data_3G2V
# 
_entry.id   3G2V 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3G2V         
RCSB  RCSB051353   
WWPDB D_1000051353 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3G2S . unspecified 
PDB 3G2T . unspecified 
PDB 3G2U . unspecified 
PDB 3G2W . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3G2V 
_pdbx_database_status.recvd_initial_deposition_date   2009-02-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Cramer, J.F.'     1 
'Behrens, M.A.'    2 
'Gustafsen, C.'    3 
'Oliveira, C.L.P.' 4 
'Pedersen, J.S.'   5 
'Madsen, P.'       6 
'Petersen, C.M.'   7 
'Thirup, S.S.'     8 
# 
_citation.id                        primary 
_citation.title                     'GGA autoinhibition revisited' 
_citation.journal_abbrev            Traffic 
_citation.journal_volume            11 
_citation.page_first                259 
_citation.page_last                 273 
_citation.year                      2010 
_citation.journal_id_ASTM           ? 
_citation.country                   DK 
_citation.journal_id_ISSN           1398-9219 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20015111 
_citation.pdbx_database_id_DOI      10.1111/j.1600-0854.2009.01017.x 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Cramer, J.F.'     1 
primary 'Gustafsen, C.'    2 
primary 'Behrens, M.A.'    3 
primary 'Oliveira, C.L.P.' 4 
primary 'Pedersen, J.S.'   5 
primary 'Madsen, P.'       6 
primary 'Petersen, C.M.'   7 
primary 'Thirup, S.S.'     8 
# 
_cell.entry_id           3G2V 
_cell.length_a           48.000 
_cell.length_b           72.900 
_cell.length_c           102.500 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3G2V 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ADP-ribosylation factor-binding protein GGA1' 16958.564 2   ? ? 'VHS Domain (N-terminal domain)' ? 
2 polymer     syn 'C-terminal fragment of Sortilin'              1575.417  2   ? ? ?                                ? 
3 non-polymer syn 'IODIDE ION'                                   126.904   5   ? ? ?                                ? 
4 water       nat water                                          18.015    153 ? ? ?                                ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Golgi-localized, gamma ear-containing, ARF-binding protein 1, Gamma-adaptin-related protein 1' 
2 'neurotensin receptor 3, NTS3, NTR3, NT3'                                                       
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;GSMEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQEWEAIQALTVLETCMKSCG
KRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLYSWTVGLPEEVKIAEAYQMLKKQGIVKS
;
;GSMEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQEWEAIQALTVLETCMKSCG
KRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLYSWTVGLPEEVKIAEAYQMLKKQGIVKS
;
A,B ? 
2 'polypeptide(L)' no yes 'SGYHDD(SEP)DEDLLE' SGYHDDSDEDLLE C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   MET n 
1 4   GLU n 
1 5   PRO n 
1 6   ALA n 
1 7   MET n 
1 8   GLU n 
1 9   PRO n 
1 10  GLU n 
1 11  THR n 
1 12  LEU n 
1 13  GLU n 
1 14  ALA n 
1 15  ARG n 
1 16  ILE n 
1 17  ASN n 
1 18  ARG n 
1 19  ALA n 
1 20  THR n 
1 21  ASN n 
1 22  PRO n 
1 23  LEU n 
1 24  ASN n 
1 25  LYS n 
1 26  GLU n 
1 27  LEU n 
1 28  ASP n 
1 29  TRP n 
1 30  ALA n 
1 31  SER n 
1 32  ILE n 
1 33  ASN n 
1 34  GLY n 
1 35  PHE n 
1 36  CYS n 
1 37  GLU n 
1 38  GLN n 
1 39  LEU n 
1 40  ASN n 
1 41  GLU n 
1 42  ASP n 
1 43  PHE n 
1 44  GLU n 
1 45  GLY n 
1 46  PRO n 
1 47  PRO n 
1 48  LEU n 
1 49  ALA n 
1 50  THR n 
1 51  ARG n 
1 52  LEU n 
1 53  LEU n 
1 54  ALA n 
1 55  HIS n 
1 56  LYS n 
1 57  ILE n 
1 58  GLN n 
1 59  SER n 
1 60  PRO n 
1 61  GLN n 
1 62  GLU n 
1 63  TRP n 
1 64  GLU n 
1 65  ALA n 
1 66  ILE n 
1 67  GLN n 
1 68  ALA n 
1 69  LEU n 
1 70  THR n 
1 71  VAL n 
1 72  LEU n 
1 73  GLU n 
1 74  THR n 
1 75  CYS n 
1 76  MET n 
1 77  LYS n 
1 78  SER n 
1 79  CYS n 
1 80  GLY n 
1 81  LYS n 
1 82  ARG n 
1 83  PHE n 
1 84  HIS n 
1 85  ASP n 
1 86  GLU n 
1 87  VAL n 
1 88  GLY n 
1 89  LYS n 
1 90  PHE n 
1 91  ARG n 
1 92  PHE n 
1 93  LEU n 
1 94  ASN n 
1 95  GLU n 
1 96  LEU n 
1 97  ILE n 
1 98  LYS n 
1 99  VAL n 
1 100 VAL n 
1 101 SER n 
1 102 PRO n 
1 103 LYS n 
1 104 TYR n 
1 105 LEU n 
1 106 GLY n 
1 107 SER n 
1 108 ARG n 
1 109 THR n 
1 110 SER n 
1 111 GLU n 
1 112 LYS n 
1 113 VAL n 
1 114 LYS n 
1 115 ASN n 
1 116 LYS n 
1 117 ILE n 
1 118 LEU n 
1 119 GLU n 
1 120 LEU n 
1 121 LEU n 
1 122 TYR n 
1 123 SER n 
1 124 TRP n 
1 125 THR n 
1 126 VAL n 
1 127 GLY n 
1 128 LEU n 
1 129 PRO n 
1 130 GLU n 
1 131 GLU n 
1 132 VAL n 
1 133 LYS n 
1 134 ILE n 
1 135 ALA n 
1 136 GLU n 
1 137 ALA n 
1 138 TYR n 
1 139 GLN n 
1 140 MET n 
1 141 LEU n 
1 142 LYS n 
1 143 LYS n 
1 144 GLN n 
1 145 GLY n 
1 146 ILE n 
1 147 VAL n 
1 148 LYS n 
1 149 SER n 
2 1   SER n 
2 2   GLY n 
2 3   TYR n 
2 4   HIS n 
2 5   ASP n 
2 6   ASP n 
2 7   SEP n 
2 8   ASP n 
2 9   GLU n 
2 10  ASP n 
2 11  LEU n 
2 12  LEU n 
2 13  GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3) CodonPlus-RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX4T-1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'The peptide was chemically synthesized' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP GGA1_HUMAN Q9UJY5 1 
;MEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQEWEAIQALTVLETCMKSCGKR
FHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLYSWTVGLPEEVKIAEAYQMLKKQGIVKS
;
1   ? 
2 UNP SORT_HUMAN Q99523 2 SGYHDDSDEDLLE 819 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3G2V A 3 ? 149 ? Q9UJY5 1   ? 147 ? 1 147 
2 2 3G2V C 1 ? 13  ? Q99523 819 ? 831 ? 0 12  
3 1 3G2V B 3 ? 149 ? Q9UJY5 1   ? 147 ? 1 147 
4 2 3G2V D 1 ? 13  ? Q99523 819 ? 831 ? 0 12  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3G2V GLY A 1 ? UNP Q9UJY5 ? ? 'EXPRESSION TAG' -1 1 
1 3G2V SER A 2 ? UNP Q9UJY5 ? ? 'EXPRESSION TAG' 0  2 
3 3G2V GLY B 1 ? UNP Q9UJY5 ? ? 'EXPRESSION TAG' -1 3 
3 3G2V SER B 2 ? UNP Q9UJY5 ? ? 'EXPRESSION TAG' 0  4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?               'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?               'C6 H13 N O2'    131.173 
IOD non-polymer         . 'IODIDE ION'    ?               'I -1'           126.904 
LEU 'L-peptide linking' y LEUCINE         ?               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?               'C5 H9 N O2'     115.130 
SEP 'L-peptide linking' n PHOSPHOSERINE   PHOSPHONOSERINE 'C3 H8 N O6 P'   185.072 
SER 'L-peptide linking' y SERINE          ?               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3G2V 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.42 
_exptl_crystal.density_percent_sol   49.15 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    
'16%(w/v) PEG 5000 mmE, 0.2M NH4I, 0.3M 1,6-hexanediol, 0.1M MES-NaOH, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 292K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2008-01-03 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Diamond (111), Ge(220)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.933 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-3' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-3 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.933 
# 
_reflns.entry_id                     3G2V 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   -3.0 
_reflns.d_resolution_low             43.5 
_reflns.d_resolution_high            2.1 
_reflns.number_obs                   21642 
_reflns.number_all                   21651 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.094 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        16.3 
_reflns.B_iso_Wilson_estimate        31.900 
_reflns.pdbx_redundancy              7.92 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.1 
_reflns_shell.d_res_low              2.2 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           0.465 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.44 
_reflns_shell.pdbx_redundancy        8.13 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2767 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3G2V 
_refine.ls_number_reflns_obs                     21636 
_refine.ls_number_reflns_all                     21651 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.01 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             43.47 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    99.950 
_refine.ls_R_factor_obs                          0.206 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.204 
_refine.ls_R_factor_R_free                       0.244 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1081 
_refine.ls_number_reflns_R_work                  20555 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.correlation_coeff_Fo_to_Fc               0.943 
_refine.correlation_coeff_Fo_to_Fc_free          0.909 
_refine.B_iso_mean                               39.744 
_refine.aniso_B[1][1]                            6.292 
_refine.aniso_B[2][2]                            -1.333 
_refine.aniso_B[3][3]                            -6.222 
_refine.aniso_B[1][2]                            -0.000 
_refine.aniso_B[1][3]                            -0.000 
_refine.aniso_B[2][3]                            -0.000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.369 
_refine.solvent_model_param_bsol                 49.857 
_refine.pdbx_solvent_vdw_probe_radii             1.110 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.900 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1JWF 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.215 
_refine.pdbx_overall_ESU_R_Free                  0.192 
_refine.overall_SU_ML                            0.090 
_refine.overall_SU_B                             8.964 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.overall_FOM_work_R_set                   0.846 
_refine.B_iso_max                                128.01 
_refine.B_iso_min                                16.42 
_refine.pdbx_overall_phase_error                 22.060 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            0.50 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2390 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         5 
_refine_hist.number_atoms_solvent             153 
_refine_hist.number_atoms_total               2548 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        43.47 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           2435 0.010  ? ? 'X-RAY DIFFRACTION' ? 
f_angle_d          3282 1.083  ? ? 'X-RAY DIFFRACTION' ? 
f_chiral_restr     366  0.093  ? ? 'X-RAY DIFFRACTION' ? 
f_plane_restr      418  0.011  ? ? 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 932  21.690 ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.redundancy_reflns_obs 
2.100 2.196  8 100.000 2514 . 0.213 0.249 . 132 . 2646 . 'X-RAY DIFFRACTION' . 
2.196 2.311  8 100.000 2511 . 0.201 0.258 . 132 . 2643 . 'X-RAY DIFFRACTION' . 
2.311 2.456  8 100.000 2531 . 0.201 0.238 . 133 . 2664 . 'X-RAY DIFFRACTION' . 
2.456 2.646  8 100.000 2552 . 0.207 0.270 . 135 . 2687 . 'X-RAY DIFFRACTION' . 
2.646 2.912  8 100.000 2554 . 0.218 0.241 . 134 . 2688 . 'X-RAY DIFFRACTION' . 
2.912 3.333  8 100.000 2568 . 0.221 0.249 . 135 . 2703 . 'X-RAY DIFFRACTION' . 
3.333 4.199  8 100.000 2603 . 0.181 0.229 . 137 . 2740 . 'X-RAY DIFFRACTION' . 
4.199 43.479 8 100.000 2722 . 0.199 0.224 . 143 . 2865 . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  3G2V 
_struct.title                     'VHS Domain of human GGA1 complexed with Sotilin C-terminal Phosphopeptide' 
_struct.pdbx_descriptor           'ADP-ribosylation factor-binding protein GGA1, C-terminal fragment of Sortilin' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3G2V 
_struct_keywords.pdbx_keywords   'PROTEIN TRANSPORT' 
_struct_keywords.text            
'ADP-ribosylation factor binding protein GGA1, VHS, acidic-cluster dileucine signal, Sortilin, PROTEIN TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
M N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 11  ? THR A 20  ? THR A 9   THR A 18  1 ? 10 
HELX_P HELX_P2  2  ASP A 28  ? ASN A 40  ? ASP A 26  ASN A 38  1 ? 13 
HELX_P HELX_P3  3  GLU A 44  ? GLN A 58  ? GLU A 42  GLN A 56  1 ? 15 
HELX_P HELX_P4  4  GLN A 61  ? CYS A 79  ? GLN A 59  CYS A 77  1 ? 19 
HELX_P HELX_P5  5  LYS A 81  ? GLY A 88  ? LYS A 79  GLY A 86  1 ? 8  
HELX_P HELX_P6  6  LYS A 89  ? SER A 101 ? LYS A 87  SER A 99  1 ? 13 
HELX_P HELX_P7  7  LEU A 105 ? THR A 109 ? LEU A 103 THR A 107 5 ? 5  
HELX_P HELX_P8  8  SER A 110 ? LEU A 128 ? SER A 108 LEU A 126 1 ? 19 
HELX_P HELX_P9  9  GLU A 131 ? GLN A 144 ? GLU A 129 GLN A 142 1 ? 14 
HELX_P HELX_P10 10 THR C 11  ? THR C 20  ? THR B 9   THR B 18  1 ? 10 
HELX_P HELX_P11 11 ASP C 28  ? ASN C 40  ? ASP B 26  ASN B 38  1 ? 13 
HELX_P HELX_P12 12 GLU C 44  ? GLN C 58  ? GLU B 42  GLN B 56  1 ? 15 
HELX_P HELX_P13 13 GLN C 61  ? SER C 78  ? GLN B 59  SER B 76  1 ? 18 
HELX_P HELX_P14 14 GLY C 80  ? GLY C 88  ? GLY B 78  GLY B 86  1 ? 9  
HELX_P HELX_P15 15 LYS C 89  ? SER C 101 ? LYS B 87  SER B 99  1 ? 13 
HELX_P HELX_P16 16 LEU C 105 ? THR C 109 ? LEU B 103 THR B 107 5 ? 5  
HELX_P HELX_P17 17 SER C 110 ? LEU C 128 ? SER B 108 LEU B 126 1 ? 19 
HELX_P HELX_P18 18 GLU C 131 ? GLN C 144 ? GLU B 129 GLN B 142 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 36 SG ? ? ? 1_555 A CYS 75 SG ? ? A CYS 34 A CYS 73 1_555 ? ? ? ? ? ? ? 2.054 ? 
disulf2 disulf ? ? A CYS 79 SG ? ? ? 1_555 C CYS 79 SG ? ? A CYS 77 B CYS 77 2_555 ? ? ? ? ? ? ? 2.175 ? 
disulf3 disulf ? ? C CYS 36 SG ? ? ? 1_555 C CYS 75 SG ? ? B CYS 34 B CYS 73 1_555 ? ? ? ? ? ? ? 2.038 ? 
covale1 covale ? ? B ASP 6  C  ? ? ? 1_555 B SEP 7  N  ? ? C ASP 5  C SEP 6  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale2 covale ? ? B SEP 7  C  ? ? ? 1_555 B ASP 8  N  ? ? C SEP 6  C ASP 7  1_555 ? ? ? ? ? ? ? 1.321 ? 
covale3 covale ? ? D SEP 7  C  ? ? ? 1_555 D ASP 8  N  ? ? D SEP 6  D ASP 7  1_555 ? ? ? ? ? ? ? 1.329 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          VAL 
_struct_mon_prot_cis.label_seq_id           147 
_struct_mon_prot_cis.label_asym_id          C 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           VAL 
_struct_mon_prot_cis.auth_seq_id            145 
_struct_mon_prot_cis.auth_asym_id           B 
_struct_mon_prot_cis.pdbx_label_comp_id_2   LYS 
_struct_mon_prot_cis.pdbx_label_seq_id_2    148 
_struct_mon_prot_cis.pdbx_label_asym_id_2   C 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    LYS 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     146 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    B 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       4.34 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE IOD A 148' 
AC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE IOD A 149' 
AC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE IOD A 150' 
AC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE IOD B 148' 
AC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE IOD B 149' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 2 LEU A 52  ? LEU A 50  . ? 1_555 ? 
2 AC1 2 GLN C 61  ? GLN B 59  . ? 1_555 ? 
3 AC2 2 ASN A 40  ? ASN A 38  . ? 1_555 ? 
4 AC2 2 PHE A 83  ? PHE A 81  . ? 1_555 ? 
5 AC3 1 TRP A 124 ? TRP A 122 . ? 1_555 ? 
6 AC4 3 GLN A 61  ? GLN A 59  . ? 1_555 ? 
7 AC4 3 HOH J .   ? HOH A 196 . ? 1_555 ? 
8 AC4 3 LEU C 52  ? LEU B 50  . ? 1_555 ? 
9 AC5 1 GLU C 62  ? GLU B 60  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3G2V 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3G2V 
_atom_sites.fract_transf_matrix[1][1]   0.020833 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013717 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009756 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
I 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A 1 9   ? 8.495   13.895  0.922   1.00 77.98  ? 7   PRO A N   1 
ATOM   2    C CA  . PRO A 1 9   ? 9.390   12.758  0.718   1.00 75.53  ? 7   PRO A CA  1 
ATOM   3    C C   . PRO A 1 9   ? 9.295   12.147  -0.688  1.00 72.53  ? 7   PRO A C   1 
ATOM   4    O O   . PRO A 1 9   ? 8.284   12.312  -1.381  1.00 71.65  ? 7   PRO A O   1 
ATOM   5    C CB  . PRO A 1 9   ? 8.925   11.751  1.775   1.00 76.23  ? 7   PRO A CB  1 
ATOM   6    C CG  . PRO A 1 9   ? 7.494   12.149  2.121   1.00 78.47  ? 7   PRO A CG  1 
ATOM   7    C CD  . PRO A 1 9   ? 7.195   13.483  1.480   1.00 79.27  ? 7   PRO A CD  1 
ATOM   8    N N   . GLU A 1 10  ? 10.352  11.446  -1.092  1.00 61.04  ? 8   GLU A N   1 
ATOM   9    C CA  . GLU A 1 10  ? 10.428  10.862  -2.421  1.00 57.91  ? 8   GLU A CA  1 
ATOM   10   C C   . GLU A 1 10  ? 9.344   9.802   -2.597  1.00 54.46  ? 8   GLU A C   1 
ATOM   11   O O   . GLU A 1 10  ? 8.899   9.173   -1.625  1.00 54.05  ? 8   GLU A O   1 
ATOM   12   C CB  . GLU A 1 10  ? 11.818  10.254  -2.666  1.00 58.59  ? 8   GLU A CB  1 
ATOM   13   C CG  . GLU A 1 10  ? 12.967  11.234  -2.412  1.00 66.16  ? 8   GLU A CG  1 
ATOM   14   C CD  . GLU A 1 10  ? 14.133  10.606  -1.661  1.00 73.51  ? 8   GLU A CD  1 
ATOM   15   O OE1 . GLU A 1 10  ? 14.960  9.920   -2.308  1.00 74.46  ? 8   GLU A OE1 1 
ATOM   16   O OE2 . GLU A 1 10  ? 14.242  10.828  -0.431  1.00 77.26  ? 8   GLU A OE2 1 
ATOM   17   N N   . THR A 1 11  ? 8.950   9.592   -3.848  1.00 40.69  ? 9   THR A N   1 
ATOM   18   C CA  . THR A 1 11  ? 7.821   8.738   -4.173  1.00 36.06  ? 9   THR A CA  1 
ATOM   19   C C   . THR A 1 11  ? 8.283   7.291   -4.162  1.00 33.13  ? 9   THR A C   1 
ATOM   20   O O   . THR A 1 11  ? 9.476   7.012   -4.266  1.00 32.32  ? 9   THR A O   1 
ATOM   21   C CB  . THR A 1 11  ? 7.248   9.085   -5.565  1.00 34.91  ? 9   THR A CB  1 
ATOM   22   O OG1 . THR A 1 11  ? 8.249   8.853   -6.556  1.00 32.16  ? 9   THR A OG1 1 
ATOM   23   C CG2 . THR A 1 11  ? 6.822   10.556  -5.624  1.00 37.58  ? 9   THR A CG2 1 
ATOM   24   N N   . LEU A 1 12  ? 7.343   6.381   -3.954  1.00 35.50  ? 10  LEU A N   1 
ATOM   25   C CA  . LEU A 1 12  ? 7.585   4.958   -4.147  1.00 34.77  ? 10  LEU A CA  1 
ATOM   26   C C   . LEU A 1 12  ? 8.320   4.662   -5.469  1.00 32.95  ? 10  LEU A C   1 
ATOM   27   O O   . LEU A 1 12  ? 9.229   3.835   -5.508  1.00 33.94  ? 10  LEU A O   1 
ATOM   28   C CB  . LEU A 1 12  ? 6.254   4.222   -4.114  1.00 35.74  ? 10  LEU A CB  1 
ATOM   29   C CG  . LEU A 1 12  ? 5.945   3.225   -2.990  1.00 39.39  ? 10  LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 12  ? 6.720   3.479   -1.702  1.00 37.33  ? 10  LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 12  ? 4.456   3.188   -2.748  1.00 41.63  ? 10  LEU A CD2 1 
ATOM   32   N N   . GLU A 1 13  ? 7.894   5.307   -6.551  1.00 28.92  ? 11  GLU A N   1 
ATOM   33   C CA  . GLU A 1 13  ? 8.542   5.138   -7.860  1.00 28.31  ? 11  GLU A CA  1 
ATOM   34   C C   . GLU A 1 13  ? 10.023  5.503   -7.829  1.00 27.90  ? 11  GLU A C   1 
ATOM   35   O O   . GLU A 1 13  ? 10.871  4.700   -8.236  1.00 26.82  ? 11  GLU A O   1 
ATOM   36   C CB  . GLU A 1 13  ? 7.815   5.937   -8.942  1.00 29.60  ? 11  GLU A CB  1 
ATOM   37   C CG  . GLU A 1 13  ? 6.463   5.353   -9.312  1.00 32.25  ? 11  GLU A CG  1 
ATOM   38   C CD  . GLU A 1 13  ? 5.317   5.916   -8.476  1.00 38.79  ? 11  GLU A CD  1 
ATOM   39   O OE1 . GLU A 1 13  ? 4.152   5.758   -8.898  1.00 41.33  ? 11  GLU A OE1 1 
ATOM   40   O OE2 . GLU A 1 13  ? 5.575   6.514   -7.408  1.00 36.12  ? 11  GLU A OE2 1 
ATOM   41   N N   . ALA A 1 14  ? 10.337  6.678   -7.277  1.00 31.36  ? 12  ALA A N   1 
ATOM   42   C CA  . ALA A 1 14  ? 11.720  7.130   -7.160  1.00 31.30  ? 12  ALA A CA  1 
ATOM   43   C C   . ALA A 1 14  ? 12.536  6.171   -6.317  1.00 32.41  ? 12  ALA A C   1 
ATOM   44   O O   . ALA A 1 14  ? 13.676  5.876   -6.667  1.00 33.57  ? 12  ALA A O   1 
ATOM   45   C CB  . ALA A 1 14  ? 11.792  8.542   -6.574  1.00 32.79  ? 12  ALA A CB  1 
ATOM   46   N N   . ARG A 1 15  ? 11.969  5.703   -5.198  1.00 30.13  ? 13  ARG A N   1 
ATOM   47   C CA  . ARG A 1 15  ? 12.721  4.839   -4.280  1.00 31.41  ? 13  ARG A CA  1 
ATOM   48   C C   . ARG A 1 15  ? 13.064  3.570   -5.017  1.00 29.58  ? 13  ARG A C   1 
ATOM   49   O O   . ARG A 1 15  ? 14.208  3.130   -4.973  1.00 30.07  ? 13  ARG A O   1 
ATOM   50   C CB  . ARG A 1 15  ? 11.921  4.414   -3.033  1.00 30.06  ? 13  ARG A CB  1 
ATOM   51   C CG  . ARG A 1 15  ? 11.450  5.480   -2.061  1.00 33.65  ? 13  ARG A CG  1 
ATOM   52   C CD  . ARG A 1 15  ? 12.359  6.653   -1.980  1.00 41.85  ? 13  ARG A CD  1 
ATOM   53   N NE  . ARG A 1 15  ? 13.564  6.449   -1.181  1.00 44.54  ? 13  ARG A NE  1 
ATOM   54   C CZ  . ARG A 1 15  ? 13.800  7.027   -0.005  1.00 44.07  ? 13  ARG A CZ  1 
ATOM   55   N NH1 . ARG A 1 15  ? 15.014  6.977   0.531   1.00 40.31  ? 13  ARG A NH1 1 
ATOM   56   N NH2 . ARG A 1 15  ? 12.826  7.648   0.637   1.00 44.82  ? 13  ARG A NH2 1 
ATOM   57   N N   . ILE A 1 16  ? 12.037  2.921   -5.571  1.00 32.88  ? 14  ILE A N   1 
ATOM   58   C CA  . ILE A 1 16  ? 12.188  1.583   -6.159  1.00 29.97  ? 14  ILE A CA  1 
ATOM   59   C C   . ILE A 1 16  ? 13.099  1.644   -7.382  1.00 29.56  ? 14  ILE A C   1 
ATOM   60   O O   . ILE A 1 16  ? 13.815  0.683   -7.679  1.00 27.91  ? 14  ILE A O   1 
ATOM   61   C CB  . ILE A 1 16  ? 10.807  0.909   -6.529  1.00 30.32  ? 14  ILE A CB  1 
ATOM   62   C CG1 . ILE A 1 16  ? 10.956  -0.605  -6.671  1.00 25.64  ? 14  ILE A CG1 1 
ATOM   63   C CG2 . ILE A 1 16  ? 10.242  1.454   -7.846  1.00 28.37  ? 14  ILE A CG2 1 
ATOM   64   C CD1 . ILE A 1 16  ? 11.634  -1.258  -5.476  1.00 30.87  ? 14  ILE A CD1 1 
ATOM   65   N N   . ASN A 1 17  ? 13.081  2.779   -8.081  1.00 26.39  ? 15  ASN A N   1 
ATOM   66   C CA  . ASN A 1 17  ? 13.935  2.970   -9.248  1.00 25.03  ? 15  ASN A CA  1 
ATOM   67   C C   . ASN A 1 17  ? 15.416  3.042   -8.856  1.00 26.00  ? 15  ASN A C   1 
ATOM   68   O O   . ASN A 1 17  ? 16.266  2.427   -9.502  1.00 23.94  ? 15  ASN A O   1 
ATOM   69   C CB  . ASN A 1 17  ? 13.508  4.221   -10.054 1.00 26.41  ? 15  ASN A CB  1 
ATOM   70   C CG  . ASN A 1 17  ? 12.171  4.031   -10.809 1.00 27.24  ? 15  ASN A CG  1 
ATOM   71   O OD1 . ASN A 1 17  ? 11.697  2.911   -11.003 1.00 31.65  ? 15  ASN A OD1 1 
ATOM   72   N ND2 . ASN A 1 17  ? 11.608  5.130   -11.290 1.00 25.11  ? 15  ASN A ND2 1 
ATOM   73   N N   . ARG A 1 18  ? 15.716  3.742   -7.759  1.00 33.31  ? 16  ARG A N   1 
ATOM   74   C CA  . ARG A 1 18  ? 17.070  3.708   -7.158  1.00 34.42  ? 16  ARG A CA  1 
ATOM   75   C C   . ARG A 1 18  ? 17.429  2.353   -6.543  1.00 31.86  ? 16  ARG A C   1 
ATOM   76   O O   . ARG A 1 18  ? 18.580  1.888   -6.637  1.00 29.73  ? 16  ARG A O   1 
ATOM   77   C CB  . ARG A 1 18  ? 17.198  4.774   -6.068  1.00 36.50  ? 16  ARG A CB  1 
ATOM   78   C CG  . ARG A 1 18  ? 18.068  5.955   -6.427  1.00 45.73  ? 16  ARG A CG  1 
ATOM   79   C CD  . ARG A 1 18  ? 18.130  6.938   -5.255  1.00 56.29  ? 16  ARG A CD  1 
ATOM   80   N NE  . ARG A 1 18  ? 16.869  7.666   -5.103  1.00 60.86  ? 16  ARG A NE  1 
ATOM   81   C CZ  . ARG A 1 18  ? 16.055  7.571   -4.052  1.00 60.56  ? 16  ARG A CZ  1 
ATOM   82   N NH1 . ARG A 1 18  ? 14.926  8.270   -4.044  1.00 59.72  ? 16  ARG A NH1 1 
ATOM   83   N NH2 . ARG A 1 18  ? 16.365  6.797   -3.008  1.00 55.49  ? 16  ARG A NH2 1 
ATOM   84   N N   . ALA A 1 19  ? 16.488  1.785   -5.796  1.00 32.74  ? 17  ALA A N   1 
ATOM   85   C CA  . ALA A 1 19  ? 16.754  0.536   -5.076  1.00 31.10  ? 17  ALA A CA  1 
ATOM   86   C C   . ALA A 1 19  ? 17.036  -0.638  -6.021  1.00 28.83  ? 17  ALA A C   1 
ATOM   87   O O   . ALA A 1 19  ? 17.715  -1.596  -5.642  1.00 27.82  ? 17  ALA A O   1 
ATOM   88   C CB  . ALA A 1 19  ? 15.607  0.192   -4.120  1.00 27.05  ? 17  ALA A CB  1 
ATOM   89   N N   . THR A 1 20  ? 16.515  -0.567  -7.244  1.00 29.38  ? 18  THR A N   1 
ATOM   90   C CA  . THR A 1 20  ? 16.604  -1.704  -8.169  1.00 25.91  ? 18  THR A CA  1 
ATOM   91   C C   . THR A 1 20  ? 17.413  -1.344  -9.408  1.00 28.15  ? 18  THR A C   1 
ATOM   92   O O   . THR A 1 20  ? 17.412  -2.062  -10.413 1.00 25.99  ? 18  THR A O   1 
ATOM   93   C CB  . THR A 1 20  ? 15.205  -2.215  -8.581  1.00 24.07  ? 18  THR A CB  1 
ATOM   94   O OG1 . THR A 1 20  ? 14.485  -1.167  -9.248  1.00 26.40  ? 18  THR A OG1 1 
ATOM   95   C CG2 . THR A 1 20  ? 14.426  -2.645  -7.334  1.00 21.13  ? 18  THR A CG2 1 
ATOM   96   N N   . ASN A 1 21  ? 18.066  -0.191  -9.355  1.00 29.93  ? 19  ASN A N   1 
ATOM   97   C CA  . ASN A 1 21  ? 18.836  0.276   -10.495 1.00 30.72  ? 19  ASN A CA  1 
ATOM   98   C C   . ASN A 1 21  ? 19.906  -0.750  -10.903 1.00 28.62  ? 19  ASN A C   1 
ATOM   99   O O   . ASN A 1 21  ? 20.719  -1.151  -10.074 1.00 26.53  ? 19  ASN A O   1 
ATOM   100  C CB  . ASN A 1 21  ? 19.485  1.612   -10.154 1.00 34.42  ? 19  ASN A CB  1 
ATOM   101  C CG  . ASN A 1 21  ? 20.031  2.311   -11.369 1.00 37.43  ? 19  ASN A CG  1 
ATOM   102  O OD1 . ASN A 1 21  ? 20.551  1.676   -12.286 1.00 38.06  ? 19  ASN A OD1 1 
ATOM   103  N ND2 . ASN A 1 21  ? 19.932  3.627   -11.379 1.00 45.44  ? 19  ASN A ND2 1 
ATOM   104  N N   . PRO A 1 22  ? 19.835  -1.262  -12.148 1.00 27.54  ? 20  PRO A N   1 
ATOM   105  C CA  . PRO A 1 22  ? 20.841  -2.250  -12.574 1.00 27.19  ? 20  PRO A CA  1 
ATOM   106  C C   . PRO A 1 22  ? 22.265  -1.683  -12.714 1.00 29.39  ? 20  PRO A C   1 
ATOM   107  O O   . PRO A 1 22  ? 23.206  -2.441  -12.928 1.00 30.15  ? 20  PRO A O   1 
ATOM   108  C CB  . PRO A 1 22  ? 20.309  -2.748  -13.924 1.00 27.63  ? 20  PRO A CB  1 
ATOM   109  C CG  . PRO A 1 22  ? 19.404  -1.647  -14.427 1.00 29.98  ? 20  PRO A CG  1 
ATOM   110  C CD  . PRO A 1 22  ? 18.831  -0.980  -13.198 1.00 28.37  ? 20  PRO A CD  1 
ATOM   111  N N   . LEU A 1 23  ? 22.427  -0.378  -12.524 1.00 31.39  ? 21  LEU A N   1 
ATOM   112  C CA  . LEU A 1 23  ? 23.761  0.214   -12.424 1.00 35.01  ? 21  LEU A CA  1 
ATOM   113  C C   . LEU A 1 23  ? 24.381  0.054   -11.027 1.00 33.52  ? 21  LEU A C   1 
ATOM   114  O O   . LEU A 1 23  ? 25.590  0.187   -10.870 1.00 34.22  ? 21  LEU A O   1 
ATOM   115  C CB  . LEU A 1 23  ? 23.749  1.691   -12.855 1.00 39.99  ? 21  LEU A CB  1 
ATOM   116  C CG  . LEU A 1 23  ? 23.630  2.055   -14.351 1.00 40.14  ? 21  LEU A CG  1 
ATOM   117  C CD1 . LEU A 1 23  ? 23.229  3.527   -14.534 1.00 41.75  ? 21  LEU A CD1 1 
ATOM   118  C CD2 . LEU A 1 23  ? 24.912  1.771   -15.130 1.00 45.85  ? 21  LEU A CD2 1 
ATOM   119  N N   . ASN A 1 24  ? 23.564  -0.296  -10.033 1.00 33.22  ? 22  ASN A N   1 
ATOM   120  C CA  . ASN A 1 24  ? 24.023  -0.380  -8.645  1.00 32.99  ? 22  ASN A CA  1 
ATOM   121  C C   . ASN A 1 24  ? 25.170  -1.385  -8.501  1.00 32.32  ? 22  ASN A C   1 
ATOM   122  O O   . ASN A 1 24  ? 25.006  -2.558  -8.834  1.00 28.32  ? 22  ASN A O   1 
ATOM   123  C CB  . ASN A 1 24  ? 22.867  -0.816  -7.733  1.00 30.57  ? 22  ASN A CB  1 
ATOM   124  C CG  . ASN A 1 24  ? 21.834  0.288   -7.494  1.00 32.43  ? 22  ASN A CG  1 
ATOM   125  O OD1 . ASN A 1 24  ? 22.043  1.441   -7.847  1.00 32.83  ? 22  ASN A OD1 1 
ATOM   126  N ND2 . ASN A 1 24  ? 20.732  -0.067  -6.836  1.00 28.31  ? 22  ASN A ND2 1 
ATOM   127  N N   . LYS A 1 25  ? 26.293  -0.941  -7.933  1.00 43.17  ? 23  LYS A N   1 
ATOM   128  C CA  . LYS A 1 25  ? 27.440  -1.819  -7.673  1.00 43.85  ? 23  LYS A CA  1 
ATOM   129  C C   . LYS A 1 25  ? 27.252  -2.685  -6.420  1.00 42.57  ? 23  LYS A C   1 
ATOM   130  O O   . LYS A 1 25  ? 28.007  -3.635  -6.181  1.00 42.89  ? 23  LYS A O   1 
ATOM   131  C CB  . LYS A 1 25  ? 28.731  -1.001  -7.548  1.00 45.99  ? 23  LYS A CB  1 
ATOM   132  C CG  . LYS A 1 25  ? 29.059  -0.155  -8.778  1.00 52.74  ? 23  LYS A CG  1 
ATOM   133  C CD  . LYS A 1 25  ? 30.096  -0.819  -9.670  1.00 59.70  ? 23  LYS A CD  1 
ATOM   134  C CE  . LYS A 1 25  ? 29.668  -2.218  -10.128 1.00 58.99  ? 23  LYS A CE  1 
ATOM   135  N NZ  . LYS A 1 25  ? 30.713  -2.847  -10.997 1.00 60.03  ? 23  LYS A NZ  1 
ATOM   136  N N   . GLU A 1 26  ? 26.280  -2.317  -5.597  1.00 35.11  ? 24  GLU A N   1 
ATOM   137  C CA  . GLU A 1 26  ? 25.973  -3.057  -4.388  1.00 33.95  ? 24  GLU A CA  1 
ATOM   138  C C   . GLU A 1 26  ? 24.579  -2.640  -3.936  1.00 33.17  ? 24  GLU A C   1 
ATOM   139  O O   . GLU A 1 26  ? 24.005  -1.708  -4.490  1.00 32.96  ? 24  GLU A O   1 
ATOM   140  C CB  . GLU A 1 26  ? 27.003  -2.757  -3.297  1.00 36.24  ? 24  GLU A CB  1 
ATOM   141  C CG  . GLU A 1 26  ? 26.895  -1.364  -2.735  1.00 43.34  ? 24  GLU A CG  1 
ATOM   142  C CD  . GLU A 1 26  ? 28.227  -0.683  -2.638  1.00 55.89  ? 24  GLU A CD  1 
ATOM   143  O OE1 . GLU A 1 26  ? 28.731  -0.210  -3.683  1.00 60.07  ? 24  GLU A OE1 1 
ATOM   144  O OE2 . GLU A 1 26  ? 28.771  -0.617  -1.513  1.00 61.57  ? 24  GLU A OE2 1 
ATOM   145  N N   . LEU A 1 27  ? 24.045  -3.326  -2.928  1.00 34.00  ? 25  LEU A N   1 
ATOM   146  C CA  . LEU A 1 27  ? 22.703  -3.036  -2.439  1.00 32.86  ? 25  LEU A CA  1 
ATOM   147  C C   . LEU A 1 27  ? 22.642  -1.628  -1.839  1.00 35.83  ? 25  LEU A C   1 
ATOM   148  O O   . LEU A 1 27  ? 23.560  -1.207  -1.147  1.00 35.65  ? 25  LEU A O   1 
ATOM   149  C CB  . LEU A 1 27  ? 22.258  -4.092  -1.427  1.00 30.76  ? 25  LEU A CB  1 
ATOM   150  C CG  . LEU A 1 27  ? 22.031  -5.529  -1.931  1.00 30.69  ? 25  LEU A CG  1 
ATOM   151  C CD1 . LEU A 1 27  ? 21.657  -6.463  -0.765  1.00 30.30  ? 25  LEU A CD1 1 
ATOM   152  C CD2 . LEU A 1 27  ? 20.974  -5.616  -3.035  1.00 26.97  ? 25  LEU A CD2 1 
ATOM   153  N N   . ASP A 1 28  ? 21.612  -0.870  -2.216  1.00 29.93  ? 26  ASP A N   1 
ATOM   154  C CA  . ASP A 1 28  ? 21.421  0.498   -1.741  1.00 31.65  ? 26  ASP A CA  1 
ATOM   155  C C   . ASP A 1 28  ? 20.375  0.486   -0.633  1.00 31.33  ? 26  ASP A C   1 
