00 39.72  ? 111 VAL B CB  1 
ATOM   1966 C CG1 . VAL B 1 113 ? 1.122   2.528   -23.284 1.00 33.56  ? 111 VAL B CG1 1 
ATOM   1967 C CG2 . VAL B 1 113 ? 1.613   4.749   -22.188 1.00 36.57  ? 111 VAL B CG2 1 
ATOM   1968 N N   . LYS B 1 114 ? -1.839  3.365   -24.899 1.00 38.68  ? 112 LYS B N   1 
ATOM   1969 C CA  . LYS B 1 114 ? -2.578  2.378   -25.696 1.00 39.45  ? 112 LYS B CA  1 
ATOM   1970 C C   . LYS B 1 114 ? -2.808  2.909   -27.102 1.00 39.20  ? 112 LYS B C   1 
ATOM   1971 O O   . LYS B 1 114 ? -2.631  2.192   -28.085 1.00 39.74  ? 112 LYS B O   1 
ATOM   1972 C CB  . LYS B 1 114 ? -3.915  2.017   -25.035 1.00 40.70  ? 112 LYS B CB  1 
ATOM   1973 C CG  . LYS B 1 114 ? -3.773  1.279   -23.700 1.00 41.10  ? 112 LYS B CG  1 
ATOM   1974 C CD  . LYS B 1 114 ? -5.112  0.751   -23.182 1.00 39.44  ? 112 LYS B CD  1 
ATOM   1975 C CE  . LYS B 1 114 ? -5.844  1.795   -22.356 1.00 46.46  ? 112 LYS B CE  1 
ATOM   1976 N NZ  . LYS B 1 114 ? -7.310  1.772   -22.611 1.00 54.89  ? 112 LYS B NZ  1 
ATOM   1977 N N   . ASN B 1 115 ? -3.064  4.209   -27.197 1.00 39.25  ? 113 ASN B N   1 
ATOM   1978 C CA  . ASN B 1 115 ? -3.351  4.834   -28.487 1.00 39.21  ? 113 ASN B CA  1 
ATOM   1979 C C   . ASN B 1 115 ? -2.101  4.891   -29.357 1.00 37.12  ? 113 ASN B C   1 
ATOM   1980 O O   . ASN B 1 115 ? -2.166  4.691   -30.564 1.00 39.35  ? 113 ASN B O   1 
ATOM   1981 C CB  . ASN B 1 115 ? -3.941  6.237   -28.289 1.00 42.40  ? 113 ASN B CB  1 
ATOM   1982 C CG  . ASN B 1 115 ? -5.427  6.210   -27.927 1.00 49.63  ? 113 ASN B CG  1 
ATOM   1983 O OD1 . ASN B 1 115 ? -5.988  7.223   -27.510 1.00 61.32  ? 113 ASN B OD1 1 
ATOM   1984 N ND2 . ASN B 1 115 ? -6.087  5.087   -28.188 1.00 48.73  ? 113 ASN B ND2 1 
ATOM   1985 N N   . LYS B 1 116 ? -0.946  5.050   -28.723 1.00 38.53  ? 114 LYS B N   1 
ATOM   1986 C CA  . LYS B 1 116 ? 0.332   5.050   -29.436 1.00 36.74  ? 114 LYS B CA  1 
ATOM   1987 C C   . LYS B 1 116 ? 0.717   3.660   -29.981 1.00 33.86  ? 114 LYS B C   1 
ATOM   1988 O O   . LYS B 1 116 ? 1.195   3.536   -31.116 1.00 30.45  ? 114 LYS B O   1 
ATOM   1989 C CB  . LYS B 1 116 ? 1.433   5.614   -28.525 1.00 38.80  ? 114 LYS B CB  1 
ATOM   1990 C CG  . LYS B 1 116 ? 2.813   5.680   -29.169 1.00 42.10  ? 114 LYS B CG  1 
ATOM   1991 C CD  . LYS B 1 116 ? 2.803   6.600   -30.386 1.00 44.70  ? 114 LYS B CD  1 
ATOM   1992 C CE  . LYS B 1 116 ? 4.219   6.893   -30.861 1.00 42.93  ? 114 LYS B CE  1 
ATOM   1993 N NZ  . LYS B 1 116 ? 4.239   7.147   -32.321 1.00 47.01  ? 114 LYS B NZ  1 
ATOM   1994 N N   . ILE B 1 117 ? 0.443   2.617   -29.200 1.00 31.94  ? 115 ILE B N   1 
ATOM   1995 C CA  . ILE B 1 117 ? 0.531   1.235   -29.690 1.00 31.63  ? 115 ILE B CA  1 
ATOM   1996 C C   . ILE B 1 117 ? -0.322  0.943   -30.930 1.00 31.82  ? 115 ILE B C   1 
ATOM   1997 O O   . ILE B 1 117 ? 0.160   0.336   -31.884 1.00 31.46  ? 115 ILE B O   1 
ATOM   1998 C CB  . ILE B 1 117 ? 0.213   0.194   -28.586 1.00 31.23  ? 115 ILE B CB  1 
ATOM   1999 C CG1 . ILE B 1 117 ? 1.270   0.243   -27.491 1.00 26.88  ? 115 ILE B CG1 1 
ATOM   2000 C CG2 . ILE B 1 117 ? 0.123   -1.236  -29.177 1.00 29.19  ? 115 ILE B CG2 1 
ATOM   2001 C CD1 . ILE B 1 117 ? 1.089   -0.825  -26.390 1.00 29.51  ? 115 ILE B CD1 1 
ATOM   2002 N N   . LEU B 1 118 ? -1.589  1.347   -30.900 1.00 35.46  ? 116 LEU B N   1 
ATOM   2003 C CA  . LEU B 1 118 ? -2.521  1.098   -32.009 1.00 37.35  ? 116 LEU B CA  1 
ATOM   2004 C C   . LEU B 1 118 ? -2.119  1.831   -33.291 1.00 37.18  ? 116 LEU B C   1 
ATOM   2005 O O   . LEU B 1 118 ? -2.226  1.294   -34.401 1.00 39.64  ? 116 LEU B O   1 
ATOM   2006 C CB  . LEU B 1 118 ? -3.948  1.502   -31.598 1.00 38.81  ? 116 LEU B CB  1 
ATOM   2007 C CG  . LEU B 1 118 ? -4.559  0.761   -30.395 1.00 41.54  ? 116 LEU B CG  1 
ATOM   2008 C CD1 . LEU B 1 118 ? -5.907  1.357   -30.016 1.00 45.08  ? 116 LEU B CD1 1 
ATOM   2009 C CD2 . LEU B 1 118 ? -4.708  -0.739  -30.656 1.00 32.92  ? 116 LEU B CD2 1 
ATOM   2010 N N   . GLU B 1 119 ? -1.760  3.096   -33.128 1.00 36.59  ? 117 GLU B N   1 
ATOM   2011 C CA  . GLU B 1 119 ? -1.169  3.915   -34.181 1.00 35.48  ? 117 GLU B CA  1 
ATOM   2012 C C   . GLU B 1 119 ? 0.035   3.255   -34.864 1.00 35.44  ? 117 GLU B C   1 
ATOM   2013 O O   . GLU B 1 119 ? 0.130   3.226   -36.093 1.00 35.48  ? 117 GLU B O   1 
ATOM   2014 C CB  . GLU B 1 119 ? -0.778  5.270   -33.587 1.00 35.01  ? 117 GLU B CB  1 
ATOM   2015 C CG  . GLU B 1 119 ? -0.008  6.193   -34.504 1.00 49.87  ? 117 GLU B CG  1 
ATOM   2016 C CD  . GLU B 1 119 ? 0.716   7.298   -33.742 1.00 64.01  ? 117 GLU B CD  1 
ATOM   2017 O OE1 . GLU B 1 119 ? 0.031   8.105   -33.068 1.00 66.41  ? 117 GLU B OE1 1 
ATOM   2018 O OE2 . GLU B 1 119 ? 1.972   7.289   -33.735 1.00 59.96  ? 117 GLU B OE2 1 
ATOM   2019 N N   . LEU B 1 120 ? 0.961   2.736   -34.064 1.00 32.30  ? 118 LEU B N   1 
ATOM   2020 C CA  . LEU B 1 120 ? 2.144   2.086   -34.586 1.00 30.06  ? 118 LEU B CA  1 
ATOM   2021 C C   . LEU B 1 120 ? 1.778   0.828   -35.366 1.00 31.64  ? 118 LEU B C   1 
ATOM   2022 O O   . LEU B 1 120 ? 2.222   0.645   -36.506 1.00 31.32  ? 118 LEU B O   1 
ATOM   2023 C CB  . LEU B 1 120 ? 3.114   1.741   -33.450 1.00 30.29  ? 118 LEU B CB  1 
ATOM   2024 C CG  . LEU B 1 120 ? 3.941   2.908   -32.893 1.00 32.83  ? 118 LEU B CG  1 
ATOM   2025 C CD1 . LEU B 1 120 ? 4.770   2.455   -31.693 1.00 24.97  ? 118 LEU B CD1 1 
ATOM   2026 C CD2 . LEU B 1 120 ? 4.826   3.541   -33.973 1.00 26.58  ? 118 LEU B CD2 1 
ATOM   2027 N N   . LEU B 1 121 ? 1.035   -0.069  -34.722 1.00 27.91  ? 119 LEU B N   1 
ATOM   2028 C CA  . LEU B 1 121 ? 0.627   -1.303  -35.364 1.00 30.46  ? 119 LEU B CA  1 
ATOM   2029 C C   . LEU B 1 121 ? 0.032   -1.036  -36.756 1.00 31.86  ? 119 LEU B C   1 
ATOM   2030 O O   . LEU B 1 121 ? 0.355   -1.729  -37.726 1.00 31.53  ? 119 LEU B O   1 
ATOM   2031 C CB  . LEU B 1 121 ? -0.382  -2.055  -34.490 1.00 29.07  ? 119 LEU B CB  1 
ATOM   2032 C CG  . LEU B 1 121 ? 0.105   -2.761  -33.222 1.00 32.32  ? 119 LEU B CG  1 
ATOM   2033 C CD1 . LEU B 1 121 ? -1.092  -3.043  -32.305 1.00 27.28  ? 119 LEU B CD1 1 
ATOM   2034 C CD2 . LEU B 1 121 ? 0.907   -4.044  -33.500 1.00 25.11  ? 119 LEU B CD2 1 
ATOM   2035 N N   . TYR B 1 122 ? -0.860  -0.051  -36.835 1.00 29.46  ? 120 TYR B N   1 
ATOM   2036 C CA  . TYR B 1 122 ? -1.492  0.322   -38.100 1.00 28.62  ? 120 TYR B CA  1 
ATOM   2037 C C   . TYR B 1 122 ? -0.477  0.784   -39.147 1.00 27.48  ? 120 TYR B C   1 
ATOM   2038 O O   . TYR B 1 122 ? -0.540  0.381   -40.298 1.00 27.91  ? 120 TYR B O   1 
ATOM   2039 C CB  . TYR B 1 122 ? -2.528  1.421   -37.873 1.00 29.88  ? 120 TYR B CB  1 
ATOM   2040 C CG  . TYR B 1 122 ? -3.164  1.905   -39.154 1.00 29.85  ? 120 TYR B CG  1 
ATOM   2041 C CD1 . TYR B 1 122 ? -4.168  1.165   -39.770 1.00 30.17  ? 120 TYR B CD1 1 
ATOM   2042 C CD2 . TYR B 1 122 ? -2.644  2.995   -39.836 1.00 27.68  ? 120 TYR B CD2 1 
ATOM   2043 C CE1 . TYR B 1 122 ? -4.687  1.543   -40.997 1.00 37.79  ? 120 TYR B CE1 1 
ATOM   2044 C CE2 . TYR B 1 122 ? -3.186  3.409   -41.053 1.00 35.88  ? 120 TYR B CE2 1 
ATOM   2045 C CZ  . TYR B 1 122 ? -4.189  2.664   -41.635 1.00 32.85  ? 120 TYR B CZ  1 
ATOM   2046 O OH  . TYR B 1 122 ? -4.753  3.080   -42.817 1.00 43.02  ? 120 TYR B OH  1 
ATOM   2047 N N   . SER B 1 123 ? 0.389   1.714   -38.765 1.00 31.19  ? 121 SER B N   1 
ATOM   2048 C CA  . SER B 1 123 ? 1.451   2.159   -39.647 1.00 32.68  ? 121 SER B CA  1 
ATOM   2049 C C   . SER B 1 123 ? 2.229   0.988   -40.228 1.00 31.73  ? 121 SER B C   1 
ATOM   2050 O O   . SER B 1 123 ? 2.584   1.009   -41.417 1.00 31.29  ? 121 SER B O   1 
ATOM   2051 C CB  . SER B 1 123 ? 2.382   3.170   -38.957 1.00 31.56  ? 121 SER B CB  1 
ATOM   2052 O OG  . SER B 1 123 ? 3.273   2.549   -38.051 1.00 34.72  ? 121 SER B OG  1 
ATOM   2053 N N   . TRP B 1 124 ? 2.365   -0.084  -39.443 1.00 28.41  ? 122 TRP B N   1 
ATOM   2054 C CA  . TRP B 1 124 ? 3.091   -1.263  -39.909 1.00 28.19  ? 122 TRP B CA  1 
ATOM   2055 C C   . TRP B 1 124 ? 2.297   -2.127  -40.877 1.00 28.87  ? 122 TRP B C   1 
ATOM   2056 O O   . TRP B 1 124 ? 2.880   -2.718  -41.777 1.00 29.92  ? 122 TRP B O   1 
ATOM   2057 C CB  . TRP B 1 124 ? 3.633   -2.117  -38.752 1.00 28.16  ? 122 TRP B CB  1 
ATOM   2058 C CG  . TRP B 1 124 ? 4.582   -1.386  -37.836 1.00 27.79  ? 122 TRP B CG  1 
ATOM   2059 C CD1 . TRP B 1 124 ? 5.396   -0.343  -38.163 1.00 24.69  ? 122 TRP B CD1 1 
ATOM   2060 C CD2 . TRP B 1 124 ? 4.746   -1.599  -36.426 1.00 23.47  ? 122 TRP B CD2 1 
ATOM   2061 N NE1 . TRP B 1 124 ? 6.005   0.154   -37.038 1.00 18.98  ? 122 TRP B NE1 1 
ATOM   2062 C CE2 . TRP B 1 124 ? 5.621   -0.596  -35.955 1.00 27.32  ? 122 TRP B CE2 1 
ATOM   2063 C CE3 . TRP B 1 124 ? 4.203   -2.514  -35.511 1.00 30.08  ? 122 TRP B CE3 1 
ATOM   2064 C CZ2 . TRP B 1 124 ? 6.013   -0.508  -34.610 1.00 26.96  ? 122 TRP B CZ2 1 
ATOM   2065 C CZ3 . TRP B 1 124 ? 4.591   -2.431  -34.171 1.00 30.91  ? 122 TRP B CZ3 1 
ATOM   2066 C CH2 . TRP B 1 124 ? 5.471   -1.417  -33.733 1.00 30.54  ? 122 TRP B CH2 1 
ATOM   2067 N N   . THR B 1 125 ? 0.984   -2.251  -40.664 1.00 30.88  ? 123 THR B N   1 
ATOM   2068 C CA  . THR B 1 125 ? 0.127   -2.959  -41.631 1.00 31.74  ? 123 THR B CA  1 
ATOM   2069 C C   . THR B 1 125 ? 0.211   -2.314  -43.015 1.00 33.59  ? 123 THR B C   1 
ATOM   2070 O O   . THR B 1 125 ? 0.064   -2.994  -44.034 1.00 34.59  ? 123 THR B O   1 
ATOM   2071 C CB  . THR B 1 125 ? -1.365  -3.037  -41.199 1.00 29.35  ? 123 THR B CB  1 
ATOM   2072 O OG1 . THR B 1 125 ? -1.924  -1.716  -41.123 1.00 36.31  ? 123 THR B OG1 1 
ATOM   2073 C CG2 . THR B 1 125 ? -1.513  -3.741  -39.859 1.00 25.13  ? 123 THR B CG2 1 
ATOM   2074 N N   . VAL B 1 126 ? 0.384   -0.992  -43.039 1.00 31.11  ? 124 VAL B N   1 
ATOM   2075 C CA  . VAL B 1 126 ? 0.390   -0.251  -44.284 1.00 32.67  ? 124 VAL B CA  1 
ATOM   2076 C C   . VAL B 1 126 ? 1.788   -0.277  -44.893 1.00 33.37  ? 124 VAL B C   1 
ATOM   2077 O O   . VAL B 1 126 ? 1.945   -0.543  -46.079 1.00 34.56  ? 124 VAL B O   1 
ATOM   2078 C CB  . VAL B 1 126 ? -0.098  1.213   -44.084 1.00 36.38  ? 124 VAL B CB  1 
ATOM   2079 C CG1 . VAL B 1 126 ? 0.111   2.062   -45.363 1.00 35.94  ? 124 VAL B CG1 1 
ATOM   2080 C CG2 . VAL B 1 126 ? -1.555  1.229   -43.671 1.00 31.47  ? 124 VAL B CG2 1 
ATOM   2081 N N   . GLY B 1 127 ? 2.804   -0.111  -44.051 1.00 32.04  ? 125 GLY B N   1 
ATOM   2082 C CA  . GLY B 1 127 ? 4.160   0.050   -44.533 1.00 29.74  ? 125 GLY B CA  1 
ATOM   2083 C C   . GLY B 1 127 ? 4.859   -1.267  -44.776 1.00 32.14  ? 125 GLY B C   1 
ATOM   2084 O O   . GLY B 1 127 ? 5.629   -1.387  -45.729 1.00 34.23  ? 125 GLY B O   1 
ATOM   2085 N N   . LEU B 1 128 ? 4.615   -2.243  -43.899 1.00 28.57  ? 126 LEU B N   1 
ATOM   2086 C CA  . LEU B 1 128 ? 5.278   -3.544  -43.973 1.00 30.56  ? 126 LEU B CA  1 
ATOM   2087 C C   . LEU B 1 128 ? 4.308   -4.710  -44.135 1.00 32.35  ? 126 LEU B C   1 
ATOM   2088 O O   . LEU B 1 128 ? 4.338   -5.655  -43.339 1.00 33.35  ? 126 LEU B O   1 
ATOM   2089 C CB  . LEU B 1 128 ? 6.152   -3.775  -42.735 1.00 30.26  ? 126 LEU B CB  1 
ATOM   2090 C CG  . LEU B 1 128 ? 7.122   -2.629  -42.440 1.00 30.84  ? 126 LEU B CG  1 
ATOM   2091 C CD1 . LEU B 1 128 ? 7.640   -2.653  -41.022 1.00 32.57  ? 126 LEU B CD1 1 
ATOM   2092 C CD2 . LEU B 1 128 ? 8.250   -2.569  -43.452 1.00 26.10  ? 126 LEU B CD2 1 
ATOM   2093 N N   . PRO B 1 129 ? 3.550   -4.717  -45.245 1.00 36.16  ? 127 PRO B N   1 
ATOM   2094 C CA  . PRO B 1 129 ? 2.453   -5.666  -45.495 1.00 37.04  ? 127 PRO B CA  1 
ATOM   2095 C C   . PRO B 1 129 ? 2.898   -7.135  -45.557 1.00 38.12  ? 127 PRO B C   1 
ATOM   2096 O O   . PRO B 1 129 ? 2.058   -8.043  -45.525 1.00 39.95  ? 127 PRO B O   1 
ATOM   2097 C CB  . PRO B 1 129 ? 1.907   -5.232  -46.869 1.00 40.77  ? 127 PRO B CB  1 
ATOM   2098 C CG  . PRO B 1 129 ? 2.527   -3.904  -47.162 1.00 39.86  ? 127 PRO B CG  1 
ATOM   2099 C CD  . PRO B 1 129 ? 3.803   -3.836  -46.399 1.00 33.89  ? 127 PRO B CD  1 
ATOM   2100 N N   . GLU B 1 130 ? 4.198   -7.367  -45.718 1.00 39.96  ? 128 GLU B N   1 
ATOM   2101 C CA  . GLU B 1 130 ? 4.721   -8.725  -45.772 1.00 41.02  ? 128 GLU B CA  1 
ATOM   2102 C C   . GLU B 1 130 ? 4.984   -9.333  -44.398 1.00 39.67  ? 128 GLU B C   1 
ATOM   2103 O O   . GLU B 1 130 ? 5.234   -10.529 -44.288 1.00 40.37  ? 128 GLU B O   1 
ATOM   2104 C CB  . GLU B 1 130 ? 5.965   -8.793  -46.660 1.00 41.19  ? 128 GLU B CB  1 
ATOM   2105 C CG  . GLU B 1 130 ? 5.641   -8.644  -48.139 1.00 45.69  ? 128 GLU B CG  1 
ATOM   2106 C CD  . GLU B 1 130 ? 6.862   -8.729  -49.042 1.00 47.21  ? 128 GLU B CD  1 
ATOM   2107 O OE1 . GLU B 1 130 ? 6.675   -8.819  -50.275 1.00 49.26  ? 128 GLU B OE1 1 
ATOM   2108 O OE2 . GLU B 1 130 ? 7.998   -8.668  -48.528 1.00 47.78  ? 128 GLU B OE2 1 
ATOM   2109 N N   . GLU B 1 131 ? 4.924   -8.504  -43.354 1.00 39.58  ? 129 GLU B N   1 
ATOM   2110 C CA  . GLU B 1 131 ? 4.810   -8.991  -41.972 1.00 34.77  ? 129 GLU B CA  1 
ATOM   2111 C C   . GLU B 1 131 ? 3.356   -9.314  -41.697 1.00 35.26  ? 129 GLU B C   1 
ATOM   2112 O O   . GLU B 1 131 ? 2.648   -8.485  -41.125 1.00 32.10  ? 129 GLU B O   1 
ATOM   2113 C CB  . GLU B 1 131 ? 5.251   -7.905  -40.972 1.00 34.44  ? 129 GLU B CB  1 
ATOM   2114 C CG  . GLU B 1 131 ? 6.678   -7.369  -41.137 1.00 30.84  ? 129 GLU B CG  1 
ATOM   2115 C CD  . GLU B 1 131 ? 7.747   -8.465  -41.042 1.00 37.38  ? 129 GLU B CD  1 
ATOM   2116 O OE1 . GLU B 1 131 ? 8.916   -8.203  -41.392 1.00 39.30  ? 129 GLU B OE1 1 
ATOM   2117 O OE2 . GLU B 1 131 ? 7.406   -9.612  -40.705 1.00 33.27  ? 129 GLU B OE2 1 
ATOM   2118 N N   . VAL B 1 132 ? 2.901   -10.495 -42.126 1.00 35.05  ? 130 VAL B N   1 
ATOM   2119 C CA  . VAL B 1 132 ? 1.464   -10.816 -42.129 1.00 35.66  ? 130 VAL B CA  1 
ATOM   2120 C C   . VAL B 1 132 ? 0.848   -10.993 -40.718 1.00 37.30  ? 130 VAL B C   1 
ATOM   2121 O O   . VAL B 1 132 ? -0.313  -10.652 -40.492 1.00 36.54  ? 130 VAL B O   1 
ATOM   2122 C CB  . VAL B 1 132 ? 1.137   -12.037 -43.025 1.00 38.71  ? 130 VAL B CB  1 
ATOM   2123 C CG1 . VAL B 1 132 ? 1.445   -11.729 -44.511 1.00 38.55  ? 130 VAL B CG1 1 
ATOM   2124 C CG2 . VAL B 1 132 ? 1.892   -13.281 -42.549 1.00 40.05  ? 130 VAL B CG2 1 
ATOM   2125 N N   . LYS B 1 133 ? 1.682   -11.372 -39.752 1.00 38.95  ? 131 LYS B N   1 
ATOM   2126 C CA  . LYS B 1 133 ? 1.248   -11.534 -38.364 1.00 39.09  ? 131 LYS B CA  1 
ATOM   2127 C C   . LYS B 1 133 ? 0.878   -10.224 -37.694 1.00 37.29  ? 131 LYS B C   1 
ATOM   2128 O O   . LYS B 1 133 ? 0.067   -10.213 -36.775 1.00 38.06  ? 131 LYS B O   1 
ATOM   2129 C CB  . LYS B 1 133 ? 2.316   -12.249 -37.540 1.00 38.46  ? 131 LYS B CB  1 
ATOM   2130 C CG  . LYS B 1 133 ? 2.478   -13.724 -37.882 1.00 38.62  ? 131 LYS B CG  1 
ATOM   2131 C CD  . LYS B 1 133 ? 3.776   -14.255 -37.301 1.00 42.65  ? 131 LYS B CD  1 
ATOM   2132 C CE  . LYS B 1 133 ? 3.855   -15.762 -37.421 1.00 44.68  ? 131 LYS B CE  1 
ATOM   2133 N NZ  . LYS B 1 133 ? 5.055   -16.263 -36.709 1.00 47.30  ? 131 LYS B NZ  1 
ATOM   2134 N N   . ILE B 1 134 ? 1.480   -9.125  -38.144 1.00 33.32  ? 132 ILE B N   1 
ATOM   2135 C CA  . ILE B 1 134 ? 1.163   -7.810  -37.597 1.00 31.58  ? 132 ILE B CA  1 
ATOM   2136 C C   . ILE B 1 134 ? -0.253  -7.410  -38.016 1.00 34.96  ? 132 ILE B C   1 
ATOM   2137 O O   . ILE B 1 134 ? -1.051  -6.940  -37.198 1.00 35.43  ? 132 ILE B O   1 
ATOM   2138 C CB  . ILE B 1 134 ? 2.174   -6.728  -38.066 1.00 32.07  ? 132 ILE B CB  1 
ATOM   2139 C CG1 . ILE B 1 134 ? 3.604   -7.084  -37.639 1.00 29.10  ? 132 ILE B CG1 1 
ATOM   2140 C CG2 . ILE B 1 134 ? 1.770   -5.345  -37.544 1.00 24.64  ? 132 ILE B CG2 1 
ATOM   2141 C CD1 . ILE B 1 134 ? 4.675   -6.019  -38.050 1.00 24.01  ? 132 ILE B CD1 1 
ATOM   2142 N N   . ALA B 1 135 ? -0.562  -7.627  -39.291 1.00 38.16  ? 133 ALA B N   1 
ATOM   2143 C CA  . ALA B 1 135 ? -1.920  -7.455  -39.816 1.00 40.57  ? 133 ALA B CA  1 
ATOM   2144 C C   . ALA B 1 135 ? -2.920  -8.348  -39.081 1.00 41.28  ? 133 ALA B C   1 
ATOM   2145 O O   . ALA B 1 135 ? -3.995  -7.898  -38.685 1.00 41.73  ? 133 ALA B O   1 
ATOM   2146 C CB  . ALA B 1 135 ? -1.950  -7.749  -41.335 1.00 40.14  ? 133 ALA B CB  1 
ATOM   2147 N N   . GLU B 1 136 ? -2.543  -9.607  -38.879 1.00 44.08  ? 134 GLU B N   1 
ATOM   2148 C CA  . GLU B 1 136 ? -3.361  -10.554 -38.123 1.00 46.53  ? 134 GLU B CA  1 
ATOM   2149 C C   . GLU B 1 136 ? -3.699  -10.006 -36.739 1.00 46.85  ? 134 GLU B C   1 
ATOM   2150 O O   . GLU B 1 136 ? -4.872  -9.894  -36.379 1.00 49.66  ? 134 GLU B O   1 
ATOM   2151 C CB  . GLU B 1 136 ? -2.632  -11.891 -37.985 1.00 46.83  ? 134 GLU B CB  1 
ATOM   2152 C CG  . GLU B 1 136 ? -2.641  -12.752 -39.237 1.00 53.40  ? 134 GLU B CG  1 
ATOM   2153 C CD  . GLU B 1 136 ? -1.910  -14.074 -39.045 1.00 62.33  ? 134 GLU B CD  1 
ATOM   2154 O OE1 . GLU B 1 136 ? -0.954  -14.337 -39.809 1.00 60.62  ? 134 GLU B OE1 1 
ATOM   2155 O OE2 . GLU B 1 136 ? -2.297  -14.849 -38.135 1.00 58.32  ? 134 GLU B OE2 1 
ATOM   2156 N N   . ALA B 1 137 ? -2.667  -9.673  -35.968 1.00 40.82  ? 135 ALA B N   1 
ATOM   2157 C CA  . ALA B 1 137 ? -2.845  -9.147  -34.611 1.00 41.32  ? 135 ALA B CA  1 
ATOM   2158 C C   . ALA B 1 137 ? -3.758  -7.919  -34.597 1.00 42.91  ? 135 ALA B C   1 
ATOM   2159 O O   . ALA B 1 137 ? -4.700  -7.836  -33.801 1.00 44.45  ? 135 ALA B O   1 
ATOM   2160 C CB  . ALA B 1 137 ? -1.491  -8.817  -33.989 1.00 34.71  ? 135 ALA B CB  1 
ATOM   2161 N N   . TYR B 1 138 ? -3.539  -7.025  -35.557 1.00 42.08  ? 136 TYR B N   1 
ATOM   2162 C CA  . TYR B 1 138 ? -4.308  -5.793  -35.653 1.00 41.80  ? 136 TYR B CA  1 
ATOM   2163 C C   . TYR B 1 138 ? -5.764  -6.070  -36.003 1.00 44.24  ? 136 TYR B C   1 
ATOM   2164 O O   . TYR B 1 138 ? -6.670  -5.430  -35.466 1.00 42.91  ? 136 TYR B O   1 
ATOM   2165 C CB  . TYR B 1 138 ? -3.690  -4.871  -36.704 1.00 40.09  ? 136 TYR B CB  1 
ATOM   2166 C CG  . TYR B 1 138 ? -4.326  -3.501  -36.761 1.00 39.84  ? 136 TYR B CG  1 
ATOM   2167 C CD1 . TYR B 1 138 ? -3.958  -2.514  -35.858 1.00 35.65  ? 136 TYR B CD1 1 
ATOM   2168 C CD2 . TYR B 1 138 ? -5.296  -3.195  -37.718 1.00 37.17  ? 136 TYR B CD2 1 
ATOM   2169 C CE1 . TYR B 1 138 ? -4.468  -1.233  -35.953 1.00 39.95  ? 136 TYR B CE1 1 
ATOM   2170 C CE2 . TYR B 1 138 ? -5.833  -1.921  -37.804 1.00 39.89  ? 136 TYR B CE2 1 
ATOM   2171 C CZ  . TYR B 1 138 ? -5.401  -0.940  -36.922 1.00 41.75  ? 136 TYR B CZ  1 
ATOM   2172 O OH  . TYR B 1 138 ? -5.915  0.334   -36.980 1.00 42.73  ? 136 TYR B OH  1 
ATOM   2173 N N   . GLN B 1 139 ? -5.968  -6.952  -36.981 1.00 59.68  ? 137 GLN B N   1 
ATOM   2174 C CA  . GLN B 1 139 ? -7.305  -7.321  -37.428 1.00 64.10  ? 137 GLN B CA  1 
ATOM   2175 C C   . GLN B 1 139 ? -8.114  -7.941  -36.296 1.00 67.08  ? 137 GLN B C   1 
ATOM   2176 O O   . GLN B 1 139 ? -9.340  -7.830  -36.266 1.00 70.02  ? 137 GLN B O   1 
ATOM   2177 C CB  . GLN B 1 139 ? -7.227  -8.288  -38.608 1.00 65.46  ? 137 GLN B CB  1 
ATOM   2178 C CG  . GLN B 1 139 ? -7.841  -7.755  -39.903 1.00 70.06  ? 137 GLN B CG  1 
ATOM   2179 C CD  . GLN B 1 139 ? -7.370  -6.349  -40.251 1.00 69.72  ? 137 GLN B CD  1 
ATOM   2180 O OE1 . GLN B 1 139 ? -6.172  -6.092  -40.369 1.00 65.79  ? 137 GLN B OE1 1 
ATOM   2181 N NE2 . GLN B 1 139 ? -8.317  -5.433  -40.415 1.00 70.64  ? 137 GLN B NE2 1 
ATOM   2182 N N   . MET B 1 140 ? -7.420  -8.551  -35.341 1.00 62.91  ? 138 MET B N   1 
ATOM   2183 C CA  . MET B 1 140 ? -8.081  -9.177  -34.205 1.00 66.30  ? 138 MET B CA  1 
ATOM   2184 C C   . MET B 1 140 ? -8.514  -8.150  -33.162 1.00 65.97  ? 138 MET B C   1 
ATOM   2185 O O   . MET B 1 140 ? -9.580  -8.271  -32.566 1.00 70.47  ? 138 MET B O   1 
ATOM   2186 C CB  . MET B 1 140 ? -7.174  -10.227 -33.561 1.00 65.43  ? 138 MET B CB  1 
ATOM   2187 C CG  . MET B 1 140 ? -7.679  -10.659 -32.153 1.00 68.57  ? 138 MET B CG  1 
ATOM   2188 S SD  . MET B 1 140 ? -6.375  -11.469 -31.201 1.00 68.04  ? 138 MET B SD  1 
ATOM   2189 C CE  . MET B 1 140 ? -6.184  -10.114 -29.762 1.00 55.42  ? 138 MET B CE  1 
ATOM   2190 N N   . LEU B 1 141 ? -7.622  -7.218  -32.856 1.00 55.15  ? 139 LEU B N   1 
ATOM   2191 C CA  . LEU B 1 141 ? -7.965  -6.062  -32.041 1.00 55.76  ? 139 LEU B CA  1 
ATOM   2192 C C   . LEU B 1 141 ? -9.160  -5.304  -32.623 1.00 57.52  ? 139 LEU B C   1 
ATOM   2193 O O   . LEU B 1 141 ? -10.080 -4.935  -31.899 1.00 61.32  ? 139 LEU B O   1 
ATOM   2194 C CB  . LEU B 1 141 ? -6.747  -5.135  -31.909 1.00 53.56  ? 139 LEU B CB  1 
ATOM   2195 C CG  . LEU B 1 141 ? -5.509  -5.752  -31.242 1.00 51.68  ? 139 LEU B CG  1 
ATOM   2196 C CD1 . LEU B 1 141 ? -4.298  -4.815  -31.315 1.00 42.01  ? 139 LEU B CD1 1 
ATOM   2197 C CD2 . LEU B 1 141 ? -5.801  -6.155  -29.790 1.00 46.76  ? 139 LEU B CD2 1 
ATOM   2198 N N   . LYS B 1 142 ? -9.105  -5.027  -33.922 1.00 59.34  ? 140 LYS B N   1 
ATOM   2199 C CA  . LYS B 1 142 ? -10.270 -4.576  -34.696 1.00 61.46  ? 140 LYS B CA  1 
ATOM   2200 C C   . LYS B 1 142 ? -11.548 -5.362  -34.389 1.00 64.25  ? 140 LYS B C   1 
ATOM   2201 O O   . LYS B 1 142 ? -12.586 -4.775  -34.085 1.00 64.94  ? 140 LYS B O   1 
ATOM   2202 C CB  . LYS B 1 142 ? -9.958  -4.674  -36.189 1.00 60.72  ? 140 LYS B CB  1 
ATOM   2203 C CG  . LYS B 1 142 ? -10.737 -3.721  -37.060 1.00 66.17  ? 140 LYS B CG  1 
ATOM   2204 C CD  . LYS B 1 142 ? -10.035 -3.518  -38.392 1.00 68.63  ? 140 LYS B CD  1 
ATOM   2205 C CE  . LYS B 1 142 ? -10.911 -2.747  -39.367 1.00 73.09  ? 140 LYS B CE  1 
ATOM   2206 N NZ  . LYS B 1 142 ? -11.817 -1.804  -38.655 1.00 73.35  ? 140 LYS B NZ  1 
ATOM   2207 N N   . LYS B 1 143 ? -11.492 -6.669  -34.637 1.00 91.59  ? 141 LYS B N   1 
ATOM   2208 C CA  . LYS B 1 143 ? -12.585 -7.605  -34.353 1.00 94.37  ? 141 LYS B CA  1 
ATOM   2209 C C   . LYS B 1 143 ? -13.210 -7.407  -32.975 1.00 96.86  ? 141 LYS B C   1 
ATOM   2210 O O   . LYS B 1 143 ? -14.394 -7.688  -32.779 1.00 100.33 ? 141 LYS B O   1 
ATOM   2211 C CB  . LYS B 1 143 ? -12.078 -9.045  -34.459 1.00 93.93  ? 141 LYS B CB  1 
ATOM   2212 C CG  . LYS B 1 143 ? -12.627 -9.824  -35.639 1.00 96.39  ? 141 LYS B CG  1 
ATOM   2213 C CD  . LYS B 1 143 ? -11.497 -10.470 -36.435 1.00 96.93  ? 141 LYS B CD  1 
ATOM   2214 C CE  . LYS B 1 143 ? -11.740 -10.360 -37.941 1.00 97.26  ? 141 LYS B CE  1 
ATOM   2215 N NZ  . LYS B 1 143 ? -10.467 -10.334 -38.724 1.00 92.21  ? 141 LYS B NZ  1 
ATOM   2216 N N   . GLN B 1 144 ? -12.368 -7.095  -31.995 1.00 69.79  ? 142 GLN B N   1 
ATOM   2217 C CA  . GLN B 1 144 ? -12.803 -6.979  -30.604 1.00 72.37  ? 142 GLN B CA  1 
ATOM   2218 C C   . GLN B 1 144 ? -13.187 -5.548  -30.239 1.00 73.21  ? 142 GLN B C   1 
ATOM   2219 O O   . GLN B 1 144 ? -13.515 -5.263  -29.090 1.00 73.99  ? 142 GLN B O   1 
ATOM   2220 C CB  . GLN B 1 144 ? -11.704 -7.456  -29.653 1.00 69.19  ? 142 GLN B CB  1 
ATOM   2221 C CG  . GLN B 1 144 ? -11.498 -8.960  -29.612 1.00 69.26  ? 142 GLN B CG  1 
ATOM   2222 C CD  . GLN B 1 144 ? -10.138 -9.324  -29.046 1.00 70.23  ? 142 GLN B CD  1 
ATOM   2223 O OE1 . GLN B 1 144 ? -9.221  -8.507  -29.019 1.00 66.74  ? 142 GLN B OE1 1 
ATOM   2224 N NE2 . GLN B 1 144 ? -10.002 -10.564 -28.592 1.00 75.86  ? 142 GLN B NE2 1 
ATOM   2225 N N   . GLY B 1 145 ? -13.084 -4.638  -31.198 1.00 69.52  ? 143 GLY B N   1 
ATOM   2226 C CA  . GLY B 1 145 ? -13.454 -3.251  -30.957 1.00 72.68  ? 143 GLY B CA  1 
ATOM   2227 C C   . GLY B 1 145 ? -12.434 -2.522  -30.104 1.00 71.56  ? 143 GLY B C   1 
ATOM   2228 O O   . GLY B 1 145 ? -12.708 -1.450  -29.565 1.00 72.99  ? 143 GLY B O   1 
ATOM   2229 N N   . ILE B 1 146 ? -11.232 -3.078  -30.026 1.00 66.24  ? 144 ILE B N   1 
ATOM   2230 C CA  . ILE B 1 146 ? -10.117 -2.372  -29.420 1.00 64.12  ? 144 ILE B CA  1 
ATOM   2231 C C   . ILE B 1 146 ? -9.600  -1.309  -30.382 1.00 65.55  ? 144 ILE B C   1 
ATOM   2232 O O   . ILE B 1 146 ? -9.527  -0.127  -30.039 1.00 65.94  ? 144 ILE B O   1 
ATOM   2233 C CB  . ILE B 1 146 ? -8.966  -3.330  -29.044 1.00 61.52  ? 144 ILE B CB  1 
ATOM   2234 C CG1 . ILE B 1 146 ? -9.494  -4.540  -28.260 1.00 59.12  ? 144 ILE B CG1 1 
ATOM   2235 C CG2 . ILE B 1 146 ? -7.887  -2.584  -28.274 1.00 56.54  ? 144 ILE B CG2 1 
ATOM   2236 C CD1 . ILE B 1 146 ? -9.095  -4.570  -26.803 1.00 51.34  ? 144 ILE B CD1 1 
ATOM   2237 N N   . VAL B 1 147 ? -9.308  -1.721  -31.612 1.00 74.50  ? 145 VAL B N   1 
ATOM   2238 C CA  . VAL B 1 147 ? -9.334  -0.797  -32.740 1.00 76.26  ? 145 VAL B CA  1 
ATOM   2239 C C   . VAL B 1 147 ? -10.752 -0.309  -33.018 1.00 81.31  ? 145 VAL B C   1 
ATOM   2240 O O   . VAL B 1 147 ? -11.577 -1.040  -33.568 1.00 83.47  ? 145 VAL B O   1 
ATOM   2241 C CB  . VAL B 1 147 ? -8.740  -1.421  -34.011 1.00 74.53  ? 145 VAL B CB  1 
ATOM   2242 C CG1 . VAL B 1 147 ? -8.692  -0.389  -35.127 1.00 74.04  ? 145 VAL B CG1 1 
ATOM   2243 C CG2 . VAL B 1 147 ? -7.349  -1.965  -33.728 1.00 71.44  ? 145 VAL B CG2 1 
ATOM   2244 N N   . LYS B 1 148 ? -11.028 0.897   -32.572 1.00 84.60  ? 146 LYS B N   1 
ATOM   2245 C CA  . LYS B 1 148 ? -12.147 1.682   -33.015 1.00 87.85  ? 146 LYS B CA  1 
ATOM   2246 C C   . LYS B 1 148 ? -12.135 1.924   -34.514 1.00 87.99  ? 146 LYS B C   1 
ATOM   2247 O O   . LYS B 1 148 ? -12.586 1.085   -35.290 1.00 122.30 ? 146 LYS B O   1 
ATOM   2248 C CB  . LYS B 1 148 ? -12.168 2.990   -32.238 1.00 88.83  ? 146 LYS B CB  1 
ATOM   2249 C CG  . LYS B 1 148 ? -12.397 2.787   -30.744 1.00 89.45  ? 146 LYS B CG  1 
ATOM   2250 C CD  . LYS B 1 148 ? -11.759 3.851   -29.875 1.00 88.74  ? 146 LYS B CD  1 
ATOM   2251 C CE  . LYS B 1 148 ? -11.473 3.321   -28.499 1.00 87.87  ? 146 LYS B CE  1 
ATOM   2252 N NZ  . LYS B 1 148 ? -11.419 4.411   -27.497 1.00 88.92  ? 146 LYS B NZ  1 
ATOM   2253 N N   . SER C 2 7   ? -12.116 -6.559  -7.149  1.00 79.02  ? 7   SER C N   1 
ATOM   2254 C CA  . SER C 2 7   ? -11.416 -6.427  -5.840  1.00 77.61  ? 7   SER C CA  1 
ATOM   2255 C C   . SER C 2 7   ? -10.395 -7.550  -5.663  1.00 75.24  ? 7   SER C C   1 
ATOM   2256 O O   . SER C 2 7   ? -9.683  -7.596  -4.654  1.00 77.68  ? 7   SER C O   1 
ATOM   2257 C CB  . SER C 2 7   ? -12.429 -6.432  -4.686  1.00 79.14  ? 7   SER C CB  1 
ATOM   2258 O OG  . SER C 2 7   ? -11.788 -6.522  -3.421  1.00 77.22  ? 7   SER C OG  1 
ATOM   2259 N N   . ASP C 2 8   ? -10.356 -8.472  -6.625  1.00 62.03  ? 8   ASP C N   1 
ATOM   2260 C CA  . ASP C 2 8   ? -9.174  -9.314  -6.849  1.00 56.95  ? 8   ASP C CA  1 
ATOM   2261 C C   . ASP C 2 8   ? -9.271  -10.175 -8.111  1.00 54.30  ? 8   ASP C C   1 
ATOM   2262 O O   . ASP C 2 8   ? -10.351 -10.641 -8.483  1.00 51.31  ? 8   ASP C O   1 
ATOM   2263 C CB  . ASP C 2 8   ? -8.899  -10.207 -5.634  1.00 53.50  ? 8   ASP C CB  1 
ATOM   2264 C CG  . ASP C 2 8   ? -7.477  -10.735 -5.609  1.00 44.02  ? 8   ASP C CG  1 
ATOM   2265 O OD1 . ASP C 2 8   ? -6.639  -10.264 -6.416  1.00 36.21  ? 8   ASP C OD1 1 
ATOM   2266 O OD2 . ASP C 2 8   ? -7.183  -11.581 -4.742  1.00 35.46  ? 8   ASP C OD2 1 
ATOM   2267 N N   . GLU C 2 9   ? -8.116  -10.453 -8.708  1.00 53.37  ? 9   GLU C N   1 
ATOM   2268 C CA  . GLU C 2 9   ? -8.004  -11.452 -9.765  1.00 52.48  ? 9   GLU C CA  1 
ATOM   2269 C C   . GLU C 2 9   ? -8.349  -12.845 -9.255  1.00 50.23  ? 9   GLU C C   1 
ATOM   2270 O O   . GLU C 2 9   ? -8.299  -13.108 -8.057  1.00 49.40  ? 9   GLU C O   1 
ATOM   2271 C CB  . GLU C 2 9   ? -6.596  -11.442 -10.368 1.00 50.10  ? 9   GLU C CB  1 
ATOM   2272 C CG  . GLU C 2 9   ? -6.449  -10.516 -11.566 1.00 59.40  ? 9   GLU C CG  1 
ATOM   2273 C CD  . GLU C 2 9   ? -4.998  -10.221 -11.911 1.00 63.66  ? 9   GLU C CD  1 
ATOM   2274 O OE1 . GLU C 2 9   ? -4.236  -11.173 -12.228 1.00 53.57  ? 9   GLU C OE1 1 
ATOM   2275 O OE2 . GLU C 2 9   ? -4.626  -9.025  -11.876 1.00 67.66  ? 9   GLU C OE2 1 
ATOM   2276 N N   . ASP C 2 10  ? -8.656  -13.747 -10.179 1.00 43.10  ? 10  ASP C N   1 
ATOM   2277 C CA  . ASP C 2 10  ? -8.638  -15.171 -9.885  1.00 42.88  ? 10  ASP C CA  1 
ATOM   2278 C C   . ASP C 2 10  ? -7.210  -15.710 -9.827  1.00 39.45  ? 10  ASP C C   1 
ATOM   2279 O O   . ASP C 2 10  ? -6.311  -15.211 -10.507 1.00 36.08  ? 10  ASP C O   1 
ATOM   2280 C CB  . ASP C 2 10  ? -9.461  -15.957 -10.917 1.00 43.21  ? 10  ASP C CB  1 
ATOM   2281 C CG  . ASP C 2 10  ? -10.904 -15.466 -11.017 1.00 52.06  ? 10  ASP C CG  1 
ATOM   2282 O OD1 . ASP C 2 10  ? -11.400 -15.304 -12.153 1.00 50.08  ? 10  ASP C OD1 1 
ATOM   2283 O OD2 . ASP C 2 10  ? -11.537 -15.225 -9.963  1.00 54.75  ? 10  ASP C OD2 1 
ATOM   2284 N N   . LEU C 2 11  ? -7.020  -16.741 -9.013  1.00 41.93  ? 11  LEU C N   1 
ATOM   2285 C CA  . LEU C 2 11  ? -5.770  -17.462 -8.981  1.00 41.95  ? 11  LEU C CA  1 
ATOM   2286 C C   . LEU C 2 11  ? -5.407  -17.969 -10.379 1.00 43.82  ? 11  LEU C C   1 
ATOM   2287 O O   . LEU C 2 11  ? -6.186  -18.673 -11.017 1.00 44.49  ? 11  LEU C O   1 
ATOM   2288 C CB  . LEU C 2 11  ? -5.847  -18.624 -7.992  1.00 37.17  ? 11  LEU C CB  1 
ATOM   2289 C CG  . LEU C 2 11  ? -4.612  -19.523 -7.964  1.00 33.78  ? 11  LEU C CG  1 
ATOM   2290 C CD1 . LEU C 2 11  ? -3.338  -18.714 -7.678  1.00 24.12  ? 11  LEU C CD1 1 
ATOM   2291 C CD2 . LEU C 2 11  ? -4.792  -20.656 -6.961  1.00 26.56  ? 11  LEU C CD2 1 
ATOM   2292 N N   . LEU C 2 12  ? -4.216  -17.601 -10.839 1.00 41.13  ? 12  LEU C N   1 
ATOM   2293 C CA  . LEU C 2 12  ? -3.692  -18.070 -12.109 1.00 43.04  ? 12  LEU C CA  1 
ATOM   2294 C C   . LEU C 2 12  ? -3.225  -19.512 -11.982 1.00 45.29  ? 12  LEU C C   1 
ATOM   2295 O O   . LEU C 2 12  ? -2.264  -19.801 -11.275 1.00 46.36  ? 12  LEU C O   1 
ATOM   2296 C CB  . LEU C 2 12  ? -2.534  -17.169 -12.557 1.00 39.80  ? 12  LEU C CB  1 
ATOM   2297 C CG  . LEU C 2 12  ? -1.787  -17.493 -13.851 1.00 38.02  ? 12  LEU C CG  1 
ATOM   2298 C CD1 . LEU C 2 12  ? -2.735  -17.413 -15.049 1.00 38.82  ? 12  LEU C CD1 1 
ATOM   2299 C CD2 . LEU C 2 12  ? -0.614  -16.542 -14.033 1.00 24.55  ? 12  LEU C CD2 1 
ATOM   2300 N N   . GLU C 2 13  ? -3.910  -20.420 -12.666 1.00 67.12  ? 13  GLU C N   1 
ATOM   2301 C CA  . GLU C 2 13  ? -3.457  -21.809 -12.764 1.00 72.51  ? 13  GLU C CA  1 
ATOM   2302 C C   . GLU C 2 13  ? -2.189  -21.974 -13.624 1.00 74.48  ? 13  GLU C C   1 
ATOM   2303 O O   . GLU C 2 13  ? -1.085  -22.150 -13.097 1.00 73.76  ? 13  GLU C O   1 
ATOM   2304 C CB  . GLU C 2 13  ? -4.586  -22.702 -13.274 1.00 71.73  ? 13  GLU C CB  1 
ATOM   2305 C CG  . GLU C 2 13  ? -5.822  -22.682 -12.372 1.00 81.40  ? 13  GLU C CG  1 
ATOM   2306 C CD  . GLU C 2 13  ? -5.562  -23.271 -10.987 1.00 85.14  ? 13  GLU C CD  1 
ATOM   2307 O OE1 . GLU C 2 13  ? -4.843  -24.290 -10.897 1.00 88.46  ? 13  GLU C OE1 1 
ATOM   2308 O OE2 . GLU C 2 13  ? -6.170  -22.789 -10.005 1.00 82.27  ? 13  GLU C OE2 1 
ATOM   2309 O OXT . GLU C 2 13  ? -2.212  -21.863 -14.856 1.00 75.87  ? 13  GLU C OXT 1 
ATOM   2310 N N   . SER D 2 7   ? 10.909  -20.979 -34.186 1.00 82.33  ? 7   SER D N   1 
ATOM   2311 C CA  . SER D 2 7   ? 9.415   -20.955 -34.179 1.00 82.81  ? 7   SER D CA  1 
ATOM   2312 C C   . SER D 2 7   ? 8.882   -19.674 -33.538 1.00 80.02  ? 7   SER D C   1 
ATOM   2313 O O   . SER D 2 7   ? 9.501   -18.607 -33.641 1.00 79.47  ? 7   SER D O   1 
ATOM   2314 C CB  . SER D 2 7   ? 8.859   -22.179 -33.449 1.00 85.24  ? 7   SER D CB  1 
ATOM   2315 O OG  . SER D 2 7   ? 7.472   -22.341 -33.702 1.00 89.00  ? 7   SER D OG  1 
ATOM   2316 N N   . ASP D 2 8   ? 7.697   -19.769 -32.944 1.00 67.81  ? 8   ASP D N   1 
ATOM   2317 C CA  . ASP D 2 8   ? 6.977   -18.585 -32.471 1.00 64.05  ? 8   ASP D CA  1 
ATOM   2318 C C   . ASP D 2 8   ? 5.840   -18.985 -31.531 1.00 61.65  ? 8   ASP D C   1 
ATOM   2319 O O   . ASP D 2 8   ? 5.313   -20.084 -31.631 1.00 59.38  ? 8   ASP D O   1 
ATOM   2320 C CB  . ASP D 2 8   ? 6.429   -17.773 -33.658 1.00 62.14  ? 8   ASP D CB  1 
ATOM   2321 C CG  . ASP D 2 8   ? 6.013   -16.365 -33.265 1.00 55.32  ? 8   ASP D CG  1 
ATOM   2322 O OD1 . ASP D 2 8   ? 6.595   -15.817 -32.300 1.00 51.35  ? 8   ASP D OD1 1 
ATOM   2323 O OD2 . ASP D 2 8   ? 5.116   -15.803 -33.935 1.00 49.99  ? 8   ASP D OD2 1 
ATOM   2324 N N   . GLU D 2 9   ? 5.501   -18.101 -30.596 1.00 62.75  ? 9   GLU D N   1 
ATOM   2325 C CA  . GLU D 2 9   ? 4.276   -18.236 -29.812 1.00 63.09  ? 9   GLU D CA  1 
ATOM   2326 C C   . GLU D 2 9   ? 3.065   -18.346 -30.723 1.00 63.05  ? 9   GLU D C   1 
ATOM   2327 O O   . GLU D 2 9   ? 3.167   -18.102 -31.925 1.00 62.47  ? 9   GLU D O   1 
ATOM   2328 C CB  . GLU D 2 9   ? 4.112   -17.051 -28.861 1.00 62.06  ? 9   GLU D CB  1 
ATOM   2329 C CG  . GLU D 2 9   ? 5.237   -16.925 -27.859 1.00 66.29  ? 9   GLU D CG  1 
ATOM   2330 C CD  . GLU D 2 9   ? 5.484   -18.224 -27.116 1.00 73.68  ? 9   GLU D CD  1 
ATOM   2331 O OE1 . GLU D 2 9   ? 4.826   -18.432 -26.078 1.00 69.91  ? 9   GLU D OE1 1 
ATOM   2332 O OE2 . GLU D 2 9   ? 6.243   -19.081 -27.627 1.00 76.23  ? 9   GLU D OE2 1 
ATOM   2333 N N   . ASP D 2 10  ? 1.928   -18.735 -30.149 1.00 56.26  ? 10  ASP D N   1 
ATOM   2334 C CA  . ASP D 2 10  ? 0.638   -18.544 -30.799 1.00 56.70  ? 10  ASP D CA  1 
ATOM   2335 C C   . ASP D 2 10  ? 0.116   -17.145 -30.517 1.00 53.92  ? 10  ASP D C   1 
ATOM   2336 O O   . ASP D 2 10  ? 0.332   -16.610 -29.432 1.00 54.88  ? 10  ASP D O   1 
ATOM   2337 C CB  . ASP D 2 10  ? -0.392  -19.562 -30.289 1.00 60.85  ? 10  ASP D CB  1 
ATOM   2338 C CG  . ASP D 2 10  ? -0.031  -21.001 -30.636 1.00 66.86  ? 10  ASP D CG  1 
ATOM   2339 O OD1 . ASP D 2 10  ? -0.453  -21.903 -29.878 1.00 73.19  ? 10  ASP D OD1 1 
ATOM   2340 O OD2 . ASP D 2 10  ? 0.675   -21.231 -31.647 1.00 71.69  ? 10  ASP D OD2 1 
ATOM   2341 N N   . LEU D 2 11  ? -0.759  -16.666 -31.396 1.00 56.12  ? 11  LEU D N   1 
ATOM   2342 C CA  . LEU D 2 11  ? -1.490  -15.439 -31.148 1.00 55.61  ? 11  LEU D CA  1 
ATOM   2343 C C   . LEU D 2 11  ? -2.267  -15.492 -29.830 1.00 54.47  ? 11  LEU D C   1 
ATOM   2344 O O   . LEU D 2 11  ? -3.275  -16.190 -29.720 1.00 54.16  ? 11  LEU D O   1 
ATOM   2345 C CB  . LEU D 2 11  ? -2.433  -15.129 -32.311 1.00 54.37  ? 11  LEU D CB  1 
ATOM   2346 C CG  . LEU D 2 11  ? -3.225  -13.827 -32.186 1.00 54.76  ? 11  LEU D CG  1 
ATOM   2347 C CD1 . LEU D 2 11  ? -2.286  -12.612 -32.116 1.00 50.71  ? 11  LEU D CD1 1 
ATOM   2348 C CD2 . LEU D 2 11  ? -4.210  -13.696 -33.338 1.00 55.65  ? 11  LEU D CD2 1 