ATOM   156  O O   . ASP A 1 28  ? 19.178  0.559   -0.904  1.00 31.33  ? 26  ASP A O   1 
ATOM   157  C CB  . ASP A 1 28  ? 20.934  1.370   -2.911  1.00 33.90  ? 26  ASP A CB  1 
ATOM   158  C CG  . ASP A 1 28  ? 20.662  2.824   -2.518  1.00 39.68  ? 26  ASP A CG  1 
ATOM   159  O OD1 . ASP A 1 28  ? 21.100  3.275   -1.449  1.00 40.72  ? 26  ASP A OD1 1 
ATOM   160  O OD2 . ASP A 1 28  ? 20.065  3.551   -3.338  1.00 45.47  ? 26  ASP A OD2 1 
ATOM   161  N N   . TRP A 1 29  ? 20.824  0.375   0.613   1.00 32.94  ? 27  TRP A N   1 
ATOM   162  C CA  . TRP A 1 29  ? 19.909  0.236   1.747   1.00 33.97  ? 27  TRP A CA  1 
ATOM   163  C C   . TRP A 1 29  ? 19.045  1.472   2.006   1.00 35.22  ? 27  TRP A C   1 
ATOM   164  O O   . TRP A 1 29  ? 17.864  1.351   2.343   1.00 33.14  ? 27  TRP A O   1 
ATOM   165  C CB  . TRP A 1 29  ? 20.661  -0.196  3.019   1.00 34.23  ? 27  TRP A CB  1 
ATOM   166  C CG  . TRP A 1 29  ? 21.132  -1.608  2.901   1.00 31.87  ? 27  TRP A CG  1 
ATOM   167  C CD1 . TRP A 1 29  ? 22.423  -2.035  2.719   1.00 33.69  ? 27  TRP A CD1 1 
ATOM   168  C CD2 . TRP A 1 29  ? 20.303  -2.767  2.756   1.00 27.99  ? 27  TRP A CD2 1 
ATOM   169  N NE1 . TRP A 1 29  ? 22.445  -3.398  2.512   1.00 29.37  ? 27  TRP A NE1 1 
ATOM   170  C CE2 . TRP A 1 29  ? 21.156  -3.868  2.520   1.00 29.91  ? 27  TRP A CE2 1 
ATOM   171  C CE3 . TRP A 1 29  ? 18.928  -2.993  2.876   1.00 28.61  ? 27  TRP A CE3 1 
ATOM   172  C CZ2 . TRP A 1 29  ? 20.672  -5.175  2.400   1.00 24.80  ? 27  TRP A CZ2 1 
ATOM   173  C CZ3 . TRP A 1 29  ? 18.446  -4.283  2.726   1.00 26.98  ? 27  TRP A CZ3 1 
ATOM   174  C CH2 . TRP A 1 29  ? 19.317  -5.360  2.499   1.00 26.78  ? 27  TRP A CH2 1 
ATOM   175  N N   . ALA A 1 30  ? 19.628  2.651   1.818   1.00 29.74  ? 28  ALA A N   1 
ATOM   176  C CA  . ALA A 1 30  ? 18.881  3.887   1.954   1.00 32.58  ? 28  ALA A CA  1 
ATOM   177  C C   . ALA A 1 30  ? 17.608  3.814   1.122   1.00 32.29  ? 28  ALA A C   1 
ATOM   178  O O   . ALA A 1 30  ? 16.514  4.036   1.633   1.00 33.95  ? 28  ALA A O   1 
ATOM   179  C CB  . ALA A 1 30  ? 19.740  5.085   1.538   1.00 33.93  ? 28  ALA A CB  1 
ATOM   180  N N   . SER A 1 31  ? 17.747  3.372   -0.126  1.00 30.49  ? 29  SER A N   1 
ATOM   181  C CA  . SER A 1 31  ? 16.612  3.259   -1.041  1.00 29.38  ? 29  SER A CA  1 
ATOM   182  C C   . SER A 1 31  ? 15.729  2.049   -0.766  1.00 26.59  ? 29  SER A C   1 
ATOM   183  O O   . SER A 1 31  ? 14.499  2.122   -0.909  1.00 26.25  ? 29  SER A O   1 
ATOM   184  C CB  . SER A 1 31  ? 17.103  3.239   -2.488  1.00 26.59  ? 29  SER A CB  1 
ATOM   185  O OG  . SER A 1 31  ? 17.703  4.498   -2.799  1.00 36.65  ? 29  SER A OG  1 
ATOM   186  N N   . ILE A 1 32  ? 16.355  0.910   -0.476  1.00 28.01  ? 30  ILE A N   1 
ATOM   187  C CA  . ILE A 1 32  ? 15.598  -0.283  -0.097  1.00 23.99  ? 30  ILE A CA  1 
ATOM   188  C C   . ILE A 1 32  ? 14.701  -0.033  1.105   1.00 26.98  ? 30  ILE A C   1 
ATOM   189  O O   . ILE A 1 32  ? 13.479  -0.189  1.037   1.00 27.48  ? 30  ILE A O   1 
ATOM   190  C CB  . ILE A 1 32  ? 16.506  -1.510  0.164   1.00 20.94  ? 30  ILE A CB  1 
ATOM   191  C CG1 . ILE A 1 32  ? 17.288  -1.896  -1.110  1.00 18.83  ? 30  ILE A CG1 1 
ATOM   192  C CG2 . ILE A 1 32  ? 15.671  -2.713  0.654   1.00 20.11  ? 30  ILE A CG2 1 
ATOM   193  C CD1 . ILE A 1 32  ? 18.468  -2.876  -0.818  1.00 18.94  ? 30  ILE A CD1 1 
ATOM   194  N N   . ASN A 1 33  ? 15.314  0.352   2.217   1.00 28.84  ? 31  ASN A N   1 
ATOM   195  C CA  . ASN A 1 33  ? 14.567  0.614   3.426   1.00 29.90  ? 31  ASN A CA  1 
ATOM   196  C C   . ASN A 1 33  ? 13.697  1.868   3.286   1.00 30.67  ? 31  ASN A C   1 
ATOM   197  O O   . ASN A 1 33  ? 12.620  1.936   3.852   1.00 29.19  ? 31  ASN A O   1 
ATOM   198  C CB  . ASN A 1 33  ? 15.529  0.700   4.624   1.00 31.27  ? 31  ASN A CB  1 
ATOM   199  C CG  . ASN A 1 33  ? 16.004  -0.685  5.084   1.00 34.23  ? 31  ASN A CG  1 
ATOM   200  O OD1 . ASN A 1 33  ? 15.243  -1.656  5.023   1.00 34.67  ? 31  ASN A OD1 1 
ATOM   201  N ND2 . ASN A 1 33  ? 17.265  -0.784  5.510   1.00 31.46  ? 31  ASN A ND2 1 
ATOM   202  N N   . GLY A 1 34  ? 14.129  2.823   2.465   1.00 29.58  ? 32  GLY A N   1 
ATOM   203  C CA  . GLY A 1 34  ? 13.324  4.032   2.216   1.00 32.66  ? 32  GLY A CA  1 
ATOM   204  C C   . GLY A 1 34  ? 12.032  3.698   1.485   1.00 34.15  ? 32  GLY A C   1 
ATOM   205  O O   . GLY A 1 34  ? 10.984  4.273   1.759   1.00 36.08  ? 32  GLY A O   1 
ATOM   206  N N   . PHE A 1 35  ? 12.101  2.705   0.602   1.00 32.25  ? 33  PHE A N   1 
ATOM   207  C CA  . PHE A 1 35  ? 10.913  2.144   -0.028  1.00 31.14  ? 33  PHE A CA  1 
ATOM   208  C C   . PHE A 1 35  ? 9.961   1.544   0.996   1.00 29.51  ? 33  PHE A C   1 
ATOM   209  O O   . PHE A 1 35  ? 8.767   1.846   0.990   1.00 30.22  ? 33  PHE A O   1 
ATOM   210  C CB  . PHE A 1 35  ? 11.298  1.120   -1.108  1.00 24.47  ? 33  PHE A CB  1 
ATOM   211  C CG  . PHE A 1 35  ? 10.128  0.562   -1.876  1.00 26.63  ? 33  PHE A CG  1 
ATOM   212  C CD1 . PHE A 1 35  ? 9.538   -0.645  -1.497  1.00 21.85  ? 33  PHE A CD1 1 
ATOM   213  C CD2 . PHE A 1 35  ? 9.650   1.210   -3.020  1.00 25.58  ? 33  PHE A CD2 1 
ATOM   214  C CE1 . PHE A 1 35  ? 8.514   -1.217  -2.267  1.00 17.77  ? 33  PHE A CE1 1 
ATOM   215  C CE2 . PHE A 1 35  ? 8.588   0.680   -3.751  1.00 24.59  ? 33  PHE A CE2 1 
ATOM   216  C CZ  . PHE A 1 35  ? 8.020   -0.528  -3.385  1.00 19.45  ? 33  PHE A CZ  1 
ATOM   217  N N   . CYS A 1 36  ? 10.474  0.680   1.869   1.00 30.12  ? 34  CYS A N   1 
ATOM   218  C CA  . CYS A 1 36  ? 9.634   0.099   2.908   1.00 30.34  ? 34  CYS A CA  1 
ATOM   219  C C   . CYS A 1 36  ? 9.006   1.194   3.763   1.00 33.11  ? 34  CYS A C   1 
ATOM   220  O O   . CYS A 1 36  ? 7.819   1.126   4.083   1.00 34.45  ? 34  CYS A O   1 
ATOM   221  C CB  . CYS A 1 36  ? 10.408  -0.903  3.783   1.00 28.14  ? 34  CYS A CB  1 
ATOM   222  S SG  . CYS A 1 36  ? 11.325  -2.196  2.871   1.00 28.30  ? 34  CYS A SG  1 
ATOM   223  N N   . GLU A 1 37  ? 9.808   2.182   4.151   1.00 28.54  ? 35  GLU A N   1 
ATOM   224  C CA  . GLU A 1 37  ? 9.336   3.282   4.991   1.00 33.26  ? 35  GLU A CA  1 
ATOM   225  C C   . GLU A 1 37  ? 8.168   4.007   4.331   1.00 37.18  ? 35  GLU A C   1 
ATOM   226  O O   . GLU A 1 37  ? 7.233   4.452   5.004   1.00 39.95  ? 35  GLU A O   1 
ATOM   227  C CB  . GLU A 1 37  ? 10.458  4.295   5.221   1.00 34.14  ? 35  GLU A CB  1 
ATOM   228  C CG  . GLU A 1 37  ? 11.427  3.960   6.330   1.00 35.55  ? 35  GLU A CG  1 
ATOM   229  C CD  . GLU A 1 37  ? 12.238  5.181   6.735   1.00 48.48  ? 35  GLU A CD  1 
ATOM   230  O OE1 . GLU A 1 37  ? 12.421  6.076   5.873   1.00 46.92  ? 35  GLU A OE1 1 
ATOM   231  O OE2 . GLU A 1 37  ? 12.649  5.267   7.914   1.00 49.06  ? 35  GLU A OE2 1 
ATOM   232  N N   . GLN A 1 38  ? 8.290   4.223   3.024   1.00 35.80  ? 36  GLN A N   1 
ATOM   233  C CA  . GLN A 1 38  ? 7.369   5.102   2.294   1.00 35.36  ? 36  GLN A CA  1 
ATOM   234  C C   . GLN A 1 38  ? 6.041   4.409   2.007   1.00 33.40  ? 36  GLN A C   1 
ATOM   235  O O   . GLN A 1 38  ? 4.978   4.998   2.177   1.00 34.56  ? 36  GLN A O   1 
ATOM   236  C CB  . GLN A 1 38  ? 8.003   5.608   0.993   1.00 33.81  ? 36  GLN A CB  1 
ATOM   237  C CG  . GLN A 1 38  ? 7.200   6.708   0.277   1.00 35.64  ? 36  GLN A CG  1 
ATOM   238  C CD  . GLN A 1 38  ? 7.055   7.967   1.111   1.00 43.83  ? 36  GLN A CD  1 
ATOM   239  O OE1 . GLN A 1 38  ? 6.014   8.630   1.081   1.00 47.97  ? 36  GLN A OE1 1 
ATOM   240  N NE2 . GLN A 1 38  ? 8.106   8.314   1.851   1.00 38.26  ? 36  GLN A NE2 1 
ATOM   241  N N   . LEU A 1 39  ? 6.094   3.141   1.626   1.00 34.73  ? 37  LEU A N   1 
ATOM   242  C CA  . LEU A 1 39  ? 4.848   2.394   1.409   1.00 34.56  ? 37  LEU A CA  1 
ATOM   243  C C   . LEU A 1 39  ? 4.005   2.282   2.698   1.00 36.43  ? 37  LEU A C   1 
ATOM   244  O O   . LEU A 1 39  ? 2.772   2.387   2.660   1.00 37.29  ? 37  LEU A O   1 
ATOM   245  C CB  . LEU A 1 39  ? 5.119   1.030   0.757   1.00 28.13  ? 37  LEU A CB  1 
ATOM   246  C CG  . LEU A 1 39  ? 5.639   -0.086  1.668   1.00 28.76  ? 37  LEU A CG  1 
ATOM   247  C CD1 . LEU A 1 39  ? 4.483   -0.654  2.509   1.00 27.92  ? 37  LEU A CD1 1 
ATOM   248  C CD2 . LEU A 1 39  ? 6.372   -1.201  0.877   1.00 23.87  ? 37  LEU A CD2 1 
ATOM   249  N N   . ASN A 1 40  ? 4.691   2.227   3.840   1.00 29.65  ? 38  ASN A N   1 
ATOM   250  C CA  . ASN A 1 40  ? 4.059   2.223   5.155   1.00 32.17  ? 38  ASN A CA  1 
ATOM   251  C C   . ASN A 1 40  ? 3.391   3.554   5.487   1.00 40.33  ? 38  ASN A C   1 
ATOM   252  O O   . ASN A 1 40  ? 2.502   3.617   6.337   1.00 41.37  ? 38  ASN A O   1 
ATOM   253  C CB  . ASN A 1 40  ? 5.095   1.860   6.226   1.00 30.98  ? 38  ASN A CB  1 
ATOM   254  C CG  . ASN A 1 40  ? 4.526   1.862   7.625   1.00 33.87  ? 38  ASN A CG  1 
ATOM   255  O OD1 . ASN A 1 40  ? 3.750   0.978   7.996   1.00 33.76  ? 38  ASN A OD1 1 
ATOM   256  N ND2 . ASN A 1 40  ? 4.906   2.865   8.417   1.00 35.11  ? 38  ASN A ND2 1 
ATOM   257  N N   . GLU A 1 41  ? 3.812   4.614   4.804   1.00 48.41  ? 39  GLU A N   1 
ATOM   258  C CA  . GLU A 1 41  ? 3.430   5.969   5.193   1.00 54.21  ? 39  GLU A CA  1 
ATOM   259  C C   . GLU A 1 41  ? 2.061   6.370   4.644   1.00 57.24  ? 39  GLU A C   1 
ATOM   260  O O   . GLU A 1 41  ? 1.244   6.953   5.358   1.00 61.55  ? 39  GLU A O   1 
ATOM   261  C CB  . GLU A 1 41  ? 4.500   6.976   4.758   1.00 53.13  ? 39  GLU A CB  1 
ATOM   262  C CG  . GLU A 1 41  ? 4.163   8.412   5.102   1.00 61.67  ? 39  GLU A CG  1 
ATOM   263  C CD  . GLU A 1 41  ? 5.302   9.129   5.792   1.00 68.72  ? 39  GLU A CD  1 
ATOM   264  O OE1 . GLU A 1 41  ? 6.225   9.591   5.084   1.00 69.69  ? 39  GLU A OE1 1 
ATOM   265  O OE2 . GLU A 1 41  ? 5.262   9.245   7.038   1.00 71.54  ? 39  GLU A OE2 1 
ATOM   266  N N   . ASP A 1 42  ? 1.823   6.068   3.372   1.00 67.55  ? 40  ASP A N   1 
ATOM   267  C CA  . ASP A 1 42  ? 0.616   6.523   2.688   1.00 71.10  ? 40  ASP A CA  1 
ATOM   268  C C   . ASP A 1 42  ? -0.417  5.401   2.554   1.00 72.27  ? 40  ASP A C   1 
ATOM   269  O O   . ASP A 1 42  ? -0.066  4.254   2.272   1.00 69.47  ? 40  ASP A O   1 
ATOM   270  C CB  . ASP A 1 42  ? 0.963   7.142   1.322   1.00 70.37  ? 40  ASP A CB  1 
ATOM   271  C CG  . ASP A 1 42  ? 2.336   6.696   0.793   1.00 69.28  ? 40  ASP A CG  1 
ATOM   272  O OD1 . ASP A 1 42  ? 2.552   5.476   0.660   1.00 69.79  ? 40  ASP A OD1 1 
ATOM   273  O OD2 . ASP A 1 42  ? 3.177   7.564   0.453   1.00 68.07  ? 40  ASP A OD2 1 
ATOM   274  N N   . PHE A 1 43  ? -1.681  5.729   2.815   1.00 90.18  ? 41  PHE A N   1 
ATOM   275  C CA  . PHE A 1 43  ? -2.774  4.746   2.840   1.00 88.45  ? 41  PHE A CA  1 
ATOM   276  C C   . PHE A 1 43  ? -2.671  3.756   1.682   1.00 82.14  ? 41  PHE A C   1 
ATOM   277  O O   . PHE A 1 43  ? -2.857  2.545   1.855   1.00 78.59  ? 41  PHE A O   1 
ATOM   278  C CB  . PHE A 1 43  ? -4.134  5.460   2.761   1.00 93.18  ? 41  PHE A CB  1 
ATOM   279  C CG  . PHE A 1 43  ? -4.543  6.149   4.035   1.00 101.47 ? 41  PHE A CG  1 
ATOM   280  C CD1 . PHE A 1 43  ? -3.602  6.477   5.005   1.00 105.40 ? 41  PHE A CD1 1 
ATOM   281  C CD2 . PHE A 1 43  ? -5.871  6.503   4.247   1.00 106.25 ? 41  PHE A CD2 1 
ATOM   282  C CE1 . PHE A 1 43  ? -3.980  7.125   6.173   1.00 110.03 ? 41  PHE A CE1 1 
ATOM   283  C CE2 . PHE A 1 43  ? -6.261  7.150   5.412   1.00 113.05 ? 41  PHE A CE2 1 
ATOM   284  C CZ  . PHE A 1 43  ? -5.313  7.461   6.377   1.00 114.32 ? 41  PHE A CZ  1 
ATOM   285  N N   . GLU A 1 44  ? -2.404  4.292   0.494   1.00 61.42  ? 42  GLU A N   1 
ATOM   286  C CA  . GLU A 1 44  ? -2.462  3.521   -0.734  1.00 56.66  ? 42  GLU A CA  1 
ATOM   287  C C   . GLU A 1 44  ? -1.067  3.055   -1.140  1.00 50.55  ? 42  GLU A C   1 
ATOM   288  O O   . GLU A 1 44  ? -0.878  2.476   -2.207  1.00 47.26  ? 42  GLU A O   1 
ATOM   289  C CB  . GLU A 1 44  ? -3.116  4.351   -1.845  1.00 60.57  ? 42  GLU A CB  1 
ATOM   290  C CG  . GLU A 1 44  ? -4.051  3.557   -2.767  1.00 64.04  ? 42  GLU A CG  1 
ATOM   291  C CD  . GLU A 1 44  ? -5.282  2.997   -2.057  1.00 69.48  ? 42  GLU A CD  1 
ATOM   292  O OE1 . GLU A 1 44  ? -5.844  3.689   -1.179  1.00 73.47  ? 42  GLU A OE1 1 
ATOM   293  O OE2 . GLU A 1 44  ? -5.710  1.875   -2.411  1.00 68.69  ? 42  GLU A OE2 1 
ATOM   294  N N   . GLY A 1 45  ? -0.104  3.251   -0.245  1.00 47.80  ? 43  GLY A N   1 
ATOM   295  C CA  . GLY A 1 45  ? 1.262   2.778   -0.459  1.00 41.18  ? 43  GLY A CA  1 
ATOM   296  C C   . GLY A 1 45  ? 1.362   1.293   -0.763  1.00 35.53  ? 43  GLY A C   1 
ATOM   297  O O   . GLY A 1 45  ? 2.007   0.905   -1.740  1.00 31.84  ? 43  GLY A O   1 
ATOM   298  N N   . PRO A 1 46  ? 0.798   0.440   0.117   1.00 35.82  ? 44  PRO A N   1 
ATOM   299  C CA  . PRO A 1 46  ? 1.055   -0.991  -0.067  1.00 30.62  ? 44  PRO A CA  1 
ATOM   300  C C   . PRO A 1 46  ? 0.597   -1.612  -1.395  1.00 28.26  ? 44  PRO A C   1 
ATOM   301  O O   . PRO A 1 46  ? 1.361   -2.357  -1.987  1.00 27.02  ? 44  PRO A O   1 
ATOM   302  C CB  . PRO A 1 46  ? 0.388   -1.640  1.147   1.00 29.82  ? 44  PRO A CB  1 
ATOM   303  C CG  . PRO A 1 46  ? 0.405   -0.533  2.211   1.00 34.00  ? 44  PRO A CG  1 
ATOM   304  C CD  . PRO A 1 46  ? 0.157   0.728   1.415   1.00 38.41  ? 44  PRO A CD  1 
ATOM   305  N N   . PRO A 1 47  ? -0.627  -1.300  -1.873  1.00 32.13  ? 45  PRO A N   1 
ATOM   306  C CA  . PRO A 1 47  ? -1.043  -1.836  -3.181  1.00 31.33  ? 45  PRO A CA  1 
ATOM   307  C C   . PRO A 1 47  ? -0.273  -1.263  -4.376  1.00 33.70  ? 45  PRO A C   1 
ATOM   308  O O   . PRO A 1 47  ? -0.150  -1.935  -5.398  1.00 33.64  ? 45  PRO A O   1 
ATOM   309  C CB  . PRO A 1 47  ? -2.539  -1.476  -3.265  1.00 33.51  ? 45  PRO A CB  1 
ATOM   310  C CG  . PRO A 1 47  ? -2.755  -0.427  -2.236  1.00 32.23  ? 45  PRO A CG  1 
ATOM   311  C CD  . PRO A 1 47  ? -1.736  -0.627  -1.173  1.00 32.92  ? 45  PRO A CD  1 
ATOM   312  N N   . LEU A 1 48  ? 0.264   -0.053  -4.238  1.00 31.82  ? 46  LEU A N   1 
ATOM   313  C CA  . LEU A 1 48  ? 1.145   0.522   -5.253  1.00 32.25  ? 46  LEU A CA  1 
ATOM   314  C C   . LEU A 1 48  ? 2.515   -0.146  -5.227  1.00 29.37  ? 46  LEU A C   1 
ATOM   315  O O   . LEU A 1 48  ? 3.044   -0.526  -6.273  1.00 28.48  ? 46  LEU A O   1 
ATOM   316  C CB  . LEU A 1 48  ? 1.299   2.038   -5.044  1.00 36.88  ? 46  LEU A CB  1 
ATOM   317  C CG  . LEU A 1 48  ? 2.222   2.784   -6.021  1.00 40.03  ? 46  LEU A CG  1 
ATOM   318  C CD1 . LEU A 1 48  ? 1.806   2.549   -7.472  1.00 41.05  ? 46  LEU A CD1 1 
ATOM   319  C CD2 . LEU A 1 48  ? 2.236   4.284   -5.700  1.00 40.90  ? 46  LEU A CD2 1 
ATOM   320  N N   . ALA A 1 49  ? 3.069   -0.303  -4.025  1.00 31.28  ? 47  ALA A N   1 
ATOM   321  C CA  . ALA A 1 49  ? 4.364   -0.947  -3.829  1.00 28.36  ? 47  ALA A CA  1 
ATOM   322  C C   . ALA A 1 49  ? 4.363   -2.287  -4.543  1.00 25.93  ? 47  ALA A C   1 
ATOM   323  O O   . ALA A 1 49  ? 5.321   -2.679  -5.188  1.00 25.37  ? 47  ALA A O   1 
ATOM   324  C CB  . ALA A 1 49  ? 4.629   -1.156  -2.343  1.00 26.30  ? 47  ALA A CB  1 
ATOM   325  N N   . THR A 1 50  ? 3.263   -2.992  -4.386  1.00 29.43  ? 48  THR A N   1 
ATOM   326  C CA  . THR A 1 50  ? 3.158   -4.364  -4.798  1.00 28.20  ? 48  THR A CA  1 
ATOM   327  C C   . THR A 1 50  ? 3.064   -4.433  -6.343  1.00 28.17  ? 48  THR A C   1 
ATOM   328  O O   . THR A 1 50  ? 3.761   -5.227  -6.994  1.00 25.20  ? 48  THR A O   1 
ATOM   329  C CB  . THR A 1 50  ? 1.980   -4.972  -3.987  1.00 30.34  ? 48  THR A CB  1 
ATOM   330  O OG1 . THR A 1 50  ? 2.390   -6.131  -3.243  1.00 35.38  ? 48  THR A OG1 1 
ATOM   331  C CG2 . THR A 1 50  ? 0.735   -5.153  -4.764  1.00 22.65  ? 48  THR A CG2 1 
ATOM   332  N N   . ARG A 1 51  ? 2.393   -3.442  -6.921  1.00 25.07  ? 49  ARG A N   1 
ATOM   333  C CA  . ARG A 1 51  ? 2.374   -3.238  -8.369  1.00 27.57  ? 49  ARG A CA  1 
ATOM   334  C C   . ARG A 1 51  ? 3.752   -2.892  -8.953  1.00 25.99  ? 49  ARG A C   1 
ATOM   335  O O   . ARG A 1 51  ? 4.130   -3.388  -10.011 1.00 24.23  ? 49  ARG A O   1 
ATOM   336  C CB  . ARG A 1 51  ? 1.376   -2.127  -8.718  1.00 31.50  ? 49  ARG A CB  1 
ATOM   337  C CG  . ARG A 1 51  ? 0.107   -2.610  -9.398  1.00 38.61  ? 49  ARG A CG  1 
ATOM   338  C CD  . ARG A 1 51  ? -1.134  -1.865  -8.908  1.00 51.22  ? 49  ARG A CD  1 
ATOM   339  N NE  . ARG A 1 51  ? -0.969  -0.409  -8.859  1.00 57.07  ? 49  ARG A NE  1 
ATOM   340  C CZ  . ARG A 1 51  ? -1.590  0.389   -7.991  1.00 56.81  ? 49  ARG A CZ  1 
ATOM   341  N NH1 . ARG A 1 51  ? -1.371  1.695   -8.015  1.00 61.13  ? 49  ARG A NH1 1 
ATOM   342  N NH2 . ARG A 1 51  ? -2.412  -0.118  -7.081  1.00 55.15  ? 49  ARG A NH2 1 
ATOM   343  N N   . LEU A 1 52  ? 4.483   -2.010  -8.284  1.00 25.35  ? 50  LEU A N   1 
ATOM   344  C CA  . LEU A 1 52  ? 5.801   -1.615  -8.755  1.00 26.61  ? 50  LEU A CA  1 
ATOM   345  C C   . LEU A 1 52  ? 6.769   -2.783  -8.661  1.00 24.37  ? 50  LEU A C   1 
ATOM   346  O O   . LEU A 1 52  ? 7.547   -3.024  -9.581  1.00 26.81  ? 50  LEU A O   1 
ATOM   347  C CB  . LEU A 1 52  ? 6.334   -0.410  -7.974  1.00 28.05  ? 50  LEU A CB  1 
ATOM   348  C CG  . LEU A 1 52  ? 5.487   0.871   -7.892  1.00 32.35  ? 50  LEU A CG  1 
ATOM   349  C CD1 . LEU A 1 52  ? 6.248   1.957   -7.118  1.00 32.28  ? 50  LEU A CD1 1 
ATOM   350  C CD2 . LEU A 1 52  ? 5.087   1.400   -9.270  1.00 36.19  ? 50  LEU A CD2 1 
ATOM   351  N N   . LEU A 1 53  ? 6.738   -3.489  -7.535  1.00 25.77  ? 51  LEU A N   1 
ATOM   352  C CA  . LEU A 1 53  ? 7.629   -4.620  -7.300  1.00 24.34  ? 51  LEU A CA  1 
ATOM   353  C C   . LEU A 1 53  ? 7.445   -5.750  -8.314  1.00 22.46  ? 51  LEU A C   1 
ATOM   354  O O   . LEU A 1 53  ? 8.421   -6.299  -8.819  1.00 23.34  ? 51  LEU A O   1 
ATOM   355  C CB  . LEU A 1 53  ? 7.436   -5.157  -5.885  1.00 21.54  ? 51  LEU A CB  1 
ATOM   356  C CG  . LEU A 1 53  ? 8.106   -4.323  -4.792  1.00 24.67  ? 51  LEU A CG  1 
ATOM   357  C CD1 . LEU A 1 53  ? 7.579   -4.751  -3.391  1.00 22.47  ? 51  LEU A CD1 1 
ATOM   358  C CD2 . LEU A 1 53  ? 9.641   -4.451  -4.901  1.00 19.52  ? 51  LEU A CD2 1 
ATOM   359  N N   . ALA A 1 54  ? 6.189   -6.059  -8.622  1.00 22.53  ? 52  ALA A N   1 
ATOM   360  C CA  . ALA A 1 54  ? 5.837   -7.131  -9.548  1.00 21.79  ? 52  ALA A CA  1 
ATOM   361  C C   . ALA A 1 54  ? 6.424   -6.892  -10.922 1.00 23.51  ? 52  ALA A C   1 
ATOM   362  O O   . ALA A 1 54  ? 6.972   -7.818  -11.539 1.00 22.76  ? 52  ALA A O   1 
ATOM   363  C CB  . ALA A 1 54  ? 4.305   -7.290  -9.637  1.00 21.94  ? 52  ALA A CB  1 
ATOM   364  N N   . HIS A 1 55  ? 6.355   -5.640  -11.387 1.00 20.32  ? 53  HIS A N   1 
ATOM   365  C CA  . HIS A 1 55  ? 7.040   -5.249  -12.624 1.00 22.08  ? 53  HIS A CA  1 
ATOM   366  C C   . HIS A 1 55  ? 8.579   -5.353  -12.574 1.00 22.29  ? 53  HIS A C   1 
ATOM   367  O O   . HIS A 1 55  ? 9.196   -5.919  -13.480 1.00 23.07  ? 53  HIS A O   1 
ATOM   368  C CB  . HIS A 1 55  ? 6.579   -3.860  -13.097 1.00 25.41  ? 53  HIS A CB  1 
ATOM   369  C CG  . HIS A 1 55  ? 7.065   -3.505  -14.469 1.00 28.63  ? 53  HIS A CG  1 
ATOM   370  N ND1 . HIS A 1 55  ? 8.097   -2.612  -14.686 1.00 30.53  ? 53  HIS A ND1 1 
ATOM   371  C CD2 . HIS A 1 55  ? 6.741   -4.007  -15.683 1.00 23.85  ? 53  HIS A CD2 1 
ATOM   372  C CE1 . HIS A 1 55  ? 8.338   -2.532  -15.982 1.00 27.08  ? 53  HIS A CE1 1 
ATOM   373  N NE2 . HIS A 1 55  ? 7.528   -3.366  -16.607 1.00 28.70  ? 53  HIS A NE2 1 
ATOM   374  N N   . LYS A 1 56  ? 9.209   -4.817  -11.534 1.00 22.01  ? 54  LYS A N   1 
ATOM   375  C CA  . LYS A 1 56  ? 10.662  -4.940  -11.406 1.00 21.99  ? 54  LYS A CA  1 
ATOM   376  C C   . LYS A 1 56  ? 11.108  -6.417  -11.359 1.00 20.85  ? 54  LYS A C   1 
ATOM   377  O O   . LYS A 1 56  ? 12.092  -6.804  -11.985 1.00 21.91  ? 54  LYS A O   1 
ATOM   378  C CB  . LYS A 1 56  ? 11.161  -4.215  -10.157 1.00 21.77  ? 54  LYS A CB  1 
ATOM   379  C CG  . LYS A 1 56  ? 10.973  -2.702  -10.150 1.00 24.44  ? 54  LYS A CG  1 
ATOM   380  C CD  . LYS A 1 56  ? 11.595  -1.999  -11.354 1.00 28.73  ? 54  LYS A CD  1 
ATOM   381  C CE  . LYS A 1 56  ? 11.603  -0.495  -11.111 1.00 28.91  ? 54  LYS A CE  1 
ATOM   382  N NZ  . LYS A 1 56  ? 12.213  0.263   -12.225 1.00 28.31  ? 54  LYS A NZ  1 
ATOM   383  N N   . ILE A 1 57  ? 10.346  -7.235  -10.636 1.00 25.26  ? 55  ILE A N   1 
ATOM   384  C CA  . ILE A 1 57  ? 10.673  -8.641  -10.434 1.00 23.41  ? 55  ILE A CA  1 
ATOM   385  C C   . ILE A 1 57  ? 10.636  -9.436  -11.736 1.00 23.74  ? 55  ILE A C   1 
ATOM   386  O O   . ILE A 1 57  ? 11.382  -10.398 -11.907 1.00 26.17  ? 55  ILE A O   1 
ATOM   387  C CB  . ILE A 1 57  ? 9.713   -9.265  -9.398  1.00 22.32  ? 55  ILE A CB  1 
ATOM   388  C CG1 . ILE A 1 57  ? 10.092  -8.795  -7.980  1.00 19.03  ? 55  ILE A CG1 1 
ATOM   389  C CG2 . ILE A 1 57  ? 9.722   -10.802 -9.486  1.00 19.54  ? 55  ILE A CG2 1 
ATOM   390  C CD1 . ILE A 1 57  ? 9.033   -9.177  -6.926  1.00 22.71  ? 55  ILE A CD1 1 
ATOM   391  N N   . GLN A 1 58  ? 9.758   -9.031  -12.640 1.00 24.68  ? 56  GLN A N   1 
ATOM   392  C CA  . GLN A 1 58  ? 9.638   -9.658  -13.952 1.00 27.65  ? 56  GLN A CA  1 
ATOM   393  C C   . GLN A 1 58  ? 10.568  -9.066  -15.001 1.00 28.14  ? 56  GLN A C   1 
ATOM   394  O O   . GLN A 1 58  ? 10.488  -9.432  -16.170 1.00 28.03  ? 56  GLN A O   1 
ATOM   395  C CB  . GLN A 1 58  ? 8.191   -9.599  -14.432 1.00 28.68  ? 56  GLN A CB  1 
ATOM   396  C CG  . GLN A 1 58  ? 7.241   -10.351 -13.515 1.00 33.26  ? 56  GLN A CG  1 
ATOM   397  C CD  . GLN A 1 58  ? 5.802   -10.292 -13.979 1.00 37.65  ? 56  GLN A CD  1 
ATOM   398  O OE1 . GLN A 1 58  ? 4.980   -11.135 -13.604 1.00 42.08  ? 56  GLN A OE1 1 
ATOM   399  N NE2 . GLN A 1 58  ? 5.486   -9.294  -14.786 1.00 43.26  ? 56  GLN A NE2 1 
ATOM   400  N N   . SER A 1 59  ? 11.526  -8.248  -14.567 1.00 24.33  ? 57  SER A N   1 
ATOM   401  C CA  . SER A 1 59  ? 12.519  -7.685  -15.497 1.00 26.64  ? 57  SER A CA  1 
ATOM   402  C C   . SER A 1 59  ? 13.431  -8.731  -16.139 1.00 26.35  ? 57  SER A C   1 
ATOM   403  O O   . SER A 1 59  ? 13.883  -9.662  -15.472 1.00 26.18  ? 57  SER A O   1 
ATOM   404  C CB  . SER A 1 59  ? 13.358  -6.604  -14.813 1.00 26.33  ? 57  SER A CB  1 
ATOM   405  O OG  . SER A 1 59  ? 14.269  -6.048  -15.736 1.00 29.77  ? 57  SER A OG  1 
ATOM   406  N N   . PRO A 1 60  ? 13.672  -8.613  -17.457 1.00 27.28  ? 58  PRO A N   1 
ATOM   407  C CA  . PRO A 1 60  ? 14.697  -9.476  -18.045 1.00 28.63  ? 58  PRO A CA  1 
ATOM   408  C C   . PRO A 1 60  ? 16.123  -9.100  -17.636 1.00 30.06  ? 58  PRO A C   1 
ATOM   409  O O   . PRO A 1 60  ? 17.057  -9.858  -17.894 1.00 31.95  ? 58  PRO A O   1 
ATOM   410  C CB  . PRO A 1 60  ? 14.497  -9.311  -19.560 1.00 29.86  ? 58  PRO A CB  1 
ATOM   411  C CG  . PRO A 1 60  ? 13.670  -8.080  -19.731 1.00 29.66  ? 58  PRO A CG  1 
ATOM   412  C CD  . PRO A 1 60  ? 12.982  -7.766  -18.446 1.00 26.73  ? 58  PRO A CD  1 
ATOM   413  N N   . GLN A 1 61  ? 16.289  -7.941  -17.009 1.00 29.25  ? 59  GLN A N   1 
ATOM   414  C CA  . GLN A 1 61  ? 17.583  -7.538  -16.500 1.00 28.52  ? 59  GLN A CA  1 
ATOM   415  C C   . GLN A 1 61  ? 17.725  -8.102  -15.096 1.00 26.98  ? 59  GLN A C   1 
ATOM   416  O O   . GLN A 1 61  ? 17.078  -7.632  -14.156 1.00 23.55  ? 59  GLN A O   1 
ATOM   417  C CB  . GLN A 1 61  ? 17.704  -6.011  -16.490 1.00 30.75  ? 59  GLN A CB  1 
ATOM   418  C CG  . GLN A 1 61  ? 17.696  -5.395  -17.907 1.00 31.45  ? 59  GLN A CG  1 
ATOM   419  C CD  . GLN A 1 61  ? 18.058  -3.926  -17.907 1.00 35.84  ? 59  GLN A CD  1 
ATOM   420  O OE1 . GLN A 1 61  ? 19.081  -3.526  -17.363 1.00 40.66  ? 59  GLN A OE1 1 
ATOM   421  N NE2 . GLN A 1 61  ? 17.242  -3.121  -18.561 1.00 39.98  ? 59  GLN A NE2 1 
ATOM   422  N N   . GLU A 1 62  ? 18.517  -9.164  -14.977 1.00 32.17  ? 60  GLU A N   1 
ATOM   423  C CA  . GLU A 1 62  ? 18.527  -9.966  -13.772 1.00 28.64  ? 60  GLU A CA  1 
ATOM   424  C C   . GLU A 1 62  ? 18.843  -9.177  -12.519 1.00 27.58  ? 60  GLU A C   1 
ATOM   425  O O   . GLU A 1 62  ? 18.296  -9.479  -11.458 1.00 26.47  ? 60  GLU A O   1 
ATOM   426  C CB  . GLU A 1 62  ? 19.485  -11.149 -13.898 1.00 30.12  ? 60  GLU A CB  1 
ATOM   427  C CG  . GLU A 1 62  ? 19.455  -12.076 -12.675 1.00 29.96  ? 60  GLU A CG  1 
ATOM   428  C CD  . GLU A 1 62  ? 20.615  -13.063 -12.664 1.00 34.49  ? 60  GLU A CD  1 
ATOM   429  O OE1 . GLU A 1 62  ? 21.761  -12.635 -12.445 1.00 37.50  ? 60  GLU A OE1 1 
ATOM   430  O OE2 . GLU A 1 62  ? 20.377  -14.264 -12.892 1.00 39.40  ? 60  GLU A OE2 1 
ATOM   431  N N   . TRP A 1 63  ? 19.785  -8.238  -12.598 1.00 25.15  ? 61  TRP A N   1 
ATOM   432  C CA  . TRP A 1 63  ? 20.206  -7.517  -11.377 1.00 26.37  ? 61  TRP A CA  1 
ATOM   433  C C   . TRP A 1 63  ? 19.092  -6.582  -10.923 1.00 25.26  ? 61  TRP A C   1 
ATOM   434  O O   . TRP A 1 63  ? 18.925  -6.318  -9.748  1.00 25.88  ? 61  TRP A O   1 
ATOM   435  C CB  . TRP A 1 63  ? 21.530  -6.763  -11.601 1.00 28.14  ? 61  TRP A CB  1 
ATOM   436  C CG  . TRP A 1 63  ? 22.098  -6.016  -10.393 1.00 29.49  ? 61  TRP A CG  1 
ATOM   437  C CD1 . TRP A 1 63  ? 22.665  -4.776  -10.407 1.00 30.03  ? 61  TRP A CD1 1 
ATOM   438  C CD2 . TRP A 1 63  ? 22.224  -6.496  -9.032  1.00 27.74  ? 61  TRP A CD2 1 
ATOM   439  N NE1 . TRP A 1 63  ? 23.105  -4.437  -9.149  1.00 33.59  ? 61  TRP A NE1 1 
ATOM   440  C CE2 . TRP A 1 63  ? 22.836  -5.465  -8.283  1.00 29.20  ? 61  TRP A CE2 1 
ATOM   441  C CE3 . TRP A 1 63  ? 21.863  -7.680  -8.377  1.00 27.95  ? 61  TRP A CE3 1 
ATOM   442  C CZ2 . TRP A 1 63  ? 23.105  -5.585  -6.913  1.00 28.98  ? 61  TRP A CZ2 1 
ATOM   443  C CZ3 . TRP A 1 63  ? 22.146  -7.806  -7.000  1.00 26.76  ? 61  TRP A CZ3 1 
ATOM   444  C CH2 . TRP A 1 63  ? 22.765  -6.766  -6.293  1.00 26.07  ? 61  TRP A CH2 1 
ATOM   445  N N   . GLU A 1 64  ? 18.302  -6.108  -11.875 1.00 24.58  ? 62  GLU A N   1 
ATOM   446  C CA  . GLU A 1 64  ? 17.110  -5.356  -11.544 1.00 22.72  ? 62  GLU A CA  1 
ATOM   447  C C   . GLU A 1 64  ? 16.100  -6.211  -10.781 1.00 20.57  ? 62  GLU A C   1 
ATOM   448  O O   . GLU A 1 64  ? 15.636  -5.808  -9.731  1.00 21.17  ? 62  GLU A O   1 
ATOM   449  C CB  . GLU A 1 64  ? 16.480  -4.789  -12.799 1.00 24.44  ? 62  GLU A CB  1 
ATOM   450  C CG  . GLU A 1 64  ? 15.272  -3.880  -12.528 1.00 25.49  ? 62  GLU A CG  1 
ATOM   451  C CD  . GLU A 1 64  ? 14.847  -3.140  -13.787 1.00 33.65  ? 62  GLU A CD  1 
ATOM   452  O OE1 . GLU A 1 64  ? 14.906  -1.898  -13.776 1.00 34.65  ? 62  GLU A OE1 1 
ATOM   453  O OE2 . GLU A 1 64  ? 14.577  -3.801  -14.819 1.00 32.03  ? 62  GLU A OE2 1 
ATOM   454  N N   . ALA A 1 65  ? 15.797  -7.401  -11.301 1.00 24.39  ? 63  ALA A N   1 
ATOM   455  C CA  . ALA A 1 65  ? 14.862  -8.322  -10.670 1.00 22.31  ? 63  ALA A CA  1 
ATOM   456  C C   . ALA A 1 65  ? 15.358  -8.832  -9.310  1.00 23.03  ? 63  ALA A C   1 
ATOM   457  O O   . ALA A 1 65  ? 14.583  -8.900  -8.359  1.00 22.29  ? 63  ALA A O   1 
ATOM   458  C CB  . ALA A 1 65  ? 14.577  -9.499  -11.595 1.00 21.94  ? 63  ALA A CB  1 
ATOM   459  N N   . ILE A 1 66  ? 16.651  -9.158  -9.217  1.00 26.15  ? 64  ILE A N   1 
ATOM   460  C CA  . ILE A 1 66  ? 17.253  -9.631  -7.961  1.00 26.18  ? 64  ILE A CA  1 
ATOM   461  C C   . ILE A 1 66  ? 17.180  -8.602  -6.836  1.00 25.82  ? 64  ILE A C   1 
ATOM   462  O O   . ILE A 1 66  ? 16.902  -8.948  -5.680  1.00 27.89  ? 64  ILE A O   1 
ATOM   463  C CB  . ILE A 1 66  ? 18.711  -10.084 -8.176  1.00 26.02  ? 64  ILE A CB  1 
ATOM   464  C CG1 . ILE A 1 66  ? 18.755  -11.399 -8.964  1.00 25.97  ? 64  ILE A CG1 1 
ATOM   465  C CG2 . ILE A 1 66  ? 19.464  -10.235 -6.843  1.00 28.28  ? 64  ILE A CG2 1 
ATOM   466  C CD1 . ILE A 1 66  ? 18.035  -12.550 -8.262  1.00 25.65  ? 64  ILE A CD1 1 
ATOM   467  N N   . GLN A 1 67  ? 17.464  -7.347  -7.168  1.00 22.67  ? 65  GLN A N   1 
ATOM   468  C CA  . GLN A 1 67  ? 17.378  -6.266  -6.200  1.00 23.12  ? 65  GLN A CA  1 
ATOM   469  C C   . GLN A 1 67  ? 15.924  -6.051  -5.807  1.00 22.38  ? 65  GLN A C   1 
ATOM   470  O O   . GLN A 1 67  ? 15.630  -5.742  -4.669  1.00 24.35  ? 65  GLN A O   1 
ATOM   471  C CB  . GLN A 1 67  ? 17.959  -4.970  -6.781  1.00 25.45  ? 65  GLN A CB  1 
ATOM   472  C CG  . GLN A 1 67  ? 19.500  -4.915  -6.763  1.00 25.29  ? 65  GLN A CG  1 
ATOM   473  C CD  . GLN A 1 67  ? 20.058  -3.630  -7.360  1.00 22.13  ? 65  GLN A CD  1 
ATOM   474  O OE1 . GLN A 1 67  ? 20.509  -2.753  -6.631  1.00 28.68  ? 65  GLN A OE1 1 
ATOM   475  N NE2 . GLN A 1 67  ? 19.968  -3.488  -8.686  1.00 26.98  ? 65  GLN A NE2 1 
ATOM   476  N N   . ALA A 1 68  ? 15.014  -6.205  -6.760  1.00 24.46  ? 66  ALA A N   1 
ATOM   477  C CA  . ALA A 1 68  ? 13.588  -6.106  -6.457  1.00 24.42  ? 66  ALA A CA  1 
ATOM   478  C C   . ALA A 1 68  ? 13.167  -7.147  -5.434  1.00 21.95  ? 66  ALA A C   1 
ATOM   479  O O   . ALA A 1 68  ? 12.319  -6.885  -4.599  1.00 21.76  ? 66  ALA A O   1 
ATOM   480  C CB  . ALA A 1 68  ? 12.740  -6.245  -7.734  1.00 22.02  ? 66  ALA A CB  1 
ATOM   481  N N   . LEU A 1 69  ? 13.647  -8.368  -5.613  1.00 22.87  ? 67  LEU A N   1 
ATOM   482  C CA  . LEU A 1 69  ? 13.310  -9.467  -4.706  1.00 21.81  ? 67  LEU A CA  1 
ATOM   483  C C   . LEU A 1 69  ? 13.891  -9.216  -3.312  1.00 23.47  ? 67  LEU A C   1 
ATOM   484  O O   . LEU A 1 69  ? 13.302  -9.608  -2.297  1.00 24.20  ? 67  LEU A O   1 
ATOM   485  C CB  . LEU A 1 69  ? 13.810  -10.797 -5.296  1.00 20.10  ? 67  LEU A CB  1 
ATOM   486  C CG  . LEU A 1 69  ? 12.994  -11.283 -6.508  1.00 21.21  ? 67  LEU A CG  1 
ATOM   487  C CD1 . LEU A 1 69  ? 13.719  -12.398 -7.247  1.00 19.22  ? 67  LEU A CD1 1 
ATOM   488  C CD2 . LEU A 1 69  ? 11.556  -11.732 -6.023  1.00 17.62  ? 67  LEU A CD2 1 
ATOM   489  N N   . THR A 1 70  ? 15.055  -8.574  -3.264  1.00 23.83  ? 68  THR A N   1 
ATOM   490  C CA  . THR A 1 70  ? 15.625  -8.119  -1.997  1.00 25.19  ? 68  THR A CA  1 
ATOM   491  C C   . THR A 1 70  ? 14.802  -7.013  -1.317  1.00 25.33  ? 68  THR A C   1 
ATOM   492  O O   . THR A 1 70  ? 14.572  -7.080  -0.119  1.00 26.86  ? 68  THR A O   1 
ATOM   493  C CB  . THR A 1 70  ? 17.103  -7.675  -2.161  1.00 27.12  ? 68  THR A CB  1 
ATOM   494  O OG1 . THR A 1 70  ? 17.896  -8.816  -2.498  1.00 29.93  ? 68  THR A OG1 1 
ATOM   495  C CG2 . THR A 1 70  ? 17.640  -7.079  -0.868  1.00 27.15  ? 68  THR A CG2 1 
ATOM   496  N N   . VAL A 1 71  ? 14.345  -6.018  -2.073  1.00 19.84  ? 69  VAL A N   1 
ATOM   497  C CA  . VAL A 1 71  ? 13.330  -5.067  -1.548  1.00 22.46  ? 69  VAL A CA  1 
ATOM   498  C C   . VAL A 1 71  ? 12.070  -5.773  -1.005  1.00 22.25  ? 69  VAL A C   1 
ATOM   499  O O   . VAL A 1 71  ? 11.673  -5.542  0.136   1.00 22.64  ? 69  VAL A O   1 
ATOM   500  C CB  . VAL A 1 71  ? 12.899  -4.005  -2.597  1.00 24.24  ? 69  VAL A CB  1 
ATOM   501  C CG1 . VAL A 1 71  ? 11.869  -3.024  -1.987  1.00 24.55  ? 69  VAL A CG1 1 
ATOM   502  C CG2 . VAL A 1 71  ? 14.115  -3.263  -3.142  1.00 20.90  ? 69  VAL A CG2 1 
ATOM   503  N N   . LEU A 1 72  ? 11.509  -6.700  -1.788  1.00 24.02  ? 70  LEU A N   1 
ATOM   504  C CA  . LEU A 1 72  ? 10.341  -7.484  -1.354  1.00 22.74  ? 70  LEU A CA  1 
ATOM   505  C C   . LEU A 1 72  ? 10.620  -8.296  -0.079  1.00 21.51  ? 70  LEU A C   1 
ATOM   506  O O   . LEU A 1 72  ? 9.824   -8.270  0.870   1.00 22.49  ? 70  LEU A O   1 
ATOM   507  C CB  . LEU A 1 72  ? 9.860   -8.420  -2.486  1.00 22.05  ? 70  LEU A CB  1 
ATOM   508  C CG  . LEU A 1 72  ? 8.695   -9.399  -2.204  1.00 21.01  ? 70  LEU A CG  1 
ATOM   509  C CD1 . LEU A 1 72  ? 7.387   -8.696  -1.800  1.00 17.41  ? 70  LEU A CD1 1 
ATOM   510  C CD2 . LEU A 1 72  ? 8.449   -10.305 -3.415  1.00 16.42  ? 70  LEU A CD2 1 
ATOM   511  N N   . GLU A 1 73  ? 11.759  -8.990  -0.042  1.00 19.81  ? 71  GLU A N   1 
ATOM   512  C CA  . GLU A 1 73  ? 12.157  -9.720  1.151   1.00 20.37  ? 71  GLU A CA  1 
ATOM   513  C C   . GLU A 1 73  ? 12.234  -8.768  2.331   1.00 22.65  ? 71  GLU A C   1 
ATOM   514  O O   . GLU A 1 73  ? 11.767  -9.090  3.409   1.00 22.34  ? 71  GLU A O   1 
ATOM   515  C CB  . GLU A 1 73  ? 13.508  -10.450 0.975   1.00 19.93  ? 71  GLU A CB  1 
ATOM   516  C CG  . GLU A 1 73  ? 13.847  -11.284 2.207   1.00 21.73  ? 71  GLU A CG  1 
ATOM   517  C CD  . GLU A 1 73  ? 15.115  -12.155 2.089   1.00 31.94  ? 71  GLU A CD  1 
ATOM   518  O OE1 . GLU A 1 73  ? 15.801  -12.158 1.036   1.00 24.94  ? 71  GLU A OE1 1 
ATOM   519  O OE2 . GLU A 1 73  ? 15.442  -12.823 3.099   1.00 34.11  ? 71  GLU A OE2 1 
ATOM   520  N N   . THR A 1 74  ? 12.842  -7.600  2.110   1.00 22.25  ? 72  THR A N   1 
ATOM   521  C CA  . THR A 1 74  ? 13.117  -6.645  3.182   1.00 24.75  ? 72  THR A CA  1 
ATOM   522  C C   . THR A 1 74  ? 11.815  -6.083  3.753   1.00 26.08  ? 72  THR A C   1 
ATOM   523  O O   . THR A 1 74  ? 11.621  -6.069  4.960   1.00 27.18  ? 72  THR A O   1 
ATOM   524  C CB  . THR A 1 74  ? 14.040  -5.483  2.701   1.00 25.55  ? 72  THR A CB  1 
ATOM   525  O OG1 . THR A 1 74  ? 15.257  -6.029  2.163   1.00 25.58  ? 72  THR A OG1 1 
ATOM   526  C CG2 . THR A 1 74  ? 14.412  -4.545  3.883   1.00 31.10  ? 72  THR A CG2 1 
ATOM   527  N N   . CYS A 1 75  ? 10.923  -5.614  2.888   1.00 21.54  ? 73  CYS A N   1 
ATOM   528  C CA  . CYS A 1 75  ? 9.687   -5.001  3.361   1.00 22.80  ? 73  CYS A CA  1 
ATOM   529  C C   . CYS A 1 75  ? 8.713   -6.009  3.958   1.00 22.00  ? 73  CYS A C   1 
ATOM   530  O O   . CYS A 1 75  ? 7.948   -5.667  4.861   1.00 25.48  ? 73  CYS A O   1 
ATOM   531  C CB  . CYS A 1 75  ? 9.006   -4.173  2.263   1.00 24.19  ? 73  CYS A CB  1 
ATOM   532  S SG  . CYS A 1 75  ? 10.046  -2.911  1.432   1.00 27.72  ? 73  CYS A SG  1 
ATOM   533  N N   . MET A 1 76  ? 8.762   -7.263  3.504   1.00 26.62  ? 74  MET A N   1 
ATOM   534  C CA  . MET A 1 76  ? 7.984   -8.315  4.157   1.00 25.80  ? 74  MET A CA  1 
ATOM   535  C C   . MET A 1 76  ? 8.437   -8.528  5.603   1.00 29.61  ? 74  MET A C   1 
ATOM   536  O O   . MET A 1 76  ? 7.624   -8.738  6.496   1.00 31.06  ? 74  MET A O   1 
ATOM   537  C CB  . MET A 1 76  ? 8.047   -9.635  3.373   1.00 24.72  ? 74  MET A CB  1 
ATOM   538  C CG  . MET A 1 76  ? 7.187   -9.655  2.095   1.00 22.80  ? 74  MET A CG  1 
ATOM   539  S SD  . MET A 1 76  ? 5.417   -9.491  2.425   1.00 23.45  ? 74  MET A SD  1 
ATOM   540  C CE  . MET A 1 76  ? 4.961   -11.180 2.856   1.00 19.19  ? 74  MET A CE  1 
ATOM   541  N N   . LYS A 1 77  ? 9.737   -8.438  5.841   1.00 30.39  ? 75  LYS A N   1 
ATOM   542  C CA  . LYS A 1 77  ? 10.244  -8.608  7.190   1.00 35.14  ? 75  LYS A CA  1 
ATOM   543  C C   . LYS A 1 77  ? 9.950   -7.383  8.046   1.00 38.77  ? 75  LYS A C   1 
ATOM   544  O O   . LYS A 1 77  ? 9.735   -7.502  9.252   1.00 40.30  ? 75  LYS A O   1 
ATOM   545  C CB  . LYS A 1 77  ? 11.743  -8.875  7.170   1.00 36.51  ? 75  LYS A CB  1 
ATOM   546  C CG  . LYS A 1 77  ? 12.096  -10.316 6.890   1.00 39.55  ? 75  LYS A CG  1 
ATOM   547  C CD  . LYS A 1 77  ? 13.604  -10.526 6.999   1.00 50.69  ? 75  LYS A CD  1 
ATOM   548  C CE  . LYS A 1 77  ? 14.178  -11.102 5.711   1.00 48.75  ? 75  LYS A CE  1 
ATOM   549  N NZ  . LYS A 1 77  ? 15.153  -12.189 5.999   1.00 52.45  ? 75  LYS A NZ  1 
ATOM   550  N N   . SER A 1 78  ? 10.006  -6.199  7.439   1.00 30.83  ? 76  SER A N   1 
ATOM   551  C CA  . SER A 1 78  ? 9.984   -4.972  8.219   1.00 33.03  ? 76  SER A CA  1 
ATOM   552  C C   . SER A 1 78  ? 8.573   -4.437  8.428   1.00 34.16  ? 76  SER A C   1 
ATOM   553  O O   . SER A 1 78  ? 8.238   -3.975  9.518   1.00 34.25  ? 76  SER A O   1 
ATOM   554  C CB  . SER A 1 78  ? 10.909  -3.907  7.628   1.00 29.73  ? 76  SER A CB  1 
ATOM   555  O OG  . SER A 1 78  ? 10.609  -3.671  6.257   1.00 35.96  ? 76  SER A OG  1 
ATOM   556  N N   . CYS A 1 79  ? 7.750   -4.502  7.386   1.00 30.86  ? 77  CYS A N   1 
ATOM   557  C CA  . CYS A 1 79  ? 6.445   -3.826  7.392   1.00 35.42  ? 77  CYS A CA  1 
ATOM   558  C C   . CYS A 1 79  ? 5.376   -4.758  7.978   1.00 34.83  ? 77  CYS A C   1 
ATOM   559  O O   . CYS A 1 79  ? 5.708   -5.839  8.446   1.00 34.28  ? 77  CYS A O   1 
ATOM   560  C CB  . CYS A 1 79  ? 6.083   -3.360  5.964   1.00 32.54  ? 77  CYS A CB  1 
ATOM   561  S SG  . CYS A 1 79  ? 7.033   -1.876  5.419   1.00 37.20  ? 77  CYS A SG  1 
ATOM   562  N N   . GLY A 1 80  ? 4.126   -4.307  8.048   1.00 52.66  ? 78  GLY A N   1 
ATOM   563  C CA  . GLY A 1 80  ? 3.017   -5.114  7.500   1.00 53.89  ? 78  GLY A CA  1 
ATOM   564  C C   . GLY A 1 80  ? 2.089   -5.771  8.490   1.00 55.99  ? 78  GLY A C   1 
ATOM   565  O O   . GLY A 1 80  ? 2.535   -6.435  9.427   1.00 60.99  ? 78  GLY A O   1 
ATOM   566  N N   . LYS A 1 81  ? 0.823   -5.381  8.425   1.00 43.90  ? 79  LYS A N   1 
ATOM   567  C CA  . LYS A 1 81  ? -0.258  -6.293  8.130   1.00 39.51  ? 79  LYS A CA  1 
ATOM   568  C C   . LYS A 1 81  ? -0.739  -5.856  6.750   1.00 36.76  ? 79  LYS A C   1 
ATOM   569  O O   . LYS A 1 81  ? -0.973  -6.689  5.879   1.00 33.06  ? 79  LYS A O   1 
ATOM   570  C CB  . LYS A 1 81  ? -1.392  -6.157  9.159   1.00 44.05  ? 79  LYS A CB  1 
ATOM   571  C CG  . LYS A 1 81  ? -2.620  -7.017  8.860   1.00 43.95  ? 79  LYS A CG  1 
ATOM   572  C CD  . LYS A 1 81  ? -3.516  -7.166  10.097  1.00 53.52  ? 79  LYS A CD  1 
ATOM   573  C CE  . LYS A 1 81  ? -4.652  -8.163  9.867   1.00 55.97  ? 79  LYS A CE  1 
ATOM   574  N NZ  . LYS A 1 81  ? -5.364  -7.927  8.580   1.00 53.37  ? 79  LYS A NZ  1 
ATOM   575  N N   . ARG A 1 82  ? -0.785  -4.542  6.526   1.00 37.47  ? 80  ARG A N   1 
ATOM   576  C CA  . ARG A 1 82  ? -1.232  -3.996  5.239   1.00 37.80  ? 80  ARG A CA  1 
ATOM   577  C C   . ARG A 1 82  ? -0.375  -4.457  4.039   1.00 34.13  ? 80  ARG A C   1 
ATOM   578  O O   . ARG A 1 82  ? -0.920  -4.844  3.008   1.00 32.15  ? 80  ARG A O   1 
ATOM   579  C CB  . ARG A 1 82  ? -1.313  -2.464  5.284   1.00 42.19  ? 80  ARG A CB  1 
ATOM   580  C CG  . ARG A 1 82  ? -2.424  -1.916  6.192   1.00 51.40  ? 80  ARG A CG  1 
ATOM   581  C CD  . ARG A 1 82  ? -2.346  -0.390  6.388   1.00 62.11  ? 80  ARG A CD  1 
ATOM   582  N NE  . ARG A 1 82  ? -1.014  0.162   6.128   1.00 65.49  ? 80  ARG A NE  1 
ATOM   583  C CZ  . ARG A 1 82  ? -0.760  1.141   5.260   1.00 68.48  ? 80  ARG A CZ  1 
ATOM   584  N NH1 . ARG A 1 82  ? -1.752  1.721   4.593   1.00 71.54  ? 80  ARG A NH1 1 
ATOM   585  N NH2 . ARG A 1 82  ? 0.488   1.551   5.060   1.00 67.26  ? 80  ARG A NH2 1 
ATOM   586  N N   . PHE A 1 83  ? 0.951   -4.390  4.165   1.00 33.32  ? 81  PHE A N   1 
ATOM   587  C CA  . PHE A 1 83  ? 1.847   -4.937  3.138   1.00 29.16  ? 81  PHE A CA  1 
ATOM   588  C C   . PHE A 1 83  ? 1.759   -6.463  3.035   1.00 25.98  ? 81  PHE A C   1 
ATOM   589  O O   . PHE A 1 83  ? 1.723   -7.010  1.945   1.00 22.71  ? 81  PHE A O   1 
ATOM   590  C CB  . PHE A 1 83  ? 3.312   -4.517  3.386   1.00 28.67  ? 81  PHE A CB  1 
ATOM   591  C CG  . PHE A 1 83  ? 4.225   -4.767  2.201   1.00 26.65  ? 81  PHE A CG  1 
ATOM   592  C CD1 . PHE A 1 83  ? 3.962   -4.175  0.967   1.00 27.57  ? 81  PHE A CD1 1 
ATOM   593  C CD2 . PHE A 1 83  ? 5.285   -5.667  2.295   1.00 27.17  ? 81  PHE A CD2 1 
ATOM   594  C CE1 . PHE A 1 83  ? 4.744   -4.458  -0.139  1.00 22.72  ? 81  PHE A CE1 1 
ATOM   595  C CE2 . PHE A 1 83  ? 6.078   -5.952  1.193   1.00 22.36  ? 81  PHE A CE2 1 
ATOM   596  C CZ  . PHE A 1 83  ? 5.821   -5.343  -0.021  1.00 23.45  ? 81  PHE A CZ  1 
ATOM   597  N N   . HIS A 1 84  ? 1.826   -7.155  4.166   1.00 27.28  ? 82  HIS A N   1 
ATOM   598  C CA  . HIS A 1 84  ? 1.690   -8.613  4.155   1.00 25.14  ? 82  HIS A CA  1 
ATOM   599  C C   . HIS A 1 84  ? 0.408   -9.051  3.443   1.00 25.98  ? 82  HIS A C   1 
ATOM   600  O O   . HIS A 1 84  ? 0.406   -10.027 2.666   1.00 24.11  ? 82  HIS A O   1 
ATOM   601  C CB  . HIS A 1 84  ? 1.723   -9.152  5.581   1.00 28.13  ? 82  HIS A CB  1 
ATOM   602  C CG  . HIS A 1 84  ? 3.037   -8.957  6.265   1.00 26.57  ? 82  HIS A CG  1 
ATOM   603  N ND1 . HIS A 1 84  ? 3.168   -8.949  7.639   1.00 29.74  ? 82  HIS A ND1 1 
ATOM   604  C CD2 . HIS A 1 84  ? 4.265   -8.682  5.767   1.00 26.99  ? 82  HIS A CD2 1 
ATOM   605  C CE1 . HIS A 1 84  ? 4.430   -8.723  7.956   1.00 39.10  ? 82  HIS A CE1 1 
ATOM   606  N NE2 . HIS A 1 84  ? 5.120   -8.572  6.837   1.00 30.62  ? 82  HIS A NE2 1 
ATOM   607  N N   . ASP A 1 85  ? -0.674  -8.317  3.698   1.00 28.52  ? 83  ASP A N   1 
ATOM   608  C CA  . ASP A 1 85  ? -1.979  -8.617  3.114   1.00 31.16  ? 83  ASP A CA  1 
ATOM   609  C C   . ASP A 1 85  ? -2.013  -8.460  1.599   1.00 29.44  ? 83  ASP A C   1 
ATOM   610  O O   . ASP A 1 85  ? -2.697  -9.219  0.928   1.00 28.13  ? 83  ASP A O   1 
ATOM   611  C CB  . ASP A 1 85  ? -3.085  -7.773  3.766   1.00 33.08  ? 83  ASP A CB  1 
ATOM   612  C CG  . ASP A 1 85  ? -3.490  -8.302  5.135   1.00 36.99  ? 83  ASP A CG  1 
ATOM   613  O OD1 . ASP A 1 85  ? -4.225  -7.603  5.858   1.00 42.66  ? 83  ASP A OD1 1 
ATOM   614  O OD2 . ASP A 1 85  ? -3.055  -9.415  5.496   1.00 37.75  ? 83  ASP A OD2 1 
ATOM   615  N N   . GLU A 1 86  ? -1.323  -7.440  1.075   1.00 29.38  ? 84  GLU A N   1 
ATOM   616  C CA  . GLU A 1 86  ? -1.282  -7.169  -0.369  1.00 27.19  ? 84  GLU A CA  1 
ATOM   617  C C   . GLU A 1 86  ? -0.440  -8.200  -1.103  1.00 25.04  ? 84  GLU A C   1 
ATOM   618  O O   . GLU A 1 86  ? -0.789  -8.643  -2.207  1.00 23.21  ? 84  GLU A O   1 
ATOM   619  C CB  . GLU A 1 86  ? -0.698  -5.776  -0.649  1.00 28.78  ? 84  GLU A CB  1 
ATOM   620  C CG  . GLU A 1 86  ? -1.633  -4.614  -0.364  1.00 36.99  ? 84  GLU A CG  1 
ATOM   621  C CD  . GLU A 1 86  ? -2.971  -4.726  -1.081  1.00 38.80  ? 84  GLU A CD  1 
ATOM   622  O OE1 . GLU A 1 86  ? -3.005  -5.020  -2.305  1.00 40.29  ? 84  GLU A OE1 1 
ATOM   623  O OE2 . GLU A 1 86  ? -3.994  -4.505  -0.414  1.00 45.60  ? 84  GLU A OE2 1 
ATOM   624  N N   . VAL A 1 87  ? 0.719   -8.502  -0.534  1.00 25.54  ? 85  VAL A N   1 
ATOM   625  C CA  . VAL A 1 87  ? 1.586   -9.546  -1.075  1.00 24.83  ? 85  VAL A CA  1 
ATOM   626  C C   . VAL A 1 87  ? 0.839   -10.887 -1.009  1.00 24.52  ? 85  VAL A C   1 
ATOM   627  O O   . VAL A 1 87  ? 0.907   -11.688 -1.943  1.00 23.61  ? 85  VAL A O   1 
ATOM   628  C CB  . VAL A 1 87  ? 2.948   -9.582  -0.331  1.00 24.95  ? 85  VAL A CB  1 
ATOM   629  C CG1 . VAL A 1 87  ? 3.805   -10.803 -0.744  1.00 21.53  ? 85  VAL A CG1 1 
ATOM   630  C CG2 . VAL A 1 87  ? 3.701   -8.288  -0.596  1.00 24.42  ? 85  VAL A CG2 1 
ATOM   631  N N   . GLY A 1 88  ? 0.001   -11.046 0.013   1.00 25.78  ? 86  GLY A N   1 
ATOM   632  C CA  . GLY A 1 88  ? -0.734  -12.288 0.206   1.00 26.47  ? 86  GLY A CA  1 
ATOM   633  C C   . GLY A 1 88  ? -2.033  -12.404 -0.575  1.00 27.72  ? 86  GLY A C   1 
ATOM   634  O O   . GLY A 1 88  ? -2.884  -13.216 -0.228  1.00 31.27  ? 86  GLY A O   1 
ATOM   635  N N   . LYS A 1 89  ? -2.211  -11.561 -1.592  1.00 27.52  ? 87  LYS A N   1 
ATOM   636  C CA  . LYS A 1 89  ? -3.280  -11.703 -2.571  1.00 27.35  ? 87  LYS A CA  1 
ATOM   637  C C   . LYS A 1 89  ? -2.812  -12.403 -3.849  1.00 25.69  ? 87  LYS A C   1 
ATOM   638  O O   . LYS A 1 89  ? -1.632  -12.307 -4.223  1.00 23.52  ? 87  LYS A O   1 
ATOM   639  C CB  . LYS A 1 89  ? -3.879  -10.327 -2.904  1.00 29.79  ? 87  LYS A CB  1 
ATOM   640  C CG  . LYS A 1 89  ? -4.552  -9.658  -1.713  1.00 30.27  ? 87  LYS A CG  1 
ATOM   641  C CD  . LYS A 1 89  ? -5.224  -8.359  -2.101  1.00 36.86  ? 87  LYS A CD  1 
ATOM   642  C CE  . LYS A 1 89  ? -5.578  -7.555  -0.857  1.00 41.68  ? 87  LYS A CE  1 
ATOM   643  N NZ  . LYS A 1 89  ? -6.529  -6.460  -1.160  1.00 46.42  ? 87  LYS A NZ  1 
ATOM   644  N N   . PHE A 1 90  ? -3.736  -13.090 -4.521  1.00 23.63  ? 88  PHE A N   1 
ATOM   645  C CA  . PHE A 1 90  ? -3.433  -13.760 -5.804  1.00 25.90  ? 88  PHE A CA  1 
ATOM   646  C C   . PHE A 1 90  ? -3.043  -12.720 -6.856  1.00 25.93  ? 88  PHE A C   1 
ATOM   647  O O   . PHE A 1 90  ? -2.226  -12.982 -7.727  1.00 27.39  ? 88  PHE A O   1 
ATOM   648  C CB  . PHE A 1 90  ? -4.608  -14.656 -6.284  1.00 23.56  ? 88  PHE A CB  1 
ATOM   649  C CG  . PHE A 1 90  ? -4.820  -15.885 -5.423  1.00 24.17  ? 88  PHE A CG  1 
ATOM   650  C CD1 . PHE A 1 90  ? -3.726  -16.650 -5.014  1.00 25.14  ? 88  PHE A CD1 1 
ATOM   651  C CD2 . PHE A 1 90  ? -6.073  -16.201 -4.923  1.00 26.12  ? 88  PHE A CD2 1 
ATOM   652  C CE1 . PHE A 1 90  ? -3.885  -17.735 -4.153  1.00 23.39  ? 88  PHE A CE1 1 
ATOM   653  C CE2 . PHE A 1 90  ? -6.240  -17.283 -4.040  1.00 25.43  ? 88  PHE A CE2 1 
ATOM   654  C CZ  . PHE A 1 90  ? -5.139  -18.034 -3.644  1.00 21.00  ? 88  PHE A CZ  1 
ATOM   655  N N   . ARG A 1 91  ? -3.525  -11.499 -6.663  1.00 28.41  ? 89  ARG A N   1 
ATOM   656  C CA  . ARG A 1 91  ? -3.204  -10.365 -7.535  1.00 29.82  ? 89  ARG A CA  1 
ATOM   657  C C   . ARG A 1 91  ? -1.693  -10.158 -7.613  1.00 28.46  ? 89  ARG A C   1 
ATOM   658  O O   . ARG A 1 91  ? -1.168  -9.807  -8.669  1.00 29.42  ? 89  ARG A O   1 
ATOM   659  C CB  . ARG A 1 91  ? -3.847  -9.097  -6.972  1.00 31.75  ? 89  ARG A CB  1 
ATOM   660  C CG  . ARG A 1 91  ? -3.826  -7.904  -7.905  1.00 36.97  ? 89  ARG A CG  1 
ATOM   661  C CD  . ARG A 1 91  ? -4.638  -6.751  -7.322  1.00 39.06  ? 89  ARG A CD  1 
ATOM   662  N NE  . ARG A 1 91  ? -6.074  -6.975  -7.452  1.00 43.85  ? 89  ARG A NE  1 
ATOM   663  C CZ  . ARG A 1 91  ? -6.954  -6.816  -6.466  1.00 47.26  ? 89  ARG A CZ  1 
ATOM   664  N NH1 . ARG A 1 91  ? -6.550  -6.426  -5.265  1.00 43.14  ? 89  ARG A NH1 1 
ATOM   665  N NH2 . ARG A 1 91  ? -8.249  -7.014  -6.695  1.00 48.15  ? 89  ARG A NH2 1 
ATOM   666  N N   . PHE A 1 92  ? -1.017  -10.293 -6.471  1.00 22.77  ? 90  PHE A N   1 
ATOM   667  C CA  . PHE A 1 92  ? 0.433   -10.257 -6.447  1.00 22.92  ? 90  PHE A CA  1 
ATOM   668  C C   . PHE A 1 92  ? 1.072   -11.625 -6.686  1.00 22.46  ? 90  PHE A C   1 
ATOM   669  O O   . PHE A 1 92  ? 1.967   -11.751 -7.505  1.00 21.73  ? 90  PHE A O   1 
ATOM   670  C CB  . PHE A 1 92  ? 0.966   -9.653  -5.148  1.00 22.40  ? 90  PHE A CB  1 
ATOM   671  C CG  . PHE A 1 92  ? 2.466   -9.496  -5.144  1.00 26.56  ? 90  PHE A CG  1 
ATOM   672  C CD1 . PHE A 1 92  ? 3.079   -8.516  -5.926  1.00 24.06  ? 90  PHE A CD1 1 
ATOM   673  C CD2 . PHE A 1 92  ? 3.259   -10.366 -4.428  1.00 20.26  ? 90  PHE A CD2 1 
ATOM   674  C CE1 . PHE A 1 92  ? 4.460   -8.405  -5.973  1.00 21.94  ? 90  PHE A CE1 1 
ATOM   675  C CE2 . PHE A 1 92  ? 4.651   -10.216 -4.411  1.00 22.50  ? 90  PHE A CE2 1 
ATOM   676  C CZ  . PHE A 1 92  ? 5.245   -9.230  -5.181  1.00 20.62  ? 90  PHE A CZ  1 
ATOM   677  N N   . LEU A 1 93  ? 0.612   -12.633 -5.949  1.00 23.76  ? 91  LEU A N   1 
ATOM   678  C CA  . LEU A 1 93  ? 1.198   -13.968 -5.981  1.00 23.65  ? 91  LEU A CA  1 
ATOM   679  C C   . LEU A 1 93  ? 1.214   -14.531 -7.404  1.00 24.57  ? 91  LEU A C   1 
ATOM   680  O O   . LEU A 1 93  ? 2.106   -15.302 -7.752  1.00 22.64  ? 91  LEU A O   1 
ATOM   681  C CB  . LEU A 1 93  ? 0.392   -14.908 -5.080  1.00 23.77  ? 91  LEU A CB  1 
ATOM   682  C CG  . LEU A 1 93  ? 0.759   -15.319 -3.647  1.00 28.28  ? 91  LEU A CG  1 
ATOM   683  C CD1 . LEU A 1 93  ? 2.065   -14.776 -3.040  1.00 21.88  ? 91  LEU A CD1 1 
ATOM   684  C CD2 . LEU A 1 93  ? -0.434  -15.250 -2.710  1.00 23.24  ? 91  LEU A CD2 1 
ATOM   685  N N   . ASN A 1 94  ? 0.188   -14.207 -8.197  1.00 23.52  ? 92  ASN A N   1 
ATOM   686  C CA  . ASN A 1 94  ? 0.138   -14.661 -9.598  1.00 24.70  ? 92  ASN A CA  1 
ATOM   687  C C   . ASN A 1 94  ? 1.311   -14.167 -10.421 1.00 23.81  ? 92  ASN A C   1 
ATOM   688  O O   . ASN A 1 94  ? 1.749   -14.826 -11.360 1.00 24.32  ? 92  ASN A O   1 
ATOM   689  C CB  . ASN A 1 94  ? -1.183  -14.259 -10.268 1.00 24.57  ? 92  ASN A CB  1 
ATOM   690  C CG  . ASN A 1 94  ? -2.341  -15.104 -9.808  1.00 27.91  ? 92  ASN A CG  1 
ATOM   691  O OD1 . ASN A 1 94  ? -2.145  -16.155 -9.181  1.00 27.44  ? 92  ASN A OD1 1 
ATOM   692  N ND2 . ASN A 1 94  ? -3.562  -14.668 -10.125 1.00 28.40  ? 92  ASN A ND2 1 
ATOM   693  N N   . GLU A 1 95  ? 1.800   -12.982 -10.083 1.00 24.19  ? 93  GLU A N   1 
ATOM   694  C CA  . GLU A 1 95  ? 2.925   -12.397 -10.796 1.00 25.03  ? 93  GLU A CA  1 
ATOM   695  C C   . GLU A 1 95  ? 4.232   -13.143 -10.498 1.00 24.47  ? 93  GLU A C   1 
ATOM   696  O O   . GLU A 1 95  ? 5.087   -13.288 -11.373 1.00 28.13  ? 93  GLU A O   1 
ATOM   697  C CB  . GLU A 1 95  ? 3.058   -10.910 -10.462 1.00 24.03  ? 93  GLU A CB  1 
ATOM   698  C CG  . GLU A 1 95  ? 1.812   -10.101 -10.773 1.00 26.33  ? 93  GLU A CG  1 
ATOM   699  C CD  . GLU A 1 95  ? 1.395   -10.214 -12.234 1.00 33.09  ? 93  GLU A CD  1 
ATOM   700  O OE1 . GLU A 1 95  ? 0.187   -10.363 -12.493 1.00 38.84  ? 93  GLU A OE1 1 
ATOM   701  O OE2 . GLU A 1 95  ? 2.274   -10.183 -13.122 1.00 34.71  ? 93  GLU A OE2 1 
ATOM   702  N N   . LEU A 1 96  ? 4.362   -13.658 -9.281  1.00 22.61  ? 94  LEU A N   1 
ATOM   703  C CA  . LEU A 1 96  ? 5.491   -14.528 -8.925  1.00 20.93  ? 94  LEU A CA  1 
ATOM   704  C C   . LEU A 1 96  ? 5.393   -15.892 -9.595  1.00 21.90  ? 94  LEU A C   1 
ATOM   705  O O   . LEU A 1 96  ? 6.394   -16.448 -10.028 1.00 23.09  ? 94  LEU A O   1 
ATOM   706  C CB  . LEU A 1 96  ? 5.544   -14.718 -7.402  1.00 21.11  ? 94  LEU A CB  1 
ATOM   707  C CG  . LEU A 1 96  ? 5.691   -13.440 -6.584  1.00 21.34  ? 94  LEU A CG  1 
ATOM   708  C CD1 . LEU A 1 96  ? 5.772   -13.761 -5.084  1.00 19.62  ? 94  LEU A CD1 1 
ATOM   709  C CD2 . LEU A 1 96  ? 6.914   -12.713 -7.025  1.00 16.93  ? 94  LEU A CD2 1 
ATOM   710  N N   . ILE A 1 97  ? 4.185   -16.454 -9.616  1.00 21.93  ? 95  ILE A N   1 
ATOM   711  C CA  . ILE A 1 97  ? 3.911   -17.715 -10.288 1.00 24.00  ? 95  ILE A CA  1 
ATOM   712  C C   . ILE A 1 97  ? 4.276   -17.649 -11.773 1.00 26.28  ? 95  ILE A C   1 
ATOM   713  O O   . ILE A 1 97  ? 4.844   -18.602 -12.326 1.00 27.28  ? 95  ILE A O   1 
ATOM   714  C CB  . ILE A 1 97  ? 2.403   -18.130 -10.116 1.00 25.03  ? 95  ILE A CB  1 
ATOM   715  C CG1 . ILE A 1 97  ? 2.135   -18.578 -8.670  1.00 24.19  ? 95  ILE A CG1 1 
ATOM   716  C CG2 . ILE A 1 97  ? 2.025   -19.237 -11.105 1.00 25.95  ? 95  ILE A CG2 1 
ATOM   717  C CD1 . ILE A 1 97  ? 0.635   -18.677 -8.285  1.00 21.16  ? 95  ILE A CD1 1 
ATOM   718  N N   . LYS A 1 98  ? 4.002   -16.506 -12.399 1.00 24.68  ? 96  LYS A N   1 
ATOM   719  C CA  . LYS A 1 98  ? 4.401   -16.268 -13.786 1.00 27.58  ? 96  LYS A CA  1 
ATOM   720  C C   . LYS A 1 98  ? 5.879   -16.451 -14.030 1.00 27.34  ? 96  LYS A C   1 
ATOM   721  O O   . LYS A 1 98  ? 6.269   -17.082 -15.014 1.00 29.72  ? 96  LYS A O   1 
ATOM   722  C CB  . LYS A 1 98  ? 3.966   -14.881 -14.265 1.00 27.76  ? 96  LYS A CB  1 
ATOM   723  C CG  . LYS A 1 98  ? 2.471   -14.803 -14.542 1.00 28.94  ? 96  LYS A CG  1 
ATOM   724  C CD  . LYS A 1 98  ? 2.045   -13.387 -14.858 1.00 34.61  ? 96  LYS A CD  1 
ATOM   725  C CE  . LYS A 1 98  ? 0.540   -13.229 -14.777 1.00 39.63  ? 96  LYS A CE  1 
ATOM   726  N NZ  . LYS A 1 98  ? 0.125   -11.886 -15.263 1.00 44.72  ? 96  LYS A NZ  1 
ATOM   727  N N   . VAL A 1 99  ? 6.682   -15.942 -13.094 1.00 25.77  ? 97  VAL A N   1 
ATOM   728  C CA  . VAL A 1 99  ? 8.137   -15.902 -13.193 1.00 25.73  ? 97  VAL A CA  1 
ATOM   729  C C   . VAL A 1 99  ? 8.753   -17.299 -12.972 1.00 26.67  ? 97  VAL A C   1 
ATOM   730  O O   . VAL A 1 99  ? 9.732   -17.649 -13.619 1.00 25.93  ? 97  VAL A O   1 
ATOM   731  C CB  . VAL A 1 99  ? 8.744   -14.886 -12.157 1.00 25.50  ? 97  VAL A CB  1 
ATOM   732  C CG1 . VAL A 1 99  ? 10.291  -14.943 -12.123 1.00 21.17  ? 97  VAL A CG1 1 
ATOM   733  C CG2 . VAL A 1 99  ? 8.284   -13.462 -12.459 1.00 22.61  ? 97  VAL A CG2 1 
ATOM   734  N N   . VAL A 1 100 ? 8.204   -18.084 -12.045 1.00 27.41  ? 98  VAL A N   1 
ATOM   735  C CA  . VAL A 1 100 ? 8.801   -19.393 -11.737 1.00 28.79  ? 98  VAL A CA  1 
ATOM   736  C C   . VAL A 1 100 ? 8.304   -20.545 -12.613 1.00 31.88  ? 98  VAL A C   1 
ATOM   737  O O   . VAL A 1 100 ? 8.824   -21.654 -12.532 1.00 35.08  ? 98  VAL A O   1 
ATOM   738  C CB  . VAL A 1 100 ? 8.631   -19.819 -10.253 1.00 28.46  ? 98  VAL A CB  1 
ATOM   739  C CG1 . VAL A 1 100 ? 9.389   -18.878 -9.310  1.00 24.68  ? 98  VAL A CG1 1 
ATOM   740  C CG2 . VAL A 1 100 ? 7.149   -19.954 -9.874  1.00 25.34  ? 98  VAL A CG2 1 
ATOM   741  N N   . SER A 1 101 ? 7.216   -20.328 -13.336 1.00 29.68  ? 99  SER A N   1 
ATOM   742  C CA  . SER A 1 101 ? 6.502   -21.433 -13.959 1.00 33.10  ? 99  SER A CA  1 
ATOM   743  C C   . SER A 1 101 ? 6.809   -21.537 -15.467 1.00 36.30  ? 99  SER A C   1 
ATOM   744  O O   . SER A 1 101 ? 6.767   -20.538 -16.182 1.00 35.08  ? 99  SER A O   1 
ATOM   745  C CB  . SER A 1 101 ? 5.002   -21.308 -13.688 1.00 31.97  ? 99  SER A CB  1 
ATOM   746  O OG  . SER A 1 101 ? 4.257   -22.177 -14.529 1.00 41.29  ? 99  SER A OG  1 
ATOM   747  N N   . PRO A 1 102 ? 7.238   -22.727 -15.921 1.00 38.08  ? 100 PRO A N   1 
ATOM   748  C CA  . PRO A 1 102 ? 7.516   -23.007 -17.338 1.00 42.71  ? 100 PRO A CA  1 
ATOM   749  C C   . PRO A 1 102 ? 6.362   -22.687 -18.305 1.00 45.61  ? 100 PRO A C   1 
ATOM   750  O O   . PRO A 1 102 ? 6.617   -22.338 -19.456 1.00 47.61  ? 100 PRO A O   1 
ATOM   751  C CB  . PRO A 1 102 ? 7.841   -24.517 -17.364 1.00 44.23  ? 100 PRO A CB  1 
ATOM   752  C CG  . PRO A 1 102 ? 7.629   -25.025 -15.971 1.00 43.86  ? 100 PRO A CG  1 
ATOM   753  C CD  . PRO A 1 102 ? 7.638   -23.842 -15.044 1.00 38.98  ? 100 PRO A CD  1 
ATOM   754  N N   . LYS A 1 103 ? 5.114   -22.797 -17.850 1.00 46.28  ? 101 LYS A N   1 
ATOM   755  C CA  . LYS A 1 103 ? 3.962   -22.372 -18.669 1.00 49.38  ? 101 LYS A CA  1 
ATOM   756  C C   . LYS A 1 103 ? 4.002   -20.876 -19.017 1.00 47.50  ? 101 LYS A C   1 
ATOM   757  O O   . LYS A 1 103 ? 3.472   -20.455 -20.050 1.00 48.53  ? 101 LYS A O   1 
ATOM   758  C CB  . LYS A 1 103 ? 2.637   -22.689 -17.967 1.00 48.74  ? 101 LYS A CB  1 
ATOM   759  C CG  . LYS A 1 103 ? 2.351   -24.166 -17.764 1.00 55.22  ? 101 LYS A CG  1 
ATOM   760  C CD  . LYS A 1 103 ? 1.146   -24.378 -16.829 1.00 61.45  ? 101 LYS A CD  1 
ATOM   761  C CE  . LYS A 1 103 ? -0.052  -23.502 -17.225 1.00 62.87  ? 101 LYS A CE  1 
ATOM   762  N NZ  . LYS A 1 103 ? -0.963  -24.127 -18.229 1.00 64.20  ? 101 LYS A NZ  1 
ATOM   763  N N   . TYR A 1 104 ? 4.598   -20.073 -18.137 1.00 45.16  ? 102 TYR A N   1 
ATOM   764  C CA  . TYR A 1 104 ? 4.571   -18.623 -18.280 1.00 43.59  ? 102 TYR A CA  1 
ATOM   765  C C   . TYR A 1 104 ? 5.945   -18.034 -18.596 1.00 43.41  ? 102 TYR A C   1 
ATOM   766  O O   . TYR A 1 104 ? 6.415   -18.147 -19.738 1.00 44.19  ? 102 TYR A O   1 
ATOM   767  C CB  . TYR A 1 104 ? 3.899   -17.963 -17.068 1.00 40.64  ? 102 TYR A CB  1 
ATOM   768  C CG  . TYR A 1 104 ? 2.521   -18.530 -16.821 1.00 41.02  ? 102 TYR A CG  1 
ATOM   769  C CD1 . TYR A 1 104 ? 2.298   -19.426 -15.784 1.00 41.37  ? 102 TYR A CD1 1 
ATOM   770  C CD2 . TYR A 1 104 ? 1.489   -18.314 -17.731 1.00 48.21  ? 102 TYR A CD2 1 
ATOM   771  C CE1 . TYR A 1 104 ? 1.071   -20.029 -15.616 1.00 43.46  ? 102 TYR A CE1 1 
ATOM   772  C CE2 . TYR A 1 104 ? 0.254   -18.924 -17.578 1.00 45.66  ? 102 TYR A CE2 1 
ATOM   773  C CZ  . TYR A 1 104 ? 0.055   -19.785 -16.517 1.00 43.82  ? 102 TYR A CZ  1 
ATOM   774  O OH  . TYR A 1 104 ? -1.167  -20.393 -16.337 1.00 45.05  ? 102 TYR A OH  1 
ATOM   775  N N   . LEU A 1 105 ? 6.598   -17.436 -17.604 1.00 36.82  ? 103 LEU A N   1 
ATOM   776  C CA  . LEU A 1 105 ? 7.891   -16.782 -17.839 1.00 37.70  ? 103 LEU A CA  1 
ATOM   777  C C   . LEU A 1 105 ? 9.111   -17.632 -17.451 1.00 36.73  ? 103 LEU A C   1 
ATOM   778  O O   . LEU A 1 105 ? 10.249  -17.247 -17.732 1.00 35.48  ? 103 LEU A O   1 
ATOM   779  C CB  . LEU A 1 105 ? 7.956   -15.425 -17.127 1.00 34.90  ? 103 LEU A CB  1 
ATOM   780  C CG  . LEU A 1 105 ? 6.811   -14.437 -17.389 1.00 38.28  ? 103 LEU A CG  1 
ATOM   781  C CD1 . LEU A 1 105 ? 6.943   -13.228 -16.469 1.00 36.75  ? 103 LEU A CD1 1 
ATOM   782  C CD2 . LEU A 1 105 ? 6.782   -13.998 -18.850 1.00 42.77  ? 103 LEU A CD2 1 
ATOM   783  N N   . GLY A 1 106 ? 8.877   -18.761 -16.783 1.00 32.41  ? 104 GLY A N   1 
ATOM   784  C CA  . GLY A 1 106 ? 9.962   -19.565 -16.219 1.00 31.23  ? 104 GLY A CA  1 
ATOM   785  C C   . GLY A 1 106 ? 11.061  -19.952 -17.201 1.00 36.21  ? 104 GLY A C   1 
ATOM   786  O O   . GLY A 1 106 ? 12.238  -19.965 -16.831 1.00 35.48  ? 104 GLY A O   1 
ATOM   787  N N   . SER A 1 107 ? 10.684  -20.246 -18.451 1.00 39.18  ? 105 SER A N   1 
ATOM   788  C CA  . SER A 1 107 ? 11.635  -20.634 -19.509 1.00 44.69  ? 105 SER A CA  1 
ATOM   789  C C   . SER A 1 107 ? 12.764  -19.639 -19.760 1.00 44.97  ? 105 SER A C   1 
ATOM   790  O O   . SER A 1 107 ? 13.849  -20.036 -20.178 1.00 47.97  ? 105 SER A O   1 
ATOM   791  C CB  . SER A 1 107 ? 10.906  -20.870 -20.835 1.00 45.98  ? 105 SER A CB  1 
ATOM   792  O OG  . SER A 1 107 ? 10.159  -22.069 -20.795 1.00 51.39  ? 105 SER A OG  1 
ATOM   793  N N   . ARG A 1 108 ? 12.479  -18.351 -19.570 1.00 49.66  ? 106 ARG A N   1 
ATOM   794  C CA  . ARG A 1 108 ? 13.426  -17.278 -19.880 1.00 50.75  ? 106 ARG A CA  1 
ATOM   795  C C   . ARG A 1 108 ? 13.902  -16.537 -18.626 1.00 47.21  ? 106 ARG A C   1 
ATOM   796  O O   . ARG A 1 108 ? 14.500  -15.464 -18.713 1.00 47.50  ? 106 ARG A O   1 
ATOM   797  C CB  . ARG A 1 108 ? 12.798  -16.285 -20.870 1.00 51.99  ? 106 ARG A CB  1 
ATOM   798  C CG  . ARG A 1 108 ? 11.545  -15.557 -20.353 1.00 53.51  ? 106 ARG A CG  1 
ATOM   799  C CD  . ARG A 1 108 ? 11.065  -14.497 -21.365 1.00 61.61  ? 106 ARG A CD  1 
ATOM   800  N NE  . ARG A 1 108 ? 9.605   -14.411 -21.470 1.00 63.88  ? 106 ARG A NE  1 
ATOM   801  C CZ  . ARG A 1 108 ? 8.830   -15.364 -21.989 1.00 67.59  ? 106 ARG A CZ  1 
ATOM   802  N NH1 . ARG A 1 108 ? 9.365   -16.509 -22.405 1.00 69.57  ? 106 ARG A NH1 1 
ATOM   803  N NH2 . ARG A 1 108 ? 7.514   -15.189 -22.069 1.00 66.09  ? 106 ARG A NH2 1 
ATOM   804  N N   . THR A 1 109 ? 13.564  -17.076 -17.462 1.00 42.62  ? 107 THR A N   1 
ATOM   805  C CA  . THR A 1 109 ? 13.978  -16.497 -16.188 1.00 37.32  ? 107 THR A CA  1 
ATOM   806  C C   . THR A 1 109 ? 15.146  -17.307 -15.649 1.00 36.28  ? 107 THR A C   1 
ATOM   807  O O   . THR A 1 109 ? 15.105  -18.542 -15.667 1.00 34.95  ? 107 THR A O   1 
ATOM   808  C CB  . THR A 1 109 ? 12.831  -16.557 -15.158 1.00 35.72  ? 107 THR A CB  1 
ATOM   809  O OG1 . THR A 1 109 ? 11.710  -15.806 -15.641 1.00 37.39  ? 107 THR A OG1 1 
ATOM   810  C CG2 . THR A 1 109 ? 13.283  -15.992 -13.796 1.00 30.57  ? 107 THR A CG2 1 
ATOM   811  N N   . SER A 1 110 ? 16.173  -16.620 -15.146 1.00 39.39  ? 108 SER A N   1 
ATOM   812  C CA  . SER A 1 110 ? 17.327  -17.317 -14.576 1.00 38.22  ? 108 SER A CA  1 
ATOM   813  C C   . SER A 1 110 ? 16.912  -18.159 -13.385 1.00 37.14  ? 108 SER A C   1 
ATOM   814  O O   . SER A 1 110 ? 15.947  -17.839 -12.686 1.00 34.56  ? 108 SER A O   1 
ATOM   815  C CB  . SER A 1 110 ? 18.439  -16.346 -14.172 1.00 36.52  ? 108 SER A CB  1 
ATOM   816  O OG  . SER A 1 110 ? 18.077  -15.591 -13.034 1.00 31.82  ? 108 SER A OG  1 
ATOM   817  N N   . GLU A 1 111 ? 17.652  -19.239 -13.169 1.00 40.94  ? 109 GLU A N   1 
ATOM   818  C CA  . GLU A 1 111 ? 17.473  -20.102 -12.008 1.00 41.11  ? 109 GLU A CA  1 
ATOM   819  C C   . GLU A 1 111 ? 17.664  -19.342 -10.691 1.00 36.33  ? 109 GLU A C   1 
ATOM   820  O O   . GLU A 1 111 ? 16.948  -19.581 -9.726  1.00 35.54  ? 109 GLU A O   1 
ATOM   821  C CB  . GLU A 1 111 ? 18.434  -21.297 -12.107 1.00 43.62  ? 109 GLU A CB  1 
ATOM   822  C CG  . GLU A 1 111 ? 17.765  -22.682 -12.284 1.00 53.65  ? 109 GLU A CG  1 