ATOM   2349 N N   . LEU D 2 12  ? -1.869  -14.639 -28.890 1.00 51.87  ? 12  LEU D N   1 
ATOM   2350 C CA  . LEU D 2 12  ? -2.719  -14.255 -27.775 1.00 52.27  ? 12  LEU D CA  1 
ATOM   2351 C C   . LEU D 2 12  ? -4.076  -13.768 -28.252 1.00 56.67  ? 12  LEU D C   1 
ATOM   2352 O O   . LEU D 2 12  ? -4.203  -12.641 -28.722 1.00 57.22  ? 12  LEU D O   1 
ATOM   2353 C CB  . LEU D 2 12  ? -2.037  -13.158 -26.954 1.00 50.35  ? 12  LEU D CB  1 
ATOM   2354 C CG  . LEU D 2 12  ? -2.522  -12.896 -25.527 1.00 50.39  ? 12  LEU D CG  1 
ATOM   2355 C CD1 . LEU D 2 12  ? -2.412  -14.173 -24.671 1.00 51.80  ? 12  LEU D CD1 1 
ATOM   2356 C CD2 . LEU D 2 12  ? -1.737  -11.729 -24.885 1.00 50.39  ? 12  LEU D CD2 1 
ATOM   2357 N N   . GLU D 2 13  ? -5.119  -14.539 -27.962 1.00 82.73  ? 13  GLU D N   1 
ATOM   2358 C CA  . GLU D 2 13  ? -6.479  -14.019 -28.053 1.00 88.26  ? 13  GLU D CA  1 
ATOM   2359 C C   . GLU D 2 13  ? -6.866  -13.205 -26.815 1.00 90.84  ? 13  GLU D C   1 
ATOM   2360 O O   . GLU D 2 13  ? -6.640  -11.989 -26.727 1.00 89.81  ? 13  GLU D O   1 
ATOM   2361 C CB  . GLU D 2 13  ? -7.474  -15.157 -28.274 1.00 90.75  ? 13  GLU D CB  1 
ATOM   2362 C CG  . GLU D 2 13  ? -8.032  -15.221 -29.694 1.00 99.08  ? 13  GLU D CG  1 
ATOM   2363 C CD  . GLU D 2 13  ? -9.241  -14.316 -29.887 1.00 105.15 ? 13  GLU D CD  1 
ATOM   2364 O OE1 . GLU D 2 13  ? -9.458  -13.425 -29.037 1.00 107.14 ? 13  GLU D OE1 1 
ATOM   2365 O OE2 . GLU D 2 13  ? -9.955  -14.474 -30.902 1.00 107.19 ? 13  GLU D OE2 1 
ATOM   2366 O OXT . GLU D 2 13  ? -7.450  -13.750 -25.876 1.00 94.33  ? 13  GLU D OXT 1 
HETATM 2367 I I   . IOD E 3 .   ? 7.755   0.088   -12.078 0.50 33.28  ? 148 IOD A I   1 
HETATM 2368 I I   . IOD F 3 .   ? 14.248  -4.485  -19.957 0.50 38.13  ? 149 IOD A I   1 
HETATM 2369 I I   . IOD G 3 .   ? 2.030   -0.896  5.767   1.00 40.19  ? 150 IOD A I   1 
HETATM 2370 I I   . IOD H 3 .   ? 0.625   -30.952 -2.443  0.50 46.56  ? 151 IOD A I   1 
HETATM 2371 I I   . IOD I 3 .   ? 4.293   10.815  -20.600 0.50 66.64  ? 148 IOD B I   1 
HETATM 2372 O O   . HOH J 4 .   ? 10.806  15.385  -0.893  1.00 51.82  ? 152 HOH A O   1 
HETATM 2373 O O   . HOH J 4 .   ? 11.346  -23.915 -17.142 1.00 33.96  ? 153 HOH A O   1 
HETATM 2374 O O   . HOH J 4 .   ? 22.165  3.489   0.711   1.00 24.14  ? 154 HOH A O   1 
HETATM 2375 O O   . HOH J 4 .   ? 15.007  -0.106  -12.128 1.00 17.80  ? 155 HOH A O   1 
HETATM 2376 O O   . HOH J 4 .   ? 1.033   -5.740  -11.734 1.00 36.60  ? 156 HOH A O   1 
HETATM 2377 O O   . HOH J 4 .   ? 22.073  -10.849 -10.144 1.00 21.69  ? 157 HOH A O   1 
HETATM 2378 O O   . HOH J 4 .   ? 6.765   -32.003 -13.303 1.00 55.43  ? 158 HOH A O   1 
HETATM 2379 O O   . HOH J 4 .   ? 10.053  -11.548 3.583   1.00 27.38  ? 159 HOH A O   1 
HETATM 2380 O O   . HOH J 4 .   ? 20.592  -18.011 -15.660 1.00 50.39  ? 160 HOH A O   1 
HETATM 2381 O O   . HOH J 4 .   ? -3.912  -13.646 1.216   1.00 25.34  ? 161 HOH A O   1 
HETATM 2382 O O   . HOH J 4 .   ? 0.063   -17.436 4.183   1.00 32.46  ? 162 HOH A O   1 
HETATM 2383 O O   . HOH J 4 .   ? 20.528  -18.875 -11.829 1.00 26.17  ? 163 HOH A O   1 
HETATM 2384 O O   . HOH J 4 .   ? 6.503   5.380   7.381   1.00 26.83  ? 164 HOH A O   1 
HETATM 2385 O O   . HOH J 4 .   ? 13.160  -5.695  6.849   1.00 20.69  ? 165 HOH A O   1 
HETATM 2386 O O   . HOH J 4 .   ? 19.784  -1.846  -4.024  1.00 26.98  ? 166 HOH A O   1 
HETATM 2387 O O   . HOH J 4 .   ? 12.376  -11.654 -13.704 1.00 24.73  ? 167 HOH A O   1 
HETATM 2388 O O   . HOH J 4 .   ? -0.965  -1.733  8.386   1.00 42.79  ? 168 HOH A O   1 
HETATM 2389 O O   . HOH J 4 .   ? 8.291   9.116   3.959   1.00 39.75  ? 169 HOH A O   1 
HETATM 2390 O O   . HOH J 4 .   ? -6.688  -13.421 3.035   1.00 32.65  ? 170 HOH A O   1 
HETATM 2391 O O   . HOH J 4 .   ? 13.934  -22.501 -10.301 1.00 32.29  ? 171 HOH A O   1 
HETATM 2392 O O   . HOH J 4 .   ? 7.894   16.619  -1.329  1.00 60.40  ? 172 HOH A O   1 
HETATM 2393 O O   . HOH J 4 .   ? 21.446  -7.841  -14.729 1.00 39.09  ? 173 HOH A O   1 
HETATM 2394 O O   . HOH J 4 .   ? 0.292   -8.152  8.849   1.00 37.27  ? 174 HOH A O   1 
HETATM 2395 O O   . HOH J 4 .   ? 23.421  1.374   1.223   1.00 24.71  ? 175 HOH A O   1 
HETATM 2396 O O   . HOH J 4 .   ? 5.241   -3.544  11.330  1.00 48.90  ? 176 HOH A O   1 
HETATM 2397 O O   . HOH J 4 .   ? -6.579  -32.962 -6.648  1.00 34.88  ? 177 HOH A O   1 
HETATM 2398 O O   . HOH J 4 .   ? 13.491  -15.559 2.088   1.00 56.53  ? 178 HOH A O   1 
HETATM 2399 O O   . HOH J 4 .   ? 12.390  -1.364  6.229   1.00 32.36  ? 179 HOH A O   1 
HETATM 2400 O O   . HOH J 4 .   ? 21.446  3.524   -6.073  1.00 36.87  ? 180 HOH A O   1 
HETATM 2401 O O   . HOH J 4 .   ? 17.683  -24.805 -9.052  1.00 34.21  ? 181 HOH A O   1 
HETATM 2402 O O   . HOH J 4 .   ? -0.559  -31.502 -10.419 1.00 40.90  ? 182 HOH A O   1 
HETATM 2403 O O   . HOH J 4 .   ? 21.459  -4.662  -16.856 1.00 36.00  ? 183 HOH A O   1 
HETATM 2404 O O   . HOH J 4 .   ? -3.805  -23.950 -4.140  1.00 41.35  ? 184 HOH A O   1 
HETATM 2405 O O   . HOH J 4 .   ? -0.815  -5.386  -7.017  1.00 28.60  ? 185 HOH A O   1 
HETATM 2406 O O   . HOH J 4 .   ? -5.145  -21.292 1.620   1.00 35.22  ? 186 HOH A O   1 
HETATM 2407 O O   . HOH J 4 .   ? 16.663  1.987   -12.507 1.00 33.84  ? 187 HOH A O   1 
HETATM 2408 O O   . HOH J 4 .   ? 19.416  -20.139 -14.738 1.00 48.45  ? 188 HOH A O   1 
HETATM 2409 O O   . HOH J 4 .   ? -2.252  -6.421  -5.105  1.00 38.12  ? 189 HOH A O   1 
HETATM 2410 O O   . HOH J 4 .   ? 15.087  3.860   -13.818 1.00 34.61  ? 190 HOH A O   1 
HETATM 2411 O O   . HOH J 4 .   ? 4.344   -15.370 -21.760 1.00 52.42  ? 191 HOH A O   1 
HETATM 2412 O O   . HOH J 4 .   ? 11.168  12.162  -5.873  1.00 50.50  ? 192 HOH A O   1 
HETATM 2413 O O   . HOH J 4 .   ? 15.811  -7.517  3.972   1.00 42.04  ? 193 HOH A O   1 
HETATM 2414 O O   . HOH J 4 .   ? 13.365  7.730   -11.212 1.00 48.72  ? 194 HOH A O   1 
HETATM 2415 O O   . HOH J 4 .   ? -7.686  2.857   0.848   1.00 54.57  ? 195 HOH A O   1 
HETATM 2416 O O   . HOH J 4 .   ? 30.228  -4.777  -7.819  1.00 58.24  ? 196 HOH A O   1 
HETATM 2417 O O   . HOH J 4 .   ? 25.394  -5.586  -1.696  1.00 55.60  ? 197 HOH A O   1 
HETATM 2418 O O   . HOH J 4 .   ? 3.103   -6.899  -13.552 1.00 45.70  ? 198 HOH A O   1 
HETATM 2419 O O   . HOH J 4 .   ? 15.423  0.269   -15.446 1.00 30.75  ? 199 HOH A O   1 
HETATM 2420 O O   . HOH J 4 .   ? 20.091  2.288   -14.848 1.00 36.32  ? 200 HOH A O   1 
HETATM 2421 O O   . HOH J 4 .   ? 21.877  -16.524 -12.294 1.00 33.75  ? 201 HOH A O   1 
HETATM 2422 O O   . HOH J 4 .   ? 9.216   17.154  0.990   1.00 58.89  ? 202 HOH A O   1 
HETATM 2423 O O   . HOH J 4 .   ? 4.987   7.705   -3.775  1.00 40.79  ? 203 HOH A O   1 
HETATM 2424 O O   . HOH J 4 .   ? 16.294  -13.599 -14.935 1.00 53.45  ? 204 HOH A O   1 
HETATM 2425 O O   . HOH J 4 .   ? -4.042  -2.452  1.840   1.00 62.22  ? 205 HOH A O   1 
HETATM 2426 O O   . HOH J 4 .   ? 6.621   12.192  -2.207  1.00 49.80  ? 206 HOH A O   1 
HETATM 2427 O O   . HOH J 4 .   ? 3.868   8.389   -6.744  1.00 47.56  ? 207 HOH A O   1 
HETATM 2428 O O   . HOH J 4 .   ? 11.266  -13.455 -25.268 1.00 40.75  ? 208 HOH A O   1 
HETATM 2429 O O   . HOH J 4 .   ? -5.162  -22.354 4.388   1.00 25.34  ? 209 HOH A O   1 
HETATM 2430 O O   . HOH J 4 .   ? 17.669  1.855   -15.212 1.00 26.79  ? 210 HOH A O   1 
HETATM 2431 O O   . HOH J 4 .   ? -3.936  -23.407 0.958   1.00 41.25  ? 211 HOH A O   1 
HETATM 2432 O O   . HOH J 4 .   ? 2.795   -3.939  -12.310 1.00 32.93  ? 212 HOH A O   1 
HETATM 2433 O O   . HOH J 4 .   ? 0.061   -6.510  -9.029  1.00 39.93  ? 213 HOH A O   1 
HETATM 2434 O O   . HOH J 4 .   ? 2.889   6.504   -2.815  1.00 42.43  ? 214 HOH A O   1 
HETATM 2435 O O   . HOH J 4 .   ? 10.912  9.256   -11.444 1.00 44.59  ? 215 HOH A O   1 
HETATM 2436 O O   . HOH J 4 .   ? 7.715   -20.141 -20.206 1.00 48.74  ? 216 HOH A O   1 
HETATM 2437 O O   . HOH J 4 .   ? 17.250  6.371   -10.384 1.00 30.98  ? 217 HOH A O   1 
HETATM 2438 O O   . HOH J 4 .   ? 13.662  -2.695  -17.148 1.00 42.80  ? 218 HOH A O   1 
HETATM 2439 O O   . HOH J 4 .   ? -4.772  -24.747 -1.433  1.00 48.96  ? 219 HOH A O   1 
HETATM 2440 O O   . HOH J 4 .   ? -2.210  -29.843 -10.227 1.00 51.62  ? 220 HOH A O   1 
HETATM 2441 O O   . HOH J 4 .   ? -4.405  1.620   -6.148  1.00 58.86  ? 221 HOH A O   1 
HETATM 2442 O O   . HOH J 4 .   ? 20.340  -9.583  -17.031 1.00 41.79  ? 222 HOH A O   1 
HETATM 2443 O O   . HOH J 4 .   ? 11.691  10.620  3.015   1.00 52.14  ? 223 HOH A O   1 
HETATM 2444 O O   . HOH J 4 .   ? 14.999  7.515   -8.895  1.00 42.87  ? 224 HOH A O   1 
HETATM 2445 O O   . HOH J 4 .   ? 27.761  0.764   -12.218 1.00 42.28  ? 225 HOH A O   1 
HETATM 2446 O O   . HOH J 4 .   ? -3.741  -9.486  7.910   1.00 62.14  ? 226 HOH A O   1 
HETATM 2447 O O   . HOH J 4 .   ? 7.521   -12.957 6.826   1.00 12.37  ? 227 HOH A O   1 
HETATM 2448 O O   . HOH J 4 .   ? 13.408  -0.635  8.600   1.00 44.44  ? 228 HOH A O   1 
HETATM 2449 O O   . HOH K 4 .   ? 14.963  -15.058 -23.476 1.00 59.33  ? 149 HOH B O   1 
HETATM 2450 O O   . HOH K 4 .   ? 25.557  -10.277 -31.649 1.00 56.24  ? 150 HOH B O   1 
HETATM 2451 O O   . HOH K 4 .   ? 6.017   1.681   -41.744 1.00 17.37  ? 151 HOH B O   1 
HETATM 2452 O O   . HOH K 4 .   ? 14.382  9.173   -24.618 1.00 28.76  ? 152 HOH B O   1 
HETATM 2453 O O   . HOH K 4 .   ? 4.633   -11.014 -39.440 1.00 30.26  ? 153 HOH B O   1 
HETATM 2454 O O   . HOH K 4 .   ? 9.202   -10.392 -27.084 1.00 32.52  ? 154 HOH B O   1 
HETATM 2455 O O   . HOH K 4 .   ? 1.817   -5.806  -41.627 1.00 38.57  ? 155 HOH B O   1 
HETATM 2456 O O   . HOH K 4 .   ? 19.423  1.186   -41.752 1.00 31.37  ? 156 HOH B O   1 
HETATM 2457 O O   . HOH K 4 .   ? -13.636 -2.295  -34.341 1.00 57.65  ? 157 HOH B O   1 
HETATM 2458 O O   . HOH K 4 .   ? 14.100  2.462   -17.994 1.00 24.98  ? 158 HOH B O   1 
HETATM 2459 O O   . HOH K 4 .   ? 11.654  5.415   -42.350 1.00 33.73  ? 159 HOH B O   1 
HETATM 2460 O O   . HOH K 4 .   ? 7.728   2.746   -36.778 1.00 32.35  ? 160 HOH B O   1 
HETATM 2461 O O   . HOH K 4 .   ? 23.634  -7.334  -23.755 1.00 39.71  ? 161 HOH B O   1 
HETATM 2462 O O   . HOH K 4 .   ? 22.153  4.251   -27.190 1.00 42.72  ? 162 HOH B O   1 
HETATM 2463 O O   . HOH K 4 .   ? 6.002   7.069   -27.860 1.00 37.01  ? 163 HOH B O   1 
HETATM 2464 O O   . HOH K 4 .   ? 15.697  9.126   -35.779 1.00 49.92  ? 164 HOH B O   1 
HETATM 2465 O O   . HOH K 4 .   ? 9.896   -11.581 -31.503 1.00 33.57  ? 165 HOH B O   1 
HETATM 2466 O O   . HOH K 4 .   ? -0.309  5.263   -38.583 1.00 40.17  ? 166 HOH B O   1 
HETATM 2467 O O   . HOH K 4 .   ? 5.701   3.875   -37.800 1.00 32.52  ? 167 HOH B O   1 
HETATM 2468 O O   . HOH K 4 .   ? 15.884  3.411   -16.960 1.00 38.32  ? 168 HOH B O   1 
HETATM 2469 O O   . HOH K 4 .   ? 6.136   8.667   -15.528 1.00 39.65  ? 169 HOH B O   1 
HETATM 2470 O O   . HOH K 4 .   ? 22.092  0.620   -17.117 1.00 35.50  ? 170 HOH B O   1 
HETATM 2471 O O   . HOH K 4 .   ? -0.286  -7.613  -44.364 1.00 48.22  ? 171 HOH B O   1 
HETATM 2472 O O   . HOH K 4 .   ? 20.505  4.482   -17.124 1.00 28.94  ? 172 HOH B O   1 
HETATM 2473 O O   . HOH K 4 .   ? 22.143  2.950   -18.512 1.00 32.70  ? 173 HOH B O   1 
HETATM 2474 O O   . HOH K 4 .   ? 14.591  -2.339  -38.882 1.00 31.38  ? 174 HOH B O   1 
HETATM 2475 O O   . HOH K 4 .   ? 2.520   0.368   -19.865 1.00 27.38  ? 175 HOH B O   1 
HETATM 2476 O O   . HOH K 4 .   ? 1.586   -9.679  -47.697 1.00 45.30  ? 176 HOH B O   1 
HETATM 2477 O O   . HOH K 4 .   ? 19.454  -12.660 -28.245 1.00 40.81  ? 177 HOH B O   1 
HETATM 2478 O O   . HOH K 4 .   ? -0.586  8.614   -28.010 1.00 43.88  ? 178 HOH B O   1 
HETATM 2479 O O   . HOH K 4 .   ? 19.464  -1.862  -40.074 1.00 54.74  ? 179 HOH B O   1 
HETATM 2480 O O   . HOH K 4 .   ? 23.192  -1.950  -17.106 1.00 30.06  ? 180 HOH B O   1 
HETATM 2481 O O   . HOH K 4 .   ? 12.877  -12.449 -28.267 1.00 40.20  ? 181 HOH B O   1 
HETATM 2482 O O   . HOH K 4 .   ? 17.679  5.292   -35.610 1.00 47.86  ? 182 HOH B O   1 
HETATM 2483 O O   . HOH K 4 .   ? 5.761   -13.249 -25.717 1.00 36.54  ? 183 HOH B O   1 
HETATM 2484 O O   . HOH K 4 .   ? 19.656  6.311   -13.762 1.00 39.80  ? 184 HOH B O   1 
HETATM 2485 O O   . HOH K 4 .   ? 17.563  13.819  -22.386 1.00 63.84  ? 185 HOH B O   1 
HETATM 2486 O O   . HOH K 4 .   ? -4.698  -1.946  -41.925 1.00 42.08  ? 186 HOH B O   1 
HETATM 2487 O O   . HOH K 4 .   ? 8.636   -6.851  -43.971 1.00 36.47  ? 187 HOH B O   1 
HETATM 2488 O O   . HOH K 4 .   ? 4.815   -12.579 -46.270 1.00 48.85  ? 188 HOH B O   1 
HETATM 2489 O O   . HOH K 4 .   ? 5.578   -12.775 -41.606 1.00 46.34  ? 189 HOH B O   1 
HETATM 2490 O O   . HOH K 4 .   ? 10.169  -9.137  -22.436 1.00 41.24  ? 190 HOH B O   1 
HETATM 2491 O O   . HOH K 4 .   ? 3.038   -14.625 -18.919 1.00 27.99  ? 191 HOH B O   1 
HETATM 2492 O O   . HOH K 4 .   ? 16.922  11.999  -34.217 1.00 51.47  ? 192 HOH B O   1 
HETATM 2493 O O   . HOH K 4 .   ? 10.879  15.234  -25.490 1.00 45.52  ? 193 HOH B O   1 
HETATM 2494 O O   . HOH K 4 .   ? 23.961  -10.274 -37.515 1.00 62.38  ? 194 HOH B O   1 
HETATM 2495 O O   . HOH K 4 .   ? 13.261  1.852   -14.722 1.00 26.07  ? 195 HOH B O   1 
HETATM 2496 O O   . HOH K 4 .   ? 19.523  -8.539  -19.683 1.00 45.04  ? 196 HOH B O   1 
HETATM 2497 O O   . HOH K 4 .   ? -7.458  -1.018  -40.879 1.00 50.58  ? 197 HOH B O   1 
HETATM 2498 O O   . HOH K 4 .   ? 18.875  14.363  -27.680 1.00 42.57  ? 198 HOH B O   1 
HETATM 2499 O O   . HOH K 4 .   ? 17.009  14.974  -19.515 1.00 47.07  ? 199 HOH B O   1 
HETATM 2500 O O   . HOH K 4 .   ? -4.414  -10.524 -41.558 1.00 52.37  ? 200 HOH B O   1 
HETATM 2501 O O   . HOH K 4 .   ? 8.012   14.576  -19.235 1.00 44.91  ? 201 HOH B O   1 
HETATM 2502 O O   . HOH K 4 .   ? -5.757  7.552   -19.798 1.00 53.37  ? 202 HOH B O   1 
HETATM 2503 O O   . HOH K 4 .   ? 10.988  7.839   -34.405 1.00 37.90  ? 203 HOH B O   1 
HETATM 2504 O O   . HOH K 4 .   ? 16.854  -0.740  -36.035 1.00 59.41  ? 204 HOH B O   1 
HETATM 2505 O O   . HOH K 4 .   ? 3.027   3.545   -42.495 1.00 47.85  ? 206 HOH B O   1 
HETATM 2506 O O   . HOH K 4 .   ? 18.386  -7.067  -41.006 1.00 42.60  ? 207 HOH B O   1 
HETATM 2507 O O   . HOH K 4 .   ? 17.874  -12.630 -35.809 1.00 53.40  ? 208 HOH B O   1 
HETATM 2508 O O   . HOH K 4 .   ? 24.380  -5.908  -25.934 1.00 44.61  ? 209 HOH B O   1 
HETATM 2509 O O   . HOH K 4 .   ? 4.721   5.957   -36.961 1.00 46.22  ? 210 HOH B O   1 
HETATM 2510 O O   . HOH L 4 .   ? -9.018  -12.490 -12.905 1.00 37.43  ? 24  HOH C O   1 
HETATM 2511 O O   . HOH L 4 .   ? -9.297  -17.647 -7.451  1.00 33.83  ? 51  HOH C O   1 
HETATM 2512 O O   . HOH L 4 .   ? -5.497  -19.821 -14.902 1.00 66.72  ? 86  HOH C O   1 
HETATM 2513 O O   . HOH L 4 .   ? -6.738  -17.540 -14.372 1.00 48.44  ? 95  HOH C O   1 
HETATM 2514 O O   . HOH L 4 .   ? -9.012  -25.127 -9.568  1.00 43.56  ? 161 HOH C O   1 
HETATM 2515 O O   . HOH M 4 .   ? -10.093 -12.655 -25.257 1.00 65.33  ? 41  HOH D O   1 
HETATM 2516 O O   . HOH M 4 .   ? -1.061  -18.311 -34.063 1.00 46.35  ? 90  HOH D O   1 
HETATM 2517 O O   . HOH M 4 .   ? 8.812   -17.643 -36.227 1.00 40.88  ? 126 HOH D O   1 
HETATM 2518 O O   . HOH M 4 .   ? 6.283   -19.306 -23.149 1.00 51.22  ? 129 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . PRO A 9   ? 1.3965 0.8003 1.2078 -0.0060 0.0669  -0.1161 7   PRO A N   
2    C CA  . PRO A 9   ? 1.3193 0.7827 1.1370 -0.0271 0.0592  -0.1042 7   PRO A CA  
3    C C   . PRO A 9   ? 1.2785 0.7512 1.1016 -0.0185 0.0457  -0.0776 7   PRO A C   
4    O O   . PRO A 9   ? 1.3285 0.7589 1.1464 0.0011  0.0410  -0.0666 7   PRO A O   
5    C CB  . PRO A 9   ? 1.2605 0.7846 1.1065 -0.0167 0.0608  -0.1148 7   PRO A CB  
6    C CG  . PRO A 9   ? 1.2870 0.7900 1.1476 0.0150  0.0672  -0.1281 7   PRO A CG  
7    C CD  . PRO A 9   ? 1.3846 0.8117 1.2186 0.0136  0.0751  -0.1363 7   PRO A CD  
8    N N   . GLU A 10  ? 1.0347 0.5588 0.8649 -0.0350 0.0399  -0.0674 8   GLU A N   
9    C CA  . GLU A 10  ? 0.9681 0.5101 0.8049 -0.0283 0.0287  -0.0449 8   GLU A CA  
10   C C   . GLU A 10  ? 0.8888 0.4713 0.7562 0.0004  0.0217  -0.0412 8   GLU A C   
11   O O   . GLU A 10  ? 0.8557 0.4778 0.7424 0.0041  0.0249  -0.0533 8   GLU A O   
12   C CB  . GLU A 10  ? 0.9233 0.5040 0.7569 -0.0572 0.0270  -0.0375 8   GLU A CB  
13   C CG  . GLU A 10  ? 1.0592 0.6033 0.8630 -0.0864 0.0310  -0.0341 8   GLU A CG  
14   C CD  . GLU A 10  ? 1.1164 0.6984 0.9191 -0.1186 0.0343  -0.0408 8   GLU A CD  
15   O OE1 . GLU A 10  ? 1.1029 0.7197 0.9111 -0.1315 0.0305  -0.0289 8   GLU A OE1 
16   O OE2 . GLU A 10  ? 1.2172 0.7930 1.0125 -0.1318 0.0410  -0.0582 8   GLU A OE2 
17   N N   . THR A 11  ? 0.7960 0.3695 0.6659 0.0183  0.0120  -0.0241 9   THR A N   
18   C CA  . THR A 11  ? 0.6820 0.2931 0.5797 0.0439  0.0041  -0.0197 9   THR A CA  
19   C C   . THR A 11  ? 0.5997 0.2709 0.5118 0.0329  0.0011  -0.0155 9   THR A C   
20   O O   . THR A 11  ? 0.5571 0.2395 0.4584 0.0088  0.0030  -0.0116 9   THR A O   
21   C CB  . THR A 11  ? 0.6912 0.2766 0.5841 0.0637  -0.0073 -0.0015 9   THR A CB  
22   O OG1 . THR A 11  ? 0.6449 0.2308 0.5195 0.0452  -0.0118 0.0151  9   THR A OG1 
23   C CG2 . THR A 11  ? 0.7559 0.2741 0.6320 0.0761  -0.0055 -0.0026 9   THR A CG2 
24   N N   . LEU A 12  ? 0.6091 0.3195 0.5471 0.0503  -0.0025 -0.0182 10  LEU A N   
25   C CA  . LEU A 12  ? 0.5670 0.3284 0.5186 0.0439  -0.0061 -0.0130 10  LEU A CA  
26   C C   . LEU A 12  ? 0.5357 0.2977 0.4756 0.0355  -0.0128 0.0048  10  LEU A C   
27   O O   . LEU A 12  ? 0.4822 0.2710 0.4220 0.0185  -0.0112 0.0075  10  LEU A O   
28   C CB  . LEU A 12  ? 0.5659 0.3610 0.5444 0.0651  -0.0098 -0.0170 10  LEU A CB  
29   C CG  . LEU A 12  ? 0.5418 0.3767 0.5368 0.0600  -0.0032 -0.0306 10  LEU A CG  
30   C CD1 . LEU A 12  ? 0.5244 0.3478 0.5063 0.0415  0.0068  -0.0429 10  LEU A CD1 
31   C CD2 . LEU A 12  ? 0.5153 0.3689 0.5345 0.0815  -0.0027 -0.0401 10  LEU A CD2 
32   N N   . GLU A 13  ? 0.5070 0.2380 0.4356 0.0469  -0.0197 0.0166  11  GLU A N   
33   C CA  . GLU A 13  ? 0.4932 0.2211 0.4062 0.0381  -0.0250 0.0332  11  GLU A CA  
34   C C   . GLU A 13  ? 0.5267 0.2426 0.4201 0.0105  -0.0176 0.0345  11  GLU A C   
35   O O   . GLU A 13  ? 0.4911 0.2311 0.3827 -0.0031 -0.0169 0.0410  11  GLU A O   
36   C CB  . GLU A 13  ? 0.5438 0.2316 0.4417 0.0534  -0.0340 0.0464  11  GLU A CB  
37   C CG  . GLU A 13  ? 0.5449 0.2531 0.4626 0.0796  -0.0448 0.0495  11  GLU A CG  
38   C CD  . GLU A 13  ? 0.6603 0.3670 0.5996 0.1005  -0.0432 0.0360  11  GLU A CD  
39   O OE1 . GLU A 13  ? 0.6346 0.3621 0.5941 0.1223  -0.0519 0.0372  11  GLU A OE1 
40   O OE2 . GLU A 13  ? 0.5887 0.2738 0.5245 0.0946  -0.0331 0.0235  11  GLU A OE2 
41   N N   . ALA A 14  ? 0.6263 0.3013 0.5038 0.0028  -0.0120 0.0289  12  ALA A N   
42   C CA  . ALA A 14  ? 0.6557 0.3148 0.5126 -0.0254 -0.0051 0.0297  12  ALA A CA  
43   C C   . ALA A 14  ? 0.6401 0.3469 0.5122 -0.0419 0.0000  0.0205  12  ALA A C   
44   O O   . ALA A 14  ? 0.6680 0.3944 0.5366 -0.0616 0.0023  0.0255  12  ALA A O   
45   C CB  . ALA A 14  ? 0.7363 0.3400 0.5735 -0.0297 0.0002  0.0224  12  ALA A CB  
46   N N   . ARG A 15  ? 0.5745 0.3024 0.4647 -0.0327 0.0013  0.0078  13  ARG A N   
47   C CA  . ARG A 15  ? 0.5557 0.3300 0.4611 -0.0443 0.0037  0.0009  13  ARG A CA  
48   C C   . ARG A 15  ? 0.4826 0.2988 0.4025 -0.0427 -0.0006 0.0108  13  ARG A C   
49   O O   . ARG A 15  ? 0.4659 0.3078 0.3884 -0.0594 0.0012  0.0131  13  ARG A O   
50   C CB  . ARG A 15  ? 0.5582 0.3450 0.4780 -0.0318 0.0054  -0.0127 13  ARG A CB  
51   C CG  . ARG A 15  ? 0.6732 0.4635 0.5873 -0.0499 0.0119  -0.0265 13  ARG A CG  
52   C CD  . ARG A 15  ? 0.6987 0.4409 0.5885 -0.0634 0.0174  -0.0319 13  ARG A CD  
53   N NE  . ARG A 15  ? 0.6526 0.4040 0.5338 -0.0878 0.0226  -0.0436 13  ARG A NE  
54   C CZ  . ARG A 15  ? 0.7901 0.5169 0.6600 -0.0920 0.0298  -0.0604 13  ARG A CZ  
55   N NH1 . ARG A 15  ? 0.5941 0.3282 0.4516 -0.1185 0.0335  -0.0701 13  ARG A NH1 
56   N NH2 . ARG A 15  ? 0.7688 0.4652 0.6403 -0.0697 0.0334  -0.0682 13  ARG A NH2 
57   N N   . ILE A 16  ? 0.4807 0.3072 0.4124 -0.0221 -0.0059 0.0148  14  ILE A N   
58   C CA  . ILE A 16  ? 0.4340 0.2968 0.3786 -0.0194 -0.0091 0.0219  14  ILE A CA  
59   C C   . ILE A 16  ? 0.4354 0.2952 0.3678 -0.0309 -0.0083 0.0330  14  ILE A C   
60   O O   . ILE A 16  ? 0.4384 0.3298 0.3801 -0.0381 -0.0065 0.0354  14  ILE A O   
61   C CB  . ILE A 16  ? 0.4484 0.3214 0.4059 0.0027  -0.0151 0.0230  14  ILE A CB  
62   C CG1 . ILE A 16  ? 0.3390 0.2528 0.3129 0.0033  -0.0160 0.0239  14  ILE A CG1 
63   C CG2 . ILE A 16  ? 0.3887 0.2354 0.3332 0.0127  -0.0212 0.0336  14  ILE A CG2 
64   C CD1 . ILE A 16  ? 0.4755 0.4137 0.4584 -0.0081 -0.0118 0.0176  14  ILE A CD1 
65   N N   . ASN A 17  ? 0.4172 0.2383 0.3284 -0.0325 -0.0090 0.0397  15  ASN A N   
66   C CA  . ASN A 17  ? 0.4126 0.2278 0.3078 -0.0466 -0.0067 0.0500  15  ASN A CA  
67   C C   . ASN A 17  ? 0.4243 0.2558 0.3195 -0.0709 0.0009  0.0471  15  ASN A C   
68   O O   . ASN A 17  ? 0.4003 0.2549 0.2977 -0.0804 0.0044  0.0521  15  ASN A O   
69   C CB  . ASN A 17  ? 0.4429 0.2076 0.3110 -0.0450 -0.0095 0.0591  15  ASN A CB  
70   C CG  . ASN A 17  ? 0.4841 0.2398 0.3527 -0.0213 -0.0193 0.0656  15  ASN A CG  
71   O OD1 . ASN A 17  ? 0.4345 0.2237 0.3221 -0.0091 -0.0231 0.0634  15  ASN A OD1 
72   N ND2 . ASN A 17  ? 0.5116 0.2214 0.3586 -0.0152 -0.0242 0.0742  15  ASN A ND2 
73   N N   . ARG A 18  ? 0.4706 0.2897 0.3623 -0.0817 0.0039  0.0387  16  ARG A N   
74   C CA  . ARG A 18  ? 0.4572 0.3000 0.3530 -0.1052 0.0092  0.0344  16  ARG A CA  
75   C C   . ARG A 18  ? 0.4279 0.3245 0.3514 -0.1017 0.0078  0.0314  16  ARG A C   
76   O O   . ARG A 18  ? 0.3954 0.3249 0.3290 -0.1144 0.0106  0.0336  16  ARG A O   
77   C CB  . ARG A 18  ? 0.5108 0.3275 0.3947 -0.1178 0.0118  0.0244  16  ARG A CB  
78   C CG  . ARG A 18  ? 0.7164 0.5101 0.5787 -0.1452 0.0177  0.0258  16  ARG A CG  
79   C CD  . ARG A 18  ? 0.9242 0.6853 0.7713 -0.1575 0.0207  0.0138  16  ARG A CD  
80   N NE  . ARG A 18  ? 1.0078 0.7144 0.8396 -0.1399 0.0199  0.0120  16  ARG A NE  
81   C CZ  . ARG A 18  ? 1.0432 0.7400 0.8801 -0.1264 0.0197  0.0001  16  ARG A CZ  
82   N NH1 . ARG A 18  ? 0.9808 0.6277 0.8056 -0.1094 0.0197  -0.0015 16  ARG A NH1 
83   N NH2 . ARG A 18  ? 0.9272 0.6644 0.7814 -0.1290 0.0196  -0.0100 16  ARG A NH2 
84   N N   . ALA A 19  ? 0.3634 0.2684 0.2992 -0.0850 0.0037  0.0261  17  ALA A N   
85   C CA  . ALA A 19  ? 0.3249 0.2728 0.2827 -0.0820 0.0016  0.0235  17  ALA A CA  
86   C C   . ALA A 19  ? 0.3388 0.3149 0.3111 -0.0733 0.0010  0.0309  17  ALA A C   
87   O O   . ALA A 19  ? 0.3388 0.3494 0.3291 -0.0721 -0.0003 0.0309  17  ALA A O   
88   C CB  . ALA A 19  ? 0.2869 0.2324 0.2501 -0.0683 -0.0012 0.0161  17  ALA A CB  
89   N N   . THR A 20  ? 0.3376 0.2968 0.3007 -0.0661 0.0015  0.0370  18  THR A N   
90   C CA  . THR A 20  ? 0.3273 0.3078 0.3001 -0.0578 0.0022  0.0419  18  THR A CA  
91   C C   . THR A 20  ? 0.3681 0.3428 0.3283 -0.0683 0.0078  0.0482  18  THR A C   
92   O O   . THR A 20  ? 0.3651 0.3525 0.3284 -0.0629 0.0101  0.0513  18  THR A O   
93   C CB  . THR A 20  ? 0.3244 0.2951 0.2969 -0.0387 -0.0029 0.0424  18  THR A CB  
94   O OG1 . THR A 20  ? 0.4178 0.3524 0.3703 -0.0357 -0.0054 0.0461  18  THR A OG1 
95   C CG2 . THR A 20  ? 0.2503 0.2298 0.2356 -0.0295 -0.0067 0.0357  18  THR A CG2 
96   N N   . ASN A 21  ? 0.3759 0.3298 0.3197 -0.0847 0.0109  0.0494  19  ASN A N   
97   C CA  . ASN A 21  ? 0.4293 0.3795 0.3594 -0.0992 0.0177  0.0553  19  ASN A CA  
98   C C   . ASN A 21  ? 0.4224 0.4168 0.3727 -0.1016 0.0241  0.0548  19  ASN A C   
99   O O   . ASN A 21  ? 0.4119 0.4402 0.3843 -0.1062 0.0252  0.0508  19  ASN A O   
100  C CB  . ASN A 21  ? 0.4464 0.3757 0.3599 -0.1218 0.0216  0.0551  19  ASN A CB  
101  C CG  . ASN A 21  ? 0.5688 0.4790 0.4581 -0.1372 0.0283  0.0630  19  ASN A CG  
102  O OD1 . ASN A 21  ? 0.4143 0.3514 0.3095 -0.1414 0.0348  0.0652  19  ASN A OD1 
103  N ND2 . ASN A 21  ? 0.5635 0.4254 0.4242 -0.1456 0.0274  0.0671  19  ASN A ND2 
104  N N   . PRO A 22  ? 0.4389 0.4339 0.3821 -0.0972 0.0280  0.0586  20  PRO A N   
105  C CA  . PRO A 22  ? 0.4095 0.4443 0.3718 -0.0991 0.0365  0.0564  20  PRO A CA  
106  C C   . PRO A 22  ? 0.4162 0.4722 0.3831 -0.1214 0.0457  0.0558  20  PRO A C   
107  O O   . PRO A 22  ? 0.3690 0.4654 0.3592 -0.1221 0.0528  0.0527  20  PRO A O   
108  C CB  . PRO A 22  ? 0.4301 0.4533 0.3759 -0.0931 0.0397  0.0594  20  PRO A CB  
109  C CG  . PRO A 22  ? 0.4486 0.4259 0.3628 -0.0942 0.0328  0.0662  20  PRO A CG  
110  C CD  . PRO A 22  ? 0.4188 0.3828 0.3397 -0.0874 0.0238  0.0640  20  PRO A CD  
111  N N   . LEU A 23  ? 0.4477 0.4787 0.3957 -0.1389 0.0451  0.0579  21  LEU A N   
112  C CA  . LEU A 23  ? 0.4959 0.5480 0.4480 -0.1636 0.0533  0.0565  21  LEU A CA  
113  C C   . LEU A 23  ? 0.4894 0.5746 0.4680 -0.1681 0.0490  0.0510  21  LEU A C   
114  O O   . LEU A 23  ? 0.5032 0.6207 0.4945 -0.1868 0.0547  0.0489  21  LEU A O   
115  C CB  . LEU A 23  ? 0.5417 0.5492 0.4575 -0.1848 0.0561  0.0615  21  LEU A CB  
116  C CG  . LEU A 23  ? 0.6399 0.6277 0.5286 -0.1922 0.0640  0.0685  21  LEU A CG  
117  C CD1 . LEU A 23  ? 0.5697 0.5081 0.4202 -0.2142 0.0656  0.0752  21  LEU A CD1 
118  C CD2 . LEU A 23  ? 0.5840 0.6210 0.4911 -0.2013 0.0774  0.0653  21  LEU A CD2 
119  N N   . ASN A 24  ? 0.4665 0.5491 0.4547 -0.1513 0.0390  0.0487  22  ASN A N   
120  C CA  . ASN A 24  ? 0.4460 0.5567 0.4539 -0.1563 0.0332  0.0444  22  ASN A CA  
121  C C   . ASN A 24  ? 0.4457 0.6156 0.4889 -0.1546 0.0355  0.0440  22  ASN A C   
122  O O   . ASN A 24  ? 0.4145 0.6012 0.4738 -0.1358 0.0374  0.0453  22  ASN A O   
123  C CB  . ASN A 24  ? 0.4273 0.5229 0.4357 -0.1388 0.0232  0.0423  22  ASN A CB  
124  C CG  . ASN A 24  ? 0.4394 0.4830 0.4188 -0.1418 0.0207  0.0404  22  ASN A CG  
125  O OD1 . ASN A 24  ? 0.4081 0.4250 0.3662 -0.1598 0.0250  0.0407  22  ASN A OD1 
126  N ND2 . ASN A 24  ? 0.4001 0.4289 0.3791 -0.1245 0.0143  0.0380  22  ASN A ND2 
127  N N   . LYS A 25  ? 0.5063 0.7073 0.5614 -0.1746 0.0358  0.0420  23  LYS A N   
128  C CA  . LYS A 25  ? 0.5057 0.7681 0.5990 -0.1717 0.0357  0.0420  23  LYS A CA  
129  C C   . LYS A 25  ? 0.4862 0.7673 0.5979 -0.1559 0.0227  0.0432  23  LYS A C   
130  O O   . LYS A 25  ? 0.4747 0.8014 0.6189 -0.1452 0.0199  0.0455  23  LYS A O   
131  C CB  . LYS A 25  ? 0.5210 0.8156 0.6219 -0.2008 0.0397  0.0397  23  LYS A CB  
132  C CG  . LYS A 25  ? 0.6090 0.8743 0.6816 -0.2240 0.0515  0.0390  23  LYS A CG  
133  C CD  . LYS A 25  ? 0.7635 1.0705 0.8557 -0.2309 0.0648  0.0386  23  LYS A CD  
134  C CE  . LYS A 25  ? 0.8104 1.1135 0.9076 -0.2049 0.0709  0.0402  23  LYS A CE  
135  N NZ  . LYS A 25  ? 0.8210 1.1782 0.9493 -0.2047 0.0834  0.0373  23  LYS A NZ  
136  N N   . GLU A 26  ? 0.4412 0.6894 0.5322 -0.1577 0.0149  0.0414  24  GLU A N   
137  C CA  . GLU A 26  ? 0.4090 0.6693 0.5100 -0.1461 0.0032  0.0425  24  GLU A CA  
138  C C   . GLU A 26  ? 0.3970 0.6079 0.4707 -0.1402 0.0001  0.0394  24  GLU A C   
139  O O   . GLU A 26  ? 0.3856 0.5555 0.4350 -0.1455 0.0057  0.0367  24  GLU A O   
140  C CB  . GLU A 26  ? 0.3803 0.6793 0.4935 -0.1648 -0.0045 0.0417  24  GLU A CB  
141  C CG  . GLU A 26  ? 0.5519 0.8269 0.6385 -0.1933 -0.0029 0.0348  24  GLU A CG  
142  C CD  . GLU A 26  ? 0.7171 1.0294 0.8121 -0.2133 -0.0122 0.0328  24  GLU A CD  
143  O OE1 . GLU A 26  ? 0.7360 1.0259 0.8096 -0.2226 -0.0177 0.0274  24  GLU A OE1 
144  O OE2 . GLU A 26  ? 0.8028 1.1672 0.9245 -0.2219 -0.0133 0.0355  24  GLU A OE2 
145  N N   . LEU A 27  ? 0.2913 0.5066 0.3694 -0.1286 -0.0086 0.0402  25  LEU A N   
146  C CA  . LEU A 27  ? 0.3126 0.4883 0.3693 -0.1221 -0.0104 0.0359  25  LEU A CA  
147  C C   . LEU A 27  ? 0.3504 0.5016 0.3838 -0.1429 -0.0097 0.0279  25  LEU A C   
148  O O   . LEU A 27  ? 0.3118 0.4851 0.3470 -0.1627 -0.0125 0.0259  25  LEU A O   
149  C CB  . LEU A 27  ? 0.2909 0.4796 0.3563 -0.1084 -0.0185 0.0385  25  LEU A CB  
150  C CG  . LEU A 27  ? 0.3135 0.5156 0.3977 -0.0864 -0.0189 0.0454  25  LEU A CG  
151  C CD1 . LEU A 27  ? 0.2439 0.4640 0.3366 -0.0785 -0.0284 0.0503  25  LEU A CD1 
152  C CD2 . LEU A 27  ? 0.3205 0.4882 0.3933 -0.0730 -0.0132 0.0433  25  LEU A CD2 
153  N N   . ASP A 28  ? 0.3397 0.4449 0.3515 -0.1386 -0.0057 0.0232  26  ASP A N   
154  C CA  . ASP A 28  ? 0.3491 0.4205 0.3365 -0.1562 -0.0027 0.0149  26  ASP A CA  
155  C C   . ASP A 28  ? 0.3818 0.4344 0.3583 -0.1505 -0.0052 0.0066  26  ASP A C   
156  O O   . ASP A 28  ? 0.4064 0.4299 0.3763 -0.1338 -0.0032 0.0046  26  ASP A O   
157  C CB  . ASP A 28  ? 0.3991 0.4291 0.3696 -0.1547 0.0042  0.0165  26  ASP A CB  
158  C CG  . ASP A 28  ? 0.4819 0.4641 0.4250 -0.1665 0.0077  0.0083  26  ASP A CG  
159  O OD1 . ASP A 28  ? 0.4822 0.4670 0.4182 -0.1838 0.0069  0.0000  26  ASP A OD1 
160  O OD2 . ASP A 28  ? 0.5611 0.5027 0.4881 -0.1612 0.0114  0.0108  26  ASP A OD2 
161  N N   . TRP A 29  ? 0.3753 0.4530 0.3538 -0.1620 -0.0104 0.0029  27  TRP A N   
162  C CA  . TRP A 29  ? 0.3925 0.4622 0.3629 -0.1565 -0.0122 -0.0044 27  TRP A CA  
163  C C   . TRP A 29  ? 0.4212 0.4442 0.3671 -0.1618 -0.0052 -0.0178 27  TRP A C   
164  O O   . TRP A 29  ? 0.4408 0.4478 0.3822 -0.1490 -0.0031 -0.0242 27  TRP A O   
165  C CB  . TRP A 29  ? 0.3842 0.4927 0.3591 -0.1694 -0.0203 -0.0038 27  TRP A CB  
166  C CG  . TRP A 29  ? 0.3744 0.5235 0.3743 -0.1569 -0.0278 0.0096  27  TRP A CG  
167  C CD1 . TRP A 29  ? 0.2934 0.4827 0.3122 -0.1636 -0.0335 0.0181  27  TRP A CD1 
168  C CD2 . TRP A 29  ? 0.3127 0.4645 0.3226 -0.1346 -0.0296 0.0156  27  TRP A CD2 
169  N NE1 . TRP A 29  ? 0.3693 0.5826 0.4094 -0.1443 -0.0384 0.0291  27  TRP A NE1 
170  C CE2 . TRP A 29  ? 0.2732 0.4621 0.3064 -0.1277 -0.0360 0.0279  27  TRP A CE2 
171  C CE3 . TRP A 29  ? 0.2973 0.4262 0.2993 -0.1212 -0.0264 0.0111  27  TRP A CE3 
172  C CZ2 . TRP A 29  ? 0.2548 0.4516 0.3000 -0.1083 -0.0392 0.0360  27  TRP A CZ2 
173  C CZ3 . TRP A 29  ? 0.3100 0.4502 0.3248 -0.1038 -0.0293 0.0192  27  TRP A CZ3 
174  C CH2 . TRP A 29  ? 0.2255 0.3967 0.2597 -0.0982 -0.0357 0.0315  27  TRP A CH2 
175  N N   . ALA A 30  ? 0.3844 0.3864 0.3148 -0.1816 -0.0011 -0.0228 28  ALA A N   
176  C CA  . ALA A 30  ? 0.4505 0.3984 0.3575 -0.1833 0.0067  -0.0340 28  ALA A CA  
177  C C   . ALA A 30  ? 0.4442 0.3635 0.3546 -0.1552 0.0093  -0.0310 28  ALA A C   
178  O O   . ALA A 30  ? 0.4674 0.3660 0.3730 -0.1427 0.0124  -0.0402 28  ALA A O   
179  C CB  . ALA A 30  ? 0.4382 0.3628 0.3290 -0.2063 0.0110  -0.0351 28  ALA A CB  
180  N N   . SER A 31  ? 0.5344 0.4594 0.4553 -0.1451 0.0075  -0.0183 29  SER A N   
181  C CA  . SER A 31  ? 0.5248 0.4254 0.4475 -0.1210 0.0081  -0.0138 29  SER A CA  
182  C C   . SER A 31  ? 0.4994 0.4226 0.4395 -0.0998 0.0047  -0.0135 29  SER A C   
183  O O   . SER A 31  ? 0.5025 0.4051 0.4422 -0.0825 0.0059  -0.0180 29  SER A O   
184  C CB  . SER A 31  ? 0.5207 0.4208 0.4446 -0.1206 0.0077  -0.0010 29  SER A CB  
185  O OG  . SER A 31  ? 0.6626 0.5280 0.5651 -0.1381 0.0123  -0.0012 29  SER A OG  
186  N N   . ILE A 32  ? 0.3976 0.3635 0.3534 -0.1017 0.0004  -0.0083 30  ILE A N   
187  C CA  . ILE A 32  ? 0.3428 0.3307 0.3131 -0.0860 -0.0027 -0.0071 30  ILE A CA  
188  C C   . ILE A 32  ? 0.3762 0.3577 0.3398 -0.0862 -0.0001 -0.0197 30  ILE A C   
189  O O   . ILE A 32  ? 0.3596 0.3346 0.3278 -0.0703 0.0015  -0.0237 30  ILE A O   
190  C CB  . ILE A 32  ? 0.3140 0.3446 0.2996 -0.0903 -0.0080 0.0012  30  ILE A CB  
191  C CG1 . ILE A 32  ? 0.2770 0.3184 0.2721 -0.0891 -0.0083 0.0116  30  ILE A CG1 
192  C CG2 . ILE A 32  ? 0.2808 0.3286 0.2768 -0.0770 -0.0108 0.0026  30  ILE A CG2 
193  C CD1 . ILE A 32  ? 0.2059 0.2886 0.2189 -0.0914 -0.0129 0.0193  30  ILE A CD1 
194  N N   . ASN A 33  ? 0.4080 0.3958 0.3612 -0.1054 0.0004  -0.0265 31  ASN A N   
195  C CA  . ASN A 33  ? 0.4414 0.4239 0.3848 -0.1085 0.0044  -0.0402 31  ASN A CA  
196  C C   . ASN A 33  ? 0.4499 0.3888 0.3808 -0.1028 0.0129  -0.0535 31  ASN A C   
197  O O   . ASN A 33  ? 0.4176 0.3509 0.3491 -0.0928 0.0181  -0.0640 31  ASN A O   
198  C CB  . ASN A 33  ? 0.4011 0.4046 0.3342 -0.1323 0.0016  -0.0436 31  ASN A CB  
199  C CG  . ASN A 33  ? 0.4952 0.5406 0.4402 -0.1316 -0.0066 -0.0333 31  ASN A CG  
200  O OD1 . ASN A 33  ? 0.4344 0.4869 0.3876 -0.1169 -0.0064 -0.0311 31  ASN A OD1 
201  N ND2 . ASN A 33  ? 0.4214 0.4943 0.3664 -0.1484 -0.0140 -0.0272 31  ASN A ND2 
202  N N   . GLY A 34  ? 0.4257 0.3337 0.3472 -0.1067 0.0146  -0.0518 32  GLY A N   
203  C CA  . GLY A 34  ? 0.4501 0.3114 0.3612 -0.0967 0.0214  -0.0610 32  GLY A CA  
204  C C   . GLY A 34  ? 0.4591 0.3151 0.3854 -0.0682 0.0203  -0.0573 32  GLY A C   
205  O O   . GLY A 34  ? 0.4984 0.3312 0.4240 -0.0548 0.0259  -0.0683 32  GLY A O   
206  N N   . PHE A 35  ? 0.4062 0.2837 0.3465 -0.0589 0.0135  -0.0426 33  PHE A N   
207  C CA  . PHE A 35  ? 0.4022 0.2842 0.3582 -0.0345 0.0108  -0.0388 33  PHE A CA  
208  C C   . PHE A 35  ? 0.3960 0.2990 0.3633 -0.0267 0.0142  -0.0499 33  PHE A C   
209  O O   . PHE A 35  ? 0.4496 0.3430 0.4252 -0.0088 0.0167  -0.0564 33  PHE A O   
210  C CB  . PHE A 35  ? 0.3240 0.2301 0.2906 -0.0308 0.0037  -0.0231 33  PHE A CB  
211  C CG  . PHE A 35  ? 0.3516 0.2659 0.3328 -0.0093 -0.0001 -0.0193 33  PHE A CG  
212  C CD1 . PHE A 35  ? 0.3351 0.2822 0.3313 -0.0044 -0.0011 -0.0207 33  PHE A CD1 
213  C CD2 . PHE A 35  ? 0.3707 0.2615 0.3489 0.0036  -0.0038 -0.0122 33  PHE A CD2 
214  C CE1 . PHE A 35  ? 0.2763 0.2337 0.2857 0.0122  -0.0049 -0.0176 33  PHE A CE1 
215  C CE2 . PHE A 35  ? 0.3401 0.2436 0.3316 0.0212  -0.0092 -0.0079 33  PHE A CE2 
216  C CZ  . PHE A 35  ? 0.2750 0.2132 0.2827 0.0245  -0.0095 -0.0111 33  PHE A CZ  
217  N N   . CYS A 36  ? 0.3817 0.3163 0.3508 -0.0393 0.0138  -0.0505 34  CYS A N   
218  C CA  . CYS A 36  ? 0.3702 0.3259 0.3460 -0.0364 0.0179  -0.0601 34  CYS A CA  
219  C C   . CYS A 36  ? 0.4129 0.3470 0.3791 -0.0374 0.0281  -0.0791 34  CYS A C   
220  O O   . CYS A 36  ? 0.3780 0.3189 0.3539 -0.0257 0.0339  -0.0894 34  CYS A O   
221  C CB  . CYS A 36  ? 0.3160 0.3031 0.2885 -0.0533 0.0148  -0.0558 34  CYS A CB  
222  S SG  . CYS A 36  ? 0.3529 0.3663 0.3368 -0.0532 0.0046  -0.0357 34  CYS A SG  