ATOM   823  C CD  . GLU A 1 111 ? 16.706  -22.763 -13.399 1.00 60.55  ? 109 GLU A CD  1 
ATOM   824  O OE1 . GLU A 1 111 ? 16.761  -21.988 -14.386 1.00 61.18  ? 109 GLU A OE1 1 
ATOM   825  O OE2 . GLU A 1 111 ? 15.845  -23.667 -13.313 1.00 63.46  ? 109 GLU A OE2 1 
ATOM   826  N N   . LYS A 1 112 ? 18.582  -18.379 -10.676 1.00 35.60  ? 110 LYS A N   1 
ATOM   827  C CA  . LYS A 1 112 ? 18.774  -17.511 -9.510  1.00 31.82  ? 110 LYS A CA  1 
ATOM   828  C C   . LYS A 1 112 ? 17.492  -16.798 -9.086  1.00 28.43  ? 110 LYS A C   1 
ATOM   829  O O   . LYS A 1 112 ? 17.155  -16.782 -7.911  1.00 27.58  ? 110 LYS A O   1 
ATOM   830  C CB  . LYS A 1 112 ? 19.861  -16.469 -9.787  1.00 30.94  ? 110 LYS A CB  1 
ATOM   831  C CG  . LYS A 1 112 ? 20.174  -15.564 -8.592  1.00 30.29  ? 110 LYS A CG  1 
ATOM   832  C CD  . LYS A 1 112 ? 21.107  -14.408 -8.985  1.00 40.40  ? 110 LYS A CD  1 
ATOM   833  C CE  . LYS A 1 112 ? 21.726  -13.720 -7.758  1.00 46.79  ? 110 LYS A CE  1 
ATOM   834  N NZ  . LYS A 1 112 ? 22.623  -12.554 -8.121  1.00 50.61  ? 110 LYS A NZ  1 
ATOM   835  N N   . VAL A 1 113 ? 16.879  -16.084 -10.028 1.00 27.24  ? 111 VAL A N   1 
ATOM   836  C CA  . VAL A 1 113 ? 15.619  -15.373 -9.802  1.00 25.14  ? 111 VAL A CA  1 
ATOM   837  C C   . VAL A 1 113 ? 14.507  -16.319 -9.344  1.00 24.63  ? 111 VAL A C   1 
ATOM   838  O O   . VAL A 1 113 ? 13.792  -16.035 -8.386  1.00 23.05  ? 111 VAL A O   1 
ATOM   839  C CB  . VAL A 1 113 ? 15.174  -14.595 -11.082 1.00 25.57  ? 111 VAL A CB  1 
ATOM   840  C CG1 . VAL A 1 113 ? 13.733  -14.070 -10.961 1.00 24.54  ? 111 VAL A CG1 1 
ATOM   841  C CG2 . VAL A 1 113 ? 16.133  -13.427 -11.365 1.00 25.80  ? 111 VAL A CG2 1 
ATOM   842  N N   . LYS A 1 114 ? 14.359  -17.447 -10.026 1.00 23.92  ? 112 LYS A N   1 
ATOM   843  C CA  . LYS A 1 114 ? 13.305  -18.392 -9.663  1.00 22.68  ? 112 LYS A CA  1 
ATOM   844  C C   . LYS A 1 114 ? 13.552  -18.992 -8.278  1.00 21.84  ? 112 LYS A C   1 
ATOM   845  O O   . LYS A 1 114 ? 12.646  -19.051 -7.459  1.00 20.47  ? 112 LYS A O   1 
ATOM   846  C CB  . LYS A 1 114 ? 13.171  -19.480 -10.733 1.00 22.68  ? 112 LYS A CB  1 
ATOM   847  C CG  . LYS A 1 114 ? 12.715  -18.895 -12.072 1.00 25.16  ? 112 LYS A CG  1 
ATOM   848  C CD  . LYS A 1 114 ? 12.505  -19.933 -13.160 1.00 25.55  ? 112 LYS A CD  1 
ATOM   849  C CE  . LYS A 1 114 ? 13.767  -20.712 -13.428 1.00 27.79  ? 112 LYS A CE  1 
ATOM   850  N NZ  . LYS A 1 114 ? 13.732  -21.291 -14.790 1.00 34.92  ? 112 LYS A NZ  1 
ATOM   851  N N   . ASN A 1 115 ? 14.792  -19.400 -8.005  1.00 23.27  ? 113 ASN A N   1 
ATOM   852  C CA  . ASN A 1 115 ? 15.142  -19.950 -6.694  1.00 23.31  ? 113 ASN A CA  1 
ATOM   853  C C   . ASN A 1 115 ? 14.886  -18.924 -5.582  1.00 20.49  ? 113 ASN A C   1 
ATOM   854  O O   . ASN A 1 115 ? 14.438  -19.278 -4.511  1.00 19.70  ? 113 ASN A O   1 
ATOM   855  C CB  . ASN A 1 115 ? 16.611  -20.390 -6.656  1.00 25.36  ? 113 ASN A CB  1 
ATOM   856  C CG  . ASN A 1 115 ? 16.873  -21.677 -7.448  1.00 32.17  ? 113 ASN A CG  1 
ATOM   857  O OD1 . ASN A 1 115 ? 18.026  -22.060 -7.664  1.00 30.26  ? 113 ASN A OD1 1 
ATOM   858  N ND2 . ASN A 1 115 ? 15.811  -22.371 -7.823  1.00 27.84  ? 113 ASN A ND2 1 
ATOM   859  N N   . LYS A 1 116 ? 15.188  -17.655 -5.835  1.00 21.69  ? 114 LYS A N   1 
ATOM   860  C CA  . LYS A 1 116 ? 14.937  -16.615 -4.827  1.00 20.16  ? 114 LYS A CA  1 
ATOM   861  C C   . LYS A 1 116 ? 13.449  -16.504 -4.504  1.00 20.02  ? 114 LYS A C   1 
ATOM   862  O O   . LYS A 1 116 ? 13.050  -16.615 -3.346  1.00 20.15  ? 114 LYS A O   1 
ATOM   863  C CB  . LYS A 1 116 ? 15.497  -15.253 -5.274  1.00 18.20  ? 114 LYS A CB  1 
ATOM   864  C CG  . LYS A 1 116 ? 15.443  -14.172 -4.199  1.00 20.70  ? 114 LYS A CG  1 
ATOM   865  C CD  . LYS A 1 116 ? 16.119  -14.635 -2.924  1.00 22.72  ? 114 LYS A CD  1 
ATOM   866  C CE  . LYS A 1 116 ? 16.078  -13.585 -1.829  1.00 28.02  ? 114 LYS A CE  1 
ATOM   867  N NZ  . LYS A 1 116 ? 17.036  -13.959 -0.725  1.00 28.60  ? 114 LYS A NZ  1 
ATOM   868  N N   . ILE A 1 117 ? 12.620  -16.466 -5.545  1.00 17.41  ? 115 ILE A N   1 
ATOM   869  C CA  . ILE A 1 117 ? 11.165  -16.438 -5.356  1.00 19.96  ? 115 ILE A CA  1 
ATOM   870  C C   . ILE A 1 117 ? 10.671  -17.641 -4.545  1.00 21.70  ? 115 ILE A C   1 
ATOM   871  O O   . ILE A 1 117 ? 9.812   -17.503 -3.674  1.00 22.24  ? 115 ILE A O   1 
ATOM   872  C CB  . ILE A 1 117 ? 10.420  -16.353 -6.716  1.00 20.82  ? 115 ILE A CB  1 
ATOM   873  C CG1 . ILE A 1 117 ? 10.626  -14.952 -7.321  1.00 21.26  ? 115 ILE A CG1 1 
ATOM   874  C CG2 . ILE A 1 117 ? 8.899   -16.668 -6.557  1.00 18.06  ? 115 ILE A CG2 1 
ATOM   875  C CD1 . ILE A 1 117 ? 10.327  -14.876 -8.800  1.00 22.32  ? 115 ILE A CD1 1 
ATOM   876  N N   . LEU A 1 118 ? 11.188  -18.824 -4.857  1.00 21.63  ? 116 LEU A N   1 
ATOM   877  C CA  . LEU A 1 118 ? 10.703  -20.048 -4.222  1.00 22.34  ? 116 LEU A CA  1 
ATOM   878  C C   . LEU A 1 118 ? 11.130  -20.071 -2.759  1.00 23.24  ? 116 LEU A C   1 
ATOM   879  O O   . LEU A 1 118 ? 10.369  -20.481 -1.894  1.00 25.14  ? 116 LEU A O   1 
ATOM   880  C CB  . LEU A 1 118 ? 11.258  -21.272 -4.943  1.00 22.87  ? 116 LEU A CB  1 
ATOM   881  C CG  . LEU A 1 118 ? 10.735  -21.525 -6.360  1.00 25.16  ? 116 LEU A CG  1 
ATOM   882  C CD1 . LEU A 1 118 ? 11.394  -22.782 -6.916  1.00 25.08  ? 116 LEU A CD1 1 
ATOM   883  C CD2 . LEU A 1 118 ? 9.219   -21.674 -6.341  1.00 27.59  ? 116 LEU A CD2 1 
ATOM   884  N N   . GLU A 1 119 ? 12.341  -19.592 -2.488  1.00 24.44  ? 117 GLU A N   1 
ATOM   885  C CA  . GLU A 1 119 ? 12.809  -19.430 -1.108  1.00 25.60  ? 117 GLU A CA  1 
ATOM   886  C C   . GLU A 1 119 ? 11.875  -18.510 -0.340  1.00 25.35  ? 117 GLU A C   1 
ATOM   887  O O   . GLU A 1 119 ? 11.530  -18.786 0.847   1.00 23.34  ? 117 GLU A O   1 
ATOM   888  C CB  . GLU A 1 119 ? 14.248  -18.883 -1.060  1.00 25.45  ? 117 GLU A CB  1 
ATOM   889  C CG  . GLU A 1 119 ? 14.787  -18.627 0.402   1.00 32.84  ? 117 GLU A CG  1 
ATOM   890  C CD  . GLU A 1 119 ? 15.702  -17.394 0.500   1.00 36.05  ? 117 GLU A CD  1 
ATOM   891  O OE1 . GLU A 1 119 ? 16.128  -17.055 1.632   1.00 36.03  ? 117 GLU A OE1 1 
ATOM   892  O OE2 . GLU A 1 119 ? 16.058  -16.818 -0.558  1.00 33.38  ? 117 GLU A OE2 1 
ATOM   893  N N   . LEU A 1 120 ? 11.587  -17.354 -0.948  1.00 22.75  ? 118 LEU A N   1 
ATOM   894  C CA  . LEU A 1 120 ? 10.757  -16.344 -0.290  1.00 22.16  ? 118 LEU A CA  1 
ATOM   895  C C   . LEU A 1 120 ? 9.379   -16.901 0.015   1.00 24.34  ? 118 LEU A C   1 
ATOM   896  O O   . LEU A 1 120 ? 8.856   -16.691 1.099   1.00 23.95  ? 118 LEU A O   1 
ATOM   897  C CB  . LEU A 1 120 ? 10.612  -15.086 -1.131  1.00 21.50  ? 118 LEU A CB  1 
ATOM   898  C CG  . LEU A 1 120 ? 11.871  -14.234 -1.299  1.00 22.35  ? 118 LEU A CG  1 
ATOM   899  C CD1 . LEU A 1 120 ? 11.558  -13.004 -2.163  1.00 21.11  ? 118 LEU A CD1 1 
ATOM   900  C CD2 . LEU A 1 120 ? 12.398  -13.838 0.097   1.00 22.74  ? 118 LEU A CD2 1 
ATOM   901  N N   . LEU A 1 121 ? 8.791   -17.592 -0.963  1.00 22.97  ? 119 LEU A N   1 
ATOM   902  C CA  . LEU A 1 121 ? 7.497   -18.225 -0.763  1.00 23.13  ? 119 LEU A CA  1 
ATOM   903  C C   . LEU A 1 121 ? 7.500   -19.245 0.395   1.00 25.02  ? 119 LEU A C   1 
ATOM   904  O O   . LEU A 1 121 ? 6.609   -19.222 1.235   1.00 27.12  ? 119 LEU A O   1 
ATOM   905  C CB  . LEU A 1 121 ? 7.000   -18.858 -2.056  1.00 23.54  ? 119 LEU A CB  1 
ATOM   906  C CG  . LEU A 1 121 ? 6.588   -17.893 -3.177  1.00 20.80  ? 119 LEU A CG  1 
ATOM   907  C CD1 . LEU A 1 121 ? 6.405   -18.701 -4.425  1.00 23.01  ? 119 LEU A CD1 1 
ATOM   908  C CD2 . LEU A 1 121 ? 5.311   -17.113 -2.843  1.00 16.79  ? 119 LEU A CD2 1 
ATOM   909  N N   . TYR A 1 122 ? 8.486   -20.137 0.431   1.00 19.97  ? 120 TYR A N   1 
ATOM   910  C CA  . TYR A 1 122 ? 8.625   -21.042 1.556   1.00 20.20  ? 120 TYR A CA  1 
ATOM   911  C C   . TYR A 1 122 ? 8.697   -20.279 2.878   1.00 21.99  ? 120 TYR A C   1 
ATOM   912  O O   . TYR A 1 122 ? 7.973   -20.587 3.807   1.00 22.34  ? 120 TYR A O   1 
ATOM   913  C CB  . TYR A 1 122 ? 9.858   -21.925 1.400   1.00 23.91  ? 120 TYR A CB  1 
ATOM   914  C CG  . TYR A 1 122 ? 10.104  -22.819 2.608   1.00 25.54  ? 120 TYR A CG  1 
ATOM   915  C CD1 . TYR A 1 122 ? 9.313   -23.949 2.828   1.00 28.80  ? 120 TYR A CD1 1 
ATOM   916  C CD2 . TYR A 1 122 ? 11.042  -22.476 3.568   1.00 22.80  ? 120 TYR A CD2 1 
ATOM   917  C CE1 . TYR A 1 122 ? 9.501   -24.754 3.948   1.00 33.22  ? 120 TYR A CE1 1 
ATOM   918  C CE2 . TYR A 1 122 ? 11.265  -23.289 4.684   1.00 30.14  ? 120 TYR A CE2 1 
ATOM   919  C CZ  . TYR A 1 122 ? 10.483  -24.426 4.860   1.00 31.36  ? 120 TYR A CZ  1 
ATOM   920  O OH  . TYR A 1 122 ? 10.678  -25.245 5.940   1.00 36.83  ? 120 TYR A OH  1 
ATOM   921  N N   . SER A 1 123 ? 9.588   -19.293 2.968   1.00 24.24  ? 121 SER A N   1 
ATOM   922  C CA  . SER A 1 123 ? 9.770   -18.545 4.208   1.00 26.22  ? 121 SER A CA  1 
ATOM   923  C C   . SER A 1 123 ? 8.509   -17.819 4.706   1.00 26.65  ? 121 SER A C   1 
ATOM   924  O O   . SER A 1 123 ? 8.277   -17.738 5.908   1.00 27.11  ? 121 SER A O   1 
ATOM   925  C CB  . SER A 1 123 ? 10.987  -17.606 4.122   1.00 24.47  ? 121 SER A CB  1 
ATOM   926  O OG  . SER A 1 123 ? 10.712  -16.470 3.310   1.00 34.61  ? 121 SER A OG  1 
ATOM   927  N N   . TRP A 1 124 ? 7.664   -17.346 3.790   1.00 27.79  ? 122 TRP A N   1 
ATOM   928  C CA  . TRP A 1 124 ? 6.390   -16.742 4.200   1.00 27.58  ? 122 TRP A CA  1 
ATOM   929  C C   . TRP A 1 124 ? 5.346   -17.765 4.631   1.00 29.56  ? 122 TRP A C   1 
ATOM   930  O O   . TRP A 1 124 ? 4.533   -17.471 5.503   1.00 29.21  ? 122 TRP A O   1 
ATOM   931  C CB  . TRP A 1 124 ? 5.820   -15.823 3.118   1.00 25.48  ? 122 TRP A CB  1 
ATOM   932  C CG  . TRP A 1 124 ? 6.789   -14.789 2.636   1.00 22.18  ? 122 TRP A CG  1 
ATOM   933  C CD1 . TRP A 1 124 ? 7.694   -14.094 3.400   1.00 26.26  ? 122 TRP A CD1 1 
ATOM   934  C CD2 . TRP A 1 124 ? 6.850   -14.215 1.324   1.00 21.16  ? 122 TRP A CD2 1 
ATOM   935  N NE1 . TRP A 1 124 ? 8.386   -13.198 2.613   1.00 24.51  ? 122 TRP A NE1 1 
ATOM   936  C CE2 . TRP A 1 124 ? 7.893   -13.259 1.333   1.00 25.02  ? 122 TRP A CE2 1 
ATOM   937  C CE3 . TRP A 1 124 ? 6.118   -14.408 0.142   1.00 21.30  ? 122 TRP A CE3 1 
ATOM   938  C CZ2 . TRP A 1 124 ? 8.235   -12.516 0.199   1.00 21.73  ? 122 TRP A CZ2 1 
ATOM   939  C CZ3 . TRP A 1 124 ? 6.500   -13.708 -1.000  1.00 22.23  ? 122 TRP A CZ3 1 
ATOM   940  C CH2 . TRP A 1 124 ? 7.532   -12.762 -0.956  1.00 21.22  ? 122 TRP A CH2 1 
ATOM   941  N N   . THR A 1 125 ? 5.374   -18.968 4.050   1.00 23.41  ? 123 THR A N   1 
ATOM   942  C CA  . THR A 1 125 ? 4.479   -20.037 4.526   1.00 26.51  ? 123 THR A CA  1 
ATOM   943  C C   . THR A 1 125 ? 4.796   -20.387 5.982   1.00 30.83  ? 123 THR A C   1 
ATOM   944  O O   . THR A 1 125 ? 3.891   -20.622 6.786   1.00 33.11  ? 123 THR A O   1 
ATOM   945  C CB  . THR A 1 125 ? 4.502   -21.323 3.643   1.00 25.76  ? 123 THR A CB  1 
ATOM   946  O OG1 . THR A 1 125 ? 5.789   -21.951 3.728   1.00 28.64  ? 123 THR A OG1 1 
ATOM   947  C CG2 . THR A 1 125 ? 4.201   -21.005 2.186   1.00 22.66  ? 123 THR A CG2 1 
ATOM   948  N N   . VAL A 1 126 ? 6.079   -20.343 6.337   1.00 33.41  ? 124 VAL A N   1 
ATOM   949  C CA  . VAL A 1 126 ? 6.516   -20.649 7.710   1.00 36.70  ? 124 VAL A CA  1 
ATOM   950  C C   . VAL A 1 126 ? 6.312   -19.433 8.620   1.00 37.54  ? 124 VAL A C   1 
ATOM   951  O O   . VAL A 1 126 ? 5.858   -19.569 9.760   1.00 39.52  ? 124 VAL A O   1 
ATOM   952  C CB  . VAL A 1 126 ? 8.014   -21.053 7.743   1.00 36.22  ? 124 VAL A CB  1 
ATOM   953  C CG1 . VAL A 1 126 ? 8.475   -21.360 9.176   1.00 45.85  ? 124 VAL A CG1 1 
ATOM   954  C CG2 . VAL A 1 126 ? 8.264   -22.233 6.837   1.00 40.18  ? 124 VAL A CG2 1 
ATOM   955  N N   . GLY A 1 127 ? 6.655   -18.250 8.113   1.00 29.84  ? 125 GLY A N   1 
ATOM   956  C CA  . GLY A 1 127 ? 6.700   -17.035 8.933   1.00 32.46  ? 125 GLY A CA  1 
ATOM   957  C C   . GLY A 1 127 ? 5.392   -16.274 9.051   1.00 32.80  ? 125 GLY A C   1 
ATOM   958  O O   . GLY A 1 127 ? 5.163   -15.556 10.029  1.00 34.99  ? 125 GLY A O   1 
ATOM   959  N N   . LEU A 1 128 ? 4.536   -16.417 8.045   1.00 32.33  ? 126 LEU A N   1 
ATOM   960  C CA  . LEU A 1 128 ? 3.260   -15.721 8.013   1.00 32.71  ? 126 LEU A CA  1 
ATOM   961  C C   . LEU A 1 128 ? 2.129   -16.718 7.686   1.00 31.67  ? 126 LEU A C   1 
ATOM   962  O O   . LEU A 1 128 ? 1.580   -16.718 6.582   1.00 27.79  ? 126 LEU A O   1 
ATOM   963  C CB  . LEU A 1 128 ? 3.315   -14.573 6.995   1.00 30.16  ? 126 LEU A CB  1 
ATOM   964  C CG  . LEU A 1 128 ? 4.350   -13.464 7.228   1.00 32.96  ? 126 LEU A CG  1 
ATOM   965  C CD1 . LEU A 1 128 ? 4.654   -12.748 5.933   1.00 31.14  ? 126 LEU A CD1 1 
ATOM   966  C CD2 . LEU A 1 128 ? 3.899   -12.461 8.294   1.00 39.51  ? 126 LEU A CD2 1 
ATOM   967  N N   . PRO A 1 129 ? 1.843   -17.635 8.620   1.00 35.42  ? 127 PRO A N   1 
ATOM   968  C CA  . PRO A 1 129 ? 0.849   -18.671 8.347   1.00 36.38  ? 127 PRO A CA  1 
ATOM   969  C C   . PRO A 1 129 ? -0.567  -18.126 8.151   1.00 36.50  ? 127 PRO A C   1 
ATOM   970  O O   . PRO A 1 129 ? -1.431  -18.842 7.628   1.00 35.72  ? 127 PRO A O   1 
ATOM   971  C CB  . PRO A 1 129 ? 0.908   -19.557 9.599   1.00 41.18  ? 127 PRO A CB  1 
ATOM   972  C CG  . PRO A 1 129 ? 1.511   -18.678 10.676  1.00 42.32  ? 127 PRO A CG  1 
ATOM   973  C CD  . PRO A 1 129 ? 2.466   -17.791 9.950   1.00 37.26  ? 127 PRO A CD  1 
ATOM   974  N N   . GLU A 1 130 ? -0.818  -16.889 8.585   1.00 36.94  ? 128 GLU A N   1 
ATOM   975  C CA  . GLU A 1 130 ? -2.164  -16.317 8.458   1.00 38.05  ? 128 GLU A CA  1 
ATOM   976  C C   . GLU A 1 130 ? -2.513  -15.951 7.025   1.00 32.83  ? 128 GLU A C   1 
ATOM   977  O O   . GLU A 1 130 ? -3.683  -15.795 6.700   1.00 31.60  ? 128 GLU A O   1 
ATOM   978  C CB  . GLU A 1 130 ? -2.397  -15.091 9.351   1.00 41.82  ? 128 GLU A CB  1 
ATOM   979  C CG  . GLU A 1 130 ? -1.345  -14.802 10.393  1.00 49.69  ? 128 GLU A CG  1 
ATOM   980  C CD  . GLU A 1 130 ? -0.007  -14.390 9.803   1.00 40.81  ? 128 GLU A CD  1 
ATOM   981  O OE1 . GLU A 1 130 ? 0.924   -15.197 9.924   1.00 46.71  ? 128 GLU A OE1 1 
ATOM   982  O OE2 . GLU A 1 130 ? 0.154   -13.232 9.359   1.00 43.09  ? 128 GLU A OE2 1 
ATOM   983  N N   . GLU A 1 131 ? -1.493  -15.773 6.194   1.00 32.87  ? 129 GLU A N   1 
ATOM   984  C CA  . GLU A 1 131 ? -1.671  -15.485 4.781   1.00 30.10  ? 129 GLU A CA  1 
ATOM   985  C C   . GLU A 1 131 ? -1.861  -16.779 4.000   1.00 27.96  ? 129 GLU A C   1 
ATOM   986  O O   . GLU A 1 131 ? -0.906  -17.308 3.416   1.00 25.88  ? 129 GLU A O   1 
ATOM   987  C CB  . GLU A 1 131 ? -0.440  -14.752 4.231   1.00 27.78  ? 129 GLU A CB  1 
ATOM   988  C CG  . GLU A 1 131 ? -0.134  -13.420 4.901   1.00 30.90  ? 129 GLU A CG  1 
ATOM   989  C CD  . GLU A 1 131 ? -1.185  -12.348 4.647   1.00 35.80  ? 129 GLU A CD  1 
ATOM   990  O OE1 . GLU A 1 131 ? -1.203  -11.354 5.407   1.00 35.90  ? 129 GLU A OE1 1 
ATOM   991  O OE2 . GLU A 1 131 ? -1.984  -12.491 3.695   1.00 29.20  ? 129 GLU A OE2 1 
ATOM   992  N N   . VAL A 1 132 ? -3.070  -17.320 4.046   1.00 26.83  ? 130 VAL A N   1 
ATOM   993  C CA  . VAL A 1 132 ? -3.326  -18.646 3.499   1.00 27.48  ? 130 VAL A CA  1 
ATOM   994  C C   . VAL A 1 132 ? -3.156  -18.749 1.975   1.00 25.51  ? 130 VAL A C   1 
ATOM   995  O O   . VAL A 1 132 ? -2.931  -19.840 1.461   1.00 25.21  ? 130 VAL A O   1 
ATOM   996  C CB  . VAL A 1 132 ? -4.714  -19.162 3.894   1.00 28.86  ? 130 VAL A CB  1 
ATOM   997  C CG1 . VAL A 1 132 ? -4.770  -19.407 5.400   1.00 30.06  ? 130 VAL A CG1 1 
ATOM   998  C CG2 . VAL A 1 132 ? -5.770  -18.184 3.447   1.00 25.04  ? 130 VAL A CG2 1 
ATOM   999  N N   . LYS A 1 133 ? -3.269  -17.622 1.272   1.00 26.25  ? 131 LYS A N   1 
ATOM   1000 C CA  . LYS A 1 133 ? -3.099  -17.594 -0.192  1.00 26.42  ? 131 LYS A CA  1 
ATOM   1001 C C   . LYS A 1 133 ? -1.638  -17.804 -0.617  1.00 26.08  ? 131 LYS A C   1 
ATOM   1002 O O   . LYS A 1 133 ? -1.355  -18.553 -1.566  1.00 23.24  ? 131 LYS A O   1 
ATOM   1003 C CB  . LYS A 1 133 ? -3.640  -16.299 -0.779  1.00 24.25  ? 131 LYS A CB  1 
ATOM   1004 C CG  . LYS A 1 133 ? -5.143  -16.128 -0.603  1.00 27.81  ? 131 LYS A CG  1 
ATOM   1005 C CD  . LYS A 1 133 ? -5.604  -14.818 -1.217  1.00 27.31  ? 131 LYS A CD  1 
ATOM   1006 C CE  . LYS A 1 133 ? -7.093  -14.606 -1.029  1.00 29.62  ? 131 LYS A CE  1 
ATOM   1007 N NZ  . LYS A 1 133 ? -7.563  -13.311 -1.610  1.00 26.50  ? 131 LYS A NZ  1 
ATOM   1008 N N   . ILE A 1 134 ? -0.711  -17.216 0.135   1.00 22.74  ? 132 ILE A N   1 
ATOM   1009 C CA  . ILE A 1 134 ? 0.714   -17.563 -0.046  1.00 24.36  ? 132 ILE A CA  1 
ATOM   1010 C C   . ILE A 1 134 ? 0.958   -19.104 0.080   1.00 26.32  ? 132 ILE A C   1 
ATOM   1011 O O   . ILE A 1 134 ? 1.598   -19.717 -0.780  1.00 25.36  ? 132 ILE A O   1 
ATOM   1012 C CB  . ILE A 1 134 ? 1.615   -16.845 0.964   1.00 21.79  ? 132 ILE A CB  1 
ATOM   1013 C CG1 . ILE A 1 134 ? 1.402   -15.315 0.920   1.00 20.21  ? 132 ILE A CG1 1 
ATOM   1014 C CG2 . ILE A 1 134 ? 3.093   -17.239 0.724   1.00 22.21  ? 132 ILE A CG2 1 
ATOM   1015 C CD1 . ILE A 1 134 ? 2.375   -14.529 1.813   1.00 19.39  ? 132 ILE A CD1 1 
ATOM   1016 N N   . ALA A 1 135 ? 0.463   -19.691 1.166   1.00 26.01  ? 133 ALA A N   1 
ATOM   1017 C CA  . ALA A 1 135 ? 0.511   -21.147 1.382   1.00 28.71  ? 133 ALA A CA  1 
ATOM   1018 C C   . ALA A 1 135 ? -0.162  -21.941 0.267   1.00 28.58  ? 133 ALA A C   1 
ATOM   1019 O O   . ALA A 1 135 ? 0.313   -23.004 -0.118  1.00 29.27  ? 133 ALA A O   1 
ATOM   1020 C CB  . ALA A 1 135 ? -0.119  -21.506 2.725   1.00 31.08  ? 133 ALA A CB  1 
ATOM   1021 N N   . GLU A 1 136 ? -1.305  -21.462 -0.212  1.00 30.69  ? 134 GLU A N   1 
ATOM   1022 C CA  . GLU A 1 136 ? -1.997  -22.158 -1.290  1.00 31.65  ? 134 GLU A CA  1 
ATOM   1023 C C   . GLU A 1 136 ? -1.197  -22.097 -2.582  1.00 32.27  ? 134 GLU A C   1 
ATOM   1024 O O   . GLU A 1 136 ? -1.105  -23.090 -3.320  1.00 32.84  ? 134 GLU A O   1 
ATOM   1025 C CB  . GLU A 1 136 ? -3.385  -21.572 -1.506  1.00 32.43  ? 134 GLU A CB  1 
ATOM   1026 C CG  . GLU A 1 136 ? -4.263  -22.420 -2.389  1.00 33.25  ? 134 GLU A CG  1 
ATOM   1027 C CD  . GLU A 1 136 ? -5.629  -21.821 -2.552  1.00 26.14  ? 134 GLU A CD  1 
ATOM   1028 O OE1 . GLU A 1 136 ? -6.020  -21.002 -1.691  1.00 32.29  ? 134 GLU A OE1 1 
ATOM   1029 O OE2 . GLU A 1 136 ? -6.277  -22.123 -3.567  1.00 28.77  ? 134 GLU A OE2 1 
ATOM   1030 N N   . ALA A 1 137 ? -0.643  -20.920 -2.868  1.00 27.86  ? 135 ALA A N   1 
ATOM   1031 C CA  . ALA A 1 137 ? 0.229   -20.732 -4.030  1.00 29.55  ? 135 ALA A CA  1 
ATOM   1032 C C   . ALA A 1 137 ? 1.455   -21.653 -3.995  1.00 30.43  ? 135 ALA A C   1 
ATOM   1033 O O   . ALA A 1 137 ? 1.795   -22.296 -4.982  1.00 31.43  ? 135 ALA A O   1 
ATOM   1034 C CB  . ALA A 1 137 ? 0.656   -19.246 -4.152  1.00 24.17  ? 135 ALA A CB  1 
ATOM   1035 N N   . TYR A 1 138 ? 2.091   -21.736 -2.838  1.00 31.39  ? 136 TYR A N   1 
ATOM   1036 C CA  . TYR A 1 138 ? 3.225   -22.634 -2.648  1.00 32.08  ? 136 TYR A CA  1 
ATOM   1037 C C   . TYR A 1 138 ? 2.929   -24.151 -2.822  1.00 35.35  ? 136 TYR A C   1 
ATOM   1038 O O   . TYR A 1 138 ? 3.661   -24.819 -3.547  1.00 37.04  ? 136 TYR A O   1 
ATOM   1039 C CB  . TYR A 1 138 ? 3.919   -22.337 -1.318  1.00 29.74  ? 136 TYR A CB  1 
ATOM   1040 C CG  . TYR A 1 138 ? 5.258   -23.010 -1.167  1.00 29.78  ? 136 TYR A CG  1 
ATOM   1041 C CD1 . TYR A 1 138 ? 6.377   -22.528 -1.838  1.00 26.42  ? 136 TYR A CD1 1 
ATOM   1042 C CD2 . TYR A 1 138 ? 5.413   -24.115 -0.338  1.00 31.51  ? 136 TYR A CD2 1 
ATOM   1043 C CE1 . TYR A 1 138 ? 7.621   -23.120 -1.672  1.00 28.03  ? 136 TYR A CE1 1 
ATOM   1044 C CE2 . TYR A 1 138 ? 6.660   -24.719 -0.172  1.00 31.15  ? 136 TYR A CE2 1 
ATOM   1045 C CZ  . TYR A 1 138 ? 7.751   -24.216 -0.846  1.00 29.80  ? 136 TYR A CZ  1 
ATOM   1046 O OH  . TYR A 1 138 ? 8.976   -24.808 -0.703  1.00 32.23  ? 136 TYR A OH  1 
ATOM   1047 N N   . GLN A 1 139 ? 1.893   -24.708 -2.184  1.00 30.29  ? 137 GLN A N   1 
ATOM   1048 C CA  . GLN A 1 139 ? 1.569   -26.141 -2.450  1.00 34.36  ? 137 GLN A CA  1 
ATOM   1049 C C   . GLN A 1 139 ? 1.024   -26.410 -3.839  1.00 34.94  ? 137 GLN A C   1 
ATOM   1050 O O   . GLN A 1 139 ? 1.251   -27.487 -4.371  1.00 37.01  ? 137 GLN A O   1 
ATOM   1051 C CB  . GLN A 1 139 ? 0.790   -26.877 -1.313  1.00 39.53  ? 137 GLN A CB  1 
ATOM   1052 C CG  . GLN A 1 139 ? -0.047  -28.229 -1.644  1.00 41.55  ? 137 GLN A CG  1 
ATOM   1053 C CD  . GLN A 1 139 ? 0.733   -29.463 -2.245  1.00 46.69  ? 137 GLN A CD  1 
ATOM   1054 O OE1 . GLN A 1 139 ? 1.056   -30.464 -1.560  1.00 29.06  ? 137 GLN A OE1 1 
ATOM   1055 N NE2 . GLN A 1 139 ? 0.801   -29.477 -3.566  1.00 55.85  ? 137 GLN A NE2 1 
ATOM   1056 N N   . MET A 1 140 ? 0.461   -25.394 -4.495  1.00 30.60  ? 138 MET A N   1 
ATOM   1057 C CA  . MET A 1 140 ? 0.175   -25.537 -5.919  1.00 31.95  ? 138 MET A CA  1 
ATOM   1058 C C   . MET A 1 140 ? 1.436   -25.735 -6.753  1.00 30.41  ? 138 MET A C   1 
ATOM   1059 O O   . MET A 1 140 ? 1.500   -26.638 -7.590  1.00 31.82  ? 138 MET A O   1 
ATOM   1060 C CB  . MET A 1 140 ? -0.632  -24.371 -6.487  1.00 28.96  ? 138 MET A CB  1 
ATOM   1061 C CG  . MET A 1 140 ? -0.975  -24.612 -7.941  1.00 30.35  ? 138 MET A CG  1 
ATOM   1062 S SD  . MET A 1 140 ? -1.335  -23.132 -8.876  1.00 33.06  ? 138 MET A SD  1 
ATOM   1063 C CE  . MET A 1 140 ? 0.309   -22.468 -9.144  1.00 29.13  ? 138 MET A CE  1 
ATOM   1064 N N   . LEU A 1 141 ? 2.445   -24.907 -6.501  1.00 31.27  ? 139 LEU A N   1 
ATOM   1065 C CA  . LEU A 1 141 ? 3.738   -25.057 -7.154  1.00 30.53  ? 139 LEU A CA  1 
ATOM   1066 C C   . LEU A 1 141 ? 4.375   -26.403 -6.805  1.00 35.03  ? 139 LEU A C   1 
ATOM   1067 O O   . LEU A 1 141 ? 5.053   -27.028 -7.636  1.00 38.64  ? 139 LEU A O   1 
ATOM   1068 C CB  . LEU A 1 141 ? 4.666   -23.910 -6.748  1.00 28.40  ? 139 LEU A CB  1 
ATOM   1069 C CG  . LEU A 1 141 ? 4.237   -22.525 -7.228  1.00 25.71  ? 139 LEU A CG  1 
ATOM   1070 C CD1 . LEU A 1 141 ? 5.158   -21.426 -6.668  1.00 21.56  ? 139 LEU A CD1 1 
ATOM   1071 C CD2 . LEU A 1 141 ? 4.156   -22.470 -8.761  1.00 22.00  ? 139 LEU A CD2 1 
ATOM   1072 N N   . LYS A 1 142 ? 4.172   -26.838 -5.567  1.00 32.54  ? 140 LYS A N   1 
ATOM   1073 C CA  . LYS A 1 142 ? 4.772   -28.077 -5.080  1.00 35.49  ? 140 LYS A CA  1 
ATOM   1074 C C   . LYS A 1 142 ? 4.040   -29.257 -5.707  1.00 38.47  ? 140 LYS A C   1 
ATOM   1075 O O   . LYS A 1 142 ? 4.655   -30.209 -6.168  1.00 40.94  ? 140 LYS A O   1 
ATOM   1076 C CB  . LYS A 1 142 ? 4.717   -28.132 -3.546  1.00 34.84  ? 140 LYS A CB  1 
ATOM   1077 C CG  . LYS A 1 142 ? 4.997   -29.492 -2.927  1.00 41.41  ? 140 LYS A CG  1 
ATOM   1078 C CD  . LYS A 1 142 ? 4.767   -29.497 -1.401  1.00 41.72  ? 140 LYS A CD  1 
ATOM   1079 C CE  . LYS A 1 142 ? 5.338   -28.250 -0.725  1.00 37.70  ? 140 LYS A CE  1 
ATOM   1080 N NZ  . LYS A 1 142 ? 5.482   -28.405 0.767   1.00 40.11  ? 140 LYS A NZ  1 
ATOM   1081 N N   . LYS A 1 143 ? 2.726   -29.137 -5.821  1.00 32.67  ? 141 LYS A N   1 
ATOM   1082 C CA  . LYS A 1 143 ? 1.937   -30.161 -6.488  1.00 36.36  ? 141 LYS A CA  1 
ATOM   1083 C C   . LYS A 1 143 ? 2.254   -30.289 -7.982  1.00 36.53  ? 141 LYS A C   1 
ATOM   1084 O O   . LYS A 1 143 ? 2.151   -31.374 -8.539  1.00 39.66  ? 141 LYS A O   1 
ATOM   1085 C CB  . LYS A 1 143 ? 0.456   -29.910 -6.266  1.00 36.68  ? 141 LYS A CB  1 
ATOM   1086 C CG  . LYS A 1 143 ? -0.320  -31.143 -5.862  1.00 42.01  ? 141 LYS A CG  1 
ATOM   1087 C CD  . LYS A 1 143 ? -1.745  -30.767 -5.540  1.00 42.44  ? 141 LYS A CD  1 
ATOM   1088 C CE  . LYS A 1 143 ? -2.736  -31.773 -6.071  1.00 45.19  ? 141 LYS A CE  1 
ATOM   1089 N NZ  . LYS A 1 143 ? -4.086  -31.162 -6.062  1.00 44.39  ? 141 LYS A NZ  1 
ATOM   1090 N N   . GLN A 1 144 ? 2.648   -29.186 -8.617  1.00 33.83  ? 142 GLN A N   1 
ATOM   1091 C CA  . GLN A 1 144 ? 3.009   -29.182 -10.039 1.00 36.52  ? 142 GLN A CA  1 
ATOM   1092 C C   . GLN A 1 144 ? 4.437   -29.698 -10.291 1.00 37.56  ? 142 GLN A C   1 
ATOM   1093 O O   . GLN A 1 144 ? 4.835   -29.937 -11.434 1.00 40.16  ? 142 GLN A O   1 
ATOM   1094 C CB  . GLN A 1 144 ? 2.848   -27.776 -10.633 1.00 32.69  ? 142 GLN A CB  1 
ATOM   1095 C CG  . GLN A 1 144 ? 1.389   -27.294 -10.748 1.00 36.24  ? 142 GLN A CG  1 
ATOM   1096 C CD  . GLN A 1 144 ? 1.283   -25.807 -11.079 1.00 40.13  ? 142 GLN A CD  1 
ATOM   1097 O OE1 . GLN A 1 144 ? 2.228   -25.038 -10.860 1.00 42.26  ? 142 GLN A OE1 1 
ATOM   1098 N NE2 . GLN A 1 144 ? 0.120   -25.388 -11.581 1.00 35.16  ? 142 GLN A NE2 1 
ATOM   1099 N N   . GLY A 1 145 ? 5.197   -29.875 -9.218  1.00 36.80  ? 143 GLY A N   1 
ATOM   1100 C CA  . GLY A 1 145 ? 6.576   -30.322 -9.320  1.00 37.02  ? 143 GLY A CA  1 
ATOM   1101 C C   . GLY A 1 145 ? 7.563   -29.195 -9.549  1.00 35.71  ? 143 GLY A C   1 
ATOM   1102 O O   . GLY A 1 145 ? 8.742   -29.444 -9.780  1.00 36.76  ? 143 GLY A O   1 
ATOM   1103 N N   . ILE A 1 146 ? 7.091   -27.953 -9.480  1.00 40.53  ? 144 ILE A N   1 
ATOM   1104 C CA  . ILE A 1 146 ? 7.989   -26.793 -9.572  1.00 39.18  ? 144 ILE A CA  1 
ATOM   1105 C C   . ILE A 1 146 ? 8.841   -26.610 -8.306  1.00 37.98  ? 144 ILE A C   1 
ATOM   1106 O O   . ILE A 1 146 ? 10.042  -26.323 -8.387  1.00 36.60  ? 144 ILE A O   1 
ATOM   1107 C CB  . ILE A 1 146 ? 7.221   -25.502 -9.927  1.00 36.71  ? 144 ILE A CB  1 
ATOM   1108 C CG1 . ILE A 1 146 ? 6.667   -25.590 -11.349 1.00 40.72  ? 144 ILE A CG1 1 
ATOM   1109 C CG2 . ILE A 1 146 ? 8.098   -24.266 -9.773  1.00 32.05  ? 144 ILE A CG2 1 
ATOM   1110 C CD1 . ILE A 1 146 ? 5.585   -24.554 -11.651 1.00 42.19  ? 144 ILE A CD1 1 
ATOM   1111 N N   . VAL A 1 147 ? 8.239   -26.826 -7.142  1.00 42.22  ? 145 VAL A N   1 
ATOM   1112 C CA  . VAL A 1 147 ? 9.018   -27.202 -5.954  1.00 45.46  ? 145 VAL A CA  1 
ATOM   1113 C C   . VAL A 1 147 ? 8.857   -28.697 -5.637  1.00 50.90  ? 145 VAL A C   1 
ATOM   1114 O O   . VAL A 1 147 ? 7.751   -29.239 -5.687  1.00 52.67  ? 145 VAL A O   1 
ATOM   1115 C CB  . VAL A 1 147 ? 8.721   -26.279 -4.732  1.00 43.70  ? 145 VAL A CB  1 
ATOM   1116 C CG1 . VAL A 1 147 ? 7.797   -25.131 -5.121  1.00 38.06  ? 145 VAL A CG1 1 
ATOM   1117 C CG2 . VAL A 1 147 ? 8.187   -27.056 -3.533  1.00 45.74  ? 145 VAL A CG2 1 
ATOM   1118 N N   . LYS A 1 148 ? 9.961   -29.388 -5.408  1.00 66.05  ? 146 LYS A N   1 
ATOM   1119 C CA  . LYS A 1 148 ? 10.782  -29.175 -4.237  1.00 65.51  ? 146 LYS A CA  1 
ATOM   1120 C C   . LYS A 1 148 ? 12.169  -28.760 -4.651  1.00 64.81  ? 146 LYS A C   1 
ATOM   1121 O O   . LYS A 1 148 ? 12.689  -27.788 -4.131  1.00 91.18  ? 146 LYS A O   1 
ATOM   1122 C CB  . LYS A 1 148 ? 10.839  -30.401 -3.339  1.00 69.10  ? 146 LYS A CB  1 
ATOM   1123 C CG  . LYS A 1 148 ? 9.623   -31.259 -3.359  1.00 70.40  ? 146 LYS A CG  1 
ATOM   1124 C CD  . LYS A 1 148 ? 9.154   -31.587 -1.994  1.00 71.27  ? 146 LYS A CD  1 
ATOM   1125 C CE  . LYS A 1 148 ? 9.876   -32.786 -1.497  1.00 72.97  ? 146 LYS A CE  1 
ATOM   1126 N NZ  . LYS A 1 148 ? 10.654  -33.411 -2.577  1.00 73.31  ? 146 LYS A NZ  1 
ATOM   1127 N N   . ASP B 2 5   ? -9.888  -4.676  1.661   1.00 53.84  ? 4   ASP C N   1 
ATOM   1128 C CA  . ASP B 2 5   ? -10.777 -5.208  0.591   1.00 54.89  ? 4   ASP C CA  1 
ATOM   1129 C C   . ASP B 2 5   ? -10.494 -6.680  0.285   1.00 52.74  ? 4   ASP C C   1 
ATOM   1130 O O   . ASP B 2 5   ? -9.352  -7.141  0.342   1.00 51.00  ? 4   ASP C O   1 
ATOM   1131 C CB  . ASP B 2 5   ? -10.667 -4.347  -0.663  1.00 57.98  ? 4   ASP C CB  1 
ATOM   1132 C CG  . ASP B 2 5   ? -11.507 -4.860  -1.806  1.00 59.38  ? 4   ASP C CG  1 
ATOM   1133 O OD1 . ASP B 2 5   ? -12.666 -4.403  -1.948  1.00 66.64  ? 4   ASP C OD1 1 
ATOM   1134 O OD2 . ASP B 2 5   ? -10.964 -5.630  -2.628  1.00 58.54  ? 4   ASP C OD2 1 
ATOM   1135 N N   . ASP B 2 6   ? -11.557 -7.406  -0.037  1.00 43.83  ? 5   ASP C N   1 
ATOM   1136 C CA  . ASP B 2 6   ? -11.599 -8.863  0.048   1.00 40.84  ? 5   ASP C CA  1 
ATOM   1137 C C   . ASP B 2 6   ? -11.434 -9.476  -1.343  1.00 40.96  ? 5   ASP C C   1 
ATOM   1138 O O   . ASP B 2 6   ? -11.240 -10.685 -1.491  1.00 40.29  ? 5   ASP C O   1 
ATOM   1139 C CB  . ASP B 2 6   ? -12.963 -9.282  0.622   1.00 43.20  ? 5   ASP C CB  1 
ATOM   1140 C CG  . ASP B 2 6   ? -14.142 -8.657  -0.142  1.00 47.45  ? 5   ASP C CG  1 
ATOM   1141 O OD1 . ASP B 2 6   ? -14.103 -7.435  -0.432  1.00 45.44  ? 5   ASP C OD1 1 
ATOM   1142 O OD2 . ASP B 2 6   ? -15.091 -9.397  -0.491  1.00 51.13  ? 5   ASP C OD2 1 
HETATM 1143 N N   . SEP B 2 7   ? -11.600 -8.645  -2.364  1.00 41.43  ? 6   SEP C N   1 
HETATM 1144 C CA  . SEP B 2 7   ? -11.587 -9.123  -3.736  1.00 42.18  ? 6   SEP C CA  1 
HETATM 1145 C CB  . SEP B 2 7   ? -12.311 -8.138  -4.663  1.00 43.82  ? 6   SEP C CB  1 
HETATM 1146 O OG  . SEP B 2 7   ? -13.578 -7.798  -4.115  1.00 46.92  ? 6   SEP C OG  1 
HETATM 1147 C C   . SEP B 2 7   ? -10.171 -9.381  -4.227  1.00 40.24  ? 6   SEP C C   1 
HETATM 1148 O O   . SEP B 2 7   ? -9.200  -8.791  -3.737  1.00 37.94  ? 6   SEP C O   1 
HETATM 1149 P P   . SEP B 2 7   ? -14.739 -7.742  -5.231  1.00 55.87  ? 6   SEP C P   1 
HETATM 1150 O O1P . SEP B 2 7   ? -16.134 -7.531  -4.454  1.00 58.60  ? 6   SEP C O1P 1 
HETATM 1151 O O2P . SEP B 2 7   ? -14.825 -9.106  -6.079  1.00 53.51  ? 6   SEP C O2P 1 
HETATM 1152 O O3P . SEP B 2 7   ? -14.434 -6.531  -6.249  1.00 58.42  ? 6   SEP C O3P 1 
ATOM   1153 N N   . ASP B 2 8   ? -10.072 -10.207 -5.253  1.00 39.78  ? 7   ASP C N   1 
ATOM   1154 C CA  . ASP B 2 8   ? -8.793  -10.769 -5.645  1.00 38.07  ? 7   ASP C CA  1 
ATOM   1155 C C   . ASP B 2 8   ? -8.973  -11.446 -7.000  1.00 38.84  ? 7   ASP C C   1 
ATOM   1156 O O   . ASP B 2 8   ? -10.106 -11.708 -7.428  1.00 41.77  ? 7   ASP C O   1 