223  N N   . GLU A 37  ? 0.4074 0.3213 0.3541 -0.0548 0.0311  -0.0853 35  GLU A N   
224  C CA  . GLU A 37  ? 0.4832 0.3689 0.4168 -0.0572 0.0421  -0.1049 35  GLU A CA  
225  C C   . GLU A 37  ? 0.5175 0.3725 0.4609 -0.0318 0.0462  -0.1101 35  GLU A C   
226  O O   . GLU A 37  ? 0.5574 0.4033 0.5036 -0.0224 0.0563  -0.1272 35  GLU A O   
227  C CB  . GLU A 37  ? 0.5130 0.3752 0.4228 -0.0806 0.0432  -0.1084 35  GLU A CB  
228  C CG  . GLU A 37  ? 0.7554 0.5860 0.6464 -0.0884 0.0556  -0.1306 35  GLU A CG  
229  C CD  . GLU A 37  ? 1.0182 0.7937 0.8974 -0.0841 0.0593  -0.1339 35  GLU A CD  
230  O OE1 . GLU A 37  ? 1.0416 0.7829 0.9082 -0.0834 0.0709  -0.1531 35  GLU A OE1 
231  O OE2 . GLU A 37  ? 1.0835 0.8478 0.9644 -0.0815 0.0515  -0.1174 35  GLU A OE2 
232  N N   . GLN A 38  ? 0.4986 0.3386 0.4473 -0.0204 0.0384  -0.0952 36  GLN A N   
233  C CA  . GLN A 38  ? 0.5376 0.3425 0.4913 0.0025  0.0393  -0.0965 36  GLN A CA  
234  C C   . GLN A 38  ? 0.5000 0.3301 0.4808 0.0276  0.0374  -0.0965 36  GLN A C   
235  O O   . GLN A 38  ? 0.5056 0.3199 0.4959 0.0469  0.0428  -0.1072 36  GLN A O   
236  C CB  . GLN A 38  ? 0.5679 0.3449 0.5115 0.0020  0.0313  -0.0796 36  GLN A CB  
237  C CG  . GLN A 38  ? 0.6038 0.3357 0.5460 0.0237  0.0307  -0.0784 36  GLN A CG  
238  C CD  . GLN A 38  ? 0.6948 0.3882 0.6267 0.0259  0.0425  -0.0981 36  GLN A CD  
239  O OE1 . GLN A 38  ? 0.7783 0.4631 0.7252 0.0504  0.0461  -0.1069 36  GLN A OE1 
240  N NE2 . GLN A 38  ? 0.6890 0.3578 0.5956 0.0008  0.0487  -0.1053 36  GLN A NE2 
241  N N   . LEU A 39  ? 0.4678 0.3395 0.4616 0.0260  0.0311  -0.0868 37  LEU A N   
242  C CA  . LEU A 39  ? 0.4501 0.3501 0.4692 0.0458  0.0288  -0.0866 37  LEU A CA  
243  C C   . LEU A 39  ? 0.4695 0.3906 0.4977 0.0461  0.0403  -0.1056 37  LEU A C   
244  O O   . LEU A 39  ? 0.4285 0.3629 0.4782 0.0650  0.0431  -0.1131 37  LEU A O   
245  C CB  . LEU A 39  ? 0.3805 0.3136 0.4070 0.0411  0.0196  -0.0713 37  LEU A CB  
246  C CG  . LEU A 39  ? 0.3770 0.3405 0.3993 0.0214  0.0214  -0.0712 37  LEU A CG  
247  C CD1 . LEU A 39  ? 0.3746 0.3689 0.4111 0.0247  0.0274  -0.0817 37  LEU A CD1 
248  C CD2 . LEU A 39  ? 0.3221 0.2996 0.3441 0.0154  0.0121  -0.0537 37  LEU A CD2 
249  N N   . ASN A 40  ? 0.4878 0.4121 0.4987 0.0241  0.0471  -0.1138 38  ASN A N   
250  C CA  . ASN A 40  ? 0.5260 0.4668 0.5376 0.0187  0.0597  -0.1328 38  ASN A CA  
251  C C   . ASN A 40  ? 0.6007 0.5097 0.6110 0.0302  0.0717  -0.1524 38  ASN A C   
252  O O   . ASN A 40  ? 0.6092 0.5332 0.6318 0.0383  0.0831  -0.1694 38  ASN A O   
253  C CB  . ASN A 40  ? 0.4886 0.4413 0.4775 -0.0102 0.0610  -0.1331 38  ASN A CB  
254  C CG  . ASN A 40  ? 0.5056 0.4664 0.4851 -0.0208 0.0754  -0.1543 38  ASN A CG  
255  O OD1 . ASN A 40  ? 0.4372 0.4299 0.4270 -0.0203 0.0804  -0.1594 38  ASN A OD1 
256  N ND2 . ASN A 40  ? 0.4616 0.3920 0.4201 -0.0313 0.0832  -0.1681 38  ASN A ND2 
257  N N   . GLU A 41  ? 0.6693 0.5333 0.6651 0.0315  0.0698  -0.1501 39  GLU A N   
258  C CA  . GLU A 41  ? 0.7408 0.5638 0.7325 0.0435  0.0808  -0.1675 39  GLU A CA  
259  C C   . GLU A 41  ? 0.7624 0.5798 0.7821 0.0782  0.0786  -0.1666 39  GLU A C   
260  O O   . GLU A 41  ? 0.7825 0.5917 0.8141 0.0947  0.0903  -0.1852 39  GLU A O   
261  C CB  . GLU A 41  ? 0.7337 0.5068 0.6969 0.0298  0.0791  -0.1639 39  GLU A CB  
262  C CG  . GLU A 41  ? 0.8875 0.6063 0.8459 0.0465  0.0873  -0.1763 39  GLU A CG  
263  C CD  . GLU A 41  ? 0.9825 0.6511 0.9068 0.0249  0.0895  -0.1778 39  GLU A CD  
264  O OE1 . GLU A 41  ? 1.1145 0.7339 1.0316 0.0367  0.0866  -0.1714 39  GLU A OE1 
265  O OE2 . GLU A 41  ? 1.0219 0.7010 0.9256 -0.0051 0.0931  -0.1842 39  GLU A OE2 
266  N N   . ASP A 42  ? 0.7570 0.5820 0.7880 0.0895  0.0635  -0.1454 40  ASP A N   
267  C CA  . ASP A 42  ? 0.8020 0.6189 0.8561 0.1215  0.0572  -0.1403 40  ASP A CA  
268  C C   . ASP A 42  ? 0.7908 0.6613 0.8796 0.1370  0.0572  -0.1446 40  ASP A C   
269  O O   . ASP A 42  ? 0.7465 0.6593 0.8397 0.1228  0.0549  -0.1401 40  ASP A O   
270  C CB  . ASP A 42  ? 0.7900 0.5866 0.8351 0.1242  0.0408  -0.1155 40  ASP A CB  
271  C CG  . ASP A 42  ? 0.8545 0.5921 0.8680 0.1132  0.0419  -0.1122 40  ASP A CG  
272  O OD1 . ASP A 42  ? 0.8293 0.5535 0.8277 0.1041  0.0314  -0.0932 40  ASP A OD1 
273  O OD2 . ASP A 42  ? 0.8897 0.5929 0.8930 0.1135  0.0540  -0.1294 40  ASP A OD2 
274  N N   . PHE A 43  ? 0.9476 0.8157 1.0605 0.1646  0.0621  -0.1562 41  PHE A N   
275  C CA  . PHE A 43  ? 0.9528 0.8726 1.1036 0.1827  0.0615  -0.1606 41  PHE A CA  
276  C C   . PHE A 43  ? 0.8732 0.8282 1.0345 0.1813  0.0445  -0.1398 41  PHE A C   
277  O O   . PHE A 43  ? 0.8416 0.8460 1.0178 0.1729  0.0462  -0.1426 41  PHE A O   
278  C CB  . PHE A 43  ? 1.0310 0.9349 1.2076 0.2188  0.0625  -0.1682 41  PHE A CB  
279  C CG  . PHE A 43  ? 1.0991 1.0369 1.3047 0.2305  0.0796  -0.1938 41  PHE A CG  
280  C CD1 . PHE A 43  ? 1.2199 1.1322 1.4419 0.2589  0.0887  -0.2091 41  PHE A CD1 
281  C CD2 . PHE A 43  ? 1.1027 1.0960 1.3180 0.2126  0.0878  -0.2028 41  PHE A CD2 
282  C CE1 . PHE A 43  ? 1.2294 1.1752 1.4794 0.2696  0.1070  -0.2351 41  PHE A CE1 
283  C CE2 . PHE A 43  ? 1.1467 1.1726 1.3866 0.2203  0.1059  -0.2276 41  PHE A CE2 
284  C CZ  . PHE A 43  ? 1.1711 1.1752 1.4295 0.2489  0.1162  -0.2447 41  PHE A CZ  
285  N N   . GLU A 44  ? 0.8903 0.8198 1.0460 0.1924  0.0288  -0.1203 42  GLU A N   
286  C CA  . GLU A 44  ? 0.8424 0.7992 1.0029 0.1898  0.0129  -0.1011 42  GLU A CA  
287  C C   . GLU A 44  ? 0.7838 0.7209 0.9116 0.1646  0.0080  -0.0865 42  GLU A C   
288  O O   . GLU A 44  ? 0.7749 0.7124 0.8971 0.1642  -0.0055 -0.0685 42  GLU A O   
289  C CB  . GLU A 44  ? 0.8825 0.8315 1.0585 0.2180  -0.0026 -0.0881 42  GLU A CB  
290  C CG  . GLU A 44  ? 0.9162 0.9201 1.1325 0.2363  -0.0069 -0.0928 42  GLU A CG  
291  C CD  . GLU A 44  ? 1.0595 1.0530 1.3012 0.2718  -0.0105 -0.0964 42  GLU A CD  
292  O OE1 . GLU A 44  ? 1.0925 1.0613 1.3369 0.2815  0.0037  -0.1131 42  GLU A OE1 
293  O OE2 . GLU A 44  ? 1.1103 1.1200 1.3689 0.2903  -0.0277 -0.0827 42  GLU A OE2 
294  N N   . GLY A 45  ? 0.6086 0.5293 0.7151 0.1438  0.0193  -0.0953 43  GLY A N   
295  C CA  . GLY A 45  ? 0.5520 0.4668 0.6331 0.1178  0.0167  -0.0846 43  GLY A CA  
296  C C   . GLY A 45  ? 0.4753 0.4300 0.5629 0.1083  0.0094  -0.0738 43  GLY A C   
297  O O   . GLY A 45  ? 0.4415 0.3889 0.5174 0.1021  0.0001  -0.0579 43  GLY A O   
298  N N   . PRO A 46  ? 0.4487 0.4432 0.5514 0.1036  0.0155  -0.0835 44  PRO A N   
299  C CA  . PRO A 46  ? 0.3923 0.4189 0.4962 0.0901  0.0110  -0.0749 44  PRO A CA  
300  C C   . PRO A 46  ? 0.3726 0.4122 0.4872 0.1004  -0.0019 -0.0615 44  PRO A C   
301  O O   . PRO A 46  ? 0.3500 0.3959 0.4555 0.0889  -0.0073 -0.0503 44  PRO A O   
302  C CB  . PRO A 46  ? 0.3767 0.4382 0.4943 0.0850  0.0216  -0.0896 44  PRO A CB  
303  C CG  . PRO A 46  ? 0.3865 0.4289 0.4981 0.0855  0.0342  -0.1065 44  PRO A CG  
304  C CD  . PRO A 46  ? 0.4569 0.4631 0.5698 0.1056  0.0295  -0.1041 44  PRO A CD  
305  N N   . PRO A 47  ? 0.4586 0.5068 0.5943 0.1218  -0.0065 -0.0638 45  PRO A N   
306  C CA  . PRO A 47  ? 0.4462 0.5084 0.5900 0.1302  -0.0203 -0.0513 45  PRO A CA  
307  C C   . PRO A 47  ? 0.4466 0.4733 0.5685 0.1309  -0.0302 -0.0349 45  PRO A C   
308  O O   . PRO A 47  ? 0.4365 0.4714 0.5524 0.1261  -0.0390 -0.0234 45  PRO A O   
309  C CB  . PRO A 47  ? 0.4823 0.5621 0.6552 0.1545  -0.0232 -0.0585 45  PRO A CB  
310  C CG  . PRO A 47  ? 0.4827 0.5719 0.6672 0.1549  -0.0074 -0.0780 45  PRO A CG  
311  C CD  . PRO A 47  ? 0.4982 0.5519 0.6541 0.1385  0.0013  -0.0798 45  PRO A CD  
312  N N   . LEU A 48  ? 0.4243 0.4107 0.5330 0.1363  -0.0281 -0.0344 46  LEU A N   
313  C CA  . LEU A 48  ? 0.4421 0.3921 0.5258 0.1325  -0.0353 -0.0191 46  LEU A CA  
314  C C   . LEU A 48  ? 0.4207 0.3714 0.4855 0.1083  -0.0318 -0.0139 46  LEU A C   
315  O O   . LEU A 48  ? 0.3985 0.3459 0.4511 0.1028  -0.0387 -0.0010 46  LEU A O   
316  C CB  . LEU A 48  ? 0.4930 0.3959 0.5643 0.1401  -0.0318 -0.0212 46  LEU A CB  
317  C CG  . LEU A 48  ? 0.5856 0.4460 0.6271 0.1318  -0.0365 -0.0063 46  LEU A CG  
318  C CD1 . LEU A 48  ? 0.5366 0.3973 0.5741 0.1413  -0.0516 0.0112  46  LEU A CD1 
319  C CD2 . LEU A 48  ? 0.5705 0.3806 0.5990 0.1379  -0.0314 -0.0106 46  LEU A CD2 
320  N N   . ALA A 49  ? 0.3574 0.3142 0.4202 0.0944  -0.0211 -0.0241 47  ALA A N   
321  C CA  . ALA A 49  ? 0.3582 0.3184 0.4067 0.0732  -0.0180 -0.0197 47  ALA A CA  
322  C C   . ALA A 49  ? 0.3232 0.3112 0.3769 0.0689  -0.0231 -0.0122 47  ALA A C   
323  O O   . ALA A 49  ? 0.3415 0.3259 0.3835 0.0593  -0.0252 -0.0027 47  ALA A O   
324  C CB  . ALA A 49  ? 0.3526 0.3221 0.4011 0.0612  -0.0078 -0.0323 47  ALA A CB  
325  N N   . THR A 50  ? 0.3668 0.3832 0.4386 0.0754  -0.0236 -0.0179 48  THR A N   
326  C CA  . THR A 50  ? 0.3468 0.3885 0.4240 0.0709  -0.0273 -0.0136 48  THR A CA  
327  C C   . THR A 50  ? 0.3450 0.3799 0.4161 0.0773  -0.0376 -0.0022 48  THR A C   
328  O O   . THR A 50  ? 0.3454 0.3831 0.4073 0.0683  -0.0392 0.0047  48  THR A O   
329  C CB  . THR A 50  ? 0.3393 0.4124 0.4371 0.0745  -0.0242 -0.0245 48  THR A CB  
330  O OG1 . THR A 50  ? 0.4304 0.5210 0.5269 0.0595  -0.0191 -0.0261 48  THR A OG1 
331  C CG2 . THR A 50  ? 0.3445 0.4354 0.4578 0.0876  -0.0328 -0.0234 48  THR A CG2 
332  N N   . ARG A 51  ? 0.3270 0.3492 0.4005 0.0925  -0.0444 0.0004  49  ARG A N   
333  C CA  . ARG A 51  ? 0.3508 0.3625 0.4130 0.0973  -0.0552 0.0129  49  ARG A CA  
334  C C   . ARG A 51  ? 0.3679 0.3518 0.4048 0.0852  -0.0530 0.0223  49  ARG A C   
335  O O   . ARG A 51  ? 0.3527 0.3395 0.3783 0.0782  -0.0560 0.0296  49  ARG A O   
336  C CB  . ARG A 51  ? 0.3679 0.3680 0.4368 0.1177  -0.0640 0.0157  49  ARG A CB  
337  C CG  . ARG A 51  ? 0.4841 0.4983 0.5553 0.1268  -0.0784 0.0246  49  ARG A CG  
338  C CD  . ARG A 51  ? 0.7644 0.7896 0.8588 0.1499  -0.0866 0.0220  49  ARG A CD  
339  N NE  . ARG A 51  ? 0.9048 0.8941 0.9967 0.1631  -0.0840 0.0216  49  ARG A NE  
340  C CZ  . ARG A 51  ? 0.9497 0.9430 1.0619 0.1736  -0.0757 0.0079  49  ARG A CZ  
341  N NH1 . ARG A 51  ? 0.9350 0.8892 1.0411 0.1848  -0.0728 0.0073  49  ARG A NH1 
342  N NH2 . ARG A 51  ? 0.8960 0.9303 1.0331 0.1719  -0.0691 -0.0058 49  ARG A NH2 
343  N N   . LEU A 52  ? 0.3631 0.3223 0.3912 0.0809  -0.0465 0.0205  50  LEU A N   
344  C CA  . LEU A 52  ? 0.3694 0.3051 0.3754 0.0680  -0.0439 0.0286  50  LEU A CA  
345  C C   . LEU A 52  ? 0.3467 0.3027 0.3526 0.0528  -0.0380 0.0281  50  LEU A C   
346  O O   . LEU A 52  ? 0.3229 0.2747 0.3157 0.0443  -0.0375 0.0356  50  LEU A O   
347  C CB  . LEU A 52  ? 0.3544 0.2597 0.3511 0.0644  -0.0381 0.0253  50  LEU A CB  
348  C CG  . LEU A 52  ? 0.4228 0.2976 0.4175 0.0802  -0.0417 0.0249  50  LEU A CG  
349  C CD1 . LEU A 52  ? 0.3515 0.1998 0.3383 0.0731  -0.0328 0.0167  50  LEU A CD1 
350  C CD2 . LEU A 52  ? 0.4429 0.2900 0.4193 0.0862  -0.0512 0.0401  50  LEU A CD2 
351  N N   . LEU A 53  ? 0.3715 0.3495 0.3918 0.0498  -0.0331 0.0193  51  LEU A N   
352  C CA  . LEU A 53  ? 0.3417 0.3381 0.3642 0.0382  -0.0285 0.0194  51  LEU A CA  
353  C C   . LEU A 53  ? 0.3220 0.3320 0.3448 0.0389  -0.0315 0.0236  51  LEU A C   
354  O O   . LEU A 53  ? 0.2956 0.3071 0.3121 0.0313  -0.0284 0.0279  51  LEU A O   
355  C CB  . LEU A 53  ? 0.3299 0.3436 0.3643 0.0350  -0.0238 0.0106  51  LEU A CB  
356  C CG  . LEU A 53  ? 0.3627 0.3673 0.3921 0.0263  -0.0186 0.0063  51  LEU A CG  
357  C CD1 . LEU A 53  ? 0.3149 0.3346 0.3530 0.0246  -0.0146 -0.0036 51  LEU A CD1 
358  C CD2 . LEU A 53  ? 0.2259 0.2326 0.2486 0.0133  -0.0165 0.0124  51  LEU A CD2 
359  N N   . ALA A 54  ? 0.3095 0.3311 0.3406 0.0474  -0.0368 0.0211  52  ALA A N   
360  C CA  . ALA A 54  ? 0.2939 0.3275 0.3233 0.0462  -0.0400 0.0231  52  ALA A CA  
361  C C   . ALA A 54  ? 0.3215 0.3400 0.3321 0.0431  -0.0417 0.0315  52  ALA A C   
362  O O   . ALA A 54  ? 0.3510 0.3739 0.3558 0.0361  -0.0378 0.0324  52  ALA A O   
363  C CB  . ALA A 54  ? 0.3135 0.3627 0.3541 0.0553  -0.0475 0.0195  52  ALA A CB  
364  N N   . HIS A 55  ? 0.3558 0.3548 0.3558 0.0481  -0.0468 0.0376  53  HIS A N   
365  C CA  . HIS A 55  ? 0.3710 0.3540 0.3491 0.0432  -0.0484 0.0466  53  HIS A CA  
366  C C   . HIS A 55  ? 0.3559 0.3349 0.3269 0.0305  -0.0379 0.0475  53  HIS A C   
367  O O   . HIS A 55  ? 0.3539 0.3370 0.3153 0.0238  -0.0343 0.0493  53  HIS A O   
368  C CB  . HIS A 55  ? 0.3994 0.3567 0.3649 0.0507  -0.0562 0.0548  53  HIS A CB  
369  C CG  . HIS A 55  ? 0.4541 0.3933 0.3924 0.0437  -0.0583 0.0656  53  HIS A CG  
370  N ND1 . HIS A 55  ? 0.4441 0.3578 0.3648 0.0347  -0.0531 0.0717  53  HIS A ND1 
371  C CD2 . HIS A 55  ? 0.4188 0.3629 0.3425 0.0414  -0.0638 0.0706  53  HIS A CD2 
372  C CE1 . HIS A 55  ? 0.4623 0.3658 0.3586 0.0276  -0.0550 0.0806  53  HIS A CE1 
373  N NE2 . HIS A 55  ? 0.4762 0.3982 0.3732 0.0313  -0.0611 0.0797  53  HIS A NE2 
374  N N   . LYS A 56  ? 0.2899 0.2640 0.2669 0.0269  -0.0327 0.0452  54  LYS A N   
375  C CA  . LYS A 56  ? 0.3304 0.3064 0.3048 0.0147  -0.0239 0.0460  54  LYS A CA  
376  C C   . LYS A 56  ? 0.3306 0.3301 0.3166 0.0124  -0.0186 0.0423  54  LYS A C   
377  O O   . LYS A 56  ? 0.3282 0.3332 0.3110 0.0053  -0.0118 0.0439  54  LYS A O   
378  C CB  . LYS A 56  ? 0.3535 0.3251 0.3342 0.0104  -0.0209 0.0426  54  LYS A CB  
379  C CG  . LYS A 56  ? 0.3955 0.3370 0.3628 0.0110  -0.0236 0.0452  54  LYS A CG  
380  C CD  . LYS A 56  ? 0.3565 0.2774 0.3014 0.0026  -0.0226 0.0545  54  LYS A CD  
381  C CE  . LYS A 56  ? 0.4772 0.3627 0.4069 0.0000  -0.0236 0.0574  54  LYS A CE  
382  N NZ  . LYS A 56  ? 0.4797 0.3466 0.3869 -0.0154 -0.0193 0.0655  54  LYS A NZ  
383  N N   . ILE A 57  ? 0.2839 0.2964 0.2837 0.0184  -0.0208 0.0369  55  ILE A N   
384  C CA  . ILE A 57  ? 0.2655 0.2947 0.2759 0.0173  -0.0165 0.0338  55  ILE A CA  
385  C C   . ILE A 57  ? 0.2661 0.2959 0.2680 0.0173  -0.0150 0.0337  55  ILE A C   
386  O O   . ILE A 57  ? 0.1972 0.2345 0.2037 0.0157  -0.0087 0.0317  55  ILE A O   
387  C CB  . ILE A 57  ? 0.2601 0.2994 0.2832 0.0213  -0.0191 0.0286  55  ILE A CB  
388  C CG1 . ILE A 57  ? 0.2407 0.2827 0.2708 0.0183  -0.0177 0.0274  55  ILE A CG1 
389  C CG2 . ILE A 57  ? 0.2512 0.3005 0.2801 0.0207  -0.0159 0.0265  55  ILE A CG2 
390  C CD1 . ILE A 57  ? 0.1933 0.2437 0.2320 0.0208  -0.0195 0.0217  55  ILE A CD1 
391  N N   . GLN A 58  ? 0.3208 0.3418 0.3096 0.0193  -0.0210 0.0358  56  GLN A N   
392  C CA  . GLN A 58  ? 0.3409 0.3618 0.3167 0.0169  -0.0205 0.0351  56  GLN A CA  
393  C C   . GLN A 58  ? 0.3434 0.3548 0.3013 0.0099  -0.0152 0.0397  56  GLN A C   
394  O O   . GLN A 58  ? 0.3479 0.3569 0.2895 0.0061  -0.0144 0.0393  56  GLN A O   
395  C CB  . GLN A 58  ? 0.3589 0.3804 0.3294 0.0215  -0.0316 0.0353  56  GLN A CB  
396  C CG  . GLN A 58  ? 0.3745 0.4107 0.3629 0.0255  -0.0345 0.0288  56  GLN A CG  
397  C CD  . GLN A 58  ? 0.4821 0.5264 0.4699 0.0298  -0.0458 0.0283  56  GLN A CD  
398  O OE1 . GLN A 58  ? 0.4951 0.5549 0.4959 0.0303  -0.0479 0.0221  56  GLN A OE1 
399  N NE2 . GLN A 58  ? 0.4533 0.4883 0.4263 0.0325  -0.0537 0.0355  56  GLN A NE2 
400  N N   . SER A 59  ? 0.3459 0.3528 0.3052 0.0060  -0.0110 0.0434  57  SER A N   
401  C CA  . SER A 59  ? 0.3521 0.3519 0.2951 -0.0035 -0.0042 0.0476  57  SER A CA  
402  C C   . SER A 59  ? 0.3688 0.3820 0.3142 -0.0075 0.0075  0.0420  57  SER A C   
403  O O   . SER A 59  ? 0.3740 0.4016 0.3400 -0.0038 0.0127  0.0371  57  SER A O   
404  C CB  . SER A 59  ? 0.3326 0.3281 0.2796 -0.0093 -0.0014 0.0511  57  SER A CB  
405  O OG  . SER A 59  ? 0.4093 0.3971 0.3384 -0.0210 0.0052  0.0557  57  SER A OG  
406  N N   . PRO A 60  ? 0.3859 0.3934 0.3094 -0.0152 0.0124  0.0432  58  PRO A N   
407  C CA  . PRO A 60  ? 0.4008 0.4199 0.3245 -0.0200 0.0267  0.0367  58  PRO A CA  
408  C C   . PRO A 60  ? 0.3690 0.4020 0.3085 -0.0246 0.0368  0.0368  58  PRO A C   
409  O O   . PRO A 60  ? 0.3794 0.4275 0.3273 -0.0259 0.0496  0.0306  58  PRO A O   
410  C CB  . PRO A 60  ? 0.4049 0.4119 0.2952 -0.0301 0.0281  0.0395  58  PRO A CB  
411  C CG  . PRO A 60  ? 0.4447 0.4341 0.3193 -0.0278 0.0119  0.0485  58  PRO A CG  
412  C CD  . PRO A 60  ? 0.3429 0.3312 0.2385 -0.0197 0.0045  0.0515  58  PRO A CD  
413  N N   . GLN A 61  ? 0.3565 0.3839 0.2968 -0.0289 0.0319  0.0436  59  GLN A N   
414  C CA  . GLN A 61  ? 0.3701 0.4140 0.3268 -0.0353 0.0396  0.0436  59  GLN A CA  
415  C C   . GLN A 61  ? 0.3480 0.4077 0.3341 -0.0261 0.0357  0.0413  59  GLN A C   
416  O O   . GLN A 61  ? 0.3446 0.3949 0.3327 -0.0231 0.0258  0.0439  59  GLN A O   
417  C CB  . GLN A 61  ? 0.4157 0.4435 0.3549 -0.0485 0.0377  0.0513  59  GLN A CB  
418  C CG  . GLN A 61  ? 0.4172 0.4237 0.3214 -0.0581 0.0391  0.0568  59  GLN A CG  
419  C CD  . GLN A 61  ? 0.4398 0.4246 0.3243 -0.0722 0.0378  0.0656  59  GLN A CD  
420  O OE1 . GLN A 61  ? 0.5008 0.4970 0.3959 -0.0829 0.0445  0.0648  59  GLN A OE1 
421  N NE2 . GLN A 61  ? 0.5683 0.5223 0.4219 -0.0739 0.0298  0.0744  59  GLN A NE2 
422  N N   . GLU A 62  ? 0.3226 0.4055 0.3305 -0.0210 0.0436  0.0363  60  GLU A N   
423  C CA  . GLU A 62  ? 0.2990 0.3942 0.3311 -0.0103 0.0390  0.0353  60  GLU A CA  
424  C C   . GLU A 62  ? 0.3224 0.4237 0.3641 -0.0148 0.0317  0.0397  60  GLU A C   
425  O O   . GLU A 62  ? 0.2943 0.3936 0.3433 -0.0085 0.0234  0.0404  60  GLU A O   
426  C CB  . GLU A 62  ? 0.3099 0.4282 0.3643 -0.0032 0.0490  0.0309  60  GLU A CB  
427  C CG  . GLU A 62  ? 0.3917 0.5114 0.4625 0.0108  0.0445  0.0300  60  GLU A CG  
428  C CD  . GLU A 62  ? 0.4474 0.5933 0.5472 0.0189  0.0495  0.0300  60  GLU A CD  
429  O OE1 . GLU A 62  ? 0.5841 0.7525 0.6975 0.0129  0.0485  0.0338  60  GLU A OE1 
430  O OE2 . GLU A 62  ? 0.4619 0.6062 0.5708 0.0309  0.0547  0.0261  60  GLU A OE2 
431  N N   . TRP A 63  ? 0.2793 0.3882 0.3194 -0.0277 0.0355  0.0418  61  TRP A N   
432  C CA  . TRP A 63  ? 0.2901 0.4085 0.3394 -0.0352 0.0303  0.0442  61  TRP A CA  
433  C C   . TRP A 63  ? 0.3062 0.3953 0.3366 -0.0383 0.0216  0.0459  61  TRP A C   
434  O O   . TRP A 63  ? 0.2532 0.3439 0.2900 -0.0379 0.0149  0.0454  61  TRP A O   
435  C CB  . TRP A 63  ? 0.2867 0.4240 0.3402 -0.0507 0.0383  0.0448  61  TRP A CB  
436  C CG  . TRP A 63  ? 0.3571 0.5058 0.4180 -0.0625 0.0333  0.0462  61  TRP A CG  
437  C CD1 . TRP A 63  ? 0.2903 0.4326 0.3384 -0.0820 0.0359  0.0471  61  TRP A CD1 
438  C CD2 . TRP A 63  ? 0.3270 0.4930 0.4060 -0.0579 0.0248  0.0467  61  TRP A CD2 
439  N NE1 . TRP A 63  ? 0.3105 0.4653 0.3677 -0.0903 0.0297  0.0467  61  TRP A NE1 
440  C CE2 . TRP A 63  ? 0.2853 0.4567 0.3614 -0.0758 0.0225  0.0467  61  TRP A CE2 
441  C CE3 . TRP A 63  ? 0.2545 0.4317 0.3499 -0.0421 0.0191  0.0475  61  TRP A CE3 
442  C CZ2 . TRP A 63  ? 0.2563 0.4476 0.3456 -0.0787 0.0143  0.0471  61  TRP A CZ2 
443  C CZ3 . TRP A 63  ? 0.2754 0.4704 0.3831 -0.0442 0.0106  0.0496  61  TRP A CZ3 
444  C CH2 . TRP A 63  ? 0.2927 0.4958 0.3970 -0.0625 0.0079  0.0491  61  TRP A CH2 
445  N N   . GLU A 64  ? 0.2937 0.3562 0.3010 -0.0390 0.0213  0.0474  62  GLU A N   
446  C CA  . GLU A 64  ? 0.2829 0.3179 0.2761 -0.0351 0.0126  0.0485  62  GLU A CA  
447  C C   . GLU A 64  ? 0.2810 0.3204 0.2860 -0.0213 0.0063  0.0451  62  GLU A C   
448  O O   . GLU A 64  ? 0.2878 0.3186 0.2932 -0.0192 0.0006  0.0435  62  GLU A O   
449  C CB  . GLU A 64  ? 0.2649 0.2742 0.2331 -0.0354 0.0116  0.0525  62  GLU A CB  
450  C CG  . GLU A 64  ? 0.2715 0.2517 0.2262 -0.0301 0.0024  0.0549  62  GLU A CG  
451  C CD  . GLU A 64  ? 0.3753 0.3277 0.3021 -0.0339 0.0006  0.0625  62  GLU A CD  
452  O OE1 . GLU A 64  ? 0.4593 0.3859 0.3714 -0.0404 -0.0009 0.0667  62  GLU A OE1 
453  O OE2 . GLU A 64  ? 0.3185 0.2735 0.2357 -0.0323 0.0015  0.0645  62  GLU A OE2 
454  N N   . ALA A 65  ? 0.2369 0.2843 0.2466 -0.0130 0.0081  0.0434  63  ALA A N   
455  C CA  . ALA A 65  ? 0.2183 0.2683 0.2367 -0.0027 0.0032  0.0404  63  ALA A CA  
456  C C   . ALA A 65  ? 0.2141 0.2809 0.2505 -0.0018 0.0019  0.0398  63  ALA A C   
457  O O   . ALA A 65  ? 0.2566 0.3206 0.2948 0.0005  -0.0034 0.0382  63  ALA A O   
458  C CB  . ALA A 65  ? 0.1962 0.2484 0.2132 0.0030  0.0066  0.0379  63  ALA A CB  
459  N N   . ILE A 66  ? 0.2736 0.3591 0.3224 -0.0052 0.0064  0.0415  64  ILE A N   
460  C CA  . ILE A 66  ? 0.2758 0.3798 0.3411 -0.0043 0.0034  0.0431  64  ILE A CA  
461  C C   . ILE A 66  ? 0.2835 0.3859 0.3448 -0.0133 -0.0017 0.0430  64  ILE A C   
462  O O   . ILE A 66  ? 0.2928 0.3992 0.3576 -0.0122 -0.0068 0.0428  64  ILE A O   
463  C CB  . ILE A 66  ? 0.2793 0.4088 0.3625 -0.0043 0.0086  0.0455  64  ILE A CB  
464  C CG1 . ILE A 66  ? 0.2719 0.4026 0.3628 0.0080  0.0137  0.0441  64  ILE A CG1 
465  C CG2 . ILE A 66  ? 0.2217 0.3731 0.3199 -0.0072 0.0027  0.0493  64  ILE A CG2 
466  C CD1 . ILE A 66  ? 0.3864 0.5099 0.4801 0.0169  0.0082  0.0452  64  ILE A CD1 
467  N N   . GLN A 67  ? 0.2683 0.3620 0.3192 -0.0236 0.0003  0.0425  65  GLN A N   
468  C CA  . GLN A 67  ? 0.2636 0.3480 0.3061 -0.0332 -0.0031 0.0402  65  GLN A CA  
469  C C   . GLN A 67  ? 0.2724 0.3363 0.3058 -0.0263 -0.0069 0.0361  65  GLN A C   
470  O O   . GLN A 67  ? 0.2786 0.3411 0.3102 -0.0303 -0.0094 0.0322  65  GLN A O   
471  C CB  . GLN A 67  ? 0.2844 0.3562 0.3141 -0.0461 0.0009  0.0407  65  GLN A CB  
472  C CG  . GLN A 67  ? 0.2511 0.3499 0.2922 -0.0583 0.0046  0.0427  65  GLN A CG  
473  C CD  . GLN A 67  ? 0.3203 0.4046 0.3458 -0.0751 0.0095  0.0430  65  GLN A CD  
474  O OE1 . GLN A 67  ? 0.3818 0.4703 0.4054 -0.0906 0.0088  0.0410  65  GLN A OE1 
475  N NE2 . GLN A 67  ? 0.2705 0.3380 0.2830 -0.0743 0.0145  0.0456  65  GLN A NE2 
476  N N   . ALA A 68  ? 0.2898 0.3388 0.3166 -0.0173 -0.0068 0.0362  66  ALA A N   
477  C CA  . ALA A 68  ? 0.2829 0.3181 0.3055 -0.0092 -0.0104 0.0321  66  ALA A CA  
478  C C   . ALA A 68  ? 0.2706 0.3210 0.3040 -0.0051 -0.0123 0.0293  66  ALA A C   
479  O O   . ALA A 68  ? 0.2702 0.3165 0.3026 -0.0037 -0.0137 0.0239  66  ALA A O   
480  C CB  . ALA A 68  ? 0.2522 0.2755 0.2677 -0.0009 -0.0118 0.0339  66  ALA A CB  
481  N N   . LEU A 69  ? 0.2530 0.3180 0.2953 -0.0022 -0.0115 0.0326  67  LEU A N   
482  C CA  . LEU A 69  ? 0.2528 0.3292 0.3024 -0.0003 -0.0133 0.0324  67  LEU A CA  
483  C C   . LEU A 69  ? 0.2616 0.3483 0.3125 -0.0087 -0.0153 0.0326  67  LEU A C   
484  O O   . LEU A 69  ? 0.2311 0.3223 0.2819 -0.0095 -0.0170 0.0314  67  LEU A O   
485  C CB  . LEU A 69  ? 0.1825 0.2672 0.2401 0.0048  -0.0117 0.0367  67  LEU A CB  
486  C CG  . LEU A 69  ? 0.2840 0.3589 0.3376 0.0111  -0.0099 0.0344  67  LEU A CG  
487  C CD1 . LEU A 69  ? 0.2260 0.3047 0.2854 0.0154  -0.0056 0.0369  67  LEU A CD1 
488  C CD2 . LEU A 69  ? 0.1720 0.2435 0.2236 0.0131  -0.0123 0.0301  67  LEU A CD2 
489  N N   . THR A 70  ? 0.2776 0.3709 0.3295 -0.0164 -0.0151 0.0350  68  THR A N   
490  C CA  . THR A 70  ? 0.2816 0.3866 0.3327 -0.0271 -0.0181 0.0350  68  THR A CA  
491  C C   . THR A 70  ? 0.3194 0.4090 0.3576 -0.0328 -0.0171 0.0262  68  THR A C   
492  O O   . THR A 70  ? 0.3014 0.3976 0.3353 -0.0396 -0.0190 0.0233  68  THR A O   
493  C CB  . THR A 70  ? 0.3247 0.4427 0.3806 -0.0363 -0.0178 0.0383  68  THR A CB  
494  O OG1 . THR A 70  ? 0.3510 0.4901 0.4233 -0.0301 -0.0185 0.0456  68  THR A OG1 
495  C CG2 . THR A 70  ? 0.2555 0.3833 0.3063 -0.0513 -0.0214 0.0361  68  THR A CG2 
496  N N   . VAL A 71  ? 0.2702 0.3385 0.3013 -0.0300 -0.0141 0.0220  69  VAL A N   
497  C CA  . VAL A 71  ? 0.2957 0.3453 0.3172 -0.0301 -0.0122 0.0127  69  VAL A CA  
498  C C   . VAL A 71  ? 0.2850 0.3393 0.3106 -0.0221 -0.0120 0.0082  69  VAL A C   
499  O O   . VAL A 71  ? 0.2927 0.3477 0.3138 -0.0267 -0.0100 0.0004  69  VAL A O   
500  C CB  . VAL A 71  ? 0.2902 0.3137 0.3045 -0.0243 -0.0106 0.0119  69  VAL A CB  
501  C CG1 . VAL A 71  ? 0.3013 0.3052 0.3098 -0.0194 -0.0086 0.0021  69  VAL A CG1 
502  C CG2 . VAL A 71  ? 0.3002 0.3156 0.3066 -0.0361 -0.0091 0.0156  69  VAL A CG2 
503  N N   . LEU A 72  ? 0.2488 0.3061 0.2816 -0.0115 -0.0130 0.0117  70  LEU A N   
504  C CA  . LEU A 72  ? 0.2348 0.3004 0.2726 -0.0066 -0.0126 0.0080  70  LEU A CA  
505  C C   . LEU A 72  ? 0.2359 0.3162 0.2721 -0.0156 -0.0126 0.0084  70  LEU A C   
506  O O   . LEU A 72  ? 0.2373 0.3203 0.2701 -0.0190 -0.0096 0.0005  70  LEU A O   
507  C CB  . LEU A 72  ? 0.2398 0.3083 0.2838 0.0015  -0.0143 0.0129  70  LEU A CB  
508  C CG  . LEU A 72  ? 0.1957 0.2735 0.2447 0.0041  -0.0137 0.0095  70  LEU A CG  
509  C CD1 . LEU A 72  ? 0.1198 0.1982 0.1720 0.0081  -0.0117 -0.0008 70  LEU A CD1 
510  C CD2 . LEU A 72  ? 0.1096 0.1870 0.1614 0.0094  -0.0152 0.0137  70  LEU A CD2 
511  N N   . GLU A 73  ? 0.2065 0.2967 0.2449 -0.0189 -0.0159 0.0178  71  GLU A N   
512  C CA  . GLU A 73  ? 0.2460 0.3491 0.2809 -0.0274 -0.0185 0.0219  71  GLU A CA  
513  C C   . GLU A 73  ? 0.2806 0.3855 0.3043 -0.0396 -0.0177 0.0151  71  GLU A C   
514  O O   . GLU A 73  ? 0.2772 0.3877 0.2928 -0.0465 -0.0166 0.0119  71  GLU A O   
515  C CB  . GLU A 73  ? 0.2098 0.3235 0.2518 -0.0266 -0.0233 0.0337  71  GLU A CB  
516  C CG  . GLU A 73  ? 0.2907 0.4175 0.3290 -0.0332 -0.0287 0.0412  71  GLU A CG  
517  C CD  . GLU A 73  ? 0.4486 0.5868 0.4986 -0.0275 -0.0342 0.0538  71  GLU A CD  
518  O OE1 . GLU A 73  ? 0.4258 0.5695 0.4865 -0.0240 -0.0336 0.0551  71  GLU A OE1 
519  O OE2 . GLU A 73  ? 0.5470 0.6896 0.5952 -0.0271 -0.0390 0.0628  71  GLU A OE2 
520  N N   . THR A 74  ? 0.2579 0.3576 0.2789 -0.0446 -0.0176 0.0127  72  THR A N   
521  C CA  . THR A 74  ? 0.2749 0.3732 0.2831 -0.0583 -0.0163 0.0047  72  THR A CA  
522  C C   . THR A 74  ? 0.3093 0.3967 0.3098 -0.0579 -0.0092 -0.0091 72  THR A C   
523  O O   . THR A 74  ? 0.3507 0.4445 0.3395 -0.0692 -0.0074 -0.0149 72  THR A O   
524  C CB  . THR A 74  ? 0.2983 0.3865 0.3037 -0.0642 -0.0159 0.0029  72  THR A CB  
525  O OG1 . THR A 74  ? 0.2445 0.3494 0.2599 -0.0655 -0.0213 0.0144  72  THR A OG1 
526  C CG2 . THR A 74  ? 0.2947 0.3789 0.2840 -0.0812 -0.0140 -0.0071 72  THR A CG2 
527  N N   . CYS A 75  ? 0.2944 0.3665 0.3011 -0.0452 -0.0050 -0.0147 73  CYS A N   
528  C CA  . CYS A 75  ? 0.2901 0.3535 0.2948 -0.0413 0.0024  -0.0288 73  CYS A CA  
529  C C   . CYS A 75  ? 0.2806 0.3610 0.2898 -0.0398 0.0049  -0.0308 73  CYS A C   
530  O O   . CYS A 75  ? 0.2713 0.3531 0.2787 -0.0404 0.0125  -0.0437 73  CYS A O   
531  C CB  . CYS A 75  ? 0.2619 0.3059 0.2744 -0.0258 0.0039  -0.0320 73  CYS A CB  
532  S SG  . CYS A 75  ? 0.3434 0.3590 0.3472 -0.0275 0.0025  -0.0296 73  CYS A SG  
533  N N   . MET A 76  ? 0.2909 0.3823 0.3071 -0.0367 0.0000  -0.0194 74  MET A N   
534  C CA  . MET A 76  ? 0.2698 0.3750 0.2870 -0.0389 0.0026  -0.0202 74  MET A CA  
535  C C   . MET A 76  ? 0.3231 0.4374 0.3240 -0.0555 0.0033  -0.0201 74  MET A C   
536  O O   . MET A 76  ? 0.3413 0.4632 0.3361 -0.0621 0.0102  -0.0290 74  MET A O   
537  C CB  . MET A 76  ? 0.2786 0.3875 0.3037 -0.0333 -0.0026 -0.0080 74  MET A CB  
538  C CG  . MET A 76  ? 0.2694 0.3753 0.3080 -0.0200 -0.0021 -0.0106 74  MET A CG  
539  S SD  . MET A 76  ? 0.2880 0.4062 0.3354 -0.0172 0.0054  -0.0249 74  MET A SD  
540  C CE  . MET A 76  ? 0.1651 0.2955 0.2103 -0.0264 0.0059  -0.0190 74  MET A CE  
541  N N   . LYS A 77  ? 0.3476 0.4629 0.3410 -0.0630 -0.0037 -0.0110 75  LYS A N   
542  C CA  . LYS A 77  ? 0.3885 0.5134 0.3640 -0.0797 -0.0056 -0.0095 75  LYS A CA  
543  C C   . LYS A 77  ? 0.4028 0.5235 0.3647 -0.0901 0.0024  -0.0266 75  LYS A C   
544  O O   . LYS A 77  ? 0.4284 0.5571 0.3743 -0.1032 0.0062  -0.0316 75  LYS A O   
545  C CB  . LYS A 77  ? 0.3852 0.5175 0.3599 -0.0840 -0.0167 0.0049  75  LYS A CB  
546  C CG  . LYS A 77  ? 0.4450 0.5820 0.4298 -0.0753 -0.0237 0.0215  75  LYS A CG  
547  C CD  . LYS A 77  ? 0.5854 0.7338 0.5752 -0.0763 -0.0342 0.0347  75  LYS A CD  
548  C CE  . LYS A 77  ? 0.6813 0.8307 0.6839 -0.0638 -0.0395 0.0495  75  LYS A CE  
549  N NZ  . LYS A 77  ? 0.7012 0.8658 0.7146 -0.0614 -0.0490 0.0617  75  LYS A NZ  
550  N N   . SER A 78  ? 0.3241 0.4295 0.2900 -0.0849 0.0058  -0.0358 76  SER A N   
551  C CA  . SER A 78  ? 0.3757 0.4716 0.3264 -0.0958 0.0132  -0.0521 76  SER A CA  
552  C C   . SER A 78  ? 0.4021 0.4894 0.3567 -0.0875 0.0262  -0.0704 76  SER A C   
553  O O   . SER A 78  ? 0.4115 0.4964 0.3516 -0.0980 0.0352  -0.0857 76  SER A O   
554  C CB  . SER A 78  ? 0.3694 0.4500 0.3172 -0.0992 0.0100  -0.0525 76  SER A CB  
555  O OG  . SER A 78  ? 0.4143 0.4790 0.3777 -0.0823 0.0100  -0.0500 76  SER A OG  
556  N N   . CYS A 79  ? 0.4111 0.4948 0.3861 -0.0685 0.0274  -0.0697 77  CYS A N   
557  C CA  . CYS A 79  ? 0.4213 0.4990 0.4059 -0.0567 0.0383  -0.0864 77  CYS A CA  
558  C C   . CYS A 79  ? 0.4020 0.5032 0.3921 -0.0580 0.0453  -0.0922 77  CYS A C   
559  O O   . CYS A 79  ? 0.3669 0.4840 0.3481 -0.0705 0.0422  -0.0832 77  CYS A O   
560  C CB  . CYS A 79  ? 0.4169 0.4798 0.4201 -0.0357 0.0348  -0.0831 77  CYS A CB  
561  S SG  . CYS A 79  ? 0.4824 0.5088 0.4762 -0.0341 0.0330  -0.0843 77  CYS A SG  
562  N N   . GLY A 80  ? 0.6599 0.7633 0.6657 -0.0448 0.0547  -0.1067 78  GLY A N   
563  C CA  . GLY A 80  ? 0.6906 0.8110 0.7204 -0.0305 0.0538  -0.1042 78  GLY A CA  
564  C C   . GLY A 80  ? 0.7063 0.8495 0.7340 -0.0407 0.0665  -0.1177 78  GLY A C   
565  O O   . GLY A 80  ? 0.7660 0.9094 0.7702 -0.0597 0.0702  -0.1200 78  GLY A O   
566  N N   . LYS A 81  ? 0.4658 0.6236 0.5158 -0.0275 0.0753  -0.1315 79  LYS A N   
567  C CA  . LYS A 81  ? 0.4329 0.6196 0.5026 -0.0243 0.0757  -0.1297 79  LYS A CA  
568  C C   . LYS A 81  ? 0.3901 0.5762 0.4877 0.0003  0.0687  -0.1278 79  LYS A C   
569  O O   . LYS A 81  ? 0.3321 0.5323 0.4422 0.0035  0.0609  -0.1178 79  LYS A O   
570  C CB  . LYS A 81  ? 0.4453 0.6591 0.5203 -0.0314 0.0927  -0.1490 79  LYS A CB  
571  C CG  . LYS A 81  ? 0.4936 0.7420 0.5923 -0.0295 0.0950  -0.1501 79  LYS A CG  
572  C CD  . LYS A 81  ? 0.5898 0.8675 0.7049 -0.0284 0.1134  -0.1735 79  LYS A CD  
573  C CE  . LYS A 81  ? 0.6398 0.9560 0.7663 -0.0408 0.1188  -0.1745 79  LYS A CE  
574  N NZ  . LYS A 81  ? 0.5000 0.8423 0.6658 -0.0212 0.1146  -0.1771 79  LYS A NZ  
575  N N   . ARG A 82  ? 0.3991 0.5661 0.5038 0.0168  0.0707  -0.1366 80  ARG A N   
576  C CA  . ARG A 82  ? 0.4177 0.5775 0.5438 0.0408  0.0615  -0.1318 80  ARG A CA  
577  C C   . ARG A 82  ? 0.4000 0.5455 0.5177 0.0397  0.0459  -0.1105 80  ARG A C   
578  O O   . ARG A 82  ? 0.3978 0.5573 0.5307 0.0480  0.0375  -0.1026 80  ARG A O   
579  C CB  . ARG A 82  ? 0.4359 0.5665 0.5635 0.0569  0.0657  -0.1422 80  ARG A CB  
580  C CG  . ARG A 82  ? 0.5408 0.6888 0.6883 0.0679  0.0809  -0.1649 80  ARG A CG  
581  C CD  . ARG A 82  ? 0.6429 0.7548 0.7903 0.0852  0.0856  -0.1755 80  ARG A CD  
582  N NE  . ARG A 82  ? 0.6468 0.7179 0.7608 0.0708  0.0842  -0.1710 80  ARG A NE  
583  C CZ  . ARG A 82  ? 0.7135 0.7441 0.8192 0.0808  0.0762  -0.1629 80  ARG A CZ  
584  N NH1 . ARG A 82  ? 0.7744 0.7973 0.9008 0.1064  0.0680  -0.1569 80  ARG A NH1 
585  N NH2 . ARG A 82  ? 0.7937 0.7926 0.8697 0.0638  0.0759  -0.1601 80  ARG A NH2 
586  N N   . PHE A 83  ? 0.3794 0.5025 0.4723 0.0262  0.0429  -0.1020 81  PHE A N   
587  C CA  . PHE A 83  ? 0.3334 0.4451 0.4190 0.0246  0.0304  -0.0835 81  PHE A CA  
588  C C   . PHE A 83  ? 0.3212 0.4548 0.4083 0.0150  0.0265  -0.0741 81  PHE A C   
589  O O   . PHE A 83  ? 0.3026 0.4375 0.3965 0.0213  0.0179  -0.0639 81  PHE A O   
590  C CB  . PHE A 83  ? 0.3272 0.4144 0.3901 0.0131  0.0284  -0.0777 81  PHE A CB  
591  C CG  . PHE A 83  ? 0.2934 0.3689 0.3518 0.0139  0.0174  -0.0607 81  PHE A CG  
592  C CD1 . PHE A 83  ? 0.2681 0.3304 0.3345 0.0294  0.0110  -0.0554 81  PHE A CD1 
593  C CD2 . PHE A 83  ? 0.1836 0.2641 0.2310 0.0002  0.0133  -0.0498 81  PHE A CD2 
594  C CE1 . PHE A 83  ? 0.2829 0.3360 0.3436 0.0286  0.0027  -0.0412 81  PHE A CE1 
595  C CE2 . PHE A 83  ? 0.2546 0.3269 0.3002 0.0017  0.0053  -0.0361 81  PHE A CE2 
596  C CZ  . PHE A 83  ? 0.2142 0.2729 0.2654 0.0149  0.0009  -0.0326 81  PHE A CZ  
597  N N   . HIS A 84  ? 0.2953 0.4421 0.3721 -0.0018 0.0329  -0.0769 82  HIS A N   
598  C CA  . HIS A 84  ? 0.2565 0.4208 0.3329 -0.0121 0.0314  -0.0696 82  HIS A CA  
599  C C   . HIS A 84  ? 0.2414 0.4273 0.3400 -0.0036 0.0308  -0.0730 82  HIS A C   
600  O O   . HIS A 84  ? 0.2415 0.4297 0.3411 -0.0056 0.0241  -0.0631 82  HIS A O   
601  C CB  . HIS A 84  ? 0.2836 0.4582 0.3441 -0.0314 0.0398  -0.0739 82  HIS A CB  
602  C CG  . HIS A 84  ? 0.2664 0.4245 0.3035 -0.0428 0.0366  -0.0664 82  HIS A CG  
603  N ND1 . HIS A 84  ? 0.2720 0.4339 0.2910 -0.0584 0.0439  -0.0732 82  HIS A ND1 
604  C CD2 . HIS A 84  ? 0.2191 0.3597 0.2492 -0.0409 0.0270  -0.0540 82  HIS A CD2 
605  C CE1 . HIS A 84  ? 0.2908 0.4392 0.2927 -0.0658 0.0372  -0.0645 82  HIS A CE1 
606  N NE2 . HIS A 84  ? 0.2947 0.4313 0.3047 -0.0552 0.0273  -0.0529 82  HIS A NE2 
607  N N   . ASP A 85  ? 0.3031 0.5040 0.4206 0.0074  0.0369  -0.0873 83  ASP A N   
608  C CA  . ASP A 85  ? 0.2891 0.5175 0.4316 0.0159  0.0356  -0.0917 83  ASP A CA  
609  C C   . ASP A 85  ? 0.2951 0.5141 0.4467 0.0319  0.0221  -0.0820 83  ASP A C   
610  O O   . ASP A 85  ? 0.3099 0.5477 0.4734 0.0326  0.0164  -0.0790 83  ASP A O   
611  C CB  . ASP A 85  ? 0.3361 0.5867 0.5001 0.0258  0.0462  -0.1104 83  ASP A CB  
612  C CG  . ASP A 85  ? 0.3655 0.6349 0.5223 0.0074  0.0615  -0.1222 83  ASP A CG  
613  O OD1 . ASP A 85  ? 0.4283 0.7107 0.5976 0.0139  0.0732  -0.1395 83  ASP A OD1 
614  O OD2 . ASP A 85  ? 0.4255 0.6963 0.5640 -0.0132 0.0622  -0.1146 83  ASP A OD2 
615  N N   . GLU A 86  ? 0.3088 0.5001 0.4546 0.0441  0.0176  -0.0784 84  GLU A N   
616  C CA  . GLU A 86  ? 0.3289 0.5080 0.4779 0.0574  0.0050  -0.0678 84  GLU A CA  
617  C C   . GLU A 86  ? 0.3128 0.4845 0.4470 0.0460  -0.0018 -0.0541 84  GLU A C   
618  O O   . GLU A 86  ? 0.3094 0.4880 0.4490 0.0502  -0.0102 -0.0483 84  GLU A O   
619  C CB  . GLU A 86  ? 0.3322 0.4781 0.4731 0.0692  0.0028  -0.0658 84  GLU A CB  
620  C CG  . GLU A 86  ? 0.4439 0.5918 0.6042 0.0899  0.0036  -0.0751 84  GLU A CG  
621  C CD  . GLU A 86  ? 0.5407 0.7199 0.7263 0.1023  -0.0040 -0.0752 84  GLU A CD  
622  O OE1 . GLU A 86  ? 0.5571 0.7311 0.7397 0.1071  -0.0167 -0.0626 84  GLU A OE1 
623  O OE2 . GLU A 86  ? 0.5396 0.7511 0.7479 0.1060  0.0031  -0.0883 84  GLU A OE2 
624  N N   . VAL A 87  ? 0.2506 0.4099 0.3664 0.0317  0.0021  -0.0497 85  VAL A N   
625  C CA  . VAL A 87  ? 0.2491 0.3992 0.3522 0.0230  -0.0028 -0.0376 85  VAL A CA  
626  C C   . VAL A 87  ? 0.2706 0.4404 0.3775 0.0128  -0.0014 -0.0383 85  VAL A C   
627  O O   . VAL A 87  ? 0.2575 0.4240 0.3612 0.0109  -0.0066 -0.0315 85  VAL A O   
628  C CB  . VAL A 87  ? 0.2484 0.3809 0.3335 0.0133  -0.0007 -0.0316 85  VAL A CB  
629  C CG1 . VAL A 87  ? 0.1618 0.2888 0.2377 0.0057  -0.0041 -0.0203 85  VAL A CG1 
630  C CG2 . VAL A 87  ? 0.1771 0.2886 0.2568 0.0206  -0.0030 -0.0298 85  VAL A CG2 
631  N N   . GLY A 88  ? 0.2405 0.4316 0.3553 0.0064  0.0064  -0.0484 86  GLY A N   
632  C CA  . GLY A 88  ? 0.2482 0.4588 0.3663 -0.0061 0.0092  -0.0504 86  GLY A CA  
633  C C   . GLY A 88  ? 0.2897 0.5270 0.4299 0.0008  0.0057  -0.0572 86  GLY A C   
634  O O   . GLY A 88  ? 0.2609 0.5240 0.4103 -0.0096 0.0107  -0.0642 86  GLY A O   
635  N N   . LYS A 89  ? 0.3005 0.5328 0.4484 0.0171  -0.0035 -0.0542 87  LYS A N   
636  C CA  . LYS A 89  ? 0.2766 0.5328 0.4422 0.0233  -0.0110 -0.0567 87  LYS A CA  
637  C C   . LYS A 89  ? 0.2623 0.5023 0.4140 0.0209  -0.0203 -0.0463 87  LYS A C   
638  O O   . LYS A 89  ? 0.2767 0.4869 0.4118 0.0242  -0.0228 -0.0374 87  LYS A O   
639  C CB  . LYS A 89  ? 0.2713 0.5358 0.4560 0.0451  -0.0158 -0.0608 87  LYS A CB  
640  C CG  . LYS A 89  ? 0.3105 0.5965 0.5139 0.0497  -0.0054 -0.0747 87  LYS A CG  
641  C CD  . LYS A 89  ? 0.3467 0.6318 0.5676 0.0746  -0.0102 -0.0777 87  LYS A CD  
642  C CE  . LYS A 89  ? 0.4752 0.7746 0.7121 0.0804  0.0030  -0.0934 87  LYS A CE  
643  N NZ  . LYS A 89  ? 0.5545 0.8632 0.8176 0.1072  -0.0019 -0.0983 87  LYS A NZ  
644  N N   . PHE A 90  ? 0.2659 0.5273 0.4247 0.0143  -0.0248 -0.0486 88  PHE A N   
645  C CA  . PHE A 90  ? 0.2399 0.4884 0.3848 0.0105  -0.0329 -0.0415 88  PHE A CA  
646  C C   . PHE A 90  ? 0.2694 0.5038 0.4108 0.0272  -0.0432 -0.0341 88  PHE A C   
647  O O   . PHE A 90  ? 0.3008 0.5121 0.4232 0.0252  -0.0465 -0.0266 88  PHE A O   
648  C CB  . PHE A 90  ? 0.2502 0.5291 0.4049 -0.0005 -0.0366 -0.0477 88  PHE A CB  
649  C CG  . PHE A 90  ? 0.2204 0.5082 0.3732 -0.0213 -0.0262 -0.0537 88  PHE A CG  
650  C CD1 . PHE A 90  ? 0.2773 0.5332 0.4078 -0.0325 -0.0184 -0.0485 88  PHE A CD1 
651  C CD2 . PHE A 90  ? 0.2493 0.5780 0.4232 -0.0292 -0.0239 -0.0640 88  PHE A CD2 
652  C CE1 . PHE A 90  ? 0.2278 0.4867 0.3527 -0.0521 -0.0094 -0.0519 88  PHE A CE1 
653  C CE2 . PHE A 90  ? 0.2892 0.6240 0.4583 -0.0508 -0.0132 -0.0690 88  PHE A CE2 
654  C CZ  . PHE A 90  ? 0.2232 0.5206 0.3662 -0.0621 -0.0060 -0.0623 88  PHE A CZ  
655  N N   . ARG A 91  ? 0.2816 0.5284 0.4404 0.0438  -0.0473 -0.0364 89  ARG A N   
656  C CA  . ARG A 91  ? 0.3279 0.5560 0.4815 0.0602  -0.0564 -0.0281 89  ARG A CA  
657  C C   . ARG A 91  ? 0.3299 0.5186 0.4593 0.0579  -0.0524 -0.0200 89  ARG A C   
658  O O   . ARG A 91  ? 0.3307 0.5000 0.4460 0.0627  -0.0593 -0.0111 89  ARG A O   
659  C CB  . ARG A 91  ? 0.3574 0.5965 0.5328 0.0789  -0.0575 -0.0328 89  ARG A CB  
660  C CG  . ARG A 91  ? 0.4561 0.6758 0.6270 0.0971  -0.0690 -0.0233 89  ARG A CG  
661  C CD  . ARG A 91  ? 0.5181 0.7471 0.7130 0.1180  -0.0696 -0.0289 89  ARG A CD  
662  N NE  . ARG A 91  ? 0.5908 0.8639 0.8142 0.1265  -0.0782 -0.0336 89  ARG A NE  
663  C CZ  . ARG A 91  ? 0.7103 1.0178 0.9640 0.1323  -0.0714 -0.0468 89  ARG A CZ  
664  N NH1 . ARG A 91  ? 0.6843 0.9832 0.9404 0.1307  -0.0558 -0.0570 89  ARG A NH1 
665  N NH2 . ARG A 91  ? 0.6684 1.0215 0.9499 0.1385  -0.0802 -0.0507 89  ARG A NH2 
666  N N   . PHE A 92  ? 0.3117 0.4909 0.4373 0.0507  -0.0415 -0.0229 90  PHE A N   
667  C CA  . PHE A 92  ? 0.2665 0.4158 0.3726 0.0461  -0.0374 -0.0159 90  PHE A CA  
668  C C   . PHE A 92  ? 0.2586 0.4016 0.3517 0.0323  -0.0342 -0.0126 90  PHE A C   
669  O O   . PHE A 92  ? 0.2887 0.4128 0.3676 0.0314  -0.0353 -0.0057 90  PHE A O   
670  C CB  . PHE A 92  ? 0.2551 0.3974 0.3622 0.0454  -0.0291 -0.0199 90  PHE A CB  
671  C CG  . PHE A 92  ? 0.2938 0.4108 0.3842 0.0409  -0.0264 -0.0128 90  PHE A CG  
672  C CD1 . PHE A 92  ? 0.2572 0.3533 0.3387 0.0480  -0.0305 -0.0065 90  PHE A CD1 
673  C CD2 . PHE A 92  ? 0.2357 0.3506 0.3185 0.0289  -0.0209 -0.0109 90  PHE A CD2 
674  C CE1 . PHE A 92  ? 0.2315 0.3094 0.2993 0.0417  -0.0278 -0.0003 90  PHE A CE1 
675  C CE2 . PHE A 92  ? 0.1700 0.2679 0.2414 0.0255  -0.0195 -0.0042 90  PHE A CE2 
676  C CZ  . PHE A 92  ? 0.2067 0.2883 0.2715 0.0312  -0.0227 0.0007  90  PHE A CZ  
677  N N   . LEU A 93  ? 0.2380 0.3945 0.3355 0.0215  -0.0289 -0.0178 91  LEU A N   
678  C CA  . LEU A 93  ? 0.2477 0.3934 0.3327 0.0093  -0.0250 -0.0148 91  LEU A CA  
679  C C   . LEU A 93  ? 0.2762 0.4159 0.3521 0.0076  -0.0298 -0.0127 91  LEU A C   
680  O O   . LEU A 93  ? 0.2484 0.3696 0.3114 0.0027  -0.0264 -0.0089 91  LEU A O   
681  C CB  . LEU A 93  ? 0.2852 0.4465 0.3753 -0.0032 -0.0196 -0.0209 91  LEU A CB  
682  C CG  . LEU A 93  ? 0.2768 0.4373 0.3647 -0.0109 -0.0117 -0.0214 91  LEU A CG  
683  C CD1 . LEU A 93  ? 0.2220 0.3645 0.3018 -0.0062 -0.0103 -0.0150 91  LEU A CD1 
684  C CD2 . LEU A 93  ? 0.1878 0.3761 0.2908 -0.0132 -0.0080 -0.0314 91  LEU A CD2 
685  N N   . ASN A 94  ? 0.2658 0.4235 0.3490 0.0106  -0.0374 -0.0161 92  ASN A N   
686  C CA  . ASN A 94  ? 0.2796 0.4332 0.3512 0.0081  -0.0433 -0.0146 92  ASN A CA  
687  C C   . ASN A 94  ? 0.2714 0.4002 0.3270 0.0139  -0.0437 -0.0069 92  ASN A C   
688  O O   . ASN A 94  ? 0.2782 0.3958 0.3187 0.0082  -0.0430 -0.0063 92  ASN A O   
689  C CB  . ASN A 94  ? 0.2799 0.4600 0.3624 0.0125  -0.0544 -0.0174 92  ASN A CB  
690  C CG  . ASN A 94  ? 0.2760 0.4853 0.3724 0.0015  -0.0537 -0.0266 92  ASN A CG  
691  O OD1 . ASN A 94  ? 0.2816 0.4862 0.3746 -0.0116 -0.0447 -0.0303 92  ASN A OD1 
692  N ND2 . ASN A 94  ? 0.2682 0.5088 0.3817 0.0071  -0.0634 -0.0296 92  ASN A ND2 
693  N N   . GLU A 95  ? 0.2470 0.3685 0.3054 0.0244  -0.0448 -0.0021 93  GLU A N   
694  C CA  . GLU A 95  ? 0.2676 0.3675 0.3112 0.0276  -0.0442 0.0052  93  GLU A CA  
695  C C   . GLU A 95  ? 0.2847 0.3701 0.3214 0.0213  -0.0343 0.0065  93  GLU A C   
696  O O   . GLU A 95  ? 0.3079 0.3806 0.3318 0.0196  -0.0316 0.0095  93  GLU A O   
697  C CB  . GLU A 95  ? 0.2545 0.3471 0.3015 0.0380  -0.0470 0.0096  93  GLU A CB  
698  C CG  . GLU A 95  ? 0.3183 0.4232 0.3750 0.0487  -0.0572 0.0093  93  GLU A CG  
699  C CD  . GLU A 95  ? 0.4665 0.5755 0.5126 0.0489  -0.0675 0.0133  93  GLU A CD  
700  O OE1 . GLU A 95  ? 0.5602 0.6934 0.6175 0.0497  -0.0747 0.0091  93  GLU A OE1 
701  O OE2 . GLU A 95  ? 0.4275 0.5186 0.4532 0.0453  -0.0675 0.0194  93  GLU A OE2 
702  N N   . LEU A 96  ? 0.2184 0.3074 0.2637 0.0179  -0.0290 0.0042  94  LEU A N   
703  C CA  . LEU A 96  ? 0.2264 0.3040 0.2678 0.0136  -0.0216 0.0066  94  LEU A CA  
704  C C   . LEU A 96  ? 0.2228 0.2940 0.2563 0.0071  -0.0186 0.0033  94  LEU A C   
705  O O   . LEU A 96  ? 0.2671 0.3247 0.2946 0.0073  -0.0130 0.0053  94  LEU A O   
706  C CB  . LEU A 96  ? 0.1641 0.2469 0.2136 0.0107  -0.0187 0.0064  94  LEU A CB  
707  C CG  . LEU A 96  ? 0.2315 0.3183 0.2867 0.0152  -0.0199 0.0072  94  LEU A CG  
708  C CD1 . LEU A 96  ? 0.1821 0.2751 0.2412 0.0097  -0.0164 0.0061  94  LEU A CD1 
709  C CD2 . LEU A 96  ? 0.1438 0.2189 0.1936 0.0187  -0.0193 0.0132  94  LEU A CD2 
710  N N   . ILE A 97  ? 0.2722 0.3538 0.3076 0.0007  -0.0210 -0.0025 95  ILE A N   
711  C CA  . ILE A 97  ? 0.2749 0.3492 0.3007 -0.0085 -0.0183 -0.0076 95  ILE A CA  
712  C C   . ILE A 97  ? 0.3257 0.3916 0.3378 -0.0075 -0.0192 -0.0086 95  ILE A C   
713  O O   . ILE A 97  ? 0.3717 0.4203 0.3731 -0.0109 -0.0123 -0.0110 95  ILE A O   
714  C CB  . ILE A 97  ? 0.2917 0.3851 0.3230 -0.0178 -0.0222 -0.0145 95  ILE A CB  
715  C CG1 . ILE A 97  ? 0.2687 0.3660 0.3078 -0.0238 -0.0176 -0.0148 95  ILE A CG1 
716  C CG2 . ILE A 97  ? 0.2095 0.2963 0.2273 -0.0293 -0.0214 -0.0213 95  ILE A CG2 
717  C CD1 . ILE A 97  ? 0.2037 0.3267 0.2526 -0.0326 -0.0203 -0.0220 95  ILE A CD1 
718  N N   . LYS A 98  ? 0.3244 0.4002 0.3357 -0.0022 -0.0269 -0.0062 96  LYS A N   
719  C CA  . LYS A 98  ? 0.3300 0.3974 0.3246 -0.0023 -0.0278 -0.0053 96  LYS A CA  
720  C C   . LYS A 98  ? 0.3258 0.3754 0.3143 0.0006  -0.0178 -0.0027 96  LYS A C   
721  O O   . LYS A 98  ? 0.3554 0.3947 0.3292 -0.0034 -0.0125 -0.0063 96  LYS A O   
722  C CB  . LYS A 98  ? 0.3067 0.3834 0.3006 0.0045  -0.0384 0.0003  96  LYS A CB  
723  C CG  . LYS A 98  ? 0.2895 0.3865 0.2863 0.0022  -0.0499 -0.0025 96  LYS A CG  
724  C CD  . LYS A 98  ? 0.3456 0.4488 0.3454 0.0133  -0.0609 0.0053  96  LYS A CD  
725  C CE  . LYS A 98  ? 0.3521 0.4812 0.3604 0.0144  -0.0742 0.0035  96  LYS A CE  
726  N NZ  . LYS A 98  ? 0.3801 0.5135 0.3974 0.0296  -0.0844 0.0114  96  LYS A NZ  
727  N N   . VAL A 99  ? 0.3194 0.3682 0.3194 0.0071  -0.0153 0.0030  97  VAL A N   
728  C CA  . VAL A 99  ? 0.3085 0.3477 0.3082 0.0103  -0.0067 0.0060  97  VAL A CA  
729  C C   . VAL A 99  ? 0.2871 0.3155 0.2883 0.0096  0.0025  0.0022  97  VAL A C   
730  O O   . VAL A 99  ? 0.2925 0.3134 0.2899 0.0117  0.0107  0.0008  97  VAL A O   
731  C CB  . VAL A 99  ? 0.2856 0.3297 0.2974 0.0155  -0.0078 0.0128  97  VAL A CB  
732  C CG1 . VAL A 99  ? 0.3058 0.3467 0.3211 0.0180  0.0004  0.0158  97  VAL A CG1 
733  C CG2 . VAL A 99  ? 0.2153 0.2624 0.2232 0.0174  -0.0154 0.0164  97  VAL A CG2 
734  N N   . VAL A 100 ? 0.3221 0.3488 0.3287 0.0068  0.0018  0.0006  98  VAL A N   
735  C CA  . VAL A 100 ? 0.3546 0.3660 0.3628 0.0079  0.0096  -0.0003 98  VAL A CA  
736  C C   . VAL A 100 ? 0.3816 0.3771 0.3758 0.0005  0.0144  -0.0096 98  VAL A C   
737  O O   . VAL A 100 ? 0.4274 0.4039 0.4204 0.0024  0.0221  -0.0114 98  VAL A O   
738  C CB  . VAL A 100 ? 0.3406 0.3527 0.3588 0.0079  0.0074  0.0052  98  VAL A CB  
739  C CG1 . VAL A 100 ? 0.3430 0.3686 0.3729 0.0138  0.0038  0.0132  98  VAL A CG1 
740  C CG2 . VAL A 100 ? 0.3042 0.3226 0.3198 -0.0023 0.0027  0.0012  98  VAL A CG2 
741  N N   . SER A 101 ? 0.3928 0.3955 0.3765 -0.0080 0.0094  -0.0155 99  SER A N   
742  C CA  . SER A 101 ? 0.4395 0.4300 0.4085 -0.0194 0.0123  -0.0255 99  SER A CA  
743  C C   . SER A 101 ? 0.4673 0.4510 0.4183 -0.0224 0.0167  -0.0330 99  SER A C   
744  O O   . SER A 101 ? 0.4164 0.4137 0.3630 -0.0210 0.0113  -0.0302 99  SER A O   
745  C CB  . SER A 101 ? 0.4263 0.4344 0.3968 -0.0298 0.0028  -0.0280 99  SER A CB  
746  O OG  . SER A 101 ? 0.5620 0.5632 0.5165 -0.0438 0.0040  -0.0386 99  SER A OG  
747  N N   . PRO A 102 ? 0.5328 0.4923 0.4727 -0.0252 0.0281  -0.0416 100 PRO A N   
748  C CA  . PRO A 102 ? 0.5797 0.5286 0.4989 -0.0303 0.0358  -0.0521 100 PRO A CA  
749  C C   . PRO A 102 ? 0.6191 0.5826 0.5205 -0.0441 0.0259  -0.0568 100 PRO A C   
750  O O   . PRO A 102 ? 0.6397 0.6060 0.5247 -0.0469 0.0271  -0.0596 100 PRO A O   
751  C CB  . PRO A 102 ? 0.5789 0.4966 0.4897 -0.0343 0.0475  -0.0624 100 PRO A CB  
752  C CG  . PRO A 102 ? 0.6256 0.5351 0.5565 -0.0236 0.0485  -0.0531 100 PRO A CG  
753  C CD  . PRO A 102 ? 0.4991 0.4363 0.4451 -0.0228 0.0350  -0.0416 100 PRO A CD  
754  N N   . LYS A 103 ? 0.7197 0.6911 0.6220 -0.0548 0.0176  -0.0590 101 LYS A N   
755  C CA  . LYS A 103 ? 0.7365 0.7309 0.6294 -0.0661 0.0042  -0.0609 101 LYS A CA  
756  C C   . LYS A 103 ? 0.7182 0.7334 0.6133 -0.0574 -0.0061 -0.0505 101 LYS A C   
757  O O   . LYS A 103 ? 0.7368 0.7646 0.6163 -0.0649 -0.0154 -0.0516 101 LYS A O   
758  C CB  . LYS A 103 ? 0.7447 0.7555 0.6514 -0.0735 -0.0043 -0.0607 101 LYS A CB  
759  C CG  . LYS A 103 ? 0.8889 0.9026 0.7799 -0.0945 -0.0072 -0.0728 101 LYS A CG  
760  C CD  . LYS A 103 ? 0.9762 0.9890 0.8781 -0.1043 -0.0056 -0.0756 101 LYS A CD  
761  C CE  . LYS A 103 ? 1.0696 1.1241 0.9866 -0.1113 -0.0202 -0.0744 101 LYS A CE  
762  N NZ  . LYS A 103 ? 1.0689 1.1392 0.9699 -0.1307 -0.0279 -0.0848 101 LYS A NZ  
763  N N   . TYR A 104 ? 0.6300 0.6490 0.5440 -0.0429 -0.0063 -0.0397 102 TYR A N   
764  C CA  . TYR A 104 ? 0.6079 0.6412 0.5242 -0.0347 -0.0157 -0.0292 102 TYR A CA  
765  C C   . TYR A 104 ? 0.5729 0.5948 0.4854 -0.0268 -0.0065 -0.0243 102 TYR A C   
766  O O   . TYR A 104 ? 0.6043 0.6188 0.4957 -0.0321 -0.0016 -0.0277 102 TYR A O   
767  C CB  . TYR A 104 ? 0.5723 0.6240 0.5121 -0.0269 -0.0257 -0.0215 102 TYR A CB  
768  C CG  . TYR A 104 ? 0.5936 0.6620 0.5408 -0.0355 -0.0329 -0.0273 102 TYR A CG  
769  C CD1 . TYR A 104 ? 0.6605 0.7249 0.6191 -0.0395 -0.0265 -0.0315 102 TYR A CD1 
770  C CD2 . TYR A 104 ? 0.6960 0.7831 0.6350 -0.0425 -0.0452 -0.0293 102 TYR A CD2 
771  C CE1 . TYR A 104 ? 0.6072 0.6865 0.5701 -0.0514 -0.0309 -0.0382 102 TYR A CE1 
772  C CE2 . TYR A 104 ? 0.6738 0.7805 0.6204 -0.0531 -0.0510 -0.0362 102 TYR A CE2 
773  C CZ  . TYR A 104 ? 0.6563 0.7588 0.6147 -0.0585 -0.0429 -0.0412 102 TYR A CZ  
774  O OH  . TYR A 104 ? 0.7062 0.8292 0.6716 -0.0720 -0.0473 -0.0486 102 TYR A OH  
775  N N   . LEU A 105 ? 0.4566 0.4807 0.3881 -0.0161 -0.0056 -0.0161 103 LEU A N   
776  C CA  . LEU A 105 ? 0.4468 0.4656 0.3769 -0.0106 0.0016  -0.0109 103 LEU A CA  
777  C C   . LEU A 105 ? 0.4288 0.4375 0.3689 -0.0062 0.0162  -0.0151 103 LEU A C   
778  O O   . LEU A 105 ? 0.4336 0.4419 0.3761 -0.0022 0.0242  -0.0127 103 LEU A O   
779  C CB  . LEU A 105 ? 0.4005 0.4275 0.3436 -0.0029 -0.0059 0.0001  103 LEU A CB  
780  C CG  . LEU A 105 ? 0.5472 0.5825 0.4856 -0.0020 -0.0209 0.0064  103 LEU A CG  
781  C CD1 . LEU A 105 ? 0.4095 0.4456 0.3605 0.0063  -0.0245 0.0154  103 LEU A CD1 
782  C CD2 . LEU A 105 ? 0.4846 0.5164 0.3958 -0.0088 -0.0249 0.0078  103 LEU A CD2 
783  N N   . GLY A 106 ? 0.4007 0.4022 0.3483 -0.0065 0.0190  -0.0203 104 GLY A N   
784  C CA  . GLY A 106 ? 0.4247 0.4164 0.3862 0.0013  0.0294  -0.0208 104 GLY A CA  
785  C C   . GLY A 106 ? 0.4755 0.4597 0.4315 0.0042  0.0433  -0.0265 104 GLY A C   
786  O O   . GLY A 106 ? 0.4698 0.4573 0.4425 0.0140  0.0500  -0.0229 104 GLY A O   
787  N N   . SER A 107 ? 0.4934 0.4705 0.4264 -0.0048 0.0477  -0.0360 105 SER A N   
788  C CA  . SER A 107 ? 0.5392 0.5079 0.4636 -0.0039 0.0639  -0.0454 105 SER A CA  
789  C C   . SER A 107 ? 0.5195 0.5030 0.4485 -0.0003 0.0690  -0.0400 105 SER A C   
790  O O   . SER A 107 ? 0.5199 0.5028 0.4535 0.0044  0.0841  -0.0464 105 SER A O   
791  C CB  . SER A 107 ? 0.5710 0.5296 0.4642 -0.0180 0.0666  -0.0575 105 SER A CB  
792  O OG  . SER A 107 ? 0.7339 0.6723 0.6227 -0.0213 0.0709  -0.0679 105 SER A OG  
793  N N   . ARG A 108 ? 0.6448 0.6410 0.5711 -0.0037 0.0574  -0.0293 106 ARG A N   
794  C CA  . ARG A 108 ? 0.6792 0.6873 0.6083 -0.0031 0.0620  -0.0233 106 ARG A CA  
795  C C   . ARG A 108 ? 0.6417 0.6622 0.5961 0.0045  0.0562  -0.0120 106 ARG A C   
796  O O   . ARG A 108 ? 0.6679 0.6981 0.6236 0.0021  0.0582  -0.0064 106 ARG A O   
797  C CB  . ARG A 108 ? 0.7355 0.7435 0.6359 -0.0149 0.0564  -0.0199 106 ARG A CB  
798  C CG  . ARG A 108 ? 0.7912 0.7988 0.6849 -0.0171 0.0373  -0.0117 106 ARG A CG  
799  C CD  . ARG A 108 ? 0.8893 0.8952 0.7546 -0.0266 0.0309  -0.0055 106 ARG A CD  
800  N NE  . ARG A 108 ? 0.9268 0.9339 0.7865 -0.0264 0.0119  0.0018  106 ARG A NE  
801  C CZ  . ARG A 108 ? 0.9645 0.9729 0.8155 -0.0305 0.0041  -0.0038 106 ARG A CZ  
802  N NH1 . ARG A 108 ? 0.8787 0.8823 0.7236 -0.0360 0.0142  -0.0173 106 ARG A NH1 
803  N NH2 . ARG A 108 ? 0.9185 0.9334 0.7677 -0.0292 -0.0136 0.0036  106 ARG A NH2 
804  N N   . THR A 109 ? 0.5190 0.5386 0.4914 0.0117  0.0500  -0.0094 107 THR A N   
805  C CA  . THR A 109 ? 0.4558 0.4870 0.4507 0.0179  0.0448  -0.0001 107 THR A CA  
806  C C   . THR A 109 ? 0.4209 0.4569 0.4381 0.0282  0.0538  -0.0016 107 THR A C   
807  O O   . THR A 109 ? 0.4342 0.4575 0.4527 0.0330  0.0588  -0.0077 107 THR A O   
808  C CB  . THR A 109 ? 0.4440 0.4726 0.4429 0.0185  0.0319  0.0041  107 THR A CB  
809  O OG1 . THR A 109 ? 0.4363 0.4613 0.4170 0.0117  0.0234  0.0038  107 THR A OG1 
810  C CG2 . THR A 109 ? 0.3797 0.4197 0.3949 0.0215  0.0258  0.0129  107 THR A CG2 
811  N N   . SER A 110 ? 0.3800 0.4337 0.4157 0.0316  0.0543  0.0049  108 SER A N   
812  C CA  . SER A 110 ? 0.3623 0.4256 0.4233 0.0434  0.0594  0.0061  108 SER A CA  
813  C C   . SER A 110 ? 0.3684 0.4209 0.4373 0.0502  0.0518  0.0102  108 SER A C   
814  O O   . SER A 110 ? 0.3505 0.3981 0.4123 0.0449  0.0410  0.0145  108 SER A O   
815  C CB  . SER A 110 ? 0.3397 0.4295 0.4193 0.0431  0.0590  0.0128  108 SER A CB  
816  O OG  . SER A 110 ? 0.3002 0.3937 0.3801 0.0380  0.0462  0.0213  108 SER A OG  
817  N N   . GLU A 111 ? 0.3968 0.4464 0.4813 0.0624  0.0578  0.0094  109 GLU A N   
818  C CA  . GLU A 111 ? 0.4119 0.4530 0.5062 0.0700  0.0505  0.0168  109 GLU A CA  
819  C C   . GLU A 111 ? 0.3784 0.4381 0.4825 0.0672  0.0381  0.0285  109 GLU A C   
820  O O   . GLU A 111 ? 0.3791 0.4298 0.4788 0.0650  0.0293  0.0342  109 GLU A O   
821  C CB  . GLU A 111 ? 0.4214 0.4600 0.5350 0.0867  0.0587  0.0163  109 GLU A CB  
822  C CG  . GLU A 111 ? 0.6228 0.6260 0.7250 0.0913  0.0646  0.0098  109 GLU A CG  
823  C CD  . GLU A 111 ? 0.7837 0.7699 0.8597 0.0791  0.0715  -0.0037 109 GLU A CD  
824  O OE1 . GLU A 111 ? 0.8614 0.8589 0.9341 0.0763  0.0807  -0.0118 109 GLU A OE1 
825  O OE2 . GLU A 111 ? 0.9047 0.8688 0.9625 0.0704  0.0673  -0.0057 109 GLU A OE2 
826  N N   . LYS A 112 ? 0.3930 0.4789 0.5097 0.0660  0.0383  0.0314  110 LYS A N   
827  C CA  . LYS A 112 ? 0.3456 0.4496 0.4698 0.0611  0.0275  0.0405  110 LYS A CA  
828  C C   . LYS A 112 ? 0.3269 0.4201 0.4319 0.0494  0.0196  0.0406  110 LYS A C   
829  O O   . LYS A 112 ? 0.3116 0.4031 0.4156 0.0476  0.0112  0.0462  110 LYS A O   
830  C CB  . LYS A 112 ? 0.3293 0.4618 0.4666 0.0576  0.0308  0.0411  110 LYS A CB  
831  C CG  . LYS A 112 ? 0.3862 0.5366 0.5281 0.0491  0.0203  0.0487  110 LYS A CG  
832  C CD  . LYS A 112 ? 0.4464 0.6217 0.5966 0.0406  0.0244  0.0477  110 LYS A CD  
833  C CE  . LYS A 112 ? 0.5089 0.7116 0.6757 0.0373  0.0154  0.0554  110 LYS A CE  
834  N NZ  . LYS A 112 ? 0.5792 0.8021 0.7478 0.0226  0.0177  0.0541  110 LYS A NZ  
835  N N   . VAL A 113 ? 0.3297 0.4148 0.4187 0.0422  0.0227  0.0343  111 VAL A N   
836  C CA  . VAL A 113 ? 0.3054 0.3823 0.3794 0.0339  0.0156  0.0338  111 VAL A CA  
837  C C   . VAL A 113 ? 0.3166 0.3786 0.3835 0.0342  0.0119  0.0322  111 VAL A C   
838  O O   . VAL A 113 ? 0.2967 0.3596 0.3618 0.0303  0.0050  0.0344  111 VAL A O   
839  C CB  . VAL A 113 ? 0.3200 0.3908 0.3782 0.0280  0.0185  0.0292  111 VAL A CB  
840  C CG1 . VAL A 113 ? 0.2402 0.3004 0.2849 0.0239  0.0109  0.0277  111 VAL A CG1 
841  C CG2 . VAL A 113 ? 0.3004 0.3834 0.3609 0.0225  0.0202  0.0321  111 VAL A CG2 
842  N N   . LYS A 114 ? 0.2564 0.3049 0.3192 0.0378  0.0176  0.0273  112 LYS A N   
843  C CA  . LYS A 114 ? 0.2808 0.3141 0.3354 0.0353  0.0154  0.0250  112 LYS A CA  
844  C C   . LYS A 114 ? 0.2929 0.3241 0.3556 0.0383  0.0116  0.0327  112 LYS A C   
845  O O   . LYS A 114 ? 0.3062 0.3339 0.3629 0.0319  0.0067  0.0338  112 LYS A O   
846  C CB  . LYS A 114 ? 0.2438 0.2600 0.2890 0.0361  0.0235  0.0166  112 LYS A CB  
847  C CG  . LYS A 114 ? 0.2322 0.2499 0.2642 0.0307  0.0260  0.0097  112 LYS A CG  
848  C CD  . LYS A 114 ? 0.3103 0.3105 0.3294 0.0292  0.0346  -0.0004 112 LYS A CD  
849  C CE  . LYS A 114 ? 0.3728 0.3688 0.4021 0.0394  0.0460  -0.0024 112 LYS A CE  
850  N NZ  . LYS A 114 ? 0.5112 0.4902 0.5257 0.0372  0.0569  -0.0147 112 LYS A NZ  
851  N N   . ASN A 115 ? 0.2842 0.3198 0.3605 0.0477  0.0135  0.0385  113 ASN A N   
852  C CA  . ASN A 115 ? 0.2679 0.3019 0.3502 0.0510  0.0078  0.0486  113 ASN A CA  
853  C C   . ASN A 115 ? 0.2552 0.3066 0.3375 0.0431  -0.0011 0.0541  113 ASN A C   
854  O O   . ASN A 115 ? 0.2807 0.3276 0.3571 0.0384  -0.0063 0.0593  113 ASN A O   
855  C CB  . ASN A 115 ? 0.2815 0.3210 0.3820 0.0653  0.0101  0.0546  113 ASN A CB  
856  C CG  . ASN A 115 ? 0.3466 0.3610 0.4460 0.0750  0.0194  0.0495  113 ASN A CG  
857  O OD1 . ASN A 115 ? 0.3652 0.3823 0.4814 0.0894  0.0232  0.0523  113 ASN A OD1 
858  N ND2 . ASN A 115 ? 0.2644 0.2568 0.3455 0.0670  0.0238  0.0404  113 ASN A ND2 
859  N N   . LYS A 116 ? 0.2745 0.3432 0.3606 0.0399  -0.0016 0.0518  114 LYS A N   
860  C CA  . LYS A 116 ? 0.2661 0.3479 0.3502 0.0316  -0.0083 0.0544  114 LYS A CA  
861  C C   . LYS A 116 ? 0.2638 0.3365 0.3346 0.0236  -0.0099 0.0493  114 LYS A C   
862  O O   . LYS A 116 ? 0.2615 0.3369 0.3281 0.0178  -0.0141 0.0523  114 LYS A O   
863  C CB  . LYS A 116 ? 0.2466 0.3422 0.3345 0.0284  -0.0072 0.0519  114 LYS A CB  
864  C CG  . LYS A 116 ? 0.2893 0.3950 0.3739 0.0192  -0.0129 0.0529  114 LYS A CG  
865  C CD  . LYS A 116 ? 0.4506 0.5670 0.5398 0.0180  -0.0196 0.0614  114 LYS A CD  
866  C CE  . LYS A 116 ? 0.4938 0.6245 0.5806 0.0073  -0.0244 0.0617  114 LYS A CE  
867  N NZ  . LYS A 116 ? 0.5326 0.6793 0.6250 0.0061  -0.0322 0.0715  114 LYS A NZ  
868  N N   . ILE A 117 ? 0.2744 0.3384 0.3388 0.0230  -0.0063 0.0416  115 ILE A N   
869  C CA  . ILE A 117 ? 0.2841 0.3448 0.3403 0.0168  -0.0078 0.0358  115 ILE A CA  
870  C C   . ILE A 117 ? 0.2656 0.3182 0.3172 0.0126  -0.0079 0.0377  115 ILE A C   
871  O O   . ILE A 117 ? 0.2778 0.3358 0.3259 0.0054  -0.0098 0.0362  115 ILE A O   
872  C CB  . ILE A 117 ? 0.2789 0.3341 0.3295 0.0173  -0.0056 0.0284  115 ILE A CB  
873  C CG1 . ILE A 117 ? 0.2746 0.3353 0.3250 0.0188  -0.0067 0.0276  115 ILE A CG1 
874  C CG2 . ILE A 117 ? 0.1980 0.2542 0.2443 0.0114  -0.0076 0.0226  115 ILE A CG2 
875  C CD1 . ILE A 117 ? 0.2583 0.3132 0.3003 0.0195  -0.0056 0.0231  115 ILE A CD1 
876  N N   . LEU A 118 ? 0.2857 0.3235 0.3360 0.0164  -0.0047 0.0399  116 LEU A N   
877  C CA  . LEU A 118 ? 0.3478 0.3707 0.3905 0.0115  -0.0043 0.0432  116 LEU A CA  
878  C C   . LEU A 118 ? 0.3351 0.3632 0.3771 0.0088  -0.0094 0.0533  116 LEU A C   
879  O O   . LEU A 118 ? 0.3745 0.3989 0.4068 -0.0011 -0.0100 0.0546  116 LEU A O   
880  C CB  . LEU A 118 ? 0.3834 0.3840 0.4247 0.0184  0.0006  0.0442  116 LEU A CB  
881  C CG  . LEU A 118 ? 0.4082 0.3999 0.4435 0.0165  0.0063  0.0328  116 LEU A CG  
882  C CD1 . LEU A 118 ? 0.4654 0.4362 0.5007 0.0254  0.0132  0.0315  116 LEU A CD1 
883  C CD2 . LEU A 118 ? 0.4463 0.4333 0.4705 0.0028  0.0062  0.0265  116 LEU A CD2 
884  N N   . GLU A 119 ? 0.3500 0.3892 0.4014 0.0159  -0.0129 0.0602  117 GLU A N   
885  C CA  . GLU A 119 ? 0.3272 0.3757 0.3771 0.0125  -0.0195 0.0700  117 GLU A CA  
886  C C   . GLU A 119 ? 0.3640 0.4253 0.4063 0.0003  -0.0205 0.0643  117 GLU A C   
887  O O   . GLU A 119 ? 0.3304 0.3918 0.3618 -0.0091 -0.0229 0.0687  117 GLU A O   
888  C CB  . GLU A 119 ? 0.3377 0.4025 0.4020 0.0211  -0.0232 0.0759  117 GLU A CB  
889  C CG  . GLU A 119 ? 0.4603 0.5265 0.5281 0.0264  -0.0304 0.0904  117 GLU A CG  
890  C CD  . GLU A 119 ? 0.6318 0.7161 0.6938 0.0164  -0.0386 0.0963  117 GLU A CD  
891  O OE1 . GLU A 119 ? 0.7841 0.8596 0.8305 0.0083  -0.0422 0.1026  117 GLU A OE1 
892  O OE2 . GLU A 119 ? 0.4817 0.5885 0.5538 0.0161  -0.0418 0.0959  117 GLU A OE2 
893  N N   . LEU A 120 ? 0.2553 0.3270 0.3028 0.0007  -0.0187 0.0553  118 LEU A N   
894  C CA  . LEU A 120 ? 0.2465 0.3283 0.2893 -0.0077 -0.0183 0.0479  118 LEU A CA  
895  C C   . LEU A 120 ? 0.2683 0.3472 0.3037 -0.0157 -0.0147 0.0419  118 LEU A C   
896  O O   . LEU A 120 ? 0.2869 0.3727 0.3147 -0.0252 -0.0143 0.0407  118 LEU A O   
897  C CB  . LEU A 120 ? 0.1976 0.2841 0.2465 -0.0037 -0.0168 0.0400  118 LEU A CB  
898  C CG  . LEU A 120 ? 0.2857 0.3795 0.3398 -0.0016 -0.0194 0.0441  118 LEU A CG  
899  C CD1 . LEU A 120 ? 0.2902 0.3823 0.3461 0.0008  -0.0173 0.0373  118 LEU A CD1 
900  C CD2 . LEU A 120 ? 0.2577 0.3616 0.3063 -0.0107 -0.0231 0.0468  118 LEU A CD2 
901  N N   . LEU A 121 ? 0.2450 0.3160 0.2820 -0.0135 -0.0117 0.0371  119 LEU A N   
902  C CA  . LEU A 121 ? 0.2956 0.3677 0.3278 -0.0229 -0.0081 0.0309  119 LEU A CA  
903  C C   . LEU A 121 ? 0.3410 0.4054 0.3604 -0.0337 -0.0076 0.0385  119 LEU A C   
904  O O   . LEU A 121 ? 0.3585 0.4331 0.3723 -0.0449 -0.0047 0.0343  119 LEU A O   
905  C CB  . LEU A 121 ? 0.2399 0.3038 0.2737 -0.0212 -0.0061 0.0259  119 LEU A CB  
906  C CG  . LEU A 121 ? 0.2798 0.3505 0.3216 -0.0134 -0.0072 0.0188  119 LEU A CG  
907  C CD1 . LEU A 121 ? 0.2648 0.3232 0.3029 -0.0132 -0.0057 0.0163  119 LEU A CD1 
908  C CD2 . LEU A 121 ? 0.2133 0.3034 0.2620 -0.0153 -0.0076 0.0096  119 LEU A CD2 
909  N N   . TYR A 122 ? 0.3242 0.3705 0.3387 -0.0299 -0.0100 0.0498  120 TYR A N   
910  C CA  . TYR A 122 ? 0.3619 0.3970 0.3620 -0.0381 -0.0119 0.0611  120 TYR A CA  
911  C C   . TYR A 122 ? 0.3509 0.4023 0.3441 -0.0461 -0.0147 0.0638  120 TYR A C   
912  O O   . TYR A 122 ? 0.3816 0.4347 0.3610 -0.0606 -0.0120 0.0636  120 TYR A O   
913  C CB  . TYR A 122 ? 0.3716 0.3863 0.3719 -0.0270 -0.0161 0.0744  120 TYR A CB  
914  C CG  . TYR A 122 ? 0.4901 0.4878 0.4731 -0.0345 -0.0194 0.0884  120 TYR A CG  
915  C CD1 . TYR A 122 ? 0.4815 0.4617 0.4483 -0.0486 -0.0143 0.0874  120 TYR A CD1 
916  C CD2 . TYR A 122 ? 0.5026 0.5061 0.4829 -0.0315 -0.0281 0.1021  120 TYR A CD2 
917  C CE1 . TYR A 122 ? 0.5702 0.5339 0.5165 -0.0589 -0.0172 0.1011  120 TYR A CE1 
918  C CE2 . TYR A 122 ? 0.6081 0.5981 0.5682 -0.0410 -0.0325 0.1160  120 TYR A CE2 
919  C CZ  . TYR A 122 ? 0.5780 0.5462 0.5200 -0.0546 -0.0267 0.1159  120 TYR A CZ  
920  O OH  . TYR A 122 ? 0.6673 0.6188 0.5852 -0.0657 -0.0311 0.1314  120 TYR A OH  
921  N N   . SER A 123 ? 0.2967 0.3600 0.2977 -0.0387 -0.0197 0.0661  121 SER A N   
922  C CA  . SER A 123 ? 0.3359 0.4141 0.3288 -0.0474 -0.0225 0.0671  121 SER A CA  
923  C C   . SER A 123 ? 0.3341 0.4246 0.3224 -0.0588 -0.0148 0.0527  121 SER A C   
924  O O   . SER A 123 ? 0.3321 0.4286 0.3052 -0.0720 -0.0138 0.0534  121 SER A O   
925  C CB  . SER A 123 ? 0.3118 0.4023 0.3157 -0.0394 -0.0276 0.0678  121 SER A CB  
926  O OG  . SER A 123 ? 0.3740 0.4719 0.3877 -0.0363 -0.0226 0.0538  121 SER A OG  
927  N N   . TRP A 124 ? 0.2960 0.3908 0.2970 -0.0535 -0.0095 0.0400  122 TRP A N   
928  C CA  . TRP A 124 ? 0.2843 0.3937 0.2870 -0.0606 -0.0019 0.0254  122 TRP A CA  
929  C C   . TRP A 124 ? 0.3066 0.4170 0.3002 -0.0744 0.0041  0.0236  122 TRP A C   
930  O O   . TRP A 124 ? 0.3398 0.4644 0.3277 -0.0856 0.0105  0.0155  122 TRP A O   
931  C CB  . TRP A 124 ? 0.2386 0.3543 0.2592 -0.0490 -0.0001 0.0141  122 TRP A CB  
932  C CG  . TRP A 124 ? 0.1867 0.3001 0.2135 -0.0385 -0.0043 0.0148  122 TRP A CG  
933  C CD1 . TRP A 124 ? 0.2072 0.3216 0.2274 -0.0413 -0.0072 0.0185  122 TRP A CD1 
934  C CD2 . TRP A 124 ? 0.2137 0.3231 0.2520 -0.0261 -0.0062 0.0124  122 TRP A CD2 
935  N NE1 . TRP A 124 ? 0.2894 0.4006 0.3174 -0.0323 -0.0098 0.0176  122 TRP A NE1 
936  C CE2 . TRP A 124 ? 0.2703 0.3771 0.3085 -0.0226 -0.0093 0.0150  122 TRP A CE2 
937  C CE3 . TRP A 124 ? 0.2236 0.3321 0.2704 -0.0195 -0.0061 0.0087  122 TRP A CE3 
938  C CZ2 . TRP A 124 ? 0.2191 0.3203 0.2642 -0.0130 -0.0110 0.0140  122 TRP A CZ2 
939  C CZ3 . TRP A 124 ? 0.2180 0.3209 0.2704 -0.0092 -0.0091 0.0088  122 TRP A CZ3 
940  C CH2 . TRP A 124 ? 0.2009 0.2995 0.2521 -0.0061 -0.0109 0.0115  122 TRP A CH2 
941  N N   . THR A 125 ? 0.3096 0.4051 0.3013 -0.0750 0.0034  0.0296  123 THR A N   
942  C CA  . THR A 125 ? 0.3552 0.4492 0.3357 -0.0916 0.0095  0.0285  123 THR A CA  
943  C C   . THR A 125 ? 0.3717 0.4619 0.3292 -0.1066 0.0100  0.0376  123 THR A C   
944  O O   . THR A 125 ? 0.4178 0.5105 0.3628 -0.1240 0.0167  0.0356  123 THR A O   
945  C CB  . THR A 125 ? 0.3545 0.4251 0.3315 -0.0917 0.0086  0.0347  123 THR A CB  
946  O OG1 . THR A 125 ? 0.4528 0.4977 0.4171 -0.0878 0.0023  0.0517  123 THR A OG1 
947  C CG2 . THR A 125 ? 0.3194 0.3918 0.3147 -0.0775 0.0069  0.0273  123 THR A CG2 
948  N N   . VAL A 126 ? 0.4254 0.5107 0.3763 -0.1012 0.0024  0.0480  124 VAL A N   
949  C CA  . VAL A 126 ? 0.4615 0.5420 0.3879 -0.1147 -0.0005 0.0598  124 VAL A CA  
950  C C   . VAL A 126 ? 0.4512 0.5547 0.3735 -0.1218 0.0029  0.0496  124 VAL A C   
951  O O   . VAL A 126 ? 0.4864 0.5971 0.3900 -0.1397 0.0089  0.0471  124 VAL A O   
952  C CB  . VAL A 126 ? 0.5159 0.5789 0.4378 -0.1042 -0.0132 0.0795  124 VAL A CB  
953  C CG1 . VAL A 126 ? 0.5636 0.6258 0.4595 -0.1175 -0.0192 0.0931  124 VAL A CG1 
954  C CG2 . VAL A 126 ? 0.5059 0.5414 0.4299 -0.0964 -0.0151 0.0889  124 VAL A CG2 
955  N N   . GLY A 127 ? 0.3405 0.4538 0.2789 -0.1090 0.0005  0.0422  125 GLY A N   
956  C CA  . GLY A 127 ? 0.3233 0.4527 0.2565 -0.1150 0.0037  0.0317  125 GLY A CA  
957  C C   . GLY A 127 ? 0.3674 0.5133 0.3110 -0.1173 0.0167  0.0105  125 GLY A C   
958  O O   . GLY A 127 ? 0.3947 0.5526 0.3299 -0.1262 0.0234  -0.0008 125 GLY A O   
959  N N   . LEU A 128 ? 0.3377 0.4854 0.3009 -0.1083 0.0201  0.0042  126 LEU A N   
960  C CA  . LEU A 128 ? 0.3366 0.5040 0.3159 -0.1068 0.0309  -0.0151 126 LEU A CA  
961  C C   . LEU A 128 ? 0.3505 0.5254 0.3357 -0.1138 0.0364  -0.0177 126 LEU A C   
962  O O   . LEU A 128 ? 0.3337 0.5142 0.3398 -0.1029 0.0356  -0.0232 126 LEU A O   
963  C CB  . LEU A 128 ? 0.3233 0.4915 0.3252 -0.0868 0.0282  -0.0229 126 LEU A CB  
964  C CG  . LEU A 128 ? 0.3475 0.5065 0.3448 -0.0808 0.0230  -0.0211 126 LEU A CG  
965  C CD1 . LEU A 128 ? 0.2939 0.4473 0.3104 -0.0623 0.0192  -0.0243 126 LEU A CD1 
966  C CD2 . LEU A 128 ? 0.3722 0.5403 0.3582 -0.0908 0.0314  -0.0340 126 LEU A CD2 
967  N N   . PRO A 129 ? 0.3756 0.5512 0.3405 -0.1341 0.0418  -0.0138 127 PRO A N   
968  C CA  . PRO A 129 ? 0.3942 0.5731 0.3595 -0.1459 0.0470  -0.0141 127 PRO A CA  
969  C C   . PRO A 129 ? 0.3976 0.6093 0.3874 -0.1457 0.0575  -0.0342 127 PRO A C   
970  O O   . PRO A 129 ? 0.3968 0.6151 0.3969 -0.1497 0.0589  -0.0364 127 PRO A O   
971  C CB  . PRO A 129 ? 0.4376 0.6089 0.3709 -0.1696 0.0511  -0.0051 127 PRO A CB  
972  C CG  . PRO A 129 ? 0.4134 0.5905 0.3342 -0.1714 0.0517  -0.0076 127 PRO A CG  
973  C CD  . PRO A 129 ? 0.3820 0.5522 0.3184 -0.1490 0.0419  -0.0065 127 PRO A CD  
974  N N   . GLU A 130 ? 0.4061 0.6387 0.4066 -0.1403 0.0645  -0.0492 128 GLU A N   
975  C CA  . GLU A 130 ? 0.4135 0.6804 0.4419 -0.1361 0.0741  -0.0686 128 GLU A CA  
976  C C   . GLU A 130 ? 0.3666 0.6375 0.4239 -0.1142 0.0656  -0.0710 128 GLU A C   
977  O O   . GLU A 130 ? 0.3731 0.6740 0.4562 -0.1097 0.0702  -0.0840 128 GLU A O   
978  C CB  . GLU A 130 ? 0.4153 0.6997 0.4478 -0.1336 0.0848  -0.0851 128 GLU A CB  
979  C CG  . GLU A 130 ? 0.5991 0.8630 0.6012 -0.1417 0.0837  -0.0784 128 GLU A CG  
980  C CD  . GLU A 130 ? 0.5227 0.7624 0.5254 -0.1238 0.0710  -0.0702 128 GLU A CD  
981  O OE1 . GLU A 130 ? 0.4164 0.6348 0.3954 -0.1302 0.0627  -0.0550 128 GLU A OE1 
982  O OE2 . GLU A 130 ? 0.6563 0.8996 0.6823 -0.1040 0.0697  -0.0793 128 GLU A OE2 
983  N N   . GLU A 131 ? 0.3239 0.5682 0.3778 -0.0998 0.0536  -0.0595 129 GLU A N   
984  C CA  . GLU A 131 ? 0.2764 0.5207 0.3516 -0.0806 0.0449  -0.0599 129 GLU A CA  
985  C C   . GLU A 131 ? 0.2796 0.5173 0.3524 -0.0878 0.0401  -0.0519 129 GLU A C   
986  O O   . GLU A 131 ? 0.2521 0.4620 0.3123 -0.0853 0.0322  -0.0388 129 GLU A O   
987  C CB  . GLU A 131 ? 0.2337 0.4527 0.3042 -0.0651 0.0358  -0.0517 129 GLU A CB  
988  C CG  . GLU A 131 ? 0.2645 0.4832 0.3333 -0.0597 0.0403  -0.0596 129 GLU A CG  
989  C CD  . GLU A 131 ? 0.3459 0.5836 0.4400 -0.0444 0.0442  -0.0750 129 GLU A CD  
990  O OE1 . GLU A 131 ? 0.3279 0.5659 0.4218 -0.0407 0.0508  -0.0853 129 GLU A OE1 
991  O OE2 . GLU A 131 ? 0.2916 0.5440 0.4056 -0.0361 0.0406  -0.0771 129 GLU A OE2 
992  N N   . VAL A 132 ? 0.2834 0.5467 0.3658 -0.1002 0.0466  -0.0605 130 VAL A N   
993  C CA  . VAL A 132 ? 0.2848 0.5400 0.3584 -0.1149 0.0451  -0.0545 130 VAL A CA  
994  C C   . VAL A 132 ? 0.2994 0.5446 0.3815 -0.1028 0.0343  -0.0507 130 VAL A C   
995  O O   . VAL A 132 ? 0.2995 0.5225 0.3672 -0.1120 0.0317  -0.0430 130 VAL A O   
996  C CB  . VAL A 132 ? 0.2580 0.5473 0.3405 -0.1343 0.0556  -0.0662 130 VAL A CB  
997  C CG1 . VAL A 132 ? 0.2292 0.5239 0.2963 -0.1499 0.0675  -0.0687 130 VAL A CG1 
998  C CG2 . VAL A 132 ? 0.1914 0.5229 0.3098 -0.1212 0.0556  -0.0814 130 VAL A CG2 
999  N N   . LYS A 133 ? 0.2852 0.5410 0.3866 -0.0820 0.0281  -0.0551 131 LYS A N   
1000 C CA  . LYS A 133 ? 0.2790 0.5276 0.3864 -0.0707 0.0177  -0.0519 131 LYS A CA  
1001 C C   . LYS A 133 ? 0.2849 0.4940 0.3732 -0.0643 0.0121  -0.0386 131 LYS A C   
1002 O O   . LYS A 133 ? 0.2732 0.4671 0.3549 -0.0654 0.0074  -0.0343 131 LYS A O   
1003 C CB  . LYS A 133 ? 0.2829 0.5539 0.4148 -0.0506 0.0122  -0.0590 131 LYS A CB  
1004 C CG  . LYS A 133 ? 0.2527 0.5688 0.4108 -0.0525 0.0163  -0.0727 131 LYS A CG  
1005 C CD  . LYS A 133 ? 0.2628 0.5963 0.4449 -0.0292 0.0079  -0.0767 131 LYS A CD  
1006 C CE  . LYS A 133 ? 0.2198 0.6035 0.4331 -0.0289 0.0097  -0.0897 131 LYS A CE  
1007 N NZ  . LYS A 133 ? 0.2506 0.6498 0.4882 -0.0029 -0.0002 -0.0918 131 LYS A NZ  
1008 N N   . ILE A 134 ? 0.3003 0.4943 0.3797 -0.0593 0.0133  -0.0331 132 ILE A N   
1009 C CA  . ILE A 134 ? 0.3121 0.4739 0.3753 -0.0554 0.0091  -0.0204 132 ILE A CA  
1010 C C   . ILE A 134 ? 0.3476 0.4891 0.3938 -0.0694 0.0110  -0.0129 132 ILE A C   
1011 O O   . ILE A 134 ? 0.3419 0.4607 0.3811 -0.0649 0.0074  -0.0061 132 ILE A O   
1012 C CB  . ILE A 134 ? 0.3324 0.4864 0.3886 -0.0514 0.0098  -0.0158 132 ILE A CB  
1013 C CG1 . ILE A 134 ? 0.2793 0.4486 0.3498 -0.0396 0.0100  -0.0250 132 ILE A CG1 
1014 C CG2 . ILE A 134 ? 0.2802 0.4084 0.3265 -0.0446 0.0042  -0.0033 132 ILE A CG2 
1015 C CD1 . ILE A 134 ? 0.1850 0.3459 0.2468 -0.0382 0.0111  -0.0228 132 ILE A CD1 
1016 N N   . ALA A 135 ? 0.3186 0.4660 0.3566 -0.0864 0.0176  -0.0141 133 ALA A N   
1017 C CA  . ALA A 135 ? 0.3518 0.4760 0.3711 -0.1014 0.0199  -0.0066 133 ALA A CA  
1018 C C   . ALA A 135 ? 0.3633 0.4863 0.3859 -0.1072 0.0196  -0.0124 133 ALA A C   
1019 O O   . ALA A 135 ? 0.3552 0.4475 0.3634 -0.1110 0.0189  -0.0058 133 ALA A O   
1020 C CB  . ALA A 135 ? 0.3487 0.4798 0.3554 -0.1212 0.0276  -0.0065 133 ALA A CB  
1021 N N   . GLU A 136 ? 0.3544 0.5107 0.3963 -0.1069 0.0195  -0.0249 134 GLU A N   
1022 C CA  . GLU A 136 ? 0.3640 0.5258 0.4101 -0.1132 0.0173  -0.0314 134 GLU A CA  
1023 C C   . GLU A 136 ? 0.3757 0.5138 0.4175 -0.0989 0.0105  -0.0268 134 GLU A C   
1024 O O   . GLU A 136 ? 0.4115 0.5260 0.4400 -0.1065 0.0109  -0.0259 134 GLU A O   
1025 C CB  . GLU A 136 ? 0.3387 0.5471 0.4105 -0.1116 0.0160  -0.0444 134 GLU A CB  