ATOM   1157 C CB  . ASP B 2 8   ? -8.346  -11.782 -4.584  1.00 36.60  ? 7   ASP C CB  1 
ATOM   1158 C CG  . ASP B 2 8   ? -6.846  -12.018 -4.583  1.00 34.08  ? 7   ASP C CG  1 
ATOM   1159 O OD1 . ASP B 2 8   ? -6.135  -11.416 -5.423  1.00 32.21  ? 7   ASP C OD1 1 
ATOM   1160 O OD2 . ASP B 2 8   ? -6.391  -12.838 -3.756  1.00 31.79  ? 7   ASP C OD2 1 
ATOM   1161 N N   . GLU B 2 9   ? -7.860  -11.743 -7.661  1.00 44.62  ? 8   GLU C N   1 
ATOM   1162 C CA  . GLU B 2 9   ? -7.875  -12.597 -8.846  1.00 46.62  ? 8   GLU C CA  1 
ATOM   1163 C C   . GLU B 2 9   ? -8.096  -14.048 -8.451  1.00 44.02  ? 8   GLU C C   1 
ATOM   1164 O O   . GLU B 2 9   ? -7.982  -14.405 -7.278  1.00 42.78  ? 8   GLU C O   1 
ATOM   1165 C CB  . GLU B 2 9   ? -6.552  -12.461 -9.610  1.00 43.74  ? 8   GLU C CB  1 
ATOM   1166 C CG  . GLU B 2 9   ? -6.307  -11.087 -10.177 1.00 52.33  ? 8   GLU C CG  1 
ATOM   1167 C CD  . GLU B 2 9   ? -4.961  -10.963 -10.880 1.00 57.99  ? 8   GLU C CD  1 
ATOM   1168 O OE1 . GLU B 2 9   ? -4.280  -12.002 -11.099 1.00 58.09  ? 8   GLU C OE1 1 
ATOM   1169 O OE2 . GLU B 2 9   ? -4.598  -9.814  -11.241 1.00 61.88  ? 8   GLU C OE2 1 
ATOM   1170 N N   . ASP B 2 10  ? -8.402  -14.889 -9.432  1.00 39.04  ? 9   ASP C N   1 
ATOM   1171 C CA  . ASP B 2 10  ? -8.286  -16.331 -9.262  1.00 37.58  ? 9   ASP C CA  1 
ATOM   1172 C C   . ASP B 2 10  ? -6.803  -16.709 -9.148  1.00 34.33  ? 9   ASP C C   1 
ATOM   1173 O O   . ASP B 2 10  ? -5.969  -16.174 -9.873  1.00 33.99  ? 9   ASP C O   1 
ATOM   1174 C CB  . ASP B 2 10  ? -8.875  -17.060 -10.467 1.00 39.22  ? 9   ASP C CB  1 
ATOM   1175 C CG  . ASP B 2 10  ? -10.358 -16.760 -10.682 1.00 47.78  ? 9   ASP C CG  1 
ATOM   1176 O OD1 . ASP B 2 10  ? -10.802 -16.863 -11.846 1.00 53.42  ? 9   ASP C OD1 1 
ATOM   1177 O OD2 . ASP B 2 10  ? -11.075 -16.449 -9.702  1.00 51.38  ? 9   ASP C OD2 1 
ATOM   1178 N N   . LEU B 2 11  ? -6.506  -17.711 -8.325  1.00 39.85  ? 10  LEU C N   1 
ATOM   1179 C CA  . LEU B 2 11  ? -5.201  -18.368 -8.358  1.00 39.00  ? 10  LEU C CA  1 
ATOM   1180 C C   . LEU B 2 11  ? -4.875  -18.843 -9.776  1.00 41.72  ? 10  LEU C C   1 
ATOM   1181 O O   . LEU B 2 11  ? -5.662  -19.569 -10.389 1.00 43.43  ? 10  LEU C O   1 
ATOM   1182 C CB  . LEU B 2 11  ? -5.187  -19.554 -7.400  1.00 37.92  ? 10  LEU C CB  1 
ATOM   1183 C CG  . LEU B 2 11  ? -3.966  -20.471 -7.442  1.00 32.78  ? 10  LEU C CG  1 
ATOM   1184 C CD1 . LEU B 2 11  ? -2.696  -19.693 -7.130  1.00 29.46  ? 10  LEU C CD1 1 
ATOM   1185 C CD2 . LEU B 2 11  ? -4.139  -21.615 -6.468  1.00 33.33  ? 10  LEU C CD2 1 
ATOM   1186 N N   . LEU B 2 12  ? -3.739  -18.388 -10.302 1.00 45.49  ? 11  LEU C N   1 
ATOM   1187 C CA  . LEU B 2 12  ? -3.247  -18.814 -11.610 1.00 48.45  ? 11  LEU C CA  1 
ATOM   1188 C C   . LEU B 2 12  ? -2.761  -20.255 -11.569 1.00 49.54  ? 11  LEU C C   1 
ATOM   1189 O O   . LEU B 2 12  ? -1.684  -20.544 -11.057 1.00 48.19  ? 11  LEU C O   1 
ATOM   1190 C CB  . LEU B 2 12  ? -2.115  -17.898 -12.073 1.00 46.84  ? 11  LEU C CB  1 
ATOM   1191 C CG  . LEU B 2 12  ? -1.563  -18.132 -13.476 1.00 47.66  ? 11  LEU C CG  1 
ATOM   1192 C CD1 . LEU B 2 12  ? -2.687  -17.971 -14.509 1.00 51.45  ? 11  LEU C CD1 1 
ATOM   1193 C CD2 . LEU B 2 12  ? -0.426  -17.159 -13.752 1.00 41.85  ? 11  LEU C CD2 1 
ATOM   1194 N N   . GLU B 2 13  ? -3.587  -21.167 -12.063 1.00 64.43  ? 12  GLU C N   1 
ATOM   1195 C CA  . GLU B 2 13  ? -3.192  -22.560 -12.164 1.00 66.51  ? 12  GLU C CA  1 
ATOM   1196 C C   . GLU B 2 13  ? -2.928  -22.942 -13.622 1.00 69.88  ? 12  GLU C C   1 
ATOM   1197 O O   . GLU B 2 13  ? -2.043  -22.377 -14.293 1.00 69.25  ? 12  GLU C O   1 
ATOM   1198 C CB  . GLU B 2 13  ? -4.256  -23.456 -11.531 1.00 68.14  ? 12  GLU C CB  1 
ATOM   1199 C CG  . GLU B 2 13  ? -4.340  -23.309 -10.020 1.00 69.33  ? 12  GLU C CG  1 
ATOM   1200 C CD  . GLU B 2 13  ? -5.602  -23.899 -9.427  1.00 76.16  ? 12  GLU C CD  1 
ATOM   1201 O OE1 . GLU B 2 13  ? -5.502  -24.931 -8.723  1.00 75.67  ? 12  GLU C OE1 1 
ATOM   1202 O OE2 . GLU B 2 13  ? -6.688  -23.311 -9.630  1.00 79.59  ? 12  GLU C OE2 1 
ATOM   1203 O OXT . GLU B 2 13  ? -3.611  -23.811 -14.168 1.00 72.66  ? 12  GLU C OXT 1 
ATOM   1204 N N   . PRO C 1 9   ? 30.781  2.098   -27.301 1.00 105.89 ? 7   PRO B N   1 
ATOM   1205 C CA  . PRO C 1 9   ? 29.385  1.694   -27.443 1.00 101.18 ? 7   PRO B CA  1 
ATOM   1206 C C   . PRO C 1 9   ? 28.955  0.748   -26.319 1.00 97.39  ? 7   PRO B C   1 
ATOM   1207 O O   . PRO C 1 9   ? 29.785  0.001   -25.803 1.00 100.01 ? 7   PRO B O   1 
ATOM   1208 C CB  . PRO C 1 9   ? 29.377  0.971   -28.794 1.00 102.03 ? 7   PRO B CB  1 
ATOM   1209 C CG  . PRO C 1 9   ? 30.440  1.672   -29.588 1.00 107.40 ? 7   PRO B CG  1 
ATOM   1210 C CD  . PRO C 1 9   ? 31.488  2.140   -28.596 1.00 109.50 ? 7   PRO B CD  1 
ATOM   1211 N N   . GLU C 1 10  ? 27.682  0.812   -25.925 1.00 61.82  ? 8   GLU B N   1 
ATOM   1212 C CA  . GLU C 1 10  ? 27.186  0.096   -24.738 1.00 56.63  ? 8   GLU B CA  1 
ATOM   1213 C C   . GLU C 1 10  ? 26.143  -0.961  -25.105 1.00 52.53  ? 8   GLU B C   1 
ATOM   1214 O O   . GLU C 1 10  ? 25.671  -1.024  -26.244 1.00 51.67  ? 8   GLU B O   1 
ATOM   1215 C CB  . GLU C 1 10  ? 26.600  1.069   -23.697 1.00 55.29  ? 8   GLU B CB  1 
ATOM   1216 C CG  . GLU C 1 10  ? 27.382  1.157   -22.364 1.00 58.73  ? 8   GLU B CG  1 
ATOM   1217 C CD  . GLU C 1 10  ? 27.518  -0.182  -21.619 1.00 56.85  ? 8   GLU B CD  1 
ATOM   1218 O OE1 . GLU C 1 10  ? 28.595  -0.438  -21.034 1.00 62.33  ? 8   GLU B OE1 1 
ATOM   1219 O OE2 . GLU C 1 10  ? 26.553  -0.970  -21.589 1.00 51.56  ? 8   GLU B OE2 1 
ATOM   1220 N N   . THR C 1 11  ? 25.756  -1.753  -24.110 1.00 48.63  ? 9   THR B N   1 
ATOM   1221 C CA  . THR C 1 11  ? 24.761  -2.809  -24.280 1.00 45.60  ? 9   THR B CA  1 
ATOM   1222 C C   . THR C 1 11  ? 23.381  -2.248  -24.596 1.00 41.28  ? 9   THR B C   1 
ATOM   1223 O O   . THR C 1 11  ? 23.100  -1.078  -24.330 1.00 40.81  ? 9   THR B O   1 
ATOM   1224 C CB  . THR C 1 11  ? 24.646  -3.647  -23.004 1.00 44.81  ? 9   THR B CB  1 
ATOM   1225 O OG1 . THR C 1 11  ? 24.227  -2.800  -21.929 1.00 44.15  ? 9   THR B OG1 1 
ATOM   1226 C CG2 . THR C 1 11  ? 25.999  -4.263  -22.650 1.00 46.12  ? 9   THR B CG2 1 
ATOM   1227 N N   . LEU C 1 12  ? 22.505  -3.105  -25.110 1.00 36.94  ? 10  LEU B N   1 
ATOM   1228 C CA  . LEU C 1 12  ? 21.099  -2.758  -25.274 1.00 34.36  ? 10  LEU B CA  1 
ATOM   1229 C C   . LEU C 1 12  ? 20.433  -2.413  -23.926 1.00 31.79  ? 10  LEU B C   1 
ATOM   1230 O O   . LEU C 1 12  ? 19.587  -1.524  -23.861 1.00 28.85  ? 10  LEU B O   1 
ATOM   1231 C CB  . LEU C 1 12  ? 20.340  -3.890  -25.984 1.00 34.49  ? 10  LEU B CB  1 
ATOM   1232 C CG  . LEU C 1 12  ? 20.006  -3.732  -27.472 1.00 40.97  ? 10  LEU B CG  1 
ATOM   1233 C CD1 . LEU C 1 12  ? 21.036  -2.885  -28.205 1.00 40.48  ? 10  LEU B CD1 1 
ATOM   1234 C CD2 . LEU C 1 12  ? 19.807  -5.075  -28.176 1.00 40.07  ? 10  LEU B CD2 1 
ATOM   1235 N N   . GLU C 1 13  ? 20.828  -3.102  -22.855 1.00 29.64  ? 11  GLU B N   1 
ATOM   1236 C CA  . GLU C 1 13  ? 20.253  -2.818  -21.543 1.00 30.32  ? 11  GLU B CA  1 
ATOM   1237 C C   . GLU C 1 13  ? 20.621  -1.410  -21.087 1.00 29.63  ? 11  GLU B C   1 
ATOM   1238 O O   . GLU C 1 13  ? 19.754  -0.645  -20.687 1.00 29.99  ? 11  GLU B O   1 
ATOM   1239 C CB  . GLU C 1 13  ? 20.672  -3.863  -20.497 1.00 32.13  ? 11  GLU B CB  1 
ATOM   1240 C CG  . GLU C 1 13  ? 20.102  -5.254  -20.735 1.00 32.45  ? 11  GLU B CG  1 
ATOM   1241 C CD  . GLU C 1 13  ? 20.980  -6.113  -21.638 1.00 40.44  ? 11  GLU B CD  1 
ATOM   1242 O OE1 . GLU C 1 13  ? 20.958  -7.350  -21.483 1.00 41.94  ? 11  GLU B OE1 1 
ATOM   1243 O OE2 . GLU C 1 13  ? 21.718  -5.553  -22.479 1.00 38.67  ? 11  GLU B OE2 1 
ATOM   1244 N N   . ALA C 1 14  ? 21.890  -1.040  -21.214 1.00 31.91  ? 12  ALA B N   1 
ATOM   1245 C CA  . ALA C 1 14  ? 22.317  0.295   -20.795 1.00 34.31  ? 12  ALA B CA  1 
ATOM   1246 C C   . ALA C 1 14  ? 21.585  1.379   -21.590 1.00 33.39  ? 12  ALA B C   1 
ATOM   1247 O O   . ALA C 1 14  ? 21.034  2.320   -21.019 1.00 33.32  ? 12  ALA B O   1 
ATOM   1248 C CB  . ALA C 1 14  ? 23.841  0.452   -20.933 1.00 36.32  ? 12  ALA B CB  1 
ATOM   1249 N N   . ARG C 1 15  ? 21.572  1.234   -22.908 1.00 31.29  ? 13  ARG B N   1 
ATOM   1250 C CA  . ARG C 1 15  ? 20.938  2.215   -23.764 1.00 32.20  ? 13  ARG B CA  1 
ATOM   1251 C C   . ARG C 1 15  ? 19.439  2.358   -23.516 1.00 29.53  ? 13  ARG B C   1 
ATOM   1252 O O   . ARG C 1 15  ? 18.910  3.467   -23.568 1.00 30.89  ? 13  ARG B O   1 
ATOM   1253 C CB  . ARG C 1 15  ? 21.183  1.889   -25.235 1.00 31.42  ? 13  ARG B CB  1 
ATOM   1254 C CG  . ARG C 1 15  ? 22.641  1.851   -25.635 1.00 35.11  ? 13  ARG B CG  1 
ATOM   1255 C CD  . ARG C 1 15  ? 22.751  1.709   -27.148 1.00 41.80  ? 13  ARG B CD  1 
ATOM   1256 N NE  . ARG C 1 15  ? 23.766  2.604   -27.699 1.00 53.60  ? 13  ARG B NE  1 
ATOM   1257 C CZ  . ARG C 1 15  ? 24.976  2.207   -28.059 1.00 58.34  ? 13  ARG B CZ  1 
ATOM   1258 N NH1 . ARG C 1 15  ? 25.849  3.075   -28.536 1.00 64.31  ? 13  ARG B NH1 1 
ATOM   1259 N NH2 . ARG C 1 15  ? 25.312  0.932   -27.931 1.00 64.57  ? 13  ARG B NH2 1 
ATOM   1260 N N   . ILE C 1 16  ? 18.741  1.233   -23.414 1.00 28.61  ? 14  ILE B N   1 
ATOM   1261 C CA  . ILE C 1 16  ? 17.300  1.270   -23.165 1.00 28.32  ? 14  ILE B CA  1 
ATOM   1262 C C   . ILE C 1 16  ? 16.991  1.902   -21.811 1.00 28.83  ? 14  ILE B C   1 
ATOM   1263 O O   . ILE C 1 16  ? 16.006  2.624   -21.665 1.00 31.64  ? 14  ILE B O   1 
ATOM   1264 C CB  . ILE C 1 16  ? 16.621  -0.128  -23.305 1.00 27.27  ? 14  ILE B CB  1 
ATOM   1265 C CG1 . ILE C 1 16  ? 15.117  0.033   -23.540 1.00 25.70  ? 14  ILE B CG1 1 
ATOM   1266 C CG2 . ILE C 1 16  ? 16.878  -1.016  -22.076 1.00 25.67  ? 14  ILE B CG2 1 
ATOM   1267 C CD1 . ILE C 1 16  ? 14.784  0.943   -24.731 1.00 28.80  ? 14  ILE B CD1 1 
ATOM   1268 N N   . ASN C 1 17  ? 17.856  1.673   -20.831 1.00 24.64  ? 15  ASN B N   1 
ATOM   1269 C CA  . ASN C 1 17  ? 17.636  2.242   -19.509 1.00 25.28  ? 15  ASN B CA  1 
ATOM   1270 C C   . ASN C 1 17  ? 17.773  3.763   -19.565 1.00 28.99  ? 15  ASN B C   1 
ATOM   1271 O O   . ASN C 1 17  ? 17.002  4.494   -18.948 1.00 28.59  ? 15  ASN B O   1 
ATOM   1272 C CB  . ASN C 1 17  ? 18.610  1.643   -18.494 1.00 25.45  ? 15  ASN B CB  1 
ATOM   1273 C CG  . ASN C 1 17  ? 18.308  0.190   -18.179 1.00 25.99  ? 15  ASN B CG  1 
ATOM   1274 O OD1 . ASN C 1 17  ? 17.217  -0.323  -18.479 1.00 25.94  ? 15  ASN B OD1 1 
ATOM   1275 N ND2 . ASN C 1 17  ? 19.282  -0.494  -17.594 1.00 23.23  ? 15  ASN B ND2 1 
ATOM   1276 N N   . ARG C 1 18  ? 18.726  4.232   -20.362 1.00 30.49  ? 16  ARG B N   1 
ATOM   1277 C CA  . ARG C 1 18  ? 18.875  5.659   -20.605 1.00 36.71  ? 16  ARG B CA  1 
ATOM   1278 C C   . ARG C 1 18  ? 17.703  6.204   -21.416 1.00 35.12  ? 16  ARG B C   1 
ATOM   1279 O O   . ARG C 1 18  ? 17.126  7.228   -21.064 1.00 36.07  ? 16  ARG B O   1 
ATOM   1280 C CB  . ARG C 1 18  ? 20.197  5.948   -21.307 1.00 39.89  ? 16  ARG B CB  1 
ATOM   1281 C CG  . ARG C 1 18  ? 21.328  6.350   -20.360 1.00 50.29  ? 16  ARG B CG  1 
ATOM   1282 C CD  . ARG C 1 18  ? 22.547  6.847   -21.140 1.00 61.51  ? 16  ARG B CD  1 
ATOM   1283 N NE  . ARG C 1 18  ? 23.421  5.738   -21.526 1.00 66.02  ? 16  ARG B NE  1 
ATOM   1284 C CZ  . ARG C 1 18  ? 23.550  5.263   -22.764 1.00 67.41  ? 16  ARG B CZ  1 
ATOM   1285 N NH1 . ARG C 1 18  ? 24.361  4.236   -22.992 1.00 67.27  ? 16  ARG B NH1 1 
ATOM   1286 N NH2 . ARG C 1 18  ? 22.883  5.815   -23.776 1.00 68.80  ? 16  ARG B NH2 1 
ATOM   1287 N N   . ALA C 1 19  ? 17.315  5.482   -22.465 1.00 32.34  ? 17  ALA B N   1 
ATOM   1288 C CA  . ALA C 1 19  ? 16.299  5.955   -23.397 1.00 30.72  ? 17  ALA B CA  1 
ATOM   1289 C C   . ALA C 1 19  ? 14.898  6.038   -22.796 1.00 29.38  ? 17  ALA B C   1 
ATOM   1290 O O   . ALA C 1 19  ? 14.030  6.714   -23.351 1.00 30.30  ? 17  ALA B O   1 
ATOM   1291 C CB  . ALA C 1 19  ? 16.279  5.074   -24.668 1.00 28.60  ? 17  ALA B CB  1 
ATOM   1292 N N   . THR C 1 20  ? 14.635  5.227   -21.771 1.00 31.13  ? 18  THR B N   1 
ATOM   1293 C CA  . THR C 1 20  ? 13.306  5.143   -21.171 1.00 28.00  ? 18  THR B CA  1 
ATOM   1294 C C   . THR C 1 20  ? 13.300  5.600   -19.725 1.00 30.37  ? 18  THR B C   1 
ATOM   1295 O O   . THR C 1 20  ? 12.331  5.376   -19.002 1.00 30.00  ? 18  THR B O   1 
ATOM   1296 C CB  . THR C 1 20  ? 12.698  3.725   -21.275 1.00 26.87  ? 18  THR B CB  1 
ATOM   1297 O OG1 . THR C 1 20  ? 13.485  2.790   -20.518 1.00 21.56  ? 18  THR B OG1 1 
ATOM   1298 C CG2 . THR C 1 20  ? 12.651  3.277   -22.738 1.00 24.00  ? 18  THR B CG2 1 
ATOM   1299 N N   . ASN C 1 21  ? 14.371  6.261   -19.303 1.00 29.93  ? 19  ASN B N   1 
ATOM   1300 C CA  . ASN C 1 21  ? 14.498  6.648   -17.908 1.00 30.61  ? 19  ASN B CA  1 
ATOM   1301 C C   . ASN C 1 21  ? 13.327  7.516   -17.465 1.00 30.89  ? 19  ASN B C   1 
ATOM   1302 O O   . ASN C 1 21  ? 13.030  8.525   -18.105 1.00 29.50  ? 19  ASN B O   1 
ATOM   1303 C CB  . ASN C 1 21  ? 15.822  7.383   -17.662 1.00 33.07  ? 19  ASN B CB  1 
ATOM   1304 C CG  . ASN C 1 21  ? 16.298  7.263   -16.223 1.00 39.01  ? 19  ASN B CG  1 
ATOM   1305 O OD1 . ASN C 1 21  ? 15.594  7.642   -15.282 1.00 39.77  ? 19  ASN B OD1 1 
ATOM   1306 N ND2 . ASN C 1 21  ? 17.496  6.722   -16.044 1.00 45.59  ? 19  ASN B ND2 1 
ATOM   1307 N N   . PRO C 1 22  ? 12.648  7.121   -16.371 1.00 29.71  ? 20  PRO B N   1 
ATOM   1308 C CA  . PRO C 1 22  ? 11.547  7.929   -15.849 1.00 30.02  ? 20  PRO B CA  1 
ATOM   1309 C C   . PRO C 1 22  ? 12.032  9.281   -15.314 1.00 32.91  ? 20  PRO B C   1 
ATOM   1310 O O   . PRO C 1 22  ? 11.218  10.167  -15.082 1.00 32.61  ? 20  PRO B O   1 
ATOM   1311 C CB  . PRO C 1 22  ? 10.991  7.078   -14.694 1.00 31.58  ? 20  PRO B CB  1 
ATOM   1312 C CG  . PRO C 1 22  ? 11.561  5.721   -14.878 1.00 28.54  ? 20  PRO B CG  1 
ATOM   1313 C CD  . PRO C 1 22  ? 12.862  5.900   -15.578 1.00 28.01  ? 20  PRO B CD  1 
ATOM   1314 N N   . LEU C 1 23  ? 13.347  9.450   -15.186 1.00 34.97  ? 21  LEU B N   1 
ATOM   1315 C CA  . LEU C 1 23  ? 13.918  10.718  -14.735 1.00 39.17  ? 21  LEU B CA  1 
ATOM   1316 C C   . LEU C 1 23  ? 14.082  11.729  -15.863 1.00 40.55  ? 21  LEU B C   1 
ATOM   1317 O O   . LEU C 1 23  ? 14.257  12.909  -15.603 1.00 44.06  ? 21  LEU B O   1 
ATOM   1318 C CB  . LEU C 1 23  ? 15.265  10.512  -14.042 1.00 42.09  ? 21  LEU B CB  1 
ATOM   1319 C CG  . LEU C 1 23  ? 15.289  9.861   -12.659 1.00 39.06  ? 21  LEU B CG  1 
ATOM   1320 C CD1 . LEU C 1 23  ? 16.713  9.810   -12.162 1.00 42.17  ? 21  LEU B CD1 1 
ATOM   1321 C CD2 . LEU C 1 23  ? 14.416  10.624  -11.686 1.00 45.78  ? 21  LEU B CD2 1 
ATOM   1322 N N   . ASN C 1 24  ? 14.053  11.261  -17.107 1.00 36.17  ? 22  ASN B N   1 
ATOM   1323 C CA  . ASN C 1 24  ? 14.225  12.145  -18.257 1.00 38.01  ? 22  ASN B CA  1 
ATOM   1324 C C   . ASN C 1 24  ? 13.240  13.315  -18.235 1.00 39.28  ? 22  ASN B C   1 
ATOM   1325 O O   . ASN C 1 24  ? 12.037  13.118  -18.068 1.00 38.00  ? 22  ASN B O   1 
ATOM   1326 C CB  . ASN C 1 24  ? 14.096  11.367  -19.575 1.00 32.64  ? 22  ASN B CB  1 
ATOM   1327 C CG  . ASN C 1 24  ? 15.266  10.406  -19.816 1.00 36.15  ? 22  ASN B CG  1 
ATOM   1328 O OD1 . ASN C 1 24  ? 16.300  10.476  -19.150 1.00 36.66  ? 22  ASN B OD1 1 
ATOM   1329 N ND2 . ASN C 1 24  ? 15.092  9.493   -20.767 1.00 29.22  ? 22  ASN B ND2 1 
ATOM   1330 N N   . LYS C 1 25  ? 13.761  14.528  -18.425 1.00 47.80  ? 23  LYS B N   1 
ATOM   1331 C CA  . LYS C 1 25  ? 12.932  15.727  -18.515 1.00 49.02  ? 23  LYS B CA  1 
ATOM   1332 C C   . LYS C 1 25  ? 12.289  15.818  -19.886 1.00 47.34  ? 23  LYS B C   1 
ATOM   1333 O O   . LYS C 1 25  ? 11.251  16.454  -20.059 1.00 47.59  ? 23  LYS B O   1 
ATOM   1334 C CB  . LYS C 1 25  ? 13.773  16.983  -18.276 1.00 53.87  ? 23  LYS B CB  1 
ATOM   1335 C CG  . LYS C 1 25  ? 14.539  16.992  -16.969 1.00 58.62  ? 23  LYS B CG  1 
ATOM   1336 C CD  . LYS C 1 25  ? 13.764  17.720  -15.886 1.00 64.67  ? 23  LYS B CD  1 
ATOM   1337 C CE  . LYS C 1 25  ? 13.295  16.754  -14.809 1.00 65.59  ? 23  LYS B CE  1 
ATOM   1338 N NZ  . LYS C 1 25  ? 13.189  17.439  -13.493 1.00 66.62  ? 23  LYS B NZ  1 
ATOM   1339 N N   . GLU C 1 26  ? 12.933  15.198  -20.866 1.00 47.32  ? 24  GLU B N   1 
ATOM   1340 C CA  . GLU C 1 26  ? 12.446  15.200  -22.237 1.00 46.85  ? 24  GLU B CA  1 
ATOM   1341 C C   . GLU C 1 26  ? 13.016  13.973  -22.927 1.00 45.81  ? 24  GLU B C   1 
ATOM   1342 O O   . GLU C 1 26  ? 13.966  13.364  -22.419 1.00 44.94  ? 24  GLU B O   1 
ATOM   1343 C CB  . GLU C 1 26  ? 12.921  16.464  -22.964 1.00 50.65  ? 24  GLU B CB  1 
ATOM   1344 C CG  . GLU C 1 26  ? 14.423  16.660  -22.908 1.00 55.90  ? 24  GLU B CG  1 
ATOM   1345 C CD  . GLU C 1 26  ? 14.923  17.704  -23.877 1.00 62.97  ? 24  GLU B CD  1 
ATOM   1346 O OE1 . GLU C 1 26  ? 15.898  18.394  -23.530 1.00 69.87  ? 24  GLU B OE1 1 
ATOM   1347 O OE2 . GLU C 1 26  ? 14.366  17.821  -24.990 1.00 65.11  ? 24  GLU B OE2 1 
ATOM   1348 N N   . LEU C 1 27  ? 12.461  13.628  -24.089 1.00 45.48  ? 25  LEU B N   1 
ATOM   1349 C CA  . LEU C 1 27  ? 12.961  12.491  -24.860 1.00 44.53  ? 25  LEU B CA  1 
ATOM   1350 C C   . LEU C 1 27  ? 14.462  12.633  -25.084 1.00 47.59  ? 25  LEU B C   1 
ATOM   1351 O O   . LEU C 1 27  ? 14.942  13.691  -25.491 1.00 50.26  ? 25  LEU B O   1 
ATOM   1352 C CB  . LEU C 1 27  ? 12.240  12.375  -26.199 1.00 44.18  ? 25  LEU B CB  1 
ATOM   1353 C CG  . LEU C 1 27  ? 10.749  12.029  -26.156 1.00 45.12  ? 25  LEU B CG  1 
ATOM   1354 C CD1 . LEU C 1 27  ? 10.131  12.211  -27.541 1.00 40.42  ? 25  LEU B CD1 1 
ATOM   1355 C CD2 . LEU C 1 27  ? 10.496  10.604  -25.594 1.00 40.39  ? 25  LEU B CD2 1 
ATOM   1356 N N   . ASP C 1 28  ? 15.195  11.585  -24.733 1.00 37.70  ? 26  ASP B N   1 
ATOM   1357 C CA  . ASP C 1 28  ? 16.626  11.480  -24.997 1.00 40.41  ? 26  ASP B CA  1 
ATOM   1358 C C   . ASP C 1 28  ? 16.885  10.848  -26.369 1.00 40.01  ? 26  ASP B C   1 
ATOM   1359 O O   . ASP C 1 28  ? 17.085  9.638   -26.468 1.00 37.62  ? 26  ASP B O   1 
ATOM   1360 C CB  . ASP C 1 28  ? 17.254  10.609  -23.903 1.00 39.27  ? 26  ASP B CB  1 
ATOM   1361 C CG  . ASP C 1 28  ? 18.756  10.546  -23.991 1.00 41.13  ? 26  ASP B CG  1 
ATOM   1362 O OD1 . ASP C 1 28  ? 19.337  11.031  -24.988 1.00 44.43  ? 26  ASP B OD1 1 
ATOM   1363 O OD2 . ASP C 1 28  ? 19.354  9.942   -23.087 1.00 42.11  ? 26  ASP B OD2 1 
ATOM   1364 N N   . TRP C 1 29  ? 16.891  11.663  -27.423 1.00 43.46  ? 27  TRP B N   1 
ATOM   1365 C CA  . TRP C 1 29  ? 17.030  11.150  -28.789 1.00 44.08  ? 27  TRP B CA  1 
ATOM   1366 C C   . TRP C 1 29  ? 18.375  10.478  -29.055 1.00 45.11  ? 27  TRP B C   1 
ATOM   1367 O O   . TRP C 1 29  ? 18.463  9.548   -29.848 1.00 43.50  ? 27  TRP B O   1 
ATOM   1368 C CB  . TRP C 1 29  ? 16.771  12.253  -29.823 1.00 47.57  ? 27  TRP B CB  1 
ATOM   1369 C CG  . TRP C 1 29  ? 15.316  12.548  -29.971 1.00 45.60  ? 27  TRP B CG  1 
ATOM   1370 C CD1 . TRP C 1 29  ? 14.652  13.655  -29.529 1.00 44.97  ? 27  TRP B CD1 1 
ATOM   1371 C CD2 . TRP C 1 29  ? 14.322  11.670  -30.509 1.00 41.74  ? 27  TRP B CD2 1 
ATOM   1372 N NE1 . TRP C 1 29  ? 13.306  13.530  -29.781 1.00 41.13  ? 27  TRP B NE1 1 
ATOM   1373 C CE2 . TRP C 1 29  ? 13.080  12.327  -30.395 1.00 37.18  ? 27  TRP B CE2 1 
ATOM   1374 C CE3 . TRP C 1 29  ? 14.365  10.399  -31.095 1.00 35.09  ? 27  TRP B CE3 1 
ATOM   1375 C CZ2 . TRP C 1 29  ? 11.896  11.760  -30.843 1.00 36.31  ? 27  TRP B CZ2 1 
ATOM   1376 C CZ3 . TRP C 1 29  ? 13.185  9.828   -31.519 1.00 37.65  ? 27  TRP B CZ3 1 
ATOM   1377 C CH2 . TRP C 1 29  ? 11.963  10.502  -31.381 1.00 35.26  ? 27  TRP B CH2 1 
ATOM   1378 N N   . ALA C 1 30  ? 19.430  10.990  -28.437 1.00 47.33  ? 28  ALA B N   1 
ATOM   1379 C CA  . ALA C 1 30  ? 20.741  10.362  -28.539 1.00 48.68  ? 28  ALA B CA  1 
ATOM   1380 C C   . ALA C 1 30  ? 20.686  8.883   -28.129 1.00 43.51  ? 28  ALA B C   1 
ATOM   1381 O O   . ALA C 1 30  ? 21.119  8.016   -28.882 1.00 41.84  ? 28  ALA B O   1 
ATOM   1382 C CB  . ALA C 1 30  ? 21.782  11.135  -27.708 1.00 52.93  ? 28  ALA B CB  1 
ATOM   1383 N N   . SER C 1 31  ? 20.089  8.593   -26.975 1.00 43.17  ? 29  SER B N   1 
ATOM   1384 C CA  . SER C 1 31  ? 19.961  7.210   -26.492 1.00 39.22  ? 29  SER B CA  1 
ATOM   1385 C C   . SER C 1 31  ? 18.952  6.376   -27.284 1.00 35.73  ? 29  SER B C   1 
ATOM   1386 O O   . SER C 1 31  ? 19.220  5.218   -27.610 1.00 33.07  ? 29  SER B O   1 
ATOM   1387 C CB  . SER C 1 31  ? 19.617  7.171   -25.002 1.00 37.85  ? 29  SER B CB  1 
ATOM   1388 O OG  . SER C 1 31  ? 20.595  7.867   -24.246 1.00 44.23  ? 29  SER B OG  1 
ATOM   1389 N N   . ILE C 1 32  ? 17.806  6.976   -27.594 1.00 35.15  ? 30  ILE B N   1 
ATOM   1390 C CA  . ILE C 1 32  ? 16.788  6.344   -28.441 1.00 33.09  ? 30  ILE B CA  1 
ATOM   1391 C C   . ILE C 1 32  ? 17.386  5.845   -29.757 1.00 34.10  ? 30  ILE B C   1 
ATOM   1392 O O   . ILE C 1 32  ? 17.286  4.656   -30.086 1.00 32.02  ? 30  ILE B O   1 
ATOM   1393 C CB  . ILE C 1 32  ? 15.592  7.310   -28.727 1.00 32.83  ? 30  ILE B CB  1 
ATOM   1394 C CG1 . ILE C 1 32  ? 14.734  7.492   -27.469 1.00 31.70  ? 30  ILE B CG1 1 
ATOM   1395 C CG2 . ILE C 1 32  ? 14.735  6.798   -29.889 1.00 29.81  ? 30  ILE B CG2 1 
ATOM   1396 C CD1 . ILE C 1 32  ? 13.816  8.694   -27.514 1.00 33.85  ? 30  ILE B CD1 1 
ATOM   1397 N N   . ASN C 1 33  ? 18.022  6.756   -30.492 1.00 35.13  ? 31  ASN B N   1 
ATOM   1398 C CA  . ASN C 1 33  ? 18.618  6.438   -31.777 1.00 36.63  ? 31  ASN B CA  1 
ATOM   1399 C C   . ASN C 1 33  ? 19.764  5.440   -31.665 1.00 37.78  ? 31  ASN B C   1 
ATOM   1400 O O   . ASN C 1 33  ? 19.934  4.594   -32.539 1.00 38.59  ? 31  ASN B O   1 
ATOM   1401 C CB  . ASN C 1 33  ? 19.104  7.721   -32.480 1.00 40.43  ? 31  ASN B CB  1 
ATOM   1402 C CG  . ASN C 1 33  ? 17.961  8.561   -33.004 1.00 40.93  ? 31  ASN B CG  1 
ATOM   1403 O OD1 . ASN C 1 33  ? 16.899  8.039   -33.347 1.00 36.50  ? 31  ASN B OD1 1 
ATOM   1404 N ND2 . ASN C 1 33  ? 18.175  9.868   -33.083 1.00 44.46  ? 31  ASN B ND2 1 
ATOM   1405 N N   . GLY C 1 34  ? 20.616  5.627   -30.660 1.00 44.63  ? 32  GLY B N   1 
ATOM   1406 C CA  . GLY C 1 34  ? 21.688  4.673   -30.352 1.00 44.63  ? 32  GLY B CA  1 
ATOM   1407 C C   . GLY C 1 34  ? 21.195  3.256   -30.090 1.00 40.49  ? 32  GLY B C   1 
ATOM   1408 O O   . GLY C 1 34  ? 21.843  2.279   -30.467 1.00 40.58  ? 32  GLY B O   1 
ATOM   1409 N N   . PHE C 1 35  ? 20.053  3.141   -29.425 1.00 40.01  ? 33  PHE B N   1 
ATOM   1410 C CA  . PHE C 1 35  ? 19.421  1.838   -29.202 1.00 36.00  ? 33  PHE B CA  1 
ATOM   1411 C C   . PHE C 1 35  ? 19.063  1.131   -30.519 1.00 36.33  ? 33  PHE B C   1 
ATOM   1412 O O   . PHE C 1 35  ? 19.441  -0.023  -30.736 1.00 35.27  ? 33  PHE B O   1 
ATOM   1413 C CB  . PHE C 1 35  ? 18.193  1.986   -28.299 1.00 34.60  ? 33  PHE B CB  1 
ATOM   1414 C CG  . PHE C 1 35  ? 17.509  0.686   -27.989 1.00 29.67  ? 33  PHE B CG  1 
ATOM   1415 C CD1 . PHE C 1 35  ? 16.472  0.228   -28.787 1.00 28.41  ? 33  PHE B CD1 1 
ATOM   1416 C CD2 . PHE C 1 35  ? 17.924  -0.094  -26.918 1.00 26.58  ? 33  PHE B CD2 1 
ATOM   1417 C CE1 . PHE C 1 35  ? 15.804  -0.952  -28.485 1.00 28.09  ? 33  PHE B CE1 1 
ATOM   1418 C CE2 . PHE C 1 35  ? 17.285  -1.307  -26.629 1.00 28.63  ? 33  PHE B CE2 1 
ATOM   1419 C CZ  . PHE C 1 35  ? 16.218  -1.727  -27.408 1.00 27.27  ? 33  PHE B CZ  1 
ATOM   1420 N N   . CYS C 1 36  ? 18.386  1.845   -31.415 1.00 35.12  ? 34  CYS B N   1 
ATOM   1421 C CA  . CYS C 1 36  ? 18.010  1.298   -32.722 1.00 37.14  ? 34  CYS B CA  1 
ATOM   1422 C C   . CYS C 1 36  ? 19.249  0.963   -33.540 1.00 39.95  ? 34  CYS B C   1 
ATOM   1423 O O   . CYS C 1 36  ? 19.310  -0.085  -34.183 1.00 39.76  ? 34  CYS B O   1 
ATOM   1424 C CB  . CYS C 1 36  ? 17.139  2.294   -33.501 1.00 37.58  ? 34  CYS B CB  1 
ATOM   1425 S SG  . CYS C 1 36  ? 15.617  2.825   -32.642 1.00 40.58  ? 34  CYS B SG  1 
ATOM   1426 N N   . GLU C 1 37  ? 20.226  1.868   -33.520 1.00 49.18  ? 35  GLU B N   1 
ATOM   1427 C CA  . GLU C 1 37  ? 21.521  1.630   -34.153 1.00 54.43  ? 35  GLU B CA  1 
ATOM   1428 C C   . GLU C 1 37  ? 22.155  0.349   -33.619 1.00 53.02  ? 35  GLU B C   1 
ATOM   1429 O O   . GLU C 1 37  ? 22.469  -0.560  -34.389 1.00 55.05  ? 35  GLU B O   1 
ATOM   1430 C CB  . GLU C 1 37  ? 22.462  2.822   -33.929 1.00 57.80  ? 35  GLU B CB  1 
ATOM   1431 C CG  . GLU C 1 37  ? 23.966  2.504   -34.062 1.00 68.39  ? 35  GLU B CG  1 
ATOM   1432 C CD  . GLU C 1 37  ? 24.716  2.466   -32.717 1.00 75.05  ? 35  GLU B CD  1 
ATOM   1433 O OE1 . GLU C 1 37  ? 25.754  1.765   -32.625 1.00 77.21  ? 35  GLU B OE1 1 
ATOM   1434 O OE2 . GLU C 1 37  ? 24.295  3.158   -31.761 1.00 76.89  ? 35  GLU B OE2 1 
ATOM   1435 N N   . GLN C 1 38  ? 22.338  0.285   -32.301 1.00 45.13  ? 36  GLN B N   1 
ATOM   1436 C CA  . GLN C 1 38  ? 23.086  -0.798  -31.673 1.00 45.45  ? 36  GLN B CA  1 
ATOM   1437 C C   . GLN C 1 38  ? 22.441  -2.161  -31.925 1.00 45.31  ? 36  GLN B C   1 
ATOM   1438 O O   . GLN C 1 38  ? 23.142  -3.149  -32.149 1.00 46.84  ? 36  GLN B O   1 
ATOM   1439 C CB  . GLN C 1 38  ? 23.242  -0.542  -30.171 1.00 44.49  ? 36  GLN B CB  1 
ATOM   1440 C CG  . GLN C 1 38  ? 23.983  -1.634  -29.409 1.00 46.86  ? 36  GLN B CG  1 
ATOM   1441 C CD  . GLN C 1 38  ? 25.476  -1.655  -29.701 1.00 55.77  ? 36  GLN B CD  1 
ATOM   1442 O OE1 . GLN C 1 38  ? 26.148  -2.664  -29.469 1.00 60.72  ? 36  GLN B OE1 1 
ATOM   1443 N NE2 . GLN C 1 38  ? 26.007  -0.536  -30.197 1.00 56.48  ? 36  GLN B NE2 1 
ATOM   1444 N N   . LEU C 1 39  ? 21.112  -2.208  -31.931 1.00 38.70  ? 37  LEU B N   1 
ATOM   1445 C CA  . LEU C 1 39  ? 20.409  -3.489  -32.027 1.00 41.94  ? 37  LEU B CA  1 
ATOM   1446 C C   . LEU C 1 39  ? 20.635  -4.207  -33.367 1.00 47.52  ? 37  LEU B C   1 
ATOM   1447 O O   . LEU C 1 39  ? 20.470  -5.420  -33.463 1.00 50.05  ? 37  LEU B O   1 
ATOM   1448 C CB  . LEU C 1 39  ? 18.913  -3.350  -31.693 1.00 37.58  ? 37  LEU B CB  1 
ATOM   1449 C CG  . LEU C 1 39  ? 17.910  -2.780  -32.709 1.00 36.25  ? 37  LEU B CG  1 
ATOM   1450 C CD1 . LEU C 1 39  ? 17.577  -3.778  -33.810 1.00 37.10  ? 37  LEU B CD1 1 
ATOM   1451 C CD2 . LEU C 1 39  ? 16.633  -2.362  -32.002 1.00 29.60  ? 37  LEU B CD2 1 
ATOM   1452 N N   . ASN C 1 40  ? 21.054  -3.460  -34.382 1.00 58.68  ? 38  ASN B N   1 
ATOM   1453 C CA  . ASN C 1 40  ? 21.335  -4.037  -35.700 1.00 65.71  ? 38  ASN B CA  1 
ATOM   1454 C C   . ASN C 1 40  ? 22.777  -4.473  -35.906 1.00 70.67  ? 38  ASN B C   1 
ATOM   1455 O O   . ASN C 1 40  ? 23.103  -5.103  -36.912 1.00 74.47  ? 38  ASN B O   1 
ATOM   1456 C CB  . ASN C 1 40  ? 20.921  -3.082  -36.813 1.00 65.00  ? 38  ASN B CB  1 
ATOM   1457 C CG  . ASN C 1 40  ? 19.425  -3.023  -36.987 1.00 64.87  ? 38  ASN B CG  1 
ATOM   1458 O OD1 . ASN C 1 40  ? 18.811  -1.974  -36.786 1.00 67.81  ? 38  ASN B OD1 1 
ATOM   1459 N ND2 . ASN C 1 40  ? 18.813  -4.172  -37.291 1.00 66.37  ? 38  ASN B ND2 1 
ATOM   1460 N N   . GLU C 1 41  ? 23.632  -4.133  -34.947 1.00 71.81  ? 39  GLU B N   1 
ATOM   1461 C CA  . GLU C 1 41  ? 25.049  -4.437  -35.035 1.00 77.47  ? 39  GLU B CA  1 
ATOM   1462 C C   . GLU C 1 41  ? 25.303  -5.909  -34.692 1.00 80.96  ? 39  GLU B C   1 
ATOM   1463 O O   . GLU C 1 41  ? 26.349  -6.462  -35.026 1.00 84.52  ? 39  GLU B O   1 
ATOM   1464 C CB  . GLU C 1 41  ? 25.835  -3.522  -34.092 1.00 76.64  ? 39  GLU B CB  1 
ATOM   1465 C CG  . GLU C 1 41  ? 26.988  -2.772  -34.751 1.00 81.95  ? 39  GLU B CG  1 
ATOM   1466 C CD  . GLU C 1 41  ? 28.000  -2.259  -33.735 1.00 86.48  ? 39  GLU B CD  1 
ATOM   1467 O OE1 . GLU C 1 41  ? 29.219  -2.406  -33.983 1.00 90.09  ? 39  GLU B OE1 1 
ATOM   1468 O OE2 . GLU C 1 41  ? 27.574  -1.729  -32.682 1.00 82.12  ? 39  GLU B OE2 1 
ATOM   1469 N N   . ASP C 1 42  ? 24.339  -6.535  -34.019 1.00 95.17  ? 40  ASP B N   1 
ATOM   1470 C CA  . ASP C 1 42  ? 24.482  -7.923  -33.577 1.00 98.56  ? 40  ASP B CA  1 
ATOM   1471 C C   . ASP C 1 42  ? 23.336  -8.787  -34.097 1.00 98.05  ? 40  ASP B C   1 
ATOM   1472 O O   . ASP C 1 42  ? 22.223  -8.292  -34.309 1.00 94.02  ? 40  ASP B O   1 
ATOM   1473 C CB  . ASP C 1 42  ? 24.532  -7.993  -32.048 1.00 97.21  ? 40  ASP B CB  1 
ATOM   1474 C CG  . ASP C 1 42  ? 25.177  -6.762  -31.425 1.00 97.35  ? 40  ASP B CG  1 
ATOM   1475 O OD1 . ASP C 1 42  ? 24.446  -5.953  -30.806 1.00 94.17  ? 40  ASP B OD1 1 
ATOM   1476 O OD2 . ASP C 1 42  ? 26.414  -6.605  -31.553 1.00 101.34 ? 40  ASP B OD2 1 
ATOM   1477 N N   . PHE C 1 43  ? 23.607  -10.078 -34.275 1.00 82.31  ? 41  PHE B N   1 
ATOM   1478 C CA  . PHE C 1 43  ? 22.566  -11.050 -34.608 1.00 79.78  ? 41  PHE B CA  1 
ATOM   1479 C C   . PHE C 1 43  ? 21.651  -11.356 -33.424 1.00 74.58  ? 41  PHE B C   1 
ATOM   1480 O O   . PHE C 1 43  ? 20.455  -11.610 -33.603 1.00 71.04  ? 41  PHE B O   1 
ATOM   1481 C CB  . PHE C 1 43  ? 23.178  -12.347 -35.148 1.00 86.88  ? 41  PHE B CB  1 
ATOM   1482 C CG  . PHE C 1 43  ? 22.155  -13.373 -35.569 1.00 89.30  ? 41  PHE B CG  1 
ATOM   1483 C CD1 . PHE C 1 43  ? 21.372  -13.172 -36.702 1.00 89.11  ? 41  PHE B CD1 1 
ATOM   1484 C CD2 . PHE C 1 43  ? 21.974  -14.538 -34.830 1.00 93.83  ? 41  PHE B CD2 1 
ATOM   1485 C CE1 . PHE C 1 43  ? 20.427  -14.113 -37.092 1.00 90.08  ? 41  PHE B CE1 1 
ATOM   1486 C CE2 . PHE C 1 43  ? 21.031  -15.485 -35.212 1.00 95.12  ? 41  PHE B CE2 1 
ATOM   1487 C CZ  . PHE C 1 43  ? 20.258  -15.272 -36.347 1.00 92.62  ? 41  PHE B CZ  1 
ATOM   1488 N N   . GLU C 1 44  ? 22.219  -11.332 -32.221 1.00 69.01  ? 42  GLU B N   1 
ATOM   1489 C CA  . GLU C 1 44  ? 21.438  -11.468 -30.992 1.00 64.59  ? 42  GLU B CA  1 
ATOM   1490 C C   . GLU C 1 44  ? 20.539  -10.248 -30.759 1.00 56.77  ? 42  GLU B C   1 