1026 C CG  . GLU A 136 ? 0.3522 0.5816 0.4277 -0.1327 0.0192  -0.0533 134 GLU A CG  
1027 C CD  . GLU A 136 ? 0.4402 0.7208 0.5461 -0.1275 0.0157  -0.0654 134 GLU A CD  
1028 O OE1 . GLU A 136 ? 0.3664 0.6772 0.4897 -0.1242 0.0208  -0.0716 134 GLU A OE1 
1029 O OE2 . GLU A 136 ? 0.3986 0.6911 0.5106 -0.1297 0.0086  -0.0697 134 GLU A OE2 
1030 N N   . ALA A 137 ? 0.3208 0.4628 0.3718 -0.0794 0.0054  -0.0244 135 ALA A N   
1031 C CA  . ALA A 137 ? 0.3237 0.4466 0.3708 -0.0660 0.0001  -0.0203 135 ALA A CA  
1032 C C   . ALA A 137 ? 0.3543 0.4395 0.3841 -0.0656 0.0028  -0.0106 135 ALA A C   
1033 O O   . ALA A 137 ? 0.3686 0.4342 0.3898 -0.0654 0.0028  -0.0109 135 ALA A O   
1034 C CB  . ALA A 137 ? 0.2717 0.4051 0.3304 -0.0480 -0.0047 -0.0189 135 ALA A CB  
1035 N N   . TYR A 138 ? 0.4397 0.5153 0.4634 -0.0673 0.0054  -0.0027 136 TYR A N   
1036 C CA  . TYR A 138 ? 0.4525 0.4943 0.4620 -0.0657 0.0068  0.0083  136 TYR A CA  
1037 C C   . TYR A 138 ? 0.4726 0.4889 0.4667 -0.0798 0.0113  0.0081  136 TYR A C   
1038 O O   . TYR A 138 ? 0.4604 0.4487 0.4469 -0.0745 0.0123  0.0105  136 TYR A O   
1039 C CB  . TYR A 138 ? 0.4291 0.4703 0.4346 -0.0654 0.0064  0.0179  136 TYR A CB  
1040 C CG  . TYR A 138 ? 0.4634 0.4748 0.4589 -0.0587 0.0048  0.0313  136 TYR A CG  
1041 C CD1 . TYR A 138 ? 0.4154 0.4234 0.4190 -0.0417 0.0012  0.0358  136 TYR A CD1 
1042 C CD2 . TYR A 138 ? 0.4947 0.4825 0.4734 -0.0691 0.0067  0.0401  136 TYR A CD2 
1043 C CE1 . TYR A 138 ? 0.3893 0.3756 0.3887 -0.0334 -0.0006 0.0479  136 TYR A CE1 
1044 C CE2 . TYR A 138 ? 0.4439 0.4042 0.4158 -0.0599 0.0039  0.0535  136 TYR A CE2 
1045 C CZ  . TYR A 138 ? 0.4201 0.3821 0.4046 -0.0410 0.0002  0.0569  136 TYR A CZ  
1046 O OH  . TYR A 138 ? 0.4829 0.4229 0.4654 -0.0296 -0.0028 0.0699  136 TYR A OH  
1047 N N   . GLN A 139 ? 0.4635 0.4879 0.4521 -0.0986 0.0152  0.0046  137 GLN A N   
1048 C CA  . GLN A 139 ? 0.5217 0.5207 0.4939 -0.1156 0.0200  0.0030  137 GLN A CA  
1049 C C   . GLN A 139 ? 0.5382 0.5345 0.5113 -0.1173 0.0198  -0.0078 137 GLN A C   
1050 O O   . GLN A 139 ? 0.5680 0.5284 0.5254 -0.1219 0.0233  -0.0073 137 GLN A O   
1051 C CB  . GLN A 139 ? 0.5419 0.5525 0.5071 -0.1390 0.0253  0.0010  137 GLN A CB  
1052 C CG  . GLN A 139 ? 0.6098 0.6277 0.5723 -0.1602 0.0294  -0.0111 137 GLN A CG  
1053 C CD  . GLN A 139 ? 0.7722 0.7415 0.7099 -0.1732 0.0338  -0.0080 137 GLN A CD  
1054 O OE1 . GLN A 139 ? 0.7338 0.6615 0.6572 -0.1638 0.0339  0.0041  137 GLN A OE1 
1055 N NE2 . GLN A 139 ? 0.7619 0.7367 0.6955 -0.1942 0.0373  -0.0197 137 GLN A NE2 
1056 N N   . MET A 140 ? 0.4951 0.5252 0.4850 -0.1107 0.0151  -0.0165 138 MET A N   
1057 C CA  . MET A 140 ? 0.5258 0.5541 0.5134 -0.1124 0.0133  -0.0256 138 MET A CA  
1058 C C   . MET A 140 ? 0.5302 0.5256 0.5090 -0.0975 0.0141  -0.0216 138 MET A C   
1059 O O   . MET A 140 ? 0.5829 0.5515 0.5470 -0.1044 0.0181  -0.0266 138 MET A O   
1060 C CB  . MET A 140 ? 0.4880 0.5597 0.4944 -0.1078 0.0061  -0.0336 138 MET A CB  
1061 C CG  . MET A 140 ? 0.4682 0.5401 0.4690 -0.1115 0.0025  -0.0420 138 MET A CG  
1062 S SD  . MET A 140 ? 0.4795 0.5806 0.4946 -0.0931 -0.0082 -0.0431 138 MET A SD  
1063 C CE  . MET A 140 ? 0.3561 0.4298 0.3676 -0.0714 -0.0061 -0.0320 138 MET A CE  
1064 N N   . LEU A 141 ? 0.4284 0.4249 0.4155 -0.0786 0.0117  -0.0132 139 LEU A N   
1065 C CA  . LEU A 141 ? 0.4499 0.4212 0.4327 -0.0638 0.0136  -0.0093 139 LEU A CA  
1066 C C   . LEU A 141 ? 0.4908 0.4210 0.4599 -0.0653 0.0198  -0.0033 139 LEU A C   
1067 O O   . LEU A 141 ? 0.5547 0.4579 0.5153 -0.0609 0.0247  -0.0067 139 LEU A O   
1068 C CB  . LEU A 141 ? 0.4190 0.4045 0.4151 -0.0461 0.0096  -0.0014 139 LEU A CB  
1069 C CG  . LEU A 141 ? 0.3537 0.3701 0.3617 -0.0398 0.0037  -0.0054 139 LEU A CG  
1070 C CD1 . LEU A 141 ? 0.3679 0.3945 0.3864 -0.0275 0.0010  0.0029  139 LEU A CD1 
1071 C CD2 . LEU A 141 ? 0.2754 0.2872 0.2780 -0.0356 0.0037  -0.0111 139 LEU A CD2 
1072 N N   . LYS A 142 ? 0.5042 0.4281 0.4696 -0.0717 0.0200  0.0053  140 LYS A N   
1073 C CA  . LYS A 142 ? 0.5299 0.4114 0.4795 -0.0746 0.0245  0.0131  140 LYS A CA  
1074 C C   . LYS A 142 ? 0.5783 0.4316 0.5102 -0.0915 0.0311  0.0031  140 LYS A C   
1075 O O   . LYS A 142 ? 0.5969 0.4109 0.5183 -0.0857 0.0364  0.0030  140 LYS A O   
1076 C CB  . LYS A 142 ? 0.5231 0.4056 0.4678 -0.0824 0.0225  0.0249  140 LYS A CB  
1077 C CG  . LYS A 142 ? 0.6155 0.4549 0.5461 -0.0779 0.0237  0.0391  140 LYS A CG  
1078 C CD  . LYS A 142 ? 0.6836 0.5145 0.5975 -0.0974 0.0242  0.0472  140 LYS A CD  
1079 C CE  . LYS A 142 ? 0.7689 0.6110 0.6853 -0.0894 0.0174  0.0628  140 LYS A CE  
1080 N NZ  . LYS A 142 ? 0.7955 0.5968 0.7013 -0.0775 0.0146  0.0800  140 LYS A NZ  
1081 N N   . LYS A 143 ? 0.5661 0.4402 0.4954 -0.1126 0.0312  -0.0062 141 LYS A N   
1082 C CA  . LYS A 143 ? 0.5983 0.4506 0.5103 -0.1329 0.0368  -0.0172 141 LYS A CA  
1083 C C   . LYS A 143 ? 0.6341 0.4725 0.5416 -0.1265 0.0394  -0.0283 141 LYS A C   
1084 O O   . LYS A 143 ? 0.6854 0.4850 0.5736 -0.1369 0.0465  -0.0349 141 LYS A O   
1085 C CB  . LYS A 143 ? 0.5891 0.4789 0.5052 -0.1561 0.0353  -0.0264 141 LYS A CB  
1086 C CG  . LYS A 143 ? 0.5785 0.4415 0.4732 -0.1840 0.0421  -0.0319 141 LYS A CG  
1087 C CD  . LYS A 143 ? 0.5767 0.4820 0.4791 -0.2071 0.0414  -0.0385 141 LYS A CD  
1088 C CE  . LYS A 143 ? 0.5474 0.4278 0.4276 -0.2383 0.0485  -0.0462 141 LYS A CE  
1089 N NZ  . LYS A 143 ? 0.5319 0.4646 0.4250 -0.2605 0.0466  -0.0594 141 LYS A NZ  
1090 N N   . GLN A 144 ? 0.6828 0.5492 0.6055 -0.1100 0.0345  -0.0302 142 GLN A N   
1091 C CA  . GLN A 144 ? 0.7222 0.5778 0.6393 -0.1028 0.0375  -0.0397 142 GLN A CA  
1092 C C   . GLN A 144 ? 0.7242 0.5447 0.6400 -0.0822 0.0440  -0.0337 142 GLN A C   
1093 O O   . GLN A 144 ? 0.7047 0.5127 0.6151 -0.0755 0.0493  -0.0422 142 GLN A O   
1094 C CB  . GLN A 144 ? 0.6856 0.5848 0.6168 -0.0952 0.0295  -0.0431 142 GLN A CB  
1095 C CG  . GLN A 144 ? 0.6709 0.6086 0.6068 -0.1121 0.0222  -0.0503 142 GLN A CG  
1096 C CD  . GLN A 144 ? 0.6589 0.6377 0.6116 -0.1001 0.0125  -0.0487 142 GLN A CD  
1097 O OE1 . GLN A 144 ? 0.5111 0.4929 0.4738 -0.0815 0.0112  -0.0401 142 GLN A OE1 
1098 N NE2 . GLN A 144 ? 0.6935 0.7038 0.6491 -0.1111 0.0052  -0.0566 142 GLN A NE2 
1099 N N   . GLY A 145 ? 0.6798 0.4898 0.6024 -0.0714 0.0429  -0.0191 143 GLY A N   
1100 C CA  . GLY A 145 ? 0.7246 0.5063 0.6507 -0.0500 0.0476  -0.0119 143 GLY A CA  
1101 C C   . GLY A 145 ? 0.7260 0.5363 0.6715 -0.0299 0.0448  -0.0094 143 GLY A C   
1102 O O   . GLY A 145 ? 0.7360 0.5309 0.6877 -0.0120 0.0501  -0.0076 143 GLY A O   
1103 N N   . ILE A 146 ? 0.6333 0.4852 0.5891 -0.0328 0.0372  -0.0095 144 ILE A N   
1104 C CA  . ILE A 146 ? 0.6071 0.4857 0.5801 -0.0167 0.0335  -0.0046 144 ILE A CA  
1105 C C   . ILE A 146 ? 0.6153 0.4982 0.6005 -0.0059 0.0289  0.0109  144 ILE A C   
1106 O O   . ILE A 146 ? 0.5970 0.4757 0.5927 0.0107  0.0307  0.0170  144 ILE A O   
1107 C CB  . ILE A 146 ? 0.5758 0.4917 0.5535 -0.0230 0.0266  -0.0093 144 ILE A CB  
1108 C CG1 . ILE A 146 ? 0.5835 0.4977 0.5481 -0.0326 0.0291  -0.0231 144 ILE A CG1 
1109 C CG2 . ILE A 146 ? 0.4972 0.4362 0.4901 -0.0086 0.0229  -0.0029 144 ILE A CG2 
1110 C CD1 . ILE A 146 ? 0.5021 0.4511 0.4710 -0.0360 0.0207  -0.0261 144 ILE A CD1 
1111 N N   . VAL A 147 ? 0.7477 0.6399 0.7311 -0.0164 0.0234  0.0169  145 VAL A N   
1112 C CA  . VAL A 147 ? 0.7722 0.6576 0.7581 -0.0114 0.0197  0.0319  145 VAL A CA  
1113 C C   . VAL A 147 ? 0.8455 0.6870 0.8203 -0.0080 0.0244  0.0375  145 VAL A C   
1114 O O   . VAL A 147 ? 0.8856 0.7020 0.8430 -0.0231 0.0283  0.0336  145 VAL A O   
1115 C CB  . VAL A 147 ? 0.7302 0.6333 0.7119 -0.0269 0.0148  0.0352  145 VAL A CB  
1116 C CG1 . VAL A 147 ? 0.7049 0.5928 0.6802 -0.0266 0.0115  0.0509  145 VAL A CG1 
1117 C CG2 . VAL A 147 ? 0.6354 0.5779 0.6309 -0.0244 0.0099  0.0323  145 VAL A CG2 
1118 N N   . LYS A 148 ? 1.2713 1.1026 1.2566 0.0119  0.0250  0.0447  146 LYS A N   
1119 C CA  . LYS A 148 ? 1.2467 1.1016 1.2500 0.0267  0.0264  0.0402  146 LYS A CA  
1120 C C   . LYS A 148 ? 1.2682 1.1016 1.2710 0.0360  0.0371  0.0292  146 LYS A C   
1121 O O   . LYS A 148 ? 1.7873 1.5854 1.7861 0.0444  0.0424  0.0315  146 LYS A O   
1122 C CB  . LYS A 148 ? 1.2317 1.1068 1.2532 0.0416  0.0191  0.0545  146 LYS A CB  
1123 C CG  . LYS A 148 ? 1.2244 1.1107 1.2413 0.0324  0.0096  0.0663  146 LYS A CG  
1124 C CD  . LYS A 148 ? 1.1873 1.1133 1.2171 0.0330  0.0036  0.0674  146 LYS A CD  
1125 C CE  . LYS A 148 ? 1.1758 1.1155 1.1960 0.0167  -0.0013 0.0686  146 LYS A CE  
1126 N NZ  . LYS A 148 ? 1.1638 1.1254 1.1896 0.0179  -0.0098 0.0794  146 LYS A NZ  
1127 N N   . PRO B 9   ? 1.0236 1.8600 1.3006 -0.0395 0.0586  0.0923  7   PRO B N   
1128 C CA  . PRO B 9   ? 1.0176 1.7554 1.2535 -0.0648 0.0515  0.0960  7   PRO B CA  
1129 C C   . PRO B 9   ? 0.9974 1.6754 1.2268 -0.0385 0.0392  0.0982  7   PRO B C   
1130 O O   . PRO B 9   ? 1.0075 1.7239 1.2609 -0.0117 0.0320  0.0998  7   PRO B O   
1131 C CB  . PRO B 9   ? 1.0374 1.7250 1.2531 -0.0603 0.0654  0.0893  7   PRO B CB  
1132 C CG  . PRO B 9   ? 1.0386 1.7754 1.2818 -0.0187 0.0780  0.0808  7   PRO B CG  
1133 C CD  . PRO B 9   ? 1.0452 1.8914 1.3258 -0.0191 0.0770  0.0827  7   PRO B CD  
1134 N N   . GLU B 10  ? 0.7936 1.3815 0.9897 -0.0473 0.0361  0.0987  8   GLU B N   
1135 C CA  . GLU B 10  ? 0.7487 1.2831 0.9343 -0.0324 0.0246  0.1018  8   GLU B CA  
1136 C C   . GLU B 10  ? 0.7038 1.1734 0.8794 -0.0012 0.0297  0.0971  8   GLU B C   
1137 O O   . GLU B 10  ? 0.7049 1.1439 0.8683 -0.0030 0.0395  0.0923  8   GLU B O   
1138 C CB  . GLU B 10  ? 0.7696 1.2571 0.9240 -0.0685 0.0149  0.1064  8   GLU B CB  
1139 C CG  . GLU B 10  ? 0.8195 1.3028 0.9725 -0.0663 0.0008  0.1116  8   GLU B CG  
1140 C CD  . GLU B 10  ? 0.9829 1.4377 1.1046 -0.1066 -0.0087 0.1153  8   GLU B CD  
1141 O OE1 . GLU B 10  ? 1.0521 1.4786 1.1501 -0.1328 -0.0046 0.1137  8   GLU B OE1 
1142 O OE2 . GLU B 10  ? 0.9719 1.4347 1.0902 -0.1134 -0.0210 0.1198  8   GLU B OE2 
1143 N N   . THR B 11  ? 0.4307 0.8725 0.6052 0.0210  0.0214  0.0996  9   THR B N   
1144 C CA  . THR B 11  ? 0.3495 0.7352 0.5141 0.0494  0.0245  0.0964  9   THR B CA  
1145 C C   . THR B 11  ? 0.3305 0.6478 0.4681 0.0327  0.0270  0.0951  9   THR B C   
1146 O O   . THR B 11  ? 0.3144 0.6159 0.4371 0.0051  0.0227  0.0976  9   THR B O   
1147 C CB  . THR B 11  ? 0.3862 0.7580 0.5512 0.0722  0.0136  0.1012  9   THR B CB  
1148 O OG1 . THR B 11  ? 0.3560 0.6985 0.5041 0.0504  0.0048  0.1064  9   THR B OG1 
1149 C CG2 . THR B 11  ? 0.3618 0.8039 0.5536 0.0913  0.0078  0.1033  9   THR B CG2 
1150 N N   . LEU B 12  ? 0.3498 0.6256 0.4791 0.0505  0.0329  0.0911  10  LEU B N   
1151 C CA  . LEU B 12  ? 0.3446 0.5621 0.4521 0.0387  0.0345  0.0898  10  LEU B CA  
1152 C C   . LEU B 12  ? 0.3303 0.5169 0.4253 0.0308  0.0258  0.0943  10  LEU B C   
1153 O O   . LEU B 12  ? 0.2822 0.4380 0.3608 0.0137  0.0250  0.0938  10  LEU B O   
1154 C CB  . LEU B 12  ? 0.3775 0.5601 0.4790 0.0599  0.0400  0.0857  10  LEU B CB  
1155 C CG  . LEU B 12  ? 0.4074 0.5792 0.5021 0.0566  0.0492  0.0798  10  LEU B CG  
1156 C CD1 . LEU B 12  ? 0.4380 0.6517 0.5386 0.0381  0.0543  0.0784  10  LEU B CD1 
1157 C CD2 . LEU B 12  ? 0.4108 0.5710 0.5040 0.0832  0.0541  0.0750  10  LEU B CD2 
1158 N N   . GLU B 13  ? 0.3205 0.5149 0.4210 0.0452  0.0193  0.0983  11  GLU B N   
1159 C CA  . GLU B 13  ? 0.3055 0.4750 0.3928 0.0386  0.0118  0.1025  11  GLU B CA  
1160 C C   . GLU B 13  ? 0.3145 0.4933 0.3932 0.0120  0.0071  0.1035  11  GLU B C   
1161 O O   . GLU B 13  ? 0.3278 0.4697 0.3870 0.0000  0.0068  0.1020  11  GLU B O   
1162 C CB  . GLU B 13  ? 0.3302 0.5125 0.4231 0.0573  0.0040  0.1077  11  GLU B CB  
1163 C CG  . GLU B 13  ? 0.3268 0.4732 0.4117 0.0796  0.0055  0.1081  11  GLU B CG  
1164 C CD  . GLU B 13  ? 0.4024 0.5662 0.4990 0.1033  0.0089  0.1049  11  GLU B CD  
1165 O OE1 . GLU B 13  ? 0.4881 0.6184 0.5729 0.1223  0.0083  0.1053  11  GLU B OE1 
1166 O OE2 . GLU B 13  ? 0.4025 0.6131 0.5173 0.1023  0.0123  0.1019  11  GLU B OE2 
1167 N N   . ALA B 14  ? 0.3414 0.5699 0.4331 0.0027  0.0036  0.1055  12  ALA B N   
1168 C CA  . ALA B 14  ? 0.3684 0.6049 0.4472 -0.0274 -0.0024 0.1071  12  ALA B CA  
1169 C C   . ALA B 14  ? 0.3912 0.5961 0.4500 -0.0476 0.0022  0.1032  12  ALA B C   
1170 O O   . ALA B 14  ? 0.4433 0.6129 0.4755 -0.0651 -0.0027 0.1027  12  ALA B O   
1171 C CB  . ALA B 14  ? 0.3594 0.6647 0.4585 -0.0361 -0.0073 0.1107  12  ALA B CB  
1172 N N   . ARG B 15  ? 0.3359 0.5450 0.4028 -0.0420 0.0112  0.0999  13  ARG B N   
1173 C CA  . ARG B 15  ? 0.3564 0.5307 0.4017 -0.0586 0.0144  0.0970  13  ARG B CA  
1174 C C   . ARG B 15  ? 0.3514 0.4652 0.3765 -0.0514 0.0136  0.0943  13  ARG B C   
1175 O O   . ARG B 15  ? 0.3647 0.4432 0.3628 -0.0673 0.0093  0.0932  13  ARG B O   
1176 C CB  . ARG B 15  ? 0.3508 0.5448 0.4075 -0.0545 0.0242  0.0943  13  ARG B CB  
1177 C CG  . ARG B 15  ? 0.4118 0.6747 0.4968 -0.0486 0.0281  0.0951  13  ARG B CG  
1178 C CD  . ARG B 15  ? 0.4787 0.7642 0.5678 -0.0527 0.0387  0.0916  13  ARG B CD  
1179 N NE  . ARG B 15  ? 0.5921 0.8778 0.6605 -0.0895 0.0372  0.0939  13  ARG B NE  
1180 C CZ  . ARG B 15  ? 0.5438 0.8882 0.6209 -0.1107 0.0398  0.0959  13  ARG B CZ  
1181 N NH1 . ARG B 15  ? 0.5464 0.8790 0.5960 -0.1490 0.0361  0.0994  13  ARG B NH1 
1182 N NH2 . ARG B 15  ? 0.4766 0.8905 0.5874 -0.0936 0.0464  0.0942  13  ARG B NH2 
1183 N N   . ILE B 16  ? 0.3323 0.4344 0.3685 -0.0275 0.0173  0.0931  14  ILE B N   
1184 C CA  . ILE B 16  ? 0.3004 0.3571 0.3229 -0.0200 0.0179  0.0905  14  ILE B CA  
1185 C C   . ILE B 16  ? 0.3076 0.3453 0.3134 -0.0251 0.0119  0.0908  14  ILE B C   
1186 O O   . ILE B 16  ? 0.3221 0.3248 0.3088 -0.0261 0.0111  0.0873  14  ILE B O   
1187 C CB  . ILE B 16  ? 0.3060 0.3577 0.3422 0.0017  0.0229  0.0901  14  ILE B CB  
1188 C CG1 . ILE B 16  ? 0.2896 0.3062 0.3160 0.0056  0.0248  0.0871  14  ILE B CG1 
1189 C CG2 . ILE B 16  ? 0.1838 0.2451 0.2267 0.0127  0.0199  0.0940  14  ILE B CG2 
1190 C CD1 . ILE B 16  ? 0.3487 0.3484 0.3644 -0.0024 0.0252  0.0840  14  ILE B CD1 
1191 N N   . ASN B 17  ? 0.3264 0.3882 0.3378 -0.0268 0.0073  0.0946  15  ASN B N   
1192 C CA  . ASN B 17  ? 0.3394 0.3836 0.3315 -0.0327 0.0016  0.0946  15  ASN B CA  
1193 C C   . ASN B 17  ? 0.3670 0.3895 0.3309 -0.0547 -0.0038 0.0922  15  ASN B C   
1194 O O   . ASN B 17  ? 0.3910 0.3763 0.3289 -0.0561 -0.0059 0.0881  15  ASN B O   
1195 C CB  . ASN B 17  ? 0.3127 0.3885 0.3151 -0.0311 -0.0043 0.1002  15  ASN B CB  
1196 C CG  . ASN B 17  ? 0.2680 0.3487 0.2859 -0.0091 -0.0014 0.1031  15  ASN B CG  
1197 O OD1 . ASN B 17  ? 0.3396 0.3979 0.3581 0.0016  0.0052  0.1008  15  ASN B OD1 
1198 N ND2 . ASN B 17  ? 0.2582 0.3680 0.2871 -0.0030 -0.0076 0.1087  15  ASN B ND2 
1199 N N   . ARG B 18  ? 0.3831 0.4284 0.3494 -0.0721 -0.0060 0.0944  16  ARG B N   
1200 C CA  . ARG B 18  ? 0.4247 0.4434 0.3585 -0.0973 -0.0118 0.0931  16  ARG B CA  
1201 C C   . ARG B 18  ? 0.4305 0.4015 0.3447 -0.0922 -0.0091 0.0884  16  ARG B C   
1202 O O   . ARG B 18  ? 0.4732 0.3961 0.3504 -0.0997 -0.0149 0.0849  16  ARG B O   
1203 C CB  . ARG B 18  ? 0.4597 0.5226 0.4036 -0.1195 -0.0132 0.0977  16  ARG B CB  
1204 C CG  . ARG B 18  ? 0.6230 0.6930 0.5447 -0.1500 -0.0240 0.1009  16  ARG B CG  
1205 C CD  . ARG B 18  ? 0.7862 0.9040 0.7168 -0.1764 -0.0242 0.1054  16  ARG B CD  
1206 N NE  . ARG B 18  ? 0.7912 0.9843 0.7683 -0.1630 -0.0200 0.1086  16  ARG B NE  
1207 C CZ  . ARG B 18  ? 0.7635 0.9952 0.7697 -0.1507 -0.0099 0.1080  16  ARG B CZ  
1208 N NH1 . ARG B 18  ? 0.6616 0.9566 0.7064 -0.1327 -0.0073 0.1098  16  ARG B NH1 
1209 N NH2 . ARG B 18  ? 0.7506 0.9572 0.7443 -0.1561 -0.0032 0.1055  16  ARG B NH2 
1210 N N   . ALA B 19  ? 0.3888 0.3710 0.3243 -0.0793 -0.0017 0.0881  17  ALA B N   
1211 C CA  . ALA B 19  ? 0.4089 0.3520 0.3279 -0.0750 -0.0007 0.0847  17  ALA B CA  
1212 C C   . ALA B 19  ? 0.4168 0.3240 0.3258 -0.0549 -0.0008 0.0795  17  ALA B C   
1213 O O   . ALA B 19  ? 0.4581 0.3271 0.3456 -0.0508 -0.0037 0.0761  17  ALA B O   
1214 C CB  . ALA B 19  ? 0.3551 0.3216 0.2985 -0.0672 0.0069  0.0856  17  ALA B CB  
1215 N N   . THR B 20  ? 0.3995 0.3213 0.3234 -0.0419 0.0020  0.0791  18  THR B N   
1216 C CA  . THR B 20  ? 0.3699 0.2720 0.2907 -0.0229 0.0048  0.0743  18  THR B CA  
1217 C C   . THR B 20  ? 0.4138 0.3042 0.3158 -0.0236 0.0022  0.0718  18  THR B C   
1218 O O   . THR B 20  ? 0.3985 0.2838 0.3006 -0.0086 0.0064  0.0679  18  THR B O   
1219 C CB  . THR B 20  ? 0.3900 0.3179 0.3432 -0.0069 0.0126  0.0759  18  THR B CB  
1220 O OG1 . THR B 20  ? 0.3239 0.2792 0.2923 -0.0072 0.0139  0.0805  18  THR B OG1 
1221 C CG2 . THR B 20  ? 0.2872 0.2236 0.2546 -0.0069 0.0150  0.0776  18  THR B CG2 
1222 N N   . ASN B 21  ? 0.4249 0.3140 0.3097 -0.0430 -0.0046 0.0740  19  ASN B N   
1223 C CA  . ASN B 21  ? 0.4900 0.3648 0.3514 -0.0470 -0.0085 0.0716  19  ASN B CA  
1224 C C   . ASN B 21  ? 0.5522 0.3793 0.3799 -0.0353 -0.0088 0.0623  19  ASN B C   
1225 O O   . ASN B 21  ? 0.5912 0.3774 0.3860 -0.0419 -0.0153 0.0588  19  ASN B O   
1226 C CB  . ASN B 21  ? 0.4954 0.3738 0.3391 -0.0745 -0.0180 0.0755  19  ASN B CB  
1227 C CG  . ASN B 21  ? 0.5617 0.4421 0.3914 -0.0804 -0.0224 0.0757  19  ASN B CG  
1228 O OD1 . ASN B 21  ? 0.5738 0.4180 0.3739 -0.0736 -0.0226 0.0689  19  ASN B OD1 
1229 N ND2 . ASN B 21  ? 0.6378 0.5602 0.4850 -0.0940 -0.0272 0.0831  19  ASN B ND2 
1230 N N   . PRO B 22  ? 0.5865 0.4171 0.4166 -0.0192 -0.0026 0.0583  20  PRO B N   
1231 C CA  . PRO B 22  ? 0.6175 0.4115 0.4192 -0.0022 -0.0007 0.0478  20  PRO B CA  
1232 C C   . PRO B 22  ? 0.6652 0.4109 0.4152 -0.0138 -0.0098 0.0423  20  PRO B C   
1233 O O   . PRO B 22  ? 0.6803 0.3849 0.3977 0.0017  -0.0102 0.0323  20  PRO B O   
1234 C CB  . PRO B 22  ? 0.6036 0.4248 0.4222 0.0115  0.0093  0.0464  20  PRO B CB  
1235 C CG  . PRO B 22  ? 0.5149 0.3683 0.3521 -0.0037 0.0078  0.0560  20  PRO B CG  
1236 C CD  . PRO B 22  ? 0.4964 0.3647 0.3525 -0.0160 0.0026  0.0633  20  PRO B CD  
1237 N N   . LEU B 23  ? 0.6827 0.4330 0.4235 -0.0407 -0.0180 0.0486  21  LEU B N   
1238 C CA  . LEU B 23  ? 0.7457 0.4471 0.4330 -0.0601 -0.0293 0.0451  21  LEU B CA  
1239 C C   . LEU B 23  ? 0.7890 0.4507 0.4496 -0.0725 -0.0379 0.0456  21  LEU B C   
1240 O O   . LEU B 23  ? 0.8665 0.4707 0.4722 -0.0856 -0.0480 0.0411  21  LEU B O   
1241 C CB  . LEU B 23  ? 0.7533 0.4809 0.4408 -0.0876 -0.0363 0.0525  21  LEU B CB  
1242 C CG  . LEU B 23  ? 0.7949 0.5342 0.4775 -0.0850 -0.0346 0.0512  21  LEU B CG  
1243 C CD1 . LEU B 23  ? 0.7209 0.4987 0.4146 -0.1117 -0.0437 0.0613  21  LEU B CD1 
1244 C CD2 . LEU B 23  ? 0.8327 0.5114 0.4576 -0.0802 -0.0369 0.0392  21  LEU B CD2 
1245 N N   . ASN B 24  ? 0.7546 0.4410 0.4481 -0.0693 -0.0344 0.0508  22  ASN B N   
1246 C CA  . ASN B 24  ? 0.7618 0.4126 0.4289 -0.0843 -0.0426 0.0528  22  ASN B CA  
1247 C C   . ASN B 24  ? 0.8438 0.4209 0.4599 -0.0672 -0.0485 0.0432  22  ASN B C   
1248 O O   . ASN B 24  ? 0.8393 0.4154 0.4683 -0.0340 -0.0420 0.0366  22  ASN B O   
1249 C CB  . ASN B 24  ? 0.7135 0.4025 0.4235 -0.0792 -0.0364 0.0587  22  ASN B CB  
1250 C CG  . ASN B 24  ? 0.6616 0.4109 0.4077 -0.1008 -0.0339 0.0682  22  ASN B CG  
1251 O OD1 . ASN B 24  ? 0.6027 0.3682 0.3428 -0.1222 -0.0385 0.0715  22  ASN B OD1 
1252 N ND2 . ASN B 24  ? 0.5898 0.3762 0.3754 -0.0923 -0.0265 0.0718  22  ASN B ND2 
1253 N N   . LYS B 25  ? 0.9345 0.4512 0.4929 -0.0901 -0.0615 0.0430  23  LYS B N   
1254 C CA  . LYS B 25  ? 1.0343 0.4699 0.5358 -0.0728 -0.0699 0.0342  23  LYS B CA  
1255 C C   . LYS B 25  ? 1.0314 0.4533 0.5368 -0.0634 -0.0724 0.0373  23  LYS B C   
1256 O O   . LYS B 25  ? 1.0794 0.4562 0.5609 -0.0331 -0.0760 0.0298  23  LYS B O   
1257 C CB  . LYS B 25  ? 1.1369 0.4998 0.5635 -0.1028 -0.0850 0.0328  23  LYS B CB  
1258 C CG  . LYS B 25  ? 1.1977 0.5570 0.6060 -0.1075 -0.0848 0.0270  23  LYS B CG  
1259 C CD  . LYS B 25  ? 1.4064 0.6709 0.7376 -0.0922 -0.0938 0.0139  23  LYS B CD  
1260 C CE  . LYS B 25  ? 1.4433 0.7078 0.7598 -0.0880 -0.0902 0.0056  23  LYS B CE  
1261 N NZ  . LYS B 25  ? 1.5150 0.6766 0.7417 -0.0844 -0.1021 -0.0067 23  LYS B NZ  
1262 N N   . GLU B 26  ? 1.0102 0.4740 0.5462 -0.0875 -0.0706 0.0481  24  GLU B N   
1263 C CA  . GLU B 26  ? 0.9917 0.4544 0.5393 -0.0793 -0.0710 0.0519  24  GLU B CA  
1264 C C   . GLU B 26  ? 0.8957 0.4386 0.5068 -0.0888 -0.0598 0.0602  24  GLU B C   
1265 O O   . GLU B 26  ? 0.8449 0.4386 0.4841 -0.1063 -0.0542 0.0642  24  GLU B O   
1266 C CB  . GLU B 26  ? 1.0769 0.4673 0.5596 -0.1052 -0.0863 0.0559  24  GLU B CB  
1267 C CG  . GLU B 26  ? 1.1326 0.5214 0.5890 -0.1546 -0.0921 0.0631  24  GLU B CG  
1268 C CD  . GLU B 26  ? 1.3654 0.6998 0.7679 -0.1873 -0.1045 0.0705  24  GLU B CD  
1269 O OE1 . GLU B 26  ? 1.3972 0.7055 0.7921 -0.1720 -0.1074 0.0716  24  GLU B OE1 
1270 O OE2 . GLU B 26  ? 1.4182 0.7393 0.7860 -0.2313 -0.1119 0.0761  24  GLU B OE2 
1271 N N   . LEU B 27  ? 0.8097 0.3623 0.4412 -0.0751 -0.0573 0.0621  25  LEU B N   
1272 C CA  . LEU B 27  ? 0.7447 0.3608 0.4253 -0.0844 -0.0478 0.0690  25  LEU B CA  
1273 C C   . LEU B 27  ? 0.7486 0.3871 0.4241 -0.1247 -0.0484 0.0767  25  LEU B C   
1274 O O   . LEU B 27  ? 0.7567 0.3501 0.3823 -0.1524 -0.0589 0.0796  25  LEU B O   
1275 C CB  . LEU B 27  ? 0.7276 0.3333 0.4120 -0.0719 -0.0490 0.0704  25  LEU B CB  
1276 C CG  . LEU B 27  ? 0.7844 0.3879 0.4863 -0.0323 -0.0475 0.0640  25  LEU B CG  
1277 C CD1 . LEU B 27  ? 0.7409 0.3190 0.4303 -0.0247 -0.0545 0.0662  25  LEU B CD1 
1278 C CD2 . LEU B 27  ? 0.7095 0.3799 0.4707 -0.0178 -0.0339 0.0631  25  LEU B CD2 
1279 N N   . ASP B 28  ? 0.6901 0.3995 0.4160 -0.1277 -0.0378 0.0799  26  ASP B N   
1280 C CA  . ASP B 28  ? 0.6845 0.4341 0.4166 -0.1611 -0.0369 0.0863  26  ASP B CA  
1281 C C   . ASP B 28  ? 0.6605 0.4528 0.4210 -0.1671 -0.0286 0.0907  26  ASP B C   
1282 O O   . ASP B 28  ? 0.6042 0.4539 0.4129 -0.1530 -0.0181 0.0908  26  ASP B O   
1283 C CB  . ASP B 28  ? 0.6592 0.4584 0.4250 -0.1560 -0.0323 0.0859  26  ASP B CB  
1284 C CG  . ASP B 28  ? 0.7425 0.5972 0.5235 -0.1856 -0.0317 0.0924  26  ASP B CG  
1285 O OD1 . ASP B 28  ? 0.7495 0.6071 0.5151 -0.2127 -0.0331 0.0969  26  ASP B OD1 
1286 O OD2 . ASP B 28  ? 0.7674 0.6682 0.5783 -0.1805 -0.0292 0.0933  26  ASP B OD2 
1287 N N   . TRP B 29  ? 0.6576 0.4136 0.3828 -0.1851 -0.0337 0.0937  27  TRP B N   
1288 C CA  . TRP B 29  ? 0.6415 0.4242 0.3835 -0.1886 -0.0262 0.0966  27  TRP B CA  
1289 C C   . TRP B 29  ? 0.6143 0.4729 0.3897 -0.2078 -0.0160 0.1004  27  TRP B C   
1290 O O   . TRP B 29  ? 0.6134 0.5115 0.4205 -0.1969 -0.0053 0.0998  27  TRP B O   
1291 C CB  . TRP B 29  ? 0.7090 0.4291 0.3964 -0.2075 -0.0361 0.1000  27  TRP B CB  
1292 C CG  . TRP B 29  ? 0.7493 0.4089 0.4166 -0.1775 -0.0440 0.0958  27  TRP B CG  
1293 C CD1 . TRP B 29  ? 0.7882 0.3732 0.4046 -0.1730 -0.0581 0.0935  27  TRP B CD1 
1294 C CD2 . TRP B 29  ? 0.6872 0.3599 0.3865 -0.1452 -0.0387 0.0925  27  TRP B CD2 
1295 N NE1 . TRP B 29  ? 0.7950 0.3525 0.4137 -0.1375 -0.0615 0.0890  27  TRP B NE1 
1296 C CE2 . TRP B 29  ? 0.6955 0.3079 0.3657 -0.1221 -0.0500 0.0888  27  TRP B CE2 
1297 C CE3 . TRP B 29  ? 0.6477 0.3752 0.3937 -0.1340 -0.0263 0.0921  27  TRP B CE3 
1298 C CZ2 . TRP B 29  ? 0.6680 0.2810 0.3578 -0.0916 -0.0498 0.0859  27  TRP B CZ2 
1299 C CZ3 . TRP B 29  ? 0.5725 0.2930 0.3340 -0.1056 -0.0264 0.0891  27  TRP B CZ3 
1300 C CH2 . TRP B 29  ? 0.5986 0.2661 0.3338 -0.0863 -0.0382 0.0865  27  TRP B CH2 
1301 N N   . ALA B 30  ? 0.6889 0.5664 0.4529 -0.2377 -0.0199 0.1041  28  ALA B N   
1302 C CA  . ALA B 30  ? 0.6895 0.6525 0.4948 -0.2484 -0.0109 0.1066  28  ALA B CA  
1303 C C   . ALA B 30  ? 0.6119 0.6236 0.4730 -0.2102 -0.0009 0.1024  28  ALA B C   
1304 O O   . ALA B 30  ? 0.6269 0.6804 0.5184 -0.1980 0.0102  0.1012  28  ALA B O   
1305 C CB  . ALA B 30  ? 0.6668 0.6422 0.4552 -0.2801 -0.0197 0.1105  28  ALA B CB  
1306 N N   . SER B 31  ? 0.6076 0.6053 0.4758 -0.1905 -0.0052 0.0998  29  SER B N   
1307 C CA  . SER B 31  ? 0.5667 0.6002 0.4792 -0.1572 0.0022  0.0970  29  SER B CA  
1308 C C   . SER B 31  ? 0.5377 0.5580 0.4645 -0.1301 0.0098  0.0933  29  SER B C   
1309 O O   . SER B 31  ? 0.4858 0.5459 0.4467 -0.1116 0.0183  0.0921  29  SER B O   
1310 C CB  . SER B 31  ? 0.5879 0.6020 0.4970 -0.1455 -0.0042 0.0955  29  SER B CB  
1311 O OG  . SER B 31  ? 0.6710 0.6970 0.5647 -0.1720 -0.0124 0.0989  29  SER B OG  
1312 N N   . ILE B 32  ? 0.5140 0.4771 0.4121 -0.1280 0.0054  0.0916  30  ILE B N   
1313 C CA  . ILE B 32  ? 0.4766 0.4252 0.3856 -0.1045 0.0100  0.0884  30  ILE B CA  
1314 C C   . ILE B 32  ? 0.4981 0.4769 0.4193 -0.1092 0.0188  0.0890  30  ILE B C   
1315 O O   . ILE B 32  ? 0.4430 0.4456 0.3917 -0.0892 0.0267  0.0865  30  ILE B O   
1316 C CB  . ILE B 32  ? 0.4966 0.3826 0.3707 -0.1021 0.0014  0.0870  30  ILE B CB  
1317 C CG1 . ILE B 32  ? 0.4674 0.3251 0.3321 -0.0888 -0.0047 0.0838  30  ILE B CG1 
1318 C CG2 . ILE B 32  ? 0.3822 0.2599 0.2652 -0.0855 0.0047  0.0852  30  ILE B CG2 
1319 C CD1 . ILE B 32  ? 0.5139 0.3093 0.3392 -0.0842 -0.0147 0.0815  30  ILE B CD1 
1320 N N   . ASN B 33  ? 0.5114 0.4908 0.4093 -0.1378 0.0175  0.0923  31  ASN B N   
1321 C CA  . ASN B 33  ? 0.5213 0.5298 0.4240 -0.1471 0.0267  0.0926  31  ASN B CA  
1322 C C   . ASN B 33  ? 0.4705 0.5528 0.4108 -0.1432 0.0375  0.0916  31  ASN B C   
1323 O O   . ASN B 33  ? 0.4387 0.5488 0.3978 -0.1294 0.0479  0.0881  31  ASN B O   
1324 C CB  . ASN B 33  ? 0.5794 0.5637 0.4398 -0.1834 0.0214  0.0975  31  ASN B CB  
1325 C CG  . ASN B 33  ? 0.6280 0.5381 0.4489 -0.1817 0.0110  0.0982  31  ASN B CG  
1326 O OD1 . ASN B 33  ? 0.7696 0.6313 0.5477 -0.2016 -0.0006 0.1018  31  ASN B OD1 
1327 N ND2 . ASN B 33  ? 0.6615 0.5606 0.4943 -0.1572 0.0138  0.0948  31  ASN B ND2 
1328 N N   . GLY B 34  ? 0.4828 0.5951 0.4323 -0.1532 0.0339  0.0942  32  GLY B N   
1329 C CA  . GLY B 34  ? 0.4496 0.6334 0.4384 -0.1421 0.0413  0.0932  32  GLY B CA  
1330 C C   . GLY B 34  ? 0.4208 0.6080 0.4375 -0.1028 0.0463  0.0885  32  GLY B C   
1331 O O   . GLY B 34  ? 0.4406 0.6728 0.4821 -0.0865 0.0558  0.0853  32  GLY B O   
1332 N N   . PHE B 35  ? 0.3576 0.4958 0.3671 -0.0877 0.0402  0.0878  33  PHE B N   
1333 C CA  . PHE B 35  ? 0.3583 0.4924 0.3877 -0.0557 0.0435  0.0847  33  PHE B CA  
1334 C C   . PHE B 35  ? 0.3696 0.4963 0.3989 -0.0448 0.0518  0.0803  33  PHE B C   
1335 O O   . PHE B 35  ? 0.3659 0.5155 0.4130 -0.0240 0.0586  0.0769  33  PHE B O   
1336 C CB  . PHE B 35  ? 0.3356 0.4229 0.3549 -0.0472 0.0360  0.0851  33  PHE B CB  
1337 C CG  . PHE B 35  ? 0.3707 0.4493 0.4046 -0.0208 0.0386  0.0831  33  PHE B CG  
1338 C CD1 . PHE B 35  ? 0.2853 0.3350 0.3133 -0.0123 0.0410  0.0803  33  PHE B CD1 
1339 C CD2 . PHE B 35  ? 0.2672 0.3630 0.3164 -0.0071 0.0369  0.0848  33  PHE B CD2 
1340 C CE1 . PHE B 35  ? 0.2464 0.2844 0.2826 0.0064  0.0422  0.0793  33  PHE B CE1 
1341 C CE2 . PHE B 35  ? 0.3043 0.3853 0.3598 0.0135  0.0383  0.0841  33  PHE B CE2 
1342 C CZ  . PHE B 35  ? 0.2999 0.3523 0.3486 0.0189  0.0413  0.0812  33  PHE B CZ  
1343 N N   . CYS B 36  ? 0.4114 0.5043 0.4164 -0.0592 0.0504  0.0804  34  CYS B N   
1344 C CA  . CYS B 36  ? 0.4058 0.4851 0.4051 -0.0516 0.0565  0.0765  34  CYS B CA  
1345 C C   . CYS B 36  ? 0.4101 0.5363 0.4182 -0.0539 0.0682  0.0735  34  CYS B C   
1346 O O   . CYS B 36  ? 0.4064 0.5348 0.4186 -0.0373 0.0758  0.0682  34  CYS B O   
1347 C CB  . CYS B 36  ? 0.4197 0.4528 0.3884 -0.0672 0.0501  0.0784  34  CYS B CB  
1348 S SG  . CYS B 36  ? 0.5449 0.5266 0.5039 -0.0578 0.0376  0.0797  34  CYS B SG  
1349 N N   . GLU B 37  ? 0.5282 0.6916 0.5361 -0.0762 0.0697  0.0764  35  GLU B N   
1350 C CA  . GLU B 37  ? 0.5735 0.7970 0.5948 -0.0786 0.0821  0.0733  35  GLU B CA  
1351 C C   . GLU B 37  ? 0.5503 0.8168 0.6049 -0.0473 0.0871  0.0692  35  GLU B C   
1352 O O   . GLU B 37  ? 0.5827 0.8787 0.6476 -0.0293 0.0983  0.0626  35  GLU B O   
1353 C CB  . GLU B 37  ? 0.5975 0.8564 0.6113 -0.1144 0.0813  0.0787  35  GLU B CB  
1354 C CG  . GLU B 37  ? 0.7825 1.0009 0.7563 -0.1464 0.0783  0.0825  35  GLU B CG  
1355 C CD  . GLU B 37  ? 0.9727 1.2029 0.9279 -0.1863 0.0720  0.0899  35  GLU B CD  
1356 O OE1 . GLU B 37  ? 1.0447 1.2394 0.9611 -0.2158 0.0684  0.0940  35  GLU B OE1 
1357 O OE2 . GLU B 37  ? 1.0076 1.2772 0.9828 -0.1895 0.0688  0.0920  35  GLU B OE2 
1358 N N   . GLN B 38  ? 0.4353 0.7031 0.5032 -0.0395 0.0782  0.0728  36  GLN B N   
1359 C CA  . GLN B 38  ? 0.4328 0.7444 0.5294 -0.0123 0.0803  0.0707  36  GLN B CA  
1360 C C   . GLN B 38  ? 0.4116 0.6918 0.5087 0.0221  0.0833  0.0649  36  GLN B C   
1361 O O   . GLN B 38  ? 0.4078 0.7202 0.5185 0.0473  0.0906  0.0593  36  GLN B O   
1362 C CB  . GLN B 38  ? 0.4446 0.7631 0.5506 -0.0159 0.0687  0.0770  36  GLN B CB  
1363 C CG  . GLN B 38  ? 0.5247 0.8586 0.6515 0.0178  0.0659  0.0762  36  GLN B CG  
1364 C CD  . GLN B 38  ? 0.5967 1.0099 0.7514 0.0231  0.0667  0.0770  36  GLN B CD  
1365 O OE1 . GLN B 38  ? 0.6252 1.0536 0.7937 0.0395  0.0585  0.0802  36  GLN B OE1 
1366 N NE2 . GLN B 38  ? 0.5630 1.0301 0.7253 0.0078  0.0760  0.0748  36  GLN B NE2 
1367 N N   . LEU B 39  ? 0.3850 0.6019 0.4634 0.0221  0.0782  0.0657  37  LEU B N   
1368 C CA  . LEU B 39  ? 0.3953 0.5760 0.4686 0.0484  0.0790  0.0615  37  LEU B CA  
1369 C C   . LEU B 39  ? 0.4386 0.6237 0.5043 0.0603  0.0903  0.0531  37  LEU B C   
1370 O O   . LEU B 39  ? 0.4406 0.6121 0.5040 0.0873  0.0926  0.0480  37  LEU B O   
1371 C CB  . LEU B 39  ? 0.3312 0.4531 0.3883 0.0417  0.0712  0.0644  37  LEU B CB  
1372 C CG  . LEU B 39  ? 0.3704 0.4611 0.4076 0.0226  0.0708  0.0642  37  LEU B CG  
1373 C CD1 . LEU B 39  ? 0.3911 0.4587 0.4147 0.0322  0.0764  0.0581  37  LEU B CD1 
1374 C CD2 . LEU B 39  ? 0.2979 0.3521 0.3280 0.0145  0.0608  0.0688  37  LEU B CD2 
1375 N N   . ASN B 40  ? 0.6841 0.8894 0.7430 0.0402  0.0975  0.0515  38  ASN B N   
1376 C CA  . ASN B 40  ? 0.7472 0.9552 0.7941 0.0479  0.1093  0.0430  38  ASN B CA  
1377 C C   . ASN B 40  ? 0.7819 1.0567 0.8473 0.0646  0.1214  0.0366  38  ASN B C   
1378 O O   . ASN B 40  ? 0.8067 1.0858 0.8630 0.0808  0.1326  0.0272  38  ASN B O   
1379 C CB  . ASN B 40  ? 0.7526 0.9429 0.7766 0.0179  0.1110  0.0445  38  ASN B CB  
1380 C CG  . ASN B 40  ? 0.8606 0.9848 0.8609 0.0176  0.1046  0.0442  38  ASN B CG  
1381 O OD1 . ASN B 40  ? 0.9685 1.0601 0.9591 0.0004  0.0943  0.0506  38  ASN B OD1 
1382 N ND2 . ASN B 40  ? 0.8636 0.9667 0.8548 0.0395  0.1091  0.0367  38  ASN B ND2 
1383 N N   . GLU B 41  ? 0.7753 1.1046 0.8661 0.0612  0.1191  0.0411  39  GLU B N   
1384 C CA  . GLU B 41  ? 0.7999 1.2068 0.9144 0.0773  0.1298  0.0355  39  GLU B CA  
1385 C C   . GLU B 41  ? 0.8210 1.2293 0.9479 0.1226  0.1276  0.0307  39  GLU B C   
1386 O O   . GLU B 41  ? 0.8223 1.2677 0.9565 0.1511  0.1384  0.0211  39  GLU B O   
1387 C CB  . GLU B 41  ? 0.7914 1.2644 0.9269 0.0492  0.1277  0.0429  39  GLU B CB  
1388 C CG  . GLU B 41  ? 0.8006 1.2871 0.9566 0.0564  0.1142  0.0500  39  GLU B CG  
1389 C CD  . GLU B 41  ? 0.8805 1.4568 1.0641 0.0409  0.1151  0.0537  39  GLU B CD  
1390 O OE1 . GLU B 41  ? 0.8732 1.4633 1.0706 0.0383  0.1027  0.0607  39  GLU B OE1 
1391 O OE2 . GLU B 41  ? 0.9079 1.5448 1.0993 0.0311  0.1283  0.0494  39  GLU B OE2 
1392 N N   . ASP B 42  ? 0.8650 1.2208 0.9864 0.1307  0.1140  0.0362  40  ASP B N   
1393 C CA  . ASP B 42  ? 0.9194 1.2532 1.0398 0.1713  0.1093  0.0329  40  ASP B CA  
1394 C C   . ASP B 42  ? 0.9573 1.2176 1.0446 0.1857  0.1114  0.0262  40  ASP B C   
1395 O O   . ASP B 42  ? 0.9328 1.1424 1.0002 0.1622  0.1086  0.0289  40  ASP B O   
1396 C CB  . ASP B 42  ? 0.9402 1.2531 1.0666 0.1705  0.0935  0.0431  40  ASP B CB  
1397 C CG  . ASP B 42  ? 0.9465 1.3008 1.0913 0.1382  0.0883  0.0519  40  ASP B CG  
1398 O OD1 . ASP B 42  ? 0.9314 1.2477 1.0685 0.1222  0.0778  0.0595  40  ASP B OD1 
1399 O OD2 . ASP B 42  ? 0.9983 1.4253 1.1644 0.1305  0.0942  0.0510  40  ASP B OD2 
1400 N N   . PHE B 43  ? 0.9781 1.2279 1.0569 0.2252  0.1136  0.0181  41  PHE B N   
1401 C CA  . PHE B 43  ? 1.0332 1.2038 1.0740 0.2382  0.1126  0.0123  41  PHE B CA  
1402 C C   . PHE B 43  ? 1.0029 1.1068 1.0278 0.2302  0.0974  0.0215  41  PHE B C   
1403 O O   . PHE B 43  ? 1.0142 1.0563 1.0110 0.2179  0.0947  0.0212  41  PHE B O   
1404 C CB  . PHE B 43  ? 1.1133 1.2806 1.1409 0.2844  0.1181  0.0002  41  PHE B CB  
1405 C CG  . PHE B 43  ? 1.2475 1.3241 1.2283 0.2958  0.1150  -0.0056 41  PHE B CG  
1406 C CD1 . PHE B 43  ? 1.3141 1.3313 1.2720 0.3185  0.1021  -0.0030 41  PHE B CD1 
1407 C CD2 . PHE B 43  ? 1.3066 1.3515 1.2623 0.2771  0.1226  -0.0116 41  PHE B CD2 
1408 C CE1 . PHE B 43  ? 1.3627 1.2915 1.2727 0.3212  0.0974  -0.0067 41  PHE B CE1 
1409 C CE2 . PHE B 43  ? 1.3434 1.3037 1.2538 0.2814  0.1177  -0.0158 41  PHE B CE2 
1410 C CZ  . PHE B 43  ? 1.3512 1.2531 1.2383 0.3023  0.1052  -0.0135 41  PHE B CZ  
1411 N N   . GLU B 44  ? 0.7806 0.8996 0.8221 0.2377  0.0873  0.0295  42  GLU B N   
1412 C CA  . GLU B 44  ? 0.7549 0.8201 0.7830 0.2274  0.0741  0.0390  42  GLU B CA  
1413 C C   . GLU B 44  ? 0.6706 0.7473 0.7131 0.1892  0.0712  0.0476  42  GLU B C   
1414 O O   . GLU B 44  ? 0.6646 0.7014 0.6967 0.1755  0.0629  0.0545  42  GLU B O   
1415 C CB  . GLU B 44  ? 0.7796 0.8485 0.8121 0.2542  0.0637  0.0437  42  GLU B CB  
1416 C CG  . GLU B 44  ? 0.8970 0.9102 0.8956 0.2901  0.0599  0.0381  42  GLU B CG  
1417 C CD  . GLU B 44  ? 1.0070 0.9350 0.9647 0.2751  0.0561  0.0387  42  GLU B CD  
1418 O OE1 . GLU B 44  ? 0.9802 0.8740 0.9289 0.2560  0.0462  0.0488  42  GLU B OE1 
1419 O OE2 . GLU B 44  ? 1.0088 0.9068 0.9424 0.2806  0.0631  0.0290  42  GLU B OE2 
1420 N N   . GLY B 45  ? 0.5741 0.7017 0.6358 0.1715  0.0787  0.0464  43  GLY B N   
1421 C CA  . GLY B 45  ? 0.4985 0.6299 0.5663 0.1367  0.0762  0.0528  43  GLY B CA  
1422 C C   . GLY B 45  ? 0.4683 0.5405 0.5163 0.1209  0.0707  0.0560  43  GLY B C   
1423 O O   . GLY B 45  ? 0.4144 0.4750 0.4653 0.1096  0.0629  0.0630  43  GLY B O   
1424 N N   . PRO B 46  ? 0.5327 0.5742 0.5615 0.1172  0.0752  0.0506  44  PRO B N   
1425 C CA  . PRO B 46  ? 0.5192 0.5193 0.5341 0.0975  0.0701  0.0538  44  PRO B CA  
1426 C C   . PRO B 46  ? 0.5074 0.4700 0.5143 0.0996  0.0612  0.0591  44  PRO B C   
1427 O O   . PRO B 46  ? 0.4962 0.4469 0.5039 0.0823  0.0562  0.0639  44  PRO B O   
1428 C CB  . PRO B 46  ? 0.5271 0.5042 0.5210 0.0978  0.0758  0.0464  44  PRO B CB  
1429 C CG  . PRO B 46  ? 0.5111 0.5325 0.5133 0.1061  0.0867  0.0401  44  PRO B CG  
1430 C CD  . PRO B 46  ? 0.5465 0.6010 0.5677 0.1272  0.0861  0.0413  44  PRO B CD  
1431 N N   . PRO B 47  ? 0.4959 0.4364 0.4905 0.1205  0.0592  0.0579  45  PRO B N   
1432 C CA  . PRO B 47  ? 0.5018 0.4035 0.4829 0.1176  0.0506  0.0641  45  PRO B CA  
1433 C C   . PRO B 47  ? 0.4708 0.3926 0.4678 0.1161  0.0452  0.0719  45  PRO B C   
1434 O O   . PRO B 47  ? 0.4540 0.3561 0.4453 0.1037  0.0400  0.0778  45  PRO B O   
1435 C CB  . PRO B 47  ? 0.5599 0.4215 0.5134 0.1401  0.0491  0.0601  45  PRO B CB  
1436 C CG  . PRO B 47  ? 0.5748 0.4679 0.5361 0.1631  0.0572  0.0516  45  PRO B CG  
1437 C CD  . PRO B 47  ? 0.5084 0.4480 0.4924 0.1460  0.0649  0.0496  45  PRO B CD  
1438 N N   . LEU B 48  ? 0.4489 0.4130 0.4651 0.1271  0.0466  0.0718  46  LEU B N   
1439 C CA  . LEU B 48  ? 0.4186 0.4072 0.4501 0.1213  0.0413  0.0787  46  LEU B CA  
1440 C C   . LEU B 48  ? 0.3933 0.3908 0.4329 0.0957  0.0418  0.0808  46  LEU B C   
1441 O O   . LEU B 48  ? 0.3834 0.3701 0.4208 0.0862  0.0372  0.0859  46  LEU B O   
1442 C CB  . LEU B 48  ? 0.3943 0.4331 0.4455 0.1361  0.0419  0.0779  46  LEU B CB  
1443 C CG  . LEU B 48  ? 0.4352 0.5048 0.5014 0.1288  0.0353  0.0847  46  LEU B CG  
1444 C CD1 . LEU B 48  ? 0.4453 0.4807 0.4969 0.1312  0.0264  0.0919  46  LEU B CD1 
1445 C CD2 . LEU B 48  ? 0.4178 0.5432 0.5046 0.1444  0.0348  0.0838  46  LEU B CD2 
1446 N N   . ALA B 49  ? 0.3039 0.3162 0.3483 0.0856  0.0473  0.0765  47  ALA B N   
1447 C CA  . ALA B 49  ? 0.3451 0.3631 0.3928 0.0645  0.0465  0.0778  47  ALA B CA  
1448 C C   . ALA B 49  ? 0.3229 0.3077 0.3606 0.0561  0.0435  0.0794  47  ALA B C   
1449 O O   . ALA B 49  ? 0.3348 0.3186 0.3740 0.0471  0.0403  0.0821  47  ALA B O   
1450 C CB  . ALA B 49  ? 0.2943 0.3271 0.3418 0.0554  0.0522  0.0735  47  ALA B CB  
1451 N N   . THR B 50  ? 0.4035 0.3623 0.4298 0.0608  0.0444  0.0775  48  THR B N   
1452 C CA  . THR B 50  ? 0.4212 0.3550 0.4390 0.0518  0.0415  0.0790  48  THR B CA  
1453 C C   . THR B 50  ? 0.4275 0.3531 0.4432 0.0511  0.0378  0.0846  48  THR B C   
1454 O O   . THR B 50  ? 0.3906 0.3193 0.4098 0.0413  0.0364  0.0866  48  THR B O   
1455 C CB  . THR B 50  ? 0.4615 0.3692 0.4632 0.0540  0.0426  0.0754  48  THR B CB  
1456 O OG1 . THR B 50  ? 0.6068 0.5083 0.6059 0.0409  0.0410  0.0742  48  THR B OG1 
1457 C CG2 . THR B 50  ? 0.4134 0.2911 0.3984 0.0589  0.0395  0.0778  48  THR B CG2 
1458 N N   . ARG B 51  ? 0.3833 0.3034 0.3937 0.0632  0.0363  0.0869  49  ARG B N   
1459 C CA  . ARG B 51  ? 0.4266 0.3399 0.4318 0.0627  0.0323  0.0933  49  ARG B CA  
1460 C C   . ARG B 51  ? 0.4001 0.3395 0.4185 0.0563  0.0318  0.0953  49  ARG B C   
1461 O O   . ARG B 51  ? 0.3724 0.3083 0.3871 0.0476  0.0310  0.0986  49  ARG B O   
1462 C CB  . ARG B 51  ? 0.4690 0.3710 0.4641 0.0812  0.0288  0.0952  49  ARG B CB  
1463 C CG  . ARG B 51  ? 0.5939 0.4776 0.5747 0.0810  0.0228  0.1029  49  ARG B CG  
1464 C CD  . ARG B 51  ? 0.8271 0.6782 0.7855 0.1002  0.0174  0.1044  49  ARG B CD  
1465 N NE  . ARG B 51  ? 0.8947 0.7605 0.8568 0.1165  0.0113  0.1086  49  ARG B NE  
1466 C CZ  . ARG B 51  ? 0.9695 0.8192 0.9166 0.1133  0.0043  0.1170  49  ARG B CZ  
1467 N NH1 . ARG B 51  ? 1.0026 0.8689 0.9539 0.1288  -0.0027 0.1210  49  ARG B NH1 
1468 N NH2 . ARG B 51  ? 1.0025 0.8244 0.9309 0.0928  0.0043  0.1218  49  ARG B NH2 
1469 N N   . LEU B 52  ? 0.3874 0.3528 0.4181 0.0593  0.0326  0.0930  50  LEU B N   
1470 C CA  . LEU B 52  ? 0.3437 0.3279 0.3806 0.0514  0.0310  0.0941  50  LEU B CA  
1471 C C   . LEU B 52  ? 0.3508 0.3292 0.3863 0.0400  0.0327  0.0913  50  LEU B C   
1472 O O   . LEU B 52  ? 0.3376 0.3164 0.3699 0.0351  0.0317  0.0921  50  LEU B O   
1473 C CB  . LEU B 52  ? 0.3133 0.3270 0.3607 0.0526  0.0305  0.0927  50  LEU B CB  
1474 C CG  . LEU B 52  ? 0.3979 0.4293 0.4515 0.0683  0.0282  0.0948  50  LEU B CG  
1475 C CD1 . LEU B 52  ? 0.2193 0.2931 0.2874 0.0662  0.0286  0.0933  50  LEU B CD1 
1476 C CD2 . LEU B 52  ? 0.3172 0.3411 0.3640 0.0740  0.0216  0.1011  50  LEU B CD2 
1477 N N   . LEU B 53  ? 0.3783 0.3502 0.4143 0.0377  0.0348  0.0877  51  LEU B N   
1478 C CA  . LEU B 53  ? 0.3495 0.3169 0.3839 0.0309  0.0345  0.0849  51  LEU B CA  
1479 C C   . LEU B 53  ? 0.3489 0.3112 0.3825 0.0296  0.0349  0.0859  51  LEU B C   
1480 O O   . LEU B 53  ? 0.3362 0.3022 0.3693 0.0285  0.0346  0.0840  51  LEU B O   
1481 C CB  . LEU B 53  ? 0.3435 0.3046 0.3762 0.0289  0.0351  0.0818  51  LEU B CB  
1482 C CG  . LEU B 53  ? 0.3506 0.3199 0.3813 0.0246  0.0354  0.0801  51  LEU B CG  
1483 C CD1 . LEU B 53  ? 0.3260 0.2885 0.3523 0.0234  0.0375  0.0775  51  LEU B CD1 
1484 C CD2 . LEU B 53  ? 0.2557 0.2191 0.2778 0.0170  0.0314  0.0793  51  LEU B CD2 
1485 N N   . ALA B 54  ? 0.3218 0.2751 0.3531 0.0290  0.0356  0.0881  52  ALA B N   
1486 C CA  . ALA B 54  ? 0.3279 0.2808 0.3572 0.0230  0.0364  0.0907  52  ALA B CA  
1487 C C   . ALA B 54  ? 0.3331 0.2962 0.3613 0.0223  0.0379  0.0925  52  ALA B C   
1488 O O   . ALA B 54  ? 0.3932 0.3693 0.4252 0.0200  0.0403  0.0905  52  ALA B O   
1489 C CB  . ALA B 54  ? 0.3018 0.2347 0.3193 0.0198  0.0353  0.0946  52  ALA B CB  
1490 N N   . HIS B 55  ? 0.4008 0.3599 0.4232 0.0256  0.0365  0.0959  53  HIS B N   
1491 C CA  . HIS B 55  ? 0.3837 0.3498 0.4008 0.0237  0.0373  0.0978  53  HIS B CA  
1492 C C   . HIS B 55  ? 0.3775 0.3543 0.3972 0.0251  0.0386  0.0920  53  HIS B C   
1493 O O   . HIS B 55  ? 0.3913 0.3757 0.4074 0.0235  0.0423  0.0902  53  HIS B O   
1494 C CB  . HIS B 55  ? 0.3745 0.3360 0.3846 0.0281  0.0329  0.1028  53  HIS B CB  
1495 C CG  . HIS B 55  ? 0.3722 0.3360 0.3714 0.0238  0.0329  0.1060  53  HIS B CG  
1496 N ND1 . HIS B 55  ? 0.3596 0.3319 0.3563 0.0248  0.0300  0.1051  53  HIS B ND1 
1497 C CD2 . HIS B 55  ? 0.3666 0.3264 0.3543 0.0158  0.0357  0.1098  53  HIS B CD2 
1498 C CE1 . HIS B 55  ? 0.3849 0.3557 0.3680 0.0197  0.0309  0.1080  53  HIS B CE1 
1499 N NE2 . HIS B 55  ? 0.4251 0.3894 0.4028 0.0141  0.0350  0.1110  53  HIS B NE2 
1500 N N   . LYS B 56  ? 0.3224 0.2980 0.3442 0.0277  0.0357  0.0889  54  LYS B N   
1501 C CA  . LYS B 56  ? 0.3549 0.3287 0.3702 0.0281  0.0347  0.0835  54  LYS B CA  
1502 C C   . LYS B 56  ? 0.3611 0.3356 0.3785 0.0326  0.0371  0.0784  54  LYS B C   
1503 O O   . LYS B 56  ? 0.3754 0.3484 0.3842 0.0374  0.0381  0.0735  54  LYS B O   
1504 C CB  . LYS B 56  ? 0.3219 0.2913 0.3348 0.0251  0.0304  0.0823  54  LYS B CB  
1505 C CG  . LYS B 56  ? 0.3757 0.3561 0.3914 0.0222  0.0278  0.0868  54  LYS B CG  
1506 C CD  . LYS B 56  ? 0.3269 0.3090 0.3312 0.0177  0.0245  0.0876  54  LYS B CD  
1507 C CE  . LYS B 56  ? 0.3265 0.3267 0.3355 0.0135  0.0196  0.0917  54  LYS B CE  
1508 N NZ  . LYS B 56  ? 0.3542 0.3581 0.3524 0.0089  0.0148  0.0942  54  LYS B NZ  
1509 N N   . ILE B 57  ? 0.3602 0.3364 0.3872 0.0327  0.0370  0.0789  55  ILE B N   
1510 C CA  . ILE B 57  ? 0.3586 0.3411 0.3908 0.0379  0.0370  0.0749  55  ILE B CA  
1511 C C   . ILE B 57  ? 0.3508 0.3543 0.3880 0.0390  0.0426  0.0742  55  ILE B C   
1512 O O   . ILE B 57  ? 0.3231 0.3411 0.3655 0.0474  0.0436  0.0693  55  ILE B O   
1513 C CB  . ILE B 57  ? 0.3567 0.3386 0.3970 0.0344  0.0348  0.0767  55  ILE B CB  
1514 C CG1 . ILE B 57  ? 0.4221 0.3867 0.4555 0.0340  0.0303  0.0757  55  ILE B CG1 
1515 C CG2 . ILE B 57  ? 0.3031 0.3021 0.3529 0.0382  0.0341  0.0742  55  ILE B CG2 
1516 C CD1 . ILE B 57  ? 0.3030 0.2633 0.3393 0.0297  0.0289  0.0772  55  ILE B CD1 
1517 N N   . GLN B 58  ? 0.3679 0.3752 0.4035 0.0305  0.0460  0.0795  56  GLN B N   
1518 C CA  . GLN B 58  ? 0.3712 0.3998 0.4087 0.0258  0.0524  0.0806  56  GLN B CA  
1519 C C   . GLN B 58  ? 0.3742 0.4052 0.4000 0.0300  0.0564  0.0775  56  GLN B C   
1520 O O   . GLN B 58  ? 0.3703 0.4198 0.3941 0.0249  0.0632  0.0784  56  GLN B O   
1521 C CB  . GLN B 58  ? 0.4064 0.4299 0.4399 0.0115  0.0527  0.0891  56  GLN B CB  
1522 C CG  . GLN B 58  ? 0.4348 0.4550 0.4746 0.0048  0.0494  0.0914  56  GLN B CG  
1523 C CD  . GLN B 58  ? 0.5223 0.5255 0.5486 -0.0096 0.0484  0.0994  56  GLN B CD  
1524 O OE1 . GLN B 58  ? 0.5669 0.5688 0.5925 -0.0209 0.0466  0.1018  56  GLN B OE1 
1525 N NE2 . GLN B 58  ? 0.4577 0.4449 0.4694 -0.0101 0.0480  0.1040  56  GLN B NE2 
1526 N N   . SER B 59  ? 0.3943 0.4066 0.4095 0.0367  0.0524  0.0740  57  SER B N   
1527 C CA  . SER B 59  ? 0.4253 0.4338 0.4237 0.0398  0.0550  0.0700  57  SER B CA  
1528 C C   . SER B 59  ? 0.4358 0.4622 0.4332 0.0513  0.0620  0.0613  57  SER B C   
1529 O O   . SER B 59  ? 0.4416 0.4715 0.4459 0.0635  0.0605  0.0555  57  SER B O   
1530 C CB  . SER B 59  ? 0.3966 0.3796 0.3803 0.0413  0.0477  0.0678  57  SER B CB  
1531 O OG  . SER B 59  ? 0.4852 0.4600 0.4477 0.0438  0.0493  0.0627  57  SER B OG  
1532 N N   . PRO B 60  ? 0.4744 0.5115 0.4605 0.0493  0.0693  0.0599  58  PRO B N   
1533 C CA  . PRO B 60  ? 0.4868 0.5389 0.4656 0.0638  0.0772  0.0492  58  PRO B CA  
1534 C C   . PRO B 60  ? 0.5047 0.5236 0.4612 0.0793  0.0717  0.0395  58  PRO B C   
1535 O O   . PRO B 60  ? 0.5389 0.5626 0.4858 0.0974  0.0767  0.0286  58  PRO B O   
1536 C CB  . PRO B 60  ? 0.4326 0.4950 0.3970 0.0533  0.0853  0.0515  58  PRO B CB  
1537 C CG  . PRO B 60  ? 0.4413 0.4965 0.4083 0.0339  0.0809  0.0646  58  PRO B CG  
1538 C CD  . PRO B 60  ? 0.4773 0.5091 0.4523 0.0347  0.0697  0.0681  58  PRO B CD  
1539 N N   . GLN B 61  ? 0.4796 0.4644 0.4235 0.0714  0.0617  0.0432  59  GLN B N   
1540 C CA  . GLN B 61  ? 0.5105 0.4572 0.4266 0.0800  0.0548  0.0354  59  GLN B CA  
1541 C C   . GLN B 61  ? 0.5107 0.4426 0.4325 0.0878  0.0471  0.0341  59  GLN B C   
1542 O O   . GLN B 61  ? 0.4936 0.4190 0.4246 0.0756  0.0407  0.0416  59  GLN B O   
1543 C CB  . GLN B 61  ? 0.5375 0.4584 0.4326 0.0633  0.0476  0.0399  59  GLN B CB  
1544 C CG  . GLN B 61  ? 0.5326 0.4605 0.4132 0.0565  0.0529  0.0404  59  GLN B CG  
1545 C CD  . GLN B 61  ? 0.5342 0.4456 0.3999 0.0386  0.0434  0.0471  59  GLN B CD  
1546 O OE1 . GLN B 61  ? 0.5713 0.4525 0.4136 0.0341  0.0349  0.0439  59  GLN B OE1 
1547 N NE2 . GLN B 61  ? 0.5235 0.4543 0.4002 0.0279  0.0440  0.0567  59  GLN B NE2 
1548 N N   . GLU B 62  ? 0.5086 0.4378 0.4249 0.1099  0.0479  0.0247  60  GLU B N   
1549 C CA  . GLU B 62  ? 0.5162 0.4420 0.4434 0.1196  0.0413  0.0246  60  GLU B CA  
1550 C C   . GLU B 62  ? 0.5196 0.4037 0.4294 0.1073  0.0294  0.0292  60  GLU B C   
1551 O O   . GLU B 62  ? 0.5143 0.4049 0.4414 0.0997  0.0256  0.0356  60  GLU B O   
1552 C CB  . GLU B 62  ? 0.5598 0.4828 0.4767 0.1498  0.0413  0.0128  60  GLU B CB  
1553 C CG  . GLU B 62  ? 0.6304 0.5410 0.5510 0.1615  0.0309  0.0131  60  GLU B CG  
1554 C CD  . GLU B 62  ? 0.7521 0.6586 0.6608 0.1966  0.0288  0.0012  60  GLU B CD  
1555 O OE1 . GLU B 62  ? 0.8378 0.6983 0.7059 0.2101  0.0254  -0.0076 60  GLU B OE1 
1556 O OE2 . GLU B 62  ? 0.7042 0.6498 0.6412 0.2113  0.0286  0.0008  60  GLU B OE2 
1557 N N   . TRP B 63  ? 0.5219 0.3651 0.3958 0.1015  0.0240  0.0263  61  TRP B N   
1558 C CA  . TRP B 63  ? 0.5495 0.3530 0.4008 0.0864  0.0127  0.0302  61  TRP B CA  
1559 C C   . TRP B 63  ? 0.5116 0.3372 0.3849 0.0616  0.0130  0.0412  61  TRP B C   
1560 O O   . TRP B 63  ? 0.4890 0.3040 0.3614 0.0504  0.0070  0.0460  61  TRP B O   
1561 C CB  . TRP B 63  ? 0.5605 0.3140 0.3629 0.0835  0.0064  0.0240  61  TRP B CB  
1562 C CG  . TRP B 63  ? 0.6265 0.3415 0.4011 0.0599  -0.0051 0.0290  61  TRP B CG  
1563 C CD1 . TRP B 63  ? 0.5723 0.2689 0.3214 0.0368  -0.0099 0.0312  61  TRP B CD1 
1564 C CD2 . TRP B 63  ? 0.6669 0.3518 0.4272 0.0564  -0.0146 0.0316  61  TRP B CD2 
1565 N NE1 . TRP B 63  ? 0.6564 0.3169 0.3777 0.0171  -0.0209 0.0351  61  TRP B NE1 
1566 C CE2 . TRP B 63  ? 0.6279 0.2792 0.3546 0.0284  -0.0236 0.0357  61  TRP B CE2 
1567 C CE3 . TRP B 63  ? 0.6817 0.3657 0.4526 0.0726  -0.0172 0.0315  61  TRP B CE3 
1568 C CZ2 . TRP B 63  ? 0.6391 0.2556 0.3415 0.0142  -0.0336 0.0400  61  TRP B CZ2 
1569 C CZ3 . TRP B 63  ? 0.6456 0.2910 0.3908 0.0609  -0.0282 0.0356  61  TRP B CZ3 
1570 C CH2 . TRP B 63  ? 0.6405 0.2557 0.3540 0.0303  -0.0351 0.0404  61  TRP B CH2 
1571 N N   . GLU B 64  ? 0.4782 0.3361 0.3711 0.0554  0.0202  0.0450  62  GLU B N   
1572 C CA  . GLU B 64  ? 0.4399 0.3238 0.3580 0.0404  0.0213  0.0545  62  GLU B CA  
1573 C C   . GLU B 64  ? 0.4264 0.3286 0.3714 0.0444  0.0233  0.0578  62  GLU B C   
1574 O O   . GLU B 64  ? 0.4393 0.3440 0.3924 0.0345  0.0206  0.0628  62  GLU B O   
1575 C CB  . GLU B 64  ? 0.3900 0.2981 0.3181 0.0371  0.0272  0.0578  62  GLU B CB  
1576 C CG  . GLU B 64  ? 0.3371 0.2670 0.2866 0.0265  0.0269  0.0671  62  GLU B CG  
1577 C CD  . GLU B 64  ? 0.3743 0.3174 0.3234 0.0222  0.0287  0.0714  62  GLU B CD  
1578 O OE1 . GLU B 64  ? 0.3397 0.2856 0.2850 0.0124  0.0229  0.0759  62  GLU B OE1 
1579 O OE2 . GLU B 64  ? 0.3914 0.3423 0.3405 0.0278  0.0353  0.0698  62  GLU B OE2 
1580 N N   . ALA B 65  ? 0.4457 0.3634 0.4035 0.0583  0.0282  0.0544  63  ALA B N   
1581 C CA  . ALA B 65  ? 0.4239 0.3604 0.4053 0.0605  0.0293  0.0574  63  ALA B CA  
1582 C C   . ALA B 65  ? 0.4318 0.3460 0.4039 0.0641  0.0213  0.0558  63  ALA B C   
1583 O O   . ALA B 65  ? 0.4479 0.3667 0.4314 0.0580  0.0196  0.0600  63  ALA B O   
1584 C CB  . ALA B 65  ? 0.3838 0.3495 0.3806 0.0714  0.0359  0.0543  63  ALA B CB  
1585 N N   . ILE B 66  ? 0.4431 0.3290 0.3901 0.0750  0.0160  0.0495  64  ILE B N   
1586 C CA  . ILE B 66  ? 0.4463 0.3005 0.3746 0.0790  0.0061  0.0484  64  ILE B CA  
1587 C C   . ILE B 66  ? 0.4521 0.2866 0.3678 0.0573  0.0015  0.0544  64  ILE B C   
1588 O O   . ILE B 66  ? 0.4801 0.3167 0.4030 0.0518  -0.0009 0.0582  64  ILE B O   
1589 C CB  . ILE B 66  ? 0.4748 0.2938 0.3707 0.0977  0.0003  0.0399  64  ILE B CB  
1590 C CG1 . ILE B 66  ? 0.5423 0.3923 0.4571 0.1233  0.0050  0.0335  64  ILE B CG1 
1591 C CG2 . ILE B 66  ? 0.4295 0.1992 0.2925 0.0981  -0.0130 0.0402  64  ILE B CG2 
1592 C CD1 . ILE B 66  ? 0.5673 0.4409 0.5061 0.1313  0.0014  0.0360  64  ILE B CD1 
1593 N N   . GLN B 67  ? 0.4824 0.3081 0.3841 0.0431  0.0018  0.0556  65  GLN B N   
1594 C CA  . GLN B 67  ? 0.4519 0.2749 0.3481 0.0205  -0.0006 0.0615  65  GLN B CA  
1595 C C   . GLN B 67  ? 0.4343 0.2929 0.3625 0.0150  0.0056  0.0668  65  GLN B C   
1596 O O   . GLN B 67  ? 0.4462 0.3033 0.3709 0.0021  0.0040  0.0701  65  GLN B O   
1597 C CB  . GLN B 67  ? 0.4574 0.2786 0.3402 0.0064  -0.0012 0.0623  65  GLN B CB  
1598 C CG  . GLN B 67  ? 0.5052 0.2793 0.3445 0.0052  -0.0092 0.0572  65  GLN B CG  
1599 C CD  . GLN B 67  ? 0.5186 0.2920 0.3429 -0.0128 -0.0112 0.0586  65  GLN B CD  
1600 O OE1 . GLN B 67  ? 0.5907 0.3520 0.3952 -0.0368 -0.0175 0.0624  65  GLN B OE1 
1601 N NE2 . GLN B 67  ? 0.4793 0.2651 0.3095 -0.0035 -0.0065 0.0554  65  GLN B NE2 
1602 N N   . ALA B 68  ? 0.4093 0.2979 0.3635 0.0218  0.0127  0.0676  66  ALA B N   
1603 C CA  . ALA B 68  ? 0.3868 0.3006 0.3655 0.0199  0.0178  0.0716  66  ALA B CA  
1604 C C   . ALA B 68  ? 0.3850 0.2953 0.3690 0.0240  0.0166  0.0713  66  ALA B C   
1605 O O   . ALA B 68  ? 0.3796 0.2976 0.3709 0.0183  0.0187  0.0737  66  ALA B O   
1606 C CB  . ALA B 68  ? 0.3170 0.2525 0.3132 0.0254  0.0236  0.0732  66  ALA B CB  
1607 N N   . LEU B 69  ? 0.3940 0.2964 0.3752 0.0356  0.0134  0.0680  67  LEU B N   
1608 C CA  . LEU B 69  ? 0.4122 0.3125 0.3970 0.0393  0.0097  0.0682  67  LEU B CA  
1609 C C   . LEU B 69  ? 0.4337 0.3054 0.3948 0.0318  0.0026  0.0690  67  LEU B C   
1610 O O   . LEU B 69  ? 0.4054 0.2750 0.3667 0.0283  0.0004  0.0708  67  LEU B O   
1611 C CB  . LEU B 69  ? 0.4120 0.3194 0.4025 0.0557  0.0069  0.0645  67  LEU B CB  
1612 C CG  . LEU B 69  ? 0.4476 0.3899 0.4630 0.0591  0.0138  0.0646  67  LEU B CG  
1613 C CD1 . LEU B 69  ? 0.4072 0.3631 0.4260 0.0766  0.0130  0.0593  67  LEU B CD1 
1614 C CD2 . LEU B 69  ? 0.3321 0.2886 0.3619 0.0515  0.0139  0.0682  67  LEU B CD2 
1615 N N   . THR B 70  ? 0.4271 0.2740 0.3635 0.0271  -0.0015 0.0681  68  THR B N   
1616 C CA  . THR B 70  ? 0.4629 0.2825 0.3720 0.0117  -0.0072 0.0707  68  THR B CA  
1617 C C   . THR B 70  ? 0.4572 0.2989 0.3758 -0.0064 -0.0003 0.0745  68  THR B C   
1618 O O   . THR B 70  ? 0.4503 0.2830 0.3561 -0.0180 -0.0019 0.0768  68  THR B O   
1619 C CB  . THR B 70  ? 0.5339 0.3171 0.4082 0.0070  -0.0142 0.0691  68  THR B CB  
1620 O OG1 . THR B 70  ? 0.6137 0.3772 0.4782 0.0294  -0.0196 0.0637  68  THR B OG1 
1621 C CG2 . THR B 70  ? 0.5276 0.2755 0.3661 -0.0118 -0.0220 0.0727  68  THR B CG2 
1622 N N   . VAL B 71  ? 0.3983 0.2685 0.3360 -0.0084 0.0069  0.0750  69  VAL B N   
1623 C CA  . VAL B 71  ? 0.3896 0.2887 0.3419 -0.0180 0.0140  0.0774  69  VAL B CA  
1624 C C   . VAL B 71  ? 0.3646 0.2720 0.3299 -0.0116 0.0181  0.0769  69  VAL B C   
1625 O O   . VAL B 71  ? 0.3789 0.2908 0.3392 -0.0206 0.0209  0.0775  69  VAL B O   
1626 C CB  . VAL B 71  ? 0.3951 0.3242 0.3677 -0.0149 0.0193  0.0782  69  VAL B CB  
1627 C CG1 . VAL B 71  ? 0.3396 0.2998 0.3281 -0.0178 0.0263  0.0795  69  VAL B CG1 
1628 C CG2 . VAL B 71  ? 0.3175 0.2415 0.2754 -0.0255 0.0148  0.0790  69  VAL B CG2 
1629 N N   . LEU B 72  ? 0.3645 0.2762 0.3451 0.0020  0.0191  0.0757  70  LEU B N   
1630 C CA  . LEU B 72  ? 0.3269 0.2406 0.3150 0.0061  0.0208  0.0751  70  LEU B CA  
1631 C C   . LEU B 72  ? 0.3660 0.2598 0.3364 0.0007  0.0151  0.0752  70  LEU B C   
1632 O O   . LEU B 72  ? 0.3468 0.2418 0.3141 -0.0042 0.0182  0.0748  70  LEU B O   
1633 C CB  . LEU B 72  ? 0.3034 0.2224 0.3051 0.0163  0.0200  0.0747  70  LEU B CB  
1634 C CG  . LEU B 72  ? 0.3626 0.2828 0.3701 0.0172  0.0198  0.0746  70  LEU B CG  
1635 C CD1 . LEU B 72  ? 0.3104 0.2337 0.3196 0.0152  0.0264  0.0746  70  LEU B CD1 
1636 C CD2 . LEU B 72  ? 0.2133 0.1451 0.2334 0.0226  0.0184  0.0750  70  LEU B CD2 
1637 N N   . GLU B 73  ? 0.4053 0.2788 0.3623 0.0044  0.0062  0.0751  71  GLU B N   
1638 C CA  . GLU B 73  ? 0.4778 0.3258 0.4123 0.0006  -0.0024 0.0762  71  GLU B CA  
1639 C C   . GLU B 73  ? 0.4933 0.3335 0.4082 -0.0178 0.0002  0.0783  71  GLU B C   
1640 O O   . GLU B 73  ? 0.5065 0.3404 0.4115 -0.0239 -0.0004 0.0790  71  GLU B O   
1641 C CB  . GLU B 73  ? 0.5122 0.3329 0.4281 0.0096  -0.0135 0.0756  71  GLU B CB  
1642 C CG  . GLU B 73  ? 0.5975 0.3850 0.4847 0.0080  -0.0255 0.0778  71  GLU B CG  
1643 C CD  . GLU B 73  ? 0.7127 0.4670 0.5770 0.0225  -0.0381 0.0766  71  GLU B CD  
1644 O OE1 . GLU B 73  ? 0.6297 0.3827 0.4950 0.0305  -0.0363 0.0733  71  GLU B OE1 
1645 O OE2 . GLU B 73  ? 0.7411 0.4681 0.5836 0.0277  -0.0504 0.0784  71  GLU B OE2 
1646 N N   . THR B 74  ? 0.4898 0.3317 0.3971 -0.0282 0.0027  0.0792  72  THR B N   
1647 C CA  . THR B 74  ? 0.5128 0.3561 0.4024 -0.0496 0.0060  0.0816  72  THR B CA  
1648 C C   . THR B 74  ? 0.5157 0.3929 0.4226 -0.0524 0.0182  0.0800  72  THR B C   
1649 O O   . THR B 74  ? 0.5602 0.4359 0.4507 -0.0661 0.0208  0.0809  72  THR B O   
1650 C CB  . THR B 74  ? 0.5363 0.3829 0.4181 -0.0621 0.0058  0.0831  72  THR B CB  
1651 O OG1 . THR B 74  ? 0.5478 0.3558 0.4078 -0.0570 -0.0054 0.0830  72  THR B OG1 
1652 C CG2 . THR B 74  ? 0.5282 0.3792 0.3888 -0.0894 0.0081  0.0865  72  THR B CG2 
1653 N N   . CYS B 75  ? 0.4096 0.3151 0.3455 -0.0393 0.0255  0.0775  73  CYS B N   
1654 C CA  . CYS B 75  ? 0.3925 0.3262 0.3416 -0.0368 0.0366  0.0747  73  CYS B CA  
1655 C C   . CYS B 75  ? 0.3957 0.3140 0.3386 -0.0313 0.0368  0.0723  73  CYS B C   
1656 O O   . CYS B 75  ? 0.3734 0.3017 0.3113 -0.0340 0.0446  0.0693  73  CYS B O   
1657 C CB  . CYS B 75  ? 0.4111 0.3698 0.3864 -0.0220 0.0417  0.0733  73  CYS B CB  
1658 S SG  . CYS B 75  ? 0.3887 0.3724 0.3752 -0.0261 0.0412  0.0760  73  CYS B SG  
1659 N N   . MET B 76  ? 0.3555 0.2542 0.3003 -0.0227 0.0288  0.0728  74  MET B N   
1660 C CA  . MET B 76  ? 0.3925 0.2753 0.3279 -0.0218 0.0257  0.0715  74  MET B CA  
1661 C C   . MET B 76  ? 0.4256 0.2896 0.3327 -0.0358 0.0216  0.0732  74  MET B C   
1662 O O   . MET B 76  ? 0.4303 0.2872 0.3252 -0.0393 0.0233  0.0712  74  MET B O   
1663 C CB  . MET B 76  ? 0.3922 0.2664 0.3369 -0.0126 0.0166  0.0726  74  MET B CB  
1664 C CG  . MET B 76  ? 0.3936 0.2803 0.3579 -0.0036 0.0209  0.0711  74  MET B CG  
1665 S SD  . MET B 76  ? 0.4089 0.2920 0.3665 -0.0030 0.0289  0.0669  74  MET B SD  
1666 C CE  . MET B 76  ? 0.4010 0.2659 0.3470 -0.0092 0.0184  0.0675  74  MET B CE  
1667 N N   . LYS B 77  ? 0.4857 0.3373 0.3771 -0.0455 0.0159  0.0769  75  LYS B N   
1668 C CA  . LYS B 77  ? 0.5536 0.3791 0.4112 -0.0607 0.0097  0.0801  75  LYS B CA  
1669 C C   . LYS B 77  ? 0.5613 0.4042 0.4076 -0.0775 0.0219  0.0790  75  LYS B C   
1670 O O   . LYS B 77  ? 0.6169 0.4411 0.4324 -0.0937 0.0192  0.0816  75  LYS B O   
1671 C CB  . LYS B 77  ? 0.5471 0.3431 0.3829 -0.0661 -0.0022 0.0847  75  LYS B CB  
1672 C CG  . LYS B 77  ? 0.6005 0.3715 0.4339 -0.0494 -0.0169 0.0856  75  LYS B CG  
1673 C CD  . LYS B 77  ? 0.7831 0.5136 0.5842 -0.0522 -0.0300 0.0892  75  LYS B CD  
1674 C CE  . LYS B 77  ? 0.8257 0.5332 0.6217 -0.0316 -0.0456 0.0896  75  LYS B CE  
1675 N NZ  . LYS B 77  ? 0.9651 0.6247 0.7238 -0.0291 -0.0597 0.0921  75  LYS B NZ  
1676 N N   . SER B 78  ? 0.5088 0.3893 0.3781 -0.0745 0.0345  0.0757  76  SER B N   
1677 C CA  . SER B 78  ? 0.5580 0.4671 0.4218 -0.0876 0.0476  0.0736  76  SER B CA  
1678 C C   . SER B 78  ? 0.5828 0.5035 0.4531 -0.0748 0.0577  0.0665  76  SER B C   
1679 O O   . SER B 78  ? 0.5689 0.4747 0.4481 -0.0588 0.0537  0.0641  76  SER B O   
1680 C CB  . SER B 78  ? 0.5635 0.5128 0.4480 -0.0906 0.0548  0.0738  76  SER B CB  
1681 O OG  . SER B 78  ? 0.5849 0.5765 0.4907 -0.0789 0.0692  0.0676  76  SER B OG  
1682 N N   . CYS B 79  ? 0.6338 0.5802 0.4962 -0.0832 0.0707  0.0628  77  CYS B N   
1683 C CA  . CYS B 79  ? 0.6385 0.5799 0.4891 -0.0763 0.0784  0.0558  77  CYS B CA  
1684 C C   . CYS B 79  ? 0.6167 0.5639 0.4860 -0.0499 0.0842  0.0481  77  CYS B C   
1685 O O   . CYS B 79  ? 0.6141 0.5353 0.4677 -0.0441 0.0834  0.0436  77  CYS B O   
1686 C CB  . CYS B 79  ? 0.6751 0.6442 0.5087 -0.0923 0.0924  0.0530  77  CYS B CB  
1687 S SG  . CYS B 79  ? 0.7467 0.6738 0.5332 -0.1178 0.0845  0.0580  77  CYS B SG  
1688 N N   . GLY B 80  ? 0.5502 0.5309 0.4472 -0.0359 0.0906  0.0461  78  GLY B N   
1689 C CA  . GLY B 80  ? 0.5934 0.5815 0.5015 -0.0100 0.0984  0.0380  78  GLY B CA  
1690 C C   . GLY B 80  ? 0.5927 0.5362 0.4917 0.0009  0.0901  0.0364  78  GLY B C   
1691 O O   . GLY B 80  ? 0.5951 0.5194 0.5019 -0.0013 0.0781  0.0424  78  GLY B O   
1692 N N   . LYS B 81  ? 0.6867 0.6180 0.5706 0.0148  0.0975  0.0274  79  LYS B N   
1693 C CA  . LYS B 81  ? 0.6929 0.5786 0.5607 0.0208  0.0897  0.0253  79  LYS B CA  
1694 C C   . LYS B 81  ? 0.6431 0.5217 0.5256 0.0398  0.0867  0.0256  79  LYS B C   
1695 O O   . LYS B 81  ? 0.6215 0.4691 0.4999 0.0366  0.0761  0.0292  79  LYS B O   
1696 C CB  . LYS B 81  ? 0.7046 0.5699 0.5400 0.0252  0.0978  0.0150  79  LYS B CB  
1697 C CG  . LYS B 81  ? 0.8209 0.6460 0.6387 0.0415  0.0954  0.0089  79  LYS B CG  
1698 C CD  . LYS B 81  ? 0.9023 0.6811 0.6890 0.0257  0.0852  0.0089  79  LYS B CD  
1699 C CE  . LYS B 81  ? 0.9725 0.7136 0.7209 0.0385  0.0913  -0.0035 79  LYS B CE  
1700 N NZ  . LYS B 81  ? 0.9453 0.6558 0.6881 0.0561  0.0876  -0.0057 79  LYS B NZ  
1701 N N   . ARG B 82  ? 0.5723 0.4833 0.4724 0.0574  0.0951  0.0229  80  ARG B N   
1702 C CA  . ARG B 82  ? 0.5912 0.4945 0.5026 0.0756  0.0910  0.0244  80  ARG B CA  
1703 C C   . ARG B 82  ? 0.5451 0.4457 0.4745 0.0638  0.0794  0.0349  80  ARG B C   
1704 O O   . ARG B 82  ? 0.5835 0.4518 0.5058 0.0641  0.0714  0.0377  80  ARG B O   
1705 C CB  . ARG B 82  ? 0.5862 0.5313 0.5148 0.0984  0.1007  0.0201  80  ARG B CB  
1706 C CG  . ARG B 82  ? 0.7031 0.6472 0.6118 0.1199  0.1127  0.0073  80  ARG B CG  
1707 C CD  . ARG B 82  ? 0.7842 0.7716 0.7123 0.1493  0.1203  0.0027  80  ARG B CD  
1708 N NE  . ARG B 82  ? 0.8320 0.8819 0.7957 0.1383  0.1216  0.0096  80  ARG B NE  
1709 C CZ  . ARG B 82  ? 0.8844 0.9665 0.8734 0.1536  0.1185  0.0133  80  ARG B CZ  
1710 N NH1 . ARG B 82  ? 0.8944 0.9489 0.8762 0.1823  0.1133  0.0113  80  ARG B NH1 
1711 N NH2 . ARG B 82  ? 0.8514 0.9889 0.8686 0.1385  0.1190  0.0195  80  ARG B NH2 
1712 N N   . PHE B 83  ? 0.4719 0.4014 0.4185 0.0494  0.0782  0.0405  81  PHE B N   
1713 C CA  . PHE B 83  ? 0.4348 0.3608 0.3948 0.0394  0.0681  0.0488  81  PHE B CA  
1714 C C   . PHE B 83  ? 0.4293 0.3232 0.3771 0.0271  0.0587  0.0515  81  PHE B C   
1715 O O   . PHE B 83  ? 0.3915 0.2736 0.3451 0.0267  0.0517  0.0555  81  PHE B O   
1716 C CB  . PHE B 83  ? 0.4061 0.3635 0.3802 0.0278  0.0683  0.0532  81  PHE B CB  
1717 C CG  . PHE B 83  ? 0.4302 0.3834 0.4155 0.0220  0.0591  0.0599  81  PHE B CG  
1718 C CD1 . PHE B 83  ? 0.3476 0.3072 0.3470 0.0326  0.0574  0.0623  81  PHE B CD1 
1719 C CD2 . PHE B 83  ? 0.2802 0.2187 0.2584 0.0085  0.0516  0.0633  81  PHE B CD2 
1720 C CE1 . PHE B 83  ? 0.2977 0.2533 0.3045 0.0277  0.0505  0.0673  81  PHE B CE1 
1721 C CE2 . PHE B 83  ? 0.2711 0.2060 0.2578 0.0071  0.0442  0.0677  81  PHE B CE2 
1722 C CZ  . PHE B 83  ? 0.3101 0.2542 0.3112 0.0161  0.0446  0.0692  81  PHE B CZ  
1723 N N   . HIS B 84  ? 0.4382 0.3203 0.3681 0.0170  0.0585  0.0491  82  HIS B N   
1724 C CA  . HIS B 84  ? 0.4297 0.2851 0.3477 0.0069  0.0484  0.0512  82  HIS B CA  
1725 C C   . HIS B 84  ? 0.4307 0.2611 0.3402 0.0120  0.0457  0.0496  82  HIS B C   
1726 O O   . HIS B 84  ? 0.4345 0.2568 0.3478 0.0042  0.0365  0.0541  82  HIS B O   
1727 C CB  . HIS B 84  ? 0.4412 0.2847 0.3360 -0.0041 0.0481  0.0487  82  HIS B CB  
1728 C CG  . HIS B 84  ? 0.3782 0.2353 0.2734 -0.0148 0.0467  0.0526  82  HIS B CG  
1729 N ND1 . HIS B 84  ? 0.4762 0.3277 0.3485 -0.0257 0.0492  0.0509  82  HIS B ND1 
1730 C CD2 . HIS B 84  ? 0.4213 0.2910 0.3310 -0.0180 0.0420  0.0583  82  HIS B CD2 
1731 C CE1 . HIS B 84  ? 0.4553 0.3141 0.3268 -0.0363 0.0459  0.0562  82  HIS B CE1 
1732 N NE2 . HIS B 84  ? 0.4586 0.3262 0.3517 -0.0312 0.0410  0.0604  82  HIS B NE2 
1733 N N   . ASP B 85  ? 0.4948 0.3119 0.3889 0.0243  0.0533  0.0428  83  ASP B N   
1734 C CA  . ASP B 85  ? 0.5308 0.3130 0.4069 0.0291  0.0500  0.0411  83  ASP B CA  
1735 C C   . ASP B 85  ? 0.5262 0.3115 0.4181 0.0335  0.0462  0.0472  83  ASP B C   
1736 O O   . ASP B 85  ? 0.5802 0.3389 0.4596 0.0256  0.0391  0.0502  83  ASP B O   
1737 C CB  . ASP B 85  ? 0.5398 0.3023 0.3912 0.0468  0.0590  0.0311  83  ASP B CB  
1738 C CG  . ASP B 85  ? 0.6622 0.4102 0.4872 0.0403  0.0625  0.0239  83  ASP B CG  
1739 O OD1 . ASP B 85  ? 0.6739 0.4156 0.4811 0.0570  0.0729  0.0142  83  ASP B OD1 
1740 O OD2 . ASP B 85  ? 0.5514 0.2951 0.3721 0.0202  0.0550  0.0276  83  ASP B OD2 
1741 N N   . GLU B 86  ? 0.4658 0.2806 0.3798 0.0454  0.0511  0.0488  84  GLU B N   
1742 C CA  . GLU B 86  ? 0.4697 0.2877 0.3964 0.0492  0.0474  0.0550  84  GLU B CA  
1743 C C   . GLU B 86  ? 0.4413 0.2662 0.3802 0.0315  0.0399  0.0619  84  GLU B C   
1744 O O   . GLU B 86  ? 0.4362 0.2486 0.3721 0.0262  0.0352  0.0665  84  GLU B O   
1745 C CB  . GLU B 86  ? 0.4360 0.2902 0.3855 0.0620  0.0525  0.0559  84  GLU B CB  
1746 C CG  . GLU B 86  ? 0.5607 0.4136 0.5033 0.0858  0.0578  0.0510  84  GLU B CG  
1747 C CD  . GLU B 86  ? 0.6545 0.4639 0.5741 0.0952  0.0522  0.0522  84  GLU B CD  
1748 O OE1 . GLU B 86  ? 0.7126 0.5124 0.6344 0.0854  0.0454  0.0598  84  GLU B OE1 
1749 O OE2 . GLU B 86  ? 0.6442 0.4261 0.5394 0.1122  0.0547  0.0452  84  GLU B OE2 
1750 N N   . VAL B 87  ? 0.4411 0.2891 0.3942 0.0238  0.0391  0.0629  85  VAL B N   
1751 C CA  . VAL B 87  ? 0.4101 0.2695 0.3760 0.0125  0.0323  0.0678  85  VAL B CA  
1752 C C   . VAL B 87  ? 0.4711 0.3136 0.4247 -0.0004 0.0252  0.0687  85  VAL B C   
1753 O O   . VAL B 87  ? 0.4772 0.3292 0.4399 -0.0086 0.0203  0.0730  85  VAL B O   
1754 C CB  . VAL B 87  ? 0.4031 0.2807 0.3783 0.0101  0.0313  0.0680  85  VAL B CB  
1755 C CG1 . VAL B 87  ? 0.3448 0.2293 0.3277 0.0028  0.0227  0.0712  85  VAL B CG1 
1756 C CG2 . VAL B 87  ? 0.3324 0.2298 0.3209 0.0167  0.0356  0.0690  85  VAL B CG2 
1757 N N   . GLY B 88  ? 0.5294 0.3476 0.4600 -0.0030 0.0253  0.0642  86  GLY B N   
1758 C CA  . GLY B 88  ? 0.5411 0.3409 0.4555 -0.0183 0.0173  0.0649  86  GLY B CA  
1759 C C   . GLY B 88  ? 0.6136 0.3814 0.5062 -0.0228 0.0160  0.0654  86  GLY B C   
1760 O O   . GLY B 88  ? 0.6541 0.3917 0.5194 -0.0343 0.0110  0.0633  86  GLY B O   
1761 N N   . LYS B 89  ? 0.5522 0.3207 0.4512 -0.0141 0.0195  0.0680  87  LYS B N   
1762 C CA  . LYS B 89  ? 0.5810 0.3179 0.4580 -0.0219 0.0158  0.0714  87  LYS B CA  
1763 C C   . LYS B 89  ? 0.5548 0.3196 0.4517 -0.0366 0.0123  0.0794  87  LYS B C   
1764 O O   . LYS B 89  ? 0.5142 0.3152 0.4402 -0.0290 0.0158  0.0814  87  LYS B O   
1765 C CB  . LYS B 89  ? 0.5917 0.3064 0.4568 -0.0009 0.0209  0.0695  87  LYS B CB  
1766 C CG  . LYS B 89  ? 0.6605 0.3434 0.4992 0.0161  0.0251  0.0604  87  LYS B CG  
1767 C CD  . LYS B 89  ? 0.6352 0.3191 0.4767 0.0437  0.0309  0.0581  87  LYS B CD  
1768 C CE  . LYS B 89  ? 0.7878 0.4471 0.6045 0.0642  0.0365  0.0474  87  LYS B CE  
1769 N NZ  . LYS B 89  ? 0.7987 0.4660 0.6202 0.0949  0.0416  0.0445  87  LYS B NZ  
1770 N N   . PHE B 90  ? 0.6633 0.4075 0.5398 -0.0575 0.0060  0.0837  88  PHE B N   
1771 C CA  . PHE B 90  ? 0.6340 0.4025 0.5231 -0.0732 0.0044  0.0915  88  PHE B CA  
1772 C C   . PHE B 90  ? 0.6391 0.4120 0.5365 -0.0589 0.0101  0.0945  88  PHE B C   
1773 O O   . PHE B 90  ? 0.6576 0.4667 0.5771 -0.0642 0.0122  0.0989  88  PHE B O   
1774 C CB  . PHE B 90  ? 0.7004 0.4360 0.5556 -0.1014 -0.0032 0.0963  88  PHE B CB  
1775 C CG  . PHE B 90  ? 0.7094 0.4494 0.5586 -0.1214 -0.0109 0.0949  88  PHE B CG  
1776 C CD1 . PHE B 90  ? 0.6801 0.4767 0.5660 -0.1233 -0.0124 0.0949  88  PHE B CD1 
1777 C CD2 . PHE B 90  ? 0.7917 0.4750 0.5955 -0.1344 -0.0174 0.0927  88  PHE B CD2 
1778 C CE1 . PHE B 90  ? 0.6714 0.4731 0.5520 -0.1386 -0.0211 0.0938  88  PHE B CE1 
1779 C CE2 . PHE B 90  ? 0.8140 0.5003 0.6101 -0.1530 -0.0255 0.0912  88  PHE B CE2 
1780 C CZ  . PHE B 90  ? 0.7645 0.5129 0.6008 -0.1557 -0.0278 0.0923  88  PHE B CZ  
1781 N N   . ARG B 91  ? 0.5696 0.3052 0.4464 -0.0412 0.0119  0.0921  89  ARG B N   
1782 C CA  . ARG B 91  ? 0.5921 0.3326 0.4760 -0.0262 0.0153  0.0951  89  ARG B CA  
1783 C C   . ARG B 91  ? 0.5332 0.3271 0.4574 -0.0170 0.0208  0.0943  89  ARG B C   
1784 O O   . ARG B 91  ? 0.5191 0.3305 0.4539 -0.0164 0.0225  0.0988  89  ARG B O   
1785 C CB  . ARG B 91  ? 0.6222 0.3258 0.4848 -0.0017 0.0160  0.0908  89  ARG B CB  
1786 C CG  . ARG B 91  ? 0.6681 0.3893 0.5461 0.0182  0.0189  0.0929  89  ARG B CG  
1787 C CD  . ARG B 91  ? 0.8136 0.4982 0.6673 0.0434  0.0174  0.0899  89  ARG B CD  
1788 N NE  . ARG B 91  ? 0.8578 0.4781 0.6640 0.0366  0.0101  0.0919  89  ARG B NE  
1789 C CZ  . ARG B 91  ? 0.9946 0.5725 0.7701 0.0442  0.0088  0.0847  89  ARG B CZ  
1790 N NH1 . ARG B 91  ? 0.9532 0.5518 0.7434 0.0604  0.0156  0.0751  89  ARG B NH1 
1791 N NH2 . ARG B 91  ? 1.0911 0.6030 0.8168 0.0342  0.0006  0.0871  89  ARG B NH2 
1792 N N   . PHE B 92  ? 0.5376 0.3514 0.4784 -0.0103 0.0229  0.0886  90  PHE B N   
1793 C CA  . PHE B 92  ? 0.4774 0.3330 0.4486 -0.0054 0.0258  0.0878  90  PHE B CA  
1794 C C   . PHE B 92  ? 0.4596 0.3434 0.4460 -0.0191 0.0232  0.0894  90  PHE B C   
1795 O O   . PHE B 92  ? 0.4570 0.3700 0.4620 -0.0166 0.0253  0.0905  90  PHE B O   
1796 C CB  . PHE B 92  ? 0.4703 0.3321 0.4482 0.0070  0.0285  0.0820  90  PHE B CB  
1797 C CG  . PHE B 92  ? 0.3976 0.2905 0.3974 0.0113  0.0301  0.0816  90  PHE B CG  
1798 C CD1 . PHE B 92  ? 0.4279 0.3334 0.4366 0.0185  0.0327  0.0834  90  PHE B CD1 
1799 C CD2 . PHE B 92  ? 0.4449 0.3503 0.4524 0.0072  0.0271  0.0798  90  PHE B CD2 
1800 C CE1 . PHE B 92  ? 0.3104 0.2364 0.3321 0.0205  0.0330  0.0827  90  PHE B CE1 
1801 C CE2 . PHE B 92  ? 0.4887 0.4121 0.5083 0.0120  0.0271  0.0792  90  PHE B CE2 
1802 C CZ  . PHE B 92  ? 0.3907 0.3229 0.4163 0.0179  0.0303  0.0803  90  PHE B CZ  
1803 N N   . LEU B 93  ? 0.4562 0.3342 0.4354 -0.0303 0.0183  0.0883  91  LEU B N   
1804 C CA  . LEU B 93  ? 0.4556 0.3672 0.4522 -0.0400 0.0142  0.0893  91  LEU B CA  
1805 C C   . LEU B 93  ? 0.4686 0.4060 0.4747 -0.0514 0.0157  0.0943  91  LEU B C   
1806 O O   . LEU B 93  ? 0.4520 0.4303 0.4810 -0.0495 0.0161  0.0939  91  LEU B O   
1807 C CB  . LEU B 93  ? 0.4720 0.3702 0.4541 -0.0548 0.0068  0.0887  91  LEU B CB  
1808 C CG  . LEU B 93  ? 0.4913 0.3869 0.4726 -0.0497 0.0025  0.0845  91  LEU B CG  
1809 C CD1 . LEU B 93  ? 0.4105 0.3131 0.4032 -0.0305 0.0065  0.0811  91  LEU B CD1 
1810 C CD2 . LEU B 93  ? 0.3905 0.2440 0.3400 -0.0576 -0.0001 0.0818  91  LEU B CD2 
1811 N N   . ASN B 94  ? 0.4882 0.3999 0.4727 -0.0639 0.0161  0.0987  92  ASN B N   
1812 C CA  . ASN B 94  ? 0.5074 0.4390 0.4935 -0.0799 0.0182  0.1047  92  ASN B CA  
1813 C C   . ASN B 94  ? 0.4644 0.4266 0.4710 -0.0663 0.0253  0.1041  92  ASN B C   
1814 O O   . ASN B 94  ? 0.4540 0.4540 0.4737 -0.0754 0.0286  0.1063  92  ASN B O   
1815 C CB  . ASN B 94  ? 0.4946 0.3780 0.4440 -0.0938 0.0161  0.1102  92  ASN B CB  
1816 C CG  . ASN B 94  ? 0.5749 0.4298 0.4980 -0.1164 0.0083  0.1118  92  ASN B CG  
1817 O OD1 . ASN B 94  ? 0.4659 0.3481 0.4027 -0.1259 0.0044  0.1101  92  ASN B OD1 
1818 N ND2 . ASN B 94  ? 0.6339 0.4330 0.5159 -0.1270 0.0045  0.1158  92  ASN B ND2 
1819 N N   . GLU B 95  ? 0.4211 0.3684 0.4288 -0.0457 0.0277  0.1009  93  GLU B N   
1820 C CA  . GLU B 95  ? 0.3949 0.3631 0.4162 -0.0332 0.0331  0.0998  93  GLU B CA  
1821 C C   . GLU B 95  ? 0.3744 0.3805 0.4196 -0.0241 0.0341  0.0946  93  GLU B C   
1822 O O   . GLU B 95  ? 0.3661 0.3977 0.4213 -0.0189 0.0388  0.0932  93  GLU B O   
1823 C CB  . GLU B 95  ? 0.3940 0.3381 0.4089 -0.0166 0.0336  0.0981  93  GLU B CB  
1824 C CG  . GLU B 95  ? 0.3840 0.2891 0.3745 -0.0177 0.0314  0.1021  93  GLU B CG  
1825 C CD  . GLU B 95  ? 0.5114 0.4097 0.4874 -0.0289 0.0320  0.1092  93  GLU B CD  
1826 O OE1 . GLU B 95  ? 0.6109 0.4738 0.5601 -0.0385 0.0280  0.1140  93  GLU B OE1 
1827 O OE2 . GLU B 95  ? 0.4570 0.3831 0.4444 -0.0300 0.0362  0.1100  93  GLU B OE2 