ATOM   1491 O O   . GLU C 1 44  ? 19.536  -10.327 -30.054 1.00 52.53  ? 42  GLU B O   1 
ATOM   1492 C CB  . GLU C 1 44  ? 22.365  -11.672 -29.785 1.00 67.71  ? 42  GLU B CB  1 
ATOM   1493 C CG  . GLU C 1 44  ? 22.306  -10.546 -28.734 1.00 65.72  ? 42  GLU B CG  1 
ATOM   1494 C CD  . GLU C 1 44  ? 23.609  -9.755  -28.623 1.00 68.47  ? 42  GLU B CD  1 
ATOM   1495 O OE1 . GLU C 1 44  ? 24.695  -10.379 -28.537 1.00 72.55  ? 42  GLU B OE1 1 
ATOM   1496 O OE2 . GLU C 1 44  ? 23.542  -8.507  -28.580 1.00 59.29  ? 42  GLU B OE2 1 
ATOM   1497 N N   . GLY C 1 45  ? 20.923  -9.121  -31.349 1.00 52.22  ? 43  GLY B N   1 
ATOM   1498 C CA  . GLY C 1 45  ? 20.379  -7.821  -30.974 1.00 46.20  ? 43  GLY B CA  1 
ATOM   1499 C C   . GLY C 1 45  ? 18.867  -7.758  -31.036 1.00 40.80  ? 43  GLY B C   1 
ATOM   1500 O O   . GLY C 1 45  ? 18.212  -7.474  -30.027 1.00 38.18  ? 43  GLY B O   1 
ATOM   1501 N N   . PRO C 1 46  ? 18.302  -7.954  -32.238 1.00 41.20  ? 44  PRO B N   1 
ATOM   1502 C CA  . PRO C 1 46  ? 16.877  -7.688  -32.409 1.00 37.64  ? 44  PRO B CA  1 
ATOM   1503 C C   . PRO C 1 46  ? 15.927  -8.461  -31.470 1.00 35.53  ? 44  PRO B C   1 
ATOM   1504 O O   . PRO C 1 46  ? 14.982  -7.868  -30.981 1.00 32.72  ? 44  PRO B O   1 
ATOM   1505 C CB  . PRO C 1 46  ? 16.633  -7.995  -33.893 1.00 37.72  ? 44  PRO B CB  1 
ATOM   1506 C CG  . PRO C 1 46  ? 17.956  -7.759  -34.529 1.00 40.51  ? 44  PRO B CG  1 
ATOM   1507 C CD  . PRO C 1 46  ? 18.961  -8.246  -33.526 1.00 43.13  ? 44  PRO B CD  1 
ATOM   1508 N N   . PRO C 1 47  ? 16.179  -9.765  -31.214 1.00 39.92  ? 45  PRO B N   1 
ATOM   1509 C CA  . PRO C 1 47  ? 15.426  -10.505 -30.172 1.00 39.41  ? 45  PRO B CA  1 
ATOM   1510 C C   . PRO C 1 47  ? 15.611  -9.958  -28.746 1.00 35.97  ? 45  PRO B C   1 
ATOM   1511 O O   . PRO C 1 47  ? 14.659  -9.920  -27.966 1.00 33.24  ? 45  PRO B O   1 
ATOM   1512 C CB  . PRO C 1 47  ? 15.988  -11.938 -30.267 1.00 42.50  ? 45  PRO B CB  1 
ATOM   1513 C CG  . PRO C 1 47  ? 16.614  -12.024 -31.597 1.00 46.86  ? 45  PRO B CG  1 
ATOM   1514 C CD  . PRO C 1 47  ? 17.074  -10.651 -31.978 1.00 42.82  ? 45  PRO B CD  1 
ATOM   1515 N N   . LEU C 1 48  ? 16.823  -9.525  -28.416 1.00 34.81  ? 46  LEU B N   1 
ATOM   1516 C CA  . LEU C 1 48  ? 17.077  -8.895  -27.122 1.00 33.15  ? 46  LEU B CA  1 
ATOM   1517 C C   . LEU C 1 48  ? 16.325  -7.577  -26.999 1.00 29.10  ? 46  LEU B C   1 
ATOM   1518 O O   . LEU C 1 48  ? 15.695  -7.321  -25.978 1.00 27.54  ? 46  LEU B O   1 
ATOM   1519 C CB  . LEU C 1 48  ? 18.584  -8.691  -26.892 1.00 35.72  ? 46  LEU B CB  1 
ATOM   1520 C CG  . LEU C 1 48  ? 19.032  -7.941  -25.629 1.00 34.85  ? 46  LEU B CG  1 
ATOM   1521 C CD1 . LEU C 1 48  ? 18.444  -8.580  -24.365 1.00 39.75  ? 46  LEU B CD1 1 
ATOM   1522 C CD2 . LEU C 1 48  ? 20.555  -7.937  -25.551 1.00 33.39  ? 46  LEU B CD2 1 
ATOM   1523 N N   . ALA C 1 49  ? 16.380  -6.749  -28.046 1.00 30.19  ? 47  ALA B N   1 
ATOM   1524 C CA  . ALA C 1 49  ? 15.727  -5.426  -28.043 1.00 26.13  ? 47  ALA B CA  1 
ATOM   1525 C C   . ALA C 1 49  ? 14.242  -5.570  -27.726 1.00 25.75  ? 47  ALA B C   1 
ATOM   1526 O O   . ALA C 1 49  ? 13.655  -4.818  -26.964 1.00 25.17  ? 47  ALA B O   1 
ATOM   1527 C CB  . ALA C 1 49  ? 15.906  -4.745  -29.411 1.00 24.28  ? 47  ALA B CB  1 
ATOM   1528 N N   . THR C 1 50  ? 13.653  -6.580  -28.330 1.00 32.52  ? 48  THR B N   1 
ATOM   1529 C CA  . THR C 1 50  ? 12.222  -6.803  -28.343 1.00 30.87  ? 48  THR B CA  1 
ATOM   1530 C C   . THR C 1 50  ? 11.772  -7.289  -26.942 1.00 29.95  ? 48  THR B C   1 
ATOM   1531 O O   . THR C 1 50  ? 10.788  -6.801  -26.369 1.00 26.45  ? 48  THR B O   1 
ATOM   1532 C CB  . THR C 1 50  ? 11.974  -7.807  -29.520 1.00 34.15  ? 48  THR B CB  1 
ATOM   1533 O OG1 . THR C 1 50  ? 11.398  -7.126  -30.649 1.00 36.25  ? 48  THR B OG1 1 
ATOM   1534 C CG2 . THR C 1 50  ? 11.214  -8.997  -29.153 1.00 31.96  ? 48  THR B CG2 1 
ATOM   1535 N N   . ARG C 1 51  ? 12.607  -8.116  -26.330 1.00 31.11  ? 49  ARG B N   1 
ATOM   1536 C CA  . ARG C 1 51  ? 12.422  -8.543  -24.942 1.00 33.51  ? 49  ARG B CA  1 
ATOM   1537 C C   . ARG C 1 51  ? 12.482  -7.353  -23.973 1.00 31.07  ? 49  ARG B C   1 
ATOM   1538 O O   . ARG C 1 51  ? 11.633  -7.214  -23.106 1.00 28.07  ? 49  ARG B O   1 
ATOM   1539 C CB  . ARG C 1 51  ? 13.517  -9.537  -24.587 1.00 35.11  ? 49  ARG B CB  1 
ATOM   1540 C CG  . ARG C 1 51  ? 13.047  -10.782 -23.879 1.00 46.85  ? 49  ARG B CG  1 
ATOM   1541 C CD  . ARG C 1 51  ? 13.617  -12.044 -24.539 1.00 53.76  ? 49  ARG B CD  1 
ATOM   1542 N NE  . ARG C 1 51  ? 15.074  -12.010 -24.719 1.00 61.22  ? 49  ARG B NE  1 
ATOM   1543 C CZ  . ARG C 1 51  ? 15.708  -12.505 -25.786 1.00 66.16  ? 49  ARG B CZ  1 
ATOM   1544 N NH1 . ARG C 1 51  ? 17.032  -12.457 -25.864 1.00 66.88  ? 49  ARG B NH1 1 
ATOM   1545 N NH2 . ARG C 1 51  ? 15.017  -13.041 -26.788 1.00 63.09  ? 49  ARG B NH2 1 
ATOM   1546 N N   . LEU C 1 52  ? 13.496  -6.502  -24.121 1.00 30.39  ? 50  LEU B N   1 
ATOM   1547 C CA  . LEU C 1 52  ? 13.668  -5.375  -23.210 1.00 28.12  ? 50  LEU B CA  1 
ATOM   1548 C C   . LEU C 1 52  ? 12.543  -4.353  -23.412 1.00 26.71  ? 50  LEU B C   1 
ATOM   1549 O O   . LEU C 1 52  ? 11.981  -3.822  -22.451 1.00 26.13  ? 50  LEU B O   1 
ATOM   1550 C CB  . LEU C 1 52  ? 15.041  -4.721  -23.415 1.00 26.77  ? 50  LEU B CB  1 
ATOM   1551 C CG  . LEU C 1 52  ? 16.284  -5.598  -23.304 1.00 29.68  ? 50  LEU B CG  1 
ATOM   1552 C CD1 . LEU C 1 52  ? 17.493  -4.862  -23.863 1.00 23.61  ? 50  LEU B CD1 1 
ATOM   1553 C CD2 . LEU C 1 52  ? 16.541  -6.037  -21.837 1.00 28.95  ? 50  LEU B CD2 1 
ATOM   1554 N N   . LEU C 1 53  ? 12.210  -4.088  -24.670 1.00 28.35  ? 51  LEU B N   1 
ATOM   1555 C CA  . LEU C 1 53  ? 11.103  -3.191  -24.988 1.00 28.02  ? 51  LEU B CA  1 
ATOM   1556 C C   . LEU C 1 53  ? 9.772   -3.648  -24.400 1.00 27.78  ? 51  LEU B C   1 
ATOM   1557 O O   . LEU C 1 53  ? 9.024   -2.829  -23.875 1.00 28.43  ? 51  LEU B O   1 
ATOM   1558 C CB  . LEU C 1 53  ? 10.976  -2.983  -26.504 1.00 27.98  ? 51  LEU B CB  1 
ATOM   1559 C CG  . LEU C 1 53  ? 11.997  -2.032  -27.126 1.00 30.09  ? 51  LEU B CG  1 
ATOM   1560 C CD1 . LEU C 1 53  ? 12.005  -2.214  -28.641 1.00 28.69  ? 51  LEU B CD1 1 
ATOM   1561 C CD2 . LEU C 1 53  ? 11.659  -0.594  -26.751 1.00 28.62  ? 51  LEU B CD2 1 
ATOM   1562 N N   . ALA C 1 54  ? 9.454   -4.937  -24.522 1.00 26.83  ? 52  ALA B N   1 
ATOM   1563 C CA  . ALA C 1 54  ? 8.179   -5.436  -24.016 1.00 26.45  ? 52  ALA B CA  1 
ATOM   1564 C C   . ALA C 1 54  ? 8.020   -5.180  -22.519 1.00 26.61  ? 52  ALA B C   1 
ATOM   1565 O O   . ALA C 1 54  ? 6.965   -4.742  -22.078 1.00 26.90  ? 52  ALA B O   1 
ATOM   1566 C CB  . ALA C 1 54  ? 7.997   -6.916  -24.334 1.00 26.20  ? 52  ALA B CB  1 
ATOM   1567 N N   . HIS C 1 55  ? 9.086   -5.417  -21.750 1.00 28.11  ? 53  HIS B N   1 
ATOM   1568 C CA  . HIS C 1 55  ? 9.115   -5.037  -20.347 1.00 28.23  ? 53  HIS B CA  1 
ATOM   1569 C C   . HIS C 1 55  ? 8.881   -3.555  -20.056 1.00 27.40  ? 53  HIS B C   1 
ATOM   1570 O O   . HIS C 1 55  ? 8.069   -3.223  -19.206 1.00 28.75  ? 53  HIS B O   1 
ATOM   1571 C CB  . HIS C 1 55  ? 10.399  -5.510  -19.649 1.00 29.45  ? 53  HIS B CB  1 
ATOM   1572 C CG  . HIS C 1 55  ? 10.293  -5.496  -18.158 1.00 27.55  ? 53  HIS B CG  1 
ATOM   1573 N ND1 . HIS C 1 55  ? 11.005  -4.615  -17.370 1.00 27.29  ? 53  HIS B ND1 1 
ATOM   1574 C CD2 . HIS C 1 55  ? 9.426   -6.126  -17.327 1.00 25.46  ? 53  HIS B CD2 1 
ATOM   1575 C CE1 . HIS C 1 55  ? 10.664  -4.790  -16.103 1.00 29.52  ? 53  HIS B CE1 1 
ATOM   1576 N NE2 . HIS C 1 55  ? 9.717   -5.710  -16.049 1.00 30.29  ? 53  HIS B NE2 1 
ATOM   1577 N N   . LYS C 1 56  ? 9.643   -2.670  -20.691 1.00 25.94  ? 54  LYS B N   1 
ATOM   1578 C CA  . LYS C 1 56  ? 9.487   -1.220  -20.456 1.00 26.52  ? 54  LYS B CA  1 
ATOM   1579 C C   . LYS C 1 56  ? 8.083   -0.765  -20.828 1.00 26.53  ? 54  LYS B C   1 
ATOM   1580 O O   . LYS C 1 56  ? 7.495   0.080   -20.157 1.00 27.37  ? 54  LYS B O   1 
ATOM   1581 C CB  . LYS C 1 56  ? 10.499  -0.400  -21.264 1.00 24.68  ? 54  LYS B CB  1 
ATOM   1582 C CG  . LYS C 1 56  ? 11.959  -0.768  -21.035 1.00 28.22  ? 54  LYS B CG  1 
ATOM   1583 C CD  . LYS C 1 56  ? 12.402  -0.524  -19.592 1.00 29.85  ? 54  LYS B CD  1 
ATOM   1584 C CE  . LYS C 1 56  ? 13.944  -0.452  -19.491 1.00 31.05  ? 54  LYS B CE  1 
ATOM   1585 N NZ  . LYS C 1 56  ? 14.399  -0.093  -18.098 1.00 28.67  ? 54  LYS B NZ  1 
ATOM   1586 N N   . ILE C 1 57  ? 7.583   -1.272  -21.949 1.00 26.97  ? 55  ILE B N   1 
ATOM   1587 C CA  . ILE C 1 57  ? 6.258   -0.890  -22.433 1.00 28.00  ? 55  ILE B CA  1 
ATOM   1588 C C   . ILE C 1 57  ? 5.152   -1.232  -21.434 1.00 28.88  ? 55  ILE B C   1 
ATOM   1589 O O   . ILE C 1 57  ? 4.142   -0.527  -21.350 1.00 30.01  ? 55  ILE B O   1 
ATOM   1590 C CB  . ILE C 1 57  ? 5.947   -1.534  -23.812 1.00 26.77  ? 55  ILE B CB  1 
ATOM   1591 C CG1 . ILE C 1 57  ? 6.817   -0.897  -24.902 1.00 26.61  ? 55  ILE B CG1 1 
ATOM   1592 C CG2 . ILE C 1 57  ? 4.474   -1.391  -24.132 1.00 24.49  ? 55  ILE B CG2 1 
ATOM   1593 C CD1 . ILE C 1 57  ? 6.865   -1.699  -26.251 1.00 25.15  ? 55  ILE B CD1 1 
ATOM   1594 N N   . GLN C 1 58  ? 5.351   -2.315  -20.682 1.00 26.54  ? 56  GLN B N   1 
ATOM   1595 C CA  . GLN C 1 58  ? 4.392   -2.749  -19.680 1.00 27.78  ? 56  GLN B CA  1 
ATOM   1596 C C   . GLN C 1 58  ? 4.599   -2.105  -18.308 1.00 28.37  ? 56  GLN B C   1 
ATOM   1597 O O   . GLN C 1 58  ? 3.960   -2.502  -17.332 1.00 27.51  ? 56  GLN B O   1 
ATOM   1598 C CB  . GLN C 1 58  ? 4.389   -4.280  -19.564 1.00 30.49  ? 56  GLN B CB  1 
ATOM   1599 C CG  . GLN C 1 58  ? 4.140   -4.971  -20.893 1.00 33.01  ? 56  GLN B CG  1 
ATOM   1600 C CD  . GLN C 1 58  ? 4.126   -6.486  -20.799 1.00 38.29  ? 56  GLN B CD  1 
ATOM   1601 O OE1 . GLN C 1 58  ? 3.673   -7.166  -21.719 1.00 38.00  ? 56  GLN B OE1 1 
ATOM   1602 N NE2 . GLN C 1 58  ? 4.645   -7.019  -19.706 1.00 36.85  ? 56  GLN B NE2 1 
ATOM   1603 N N   . SER C 1 59  ? 5.422   -1.059  -18.257 1.00 30.55  ? 57  SER B N   1 
ATOM   1604 C CA  . SER C 1 59  ? 5.692   -0.345  -16.996 1.00 32.18  ? 57  SER B CA  1 
ATOM   1605 C C   . SER C 1 59  ? 4.444   0.302   -16.405 1.00 33.13  ? 57  SER B C   1 
ATOM   1606 O O   . SER C 1 59  ? 3.677   0.930   -17.134 1.00 33.78  ? 57  SER B O   1 
ATOM   1607 C CB  . SER C 1 59  ? 6.774   0.728   -17.183 1.00 31.91  ? 57  SER B CB  1 
ATOM   1608 O OG  . SER C 1 59  ? 7.149   1.283   -15.915 1.00 34.57  ? 57  SER B OG  1 
ATOM   1609 N N   . PRO C 1 60  ? 4.244   0.164   -15.076 1.00 28.53  ? 58  PRO B N   1 
ATOM   1610 C CA  . PRO C 1 60  ? 3.241   0.954   -14.372 1.00 31.21  ? 58  PRO B CA  1 
ATOM   1611 C C   . PRO C 1 60  ? 3.594   2.438   -14.355 1.00 33.07  ? 58  PRO B C   1 
ATOM   1612 O O   . PRO C 1 60  ? 2.758   3.265   -14.002 1.00 36.32  ? 58  PRO B O   1 
ATOM   1613 C CB  . PRO C 1 60  ? 3.286   0.392   -12.944 1.00 32.39  ? 58  PRO B CB  1 
ATOM   1614 C CG  . PRO C 1 60  ? 3.931   -0.929  -13.064 1.00 31.19  ? 58  PRO B CG  1 
ATOM   1615 C CD  . PRO C 1 60  ? 4.917   -0.776  -14.167 1.00 28.73  ? 58  PRO B CD  1 
ATOM   1616 N N   . GLN C 1 61  ? 4.829   2.772   -14.707 1.00 32.25  ? 59  GLN B N   1 
ATOM   1617 C CA  . GLN C 1 61  ? 5.241   4.172   -14.720 1.00 33.80  ? 59  GLN B CA  1 
ATOM   1618 C C   . GLN C 1 61  ? 5.037   4.717   -16.116 1.00 32.66  ? 59  GLN B C   1 
ATOM   1619 O O   . GLN C 1 61  ? 5.735   4.324   -17.047 1.00 29.29  ? 59  GLN B O   1 
ATOM   1620 C CB  . GLN C 1 61  ? 6.696   4.323   -14.256 1.00 33.69  ? 59  GLN B CB  1 
ATOM   1621 C CG  . GLN C 1 61  ? 6.905   3.954   -12.774 1.00 31.88  ? 59  GLN B CG  1 
ATOM   1622 C CD  . GLN C 1 61  ? 8.373   3.956   -12.372 1.00 36.23  ? 59  GLN B CD  1 
ATOM   1623 O OE1 . GLN C 1 61  ? 9.036   4.995   -12.406 1.00 33.41  ? 59  GLN B OE1 1 
ATOM   1624 N NE2 . GLN C 1 61  ? 8.896   2.780   -12.023 1.00 29.98  ? 59  GLN B NE2 1 
ATOM   1625 N N   . GLU C 1 62  ? 4.039   5.587   -16.269 1.00 35.25  ? 60  GLU B N   1 
ATOM   1626 C CA  . GLU C 1 62  ? 3.558   5.972   -17.589 1.00 35.20  ? 60  GLU B CA  1 
ATOM   1627 C C   . GLU C 1 62  ? 4.657   6.518   -18.494 1.00 32.47  ? 60  GLU B C   1 
ATOM   1628 O O   . GLU C 1 62  ? 4.760   6.130   -19.658 1.00 31.76  ? 60  GLU B O   1 
ATOM   1629 C CB  . GLU C 1 62  ? 2.401   6.976   -17.493 1.00 38.95  ? 60  GLU B CB  1 
ATOM   1630 C CG  . GLU C 1 62  ? 1.659   7.107   -18.820 1.00 41.04  ? 60  GLU B CG  1 
ATOM   1631 C CD  . GLU C 1 62  ? 0.789   8.345   -18.923 1.00 50.91  ? 60  GLU B CD  1 
ATOM   1632 O OE1 . GLU C 1 62  ? 0.848   9.225   -18.035 1.00 56.49  ? 60  GLU B OE1 1 
ATOM   1633 O OE2 . GLU C 1 62  ? 0.048   8.445   -19.921 1.00 56.68  ? 60  GLU B OE2 1 
ATOM   1634 N N   . TRP C 1 63  ? 5.468   7.431   -17.967 1.00 35.84  ? 61  TRP B N   1 
ATOM   1635 C CA  . TRP C 1 63  ? 6.505   8.095   -18.769 1.00 34.71  ? 61  TRP B CA  1 
ATOM   1636 C C   . TRP C 1 63  ? 7.598   7.107   -19.220 1.00 32.58  ? 61  TRP B C   1 
ATOM   1637 O O   . TRP C 1 63  ? 8.219   7.292   -20.261 1.00 31.61  ? 61  TRP B O   1 
ATOM   1638 C CB  . TRP C 1 63  ? 7.087   9.288   -17.989 1.00 34.94  ? 61  TRP B CB  1 
ATOM   1639 C CG  . TRP C 1 63  ? 8.276   10.031  -18.631 1.00 36.37  ? 61  TRP B CG  1 
ATOM   1640 C CD1 . TRP C 1 63  ? 9.439   10.387  -17.996 1.00 38.95  ? 61  TRP B CD1 1 
ATOM   1641 C CD2 . TRP C 1 63  ? 8.349   10.621  -19.945 1.00 35.05  ? 61  TRP B CD2 1 
ATOM   1642 N NE1 . TRP C 1 63  ? 10.250  11.101  -18.845 1.00 37.45  ? 61  TRP B NE1 1 
ATOM   1643 C CE2 . TRP C 1 63  ? 9.610   11.258  -20.046 1.00 35.07  ? 61  TRP B CE2 1 
ATOM   1644 C CE3 . TRP C 1 63  ? 7.516   10.590  -21.077 1.00 35.69  ? 61  TRP B CE3 1 
ATOM   1645 C CZ2 . TRP C 1 63  ? 10.046  11.885  -21.220 1.00 33.60  ? 61  TRP B CZ2 1 
ATOM   1646 C CZ3 . TRP C 1 63  ? 7.948   11.220  -22.244 1.00 35.16  ? 61  TRP B CZ3 1 
ATOM   1647 C CH2 . TRP C 1 63  ? 9.200   11.865  -22.303 1.00 37.36  ? 61  TRP B CH2 1 
ATOM   1648 N N   . GLU C 1 64  ? 7.805   6.040   -18.452 1.00 31.82  ? 62  GLU B N   1 
ATOM   1649 C CA  . GLU C 1 64  ? 8.728   4.967   -18.876 1.00 29.67  ? 62  GLU B CA  1 
ATOM   1650 C C   . GLU C 1 64  ? 8.159   4.168   -20.052 1.00 28.32  ? 62  GLU B C   1 
ATOM   1651 O O   . GLU C 1 64  ? 8.874   3.852   -21.013 1.00 26.37  ? 62  GLU B O   1 
ATOM   1652 C CB  . GLU C 1 64  ? 9.017   4.030   -17.706 1.00 30.27  ? 62  GLU B CB  1 
ATOM   1653 C CG  . GLU C 1 64  ? 9.944   2.868   -18.040 1.00 28.81  ? 62  GLU B CG  1 
ATOM   1654 C CD  . GLU C 1 64  ? 10.376  2.122   -16.798 1.00 28.86  ? 62  GLU B CD  1 
ATOM   1655 O OE1 . GLU C 1 64  ? 11.585  2.120   -16.495 1.00 31.55  ? 62  GLU B OE1 1 
ATOM   1656 O OE2 . GLU C 1 64  ? 9.494   1.626   -16.072 1.00 29.60  ? 62  GLU B OE2 1 
ATOM   1657 N N   . ALA C 1 65  ? 6.875   3.830   -19.954 1.00 29.26  ? 63  ALA B N   1 
ATOM   1658 C CA  . ALA C 1 65  ? 6.159   3.134   -21.026 1.00 29.08  ? 63  ALA B CA  1 
ATOM   1659 C C   . ALA C 1 65  ? 6.054   3.952   -22.316 1.00 29.75  ? 63  ALA B C   1 
ATOM   1660 O O   . ALA C 1 65  ? 6.160   3.392   -23.411 1.00 32.03  ? 63  ALA B O   1 
ATOM   1661 C CB  . ALA C 1 65  ? 4.777   2.717   -20.552 1.00 28.94  ? 63  ALA B CB  1 
ATOM   1662 N N   . ILE C 1 66  ? 5.779   5.251   -22.182 1.00 29.32  ? 64  ILE B N   1 
ATOM   1663 C CA  . ILE C 1 66  ? 5.654   6.172   -23.319 1.00 30.30  ? 64  ILE B CA  1 
ATOM   1664 C C   . ILE C 1 66  ? 6.979   6.346   -24.082 1.00 30.30  ? 64  ILE B C   1 
ATOM   1665 O O   . ILE C 1 66  ? 7.010   6.280   -25.309 1.00 30.08  ? 64  ILE B O   1 
ATOM   1666 C CB  . ILE C 1 66  ? 5.107   7.556   -22.870 1.00 32.69  ? 64  ILE B CB  1 
ATOM   1667 C CG1 . ILE C 1 66  ? 3.643   7.437   -22.421 1.00 35.33  ? 64  ILE B CG1 1 
ATOM   1668 C CG2 . ILE C 1 66  ? 5.220   8.597   -23.985 1.00 33.15  ? 64  ILE B CG2 1 
ATOM   1669 C CD1 . ILE C 1 66  ? 2.663   7.153   -23.560 1.00 37.50  ? 64  ILE B CD1 1 
ATOM   1670 N N   . GLN C 1 67  ? 8.071   6.537   -23.347 1.00 29.42  ? 65  GLN B N   1 
ATOM   1671 C CA  . GLN C 1 67  ? 9.408   6.581   -23.933 1.00 29.57  ? 65  GLN B CA  1 
ATOM   1672 C C   . GLN C 1 67  ? 9.775   5.268   -24.622 1.00 28.55  ? 65  GLN B C   1 
ATOM   1673 O O   . GLN C 1 67  ? 10.348  5.264   -25.711 1.00 30.55  ? 65  GLN B O   1 
ATOM   1674 C CB  . GLN C 1 67  ? 10.452  6.923   -22.860 1.00 30.62  ? 65  GLN B CB  1 
ATOM   1675 C CG  . GLN C 1 67  ? 10.461  8.389   -22.455 1.00 29.06  ? 65  GLN B CG  1 
ATOM   1676 C CD  . GLN C 1 67  ? 11.501  8.691   -21.402 1.00 33.42  ? 65  GLN B CD  1 
ATOM   1677 O OE1 . GLN C 1 67  ? 12.512  9.337   -21.678 1.00 40.01  ? 65  GLN B OE1 1 
ATOM   1678 N NE2 . GLN C 1 67  ? 11.247  8.250   -20.181 1.00 29.45  ? 65  GLN B NE2 1 
ATOM   1679 N N   . ALA C 1 68  ? 9.440   4.155   -23.992 1.00 27.90  ? 66  ALA B N   1 
ATOM   1680 C CA  . ALA C 1 68  ? 9.688   2.845   -24.590 1.00 27.58  ? 66  ALA B CA  1 
ATOM   1681 C C   . ALA C 1 68  ? 8.952   2.683   -25.921 1.00 26.50  ? 66  ALA B C   1 
ATOM   1682 O O   . ALA C 1 68  ? 9.512   2.200   -26.908 1.00 27.54  ? 66  ALA B O   1 
ATOM   1683 C CB  . ALA C 1 68  ? 9.286   1.744   -23.611 1.00 25.74  ? 66  ALA B CB  1 
ATOM   1684 N N   . LEU C 1 69  ? 7.687   3.078   -25.942 1.00 27.34  ? 67  LEU B N   1 
ATOM   1685 C CA  . LEU C 1 69  ? 6.898   3.064   -27.176 1.00 27.02  ? 67  LEU B CA  1 
ATOM   1686 C C   . LEU C 1 69  ? 7.438   4.029   -28.244 1.00 28.63  ? 67  LEU B C   1 
ATOM   1687 O O   . LEU C 1 69  ? 7.346   3.753   -29.447 1.00 28.22  ? 67  LEU B O   1 
ATOM   1688 C CB  . LEU C 1 69  ? 5.438   3.379   -26.874 1.00 28.90  ? 67  LEU B CB  1 
ATOM   1689 C CG  . LEU C 1 69  ? 4.607   2.285   -26.205 1.00 27.44  ? 67  LEU B CG  1 
ATOM   1690 C CD1 . LEU C 1 69  ? 3.246   2.885   -25.780 1.00 27.36  ? 67  LEU B CD1 1 
ATOM   1691 C CD2 . LEU C 1 69  ? 4.438   1.108   -27.171 1.00 23.07  ? 67  LEU B CD2 1 
ATOM   1692 N N   . THR C 1 70  ? 8.022   5.143   -27.811 1.00 28.32  ? 68  THR B N   1 
ATOM   1693 C CA  . THR C 1 70  ? 8.778   5.996   -28.731 1.00 30.67  ? 68  THR B CA  1 
ATOM   1694 C C   . THR C 1 70  ? 10.037  5.313   -29.288 1.00 31.10  ? 68  THR B C   1 
ATOM   1695 O O   . THR C 1 70  ? 10.309  5.393   -30.484 1.00 31.75  ? 68  THR B O   1 
ATOM   1696 C CB  . THR C 1 70  ? 9.132   7.365   -28.097 1.00 33.05  ? 68  THR B CB  1 
ATOM   1697 O OG1 . THR C 1 70  ? 7.926   8.022   -27.690 1.00 36.29  ? 68  THR B OG1 1 
ATOM   1698 C CG2 . THR C 1 70  ? 9.863   8.259   -29.102 1.00 32.33  ? 68  THR B CG2 1 
ATOM   1699 N N   . VAL C 1 71  ? 10.793  4.622   -28.438 1.00 26.05  ? 69  VAL B N   1 
ATOM   1700 C CA  . VAL C 1 71  ? 11.890  3.802   -28.936 1.00 26.83  ? 69  VAL B CA  1 
ATOM   1701 C C   . VAL C 1 71  ? 11.359  2.785   -29.943 1.00 27.31  ? 69  VAL B C   1 
ATOM   1702 O O   . VAL C 1 71  ? 11.914  2.637   -31.031 1.00 28.20  ? 69  VAL B O   1 
ATOM   1703 C CB  . VAL C 1 71  ? 12.622  3.040   -27.802 1.00 26.94  ? 69  VAL B CB  1 
ATOM   1704 C CG1 . VAL C 1 71  ? 13.715  2.164   -28.386 1.00 23.06  ? 69  VAL B CG1 1 
ATOM   1705 C CG2 . VAL C 1 71  ? 13.214  4.022   -26.791 1.00 28.88  ? 69  VAL B CG2 1 
ATOM   1706 N N   . LEU C 1 72  ? 10.283  2.087   -29.571 1.00 26.29  ? 70  LEU B N   1 
ATOM   1707 C CA  . LEU C 1 72  ? 9.687   1.082   -30.440 1.00 26.30  ? 70  LEU B CA  1 
ATOM   1708 C C   . LEU C 1 72  ? 9.286   1.654   -31.800 1.00 27.35  ? 70  LEU B C   1 
ATOM   1709 O O   . LEU C 1 72  ? 9.661   1.111   -32.843 1.00 28.47  ? 70  LEU B O   1 
ATOM   1710 C CB  . LEU C 1 72  ? 8.504   0.376   -29.760 1.00 25.05  ? 70  LEU B CB  1 
ATOM   1711 C CG  . LEU C 1 72  ? 7.710   -0.610  -30.636 1.00 24.72  ? 70  LEU B CG  1 
ATOM   1712 C CD1 . LEU C 1 72  ? 8.561   -1.771  -31.131 1.00 22.00  ? 70  LEU B CD1 1 
ATOM   1713 C CD2 . LEU C 1 72  ? 6.488   -1.118  -29.892 1.00 21.04  ? 70  LEU B CD2 1 
ATOM   1714 N N   . GLU C 1 73  ? 8.578   2.780   -31.781 1.00 27.21  ? 71  GLU B N   1 
ATOM   1715 C CA  . GLU C 1 73  ? 8.187   3.472   -33.003 1.00 27.37  ? 71  GLU B CA  1 
ATOM   1716 C C   . GLU C 1 73  ? 9.401   3.817   -33.862 1.00 29.94  ? 71  GLU B C   1 
ATOM   1717 O O   . GLU C 1 73  ? 9.395   3.585   -35.062 1.00 30.06  ? 71  GLU B O   1 
ATOM   1718 C CB  . GLU C 1 73  ? 7.445   4.772   -32.671 1.00 27.25  ? 71  GLU B CB  1 
ATOM   1719 C CG  . GLU C 1 73  ? 6.987   5.534   -33.910 1.00 28.48  ? 71  GLU B CG  1 
ATOM   1720 C CD  . GLU C 1 73  ? 6.128   6.743   -33.574 1.00 34.59  ? 71  GLU B CD  1 
ATOM   1721 O OE1 . GLU C 1 73  ? 6.057   7.136   -32.388 1.00 31.09  ? 71  GLU B OE1 1 
ATOM   1722 O OE2 . GLU C 1 73  ? 5.541   7.314   -34.510 1.00 41.45  ? 71  GLU B OE2 1 
ATOM   1723 N N   . THR C 1 74  ? 10.414  4.415   -33.236 1.00 28.55  ? 72  THR B N   1 
ATOM   1724 C CA  . THR C 1 74  ? 11.610  4.874   -33.925 1.00 30.09  ? 72  THR B CA  1 
ATOM   1725 C C   . THR C 1 74  ? 12.346  3.730   -34.611 1.00 29.19  ? 72  THR B C   1 
ATOM   1726 O O   . THR C 1 74  ? 12.656  3.815   -35.800 1.00 29.82  ? 72  THR B O   1 
ATOM   1727 C CB  . THR C 1 74  ? 12.557  5.625   -32.955 1.00 31.97  ? 72  THR B CB  1 
ATOM   1728 O OG1 . THR C 1 74  ? 11.866  6.752   -32.409 1.00 31.72  ? 72  THR B OG1 1 
ATOM   1729 C CG2 . THR C 1 74  ? 13.809  6.118   -33.685 1.00 34.72  ? 72  THR B CG2 1 
ATOM   1730 N N   . CYS C 1 75  ? 12.605  2.649   -33.877 1.00 28.57  ? 73  CYS B N   1 
ATOM   1731 C CA  . CYS C 1 75  ? 13.335  1.516   -34.455 1.00 28.94  ? 73  CYS B CA  1 
ATOM   1732 C C   . CYS C 1 75  ? 12.541  0.836   -35.578 1.00 26.99  ? 73  CYS B C   1 
ATOM   1733 O O   . CYS C 1 75  ? 13.123  0.375   -36.535 1.00 28.78  ? 73  CYS B O   1 
ATOM   1734 C CB  . CYS C 1 75  ? 13.734  0.486   -33.385 1.00 29.39  ? 73  CYS B CB  1 
ATOM   1735 S SG  . CYS C 1 75  ? 14.744  1.103   -31.989 1.00 31.48  ? 73  CYS B SG  1 
ATOM   1736 N N   . MET C 1 76  ? 11.217  0.775   -35.450 1.00 24.84  ? 74  MET B N   1 
ATOM   1737 C CA  . MET C 1 76  ? 10.383  0.202   -36.493 1.00 25.96  ? 74  MET B CA  1 
ATOM   1738 C C   . MET C 1 76  ? 10.374  1.078   -37.749 1.00 27.08  ? 74  MET B C   1 
ATOM   1739 O O   . MET C 1 76  ? 10.137  0.594   -38.851 1.00 27.01  ? 74  MET B O   1 
ATOM   1740 C CB  . MET C 1 76  ? 8.952   -0.028  -36.000 1.00 25.10  ? 74  MET B CB  1 
ATOM   1741 C CG  . MET C 1 76  ? 8.754   -1.265  -35.121 1.00 26.77  ? 74  MET B CG  1 
ATOM   1742 S SD  . MET C 1 76  ? 8.991   -2.830  -35.983 1.00 29.43  ? 74  MET B SD  1 
ATOM   1743 C CE  . MET C 1 76  ? 7.476   -2.991  -36.927 1.00 34.56  ? 74  MET B CE  1 
ATOM   1744 N N   . LYS C 1 77  ? 10.605  2.375   -37.575 1.00 30.19  ? 75  LYS B N   1 
ATOM   1745 C CA  . LYS C 1 77  ? 10.694  3.261   -38.721 1.00 34.16  ? 75  LYS B CA  1 
ATOM   1746 C C   . LYS C 1 77  ? 12.002  3.119   -39.493 1.00 35.15  ? 75  LYS B C   1 
ATOM   1747 O O   . LYS C 1 77  ? 12.102  3.594   -40.622 1.00 37.85  ? 75  LYS B O   1 
ATOM   1748 C CB  . LYS C 1 77  ? 10.448  4.712   -38.328 1.00 36.51  ? 75  LYS B CB  1 
ATOM   1749 C CG  . LYS C 1 77  ? 8.966   5.059   -38.194 1.00 40.73  ? 75  LYS B CG  1 
ATOM   1750 C CD  . LYS C 1 77  ? 8.799   6.351   -37.410 1.00 48.24  ? 75  LYS B CD  1 
ATOM   1751 C CE  . LYS C 1 77  ? 7.555   7.107   -37.830 1.00 52.25  ? 75  LYS B CE  1 
ATOM   1752 N NZ  . LYS C 1 77  ? 7.417   8.362   -37.037 1.00 57.44  ? 75  LYS B NZ  1 
ATOM   1753 N N   . SER C 1 78  ? 13.003  2.492   -38.880 1.00 35.18  ? 76  SER B N   1 
ATOM   1754 C CA  . SER C 1 78  ? 14.253  2.166   -39.581 1.00 39.12  ? 76  SER B CA  1 
ATOM   1755 C C   . SER C 1 78  ? 14.016  0.967   -40.496 1.00 38.56  ? 76  SER B C   1 
ATOM   1756 O O   . SER C 1 78  ? 13.173  0.120   -40.213 1.00 38.37  ? 76  SER B O   1 
ATOM   1757 C CB  . SER C 1 78  ? 15.351  1.818   -38.573 1.00 40.37  ? 76  SER B CB  1 
ATOM   1758 O OG  . SER C 1 78  ? 15.508  2.854   -37.626 1.00 45.14  ? 76  SER B OG  1 
ATOM   1759 N N   . CYS C 1 79  ? 14.820  0.820   -41.532 1.00 40.92  ? 77  CYS B N   1 
ATOM   1760 C CA  . CYS C 1 79  ? 14.460  -0.142  -42.566 1.00 42.63  ? 77  CYS B CA  1 
ATOM   1761 C C   . CYS C 1 79  ? 14.955  -1.589  -42.361 1.00 43.68  ? 77  CYS B C   1 
ATOM   1762 O O   . CYS C 1 79  ? 14.693  -2.455  -43.207 1.00 45.10  ? 77  CYS B O   1 
ATOM   1763 C CB  . CYS C 1 79  ? 14.844  0.394   -43.940 1.00 45.69  ? 77  CYS B CB  1 
ATOM   1764 S SG  . CYS C 1 79  ? 16.568  0.696   -44.048 1.00 50.50  ? 77  CYS B SG  1 
ATOM   1765 N N   . GLY C 1 80  ? 15.549  -1.872  -41.199 1.00 39.46  ? 78  GLY B N   1 
ATOM   1766 C CA  . GLY C 1 80  ? 16.071  -3.217  -40.876 1.00 39.23  ? 78  GLY B CA  1 
ATOM   1767 C C   . GLY C 1 80  ? 15.041  -4.333  -40.749 1.00 37.65  ? 78  GLY B C   1 
ATOM   1768 O O   . GLY C 1 80  ? 14.150  -4.278  -39.909 1.00 35.68  ? 78  GLY B O   1 
ATOM   1769 N N   . LYS C 1 81  ? 15.205  -5.375  -41.557 1.00 41.40  ? 79  LYS B N   1 
ATOM   1770 C CA  . LYS C 1 81  ? 14.282  -6.513  -41.617 1.00 41.93  ? 79  LYS B CA  1 
ATOM   1771 C C   . LYS C 1 81  ? 14.214  -7.329  -40.325 1.00 41.06  ? 79  LYS B C   1 
ATOM   1772 O O   . LYS C 1 81  ? 13.132  -7.722  -39.892 1.00 39.58  ? 79  LYS B O   1 
ATOM   1773 C CB  . LYS C 1 81  ? 14.684  -7.435  -42.775 1.00 46.17  ? 79  LYS B CB  1 
ATOM   1774 C CG  . LYS C 1 81  ? 13.730  -8.593  -43.047 1.00 51.26  ? 79  LYS B CG  1 
ATOM   1775 C CD  . LYS C 1 81  ? 14.129  -9.319  -44.332 1.00 59.67  ? 79  LYS B CD  1 
ATOM   1776 C CE  . LYS C 1 81  ? 12.939  -10.021 -44.983 1.00 63.79  ? 79  LYS B CE  1 
ATOM   1777 N NZ  . LYS C 1 81  ? 12.318  -11.052 -44.100 1.00 63.12  ? 79  LYS B NZ  1 
ATOM   1778 N N   . ARG C 1 82  ? 15.370  -7.664  -39.762 1.00 40.16  ? 80  ARG B N   1 
ATOM   1779 C CA  . ARG C 1 82  ? 15.406  -8.514  -38.574 1.00 41.82  ? 80  ARG B CA  1 
ATOM   1780 C C   . ARG C 1 82  ? 14.525  -7.973  -37.449 1.00 38.31  ? 80  ARG B C   1 
ATOM   1781 O O   . ARG C 1 82  ? 13.712  -8.704  -36.884 1.00 38.07  ? 80  ARG B O   1 
ATOM   1782 C CB  . ARG C 1 82  ? 16.840  -8.742  -38.092 1.00 44.47  ? 80  ARG B CB  1 
ATOM   1783 C CG  . ARG C 1 82  ? 17.652  -9.666  -38.997 1.00 52.32  ? 80  ARG B CG  1 
ATOM   1784 C CD  . ARG C 1 82  ? 18.915  -10.160 -38.314 1.00 62.24  ? 80  ARG B CD  1 
ATOM   1785 N NE  . ARG C 1 82  ? 19.832  -9.066  -38.002 1.00 69.03  ? 80  ARG B NE  1 
ATOM   1786 C CZ  . ARG C 1 82  ? 20.607  -9.023  -36.921 1.00 74.17  ? 80  ARG B CZ  1 
ATOM   1787 N NH1 . ARG C 1 82  ? 20.590  -10.022 -36.047 1.00 77.45  ? 80  ARG B NH1 1 
ATOM   1788 N NH2 . ARG C 1 82  ? 21.414  -7.988  -36.718 1.00 74.28  ? 80  ARG B NH2 1 
ATOM   1789 N N   . PHE C 1 83  ? 14.641  -6.680  -37.162 1.00 37.30  ? 81  PHE B N   1 
ATOM   1790 C CA  . PHE C 1 83  ? 13.794  -6.079  -36.142 1.00 33.94  ? 81  PHE B CA  1 
ATOM   1791 C C   . PHE C 1 83  ? 12.308  -6.078  -36.507 1.00 31.79  ? 81  PHE B C   1 
ATOM   1792 O O   . PHE C 1 83  ? 11.452  -6.313  -35.641 1.00 31.76  ? 81  PHE B O   1 
ATOM   1793 C CB  . PHE C 1 83  ? 14.261  -4.671  -35.770 1.00 33.59  ? 81  PHE B CB  1 
ATOM   1794 C CG  . PHE C 1 83  ? 13.551  -4.099  -34.571 1.00 30.30  ? 81  PHE B CG  1 
ATOM   1795 C CD1 . PHE C 1 83  ? 13.738  -4.648  -33.310 1.00 31.98  ? 81  PHE B CD1 1 
ATOM   1796 C CD2 . PHE C 1 83  ? 12.654  -3.051  -34.714 1.00 32.34  ? 81  PHE B CD2 1 
ATOM   1797 C CE1 . PHE C 1 83  ? 13.077  -4.137  -32.208 1.00 30.18  ? 81  PHE B CE1 1 
ATOM   1798 C CE2 . PHE C 1 83  ? 11.995  -2.524  -33.609 1.00 29.68  ? 81  PHE B CE2 1 
ATOM   1799 C CZ  . PHE C 1 83  ? 12.207  -3.063  -32.361 1.00 29.84  ? 81  PHE B CZ  1 
ATOM   1800 N N   . HIS C 1 84  ? 11.998  -5.733  -37.756 1.00 30.54  ? 82  HIS B N   1 
ATOM   1801 C CA  . HIS C 1 84  ? 10.619  -5.786  -38.249 1.00 29.70  ? 82  HIS B CA  1 
ATOM   1802 C C   . HIS C 1 84  ? 10.040  -7.184  -38.035 1.00 30.91  ? 82  HIS B C   1 
ATOM   1803 O O   . HIS C 1 84  ? 8.908   -7.340  -37.560 1.00 29.24  ? 82  HIS B O   1 
ATOM   1804 C CB  . HIS C 1 84  ? 10.555  -5.409  -39.745 1.00 31.51  ? 82  HIS B CB  1 
ATOM   1805 C CG  . HIS C 1 84  ? 10.783  -3.952  -40.017 1.00 27.60  ? 82  HIS B CG  1 
ATOM   1806 N ND1 . HIS C 1 84  ? 11.149  -3.475  -41.256 1.00 27.96  ? 82  HIS B ND1 1 
ATOM   1807 C CD2 . HIS C 1 84  ? 10.719  -2.872  -39.204 1.00 24.16  ? 82  HIS B CD2 1 
ATOM   1808 C CE1 . HIS C 1 84  ? 11.296  -2.163  -41.198 1.00 32.10  ? 82  HIS B CE1 1 
ATOM   1809 N NE2 . HIS C 1 84  ? 11.029  -1.771  -39.964 1.00 26.53  ? 82  HIS B NE2 1 
ATOM   1810 N N   . ASP C 1 85  ? 10.854  -8.197  -38.330 1.00 31.85  ? 83  ASP B N   1 
ATOM   1811 C CA  . ASP C 1 85  ? 10.450  -9.597  -38.184 1.00 34.39  ? 83  ASP B CA  1 
ATOM   1812 C C   . ASP C 1 85  ? 10.198  -9.965  -36.718 1.00 35.08  ? 83  ASP B C   1 
ATOM   1813 O O   . ASP C 1 85  ? 9.280   -10.722 -36.417 1.00 34.70  ? 83  ASP B O   1 
ATOM   1814 C CB  . ASP C 1 85  ? 11.520  -10.532 -38.763 1.00 36.54  ? 83  ASP B CB  1 
ATOM   1815 C CG  . ASP C 1 85  ? 11.519  -10.566 -40.277 1.00 39.57  ? 83  ASP B CG  1 
ATOM   1816 O OD1 . ASP C 1 85  ? 12.382  -11.258 -40.853 1.00 45.49  ? 83  ASP B OD1 1 
ATOM   1817 O OD2 . ASP C 1 85  ? 10.654  -9.927  -40.892 1.00 39.32  ? 83  ASP B OD2 1 
ATOM   1818 N N   . GLU C 1 86  ? 11.060  -9.491  -35.818 1.00 38.28  ? 84  GLU B N   1 
ATOM   1819 C CA  . GLU C 1 86  ? 10.954  -9.850  -34.403 1.00 38.49  ? 84  GLU B CA  1 
ATOM   1820 C C   . GLU C 1 86  ? 9.719   -9.227  -33.777 1.00 36.48  ? 84  GLU B C   1 
ATOM   1821 O O   . GLU C 1 86  ? 9.068   -9.847  -32.939 1.00 37.13  ? 84  GLU B O   1 
ATOM   1822 C CB  . GLU C 1 86  ? 12.200  -9.421  -33.630 1.00 37.80  ? 84  GLU B CB  1 
ATOM   1823 C CG  . GLU C 1 86  ? 13.385  -10.323 -33.856 1.00 43.70  ? 84  GLU B CG  1 
ATOM   1824 C CD  . GLU C 1 86  ? 13.112  -11.742 -33.407 1.00 41.51  ? 84  GLU B CD  1 
ATOM   1825 O OE1 . GLU C 1 86  ? 12.444  -11.910 -32.363 1.00 39.21  ? 84  GLU B OE1 1 
ATOM   1826 O OE2 . GLU C 1 86  ? 13.543  -12.681 -34.107 1.00 50.51  ? 84  GLU B OE2 1 
ATOM   1827 N N   . VAL C 1 87  ? 9.422   -7.989  -34.169 1.00 33.83  ? 85  VAL B N   1 
ATOM   1828 C CA  . VAL C 1 87  ? 8.226   -7.290  -33.704 1.00 32.16  ? 85  VAL B CA  1 
ATOM   1829 C C   . VAL C 1 87  ? 6.959   -7.917  -34.295 1.00 33.37  ? 85  VAL B C   1 
ATOM   1830 O O   . VAL C 1 87  ? 5.900   -7.900  -33.657 1.00 31.90  ? 85  VAL B O   1 
ATOM   1831 C CB  . VAL C 1 87  ? 8.293   -5.778  -34.032 1.00 30.88  ? 85  VAL B CB  1 
ATOM   1832 C CG1 . VAL C 1 87  ? 6.913   -5.113  -33.912 1.00 29.56  ? 85  VAL B CG1 1 
ATOM   1833 C CG2 . VAL C 1 87  ? 9.301   -5.089  -33.107 1.00 28.68  ? 85  VAL B CG2 1 
ATOM   1834 N N   . GLY C 1 88  ? 7.099   -8.538  -35.470 1.00 30.78  ? 86  GLY B N   1 
ATOM   1835 C CA  . GLY C 1 88  ? 5.983   -9.210  -36.126 1.00 32.42  ? 86  GLY B CA  1 
ATOM   1836 C C   . GLY C 1 88  ? 5.824   -10.675 -35.746 1.00 33.81  ? 86  GLY B C   1 
ATOM   1837 O O   . GLY C 1 88  ? 5.287   -11.468 -36.525 1.00 37.54  ? 86  GLY B O   1 
ATOM   1838 N N   . LYS C 1 89  ? 6.280   -11.035 -34.545 1.00 34.82  ? 87  LYS B N   1 
ATOM   1839 C CA  . LYS C 1 89  ? 6.010   -12.354 -33.959 1.00 35.10  ? 87  LYS B CA  1 
ATOM   1840 C C   . LYS C 1 89  ? 5.059   -12.185 -32.783 1.00 34.28  ? 87  LYS B C   1 
ATOM   1841 O O   . LYS C 1 89  ? 5.099   -11.168 -32.089 1.00 31.40  ? 87  LYS B O   1 
ATOM   1842 C CB  . LYS C 1 89  ? 7.308   -13.001 -33.470 1.00 34.67  ? 87  LYS B CB  1 
ATOM   1843 C CG  . LYS C 1 89  ? 8.299   -13.308 -34.585 1.00 39.33  ? 87  LYS B CG  1 
ATOM   1844 C CD  . LYS C 1 89  ? 9.586   -13.896 -34.050 1.00 41.08  ? 87  LYS B CD  1 
ATOM   1845 C CE  . LYS C 1 89  ? 10.398  -14.528 -35.172 1.00 47.96  ? 87  LYS B CE  1 
ATOM   1846 N NZ  . LYS C 1 89  ? 11.746  -14.919 -34.669 1.00 55.36  ? 87  LYS B NZ  1 
ATOM   1847 N N   . PHE C 1 90  ? 4.200   -13.173 -32.559 1.00 33.99  ? 88  PHE B N   1 
ATOM   1848 C CA  . PHE C 1 90  ? 3.303   -13.143 -31.407 1.00 35.36  ? 88  PHE B CA  1 
ATOM   1849 C C   . PHE C 1 90  ? 4.057   -13.082 -30.088 1.00 33.45  ? 88  PHE B C   1 
ATOM   1850 O O   . PHE C 1 90  ? 3.531   -12.596 -29.096 1.00 34.18  ? 88  PHE B O   1 
ATOM   1851 C CB  . PHE C 1 90  ? 2.346   -14.336 -31.431 1.00 37.85  ? 88  PHE B CB  1 
ATOM   1852 C CG  . PHE C 1 90  ? 1.449   -14.340 -32.618 1.00 40.93  ? 88  PHE B CG  1 
ATOM   1853 C CD1 . PHE C 1 90  ? 0.745   -13.197 -32.962 1.00 37.54  ? 88  PHE B CD1 1 
ATOM   1854 C CD2 . PHE C 1 90  ? 1.408   -15.433 -33.472 1.00 42.68  ? 88  PHE B CD2 1 
ATOM   1855 C CE1 . PHE C 1 90  ? -0.075  -13.183 -34.082 1.00 45.21  ? 88  PHE B CE1 1 
ATOM   1856 C CE2 . PHE C 1 90  ? 0.601   -15.423 -34.597 1.00 46.14  ? 88  PHE B CE2 1 
ATOM   1857 C CZ  . PHE C 1 90  ? -0.124  -14.287 -34.917 1.00 41.84  ? 88  PHE B CZ  1 
ATOM   1858 N N   . ARG C 1 91  ? 5.294   -13.567 -30.091 1.00 40.89  ? 89  ARG B N   1 
ATOM   1859 C CA  . ARG C 1 91  ? 6.158   -13.498 -28.917 1.00 40.29  ? 89  ARG B CA  1 
ATOM   1860 C C   . ARG C 1 91  ? 6.274   -12.055 -28.406 1.00 36.93  ? 89  ARG B C   1 
ATOM   1861 O O   . ARG C 1 91  ? 6.304   -11.808 -27.198 1.00 35.12  ? 89  ARG B O   1 
ATOM   1862 C CB  . ARG C 1 91  ? 7.547   -14.047 -29.246 1.00 41.37  ? 89  ARG B CB  1 
ATOM   1863 C CG  . ARG C 1 91  ? 8.381   -14.335 -28.009 1.00 44.44  ? 89  ARG B CG  1 
ATOM   1864 C CD  . ARG C 1 91  ? 9.730   -14.912 -28.382 1.00 52.96  ? 89  ARG B CD  1 
ATOM   1865 N NE  . ARG C 1 91  ? 9.625   -16.299 -28.826 1.00 57.99  ? 89  ARG B NE  1 
ATOM   1866 C CZ  . ARG C 1 91  ? 9.894   -16.708 -30.061 1.00 61.75  ? 89  ARG B CZ  1 
ATOM   1867 N NH1 . ARG C 1 91  ? 10.286  -15.836 -30.986 1.00 62.40  ? 89  ARG B NH1 1 
ATOM   1868 N NH2 . ARG C 1 91  ? 9.777   -17.989 -30.369 1.00 64.38  ? 89  ARG B NH2 1 
ATOM   1869 N N   . PHE C 1 92  ? 6.349   -11.114 -29.337 1.00 31.07  ? 90  PHE B N   1 
ATOM   1870 C CA  . PHE C 1 92  ? 6.311   -9.700  -28.992 1.00 30.31  ? 90  PHE B CA  1 
ATOM   1871 C C   . PHE C 1 92  ? 4.889   -9.130  -29.028 1.00 30.78  ? 90  PHE B C   1 
ATOM   1872 O O   . PHE C 1 92  ? 4.473   -8.441  -28.101 1.00 31.88  ? 90  PHE B O   1 
ATOM   1873 C CB  . PHE C 1 92  ? 7.220   -8.887  -29.917 1.00 28.19  ? 90  PHE B CB  1 
ATOM   1874 C CG  . PHE C 1 92  ? 7.229   -7.423  -29.610 1.00 26.86  ? 90  PHE B CG  1 
ATOM   1875 C CD1 . PHE C 1 92  ? 7.812   -6.951  -28.435 1.00 22.79  ? 90  PHE B CD1 1 
ATOM   1876 C CD2 . PHE C 1 92  ? 6.552   -6.534  -30.427 1.00 24.83  ? 90  PHE B CD2 1 
ATOM   1877 C CE1 . PHE C 1 92  ? 7.820   -5.607  -28.149 1.00 22.54  ? 90  PHE B CE1 1 
ATOM   1878 C CE2 . PHE C 1 92  ? 6.515   -5.186  -30.126 1.00 25.55  ? 90  PHE B CE2 1 
ATOM   1879 C CZ  . PHE C 1 92  ? 7.138   -4.722  -28.969 1.00 25.01  ? 90  PHE B CZ  1 
ATOM   1880 N N   . LEU C 1 93  ? 4.173   -9.376  -30.121 1.00 27.37  ? 91  LEU B N   1 
ATOM   1881 C CA  . LEU C 1 93  ? 2.817   -8.845  -30.303 1.00 30.48  ? 91  LEU B CA  1 
ATOM   1882 C C   . LEU C 1 93  ? 1.927   -9.161  -29.100 1.00 32.61  ? 91  LEU B C   1 
ATOM   1883 O O   . LEU C 1 93  ? 1.012   -8.393  -28.769 1.00 34.71  ? 91  LEU B O   1 
ATOM   1884 C CB  . LEU C 1 93  ? 2.183   -9.463  -31.551 1.00 32.72  ? 91  LEU B CB  1 
ATOM   1885 C CG  . LEU C 1 93  ? 2.004   -8.740  -32.890 1.00 37.12  ? 91  LEU B CG  1 
ATOM   1886 C CD1 . LEU C 1 93  ? 2.692   -7.371  -32.989 1.00 29.25  ? 91  LEU B CD1 1 
ATOM   1887 C CD2 . LEU C 1 93  ? 2.391   -9.665  -34.028 1.00 32.13  ? 91  LEU B CD2 1 
ATOM   1888 N N   . ASN C 1 94  ? 2.140   -10.337 -28.508 1.00 35.08  ? 92  ASN B N   1 
ATOM   1889 C CA  . ASN C 1 94  ? 1.369   -10.771 -27.348 1.00 37.83  ? 92  ASN B CA  1 
ATOM   1890 C C   . ASN C 1 94  ? 1.536   -9.834  -26.162 1.00 37.41  ? 92  ASN B C   1 
ATOM   1891 O O   . ASN C 1 94  ? 0.652   -9.721  -25.311 1.00 41.47  ? 92  ASN B O   1 
ATOM   1892 C CB  . ASN C 1 94  ? 1.759   -12.192 -26.947 1.00 38.09  ? 92  ASN B CB  1 
ATOM   1893 C CG  . ASN C 1 94  ? 1.046   -13.240 -27.772 1.00 40.95  ? 92  ASN B CG  1 
ATOM   1894 O OD1 . ASN C 1 94  ? 0.262   -12.909 -28.660 1.00 39.72  ? 92  ASN B OD1 1 
ATOM   1895 N ND2 . ASN C 1 94  ? 1.330   -14.510 -27.502 1.00 38.95  ? 92  ASN B ND2 1 
ATOM   1896 N N   . GLU C 1 95  ? 2.690   -9.185  -26.099 1.00 36.51  ? 93  GLU B N   1 
ATOM   1897 C CA  . GLU C 1 95  ? 3.031   -8.345  -24.965 1.00 34.96  ? 93  GLU B CA  1 
ATOM   1898 C C   . GLU C 1 95  ? 2.370   -6.979  -25.143 1.00 34.39  ? 93  GLU B C   1 
ATOM   1899 O O   . GLU C 1 95  ? 1.992   -6.330  -24.173 1.00 34.02  ? 93  GLU B O   1 
ATOM   1900 C CB  . GLU C 1 95  ? 4.558   -8.197  -24.854 1.00 31.89  ? 93  GLU B CB  1 
ATOM   1901 C CG  . GLU C 1 95  ? 5.303   -9.513  -24.774 1.00 33.18  ? 93  GLU B CG  1 
ATOM   1902 C CD  . GLU C 1 95  ? 5.043   -10.263 -23.472 1.00 38.81  ? 93  GLU B CD  1 
ATOM   1903 O OE1 . GLU C 1 95  ? 4.999   -11.511 -23.501 1.00 42.36  ? 93  GLU B OE1 1 
ATOM   1904 O OE2 . GLU C 1 95  ? 4.850   -9.605  -22.425 1.00 37.12  ? 93  GLU B OE2 1 
ATOM   1905 N N   . LEU C 1 96  ? 2.213   -6.566  -26.396 1.00 31.13  ? 94  LEU B N   1 
ATOM   1906 C CA  . LEU C 1 96  ? 1.423   -5.396  -26.716 1.00 29.78  ? 94  LEU B CA  1 
ATOM   1907 C C   . LEU C 1 96  ? -0.048  -5.644  -26.446 1.00 32.45  ? 94  LEU B C   1 
ATOM   1908 O O   . LEU C 1 96  ? -0.724  -4.794  -25.887 1.00 32.29  ? 94  LEU B O   1 
ATOM   1909 C CB  . LEU C 1 96  ? 1.631   -4.972  -28.174 1.00 28.94  ? 94  LEU B CB  1 
ATOM   1910 C CG  . LEU C 1 96  ? 3.036   -4.569  -28.598 1.00 26.33  ? 94  LEU B CG  1 
ATOM   1911 C CD1 . LEU C 1 96  ? 2.994   -4.055  -30.029 1.00 25.38  ? 94  LEU B CD1 1 
ATOM   1912 C CD2 . LEU C 1 96  ? 3.608   -3.499  -27.667 1.00 27.73  ? 94  LEU B CD2 1 
ATOM   1913 N N   . ILE C 1 97  ? -0.528  -6.831  -26.803 1.00 32.26  ? 95  ILE B N   1 
ATOM   1914 C CA  . ILE C 1 97  ? -1.925  -7.188  -26.576 1.00 36.00  ? 95  ILE B CA  1 
ATOM   1915 C C   . ILE C 1 97  ? -2.292  -7.156  -25.093 1.00 35.95  ? 95  ILE B C   1 
ATOM   1916 O O   . ILE C 1 97  ? -3.346  -6.650  -24.725 1.00 36.42  ? 95  ILE B O   1 
ATOM   1917 C CB  . ILE C 1 97  ? -2.271  -8.570  -27.185 1.00 40.04  ? 95  ILE B CB  1 
ATOM   1918 C CG1 . ILE C 1 97  ? -2.256  -8.484  -28.713 1.00 40.40  ? 95  ILE B CG1 1 
ATOM   1919 C CG2 . ILE C 1 97  ? -3.615  -9.073  -26.662 1.00 44.29  ? 95  ILE B CG2 1 
ATOM   1920 C CD1 . ILE C 1 97  ? -2.112  -9.817  -29.429 1.00 44.72  ? 95  ILE B CD1 1 
ATOM   1921 N N   . LYS C 1 98  ? -1.402  -7.655  -24.241 1.00 40.85  ? 96  LYS B N   1 
ATOM   1922 C CA  . LYS C 1 98  ? -1.623  -7.596  -22.794 1.00 41.44  ? 96  LYS B CA  1 
ATOM   1923 C C   . LYS C 1 98  ? -1.859  -6.162  -22.323 1.00 37.90  ? 96  LYS B C   1 
ATOM   1924 O O   . LYS C 1 98  ? -2.713  -5.915  -21.484 1.00 38.61  ? 96  LYS B O   1 
ATOM   1925 C CB  . LYS C 1 98  ? -0.445  -8.203  -22.032 1.00 41.59  ? 96  LYS B CB  1 
ATOM   1926 C CG  . LYS C 1 98  ? -0.177  -9.673  -22.332 1.00 47.89  ? 96  LYS B CG  1 
ATOM   1927 C CD  . LYS C 1 98  ? 1.157   -10.112 -21.735 1.00 48.50  ? 96  LYS B CD  1 
ATOM   1928 C CE  . LYS C 1 98  ? 1.255   -11.622 -21.606 1.00 52.12  ? 96  LYS B CE  1 
ATOM   1929 N NZ  . LYS C 1 98  ? 2.656   -12.051 -21.327 1.00 50.27  ? 96  LYS B NZ  1 
ATOM   1930 N N   . VAL C 1 99  ? -1.069  -5.225  -22.827 1.00 36.48  ? 97  VAL B N   1 
ATOM   1931 C CA  . VAL C 1 99  ? -1.215  -3.826  -22.430 1.00 35.06  ? 97  VAL B CA  1 
ATOM   1932 C C   . VAL C 1 99  ? -2.599  -3.227  -22.751 1.00 36.85  ? 97  VAL B C   1 
ATOM   1933 O O   . VAL C 1 99  ? -3.172  -2.510  -21.931 1.00 36.91  ? 97  VAL B O   1 
ATOM   1934 C CB  . VAL C 1 99  ? -0.103  -2.938  -23.027 1.00 33.05  ? 97  VAL B CB  1 
ATOM   1935 C CG1 . VAL C 1 99  ? -0.331  -1.485  -22.638 1.00 31.47  ? 97  VAL B CG1 1 
ATOM   1936 C CG2 . VAL C 1 99  ? 1.261   -3.403  -22.536 1.00 29.35  ? 97  VAL B CG2 1 
ATOM   1937 N N   . VAL C 1 100 ? -3.134  -3.530  -23.933 1.00 37.54  ? 98  VAL B N   1 
ATOM   1938 C CA  . VAL C 1 100 ? -4.359  -2.890  -24.401 1.00 38.60  ? 98  VAL B CA  1 
ATOM   1939 C C   . VAL C 1 100 ? -5.637  -3.637  -24.006 1.00 43.07  ? 98  VAL B C   1 
ATOM   1940 O O   . VAL C 1 100 ? -6.720  -3.050  -23.967 1.00 44.27  ? 98  VAL B O   1 
ATOM   1941 C CB  . VAL C 1 100 ? -4.344  -2.663  -25.921 1.00 38.97  ? 98  VAL B CB  1 
ATOM   1942 C CG1 . VAL C 1 100 ? -3.255  -1.673  -26.296 1.00 35.99  ? 98  VAL B CG1 1 
ATOM   1943 C CG2 . VAL C 1 100 ? -4.170  -3.983  -26.660 1.00 38.92  ? 98  VAL B CG2 1 
ATOM   1944 N N   . SER C 1 101 ? -5.498  -4.912  -23.658 1.00 46.49  ? 99  SER B N   1 
ATOM   1945 C CA  . SER C 1 101 ? -6.650  -5.778  -23.475 1.00 51.08  ? 99  SER B CA  1 
ATOM   1946 C C   . SER C 1 101 ? -7.125  -5.746  -22.019 1.00 52.73  ? 99  SER B C   1 
ATOM   1947 O O   . SER C 1 101 ? -6.323  -5.922  -21.106 1.00 51.89  ? 99  SER B O   1 
ATOM   1948 C CB  . SER C 1 101 ? -6.305  -7.210  -23.907 1.00 54.39  ? 99  SER B CB  1 
ATOM   1949 O OG  . SER C 1 101 ? -7.327  -8.129  -23.539 1.00 60.01  ? 99  SER B OG  1 
ATOM   1950 N N   . PRO C 1 102 ? -8.438  -5.521  -21.803 1.00 54.05  ? 100 PRO B N   1 
ATOM   1951 C CA  . PRO C 1 102 ? -9.031  -5.489  -20.462 1.00 56.81  ? 100 PRO B CA  1 
ATOM   1952 C C   . PRO C 1 102 ? -8.901  -6.829  -19.735 1.00 59.65  ? 100 PRO B C   1 
ATOM   1953 O O   . PRO C 1 102 ? -8.875  -6.862  -18.499 1.00 60.23  ? 100 PRO B O   1 
ATOM   1954 C CB  . PRO C 1 102 ? -10.515 -5.191  -20.737 1.00 59.27  ? 100 PRO B CB  1 
ATOM   1955 C CG  . PRO C 1 102 ? -10.549 -4.604  -22.098 1.00 58.92  ? 100 PRO B CG  1 
ATOM   1956 C CD  . PRO C 1 102 ? -9.449  -5.287  -22.848 1.00 55.47  ? 100 PRO B CD  1 
ATOM   1957 N N   . LYS C 1 103 ? -8.817  -7.913  -20.505 1.00 57.19  ? 101 LYS B N   1 
ATOM   1958 C CA  . LYS C 1 103 ? -8.581  -9.254  -19.967 1.00 61.26  ? 101 LYS B CA  1 
ATOM   1959 C C   . LYS C 1 103 ? -7.267  -9.352  -19.196 1.00 58.89  ? 101 LYS B C   1 
ATOM   1960 O O   . LYS C 1 103 ? -7.107  -10.224 -18.340 1.00 61.87  ? 101 LYS B O   1 
ATOM   1961 C CB  . LYS C 1 103 ? -8.587  -10.290 -21.094 1.00 64.43  ? 101 LYS B CB  1 
ATOM   1962 C CG  . LYS C 1 103 ? -9.956  -10.561 -21.692 1.00 70.26  ? 101 LYS B CG  1 
ATOM   1963 C CD  . LYS C 1 103 ? -9.846  -10.992 -23.155 1.00 75.51  ? 101 LYS B CD  1 
ATOM   1964 C CE  . LYS C 1 103 ? -10.367 -12.424 -23.354 1.00 83.93  ? 101 LYS B CE  1 
ATOM   1965 N NZ  . LYS C 1 103 ? -10.938 -12.575 -24.776 1.00 84.65  ? 101 LYS B NZ  1 
ATOM   1966 N N   . TYR C 1 104 ? -6.327  -8.468  -19.521 1.00 49.95  ? 102 TYR B N   1 
ATOM   1967 C CA  . TYR C 1 104 ? -4.961  -8.559  -19.012 1.00 47.51  ? 102 TYR B CA  1 
ATOM   1968 C C   . TYR C 1 104 ? -4.563  -7.278  -18.276 1.00 43.71  ? 102 TYR B C   1 
ATOM   1969 O O   . TYR C 1 104 ? -4.997  -7.054  -17.152 1.00 43.30  ? 102 TYR B O   1 
ATOM   1970 C CB  . TYR C 1 104 ? -3.975  -8.886  -20.148 1.00 46.49  ? 102 TYR B CB  1 
ATOM   1971 C CG  . TYR C 1 104 ? -4.383  -10.095 -20.964 1.00 50.98  ? 102 TYR B CG  1 
ATOM   1972 C CD1 . TYR C 1 104 ? -4.826  -9.956  -22.271 1.00 50.94  ? 102 TYR B CD1 1 
ATOM   1973 C CD2 . TYR C 1 104 ? -4.415  -11.365 -20.393 1.00 59.33  ? 102 TYR B CD2 1 
ATOM   1974 C CE1 . TYR C 1 104 ? -5.270  -11.052 -23.001 1.00 56.87  ? 102 TYR B CE1 1 
ATOM   1975 C CE2 . TYR C 1 104 ? -4.850  -12.470 -21.119 1.00 64.79  ? 102 TYR B CE2 1 
ATOM   1976 C CZ  . TYR C 1 104 ? -5.269  -12.308 -22.426 1.00 63.54  ? 102 TYR B CZ  1 
ATOM   1977 O OH  . TYR C 1 104 ? -5.733  -13.397 -23.144 1.00 65.79  ? 102 TYR B OH  1 
ATOM   1978 N N   . LEU C 1 105 ? -3.793  -6.410  -18.927 1.00 46.83  ? 103 LEU B N   1 
ATOM   1979 C CA  . LEU C 1 105 ? -3.329  -5.185  -18.268 1.00 44.93  ? 103 LEU B CA  1 
ATOM   1980 C C   . LEU C 1 105 ? -4.162  -3.944  -18.572 1.00 44.41  ? 103 LEU B C   1 
ATOM   1981 O O   . LEU C 1 105 ? -3.889  -2.876  -18.036 1.00 44.39  ? 103 LEU B O   1 
ATOM   1982 C CB  . LEU C 1 105 ? -1.856  -4.901  -18.575 1.00 40.77  ? 103 LEU B CB  1 
ATOM   1983 C CG  . LEU C 1 105 ? -0.801  -5.941  -18.185 1.00 43.25  ? 103 LEU B CG  1 
ATOM   1984 C CD1 . LEU C 1 105 ? 0.536   -5.632  -18.882 1.00 38.40  ? 103 LEU B CD1 1 
ATOM   1985 C CD2 . LEU C 1 105 ? -0.607  -5.992  -16.673 1.00 40.30  ? 103 LEU B CD2 1 
ATOM   1986 N N   . GLY C 1 106 ? -5.159  -4.073  -19.442 1.00 49.85  ? 104 GLY B N   1 
ATOM   1987 C CA  . GLY C 1 106 ? -5.816  -2.908  -20.035 1.00 50.23  ? 104 GLY B CA  1 
ATOM   1988 C C   . GLY C 1 106 ? -6.441  -1.944  -19.037 1.00 52.70  ? 104 GLY B C   1 
ATOM   1989 O O   . GLY C 1 106 ? -6.462  -0.737  -19.256 1.00 52.77  ? 104 GLY B O   1 
ATOM   1990 N N   . SER C 1 107 ? -6.934  -2.467  -17.923 1.00 57.01  ? 105 SER B N   1 
ATOM   1991 C CA  . SER C 1 107 ? -7.785  -1.673  -17.049 1.00 60.91  ? 105 SER B CA  1 
ATOM   1992 C C   . SER C 1 107 ? -6.985  -0.853  -16.044 1.00 60.72  ? 105 SER B C   1 
ATOM   1993 O O   . SER C 1 107 ? -7.542  -0.039  -15.302 1.00 62.50  ? 105 SER B O   1 
ATOM   1994 C CB  . SER C 1 107 ? -8.802  -2.567  -16.345 1.00 64.66  ? 105 SER B CB  1 
ATOM   1995 O OG  . SER C 1 107 ? -9.724  -3.086  -17.292 1.00 70.34  ? 105 SER B OG  1 
ATOM   1996 N N   . ARG C 1 108 ? -5.672  -1.057  -16.039 1.00 59.87  ? 106 ARG B N   1 
ATOM   1997 C CA  . ARG C 1 108 ? -4.786  -0.280  -15.184 1.00 60.22  ? 106 ARG B CA  1 
ATOM   1998 C C   . ARG C 1 108 ? -3.680  0.348   -16.016 1.00 56.89  ? 106 ARG B C   1 
ATOM   1999 O O   . ARG C 1 108 ? -2.591  0.628   -15.516 1.00 57.21  ? 106 ARG B O   1 
ATOM   2000 C CB  . ARG C 1 108 ? -4.201  -1.156  -14.072 1.00 61.56  ? 106 ARG B CB  1 
ATOM   2001 C CG  . ARG C 1 108 ? -3.338  -2.321  -14.557 1.00 61.92  ? 106 ARG B CG  1 
ATOM   2002 C CD  . ARG C 1 108 ? -2.840  -3.155  -13.374 1.00 69.42  ? 106 ARG B CD  1 
ATOM   2003 N NE  . ARG C 1 108 ? -2.652  -4.564  -13.721 1.00 73.81  ? 106 ARG B NE  1 
ATOM   2004 C CZ  . ARG C 1 108 ? -3.643  -5.433  -13.923 1.00 78.35  ? 106 ARG B CZ  1 
ATOM   2005 N NH1 . ARG C 1 108 ? -4.912  -5.043  -13.826 1.00 81.76  ? 106 ARG B NH1 1 
ATOM   2006 N NH2 . ARG C 1 108 ? -3.366  -6.696  -14.228 1.00 78.97  ? 106 ARG B NH2 1 
ATOM   2007 N N   . THR C 1 109 ? -3.940  0.480   -17.312 1.00 47.25  ? 107 THR B N   1 
ATOM   2008 C CA  . THR C 1 109 ? -3.039  1.175   -18.225 1.00 43.49  ? 107 THR B CA  1 
ATOM   2009 C C   . THR C 1 109 ? -3.725  2.442   -18.716 1.00 45.19  ? 107 THR B C   1 
ATOM   2010 O O   . THR C 1 109 ? -4.911  2.424   -19.025 1.00 45.57  ? 107 THR B O   1 
ATOM   2011 C CB  . THR C 1 109 ? -2.697  0.295   -19.442 1.00 41.26  ? 107 THR B CB  1 
ATOM   2012 O OG1 . THR C 1 109 ? -2.240  -0.984  -18.993 1.00 42.07  ? 107 THR B OG1 1 
ATOM   2013 C CG2 . THR C 1 109 ? -1.615  0.943   -20.293 1.00 37.90  ? 107 THR B CG2 1 
ATOM   2014 N N   . SER C 1 110 ? -2.972  3.531   -18.827 1.00 43.20  ? 108 SER B N   1 
ATOM   2015 C CA  . SER C 1 110 ? -3.539  4.790   -19.284 1.00 46.76  ? 108 SER B CA  1 
ATOM   2016 C C   . SER C 1 110 ? -4.023  4.697   -20.730 1.00 46.65  ? 108 SER B C   1 
ATOM   2017 O O   . SER C 1 110 ? -3.578  3.843   -21.501 1.00 42.15  ? 108 SER B O   1 
ATOM   2018 C CB  . SER C 1 110 ? -2.518  5.913   -19.161 1.00 48.37  ? 108 SER B CB  1 
ATOM   2019 O OG  . SER C 1 110 ? -1.526  5.775   -20.161 1.00 45.87  ? 108 SER B OG  1 
ATOM   2020 N N   . GLU C 1 111 ? -4.918  5.608   -21.096 1.00 51.76  ? 109 GLU B N   1 
ATOM   2021 C CA  . GLU C 1 111 ? -5.450  5.641   -22.440 1.00 52.82  ? 109 GLU B CA  1 
ATOM   2022 C C   . GLU C 1 111 ? -4.393  6.137   -23.419 1.00 51.25  ? 109 GLU B C   1 
ATOM   2023 O O   . GLU C 1 111 ? -4.370  5.733   -24.586 1.00 49.52  ? 109 GLU B O   1 
ATOM   2024 C CB  . GLU C 1 111 ? -6.696  6.524   -22.493 1.00 57.81  ? 109 GLU B CB  1 
ATOM   2025 C CG  . GLU C 1 111 ? -7.785  5.973   -23.402 1.00 63.91  ? 109 GLU B CG  1 
ATOM   2026 C CD  . GLU C 1 111 ? -8.551  4.807   -22.786 1.00 67.37  ? 109 GLU B CD  1 
ATOM   2027 O OE1 . GLU C 1 111 ? -8.444  4.590   -21.557 1.00 66.58  ? 109 GLU B OE1 1 
ATOM   2028 O OE2 . GLU C 1 111 ? -9.276  4.117   -23.537 1.00 68.66  ? 109 GLU B OE2 1 
ATOM   2029 N N   . LYS C 1 112 ? -3.507  7.001   -22.930 1.00 51.99  ? 110 LYS B N   1 
ATOM   2030 C CA  . LYS C 1 112 ? -2.371  7.473   -23.711 1.00 51.57  ? 110 LYS B CA  1 
ATOM   2031 C C   . LYS C 1 112 ? -1.496  6.325   -24.212 1.00 45.44  ? 110 LYS B C   1 
ATOM   2032 O O   . LYS C 1 112 ? -1.223  6.232   -25.405 1.00 44.53  ? 110 LYS B O   1 
ATOM   2033 C CB  . LYS C 1 112 ? -1.539  8.485   -22.913 1.00 56.21  ? 110 LYS B CB  1 
ATOM   2034 C CG  . LYS C 1 112 ? -0.610  9.340   -23.779 1.00 58.31  ? 110 LYS B CG  1 
ATOM   2035 C CD  . LYS C 1 112 ? 0.267   10.272  -22.942 1.00 63.18  ? 110 LYS B CD  1 
ATOM   2036 C CE  . LYS C 1 112 ? 1.343   10.936  -23.806 1.00 62.77  ? 110 LYS B CE  1 
ATOM   2037 N NZ  . LYS C 1 112 ? 2.319   11.752  -23.014 1.00 64.37  ? 110 LYS B NZ  1 
ATOM   2038 N N   . VAL C 1 113 ? -1.084  5.441   -23.305 1.00 42.54  ? 111 VAL B N   1 
ATOM   2039 C CA  . VAL C 1 113 ? -0.274  4.276   -23.669 1.00 37.10  ? 111 VAL B CA  1 
ATOM   2040 C C   . VAL C 1 113 ? -1.026  3.331   -24.614 1.00 36.29  ? 111 VAL B C   1 
ATOM   2041 O O   . VAL C 1 113 ? -0.490  2.898   -25.633 1.00 35.06  ? 111 VAL B O   1 
ATOM   2042 C CB  . VAL C 1 113 ? 0.175   3.488   -22.415 1.00 35.92  ? 111 VAL B CB  1 
ATOM   2043 C CG1 . VAL C 1 113 ? 0.784   2.146   -22.811 1.00 26.91  ? 111 VAL B CG1 1 
ATOM   2044 C CG2 . VAL C 1 113 ? 1.162   4.317   -21.571 1.00 37.18  ? 111 VAL B CG2 1 
ATOM   2045 N N   . LYS C 1 114 ? -2.270  3.010   -24.276 1.00 42.87  ? 112 LYS B N   1 
ATOM   2046 C CA  . LYS C 1 114 ? -3.042  2.059   -25.066 1.00 41.39  ? 112 LYS B CA  1 
ATOM   2047 C C   . LYS C 1 114 ? -3.283  2.562   -26.495 1.00 41.74  ? 112 LYS B C   1 
ATOM   2048 O O   . LYS C 1 114 ? -3.048  1.835   -27.463 1.00 41.11  ? 112 LYS B O   1 
ATOM   2049 C CB  . LYS C 1 114 ? -4.361  1.712   -24.365 1.00 43.35  ? 112 LYS B CB  1 
ATOM   2050 C CG  . LYS C 1 114 ? -4.190  0.936   -23.046 1.00 41.52  ? 112 LYS B CG  1 
ATOM   2051 C CD  . LYS C 1 114 ? -5.526  0.393   -22.520 1.00 41.13  ? 112 LYS B CD  1 
ATOM   2052 C CE  . LYS C 1 114 ? -6.259  1.435   -21.690 1.00 44.41  ? 112 LYS B CE  1 
ATOM   2053 N NZ  . LYS C 1 114 ? -7.597  0.968   -21.207 1.00 45.95  ? 112 LYS B NZ  1 
ATOM   2054 N N   . ASN C 1 115 ? -3.695  3.820   -26.624 1.00 35.58  ? 113 ASN B N   1 
ATOM   2055 C CA  . ASN C 1 115 ? -3.946  4.420   -27.932 1.00 37.48  ? 113 ASN B CA  1 
ATOM   2056 C C   . ASN C 1 115 ? -2.687  4.537   -28.792 1.00 35.76  ? 113 ASN B C   1 
ATOM   2057 O O   . ASN C 1 115 ? -2.751  4.398   -30.020 1.00 35.36  ? 113 ASN B O   1 
ATOM   2058 C CB  . ASN C 1 115 ? -4.621  5.790   -27.783 1.00 44.23  ? 113 ASN B CB  1 
ATOM   2059 C CG  . ASN C 1 115 ? -6.050  5.690   -27.247 1.00 48.41  ? 113 ASN B CG  1 
ATOM   2060 O OD1 . ASN C 1 115 ? -6.591  6.654   -26.697 1.00 57.55  ? 113 ASN B OD1 1 
ATOM   2061 N ND2 . ASN C 1 115 ? -6.657  4.516   -27.393 1.00 48.77  ? 113 ASN B ND2 1 
ATOM   2062 N N   . LYS C 1 116 ? -1.553  4.798   -28.141 1.00 34.82  ? 114 LYS B N   1 
ATOM   2063 C CA  . LYS C 1 116 ? -0.249  4.838   -28.806 1.00 35.09  ? 114 LYS B CA  1 
ATOM   2064 C C   . LYS C 1 116 ? 0.074   3.474   -29.399 1.00 31.05  ? 114 LYS B C   1 
ATOM   2065 O O   . LYS C 1 116 ? 0.456   3.374   -30.554 1.00 31.93  ? 114 LYS B O   1 
ATOM   2066 C CB  . LYS C 1 116 ? 0.858   5.280   -27.824 1.00 35.48  ? 114 LYS B CB  1 
ATOM   2067 C CG  . LYS C 1 116 ? 2.262   5.350   -28.428 1.00 36.57  ? 114 LYS B CG  1 
ATOM   2068 C CD  . LYS C 1 116 ? 2.261   6.177   -29.704 1.00 44.48  ? 114 LYS B CD  1 
ATOM   2069 C CE  . LYS C 1 116 ? 3.650   6.678   -30.084 1.00 44.63  ? 114 LYS B CE  1 
ATOM   2070 N NZ  . LYS C 1 116 ? 3.551   7.488   -31.338 1.00 47.78  ? 114 LYS B NZ  1 
ATOM   2071 N N   . ILE C 1 117 ? -0.174  2.416   -28.630 1.00 31.16  ? 115 ILE B N   1 
ATOM   2072 C CA  . ILE C 1 117 ? 0.044   1.055   -29.108 1.00 29.49  ? 115 ILE B CA  1 
ATOM   2073 C C   . ILE C 1 117 ? -0.836  0.696   -30.308 1.00 31.00  ? 115 ILE B C   1 
ATOM   2074 O O   . ILE C 1 117 ? -0.339  0.218   -31.318 1.00 31.10  ? 115 ILE B O   1 
ATOM   2075 C CB  . ILE C 1 117 ? -0.133  0.011   -27.982 1.00 28.15  ? 115 ILE B CB  1 
ATOM   2076 C CG1 . ILE C 1 117 ? 1.106   -0.019  -27.099 1.00 28.33  ? 115 ILE B CG1 1 
ATOM   2077 C CG2 . ILE C 1 117 ? -0.387  -1.385  -28.561 1.00 26.04  ? 115 ILE B CG2 1 
ATOM   2078 C CD1 . ILE C 1 117 ? 0.860   -0.643  -25.731 1.00 30.33  ? 115 ILE B CD1 1 
ATOM   2079 N N   . LEU C 1 118 ? -2.132  0.984   -30.211 1.00 33.70  ? 116 LEU B N   1 
ATOM   2080 C CA  . LEU C 1 118 ? -3.071  0.749   -31.313 1.00 35.28  ? 116 LEU B CA  1 
ATOM   2081 C C   . LEU C 1 118 ? -2.708  1.560   -32.554 1.00 37.36  ? 116 LEU B C   1 
ATOM   2082 O O   . LEU C 1 118 ? -2.764  1.046   -33.672 1.00 37.48  ? 116 LEU B O   1 
ATOM   2083 C CB  . LEU C 1 118 ? -4.514  1.048   -30.880 1.00 37.05  ? 116 LEU B CB  1 
ATOM   2084 C CG  . LEU C 1 118 ? -5.011  0.213   -29.691 1.00 36.98  ? 116 LEU B CG  1 
ATOM   2085 C CD1 . LEU C 1 118 ? -6.417  0.630   -29.240 1.00 37.65  ? 116 LEU B CD1 1 
ATOM   2086 C CD2 . LEU C 1 118 ? -4.975  -1.278  -30.033 1.00 38.41  ? 116 LEU B CD2 1 
ATOM   2087 N N   . GLU C 1 119 ? -2.319  2.817   -32.348 1.00 33.85  ? 117 GLU B N   1 
ATOM   2088 C CA  . GLU C 1 119 ? -1.776  3.652   -33.422 1.00 36.84  ? 117 GLU B CA  1 
ATOM   2089 C C   . GLU C 1 119 ? -0.603  2.981   -34.134 1.00 32.94  ? 117 GLU B C   1 
ATOM   2090 O O   . GLU C 1 119 ? -0.539  2.958   -35.362 1.00 34.59  ? 117 GLU B O   1 
ATOM   2091 C CB  . GLU C 1 119 ? -1.309  4.998   -32.871 1.00 38.86  ? 117 GLU B CB  1 
ATOM   2092 C CG  . GLU C 1 119 ? -2.363  6.076   -32.819 1.00 50.63  ? 117 GLU B CG  1 
ATOM   2093 C CD  . GLU C 1 119 ? -1.753  7.466   -32.936 1.00 62.88  ? 117 GLU B CD  1 
ATOM   2094 O OE1 . GLU C 1 119 ? -2.293  8.288   -33.712 1.00 70.23  ? 117 GLU B OE1 1 
ATOM   2095 O OE2 . GLU C 1 119 ? -0.690  7.706   -32.311 1.00 62.31  ? 117 GLU B OE2 1 
ATOM   2096 N N   . LEU C 1 120 ? 0.372   2.529   -33.356 1.00 30.57  ? 118 LEU B N   1 
ATOM   2097 C CA  . LEU C 1 120 ? 1.573   1.916   -33.922 1.00 27.96  ? 118 LEU B CA  1 
ATOM   2098 C C   . LEU C 1 120 ? 1.246   0.649   -34.700 1.00 26.90  ? 118 LEU B C   1 
ATOM   2099 O O   . LEU C 1 120 ? 1.656   0.506   -35.843 1.00 30.67  ? 118 LEU B O   1 
ATOM   2100 C CB  . LEU C 1 120 ? 2.600   1.616   -32.830 1.00 24.25  ? 118 LEU B CB  1 
ATOM   2101 C CG  . LEU C 1 120 ? 3.338   2.812   -32.210 1.00 26.56  ? 118 LEU B CG  1 
ATOM   2102 C CD1 . LEU C 1 120 ? 4.327   2.291   -31.158 1.00 27.01  ? 118 LEU B CD1 1 
ATOM   2103 C CD2 . LEU C 1 120 ? 4.052   3.653   -33.292 1.00 23.73  ? 118 LEU B CD2 1 
ATOM   2104 N N   . LEU C 1 121 ? 0.497   -0.259  -34.084 1.00 25.90  ? 119 LEU B N   1 
ATOM   2105 C CA  . LEU C 1 121 ? 0.052   -1.483  -34.753 1.00 28.06  ? 119 LEU B CA  1 
ATOM   2106 C C   . LEU C 1 121 ? -0.619  -1.185  -36.083 1.00 31.02  ? 119 LEU B C   1 
ATOM   2107 O O   . LEU C 1 121 ? -0.335  -1.831  -37.090 1.00 33.00  ? 119 LEU B O   1 
ATOM   2108 C CB  . LEU C 1 121 ? -0.921  -2.264  -33.867 1.00 28.23  ? 119 LEU B CB  1 
ATOM   2109 C CG  . LEU C 1 121 ? -0.355  -2.981  -32.643 1.00 28.22  ? 119 LEU B CG  1 
ATOM   2110 C CD1 . LEU C 1 121 ? -1.491  -3.409  -31.726 1.00 28.24  ? 119 LEU B CD1 1 
ATOM   2111 C CD2 . LEU C 1 121 ? 0.488   -4.187  -33.049 1.00 30.17  ? 119 LEU B CD2 1 
ATOM   2112 N N   . TYR C 1 122 ? -1.550  -0.236  -36.084 1.00 28.36  ? 120 TYR B N   1 
ATOM   2113 C CA  . TYR C 1 122 ? -2.194  0.152   -37.329 1.00 30.63  ? 120 TYR B CA  1 
ATOM   2114 C C   . TYR C 1 122 ? -1.194  0.598   -38.393 1.00 32.11  ? 120 TYR B C   1 
ATOM   2115 O O   . TYR C 1 122 ? -1.303  0.203   -39.564 1.00 32.70  ? 120 TYR B O   1 
ATOM   2116 C CB  . TYR C 1 122 ? -3.250  1.232   -37.115 1.00 31.93  ? 120 TYR B CB  1 
ATOM   2117 C CG  . TYR C 1 122 ? -3.915  1.648   -38.414 1.00 35.80  ? 120 TYR B CG  1 
ATOM   2118 C CD1 . TYR C 1 122 ? -4.844  0.817   -39.042 1.00 40.63  ? 120 TYR B CD1 1 
ATOM   2119 C CD2 . TYR C 1 122 ? -3.548  2.817   -39.056 1.00 36.85  ? 120 TYR B CD2 1 
ATOM   2120 C CE1 . TYR C 1 122 ? -5.456  1.187   -40.237 1.00 40.04  ? 120 TYR B CE1 1 
ATOM   2121 C CE2 . TYR C 1 122 ? -4.110  3.171   -40.274 1.00 44.24  ? 120 TYR B CE2 1 
ATOM   2122 C CZ  . TYR C 1 122 ? -5.060  2.354   -40.862 1.00 44.20  ? 120 TYR B CZ  1 
ATOM   2123 O OH  . TYR C 1 122 ? -5.636  2.735   -42.057 1.00 50.24  ? 120 TYR B OH  1 
ATOM   2124 N N   . SER C 1 123 ? -0.231  1.434   -37.997 1.00 34.59  ? 121 SER B N   1 
ATOM   2125 C CA  . SER C 1 123 ? 0.741   1.968   -38.959 1.00 34.66  ? 121 SER B CA  1 
ATOM   2126 C C   . SER C 1 123 ? 1.553   0.838   -39.601 1.00 32.94  ? 121 SER B C   1 
ATOM   2127 O O   . SER C 1 123 ? 1.903   0.914   -40.780 1.00 35.43  ? 121 SER B O   1 
ATOM   2128 C CB  . SER C 1 123 ? 1.667   3.009   -38.311 1.00 31.97  ? 121 SER B CB  1 
ATOM   2129 O OG  . SER C 1 123 ? 2.571   2.402   -37.382 1.00 32.94  ? 121 SER B OG  1 
ATOM   2130 N N   . TRP C 1 124 ? 1.829   -0.214  -38.834 1.00 33.29  ? 122 TRP B N   1 
ATOM   2131 C CA  . TRP C 1 124 ? 2.586   -1.349  -39.352 1.00 31.32  ? 122 TRP B CA  1 
ATOM   2132 C C   . TRP C 1 124 ? 1.782   -2.264  -40.290 1.00 33.84  ? 122 TRP B C   1 
ATOM   2133 O O   . TRP C 1 124 ? 2.353   -2.842  -41.215 1.00 33.31  ? 122 TRP B O   1 
ATOM   2134 C CB  . TRP C 1 124 ? 3.204   -2.167  -38.216 1.00 30.97  ? 122 TRP B CB  1 
ATOM   2135 C CG  . TRP C 1 124 ? 4.053   -1.361  -37.271 1.00 25.46  ? 122 TRP B CG  1 
ATOM   2136 C CD1 . TRP C 1 124 ? 4.812   -0.270  -37.577 1.00 27.93  ? 122 TRP B CD1 1 
ATOM   2137 C CD2 . TRP C 1 124 ? 4.224   -1.588  -35.875 1.00 24.70  ? 122 TRP B CD2 1 
ATOM   2138 N NE1 . TRP C 1 124 ? 5.419   0.215   -36.454 1.00 29.07  ? 122 TRP B NE1 1 
ATOM   2139 C CE2 . TRP C 1 124 ? 5.086   -0.581  -35.392 1.00 25.30  ? 122 TRP B CE2 1 
ATOM   2140 C CE3 . TRP C 1 124 ? 3.726   -2.540  -34.978 1.00 27.49  ? 122 TRP B CE3 1 
ATOM   2141 C CZ2 . TRP C 1 124 ? 5.449   -0.485  -34.046 1.00 27.97  ? 122 TRP B CZ2 1 
ATOM   2142 C CZ3 . TRP C 1 124 ? 4.124   -2.472  -33.643 1.00 29.03  ? 122 TRP B CZ3 1 
ATOM   2143 C CH2 . TRP C 1 124 ? 4.945   -1.424  -33.188 1.00 24.90  ? 122 TRP B CH2 1 
ATOM   2144 N N   . THR C 1 125 ? 0.477   -2.414  -40.040 1.00 29.32  ? 123 THR B N   1 
ATOM   2145 C CA  . THR C 1 125 ? -0.407  -3.149  -40.969 1.00 31.51  ? 123 THR B CA  1 
ATOM   2146 C C   . THR C 1 125 ? -0.453  -2.456  -42.325 1.00 30.90  ? 123 THR B C   1 
ATOM   2147 O O   . THR C 1 125 ? -0.620  -3.096  -43.367 1.00 32.21  ? 123 THR B O   1 
ATOM   2148 C CB  . THR C 1 125 ? -1.874  -3.301  -40.432 1.00 33.49  ? 123 THR B CB  1 
ATOM   2149 O OG1 . THR C 1 125 ? -2.530  -2.026  -40.429 1.00 34.73  ? 123 THR B OG1 1 
ATOM   2150 C CG2 . THR C 1 125 ? -1.892  -3.873  -39.024 1.00 32.28  ? 123 THR B CG2 1 
ATOM   2151 N N   . VAL C 1 126 ? -0.288  -1.137  -42.304 1.00 32.80  ? 124 VAL B N   1 
ATOM   2152 C CA  . VAL C 1 126 ? -0.265  -0.347  -43.529 1.00 32.22  ? 124 VAL B CA  1 
ATOM   2153 C C   . VAL C 1 126 ? 1.139   -0.323  -44.130 1.00 30.63  ? 124 VAL B C   1 
ATOM   2154 O O   . VAL C 1 126 ? 1.307   -0.574  -45.320 1.00 32.46  ? 124 VAL B O   1 
ATOM   2155 C CB  . VAL C 1 126 ? -0.775  1.100   -43.299 1.00 34.86  ? 124 VAL B CB  1 
ATOM   2156 C CG1 . VAL C 1 126 ? -0.717  1.897   -44.608 1.00 33.24  ? 124 VAL B CG1 1 
ATOM   2157 C CG2 . VAL C 1 126 ? -2.200  1.087   -42.762 1.00 39.68  ? 124 VAL B CG2 1 