1828 N N   . LEU B 96  ? 0.3505 0.3559 0.4009 -0.0200 0.0291  0.0912  94  LEU B N   
1829 C CA  . LEU B 96  ? 0.3441 0.3776 0.4119 -0.0087 0.0271  0.0866  94  LEU B CA  
1830 C C   . LEU B 96  ? 0.3289 0.4041 0.4116 -0.0184 0.0265  0.0879  94  LEU B C   
1831 O O   . LEU B 96  ? 0.3665 0.4757 0.4657 -0.0062 0.0275  0.0841  94  LEU B O   
1832 C CB  . LEU B 96  ? 0.3401 0.3558 0.4039 -0.0030 0.0204  0.0839  94  LEU B CB  
1833 C CG  . LEU B 96  ? 0.3764 0.3619 0.4287 0.0060  0.0214  0.0819  94  LEU B CG  
1834 C CD1 . LEU B 96  ? 0.3418 0.3128 0.3870 0.0066  0.0152  0.0800  94  LEU B CD1 
1835 C CD2 . LEU B 96  ? 0.3045 0.2955 0.3604 0.0189  0.0239  0.0792  94  LEU B CD2 
1836 N N   . ILE B 97  ? 0.3786 0.4509 0.4533 -0.0401 0.0242  0.0928  95  ILE B N   
1837 C CA  . ILE B 97  ? 0.3978 0.5153 0.4859 -0.0564 0.0236  0.0955  95  ILE B CA  
1838 C C   . ILE B 97  ? 0.4265 0.5759 0.5220 -0.0592 0.0333  0.0966  95  ILE B C   
1839 O O   . ILE B 97  ? 0.4780 0.6827 0.5957 -0.0575 0.0360  0.0946  95  ILE B O   
1840 C CB  . ILE B 97  ? 0.4292 0.5266 0.4980 -0.0850 0.0181  0.1014  95  ILE B CB  
1841 C CG1 . ILE B 97  ? 0.3760 0.4526 0.4388 -0.0835 0.0083  0.0992  95  ILE B CG1 
1842 C CG2 . ILE B 97  ? 0.4653 0.6124 0.5447 -0.1095 0.0187  0.1060  95  ILE B CG2 
1843 C CD1 . ILE B 97  ? 0.4277 0.4673 0.4613 -0.1094 0.0024  0.1034  95  ILE B CD1 
1844 N N   . LYS B 98  ? 0.4648 0.5824 0.5415 -0.0622 0.0384  0.0996  96  LYS B N   
1845 C CA  . LYS B 98  ? 0.4465 0.5892 0.5253 -0.0647 0.0479  0.1007  96  LYS B CA  
1846 C C   . LYS B 98  ? 0.4133 0.5883 0.5121 -0.0387 0.0528  0.0923  96  LYS B C   
1847 O O   . LYS B 98  ? 0.4250 0.6464 0.5364 -0.0389 0.0603  0.0902  96  LYS B O   
1848 C CB  . LYS B 98  ? 0.4148 0.5117 0.4672 -0.0684 0.0499  0.1055  96  LYS B CB  
1849 C CG  . LYS B 98  ? 0.4424 0.5010 0.4669 -0.0926 0.0450  0.1139  96  LYS B CG  
1850 C CD  . LYS B 98  ? 0.4956 0.5026 0.4944 -0.0858 0.0438  0.1173  96  LYS B CD  
1851 C CE  . LYS B 98  ? 0.6046 0.5623 0.5683 -0.1052 0.0373  0.1249  96  LYS B CE  
1852 N NZ  . LYS B 98  ? 0.6221 0.5298 0.5615 -0.0921 0.0341  0.1276  96  LYS B NZ  
1853 N N   . VAL B 99  ? 0.3977 0.5479 0.4967 -0.0169 0.0484  0.0870  97  VAL B N   
1854 C CA  . VAL B 99  ? 0.3740 0.5392 0.4820 0.0083  0.0509  0.0788  97  VAL B CA  
1855 C C   . VAL B 99  ? 0.3738 0.5895 0.5048 0.0196  0.0497  0.0736  97  VAL B C   
1856 O O   . VAL B 99  ? 0.3590 0.6047 0.4980 0.0363  0.0559  0.0671  97  VAL B O   
1857 C CB  . VAL B 99  ? 0.3644 0.4858 0.4610 0.0239  0.0451  0.0756  97  VAL B CB  
1858 C CG1 . VAL B 99  ? 0.3599 0.4859 0.4567 0.0476  0.0459  0.0673  97  VAL B CG1 
1859 C CG2 . VAL B 99  ? 0.3483 0.4321 0.4268 0.0162  0.0467  0.0799  97  VAL B CG2 
1860 N N   . VAL B 100 ? 0.3887 0.6140 0.5290 0.0125  0.0411  0.0760  98  VAL B N   
1861 C CA  . VAL B 100 ? 0.3764 0.6491 0.5395 0.0267  0.0363  0.0716  98  VAL B CA  
1862 C C   . VAL B 100 ? 0.3972 0.7365 0.5812 0.0091  0.0411  0.0744  98  VAL B C   
1863 O O   . VAL B 100 ? 0.4177 0.8135 0.6259 0.0238  0.0398  0.0698  98  VAL B O   
1864 C CB  . VAL B 100 ? 0.3777 0.6296 0.5394 0.0292  0.0224  0.0728  98  VAL B CB  
1865 C CG1 . VAL B 100 ? 0.3608 0.5588 0.5038 0.0484  0.0178  0.0691  98  VAL B CG1 
1866 C CG2 . VAL B 100 ? 0.3914 0.6243 0.5431 -0.0014 0.0187  0.0806  98  VAL B CG2 
1867 N N   . SER B 101 ? 0.4812 0.8149 0.6542 -0.0225 0.0459  0.0821  99  SER B N   
1868 C CA  . SER B 101 ? 0.4971 0.8904 0.6846 -0.0488 0.0492  0.0869  99  SER B CA  
1869 C C   . SER B 101 ? 0.5168 0.9561 0.7120 -0.0479 0.0642  0.0843  99  SER B C   
1870 O O   . SER B 101 ? 0.4882 0.8927 0.6628 -0.0481 0.0720  0.0848  99  SER B O   
1871 C CB  . SER B 101 ? 0.5241 0.8816 0.6876 -0.0872 0.0452  0.0972  99  SER B CB  
1872 O OG  . SER B 101 ? 0.5261 0.8596 0.6856 -0.0924 0.0320  0.0990  99  SER B OG  
1873 N N   . PRO B 102 ? 0.4719 0.9936 0.6962 -0.0486 0.0685  0.0818  100 PRO B N   
1874 C CA  . PRO B 102 ? 0.5089 1.0863 0.7417 -0.0509 0.0846  0.0790  100 PRO B CA  
1875 C C   . PRO B 102 ? 0.5469 1.1206 0.7594 -0.0975 0.0905  0.0905  100 PRO B C   
1876 O O   . PRO B 102 ? 0.5691 1.1511 0.7700 -0.1042 0.1036  0.0907  100 PRO B O   
1877 C CB  . PRO B 102 ? 0.4981 1.1712 0.7714 -0.0388 0.0850  0.0735  100 PRO B CB  
1878 C CG  . PRO B 102 ? 0.4901 1.1510 0.7736 -0.0309 0.0669  0.0745  100 PRO B CG  
1879 C CD  . PRO B 102 ? 0.4844 1.0557 0.7348 -0.0510 0.0578  0.0824  100 PRO B CD  
1880 N N   . LYS B 103 ? 0.7444 1.2973 0.9464 -0.1297 0.0797  0.1001  101 LYS B N   
1881 C CA  . LYS B 103 ? 0.7833 1.2974 0.9506 -0.1726 0.0803  0.1120  101 LYS B CA  
1882 C C   . LYS B 103 ? 0.7920 1.2348 0.9262 -0.1651 0.0849  0.1133  101 LYS B C   
1883 O O   . LYS B 103 ? 0.8141 1.2451 0.9228 -0.1921 0.0911  0.1210  101 LYS B O   
1884 C CB  . LYS B 103 ? 0.8024 1.2722 0.9527 -0.1964 0.0647  0.1193  101 LYS B CB  
1885 C CG  . LYS B 103 ? 0.9062 1.3593 1.0242 -0.2478 0.0632  0.1318  101 LYS B CG  
1886 C CD  . LYS B 103 ? 1.0331 1.4215 1.1234 -0.2665 0.0473  0.1373  101 LYS B CD  
1887 C CE  . LYS B 103 ? 1.1728 1.5336 1.2217 -0.3192 0.0440  0.1499  101 LYS B CE  
1888 N NZ  . LYS B 103 ? 1.2130 1.5333 1.2283 -0.3282 0.0524  0.1555  101 LYS B NZ  
1889 N N   . TYR B 104 ? 0.6535 1.0484 0.7858 -0.1308 0.0804  0.1068  102 TYR B N   
1890 C CA  . TYR B 104 ? 0.6438 0.9706 0.7464 -0.1234 0.0814  0.1085  102 TYR B CA  
1891 C C   . TYR B 104 ? 0.6024 0.9367 0.7133 -0.0893 0.0893  0.0986  102 TYR B C   
1892 O O   . TYR B 104 ? 0.6133 0.9829 0.7247 -0.0909 0.1013  0.0966  102 TYR B O   
1893 C CB  . TYR B 104 ? 0.6742 0.9304 0.7594 -0.1192 0.0687  0.1109  102 TYR B CB  
1894 C CG  . TYR B 104 ? 0.7321 0.9668 0.7992 -0.1522 0.0601  0.1197  102 TYR B CG  
1895 C CD1 . TYR B 104 ? 0.7400 0.9868 0.8207 -0.1547 0.0510  0.1182  102 TYR B CD1 
1896 C CD2 . TYR B 104 ? 0.8089 1.0090 0.8407 -0.1825 0.0602  0.1298  102 TYR B CD2 
1897 C CE1 . TYR B 104 ? 0.7725 0.9969 0.8317 -0.1874 0.0425  0.1257  102 TYR B CE1 
1898 C CE2 . TYR B 104 ? 0.7677 0.9403 0.7752 -0.2145 0.0513  0.1376  102 TYR B CE2 
1899 C CZ  . TYR B 104 ? 0.8115 0.9968 0.8328 -0.2174 0.0428  0.1351  102 TYR B CZ  
1900 O OH  . TYR B 104 ? 0.8800 1.0349 0.8724 -0.2517 0.0333  0.1424  102 TYR B OH  
1901 N N   . LEU B 105 ? 0.4888 0.7860 0.6010 -0.0613 0.0827  0.0927  103 LEU B N   
1902 C CA  . LEU B 105 ? 0.4614 0.7504 0.5720 -0.0323 0.0877  0.0839  103 LEU B CA  
1903 C C   . LEU B 105 ? 0.4416 0.7735 0.5774 -0.0036 0.0887  0.0726  103 LEU B C   
1904 O O   . LEU B 105 ? 0.4366 0.7651 0.5687 0.0215  0.0930  0.0637  103 LEU B O   
1905 C CB  . LEU B 105 ? 0.4596 0.6821 0.5525 -0.0209 0.0794  0.0844  103 LEU B CB  
1906 C CG  . LEU B 105 ? 0.5371 0.7117 0.6029 -0.0354 0.0780  0.0927  103 LEU B CG  
1907 C CD1 . LEU B 105 ? 0.4971 0.6234 0.5558 -0.0210 0.0691  0.0915  103 LEU B CD1 
1908 C CD2 . LEU B 105 ? 0.4769 0.6575 0.5288 -0.0355 0.0871  0.0921  103 LEU B CD2 
1909 N N   . GLY B 106 ? 0.5323 0.8982 0.6899 -0.0060 0.0826  0.0731  104 GLY B N   
1910 C CA  . GLY B 106 ? 0.5397 0.9382 0.7193 0.0252  0.0790  0.0633  104 GLY B CA  
1911 C C   . GLY B 106 ? 0.5820 1.0245 0.7698 0.0492  0.0910  0.0528  104 GLY B C   
1912 O O   . GLY B 106 ? 0.5859 1.0194 0.7736 0.0840  0.0880  0.0427  104 GLY B O   
1913 N N   . SER B 107 ? 0.4621 0.9490 0.6526 0.0306  0.1044  0.0548  105 SER B N   
1914 C CA  . SER B 107 ? 0.4994 1.0411 0.6996 0.0518  0.1183  0.0439  105 SER B CA  
1915 C C   . SER B 107 ? 0.5091 1.0004 0.6822 0.0772  0.1220  0.0351  105 SER B C   
1916 O O   . SER B 107 ? 0.5145 1.0317 0.6904 0.1086  0.1292  0.0223  105 SER B O   
1917 C CB  . SER B 107 ? 0.5202 1.1188 0.7245 0.0197  0.1329  0.0495  105 SER B CB  
1918 O OG  . SER B 107 ? 0.5943 1.2204 0.8121 -0.0150 0.1271  0.0607  105 SER B OG  
1919 N N   . ARG B 108 ? 0.6771 1.0953 0.8231 0.0655  0.1158  0.0414  106 ARG B N   
1920 C CA  . ARG B 108 ? 0.7081 1.0774 0.8251 0.0813  0.1181  0.0352  106 ARG B CA  
1921 C C   . ARG B 108 ? 0.7043 1.0138 0.8089 0.1026  0.1043  0.0313  106 ARG B C   
1922 O O   . ARG B 108 ? 0.7542 1.0252 0.8342 0.1188  0.1043  0.0242  106 ARG B O   
1923 C CB  . ARG B 108 ? 0.7093 1.0459 0.8024 0.0526  0.1214  0.0450  106 ARG B CB  
1924 C CG  . ARG B 108 ? 0.8089 1.1836 0.8937 0.0432  0.1377  0.0431  106 ARG B CG  
1925 C CD  . ARG B 108 ? 0.9371 1.2854 0.9999 0.0087  0.1384  0.0566  106 ARG B CD  
1926 N NE  . ARG B 108 ? 0.9667 1.2994 1.0356 -0.0155 0.1283  0.0692  106 ARG B NE  
1927 C CZ  . ARG B 108 ? 0.9632 1.3398 1.0483 -0.0375 0.1307  0.0751  106 ARG B CZ  
1928 N NH1 . ARG B 108 ? 0.9631 1.4119 1.0663 -0.0375 0.1434  0.0696  106 ARG B NH1 
1929 N NH2 . ARG B 108 ? 0.9374 1.2875 1.0198 -0.0592 0.1202  0.0858  106 ARG B NH2 
1930 N N   . THR B 109 ? 0.5476 0.8478 0.6655 0.0997  0.0924  0.0363  107 THR B N   
1931 C CA  . THR B 109 ? 0.5068 0.7502 0.6106 0.1137  0.0792  0.0347  107 THR B CA  
1932 C C   . THR B 109 ? 0.4941 0.7457 0.6008 0.1490  0.0743  0.0235  107 THR B C   
1933 O O   . THR B 109 ? 0.4903 0.7989 0.6225 0.1600  0.0763  0.0202  107 THR B O   
1934 C CB  . THR B 109 ? 0.5031 0.7297 0.6151 0.0948  0.0688  0.0447  107 THR B CB  
1935 O OG1 . THR B 109 ? 0.4706 0.7014 0.5829 0.0644  0.0734  0.0547  107 THR B OG1 
1936 C CG2 . THR B 109 ? 0.5264 0.6900 0.6176 0.0994  0.0583  0.0453  107 THR B CG2 
1937 N N   . SER B 110 ? 0.5416 0.7357 0.6206 0.1660  0.0665  0.0183  108 SER B N   
1938 C CA  . SER B 110 ? 0.5555 0.7387 0.6270 0.2008  0.0581  0.0085  108 SER B CA  
1939 C C   . SER B 110 ? 0.5595 0.7534 0.6500 0.2030  0.0455  0.0134  108 SER B C   
1940 O O   . SER B 110 ? 0.5432 0.7258 0.6402 0.1773  0.0405  0.0237  108 SER B O   
1941 C CB  . SER B 110 ? 0.5887 0.6961 0.6172 0.2112  0.0506  0.0037  108 SER B CB  
1942 O OG  . SER B 110 ? 0.5426 0.6038 0.5605 0.1935  0.0389  0.0124  108 SER B OG  
1943 N N   . GLU B 111 ? 0.6292 0.8452 0.7268 0.2355  0.0398  0.0055  109 GLU B N   
1944 C CA  . GLU B 111 ? 0.6462 0.8661 0.7559 0.2423  0.0247  0.0094  109 GLU B CA  
1945 C C   . GLU B 111 ? 0.6426 0.7843 0.7206 0.2332  0.0113  0.0148  109 GLU B C   
1946 O O   . GLU B 111 ? 0.6379 0.7754 0.7239 0.2183  0.0021  0.0230  109 GLU B O   
1947 C CB  . GLU B 111 ? 0.6762 0.9237 0.7914 0.2862  0.0190  -0.0013 109 GLU B CB  
1948 C CG  . GLU B 111 ? 0.7710 1.0763 0.9217 0.2900  0.0095  0.0030  109 GLU B CG  
1949 C CD  . GLU B 111 ? 0.8868 1.2916 1.0816 0.2830  0.0229  0.0023  109 GLU B CD  
1950 O OE1 . GLU B 111 ? 0.9012 1.3680 1.1217 0.3111  0.0190  -0.0033 109 GLU B OE1 
1951 O OE2 . GLU B 111 ? 0.8435 1.2650 1.0450 0.2503  0.0370  0.0072  109 GLU B OE2 
1952 N N   . LYS B 112 ? 0.6241 0.7050 0.6639 0.2400  0.0106  0.0101  110 LYS B N   
1953 C CA  . LYS B 112 ? 0.6225 0.6306 0.6279 0.2301  -0.0015 0.0146  110 LYS B CA  
1954 C C   . LYS B 112 ? 0.5726 0.5773 0.5877 0.1920  0.0014  0.0259  110 LYS B C   
1955 O O   . LYS B 112 ? 0.5651 0.5493 0.5765 0.1812  -0.0083 0.0324  110 LYS B O   
1956 C CB  . LYS B 112 ? 0.6811 0.6304 0.6425 0.2393  -0.0015 0.0074  110 LYS B CB  
1957 C CG  . LYS B 112 ? 0.7341 0.6134 0.6586 0.2187  -0.0110 0.0132  110 LYS B CG  
1958 C CD  . LYS B 112 ? 0.9107 0.7252 0.7836 0.2336  -0.0169 0.0048  110 LYS B CD  
1959 C CE  . LYS B 112 ? 0.9817 0.7271 0.8142 0.2133  -0.0296 0.0111  110 LYS B CE  
1960 N NZ  . LYS B 112 ? 1.0273 0.7253 0.8200 0.1996  -0.0285 0.0083  110 LYS B NZ  
1961 N N   . VAL B 113 ? 0.5128 0.5413 0.5408 0.1738  0.0145  0.0281  111 VAL B N   
1962 C CA  . VAL B 113 ? 0.4776 0.5076 0.5161 0.1427  0.0178  0.0379  111 VAL B CA  
1963 C C   . VAL B 113 ? 0.4733 0.5402 0.5398 0.1323  0.0155  0.0439  111 VAL B C   
1964 O O   . VAL B 113 ? 0.4621 0.5090 0.5257 0.1166  0.0100  0.0501  111 VAL B O   
1965 C CB  . VAL B 113 ? 0.4745 0.5183 0.5162 0.1283  0.0305  0.0392  111 VAL B CB  
1966 C CG1 . VAL B 113 ? 0.3895 0.4413 0.4445 0.1015  0.0332  0.0490  111 VAL B CG1 
1967 C CG2 . VAL B 113 ? 0.4600 0.4596 0.4699 0.1298  0.0303  0.0357  111 VAL B CG2 
1968 N N   . LYS B 114 ? 0.4186 0.5406 0.5105 0.1404  0.0195  0.0415  112 LYS B N   
1969 C CA  . LYS B 114 ? 0.4070 0.5678 0.5241 0.1259  0.0168  0.0475  112 LYS B CA  
1970 C C   . LYS B 114 ? 0.4105 0.5553 0.5238 0.1352  0.0016  0.0486  112 LYS B C   
1971 O O   . LYS B 114 ? 0.4187 0.5569 0.5342 0.1164  -0.0037 0.0551  112 LYS B O   
1972 C CB  . LYS B 114 ? 0.3897 0.6214 0.5353 0.1300  0.0244  0.0449  112 LYS B CB  
1973 C CG  . LYS B 114 ? 0.3879 0.6383 0.5354 0.1141  0.0397  0.0459  112 LYS B CG  
1974 C CD  . LYS B 114 ? 0.3319 0.6589 0.5078 0.1098  0.0479  0.0452  112 LYS B CD  
1975 C CE  . LYS B 114 ? 0.4076 0.7687 0.5892 0.1423  0.0545  0.0336  112 LYS B CE  
1976 N NZ  . LYS B 114 ? 0.4764 0.9171 0.6919 0.1521  0.0543  0.0310  112 LYS B NZ  
1977 N N   . ASN B 115 ? 0.4214 0.5487 0.5212 0.1642  -0.0062 0.0420  113 ASN B N   
1978 C CA  . ASN B 115 ? 0.4301 0.5385 0.5214 0.1761  -0.0227 0.0433  113 ASN B CA  
1979 C C   . ASN B 115 ? 0.4336 0.4803 0.4965 0.1580  -0.0286 0.0490  113 ASN B C   
1980 O O   . ASN B 115 ? 0.4653 0.5038 0.5261 0.1498  -0.0385 0.0540  113 ASN B O   
1981 C CB  . ASN B 115 ? 0.4786 0.5764 0.5560 0.2151  -0.0307 0.0346  113 ASN B CB  
1982 C CG  . ASN B 115 ? 0.5338 0.7065 0.6455 0.2381  -0.0291 0.0292  113 ASN B CG  
1983 O OD1 . ASN B 115 ? 0.6835 0.8583 0.7879 0.2741  -0.0320 0.0201  113 ASN B OD1 
1984 N ND2 . ASN B 115 ? 0.4904 0.7239 0.6371 0.2180  -0.0260 0.0348  113 ASN B ND2 
1985 N N   . LYS B 116 ? 0.4707 0.4802 0.5132 0.1487  -0.0214 0.0485  114 LYS B N   
1986 C CA  . LYS B 116 ? 0.4719 0.4335 0.4906 0.1293  -0.0243 0.0536  114 LYS B CA  
1987 C C   . LYS B 116 ? 0.4251 0.4023 0.4593 0.1031  -0.0190 0.0600  114 LYS B C   
1988 O O   . LYS B 116 ? 0.3934 0.3478 0.4157 0.0916  -0.0247 0.0640  114 LYS B O   
1989 C CB  . LYS B 116 ? 0.5175 0.4441 0.5126 0.1261  -0.0187 0.0511  114 LYS B CB  
1990 C CG  . LYS B 116 ? 0.5801 0.4668 0.5526 0.1049  -0.0205 0.0561  114 LYS B CG  
1991 C CD  . LYS B 116 ? 0.6353 0.4828 0.5801 0.1085  -0.0347 0.0578  114 LYS B CD  
1992 C CE  . LYS B 116 ? 0.6349 0.4441 0.5522 0.0862  -0.0353 0.0620  114 LYS B CE  
1993 N NZ  . LYS B 116 ? 0.7003 0.4860 0.5998 0.0794  -0.0455 0.0665  114 LYS B NZ  
1994 N N   . ILE B 117 ? 0.3811 0.3946 0.4380 0.0943  -0.0085 0.0608  115 ILE B N   
1995 C CA  . ILE B 117 ? 0.3691 0.3954 0.4373 0.0725  -0.0053 0.0663  115 ILE B CA  
1996 C C   . ILE B 117 ? 0.3646 0.4047 0.4398 0.0690  -0.0153 0.0688  115 ILE B C   
1997 O O   . ILE B 117 ? 0.3697 0.3904 0.4354 0.0539  -0.0177 0.0722  115 ILE B O   
1998 C CB  . ILE B 117 ? 0.3474 0.4064 0.4328 0.0626  0.0056  0.0675  115 ILE B CB  
1999 C CG1 . ILE B 117 ? 0.3020 0.3423 0.3769 0.0612  0.0142  0.0668  115 ILE B CG1 
2000 C CG2 . ILE B 117 ? 0.3181 0.3828 0.4081 0.0402  0.0061  0.0731  115 ILE B CG2 
2001 C CD1 . ILE B 117 ? 0.3243 0.3880 0.4089 0.0495  0.0240  0.0694  115 ILE B CD1 
2002 N N   . LEU B 118 ? 0.3931 0.4695 0.4848 0.0834  -0.0212 0.0666  116 LEU B N   
2003 C CA  . LEU B 118 ? 0.4066 0.5046 0.5077 0.0804  -0.0328 0.0694  116 LEU B CA  
2004 C C   . LEU B 118 ? 0.4268 0.4823 0.5034 0.0850  -0.0457 0.0708  116 LEU B C   
2005 O O   . LEU B 118 ? 0.4613 0.5117 0.5331 0.0707  -0.0528 0.0747  116 LEU B O   
2006 C CB  . LEU B 118 ? 0.3974 0.5526 0.5245 0.0993  -0.0365 0.0662  116 LEU B CB  
2007 C CG  . LEU B 118 ? 0.4059 0.6143 0.5582 0.0915  -0.0236 0.0654  116 LEU B CG  
2008 C CD1 . LEU B 118 ? 0.4212 0.6918 0.5997 0.1151  -0.0262 0.0606  116 LEU B CD1 
2009 C CD2 . LEU B 118 ? 0.2892 0.5132 0.4483 0.0574  -0.0208 0.0720  116 LEU B CD2 
2010 N N   . GLU B 119 ? 0.4362 0.4603 0.4939 0.1046  -0.0497 0.0676  117 GLU B N   
2011 C CA  . GLU B 119 ? 0.4499 0.4230 0.4753 0.1061  -0.0608 0.0696  117 GLU B CA  
2012 C C   . GLU B 119 ? 0.4653 0.4074 0.4738 0.0800  -0.0553 0.0733  117 GLU B C   
2013 O O   . GLU B 119 ? 0.4776 0.4004 0.4701 0.0712  -0.0637 0.0767  117 GLU B O   
2014 C CB  . GLU B 119 ? 0.4641 0.4007 0.4655 0.1257  -0.0632 0.0655  117 GLU B CB  
2015 C CG  . GLU B 119 ? 0.6864 0.5623 0.6463 0.1224  -0.0737 0.0683  117 GLU B CG  
2016 C CD  . GLU B 119 ? 0.8899 0.7222 0.8200 0.1304  -0.0727 0.0649  117 GLU B CD  
2017 O OE1 . GLU B 119 ? 0.9219 0.7529 0.8485 0.1575  -0.0774 0.0593  117 GLU B OE1 
2018 O OE2 . GLU B 119 ? 0.8542 0.6581 0.7658 0.1094  -0.0662 0.0671  117 GLU B OE2 
2019 N N   . LEU B 120 ? 0.4257 0.3648 0.4369 0.0693  -0.0412 0.0724  118 LEU B N   
2020 C CA  . LEU B 120 ? 0.4088 0.3262 0.4073 0.0494  -0.0344 0.0746  118 LEU B CA  
2021 C C   . LEU B 120 ? 0.4214 0.3529 0.4279 0.0350  -0.0343 0.0768  118 LEU B C   
2022 O O   . LEU B 120 ? 0.4308 0.3403 0.4191 0.0243  -0.0372 0.0782  118 LEU B O   
2023 C CB  . LEU B 120 ? 0.4097 0.3282 0.4131 0.0449  -0.0209 0.0733  118 LEU B CB  
2024 C CG  . LEU B 120 ? 0.4567 0.3493 0.4414 0.0501  -0.0206 0.0717  118 LEU B CG  
2025 C CD1 . LEU B 120 ? 0.3511 0.2532 0.3445 0.0455  -0.0089 0.0708  118 LEU B CD1 
2026 C CD2 . LEU B 120 ? 0.3990 0.2563 0.3546 0.0397  -0.0254 0.0740  118 LEU B CD2 
2027 N N   . LEU B 121 ? 0.3553 0.3205 0.3848 0.0321  -0.0303 0.0768  119 LEU B N   
2028 C CA  . LEU B 121 ? 0.3839 0.3577 0.4159 0.0153  -0.0314 0.0789  119 LEU B CA  
2029 C C   . LEU B 121 ? 0.4073 0.3749 0.4283 0.0128  -0.0454 0.0807  119 LEU B C   
2030 O O   . LEU B 121 ? 0.4155 0.3630 0.4196 -0.0019 -0.0464 0.0814  119 LEU B O   
2031 C CB  . LEU B 121 ? 0.3447 0.3593 0.4006 0.0108  -0.0287 0.0799  119 LEU B CB  
2032 C CG  . LEU B 121 ? 0.3826 0.4009 0.4444 0.0059  -0.0157 0.0799  119 LEU B CG  
2033 C CD1 . LEU B 121 ? 0.2952 0.3608 0.3804 0.0040  -0.0142 0.0810  119 LEU B CD1 
2034 C CD2 . LEU B 121 ? 0.3064 0.2961 0.3515 -0.0104 -0.0102 0.0813  119 LEU B CD2 
2035 N N   . TYR B 122 ? 0.3688 0.3531 0.3975 0.0287  -0.0568 0.0810  120 TYR B N   
2036 C CA  . TYR B 122 ? 0.3633 0.3429 0.3811 0.0294  -0.0731 0.0835  120 TYR B CA  
2037 C C   . TYR B 122 ? 0.3775 0.3066 0.3601 0.0238  -0.0755 0.0845  120 TYR B C   
2038 O O   . TYR B 122 ? 0.3928 0.3088 0.3591 0.0107  -0.0821 0.0865  120 TYR B O   
2039 C CB  . TYR B 122 ? 0.3668 0.3710 0.3976 0.0545  -0.0854 0.0831  120 TYR B CB  
2040 C CG  . TYR B 122 ? 0.3732 0.3705 0.3906 0.0586  -0.1049 0.0866  120 TYR B CG  
2041 C CD1 . TYR B 122 ? 0.3602 0.3938 0.3921 0.0473  -0.1146 0.0895  120 TYR B CD1 
2042 C CD2 . TYR B 122 ? 0.3728 0.3218 0.3571 0.0679  -0.1142 0.0880  120 TYR B CD2 
2043 C CE1 . TYR B 122 ? 0.4644 0.4901 0.4814 0.0490  -0.1338 0.0934  120 TYR B CE1 
2044 C CE2 . TYR B 122 ? 0.4864 0.4237 0.4532 0.0704  -0.1335 0.0922  120 TYR B CE2 
2045 C CZ  . TYR B 122 ? 0.4292 0.4057 0.4133 0.0616  -0.1432 0.0948  120 TYR B CZ  
2046 O OH  . TYR B 122 ? 0.5669 0.5340 0.5336 0.0646  -0.1642 0.0995  120 TYR B OH  
2047 N N   . SER B 123 ? 0.4384 0.3402 0.4066 0.0325  -0.0713 0.0833  121 SER B N   
2048 C CA  . SER B 123 ? 0.4830 0.3415 0.4172 0.0229  -0.0713 0.0846  121 SER B CA  
2049 C C   . SER B 123 ? 0.4756 0.3275 0.4023 0.0027  -0.0604 0.0835  121 SER B C   
2050 O O   . SER B 123 ? 0.4869 0.3147 0.3872 -0.0083 -0.0639 0.0848  121 SER B O   
2051 C CB  . SER B 123 ? 0.4814 0.3158 0.4021 0.0289  -0.0661 0.0836  121 SER B CB  
2052 O OG  . SER B 123 ? 0.5135 0.3585 0.4473 0.0225  -0.0495 0.0809  121 SER B OG  
2053 N N   . TRP B 124 ? 0.4201 0.2923 0.3672 -0.0013 -0.0485 0.0811  122 TRP B N   
2054 C CA  . TRP B 124 ? 0.4240 0.2858 0.3612 -0.0155 -0.0385 0.0788  122 TRP B CA  
2055 C C   . TRP B 124 ? 0.4355 0.2967 0.3647 -0.0273 -0.0463 0.0794  122 TRP B C   
2056 O O   . TRP B 124 ? 0.4641 0.3027 0.3701 -0.0378 -0.0424 0.0770  122 TRP B O   
2057 C CB  . TRP B 124 ? 0.4143 0.2877 0.3679 -0.0145 -0.0247 0.0765  122 TRP B CB  
2058 C CG  . TRP B 124 ? 0.4080 0.2814 0.3664 -0.0062 -0.0168 0.0759  122 TRP B CG  
2059 C CD1 . TRP B 124 ? 0.3797 0.2366 0.3218 -0.0061 -0.0167 0.0762  122 TRP B CD1 
2060 C CD2 . TRP B 124 ? 0.3412 0.2315 0.3192 0.0003  -0.0093 0.0754  122 TRP B CD2 
2061 N NE1 . TRP B 124 ? 0.3023 0.1654 0.2533 -0.0003 -0.0109 0.0759  122 TRP B NE1 
2062 C CE2 . TRP B 124 ? 0.3936 0.2773 0.3670 0.0049  -0.0062 0.0752  122 TRP B CE2 
2063 C CE3 . TRP B 124 ? 0.4129 0.3215 0.4083 0.0001  -0.0059 0.0758  122 TRP B CE3 
2064 C CZ2 . TRP B 124 ? 0.3808 0.2762 0.3672 0.0108  0.0001  0.0747  122 TRP B CZ2 
2065 C CZ3 . TRP B 124 ? 0.4157 0.3352 0.4234 0.0065  0.0011  0.0758  122 TRP B CZ3 
2066 C CH2 . TRP B 124 ? 0.4144 0.3278 0.4183 0.0127  0.0037  0.0750  122 TRP B CH2 
2067 N N   . THR B 125 ? 0.4457 0.3342 0.3933 -0.0263 -0.0568 0.0819  123 THR B N   
2068 C CA  . THR B 125 ? 0.4589 0.3496 0.3975 -0.0407 -0.0677 0.0834  123 THR B CA  
2069 C C   . THR B 125 ? 0.5003 0.3655 0.4105 -0.0434 -0.0786 0.0848  123 THR B C   
2070 O O   . THR B 125 ? 0.5254 0.3750 0.4140 -0.0587 -0.0833 0.0844  123 THR B O   
2071 C CB  . THR B 125 ? 0.4041 0.3402 0.3708 -0.0402 -0.0789 0.0867  123 THR B CB  
2072 O OG1 . THR B 125 ? 0.4826 0.4360 0.4611 -0.0203 -0.0898 0.0887  123 THR B OG1 
2073 C CG2 . THR B 125 ? 0.3343 0.2957 0.3247 -0.0421 -0.0680 0.0860  123 THR B CG2 
2074 N N   . VAL B 126 ? 0.4730 0.3302 0.3788 -0.0296 -0.0839 0.0869  124 VAL B N   
2075 C CA  . VAL B 126 ? 0.5119 0.3421 0.3872 -0.0321 -0.0965 0.0899  124 VAL B CA  
2076 C C   . VAL B 126 ? 0.5432 0.3375 0.3872 -0.0430 -0.0838 0.0873  124 VAL B C   
2077 O O   . VAL B 126 ? 0.5753 0.3478 0.3899 -0.0562 -0.0870 0.0873  124 VAL B O   
2078 C CB  . VAL B 126 ? 0.5588 0.3882 0.4354 -0.0122 -0.1105 0.0939  124 VAL B CB  
2079 C CG1 . VAL B 126 ? 0.5805 0.3696 0.4156 -0.0163 -0.1235 0.0982  124 VAL B CG1 
2080 C CG2 . VAL B 126 ? 0.4715 0.3448 0.3794 0.0009  -0.1237 0.0956  124 VAL B CG2 
2081 N N   . GLY B 127 ? 0.5243 0.3176 0.3756 -0.0385 -0.0686 0.0847  125 GLY B N   
2082 C CA  . GLY B 127 ? 0.5111 0.2816 0.3373 -0.0475 -0.0564 0.0826  125 GLY B CA  
2083 C C   . GLY B 127 ? 0.5428 0.3134 0.3650 -0.0560 -0.0411 0.0763  125 GLY B C   
2084 O O   . GLY B 127 ? 0.5843 0.3376 0.3787 -0.0660 -0.0344 0.0737  125 GLY B O   
2085 N N   . LEU B 128 ? 0.4835 0.2718 0.3301 -0.0512 -0.0352 0.0735  126 LEU B N   
2086 C CA  . LEU B 128 ? 0.5131 0.2950 0.3531 -0.0547 -0.0217 0.0671  126 LEU B CA  
2087 C C   . LEU B 128 ? 0.5375 0.3157 0.3758 -0.0619 -0.0283 0.0661  126 LEU B C   
2088 O O   . LEU B 128 ? 0.5454 0.3271 0.3947 -0.0596 -0.0220 0.0640  126 LEU B O   
2089 C CB  . LEU B 128 ? 0.4971 0.2941 0.3588 -0.0441 -0.0078 0.0649  126 LEU B CB  
2090 C CG  . LEU B 128 ? 0.5013 0.3052 0.3653 -0.0408 -0.0021 0.0664  126 LEU B CG  
2091 C CD1 . LEU B 128 ? 0.5080 0.3317 0.3980 -0.0307 0.0059  0.0663  126 LEU B CD1 
2092 C CD2 . LEU B 128 ? 0.4530 0.2473 0.2914 -0.0482 0.0078  0.0626  126 LEU B CD2 
2093 N N   . PRO B 129 ? 0.5966 0.3627 0.4144 -0.0732 -0.0412 0.0676  127 PRO B N   
2094 C CA  . PRO B 129 ? 0.6095 0.3745 0.4233 -0.0855 -0.0518 0.0683  127 PRO B CA  
2095 C C   . PRO B 129 ? 0.6389 0.3777 0.4319 -0.0918 -0.0418 0.0613  127 PRO B C   
2096 O O   . PRO B 129 ? 0.6653 0.3994 0.4530 -0.1047 -0.0495 0.0620  127 PRO B O   
2097 C CB  . PRO B 129 ? 0.6698 0.4217 0.4576 -0.0962 -0.0666 0.0707  127 PRO B CB  
2098 C CG  . PRO B 129 ? 0.6614 0.4095 0.4436 -0.0879 -0.0659 0.0732  127 PRO B CG  
2099 C CD  . PRO B 129 ? 0.5822 0.3318 0.3736 -0.0780 -0.0464 0.0691  127 PRO B CD  
2100 N N   . GLU B 130 ? 0.6734 0.3939 0.4507 -0.0834 -0.0258 0.0544  128 GLU B N   
2101 C CA  . GLU B 130 ? 0.7048 0.3954 0.4584 -0.0827 -0.0162 0.0465  128 GLU B CA  
2102 C C   . GLU B 130 ? 0.6783 0.3761 0.4531 -0.0722 -0.0089 0.0467  128 GLU B C   
2103 O O   . GLU B 130 ? 0.7042 0.3720 0.4575 -0.0710 -0.0044 0.0415  128 GLU B O   
2104 C CB  . GLU B 130 ? 0.7228 0.3942 0.4479 -0.0756 -0.0021 0.0376  128 GLU B CB  
2105 C CG  . GLU B 130 ? 0.7989 0.4489 0.4882 -0.0902 -0.0094 0.0358  128 GLU B CG  
2106 C CD  . GLU B 130 ? 0.8332 0.4682 0.4922 -0.0843 0.0067  0.0262  128 GLU B CD  
2107 O OE1 . GLU B 130 ? 0.8795 0.4906 0.5014 -0.0965 0.0028  0.0229  128 GLU B OE1 
2108 O OE2 . GLU B 130 ? 0.8304 0.4820 0.5032 -0.0682 0.0229  0.0220  128 GLU B OE2 
2109 N N   . GLU B 131 ? 0.6530 0.3857 0.4652 -0.0644 -0.0086 0.0527  129 GLU B N   
2110 C CA  . GLU B 131 ? 0.5814 0.3249 0.4150 -0.0592 -0.0059 0.0554  129 GLU B CA  
2111 C C   . GLU B 131 ? 0.5817 0.3353 0.4229 -0.0759 -0.0192 0.0615  129 GLU B C   
2112 O O   . GLU B 131 ? 0.5194 0.3094 0.3908 -0.0753 -0.0251 0.0673  129 GLU B O   
2113 C CB  . GLU B 131 ? 0.5545 0.3319 0.4222 -0.0460 -0.0009 0.0591  129 GLU B CB  
2114 C CG  . GLU B 131 ? 0.5084 0.2886 0.3747 -0.0334 0.0114  0.0549  129 GLU B CG  
2115 C CD  . GLU B 131 ? 0.6022 0.3644 0.4537 -0.0223 0.0234  0.0479  129 GLU B CD  
2116 O OE1 . GLU B 131 ? 0.6256 0.3945 0.4733 -0.0130 0.0341  0.0432  129 GLU B OE1 
2117 O OE2 . GLU B 131 ? 0.5615 0.3013 0.4014 -0.0232 0.0215  0.0469  129 GLU B OE2 
2118 N N   . VAL B 132 ? 0.5991 0.3216 0.4110 -0.0912 -0.0243 0.0597  130 VAL B N   
2119 C CA  . VAL B 132 ? 0.6014 0.3373 0.4164 -0.1139 -0.0387 0.0656  130 VAL B CA  
2120 C C   . VAL B 132 ? 0.6028 0.3686 0.4460 -0.1180 -0.0388 0.0721  130 VAL B C   
2121 O O   . VAL B 132 ? 0.5720 0.3780 0.4382 -0.1298 -0.0484 0.0781  130 VAL B O   
2122 C CB  . VAL B 132 ? 0.6710 0.3602 0.4397 -0.1346 -0.0456 0.0622  130 VAL B CB  
2123 C CG1 . VAL B 132 ? 0.6852 0.3530 0.4265 -0.1347 -0.0479 0.0566  130 VAL B CG1 
2124 C CG2 . VAL B 132 ? 0.7142 0.3547 0.4527 -0.1301 -0.0367 0.0572  130 VAL B CG2 
2125 N N   . LYS B 133 ? 0.6273 0.3805 0.4720 -0.1053 -0.0276 0.0708  131 LYS B N   
2126 C CA  . LYS B 133 ? 0.6136 0.3913 0.4805 -0.1086 -0.0260 0.0767  131 LYS B CA  
2127 C C   . LYS B 133 ? 0.5576 0.3910 0.4684 -0.0976 -0.0253 0.0803  131 LYS B C   
2128 O O   . LYS B 133 ? 0.5492 0.4160 0.4810 -0.1053 -0.0268 0.0854  131 LYS B O   
2129 C CB  . LYS B 133 ? 0.6207 0.3666 0.4740 -0.0957 -0.0157 0.0747  131 LYS B CB  
2130 C CG  . LYS B 133 ? 0.6590 0.3442 0.4642 -0.1064 -0.0181 0.0720  131 LYS B CG  
2131 C CD  . LYS B 133 ? 0.7255 0.3784 0.5167 -0.0832 -0.0084 0.0682  131 LYS B CD  
2132 C CE  . LYS B 133 ? 0.7911 0.3765 0.5299 -0.0912 -0.0124 0.0661  131 LYS B CE  
2133 N NZ  . LYS B 133 ? 0.8370 0.3954 0.5649 -0.0648 -0.0048 0.0634  131 LYS B NZ  
2134 N N   . ILE B 134 ? 0.5013 0.3425 0.4222 -0.0801 -0.0227 0.0773  132 ILE B N   
2135 C CA  . ILE B 134 ? 0.4543 0.3372 0.4084 -0.0675 -0.0236 0.0797  132 ILE B CA  
2136 C C   . ILE B 134 ? 0.4809 0.3983 0.4493 -0.0770 -0.0369 0.0833  132 ILE B C   
2137 O O   . ILE B 134 ? 0.4632 0.4230 0.4598 -0.0735 -0.0386 0.0862  132 ILE B O   
2138 C CB  . ILE B 134 ? 0.4639 0.3380 0.4164 -0.0505 -0.0196 0.0764  132 ILE B CB  
2139 C CG1 . ILE B 134 ? 0.4364 0.2890 0.3801 -0.0405 -0.0066 0.0728  132 ILE B CG1 
2140 C CG2 . ILE B 134 ? 0.3507 0.2568 0.3286 -0.0378 -0.0230 0.0785  132 ILE B CG2 
2141 C CD1 . ILE B 134 ? 0.3734 0.2235 0.3154 -0.0289 -0.0017 0.0702  132 ILE B CD1 
2142 N N   . ALA B 135 ? 0.5334 0.4348 0.4817 -0.0882 -0.0463 0.0827  133 ALA B N   
2143 C CA  . ALA B 135 ? 0.5494 0.4840 0.5082 -0.1001 -0.0615 0.0866  133 ALA B CA  
2144 C C   . ALA B 135 ? 0.5449 0.5084 0.5150 -0.1206 -0.0638 0.0909  133 ALA B C   
2145 O O   . ALA B 135 ? 0.5221 0.5408 0.5227 -0.1211 -0.0701 0.0945  133 ALA B O   
2146 C CB  . ALA B 135 ? 0.5650 0.4685 0.4917 -0.1128 -0.0713 0.0852  133 ALA B CB  
2147 N N   . GLU B 136 ? 0.6018 0.5278 0.5453 -0.1371 -0.0585 0.0904  134 GLU B N   
2148 C CA  . GLU B 136 ? 0.6267 0.5696 0.5715 -0.1616 -0.0598 0.0953  134 GLU B CA  
2149 C C   . GLU B 136 ? 0.6012 0.5951 0.5839 -0.1512 -0.0523 0.0982  134 GLU B C   
2150 O O   . GLU B 136 ? 0.6094 0.6602 0.6174 -0.1629 -0.0575 0.1024  134 GLU B O   
2151 C CB  . GLU B 136 ? 0.6657 0.5450 0.5686 -0.1739 -0.0543 0.0939  134 GLU B CB  
2152 C CG  . GLU B 136 ? 0.7806 0.6097 0.6388 -0.1927 -0.0631 0.0912  134 GLU B CG  
2153 C CD  . GLU B 136 ? 0.9327 0.6916 0.7441 -0.1998 -0.0582 0.0886  134 GLU B CD  
2154 O OE1 . GLU B 136 ? 0.9386 0.6460 0.7187 -0.1867 -0.0545 0.0811  134 GLU B OE1 
2155 O OE2 . GLU B 136 ? 0.8859 0.6406 0.6895 -0.2179 -0.0581 0.0940  134 GLU B OE2 
2156 N N   . ALA B 137 ? 0.5295 0.5062 0.5154 -0.1297 -0.0400 0.0954  135 ALA B N   
2157 C CA  . ALA B 137 ? 0.5125 0.5293 0.5281 -0.1187 -0.0318 0.0970  135 ALA B CA  
2158 C C   . ALA B 137 ? 0.5001 0.5779 0.5522 -0.1046 -0.0368 0.0967  135 ALA B C   
2159 O O   . ALA B 137 ? 0.4935 0.6248 0.5705 -0.1095 -0.0355 0.0992  135 ALA B O   
2160 C CB  . ALA B 137 ? 0.4404 0.4269 0.4515 -0.0963 -0.0204 0.0936  135 ALA B CB  
2161 N N   . TYR B 138 ? 0.4927 0.5618 0.5445 -0.0881 -0.0436 0.0937  136 TYR B N   
2162 C CA  . TYR B 138 ? 0.4646 0.5796 0.5440 -0.0690 -0.0508 0.0929  136 TYR B CA  
2163 C C   . TYR B 138 ? 0.4715 0.6408 0.5686 -0.0851 -0.0626 0.0967  136 TYR B C   
2164 O O   . TYR B 138 ? 0.4240 0.6534 0.5531 -0.0728 -0.0643 0.0966  136 TYR B O   
2165 C CB  . TYR B 138 ? 0.4588 0.5406 0.5237 -0.0519 -0.0574 0.0903  136 TYR B CB  
2166 C CG  . TYR B 138 ? 0.4381 0.5524 0.5232 -0.0268 -0.0661 0.0893  136 TYR B CG  
2167 C CD1 . TYR B 138 ? 0.3812 0.4976 0.4758 -0.0022 -0.0590 0.0859  136 TYR B CD1 
2168 C CD2 . TYR B 138 ? 0.3941 0.5333 0.4849 -0.0267 -0.0828 0.0915  136 TYR B CD2 
2169 C CE1 . TYR B 138 ? 0.4269 0.5600 0.5311 0.0240  -0.0680 0.0841  136 TYR B CE1 
2170 C CE2 . TYR B 138 ? 0.4164 0.5783 0.5209 0.0011  -0.0926 0.0904  136 TYR B CE2 
2171 C CZ  . TYR B 138 ? 0.4407 0.5958 0.5499 0.0273  -0.0849 0.0863  136 TYR B CZ  
2172 O OH  . TYR B 138 ? 0.4467 0.6145 0.5624 0.0577  -0.0954 0.0844  136 TYR B OH  
2173 N N   . GLN B 139 ? 0.6810 0.8302 0.7562 -0.1107 -0.0716 0.0993  137 GLN B N   
2174 C CA  . GLN B 139 ? 0.7158 0.9155 0.8041 -0.1321 -0.0850 0.1038  137 GLN B CA  
2175 C C   . GLN B 139 ? 0.7290 0.9816 0.8383 -0.1513 -0.0785 0.1075  137 GLN B C   
2176 O O   . GLN B 139 ? 0.7328 1.0568 0.8707 -0.1595 -0.0864 0.1104  137 GLN B O   
2177 C CB  . GLN B 139 ? 0.7602 0.9156 0.8113 -0.1606 -0.0949 0.1055  137 GLN B CB  
2178 C CG  . GLN B 139 ? 0.8132 0.9838 0.8649 -0.1589 -0.1135 0.1066  137 GLN B CG  
2179 C CD  . GLN B 139 ? 0.8094 0.9713 0.8684 -0.1216 -0.1156 0.1033  137 GLN B CD  
2180 O OE1 . GLN B 139 ? 0.7856 0.8918 0.8225 -0.1085 -0.1065 0.0995  137 GLN B OE1 
2181 N NE2 . GLN B 139 ? 0.7927 1.0103 0.8810 -0.1048 -0.1282 0.1051  137 GLN B NE2 
2182 N N   . MET B 140 ? 0.6912 0.9125 0.7866 -0.1575 -0.0643 0.1074  138 MET B N   
2183 C CA  . MET B 140 ? 0.7159 0.9793 0.8239 -0.1786 -0.0569 0.1117  138 MET B CA  
2184 C C   . MET B 140 ? 0.6765 1.0046 0.8254 -0.1521 -0.0482 0.1089  138 MET B C   
2185 O O   . MET B 140 ? 0.7011 1.1004 0.8760 -0.1649 -0.0465 0.1116  138 MET B O   
2186 C CB  . MET B 140 ? 0.7380 0.9379 0.8102 -0.1942 -0.0467 0.1134  138 MET B CB  
2187 C CG  . MET B 140 ? 0.7610 1.0000 0.8445 -0.2106 -0.0363 0.1178  138 MET B CG  
2188 S SD  . MET B 140 ? 0.7928 0.9544 0.8380 -0.2119 -0.0243 0.1190  138 MET B SD  
2189 C CE  . MET B 140 ? 0.6023 0.8149 0.6883 -0.1740 -0.0086 0.1143  138 MET B CE  
2190 N N   . LEU B 141 ? 0.5482 0.8487 0.6985 -0.1175 -0.0411 0.1032  139 LEU B N   
2191 C CA  . LEU B 141 ? 0.5289 0.8787 0.7112 -0.0863 -0.0349 0.0985  139 LEU B CA  
2192 C C   . LEU B 141 ? 0.5183 0.9353 0.7319 -0.0725 -0.0472 0.0973  139 LEU B C   
2193 O O   . LEU B 141 ? 0.5315 1.0212 0.7771 -0.0635 -0.0431 0.0956  139 LEU B O   
2194 C CB  . LEU B 141 ? 0.5230 0.8195 0.6927 -0.0545 -0.0297 0.0928  139 LEU B CB  
2195 C CG  . LEU B 141 ? 0.5268 0.7659 0.6707 -0.0619 -0.0180 0.0935  139 LEU B CG  
2196 C CD1 . LEU B 141 ? 0.4241 0.6159 0.5561 -0.0348 -0.0154 0.0885  139 LEU B CD1 
2197 C CD2 . LEU B 141 ? 0.4511 0.7212 0.6043 -0.0709 -0.0053 0.0950  139 LEU B CD2 
2198 N N   . LYS B 142 ? 0.5529 0.9457 0.7561 -0.0680 -0.0622 0.0978  140 LYS B N   
2199 C CA  . LYS B 142 ? 0.5518 1.0042 0.7793 -0.0618 -0.0786 0.0989  140 LYS B CA  
2200 C C   . LYS B 142 ? 0.5512 1.0853 0.8047 -0.0915 -0.0803 0.1038  140 LYS B C   
2201 O O   . LYS B 142 ? 0.5197 1.1364 0.8114 -0.0750 -0.0829 0.1021  140 LYS B O   
2202 C CB  . LYS B 142 ? 0.5678 0.9710 0.7685 -0.0696 -0.0946 0.1013  140 LYS B CB  
2203 C CG  . LYS B 142 ? 0.6192 1.0583 0.8366 -0.0466 -0.1133 0.1012  140 LYS B CG  
2204 C CD  . LYS B 142 ? 0.6855 1.0548 0.8671 -0.0458 -0.1254 0.1022  140 LYS B CD  
2205 C CE  . LYS B 142 ? 0.7268 1.1302 0.9200 -0.0290 -0.1478 0.1042  140 LYS B CE  
2206 N NZ  . LYS B 142 ? 0.6923 1.1685 0.9262 0.0056  -0.1497 0.1011  140 LYS B NZ  
2207 N N   . LYS B 143 ? 0.9137 1.4232 1.1432 -0.1356 -0.0813 0.1099  141 LYS B N   
2208 C CA  . LYS B 143 ? 0.9224 1.4974 1.1659 -0.1755 -0.0829 0.1162  141 LYS B CA  
2209 C C   . LYS B 143 ? 0.9171 1.5684 1.1949 -0.1703 -0.0678 0.1149  141 LYS B C   
2210 O O   . LYS B 143 ? 0.9220 1.6616 1.2286 -0.1908 -0.0704 0.1185  141 LYS B O   
2211 C CB  . LYS B 143 ? 0.9540 1.4626 1.1522 -0.2207 -0.0813 0.1218  141 LYS B CB  
2212 C CG  . LYS B 143 ? 0.9932 1.4969 1.1722 -0.2573 -0.0996 0.1273  141 LYS B CG  
2213 C CD  . LYS B 143 ? 1.0551 1.4486 1.1791 -0.2665 -0.1024 0.1262  141 LYS B CD  
2214 C CE  . LYS B 143 ? 1.0678 1.4483 1.1791 -0.2709 -0.1220 0.1265  141 LYS B CE  
2215 N NZ  . LYS B 143 ? 1.0498 1.3338 1.1200 -0.2556 -0.1212 0.1214  141 LYS B NZ  
2216 N N   . GLN B 144 ? 0.5891 1.2040 0.8588 -0.1500 -0.0514 0.1104  142 GLN B N   
2217 C CA  . GLN B 144 ? 0.5940 1.2684 0.8873 -0.1468 -0.0346 0.1086  142 GLN B CA  
2218 C C   . GLN B 144 ? 0.5746 1.3030 0.9040 -0.0958 -0.0316 0.0993  142 GLN B C   
2219 O O   . GLN B 144 ? 0.5618 1.3393 0.9103 -0.0849 -0.0166 0.0953  142 GLN B O   
2220 C CB  . GLN B 144 ? 0.5874 1.1928 0.8488 -0.1537 -0.0192 0.1090  142 GLN B CB  
2221 C CG  . GLN B 144 ? 0.6148 1.1769 0.8396 -0.2039 -0.0192 0.1181  142 GLN B CG  
2222 C CD  . GLN B 144 ? 0.6696 1.1419 0.8568 -0.2002 -0.0098 0.1179  142 GLN B CD  
2223 O OE1 . GLN B 144 ? 0.6392 1.0720 0.8245 -0.1642 -0.0065 0.1115  142 GLN B OE1 
2224 N NE2 . GLN B 144 ? 0.7628 1.2019 0.9177 -0.2386 -0.0067 0.1254  142 GLN B NE2 
2225 N N   . GLY B 145 ? 0.5328 1.2435 0.8652 -0.0636 -0.0456 0.0956  143 GLY B N   
2226 C CA  . GLY B 145 ? 0.5509 1.3009 0.9096 -0.0122 -0.0460 0.0866  143 GLY B CA  
2227 C C   . GLY B 145 ? 0.5622 1.2542 0.9027 0.0176  -0.0325 0.0793  143 GLY B C   
2228 O O   . GLY B 145 ? 0.5657 1.2858 0.9219 0.0582  -0.0284 0.0706  143 GLY B O   
2229 N N   . ILE B 146 ? 0.5345 1.1430 0.8392 -0.0010 -0.0267 0.0823  144 ILE B N   
2230 C CA  . ILE B 146 ? 0.5358 1.0814 0.8192 0.0243  -0.0176 0.0765  144 ILE B CA  
2231 C C   . ILE B 146 ? 0.5758 1.0702 0.8446 0.0550  -0.0311 0.0731  144 ILE B C   
2232 O O   . ILE B 146 ? 0.5826 1.0712 0.8517 0.0926  -0.0307 0.0655  144 ILE B O   
2233 C CB  . ILE B 146 ? 0.5358 1.0142 0.7875 -0.0041 -0.0084 0.0812  144 ILE B CB  
2234 C CG1 . ILE B 146 ? 0.4907 1.0082 0.7474 -0.0417 0.0015  0.0872  144 ILE B CG1 
2235 C CG2 . ILE B 146 ? 0.4954 0.9231 0.7297 0.0203  0.0012  0.0754  144 ILE B CG2 
2236 C CD1 . ILE B 146 ? 0.3951 0.9098 0.6460 -0.0397 0.0190  0.0850  144 ILE B CD1 
2237 N N   . VAL B 147 ? 0.7072 1.1639 0.9595 0.0380  -0.0440 0.0786  145 VAL B N   
2238 C CA  . VAL B 147 ? 0.7393 1.1738 0.9843 0.0618  -0.0612 0.0774  145 VAL B CA  
2239 C C   . VAL B 147 ? 0.7652 1.2799 1.0441 0.0805  -0.0732 0.0761  145 VAL B C   
2240 O O   . VAL B 147 ? 0.7709 1.3341 1.0664 0.0566  -0.0817 0.0817  145 VAL B O   
2241 C CB  . VAL B 147 ? 0.7448 1.1243 0.9625 0.0368  -0.0714 0.0833  145 VAL B CB  
2242 C CG1 . VAL B 147 ? 0.7527 1.1034 0.9571 0.0609  -0.0888 0.0827  145 VAL B CG1 
2243 C CG2 . VAL B 147 ? 0.7392 1.0486 0.9267 0.0212  -0.0591 0.0839  145 VAL B CG2 
2244 N N   . LYS B 148 ? 0.7989 1.3287 1.0868 0.1232  -0.0738 0.0685  146 LYS B N   
2245 C CA  . LYS B 148 ? 0.8130 1.4001 1.1250 0.1550  -0.0890 0.0659  146 LYS B CA  
2246 C C   . LYS B 148 ? 0.8318 1.3846 1.1268 0.1557  -0.1121 0.0715  146 LYS B C   
2247 O O   . LYS B 148 ? 1.2546 1.8342 1.5580 0.1254  -0.1215 0.0787  146 LYS B O   
2248 C CB  . LYS B 148 ? 0.8277 1.4098 1.1379 0.2045  -0.0848 0.0553  146 LYS B CB  
2249 C CG  . LYS B 148 ? 0.8128 1.4432 1.1427 0.2062  -0.0623 0.0489  146 LYS B CG  
2250 C CD  . LYS B 148 ? 0.8287 1.4087 1.1344 0.2411  -0.0535 0.0390  146 LYS B CD  
2251 C CE  . LYS B 148 ? 0.8113 1.4065 1.1207 0.2249  -0.0298 0.0359  146 LYS B CE  
2252 N NZ  . LYS B 148 ? 0.8318 1.4164 1.1303 0.2658  -0.0210 0.0235  146 LYS B NZ  
2253 N N   . SER C 7   ? 0.9272 1.1041 0.9713 0.0585  -0.0178 -0.0531 7   SER C N   
2254 C CA  . SER C 7   ? 0.9126 1.0791 0.9569 0.0517  -0.0105 -0.0657 7   SER C CA  
2255 C C   . SER C 7   ? 0.8835 1.0502 0.9251 0.0334  -0.0169 -0.0733 7   SER C C   
2256 O O   . SER C 7   ? 0.9167 1.0768 0.9579 0.0255  -0.0120 -0.0836 7   SER C O   
2257 C CB  . SER C 7   ? 0.9201 1.1099 0.9768 0.0573  -0.0087 -0.0664 7   SER C CB  
2258 O OG  . SER C 7   ? 0.8967 1.0822 0.9551 0.0485  -0.0035 -0.0784 7   SER C OG  
2259 N N   . ASP C 8   ? 0.7137 0.8894 0.7538 0.0266  -0.0274 -0.0680 8   ASP C N   
2260 C CA  . ASP C 8   ? 0.6547 0.8210 0.6880 0.0111  -0.0319 -0.0737 8   ASP C CA  
2261 C C   . ASP C 8   ? 0.6192 0.7938 0.6500 0.0059  -0.0427 -0.0663 8   ASP C C   
2262 O O   . ASP C 8   ? 0.5708 0.7699 0.6087 0.0094  -0.0495 -0.0582 8   ASP C O   
2263 C CB  . ASP C 8   ? 0.6044 0.7845 0.6440 -0.0003 -0.0333 -0.0819 8   ASP C CB  
2264 C CG  . ASP C 8   ? 0.4923 0.6567 0.5235 -0.0144 -0.0335 -0.0895 8   ASP C CG  
2265 O OD1 . ASP C 8   ? 0.4053 0.5454 0.4250 -0.0152 -0.0313 -0.0900 8   ASP C OD1 
2266 O OD2 . ASP C 8   ? 0.3783 0.5547 0.4142 -0.0242 -0.0353 -0.0950 8   ASP C OD2 
2267 N N   . GLU C 9   ? 0.6171 0.7729 0.6379 -0.0036 -0.0442 -0.0696 9   GLU C N   
2268 C CA  . GLU C 9   ? 0.6043 0.7672 0.6225 -0.0121 -0.0542 -0.0649 9   GLU C CA  
2269 C C   . GLU C 9   ? 0.5647 0.7530 0.5907 -0.0225 -0.0617 -0.0660 9   GLU C C   
2270 O O   . GLU C 9   ? 0.5499 0.7456 0.5816 -0.0259 -0.0591 -0.0722 9   GLU C O   
2271 C CB  . GLU C 9   ? 0.5873 0.7235 0.5929 -0.0205 -0.0534 -0.0695 9   GLU C CB  
2272 C CG  . GLU C 9   ? 0.7141 0.8314 0.7113 -0.0125 -0.0516 -0.0639 9   GLU C CG  
2273 C CD  . GLU C 9   ? 0.7824 0.8699 0.7665 -0.0193 -0.0482 -0.0702 9   GLU C CD  
2274 O OE1 . GLU C 9   ? 0.6565 0.7426 0.6362 -0.0319 -0.0539 -0.0728 9   GLU C OE1 
2275 O OE2 . GLU C 9   ? 0.8427 0.9078 0.8203 -0.0120 -0.0394 -0.0724 9   GLU C OE2 
2276 N N   . ASP C 10  ? 0.4703 0.6713 0.4961 -0.0283 -0.0707 -0.0601 10  ASP C N   
2277 C CA  . ASP C 10  ? 0.4607 0.6783 0.4901 -0.0413 -0.0772 -0.0622 10  ASP C CA  
2278 C C   . ASP C 10  ? 0.4264 0.6249 0.4475 -0.0536 -0.0764 -0.0695 10  ASP C C   
2279 O O   . ASP C 10  ? 0.3949 0.5699 0.4061 -0.0541 -0.0742 -0.0707 10  ASP C O   
2280 C CB  . ASP C 10  ? 0.4577 0.6952 0.4888 -0.0442 -0.0862 -0.0539 10  ASP C CB  
2281 C CG  . ASP C 10  ? 0.5598 0.8196 0.5988 -0.0320 -0.0873 -0.0458 10  ASP C CG  
2282 O OD1 . ASP C 10  ? 0.5334 0.7991 0.5704 -0.0280 -0.0910 -0.0376 10  ASP C OD1 
2283 O OD2 . ASP C 10  ? 0.5869 0.8593 0.6342 -0.0262 -0.0843 -0.0473 10  ASP C OD2 
2284 N N   . LEU C 11  ? 0.4528 0.6623 0.4781 -0.0634 -0.0781 -0.0740 11  LEU C N   
2285 C CA  . LEU C 11  ? 0.4597 0.6560 0.4780 -0.0755 -0.0781 -0.0794 11  LEU C CA  
2286 C C   . LEU C 11  ? 0.4890 0.6770 0.4989 -0.0815 -0.0839 -0.0753 11  LEU C C   
2287 O O   . LEU C 11  ? 0.4911 0.6955 0.5039 -0.0841 -0.0905 -0.0695 11  LEU C O   
2288 C CB  . LEU C 11  ? 0.3911 0.6049 0.4164 -0.0843 -0.0798 -0.0826 11  LEU C CB  
2289 C CG  . LEU C 11  ? 0.3540 0.5569 0.3726 -0.0966 -0.0798 -0.0870 11  LEU C CG  
2290 C CD1 . LEU C 11  ? 0.2424 0.4213 0.2527 -0.0963 -0.0726 -0.0934 11  LEU C CD1 
2291 C CD2 . LEU C 11  ? 0.2538 0.4753 0.2801 -0.1041 -0.0808 -0.0892 11  LEU C CD2 
2292 N N   . LEU C 12  ? 0.4668 0.6299 0.4661 -0.0841 -0.0813 -0.0785 12  LEU C N   
2293 C CA  . LEU C 12  ? 0.4973 0.6502 0.4879 -0.0907 -0.0862 -0.0757 12  LEU C CA  
2294 C C   . LEU C 12  ? 0.5242 0.6827 0.5139 -0.1040 -0.0897 -0.0778 12  LEU C C   
2295 O O   . LEU C 12  ? 0.5416 0.6915 0.5284 -0.1097 -0.0860 -0.0838 12  LEU C O   
2296 C CB  . LEU C 12  ? 0.4695 0.5938 0.4487 -0.0891 -0.0818 -0.0789 12  LEU C CB  
2297 C CG  . LEU C 12  ? 0.4553 0.5650 0.4242 -0.0955 -0.0861 -0.0770 12  LEU C CG  
2298 C CD1 . LEU C 12  ? 0.4616 0.5810 0.4323 -0.0913 -0.0920 -0.0684 12  LEU C CD1 
2299 C CD2 . LEU C 12  ? 0.2977 0.3797 0.2556 -0.0939 -0.0807 -0.0815 12  LEU C CD2 
2300 N N   . GLU C 13  ? 0.7949 0.9683 0.7869 -0.1091 -0.0963 -0.0727 13  GLU C N   
2301 C CA  . GLU C 13  ? 0.8633 1.0390 0.8527 -0.1221 -0.0992 -0.0740 13  GLU C CA  
2302 C C   . GLU C 13  ? 0.9000 1.0526 0.8773 -0.1288 -0.0995 -0.0757 13  GLU C C   
2303 O O   . GLU C 13  ? 0.8977 1.0351 0.8699 -0.1307 -0.0919 -0.0785 13  GLU C O   
2304 C CB  . GLU C 13  ? 0.8444 1.0423 0.8387 -0.1264 -0.1054 -0.0685 13  GLU C CB  
2305 C CG  . GLU C 13  ? 0.9547 1.1774 0.9608 -0.1211 -0.1056 -0.0670 13  GLU C CG  
2306 C CD  . GLU C 13  ? 0.9984 1.2267 1.0097 -0.1251 -0.1021 -0.0724 13  GLU C CD  
2307 O OE1 . GLU C 13  ? 1.0453 1.2646 1.0514 -0.1329 -0.0977 -0.0727 13  GLU C OE1 
2308 O OE2 . GLU C 13  ? 0.9552 1.1955 0.9751 -0.1180 -0.0997 -0.0735 13  GLU C OE2 
2309 O OXT . GLU C 13  ? 0.9214 1.0681 0.8933 -0.1294 -0.1033 -0.0718 13  GLU C OXT 
2310 N N   . SER D 7   ? 1.0302 0.7563 1.3415 -0.1817 0.0724  0.2406  7   SER D N   
2311 C CA  . SER D 7   ? 1.0275 0.7887 1.3302 -0.1891 0.0651  0.2416  7   SER D CA  
2312 C C   . SER D 7   ? 0.9854 0.7830 1.2722 -0.1805 0.0686  0.2456  7   SER D C   
2313 O O   . SER D 7   ? 0.9848 0.7771 1.2577 -0.1643 0.0786  0.2402  7   SER D O   
2314 C CB  . SER D 7   ? 1.0464 0.8204 1.3720 -0.2102 0.0526  0.2555  7   SER D CB  
2315 O OG  . SER D 7   ? 1.0878 0.8881 1.4057 -0.2178 0.0454  0.2537  7   SER D OG  
2316 N N   . ASP D 8   ? 0.8181 0.6524 1.1058 -0.1910 0.0604  0.2542  8   ASP D N   
2317 C CA  . ASP D 8   ? 0.7639 0.6352 1.0344 -0.1835 0.0629  0.2565  8   ASP D CA  
2318 C C   . ASP D 8   ? 0.7177 0.6274 0.9974 -0.1992 0.0522  0.2706  8   ASP D C   
2319 O O   . ASP D 8   ? 0.6848 0.5939 0.9774 -0.2142 0.0430  0.2735  8   ASP D O   
2320 C CB  . ASP D 8   ? 0.7486 0.6206 0.9918 -0.1702 0.0684  0.2389  8   ASP D CB  
2321 C CG  . ASP D 8   ? 0.6585 0.5613 0.8819 -0.1580 0.0740  0.2393  8   ASP D CG  
2322 O OD1 . ASP D 8   ? 0.6039 0.5151 0.8319 -0.1541 0.0776  0.2492  8   ASP D OD1 
2323 O OD2 . ASP D 8   ? 0.5927 0.5106 0.7959 -0.1523 0.0747  0.2293  8   ASP D OD2 
2324 N N   . GLU D 9   ? 0.7226 0.6652 0.9964 -0.1959 0.0534  0.2795  9   GLU D N   
2325 C CA  . GLU D 9   ? 0.7123 0.6955 0.9894 -0.2081 0.0443  0.2907  9   GLU D CA  
2326 C C   . GLU D 9   ? 0.7125 0.7075 0.9756 -0.2105 0.0400  0.2802  9   GLU D C   
2327 O O   . GLU D 9   ? 0.7170 0.6915 0.9649 -0.2003 0.0453  0.2640  9   GLU D O   
2328 C CB  . GLU D 9   ? 0.6916 0.7070 0.9593 -0.2004 0.0483  0.2987  9   GLU D CB  
2329 C CG  . GLU D 9   ? 0.7431 0.7505 1.0250 -0.1988 0.0519  0.3103  9   GLU D CG  
2330 C CD  . GLU D 9   ? 0.8295 0.8304 1.1398 -0.2169 0.0431  0.3242  9   GLU D CD  
2331 O OE1 . GLU D 9   ? 0.7681 0.8000 1.0883 -0.2286 0.0357  0.3385  9   GLU D OE1 
2332 O OE2 . GLU D 9   ? 0.8694 0.8351 1.1918 -0.2202 0.0429  0.3203  9   GLU D OE2 
2333 N N   . ASP D 10  ? 0.6139 0.6413 0.8825 -0.2241 0.0304  0.2895  10  ASP D N   
2334 C CA  . ASP D 10  ? 0.6178 0.6664 0.8701 -0.2247 0.0269  0.2813  10  ASP D CA  
2335 C C   . ASP D 10  ? 0.5793 0.6592 0.8103 -0.2126 0.0321  0.2802  10  ASP D C   
2336 O O   . ASP D 10  ? 0.5838 0.6827 0.8188 -0.2113 0.0336  0.2919  10  ASP D O   
2337 C CB  . ASP D 10  ? 0.6579 0.7290 0.9252 -0.2449 0.0141  0.2919  10  ASP D CB  
2338 C CG  . ASP D 10  ? 0.7369 0.7789 1.0245 -0.2580 0.0079  0.2924  10  ASP D CG  
2339 O OD1 . ASP D 10  ? 0.8063 0.8618 1.1128 -0.2751 -0.0018 0.3054  10  ASP D OD1 
2340 O OD2 . ASP D 10  ? 0.8112 0.8169 1.0959 -0.2513 0.0127  0.2800  10  ASP D OD2 
2341 N N   . LEU D 11  ? 0.6106 0.7009 0.8209 -0.2064 0.0331  0.2678  11  LEU D N   
2342 C CA  . LEU D 11  ? 0.5994 0.7237 0.7897 -0.1971 0.0363  0.2669  11  LEU D CA  
2343 C C   . LEU D 11  ? 0.5683 0.7329 0.7684 -0.2091 0.0285  0.2842  11  LEU D C   
2344 O O   . LEU D 11  ? 0.5560 0.7393 0.7625 -0.2230 0.0189  0.2886  11  LEU D O   
2345 C CB  . LEU D 11  ? 0.5891 0.7188 0.7579 -0.1916 0.0365  0.2515  11  LEU D CB  
2346 C CG  . LEU D 11  ? 0.5903 0.7539 0.7363 -0.1810 0.0401  0.2489  11  LEU D CG  
2347 C CD1 . LEU D 11  ? 0.5462 0.7011 0.6793 -0.1623 0.0521  0.2450  11  LEU D CD1 
2348 C CD2 . LEU D 11  ? 0.6063 0.7747 0.7335 -0.1779 0.0390  0.2343  11  LEU D CD2 
2349 N N   . LEU D 12  ? 0.5307 0.7107 0.7294 -0.2023 0.0333  0.2929  12  LEU D N   
2350 C CA  . LEU D 12  ? 0.5212 0.7442 0.7207 -0.2084 0.0284  0.3061  12  LEU D CA  
2351 C C   . LEU D 12  ? 0.5737 0.8256 0.7539 -0.2068 0.0259  0.2989  12  LEU D C   
2352 O O   . LEU D 12  ? 0.5861 0.8444 0.7438 -0.1914 0.0333  0.2890  12  LEU D O   
2353 C CB  . LEU D 12  ? 0.4954 0.7275 0.6900 -0.1966 0.0364  0.3122  12  LEU D CB  
2354 C CG  . LEU D 12  ? 0.4806 0.7512 0.6829 -0.2040 0.0318  0.3296  12  LEU D CG  
2355 C CD1 . LEU D 12  ? 0.4892 0.7590 0.7201 -0.2234 0.0222  0.3450  12  LEU D CD1 
2356 C CD2 . LEU D 12  ? 0.4815 0.7564 0.6766 -0.1899 0.0411  0.3332  12  LEU D CD2 
2357 N N   . GLU D 13  ? 0.8934 1.1672 1.0827 -0.2228 0.0152  0.3058  13  GLU D N   
2358 C CA  . GLU D 13  ? 0.9568 1.2665 1.1302 -0.2231 0.0118  0.3034  13  GLU D CA  
2359 C C   . GLU D 13  ? 0.9772 1.3256 1.1486 -0.2224 0.0116  0.3163  13  GLU D C   
2360 O O   . GLU D 13  ? 0.9668 1.3236 1.1217 -0.2073 0.0199  0.3129  13  GLU D O   
2361 C CB  . GLU D 13  ? 0.9823 1.3003 1.1656 -0.2403 0.0004  0.3051  13  GLU D CB  
2362 C CG  . GLU D 13  ? 1.0971 1.4033 1.2642 -0.2359 0.0010  0.2876  13  GLU D CG  
2363 C CD  . GLU D 13  ? 1.1698 1.5105 1.3149 -0.2302 0.0009  0.2824  13  GLU D CD  
2364 O OE1 . GLU D 13  ? 1.1875 1.5570 1.3265 -0.2255 0.0030  0.2900  13  GLU D OE1 
2365 O OE2 . GLU D 13  ? 1.2002 1.5388 1.3338 -0.2299 -0.0010 0.2704  13  GLU D OE2 
2366 O OXT . GLU D 13  ? 1.0085 1.3813 1.1944 -0.2371 0.0029  0.3304  13  GLU D OXT 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -1  ?   ?   ?   A . n 
A 1 2   SER 2   0   ?   ?   ?   A . n 
A 1 3   MET 3   1   ?   ?   ?   A . n 
A 1 4   GLU 4   2   ?   ?   ?   A . n 
A 1 5   PRO 5   3   ?   ?   ?   A . n 
A 1 6   ALA 6   4   ?   ?   ?   A . n 
A 1 7   MET 7   5   ?   ?   ?   A . n 
A 1 8   GLU 8   6   ?   ?   ?   A . n 
A 1 9   PRO 9   7   7   PRO PRO A . n 
A 1 10  GLU 10  8   8   GLU GLU A . n 
A 1 11  THR 11  9   9   THR THR A . n 
A 1 12  LEU 12  10  10  LEU LEU A . n 
A 1 13  GLU 13  11  11  GLU GLU A . n 
A 1 14  ALA 14  12  12  ALA ALA A . n 
A 1 15  ARG 15  13  13  ARG ARG A . n 
A 1 16  ILE 16  14  14  ILE ILE A . n 
A 1 17  ASN 17  15  15  ASN ASN A . n 
A 1 18  ARG 18  16  16  ARG ARG A . n 
A 1 19  ALA 19  17  17  ALA ALA A . n 
A 1 20  THR 20  18  18  THR THR A . n 
A 1 21  ASN 21  19  19  ASN ASN A . n 
A 1 22  PRO 22  20  20  PRO PRO A . n 
A 1 23  LEU 23  21  21  LEU LEU A . n 
A 1 24  ASN 24  22  22  ASN ASN A . n 
A 1 25  LYS 25  23  23  LYS LYS A . n 
A 1 26  GLU 26  24  24  GLU GLU A . n 
A 1 27  LEU 27  25  25  LEU LEU A . n 
A 1 28  ASP 28  26  26  ASP ASP A . n 
A 1 29  TRP 29  27  27  TRP TRP A . n 
A 1 30  ALA 30  28  28  ALA ALA A . n 
A 1 31  SER 31  29  29  SER SER A . n 
A 1 32  ILE 32  30  30  ILE ILE A . n 
A 1 33  ASN 33  31  31  ASN ASN A . n 
A 1 34  GLY 34  32  32  GLY GLY A . n 
A 1 35  PHE 35  33  33  PHE PHE A . n 
A 1 36  CYS 36  34  34  CYS CYS A . n 
A 1 37  GLU 37  35  35  GLU GLU A . n 
A 1 38  GLN 38  36  36  GLN GLN A . n 
A 1 39  LEU 39  37  37  LEU LEU A . n 
A 1 40  ASN 40  38  38  ASN ASN A . n 
A 1 41  GLU 41  39  39  GLU GLU A . n 
A 1 42  ASP 42  40  40  ASP ASP A . n 
A 1 43  PHE 43  41  41  PHE PHE A . n 
A 1 44  GLU 44  42  42  GLU GLU A . n 
A 1 45  GLY 45  43  43  GLY GLY A . n 
A 1 46  PRO 46  44  44  PRO PRO A . n 
A 1 47  PRO 47  45  45  PRO PRO A . n 
A 1 48  LEU 48  46  46  LEU LEU A . n 
A 1 49  ALA 49  47  47  ALA ALA A . n 
A 1 50  THR 50  48  48  THR THR A . n 
A 1 51  ARG 51  49  49  ARG ARG A . n 
A 1 52  LEU 52  50  50  LEU LEU A . n 
A 1 53  LEU 53  51  51  LEU LEU A . n 
A 1 54  ALA 54  52  52  ALA ALA A . n 
A 1 55  HIS 55  53  53  HIS HIS A . n 
A 1 56  LYS 56  54  54  LYS LYS A . n 
A 1 57  ILE 57  55  55  ILE ILE A . n 
A 1 58  GLN 58  56  56  GLN GLN A . n 
A 1 59  SER 59  57  57  SER SER A . n 
A 1 60  PRO 60  58  58  PRO PRO A . n 
A 1 61  GLN 61  59  59  GLN GLN A . n 
A 1 62  GLU 62  60  60  GLU GLU A . n 
A 1 63  TRP 63  61  61  TRP TRP A . n 
A 1 64  GLU 64  62  62  GLU GLU A . n 
A 1 65  ALA 65  63  63  ALA ALA A . n 
A 1 66  ILE 66  64  64  ILE ILE A . n 
A 1 67  GLN 67  65  65  GLN GLN A . n 
A 1 68  ALA 68  66  66  ALA ALA A . n 
A 1 69  LEU 69  67  67  LEU LEU A . n 
A 1 70  THR 70  68  68  THR THR A . n 
A 1 71  VAL 71  69  69  VAL VAL A . n 
A 1 72  LEU 72  70  70  LEU LEU A . n 
A 1 73  GLU 73  71  71  GLU GLU A . n 
A 1 74  THR 74  72  72  THR THR A . n 
A 1 75  CYS 75  73  73  CYS CYS A . n 
A 1 76  MET 76  74  74  MET MET A . n 
A 1 77  LYS 77  75  75  LYS LYS A . n 
A 1 78  SER 78  76  76  SER SER A . n 
A 1 79  CYS 79  77  77  CYS CYS A . n 
A 1 80  GLY 80  78  78  GLY GLY A . n 
A 1 81  LYS 81  79  79  LYS LYS A . n 
A 1 82  ARG 82  80  80  ARG ARG A . n 
A 1 83  PHE 83  81  81  PHE PHE A . n 
A 1 84  HIS 84  82  82  HIS HIS A . n 
A 1 85  ASP 85  83  83  ASP ASP A . n 
A 1 86  GLU 86  84  84  GLU GLU A . n 
A 1 87  VAL 87  85  85  VAL VAL A . n 
A 1 88  GLY 88  86  86  GLY GLY A . n 
A 1 89  LYS 89  87  87  LYS LYS A . n 
A 1 90  PHE 90  88  88  PHE PHE A . n 
A 1 91  ARG 91  89  89  ARG ARG A . n 
A 1 92  PHE 92  90  90  PHE PHE A . n 
A 1 93  LEU 93  91  91  LEU LEU A . n 
A 1 94  ASN 94  92  92  ASN ASN A . n 
A 1 95  GLU 95  93  93  GLU GLU A . n 
A 1 96  LEU 96  94  94  LEU LEU A . n 
A 1 97  ILE 97  95  95  ILE ILE A . n 
A 1 98  LYS 98  96  96  LYS LYS A . n 
A 1 99  VAL 99  97  97  VAL VAL A . n 
A 1 100 VAL 100 98  98  VAL VAL A . n 
A 1 101 SER 101 99  99  SER SER A . n 
A 1 102 PRO 102 100 100 PRO PRO A . n 
A 1 103 LYS 103 101 101 LYS LYS A . n 
A 1 104 TYR 104 102 102 TYR TYR A . n 
A 1 105 LEU 105 103 103 LEU LEU A . n 
A 1 106 GLY 106 104 104 GLY GLY A . n 
A 1 107 SER 107 105 105 SER SER A . n 
A 1 108 ARG 108 106 106 ARG ARG A . n 
A 1 109 THR 109 107 107 THR THR A . n 
A 1 110 SER 110 108 108 SER SER A . n 
A 1 111 GLU 111 109 109 GLU GLU A . n 
A 1 112 LYS 112 110 110 LYS LYS A . n 
A 1 113 VAL 113 111 111 VAL VAL A . n 
A 1 114 LYS 114 112 112 LYS LYS A . n 
A 1 115 ASN 115 113 113 ASN ASN A . n 
A 1 116 LYS 116 114 114 LYS LYS A . n 
A 1 117 ILE 117 115 115 ILE ILE A . n 
A 1 118 LEU 118 116 116 LEU LEU A . n 
A 1 119 GLU 119 117 117 GLU GLU A . n 
A 1 120 LEU 120 118 118 LEU LEU A . n 
A 1 121 LEU 121 119 119 LEU LEU A . n 
A 1 122 TYR 122 120 120 TYR TYR A . n 
A 1 123 SER 123 121 121 SER SER A . n 
A 1 124 TRP 124 122 122 TRP TRP A . n 
A 1 125 THR 125 123 123 THR THR A . n 
A 1 126 VAL 126 124 124 VAL VAL A . n 
A 1 127 GLY 127 125 125 GLY GLY A . n 
A 1 128 LEU 128 126 126 LEU LEU A . n 
A 1 129 PRO 129 127 127 PRO PRO A . n 
A 1 130 GLU 130 128 128 GLU GLU A . n 
A 1 131 GLU 131 129 129 GLU GLU A . n 
A 1 132 VAL 132 130 130 VAL VAL A . n 
A 1 133 LYS 133 131 131 LYS LYS A . n 
A 1 134 ILE 134 132 132 ILE ILE A . n 
A 1 135 ALA 135 133 133 ALA ALA A . n 
A 1 136 GLU 136 134 134 GLU GLU A . n 
A 1 137 ALA 137 135 135 ALA ALA A . n 
A 1 138 TYR 138 136 136 TYR TYR A . n 
A 1 139 GLN 139 137 137 GLN GLN A . n 
A 1 140 MET 140 138 138 MET MET A . n 
A 1 141 LEU 141 139 139 LEU LEU A . n 
A 1 142 LYS 142 140 140 LYS LYS A . n 
A 1 143 LYS 143 141 141 LYS LYS A . n 
A 1 144 GLN 144 142 142 GLN GLN A . n 
A 1 145 GLY 145 143 143 GLY GLY A . n 
A 1 146 ILE 146 144 144 ILE ILE A . n 
A 1 147 VAL 147 145 145 VAL VAL A . n 
A 1 148 LYS 148 146 146 LYS LYS A . n 
A 1 149 SER 149 147 ?   ?   ?   A . n 
B 1 1   GLY 1   -1  ?   ?   ?   B . n 
B 1 2   SER 2   0   ?   ?   ?   B . n 
B 1 3   MET 3   1   ?   ?   ?   B . n 
B 1 4   GLU 4   2   ?   ?   ?   B . n 
B 1 5   PRO 5   3   ?   ?   ?   B . n 
B 1 6   ALA 6   4   ?   ?   ?   B . n 
B 1 7   MET 7   5   ?   ?   ?   B . n 
B 1 8   GLU 8   6   ?   ?   ?   B . n 
B 1 9   PRO 9   7   7   PRO PRO B . n 
B 1 10  GLU 10  8   8   GLU GLU B . n 
B 1 11  THR 11  9   9   THR THR B . n 
B 1 12  LEU 12  10  10  LEU LEU B . n 
B 1 13  GLU 13  11  11  GLU GLU B . n 
B 1 14  ALA 14  12  12  ALA ALA B . n 
B 1 15  ARG 15  13  13  ARG ARG B . n 
B 1 16  ILE 16  14  14  ILE ILE B . n 
B 1 17  ASN 17  15  15  ASN ASN B . n 
B 1 18  ARG 18  16  16  ARG ARG B . n 
B 1 19  ALA 19  17  17  ALA ALA B . n 
B 1 20  THR 20  18  18  THR THR B . n 
B 1 21  ASN 21  19  19  ASN ASN B . n 
B 1 22  PRO 22  20  20  PRO PRO B . n 
B 1 23  LEU 23  21  21  LEU LEU B . n 
B 1 24  ASN 24  22  22  ASN ASN B . n 
B 1 25  LYS 25  23  23  LYS LYS B . n 
B 1 26  GLU 26  24  24  GLU GLU B . n 
B 1 27  LEU 27  25  25  LEU LEU B . n 
B 1 28  ASP 28  26  26  ASP ASP B . n 
B 1 29  TRP 29  27  27  TRP TRP B . n 
B 1 30  ALA 30  28  28  ALA ALA B . n 
B 1 31  SER 31  29  29  SER SER B . n 
B 1 32  ILE 32  30  30  ILE ILE B . n 
B 1 33  ASN 33  31  31  ASN ASN B . n 
B 1 34  GLY 34  32  32  GLY GLY B . n 
B 1 35  PHE 35  33  33  PHE PHE B . n 
B 1 36  CYS 36  34  34  CYS CYS B . n 
B 1 37  GLU 37  35  35  GLU GLU B . n 
B 1 38  GLN 38  36  36  GLN GLN B . n 
B 1 39  LEU 39  37  37  LEU LEU B . n 
B 1 40  ASN 40  38  38  ASN ASN B . n 
B 1 41  GLU 41  39  39  GLU GLU B . n 
B 1 42  ASP 42  40  40  ASP ASP B . n 
B 1 43  PHE 43  41  41  PHE PHE B . n 
B 1 44  GLU 44  42  42  GLU GLU B . n 
B 1 45  GLY 45  43  43  GLY GLY B . n 
B 1 46  PRO 46  44  44  PRO PRO B . n 
B 1 47  PRO 47  45  45  PRO PRO B . n 
B 1 48  LEU 48  46  46  LEU LEU B . n 
B 1 49  ALA 49  47  47  ALA ALA B . n 
B 1 50  THR 50  48  48  THR THR B . n 
B 1 51  ARG 51  49  49  ARG ARG B . n 
B 1 52  LEU 52  50  50  LEU LEU B . n 
B 1 53  LEU 53  51  51  LEU LEU B . n 
B 1 54  ALA 54  52  52  ALA ALA B . n 
B 1 55  HIS 55  53  53  HIS HIS B . n 
B 1 56  LYS 56  54  54  LYS LYS B . n 
B 1 57  ILE 57  55  55  ILE ILE B . n 
B 1 58  GLN 58  56  56  GLN GLN B . n 
B 1 59  SER 59  57  57  SER SER B . n 
B 1 60  PRO 60  58  58  PRO PRO B . n 
B 1 61  GLN 61  59  59  GLN GLN B . n 
B 1 62  GLU 62  60  60  GLU GLU B . n 
B 1 63  TRP 63  61  61  TRP TRP B . n 
B 1 64  GLU 64  62  62  GLU GLU B . n 
B 1 65  ALA 65  63  63  ALA ALA B . n 
B 1 66  ILE 66  64  64  ILE ILE B . n 
B 1 67  GLN 67  65  65  GLN GLN B . n 
B 1 68  ALA 68  66  66  ALA ALA B . n 
B 1 69  LEU 69  67  67  LEU LEU B . n 
B 1 70  THR 70  68  68  THR THR B . n 
B 1 71  VAL 71  69  69  VAL VAL B . n 
B 1 72  LEU 72  70  70  LEU LEU B . n 
B 1 73  GLU 73  71  71  GLU GLU B . n 
B 1 74  THR 74  72  72  THR THR B . n 
B 1 75  CYS 75  73  73  CYS CYS B . n 
B 1 76  MET 76  74  74  MET MET B . n 
B 1 77  LYS 77  75  75  LYS LYS B . n 
B 1 78  SER 78  76  76  SER SER B . n 
B 1 79  CYS 79  77  77  CYS CYS B . n 
B 1 80  GLY 80  78  78  GLY GLY B . n 
B 1 81  LYS 81  79  79  LYS LYS B . n 
B 1 82  ARG 82  80  80  ARG ARG B . n 
B 1 83  PHE 83  81  81  PHE PHE B . n 
B 1 84  HIS 84  82  82  HIS HIS B . n 
B 1 85  ASP 85  83  83  ASP ASP B . n 
B 1 86  GLU 86  84  84  GLU GLU B . n 
B 1 87  VAL 87  85  85  VAL VAL B . n 
B 1 88  GLY 88  86  86  GLY GLY B . n 
B 1 89  LYS 89  87  87  LYS LYS B . n 
B 1 90  PHE 90  88  88  PHE PHE B . n 
B 1 91  ARG 91  89  89  ARG ARG B . n 
B 1 92  PHE 92  90  90  PHE PHE B . n 
B 1 93  LEU 93  91  91  LEU LEU B . n 
B 1 94  ASN 94  92  92  ASN ASN B . n 
B 1 95  GLU 95  93  93  GLU GLU B . n 
B 1 96  LEU 96  94  94  LEU LEU B . n 
B 1 97  ILE 97  95  95  ILE ILE B . n 
B 1 98  LYS 98  96  96  LYS LYS B . n 
B 1 99  VAL 99  97  97  VAL VAL B . n 
B 1 100 VAL 100 98  98  VAL VAL B . n 
B 1 101 SER 101 99  99  SER SER B . n 
B 1 102 PRO 102 100 100 PRO PRO B . n 
B 1 103 LYS 103 101 101 LYS LYS B . n 
B 1 104 TYR 104 102 102 TYR TYR B . n 
B 1 105 LEU 105 103 103 LEU LEU B . n 
B 1 106 GLY 106 104 104 GLY GLY B . n 
B 1 107 SER 107 105 105 SER SER B . n 
B 1 108 ARG 108 106 106 ARG ARG B . n 
B 1 109 THR 109 107 107 THR THR B . n 
B 1 110 SER 110 108 108 SER SER B . n 
B 1 111 GLU 111 109 109 GLU GLU B . n 
B 1 112 LYS 112 110 110 LYS LYS B . n 
B 1 113 VAL 113 111 111 VAL VAL B . n 
B 1 114 LYS 114 112 112 LYS LYS B . n 
B 1 115 ASN 115 113 113 ASN ASN B . n 
B 1 116 LYS 116 114 114 LYS LYS B . n 
B 1 117 ILE 117 115 115 ILE ILE B . n 
B 1 118 LEU 118 116 116 LEU LEU B . n 
B 1 119 GLU 119 117 117 GLU GLU B . n 
B 1 120 LEU 120 118 118 LEU LEU B . n 
B 1 121 LEU 121 119 119 LEU LEU B . n 
B 1 122 TYR 122 120 120 TYR TYR B . n 
B 1 123 SER 123 121 121 SER SER B . n 
B 1 124 TRP 124 122 122 TRP TRP B . n 
B 1 125 THR 125 123 123 THR THR B . n 
B 1 126 VAL 126 124 124 VAL VAL B . n 
B 1 127 GLY 127 125 125 GLY GLY B . n 
B 1 128 LEU 128 126 126 LEU LEU B . n 
B 1 129 PRO 129 127 127 PRO PRO B . n 
B 1 130 GLU 130 128 128 GLU GLU B . n 
B 1 131 GLU 131 129 129 GLU GLU B . n 
B 1 132 VAL 132 130 130 VAL VAL B . n 
B 1 133 LYS 133 131 131 LYS LYS B . n 
B 1 134 ILE 134 132 132 ILE ILE B . n 
B 1 135 ALA 135 133 133 ALA ALA B . n 
B 1 136 GLU 136 134 134 GLU GLU B . n 
B 1 137 ALA 137 135 135 ALA ALA B . n 
B 1 138 TYR 138 136 136 TYR TYR B . n 
B 1 139 GLN 139 137 137 GLN GLN B . n 
B 1 140 MET 140 138 138 MET MET B . n 
B 1 141 LEU 141 139 139 LEU LEU B . n 
B 1 142 LYS 142 140 140 LYS LYS B . n 
B 1 143 LYS 143 141 141 LYS LYS B . n 
B 1 144 GLN 144 142 142 GLN GLN B . n 
B 1 145 GLY 145 143 143 GLY GLY B . n 
B 1 146 ILE 146 144 144 ILE ILE B . n 
B 1 147 VAL 147 145 145 VAL VAL B . n 
B 1 148 LYS 148 146 146 LYS LYS B . n 
B 1 149 SER 149 147 ?   ?   ?   B . n 
C 2 1   SER 1   1   ?   ?   ?   C . n 
C 2 2   GLY 2   2   ?   ?   ?   C . n 
C 2 3   TYR 3   3   ?   ?   ?   C . n 
C 2 4   HIS 4   4   ?   ?   ?   C . n 
C 2 5   ASP 5   5   ?   ?   ?   C . n 
C 2 6   ASP 6   6   ?   ?   ?   C . n 
C 2 7   SER 7   7   7   SER SER C . n 
C 2 8   ASP 8   8   8   ASP ASP C . n 
C 2 9   GLU 9   9   9   GLU GLU C . n 
C 2 10  ASP 10  10  10  ASP ASP C . n 
C 2 11  LEU 11  11  11  LEU LEU C . n 
C 2 12  LEU 12  12  12  LEU LEU C . n 
C 2 13  GLU 13  13  13  GLU GLU C . n 
D 2 1   SER 1   1   ?   ?   ?   D . n 
D 2 2   GLY 2   2   ?   ?   ?   D . n 
D 2 3   TYR 3   3   ?   ?   ?   D . n 
D 2 4   HIS 4   4   ?   ?   ?   D . n 
D 2 5   ASP 5   5   ?   ?   ?   D . n 
D 2 6   ASP 6   6   ?   ?   ?   D . n 
D 2 7   SER 7   7   7   SER SER D . n 
D 2 8   ASP 8   8   8   ASP ASP D . n 
D 2 9   GLU 9   9   9   GLU GLU D . n 
D 2 10  ASP 10  10  10  ASP ASP D . n 
D 2 11  LEU 11  11  11  LEU LEU D . n 
D 2 12  LEU 12  12  12  LEU LEU D . n 
D 2 13  GLU 13  13  13  GLU GLU D . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E,F,G,H,J,L 
2 1 B,D,I,K,M       
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1090 ? 
1 MORE         -2   ? 
1 'SSA (A^2)'  7760 ? 
2 'ABSA (A^2)' 1100 ? 
2 MORE         -4   ? 
2 'SSA (A^2)'  8310 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-12-15 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2014-02-05 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Database references'       
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 7.9323  -8.8986  -4.4834  0.0446 0.1117 0.0945 0.0156  -0.0170 0.0123  2.1802 2.0974  3.3020 1.0719 -0.2795 0.2974  
0.0704  -0.1615 -0.0331 -0.1023 0.1384  0.0960  -0.0399 -0.2038 -0.0882 'X-RAY DIFFRACTION' 
2 ? refined 7.7252  -1.5753  -29.2797 0.1158 0.0555 0.1415 0.0235  0.0243  0.0761  1.2146 1.9842  5.6330 0.6273 0.8756  0.0076  
-0.1000 0.0435  -0.0052 -0.0711 -0.0327 0.1108  -0.1355 -0.0863 -0.0976 'X-RAY DIFFRACTION' 
3 ? refined -6.6136 -15.0573 -9.7708  0.2186 0.4003 0.2349 -0.0513 -0.0717 -0.0725 0.5335 -0.2402 0.9070 0.2072 -0.5660 -0.1368 
0.1009  0.0859  0.0344  0.0015  0.2580  0.1949  -0.1300 -0.3106 -0.4816 'X-RAY DIFFRACTION' 
4 ? refined 0.5820  -16.7458 -30.1765 0.4939 0.5728 0.7248 -0.2074 0.0360  0.2828  0.0105 0.0255  0.0429 0.0069 0.0155  0.0185  
0.2251  -0.0976 -0.0000 -0.2030 -0.7270 -0.1533 -0.2868 0.2915  -0.6735 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.pdbx_refine_id 
1 1 ? ? ? ? ? ? ? ? ? 'chain A' 'X-RAY DIFFRACTION' 
2 2 ? ? ? ? ? ? ? ? ? 'chain B' 'X-RAY DIFFRACTION' 
3 3 ? ? ? ? ? ? ? ? ? 'chain C' 'X-RAY DIFFRACTION' 
4 4 ? ? ? ? ? ? ? ? ? 'chain D' 'X-RAY DIFFRACTION' 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
PHENIX      ?     ?               package 'Paul D. Adams' PDAdams@lbl.gov       refinement        http://www.phenix-online.org/ 
C++ ? 1 
PDB_EXTRACT 3.006 'June 11, 2008' package PDB             help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 2 
XDS         .     ?               ?       ?               ?                     'data scaling'    ? ?   ? 3 
XDS         .     ?               ?       ?               ?                     'data reduction'  ? ?   ? 4 
XSCALE      .     ?               ?       ?               ?                     'data scaling'    ? ?   ? 5 
PHASER      .     ?               ?       ?               ?                     phasing           ? ?   ? 6 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             N 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             GLY 
_pdbx_validate_rmsd_angle.auth_seq_id_1              78 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             GLY 
_pdbx_validate_rmsd_angle.auth_seq_id_2              78 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             C 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             GLY 
_pdbx_validate_rmsd_angle.auth_seq_id_3              78 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                97.74 
_pdbx_validate_rmsd_angle.angle_target_value         113.10 
_pdbx_validate_rmsd_angle.angle_deviation            -15.36 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR A 102 ? ? -114.03 -104.15 
2 1 TYR B 102 ? ? -116.69 -101.62 
3 1 ASP C 8   ? ? -172.51 149.90  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 CYS A 77  ? ? GLY A 78  ? ? 115.98 
2 1 GLY A 78  ? ? LYS A 79  ? ? 100.57 
3 1 VAL A 145 ? ? LYS A 146 ? ? -31.17 
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             GLY 
_pdbx_validate_main_chain_plane.auth_asym_id             A 
_pdbx_validate_main_chain_plane.auth_seq_id              78 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   13.81 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -1  ? A GLY 1   
2  1 Y 1 A SER 0   ? A SER 2   
3  1 Y 1 A MET 1   ? A MET 3   
4  1 Y 1 A GLU 2   ? A GLU 4   
5  1 Y 1 A PRO 3   ? A PRO 5   
6  1 Y 1 A ALA 4   ? A ALA 6   
7  1 Y 1 A MET 5   ? A MET 7   
8  1 Y 1 A GLU 6   ? A GLU 8   
9  1 Y 1 A SER 147 ? A SER 149 
10 1 Y 1 B GLY -1  ? B GLY 1   
11 1 Y 1 B SER 0   ? B SER 2   
12 1 Y 1 B MET 1   ? B MET 3   
13 1 Y 1 B GLU 2   ? B GLU 4   
14 1 Y 1 B PRO 3   ? B PRO 5   
15 1 Y 1 B ALA 4   ? B ALA 6   
16 1 Y 1 B MET 5   ? B MET 7   
17 1 Y 1 B GLU 6   ? B GLU 8   
18 1 Y 1 B SER 147 ? B SER 149 
19 1 Y 1 C SER 1   ? C SER 1   
20 1 Y 1 C GLY 2   ? C GLY 2   
21 1 Y 1 C TYR 3   ? C TYR 3   
22 1 Y 1 C HIS 4   ? C HIS 4   
23 1 Y 1 C ASP 5   ? C ASP 5   
24 1 Y 1 C ASP 6   ? C ASP 6   
25 1 Y 1 D SER 1   ? D SER 1   
26 1 Y 1 D GLY 2   ? D GLY 2   
27 1 Y 1 D TYR 3   ? D TYR 3   
28 1 Y 1 D HIS 4   ? D HIS 4   
29 1 Y 1 D ASP 5   ? D ASP 5   
30 1 Y 1 D ASP 6   ? D ASP 6   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'IODIDE ION' IOD 
4 water        HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 IOD 1  148 1   IOD IOD A . 
F 3 IOD 1  149 2   IOD IOD A . 
G 3 IOD 1  150 3   IOD IOD A . 
H 3 IOD 1  151 5   IOD IOD A . 
I 3 IOD 1  148 4   IOD IOD B . 
J 4 HOH 1  152 152 HOH HOH A . 
J 4 HOH 2  153 153 HOH HOH A . 
J 4 HOH 3  154 4   HOH HOH A . 
J 4 HOH 4  155 5   HOH HOH A . 
J 4 HOH 5  156 156 HOH HOH A . 
J 4 HOH 6  157 6   HOH HOH A . 
J 4 HOH 7  158 158 HOH HOH A . 
J 4 HOH 8  159 7   HOH HOH A . 
J 4 HOH 9  160 160 HOH HOH A . 
J 4 HOH 10 161 8   HOH HOH A . 
J 4 HOH 11 162 13  HOH HOH A . 
J 4 HOH 12 163 14  HOH HOH A . 
J 4 HOH 13 164 15  HOH HOH A . 
J 4 HOH 14 165 16  HOH HOH A . 
J 4 HOH 15 166 19  HOH HOH A . 
J 4 HOH 16 167 22  HOH HOH A . 
J 4 HOH 17 168 23  HOH HOH A . 
J 4 HOH 18 169 27  HOH HOH A . 
J 4 HOH 19 170 28  HOH HOH A . 
J 4 HOH 20 171 29  HOH HOH A . 
J 4 HOH 21 172 30  HOH HOH A . 
J 4 HOH 22 173 32  HOH HOH A . 
J 4 HOH 23 174 37  HOH HOH A . 
J 4 HOH 24 175 45  HOH HOH A . 
J 4 HOH 25 176 46  HOH HOH A . 
J 4 HOH 26 177 50  HOH HOH A . 
J 4 HOH 27 178 53  HOH HOH A . 
J 4 HOH 28 179 54  HOH HOH A . 
J 4 HOH 29 180 56  HOH HOH A . 
J 4 HOH 30 181 57  HOH HOH A . 
J 4 HOH 31 182 59  HOH HOH A . 
J 4 HOH 32 183 62  HOH HOH A . 
J 4 HOH 33 184 64  HOH HOH A . 
J 4 HOH 34 185 65  HOH HOH A . 
J 4 HOH 35 186 66  HOH HOH A . 
J 4 HOH 36 187 67  HOH HOH A . 
J 4 HOH 37 188 69  HOH HOH A . 
J 4 HOH 38 189 70  HOH HOH A . 
J 4 HOH 39 190 71  HOH HOH A . 
J 4 HOH 40 191 75  HOH HOH A . 
J 4 HOH 41 192 79  HOH HOH A . 
J 4 HOH 42 193 80  HOH HOH A . 
J 4 HOH 43 194 82  HOH HOH A . 
J 4 HOH 44 195 84  HOH HOH A . 
J 4 HOH 45 196 87  HOH HOH A . 
J 4 HOH 46 197 89  HOH HOH A . 
J 4 HOH 47 198 91  HOH HOH A . 
J 4 HOH 48 199 92  HOH HOH A . 
J 4 HOH 49 200 93  HOH HOH A . 
J 4 HOH 50 201 97  HOH HOH A . 
J 4 HOH 51 202 99  HOH HOH A . 
J 4 HOH 52 203 101 HOH HOH A . 
J 4 HOH 53 204 102 HOH HOH A . 
J 4 HOH 54 205 104 HOH HOH A . 
J 4 HOH 55 206 105 HOH HOH A . 
J 4 HOH 56 207 107 HOH HOH A . 
J 4 HOH 57 208 110 HOH HOH A . 
J 4 HOH 58 209 111 HOH HOH A . 
J 4 HOH 59 210 112 HOH HOH A . 
J 4 HOH 60 211 115 HOH HOH A . 
J 4 HOH 61 212 116 HOH HOH A . 
J 4 HOH 62 213 118 HOH HOH A . 
J 4 HOH 63 214 119 HOH HOH A . 
J 4 HOH 64 215 120 HOH HOH A . 
J 4 HOH 65 216 121 HOH HOH A . 
J 4 HOH 66 217 122 HOH HOH A . 
J 4 HOH 67 218 125 HOH HOH A . 
J 4 HOH 68 219 127 HOH HOH A . 
J 4 HOH 69 220 130 HOH HOH A . 
J 4 HOH 70 221 131 HOH HOH A . 
J 4 HOH 71 222 132 HOH HOH A . 
J 4 HOH 72 223 133 HOH HOH A . 
J 4 HOH 73 224 136 HOH HOH A . 
J 4 HOH 74 225 145 HOH HOH A . 
J 4 HOH 75 226 146 HOH HOH A . 
J 4 HOH 76 227 151 HOH HOH A . 
J 4 HOH 77 228 141 HOH HOH A . 
K 4 HOH 1  149 149 HOH HOH B . 
K 4 HOH 2  150 150 HOH HOH B . 
K 4 HOH 3  151 3   HOH HOH B . 
K 4 HOH 4  152 9   HOH HOH B . 
K 4 HOH 5  153 10  HOH HOH B . 
K 4 HOH 6  154 11  HOH HOH B . 
K 4 HOH 7  155 17  HOH HOH B . 
K 4 HOH 8  156 18  HOH HOH B . 
K 4 HOH 9  157 157 HOH HOH B . 
K 4 HOH 10 158 20  HOH HOH B . 
K 4 HOH 11 159 159 HOH HOH B . 
K 4 HOH 12 160 21  HOH HOH B . 
K 4 HOH 13 161 26  HOH HOH B . 
K 4 HOH 14 162 31  HOH HOH B . 
K 4 HOH 15 163 33  HOH HOH B . 
K 4 HOH 16 164 34  HOH HOH B . 
K 4 HOH 17 165 35  HOH HOH B . 
K 4 HOH 18 166 36  HOH HOH B . 
K 4 HOH 19 167 38  HOH HOH B . 
K 4 HOH 20 168 39  HOH HOH B . 
K 4 HOH 21 169 40  HOH HOH B . 
K 4 HOH 22 170 42  HOH HOH B . 
K 4 HOH 23 171 43  HOH HOH B . 
K 4 HOH 24 172 44  HOH HOH B . 
K 4 HOH 25 173 47  HOH HOH B . 
K 4 HOH 26 174 48  HOH HOH B . 
K 4 HOH 27 175 49  HOH HOH B . 
K 4 HOH 28 176 52  HOH HOH B . 
K 4 HOH 29 177 55  HOH HOH B . 
K 4 HOH 30 178 61  HOH HOH B . 
K 4 HOH 31 179 63  HOH HOH B . 
K 4 HOH 32 180 68  HOH HOH B . 
K 4 HOH 33 181 72  HOH HOH B . 
K 4 HOH 34 182 73  HOH HOH B . 
K 4 HOH 35 183 74  HOH HOH B . 
K 4 HOH 36 184 76  HOH HOH B . 
K 4 HOH 37 185 77  HOH HOH B . 
K 4 HOH 38 186 81  HOH HOH B . 
K 4 HOH 39 187 85  HOH HOH B . 
K 4 HOH 40 188 88  HOH HOH B . 
K 4 HOH 41 189 94  HOH HOH B . 
K 4 HOH 42 190 96  HOH HOH B . 
K 4 HOH 43 191 98  HOH HOH B . 
K 4 HOH 44 192 100 HOH HOH B . 
K 4 HOH 45 193 103 HOH HOH B . 
K 4 HOH 46 194 106 HOH HOH B . 
K 4 HOH 47 195 108 HOH HOH B . 
K 4 HOH 48 196 109 HOH HOH B . 
K 4 HOH 49 197 114 HOH HOH B . 
K 4 HOH 50 198 117 HOH HOH B . 
K 4 HOH 51 199 123 HOH HOH B . 
K 4 HOH 52 200 124 HOH HOH B . 
K 4 HOH 53 201 134 HOH HOH B . 
K 4 HOH 54 202 138 HOH HOH B . 
K 4 HOH 55 203 139 HOH HOH B . 
K 4 HOH 56 204 140 HOH HOH B . 
K 4 HOH 57 206 142 HOH HOH B . 
K 4 HOH 58 207 143 HOH HOH B . 
K 4 HOH 59 208 144 HOH HOH B . 
K 4 HOH 60 209 147 HOH HOH B . 
K 4 HOH 61 210 148 HOH HOH B . 
L 4 HOH 1  24  24  HOH HOH C . 
L 4 HOH 2  51  51  HOH HOH C . 
L 4 HOH 3  86  86  HOH HOH C . 
L 4 HOH 4  95  95  HOH HOH C . 
L 4 HOH 5  161 161 HOH HOH C . 
M 4 HOH 1  41  41  HOH HOH D . 
M 4 HOH 2  90  90  HOH HOH D . 
M 4 HOH 3  126 126 HOH HOH D . 
M 4 HOH 4  129 129 HOH HOH D . 
#