ATOM   2158 N N   . GLY C 1 127 ? 2.142   -0.043  -43.300 1.00 30.48  ? 125 GLY B N   1 
ATOM   2159 C CA  . GLY C 1 127 ? 3.518   0.152   -43.776 1.00 29.31  ? 125 GLY B CA  1 
ATOM   2160 C C   . GLY C 1 127 ? 4.274   -1.142  -44.047 1.00 29.61  ? 125 GLY B C   1 
ATOM   2161 O O   . GLY C 1 127 ? 5.091   -1.216  -44.967 1.00 30.08  ? 125 GLY B O   1 
ATOM   2162 N N   . LEU C 1 128 ? 3.961   -2.177  -43.274 1.00 30.41  ? 126 LEU B N   1 
ATOM   2163 C CA  . LEU C 1 128 ? 4.634   -3.470  -43.393 1.00 31.16  ? 126 LEU B CA  1 
ATOM   2164 C C   . LEU C 1 128 ? 3.611   -4.610  -43.549 1.00 32.75  ? 126 LEU B C   1 
ATOM   2165 O O   . LEU C 1 128 ? 3.480   -5.448  -42.672 1.00 34.85  ? 126 LEU B O   1 
ATOM   2166 C CB  . LEU C 1 128 ? 5.536   -3.702  -42.167 1.00 28.72  ? 126 LEU B CB  1 
ATOM   2167 C CG  . LEU C 1 128 ? 6.599   -2.606  -41.958 1.00 30.58  ? 126 LEU B CG  1 
ATOM   2168 C CD1 . LEU C 1 128 ? 7.077   -2.505  -40.519 1.00 27.62  ? 126 LEU B CD1 1 
ATOM   2169 C CD2 . LEU C 1 128 ? 7.786   -2.771  -42.932 1.00 33.16  ? 126 LEU B CD2 1 
ATOM   2170 N N   . PRO C 1 129 ? 2.891   -4.652  -44.681 1.00 32.20  ? 127 PRO B N   1 
ATOM   2171 C CA  . PRO C 1 129 ? 1.875   -5.703  -44.852 1.00 36.21  ? 127 PRO B CA  1 
ATOM   2172 C C   . PRO C 1 129 ? 2.414   -7.149  -44.961 1.00 37.84  ? 127 PRO B C   1 
ATOM   2173 O O   . PRO C 1 129 ? 1.629   -8.097  -44.905 1.00 41.11  ? 127 PRO B O   1 
ATOM   2174 C CB  . PRO C 1 129 ? 1.152   -5.294  -46.147 1.00 38.02  ? 127 PRO B CB  1 
ATOM   2175 C CG  . PRO C 1 129 ? 2.094   -4.442  -46.870 1.00 35.69  ? 127 PRO B CG  1 
ATOM   2176 C CD  . PRO C 1 129 ? 2.963   -3.752  -45.845 1.00 31.42  ? 127 PRO B CD  1 
ATOM   2177 N N   . GLU C 1 130 ? 3.730   -7.324  -45.082 1.00 40.51  ? 128 GLU B N   1 
ATOM   2178 C CA  . GLU C 1 130 ? 4.307   -8.675  -45.153 1.00 42.31  ? 128 GLU B CA  1 
ATOM   2179 C C   . GLU C 1 130 ? 4.596   -9.245  -43.769 1.00 41.26  ? 128 GLU B C   1 
ATOM   2180 O O   . GLU C 1 130 ? 5.013   -10.396 -43.634 1.00 42.38  ? 128 GLU B O   1 
ATOM   2181 C CB  . GLU C 1 130 ? 5.560   -8.709  -46.048 1.00 42.74  ? 128 GLU B CB  1 
ATOM   2182 C CG  . GLU C 1 130 ? 5.244   -8.540  -47.543 1.00 46.49  ? 128 GLU B CG  1 
ATOM   2183 C CD  . GLU C 1 130 ? 6.477   -8.561  -48.451 1.00 46.51  ? 128 GLU B CD  1 
ATOM   2184 O OE1 . GLU C 1 130 ? 7.612   -8.682  -47.949 1.00 48.43  ? 128 GLU B OE1 1 
ATOM   2185 O OE2 . GLU C 1 130 ? 6.304   -8.413  -49.675 1.00 48.22  ? 128 GLU B OE2 1 
ATOM   2186 N N   . GLU C 1 131 ? 4.415   -8.412  -42.745 1.00 39.00  ? 129 GLU B N   1 
ATOM   2187 C CA  . GLU C 1 131 ? 4.342   -8.883  -41.366 1.00 38.68  ? 129 GLU B CA  1 
ATOM   2188 C C   . GLU C 1 131 ? 2.891   -9.228  -41.042 1.00 39.84  ? 129 GLU B C   1 
ATOM   2189 O O   . GLU C 1 131 ? 2.187   -8.452  -40.397 1.00 38.87  ? 129 GLU B O   1 
ATOM   2190 C CB  . GLU C 1 131 ? 4.880   -7.829  -40.394 1.00 35.66  ? 129 GLU B CB  1 
ATOM   2191 C CG  . GLU C 1 131 ? 6.289   -7.318  -40.719 1.00 34.20  ? 129 GLU B CG  1 
ATOM   2192 C CD  . GLU C 1 131 ? 7.362   -8.374  -40.497 1.00 38.54  ? 129 GLU B CD  1 
ATOM   2193 O OE1 . GLU C 1 131 ? 8.503   -8.183  -40.978 1.00 34.25  ? 129 GLU B OE1 1 
ATOM   2194 O OE2 . GLU C 1 131 ? 7.064   -9.395  -39.834 1.00 37.14  ? 129 GLU B OE2 1 
ATOM   2195 N N   . VAL C 1 132 ? 2.447   -10.375 -41.553 1.00 37.16  ? 130 VAL B N   1 
ATOM   2196 C CA  . VAL C 1 132 ? 1.042   -10.785 -41.514 1.00 40.03  ? 130 VAL B CA  1 
ATOM   2197 C C   . VAL C 1 132 ? 0.497   -11.037 -40.095 1.00 40.18  ? 130 VAL B C   1 
ATOM   2198 O O   . VAL C 1 132 ? -0.692  -10.837 -39.846 1.00 41.81  ? 130 VAL B O   1 
ATOM   2199 C CB  . VAL C 1 132 ? 0.803   -12.045 -42.381 1.00 43.85  ? 130 VAL B CB  1 
ATOM   2200 C CG1 . VAL C 1 132 ? 1.224   -11.798 -43.817 1.00 45.40  ? 130 VAL B CG1 1 
ATOM   2201 C CG2 . VAL C 1 132 ? 1.552   -13.255 -41.800 1.00 47.52  ? 130 VAL B CG2 1 
ATOM   2202 N N   . LYS C 1 133 ? 1.360   -11.487 -39.181 1.00 41.10  ? 131 LYS B N   1 
ATOM   2203 C CA  . LYS C 1 133 ? 0.974   -11.685 -37.771 1.00 40.46  ? 131 LYS B CA  1 
ATOM   2204 C C   . LYS C 1 133 ? 0.577   -10.367 -37.091 1.00 38.44  ? 131 LYS B C   1 
ATOM   2205 O O   . LYS C 1 133 ? -0.266  -10.352 -36.195 1.00 39.77  ? 131 LYS B O   1 
ATOM   2206 C CB  . LYS C 1 133 ? 2.106   -12.359 -36.979 1.00 36.28  ? 131 LYS B CB  1 
ATOM   2207 C CG  . LYS C 1 133 ? 2.446   -13.782 -37.440 1.00 39.00  ? 131 LYS B CG  1 
ATOM   2208 C CD  . LYS C 1 133 ? 3.694   -14.318 -36.734 1.00 37.23  ? 131 LYS B CD  1 
ATOM   2209 C CE  . LYS C 1 133 ? 3.957   -15.787 -37.073 1.00 41.09  ? 131 LYS B CE  1 
ATOM   2210 N NZ  . LYS C 1 133 ? 5.192   -16.285 -36.383 1.00 37.31  ? 131 LYS B NZ  1 
ATOM   2211 N N   . ILE C 1 134 ? 1.187   -9.259  -37.502 1.00 34.92  ? 132 ILE B N   1 
ATOM   2212 C CA  . ILE C 1 134 ? 0.788   -7.953  -36.955 1.00 34.25  ? 132 ILE B CA  1 
ATOM   2213 C C   . ILE C 1 134 ? -0.654  -7.613  -37.335 1.00 36.44  ? 132 ILE B C   1 
ATOM   2214 O O   . ILE C 1 134 ? -1.438  -7.153  -36.504 1.00 36.94  ? 132 ILE B O   1 
ATOM   2215 C CB  . ILE C 1 134 ? 1.725   -6.812  -37.390 1.00 31.53  ? 132 ILE B CB  1 
ATOM   2216 C CG1 . ILE C 1 134 ? 3.164   -7.107  -36.940 1.00 29.24  ? 132 ILE B CG1 1 
ATOM   2217 C CG2 . ILE C 1 134 ? 1.220   -5.491  -36.820 1.00 30.95  ? 132 ILE B CG2 1 
ATOM   2218 C CD1 . ILE C 1 134 ? 4.224   -6.067  -37.412 1.00 24.12  ? 132 ILE B CD1 1 
ATOM   2219 N N   . ALA C 1 135 ? -0.999  -7.881  -38.591 1.00 35.94  ? 133 ALA B N   1 
ATOM   2220 C CA  . ALA C 1 135 ? -2.339  -7.625  -39.110 1.00 39.45  ? 133 ALA B CA  1 
ATOM   2221 C C   . ALA C 1 135 ? -3.370  -8.534  -38.440 1.00 44.10  ? 133 ALA B C   1 
ATOM   2222 O O   . ALA C 1 135 ? -4.458  -8.087  -38.066 1.00 47.69  ? 133 ALA B O   1 
ATOM   2223 C CB  . ALA C 1 135 ? -2.355  -7.821  -40.618 1.00 40.42  ? 133 ALA B CB  1 
ATOM   2224 N N   . GLU C 1 136 ? -3.032  -9.812  -38.287 1.00 41.21  ? 134 GLU B N   1 
ATOM   2225 C CA  . GLU C 1 136 ? -3.919  -10.740 -37.592 1.00 45.86  ? 134 GLU B CA  1 
ATOM   2226 C C   . GLU C 1 136 ? -4.152  -10.273 -36.155 1.00 44.30  ? 134 GLU B C   1 
ATOM   2227 O O   . GLU C 1 136 ? -5.275  -10.305 -35.656 1.00 47.55  ? 134 GLU B O   1 
ATOM   2228 C CB  . GLU C 1 136 ? -3.367  -12.172 -37.627 1.00 47.39  ? 134 GLU B CB  1 
ATOM   2229 C CG  . GLU C 1 136 ? -4.243  -13.189 -36.897 1.00 54.95  ? 134 GLU B CG  1 
ATOM   2230 C CD  . GLU C 1 136 ? -3.734  -14.622 -37.019 1.00 62.10  ? 134 GLU B CD  1 
ATOM   2231 O OE1 . GLU C 1 136 ? -2.684  -14.832 -37.674 1.00 60.37  ? 134 GLU B OE1 1 
ATOM   2232 O OE2 . GLU C 1 136 ? -4.399  -15.537 -36.470 1.00 60.92  ? 134 GLU B OE2 1 
ATOM   2233 N N   . ALA C 1 137 ? -3.101  -9.791  -35.506 1.00 44.23  ? 135 ALA B N   1 
ATOM   2234 C CA  . ALA C 1 137 ? -3.219  -9.378  -34.115 1.00 43.52  ? 135 ALA B CA  1 
ATOM   2235 C C   . ALA C 1 137 ? -4.136  -8.154  -34.027 1.00 42.37  ? 135 ALA B C   1 
ATOM   2236 O O   . ALA C 1 137 ? -4.965  -8.039  -33.114 1.00 41.54  ? 135 ALA B O   1 
ATOM   2237 C CB  . ALA C 1 137 ? -1.838  -9.084  -33.518 1.00 38.60  ? 135 ALA B CB  1 
ATOM   2238 N N   . TYR C 1 138 ? -4.041  -7.289  -35.033 1.00 45.87  ? 136 TYR B N   1 
ATOM   2239 C CA  . TYR C 1 138 ? -4.821  -6.055  -35.067 1.00 43.25  ? 136 TYR B CA  1 
ATOM   2240 C C   . TYR C 1 138 ? -6.305  -6.314  -35.380 1.00 46.19  ? 136 TYR B C   1 
ATOM   2241 O O   . TYR C 1 138 ? -7.192  -5.726  -34.762 1.00 45.16  ? 136 TYR B O   1 
ATOM   2242 C CB  . TYR C 1 138 ? -4.209  -5.078  -36.070 1.00 42.68  ? 136 TYR B CB  1 
ATOM   2243 C CG  . TYR C 1 138 ? -4.874  -3.720  -36.097 1.00 41.54  ? 136 TYR B CG  1 
ATOM   2244 C CD1 . TYR C 1 138 ? -4.560  -2.754  -35.146 1.00 38.51  ? 136 TYR B CD1 1 
ATOM   2245 C CD2 . TYR C 1 138 ? -5.842  -3.421  -37.044 1.00 44.49  ? 136 TYR B CD2 1 
ATOM   2246 C CE1 . TYR C 1 138 ? -5.174  -1.513  -35.154 1.00 37.15  ? 136 TYR B CE1 1 
ATOM   2247 C CE2 . TYR C 1 138 ? -6.482  -2.189  -37.048 1.00 45.90  ? 136 TYR B CE2 1 
ATOM   2248 C CZ  . TYR C 1 138 ? -6.140  -1.239  -36.100 1.00 42.49  ? 136 TYR B CZ  1 
ATOM   2249 O OH  . TYR C 1 138 ? -6.756  -0.005  -36.103 1.00 44.03  ? 136 TYR B OH  1 
ATOM   2250 N N   . GLN C 1 139 ? -6.567  -7.226  -36.309 1.00 47.63  ? 137 GLN B N   1 
ATOM   2251 C CA  . GLN C 1 139 ? -7.935  -7.633  -36.636 1.00 52.00  ? 137 GLN B CA  1 
ATOM   2252 C C   . GLN C 1 139 ? -8.653  -8.283  -35.439 1.00 54.17  ? 137 GLN B C   1 
ATOM   2253 O O   . GLN C 1 139 ? -9.866  -8.117  -35.255 1.00 54.52  ? 137 GLN B O   1 
ATOM   2254 C CB  . GLN C 1 139 ? -7.916  -8.582  -37.836 1.00 57.11  ? 137 GLN B CB  1 
ATOM   2255 C CG  . GLN C 1 139 ? -9.131  -9.477  -37.955 1.00 67.21  ? 137 GLN B CG  1 
ATOM   2256 C CD  . GLN C 1 139 ? -10.317 -8.778  -38.592 1.00 72.30  ? 137 GLN B CD  1 
ATOM   2257 O OE1 . GLN C 1 139 ? -10.181 -8.115  -39.623 1.00 71.11  ? 137 GLN B OE1 1 
ATOM   2258 N NE2 . GLN C 1 139 ? -11.498 -8.946  -37.993 1.00 74.33  ? 137 GLN B NE2 1 
ATOM   2259 N N   . MET C 1 140 ? -7.899  -9.015  -34.626 1.00 55.49  ? 138 MET B N   1 
ATOM   2260 C CA  . MET C 1 140 ? -8.453  -9.660  -33.441 1.00 58.93  ? 138 MET B CA  1 
ATOM   2261 C C   . MET C 1 140 ? -8.845  -8.640  -32.370 1.00 55.79  ? 138 MET B C   1 
ATOM   2262 O O   . MET C 1 140 ? -9.871  -8.789  -31.713 1.00 59.05  ? 138 MET B O   1 
ATOM   2263 C CB  . MET C 1 140 ? -7.450  -10.666 -32.872 1.00 59.56  ? 138 MET B CB  1 
ATOM   2264 C CG  . MET C 1 140 ? -8.009  -11.545 -31.775 1.00 64.24  ? 138 MET B CG  1 
ATOM   2265 S SD  . MET C 1 140 ? -6.846  -11.697 -30.424 1.00 61.23  ? 138 MET B SD  1 
ATOM   2266 C CE  . MET C 1 140 ? -6.928  -10.047 -29.729 1.00 55.81  ? 138 MET B CE  1 
ATOM   2267 N N   . LEU C 1 141 ? -7.999  -7.635  -32.163 1.00 56.17  ? 139 LEU B N   1 
ATOM   2268 C CA  . LEU C 1 141 ? -8.326  -6.524  -31.274 1.00 53.21  ? 139 LEU B CA  1 
ATOM   2269 C C   . LEU C 1 141 ? -9.565  -5.774  -31.749 1.00 55.04  ? 139 LEU B C   1 
ATOM   2270 O O   . LEU C 1 141 ? -10.396 -5.372  -30.942 1.00 56.05  ? 139 LEU B O   1 
ATOM   2271 C CB  . LEU C 1 141 ? -7.152  -5.553  -31.173 1.00 47.58  ? 139 LEU B CB  1 
ATOM   2272 C CG  . LEU C 1 141 ? -5.883  -6.081  -30.507 1.00 45.07  ? 139 LEU B CG  1 
ATOM   2273 C CD1 . LEU C 1 141 ? -4.766  -5.077  -30.650 1.00 37.86  ? 139 LEU B CD1 1 
ATOM   2274 C CD2 . LEU C 1 141 ? -6.141  -6.408  -29.030 1.00 44.47  ? 139 LEU B CD2 1 
ATOM   2275 N N   . LYS C 1 142 ? -9.658  -5.553  -33.057 1.00 60.23  ? 140 LYS B N   1 
ATOM   2276 C CA  . LYS C 1 142 ? -10.852 -4.959  -33.654 1.00 62.87  ? 140 LYS B CA  1 
ATOM   2277 C C   . LYS C 1 142 ? -12.050 -5.890  -33.505 1.00 67.12  ? 140 LYS B C   1 
ATOM   2278 O O   . LYS C 1 142 ? -13.175 -5.439  -33.278 1.00 68.76  ? 140 LYS B O   1 
ATOM   2279 C CB  . LYS C 1 142 ? -10.617 -4.633  -35.134 1.00 64.00  ? 140 LYS B CB  1 
ATOM   2280 C CG  . LYS C 1 142 ? -11.354 -3.396  -35.611 1.00 66.61  ? 140 LYS B CG  1 
ATOM   2281 C CD  . LYS C 1 142 ? -11.768 -3.508  -37.078 1.00 73.20  ? 140 LYS B CD  1 
ATOM   2282 C CE  . LYS C 1 142 ? -10.623 -3.152  -38.011 1.00 71.41  ? 140 LYS B CE  1 
ATOM   2283 N NZ  . LYS C 1 142 ? -11.108 -3.003  -39.414 1.00 75.11  ? 140 LYS B NZ  1 
ATOM   2284 N N   . LYS C 1 143 ? -11.799 -7.190  -33.618 1.00 61.09  ? 141 LYS B N   1 
ATOM   2285 C CA  . LYS C 1 143 ? -12.840 -8.192  -33.434 1.00 65.50  ? 141 LYS B CA  1 
ATOM   2286 C C   . LYS C 1 143 ? -13.414 -8.138  -32.022 1.00 65.44  ? 141 LYS B C   1 
ATOM   2287 O O   . LYS C 1 143 ? -14.624 -8.218  -31.838 1.00 69.07  ? 141 LYS B O   1 
ATOM   2288 C CB  . LYS C 1 143 ? -12.307 -9.591  -33.745 1.00 68.85  ? 141 LYS B CB  1 
ATOM   2289 C CG  . LYS C 1 143 ? -13.322 -10.512 -34.397 1.00 75.53  ? 141 LYS B CG  1 
ATOM   2290 C CD  . LYS C 1 143 ? -13.989 -11.398 -33.368 1.00 77.93  ? 141 LYS B CD  1 
ATOM   2291 C CE  . LYS C 1 143 ? -15.143 -12.181 -33.975 1.00 86.77  ? 141 LYS B CE  1 
ATOM   2292 N NZ  . LYS C 1 143 ? -15.692 -13.170 -33.012 1.00 88.26  ? 141 LYS B NZ  1 
ATOM   2293 N N   . GLN C 1 144 ? -12.548 -7.954  -31.031 1.00 62.53  ? 142 GLN B N   1 
ATOM   2294 C CA  . GLN C 1 144 ? -12.994 -7.827  -29.645 1.00 63.05  ? 142 GLN B CA  1 
ATOM   2295 C C   . GLN C 1 144 ? -13.449 -6.413  -29.273 1.00 60.64  ? 142 GLN B C   1 
ATOM   2296 O O   . GLN C 1 144 ? -13.904 -6.178  -28.153 1.00 61.22  ? 142 GLN B O   1 
ATOM   2297 C CB  . GLN C 1 144 ? -11.903 -8.301  -28.684 1.00 61.15  ? 142 GLN B CB  1 
ATOM   2298 C CG  . GLN C 1 144 ? -11.309 -9.650  -29.049 1.00 64.19  ? 142 GLN B CG  1 
ATOM   2299 C CD  . GLN C 1 144 ? -10.354 -10.171 -28.000 1.00 63.36  ? 142 GLN B CD  1 
ATOM   2300 O OE1 . GLN C 1 144 ? -10.117 -9.521  -26.983 1.00 59.98  ? 142 GLN B OE1 1 
ATOM   2301 N NE2 . GLN C 1 144 ? -9.773  -11.337 -28.256 1.00 69.40  ? 142 GLN B NE2 1 
ATOM   2302 N N   . GLY C 1 145 ? -13.320 -5.475  -30.208 1.00 68.62  ? 143 GLY B N   1 
ATOM   2303 C CA  . GLY C 1 145 ? -13.805 -4.113  -30.001 1.00 66.68  ? 143 GLY B CA  1 
ATOM   2304 C C   . GLY C 1 145 ? -12.809 -3.221  -29.282 1.00 62.80  ? 143 GLY B C   1 
ATOM   2305 O O   . GLY C 1 145 ? -13.135 -2.095  -28.896 1.00 62.42  ? 143 GLY B O   1 
ATOM   2306 N N   . ILE C 1 146 ? -11.594 -3.725  -29.088 1.00 61.01  ? 144 ILE B N   1 
ATOM   2307 C CA  . ILE C 1 146 ? -10.527 -2.928  -28.490 1.00 57.52  ? 144 ILE B CA  1 
ATOM   2308 C C   . ILE C 1 146 ? -10.037 -1.839  -29.446 1.00 56.69  ? 144 ILE B C   1 
ATOM   2309 O O   . ILE C 1 146 ? -9.811  -0.702  -29.037 1.00 56.25  ? 144 ILE B O   1 
ATOM   2310 C CB  . ILE C 1 146 ? -9.355  -3.809  -28.020 1.00 54.88  ? 144 ILE B CB  1 
ATOM   2311 C CG1 . ILE C 1 146 ? -9.787  -4.652  -26.819 1.00 54.83  ? 144 ILE B CG1 1 
ATOM   2312 C CG2 . ILE C 1 146 ? -8.130  -2.955  -27.680 1.00 51.96  ? 144 ILE B CG2 1 
ATOM   2313 C CD1 . ILE C 1 146 ? -8.858  -5.784  -26.514 1.00 54.03  ? 144 ILE B CD1 1 
ATOM   2314 N N   . VAL C 1 147 ? -9.898  -2.185  -30.723 1.00 56.00  ? 145 VAL B N   1 
ATOM   2315 C CA  . VAL C 1 147 ? -9.834  -1.180  -31.782 1.00 57.09  ? 145 VAL B CA  1 
ATOM   2316 C C   . VAL C 1 147 ? -11.230 -0.655  -32.123 1.00 61.66  ? 145 VAL B C   1 
ATOM   2317 O O   . VAL C 1 147 ? -12.094 -1.409  -32.573 1.00 63.42  ? 145 VAL B O   1 
ATOM   2318 C CB  . VAL C 1 147 ? -9.163  -1.729  -33.060 1.00 57.04  ? 145 VAL B CB  1 
ATOM   2319 C CG1 . VAL C 1 147 ? -9.233  -0.700  -34.180 1.00 56.59  ? 145 VAL B CG1 1 
ATOM   2320 C CG2 . VAL C 1 147 ? -7.722  -2.123  -32.778 1.00 53.39  ? 145 VAL B CG2 1 
ATOM   2321 N N   . LYS C 1 148 ? -11.372 0.648   -31.935 1.00 101.05 ? 146 LYS B N   1 
ATOM   2322 C CA  . LYS C 1 148 ? -10.180 1.416   -31.532 1.00 98.58  ? 146 LYS B CA  1 
ATOM   2323 C C   . LYS C 1 148 ? -10.037 1.696   -30.046 1.00 97.49  ? 146 LYS B C   1 
ATOM   2324 O O   . LYS C 1 148 ? -9.468  2.707   -29.644 1.00 128.01 ? 146 LYS B O   1 
ATOM   2325 C CB  . LYS C 1 148 ? -9.955  2.694   -32.369 1.00 100.40 ? 146 LYS B CB  1 
ATOM   2326 C CG  . LYS C 1 148 ? -8.698  2.710   -33.286 1.00 98.66  ? 146 LYS B CG  1 
ATOM   2327 C CD  . LYS C 1 148 ? -8.532  4.068   -34.056 1.00 101.59 ? 146 LYS B CD  1 
ATOM   2328 C CE  . LYS C 1 148 ? -8.538  3.923   -35.605 1.00 103.29 ? 146 LYS B CE  1 
ATOM   2329 N NZ  . LYS C 1 148 ? -7.297  4.306   -36.407 1.00 102.84 ? 146 LYS B NZ  1 
HETATM 2330 N N   . SEP D 2 7   ? 7.626   -22.377 -33.789 1.00 93.72  ? 6   SEP D N   1 
HETATM 2331 C CA  . SEP D 2 7   ? 8.736   -21.824 -32.956 1.00 91.78  ? 6   SEP D CA  1 
HETATM 2332 C CB  . SEP D 2 7   ? 9.999   -21.619 -33.802 1.00 91.60  ? 6   SEP D CB  1 
HETATM 2333 O OG  . SEP D 2 7   ? 9.871   -20.504 -34.671 1.00 95.49  ? 6   SEP D OG  1 
HETATM 2334 C C   . SEP D 2 7   ? 8.326   -20.515 -32.278 1.00 87.76  ? 6   SEP D C   1 
HETATM 2335 O O   . SEP D 2 7   ? 8.886   -20.136 -31.247 1.00 86.85  ? 6   SEP D O   1 
HETATM 2336 P P   . SEP D 2 7   ? 9.717   -20.972 -36.215 1.00 106.99 ? 6   SEP D P   1 
HETATM 2337 O O1P . SEP D 2 7   ? 9.647   -19.675 -37.174 1.00 100.55 ? 6   SEP D O1P 1 
HETATM 2338 O O2P . SEP D 2 7   ? 10.989  -21.879 -36.630 1.00 106.84 ? 6   SEP D O2P 1 
HETATM 2339 O O3P . SEP D 2 7   ? 8.362   -21.827 -36.401 1.00 107.99 ? 6   SEP D O3P 1 
ATOM   2340 N N   . ASP D 2 8   ? 7.329   -19.848 -32.851 1.00 58.01  ? 7   ASP D N   1 
ATOM   2341 C CA  . ASP D 2 8   ? 6.744   -18.642 -32.266 1.00 53.63  ? 7   ASP D CA  1 
ATOM   2342 C C   . ASP D 2 8   ? 5.607   -19.017 -31.306 1.00 54.77  ? 7   ASP D C   1 
ATOM   2343 O O   . ASP D 2 8   ? 5.050   -20.114 -31.394 1.00 56.93  ? 7   ASP D O   1 
ATOM   2344 C CB  . ASP D 2 8   ? 6.226   -17.733 -33.393 1.00 51.48  ? 7   ASP D CB  1 
ATOM   2345 C CG  . ASP D 2 8   ? 5.830   -16.342 -32.910 1.00 46.89  ? 7   ASP D CG  1 
ATOM   2346 O OD1 . ASP D 2 8   ? 6.239   -15.939 -31.803 1.00 49.29  ? 7   ASP D OD1 1 
ATOM   2347 O OD2 . ASP D 2 8   ? 5.105   -15.648 -33.657 1.00 51.39  ? 7   ASP D OD2 1 
ATOM   2348 N N   . GLU D 2 9   ? 5.276   -18.108 -30.390 1.00 57.50  ? 8   GLU D N   1 
ATOM   2349 C CA  . GLU D 2 9   ? 4.113   -18.262 -29.519 1.00 59.58  ? 8   GLU D CA  1 
ATOM   2350 C C   . GLU D 2 9   ? 2.825   -18.307 -30.333 1.00 61.00  ? 8   GLU D C   1 
ATOM   2351 O O   . GLU D 2 9   ? 2.780   -17.829 -31.469 1.00 59.28  ? 8   GLU D O   1 
ATOM   2352 C CB  . GLU D 2 9   ? 4.035   -17.108 -28.514 1.00 58.57  ? 8   GLU D CB  1 
ATOM   2353 C CG  . GLU D 2 9   ? 4.791   -17.327 -27.211 1.00 62.07  ? 8   GLU D CG  1 
ATOM   2354 C CD  . GLU D 2 9   ? 4.620   -16.162 -26.237 1.00 67.60  ? 8   GLU D CD  1 
ATOM   2355 O OE1 . GLU D 2 9   ? 3.460   -15.758 -25.961 1.00 66.47  ? 8   GLU D OE1 1 
ATOM   2356 O OE2 . GLU D 2 9   ? 5.650   -15.636 -25.759 1.00 67.44  ? 8   GLU D OE2 1 
ATOM   2357 N N   . ASP D 2 10  ? 1.776   -18.879 -29.748 1.00 51.40  ? 9   ASP D N   1 
ATOM   2358 C CA  . ASP D 2 10  ? 0.435   -18.751 -30.305 1.00 53.52  ? 9   ASP D CA  1 
ATOM   2359 C C   . ASP D 2 10  ? -0.054  -17.338 -30.041 1.00 51.35  ? 9   ASP D C   1 
ATOM   2360 O O   . ASP D 2 10  ? 0.347   -16.712 -29.065 1.00 49.95  ? 9   ASP D O   1 
ATOM   2361 C CB  . ASP D 2 10  ? -0.536  -19.752 -29.666 1.00 57.45  ? 9   ASP D CB  1 
ATOM   2362 C CG  . ASP D 2 10  ? -0.104  -21.205 -29.852 1.00 60.66  ? 9   ASP D CG  1 
ATOM   2363 O OD1 . ASP D 2 10  ? -0.329  -22.000 -28.916 1.00 65.82  ? 9   ASP D OD1 1 
ATOM   2364 O OD2 . ASP D 2 10  ? 0.453   -21.553 -30.920 1.00 59.63  ? 9   ASP D OD2 1 
ATOM   2365 N N   . LEU D 2 11  ? -0.945  -16.856 -30.895 1.00 49.29  ? 10  LEU D N   1 
ATOM   2366 C CA  . LEU D 2 11  ? -1.586  -15.573 -30.685 1.00 47.31  ? 10  LEU D CA  1 
ATOM   2367 C C   . LEU D 2 11  ? -2.400  -15.583 -29.392 1.00 48.24  ? 10  LEU D C   1 
ATOM   2368 O O   . LEU D 2 11  ? -3.278  -16.422 -29.212 1.00 51.36  ? 10  LEU D O   1 
ATOM   2369 C CB  . LEU D 2 11  ? -2.477  -15.228 -31.879 1.00 50.20  ? 10  LEU D CB  1 
ATOM   2370 C CG  . LEU D 2 11  ? -3.397  -14.009 -31.755 1.00 45.94  ? 10  LEU D CG  1 
ATOM   2371 C CD1 . LEU D 2 11  ? -2.594  -12.715 -31.563 1.00 38.62  ? 10  LEU D CD1 1 
ATOM   2372 C CD2 . LEU D 2 11  ? -4.311  -13.904 -32.970 1.00 45.13  ? 10  LEU D CD2 1 
ATOM   2373 N N   . LEU D 2 12  ? -2.103  -14.636 -28.505 1.00 57.51  ? 11  LEU D N   1 
ATOM   2374 C CA  . LEU D 2 12  ? -2.903  -14.404 -27.304 1.00 58.28  ? 11  LEU D CA  1 
ATOM   2375 C C   . LEU D 2 12  ? -4.316  -13.949 -27.667 1.00 60.69  ? 11  LEU D C   1 
ATOM   2376 O O   . LEU D 2 12  ? -4.507  -12.853 -28.198 1.00 57.56  ? 11  LEU D O   1 
ATOM   2377 C CB  . LEU D 2 12  ? -2.222  -13.358 -26.415 1.00 52.19  ? 11  LEU D CB  1 
ATOM   2378 C CG  . LEU D 2 12  ? -2.716  -13.183 -24.977 1.00 52.79  ? 11  LEU D CG  1 
ATOM   2379 C CD1 . LEU D 2 12  ? -2.701  -14.505 -24.218 1.00 55.84  ? 11  LEU D CD1 1 
ATOM   2380 C CD2 . LEU D 2 12  ? -1.888  -12.127 -24.241 1.00 47.96  ? 11  LEU D CD2 1 
ATOM   2381 N N   . GLU D 2 13  ? -5.304  -14.796 -27.381 1.00 89.67  ? 12  GLU D N   1 
ATOM   2382 C CA  . GLU D 2 13  ? -6.679  -14.550 -27.824 1.00 93.83  ? 12  GLU D CA  1 
ATOM   2383 C C   . GLU D 2 13  ? -7.427  -13.597 -26.891 1.00 91.92  ? 12  GLU D C   1 
ATOM   2384 O O   . GLU D 2 13  ? -6.867  -13.036 -25.944 1.00 89.68  ? 12  GLU D O   1 
ATOM   2385 C CB  . GLU D 2 13  ? -7.454  -15.867 -27.974 1.00 100.54 ? 12  GLU D CB  1 
ATOM   2386 C CG  . GLU D 2 13  ? -6.876  -16.841 -29.014 1.00 108.09 ? 12  GLU D CG  1 
ATOM   2387 C CD  . GLU D 2 13  ? -7.235  -16.477 -30.454 1.00 111.99 ? 12  GLU D CD  1 
ATOM   2388 O OE1 . GLU D 2 13  ? -8.337  -15.932 -30.684 1.00 113.43 ? 12  GLU D OE1 1 
ATOM   2389 O OE2 . GLU D 2 13  ? -6.427  -16.773 -31.362 1.00 113.83 ? 12  GLU D OE2 1 
ATOM   2390 O OXT . GLU D 2 13  ? -8.617  -13.341 -27.085 1.00 93.28  ? 12  GLU D OXT 1 
HETATM 2391 I I   . IOD E 3 .   ? 7.701   -0.255  -11.709 0.50 32.98  ? 148 IOD A I   1 
HETATM 2392 I I   . IOD F 3 .   ? 2.489   -1.608  6.053   0.50 27.97  ? 149 IOD A I   1 
HETATM 2393 I I   . IOD G 3 .   ? 8.586   -13.424 6.857   0.50 74.90  ? 150 IOD A I   1 
HETATM 2394 I I   . IOD H 3 .   ? 14.062  -4.305  -19.655 0.50 38.03  ? 148 IOD B I   1 
HETATM 2395 I I   . IOD I 3 .   ? 3.706   10.435  -19.645 0.50 84.14  ? 149 IOD B I   1 
HETATM 2396 O O   . HOH J 4 .   ? 14.840  -0.220  -11.883 1.00 28.85  ? 151 HOH A O   1 
HETATM 2397 O O   . HOH J 4 .   ? -1.547  -10.076 -18.278 1.00 46.02  ? 152 HOH A O   1 
HETATM 2398 O O   . HOH J 4 .   ? 10.564  -11.846 3.678   1.00 25.66  ? 153 HOH A O   1 
HETATM 2399 O O   . HOH J 4 .   ? 12.734  -11.694 -14.000 1.00 30.54  ? 154 HOH A O   1 
HETATM 2400 O O   . HOH J 4 .   ? 1.485   -18.350 4.512   1.00 29.58  ? 155 HOH A O   1 
HETATM 2401 O O   . HOH J 4 .   ? 4.501   7.115   -3.635  1.00 38.99  ? 156 HOH A O   1 
HETATM 2402 O O   . HOH J 4 .   ? 8.278   15.657  3.584   1.00 64.97  ? 157 HOH A O   1 
HETATM 2403 O O   . HOH J 4 .   ? -5.071  -14.487 3.942   1.00 38.66  ? 158 HOH A O   1 
HETATM 2404 O O   . HOH J 4 .   ? -3.111  6.974   0.116   1.00 70.88  ? 159 HOH A O   1 
HETATM 2405 O O   . HOH J 4 .   ? 0.330   -31.869 -10.299 1.00 47.43  ? 160 HOH A O   1 
HETATM 2406 O O   . HOH J 4 .   ? 19.620  -13.396 -4.518  1.00 16.73  ? 161 HOH A O   1 
HETATM 2407 O O   . HOH J 4 .   ? 24.272  -8.717  -12.713 1.00 43.52  ? 162 HOH A O   1 
HETATM 2408 O O   . HOH J 4 .   ? 19.861  -2.160  -4.040  1.00 23.24  ? 163 HOH A O   1 
HETATM 2409 O O   . HOH J 4 .   ? 22.372  3.237   0.854   1.00 32.69  ? 164 HOH A O   1 
HETATM 2410 O O   . HOH J 4 .   ? 12.740  -1.785  5.965   1.00 28.42  ? 165 HOH A O   1 
HETATM 2411 O O   . HOH J 4 .   ? -2.968  -14.625 1.845   1.00 31.70  ? 166 HOH A O   1 
HETATM 2412 O O   . HOH J 4 .   ? -2.042  -7.367  -4.127  1.00 30.53  ? 167 HOH A O   1 
HETATM 2413 O O   . HOH J 4 .   ? 22.366  -10.519 -10.842 1.00 30.19  ? 168 HOH A O   1 
HETATM 2414 O O   . HOH J 4 .   ? 17.323  -11.028 -4.128  1.00 30.41  ? 169 HOH A O   1 
HETATM 2415 O O   . HOH J 4 .   ? 2.751   -4.604  -11.858 1.00 28.34  ? 170 HOH A O   1 
HETATM 2416 O O   . HOH J 4 .   ? 10.709  8.310   0.521   1.00 37.43  ? 171 HOH A O   1 
HETATM 2417 O O   . HOH J 4 .   ? 16.247  2.101   -12.245 1.00 32.50  ? 172 HOH A O   1 
HETATM 2418 O O   . HOH J 4 .   ? -0.427  -2.383  8.464   1.00 56.68  ? 173 HOH A O   1 
HETATM 2419 O O   . HOH J 4 .   ? 19.915  -14.337 -1.921  1.00 29.30  ? 174 HOH A O   1 
HETATM 2420 O O   . HOH J 4 .   ? 26.474  1.775   -7.227  1.00 43.35  ? 175 HOH A O   1 
HETATM 2421 O O   . HOH J 4 .   ? 0.656   -6.213  -10.988 1.00 37.91  ? 176 HOH A O   1 
HETATM 2422 O O   . HOH J 4 .   ? -1.822  -10.068 -11.283 1.00 35.37  ? 177 HOH A O   1 
HETATM 2423 O O   . HOH J 4 .   ? 10.740  -0.199  -14.118 1.00 31.45  ? 178 HOH A O   1 
HETATM 2424 O O   . HOH J 4 .   ? 6.779   5.093   7.535   1.00 36.52  ? 179 HOH A O   1 
HETATM 2425 O O   . HOH J 4 .   ? 18.336  -3.296  6.634   1.00 37.16  ? 180 HOH A O   1 
HETATM 2426 O O   . HOH J 4 .   ? 6.911   -7.481  9.785   1.00 35.02  ? 181 HOH A O   1 
HETATM 2427 O O   . HOH J 4 .   ? 14.823  -22.493 -10.590 1.00 48.97  ? 182 HOH A O   1 
HETATM 2428 O O   . HOH J 4 .   ? 15.236  0.018   -15.321 1.00 25.81  ? 183 HOH A O   1 
HETATM 2429 O O   . HOH J 4 .   ? 21.377  -5.076  -16.898 1.00 34.19  ? 184 HOH A O   1 
HETATM 2430 O O   . HOH J 4 .   ? -2.045  2.795   -4.485  1.00 47.04  ? 185 HOH A O   1 
HETATM 2431 O O   . HOH J 4 .   ? 10.539  -17.812 7.813   1.00 43.66  ? 186 HOH A O   1 
HETATM 2432 O O   . HOH J 4 .   ? 22.556  -15.747 -12.477 1.00 39.41  ? 187 HOH A O   1 
HETATM 2433 O O   . HOH J 4 .   ? 13.215  1.692   -14.332 1.00 31.51  ? 188 HOH A O   1 
HETATM 2434 O O   . HOH J 4 .   ? 14.728  3.754   -13.434 1.00 35.89  ? 189 HOH A O   1 
HETATM 2435 O O   . HOH J 4 .   ? 13.814  -6.061  6.995   1.00 40.38  ? 190 HOH A O   1 
HETATM 2436 O O   . HOH J 4 .   ? 15.605  -8.441  6.190   1.00 51.30  ? 191 HOH A O   1 
HETATM 2437 O O   . HOH J 4 .   ? 16.621  -8.354  3.376   1.00 44.92  ? 192 HOH A O   1 
HETATM 2438 O O   . HOH J 4 .   ? 3.688   7.647   -6.073  1.00 41.44  ? 193 HOH A O   1 
HETATM 2439 O O   . HOH J 4 .   ? -1.919  -3.812  -6.354  1.00 34.36  ? 194 HOH A O   1 
HETATM 2440 O O   . HOH J 4 .   ? 13.191  -5.924  9.567   1.00 41.33  ? 195 HOH A O   1 
HETATM 2441 O O   . HOH J 4 .   ? 13.450  -2.750  -17.108 1.00 34.58  ? 196 HOH A O   1 
HETATM 2442 O O   . HOH J 4 .   ? 15.482  -11.896 -14.736 1.00 50.72  ? 197 HOH A O   1 
HETATM 2443 O O   . HOH J 4 .   ? 13.225  7.501   -10.835 1.00 36.50  ? 198 HOH A O   1 
HETATM 2444 O O   . HOH J 4 .   ? 10.109  -11.159 -17.795 1.00 42.74  ? 199 HOH A O   1 
HETATM 2445 O O   . HOH J 4 .   ? 25.769  -5.563  -1.776  1.00 45.91  ? 200 HOH A O   1 
HETATM 2446 O O   . HOH J 4 .   ? 16.732  -13.733 -15.175 1.00 47.44  ? 201 HOH A O   1 
HETATM 2447 O O   . HOH J 4 .   ? -1.064  -20.181 5.606   1.00 59.97  ? 202 HOH A O   1 
HETATM 2448 O O   . HOH J 4 .   ? 8.126   -20.270 -20.044 1.00 47.64  ? 203 HOH A O   1 
HETATM 2449 O O   . HOH J 4 .   ? 6.287   -10.241 -17.816 1.00 49.65  ? 204 HOH A O   1 
HETATM 2450 O O   . HOH J 4 .   ? 11.601  -13.055 -15.965 1.00 41.12  ? 205 HOH A O   1 
HETATM 2451 O O   . HOH J 4 .   ? 20.450  -23.862 -11.941 1.00 67.51  ? 206 HOH A O   1 
HETATM 2452 O O   . HOH J 4 .   ? 14.901  7.383   -8.417  1.00 37.05  ? 207 HOH A O   1 
HETATM 2453 O O   . HOH J 4 .   ? -0.598  -6.064  -6.436  1.00 30.05  ? 208 HOH A O   1 
HETATM 2454 O O   . HOH J 4 .   ? 21.988  -21.584 -13.239 1.00 51.52  ? 209 HOH A O   1 
HETATM 2455 O O   . HOH J 4 .   ? 0.437   -7.316  -8.523  1.00 25.48  ? 210 HOH A O   1 
HETATM 2456 O O   . HOH J 4 .   ? 23.773  1.027   1.431   1.00 29.77  ? 211 HOH A O   1 
HETATM 2457 O O   . HOH J 4 .   ? 1.455   -21.540 5.940   1.00 36.99  ? 212 HOH A O   1 
HETATM 2458 O O   . HOH J 4 .   ? 14.948  -21.901 -3.667  1.00 29.92  ? 213 HOH A O   1 
HETATM 2459 O O   . HOH J 4 .   ? 20.131  -19.670 -14.826 1.00 42.51  ? 214 HOH A O   1 
HETATM 2460 O O   . HOH J 4 .   ? 7.721   15.816  -0.811  1.00 74.02  ? 215 HOH A O   1 
HETATM 2461 O O   . HOH J 4 .   ? 11.781  -13.726 4.123   1.00 43.40  ? 216 HOH A O   1 
HETATM 2462 O O   . HOH J 4 .   ? 10.511  11.580  -5.959  1.00 41.56  ? 217 HOH A O   1 
HETATM 2463 O O   . HOH J 4 .   ? -4.992  -11.798 4.411   1.00 51.63  ? 218 HOH A O   1 
HETATM 2464 O O   . HOH J 4 .   ? 21.267  -7.371  -14.955 1.00 34.83  ? 219 HOH A O   1 
HETATM 2465 O O   . HOH J 4 .   ? 21.321  3.687   -5.999  1.00 39.21  ? 220 HOH A O   1 
HETATM 2466 O O   . HOH J 4 .   ? 5.638   -6.776  -16.040 1.00 61.22  ? 221 HOH A O   1 
HETATM 2467 O O   . HOH J 4 .   ? 3.825   4.738   -11.126 1.00 50.64  ? 222 HOH A O   1 
HETATM 2468 O O   . HOH J 4 .   ? 18.404  -11.165 -0.372  1.00 43.76  ? 223 HOH A O   1 
HETATM 2469 O O   . HOH J 4 .   ? 12.320  -25.787 -9.054  1.00 47.36  ? 224 HOH A O   1 
HETATM 2470 O O   . HOH J 4 .   ? 3.476   -7.400  -13.145 1.00 49.29  ? 225 HOH A O   1 
HETATM 2471 O O   . HOH J 4 .   ? 11.952  -1.426  -15.639 1.00 41.01  ? 226 HOH A O   1 
HETATM 2472 O O   . HOH J 4 .   ? -0.275  -0.410  -11.732 1.00 60.45  ? 227 HOH A O   1 
HETATM 2473 O O   . HOH J 4 .   ? -0.028  6.858   -2.764  1.00 61.59  ? 228 HOH A O   1 
HETATM 2474 O O   . HOH J 4 .   ? 10.669  -23.509 -12.909 1.00 32.82  ? 229 HOH A O   1 
HETATM 2475 O O   . HOH K 4 .   ? -10.544 -13.370 -1.271  1.00 31.02  ? 55  HOH C O   1 
HETATM 2476 O O   . HOH K 4 .   ? -9.683  -15.603 -5.269  1.00 45.84  ? 81  HOH C O   1 
HETATM 2477 O O   . HOH K 4 .   ? -5.781  -16.056 -12.661 1.00 50.65  ? 82  HOH C O   1 
HETATM 2478 O O   . HOH K 4 .   ? -8.724  -13.687 -11.964 1.00 51.98  ? 86  HOH C O   1 
HETATM 2479 O O   . HOH K 4 .   ? -8.555  -18.649 -6.651  1.00 49.63  ? 95  HOH C O   1 
HETATM 2480 O O   . HOH K 4 .   ? -12.267 -13.342 -8.460  1.00 43.30  ? 145 HOH C O   1 
HETATM 2481 O O   . HOH L 4 .   ? 15.086  9.576   -34.753 1.00 53.16  ? 150 HOH B O   1 
HETATM 2482 O O   . HOH L 4 .   ? 2.820   -14.887 -18.586 1.00 38.63  ? 151 HOH B O   1 
HETATM 2483 O O   . HOH L 4 .   ? -4.780  4.649   -35.351 1.00 60.09  ? 152 HOH B O   1 
HETATM 2484 O O   . HOH L 4 .   ? 5.390   1.549   -40.980 1.00 30.70  ? 153 HOH B O   1 
HETATM 2485 O O   . HOH L 4 .   ? 5.467   -19.417 -36.581 1.00 56.45  ? 154 HOH B O   1 
HETATM 2486 O O   . HOH L 4 .   ? 1.368   -6.088  -41.074 1.00 32.26  ? 155 HOH B O   1 
HETATM 2487 O O   . HOH L 4 .   ? 13.736  2.404   -17.766 1.00 28.65  ? 156 HOH B O   1 
HETATM 2488 O O   . HOH L 4 .   ? -7.726  -9.822  -25.621 1.00 50.27  ? 157 HOH B O   1 
HETATM 2489 O O   . HOH L 4 .   ? 8.607   -10.358 -26.422 1.00 30.99  ? 158 HOH B O   1 
HETATM 2490 O O   . HOH L 4 .   ? -0.278  3.768   -17.743 1.00 41.86  ? 159 HOH B O   1 
HETATM 2491 O O   . HOH L 4 .   ? 15.960  12.219  -33.887 1.00 48.80  ? 160 HOH B O   1 
HETATM 2492 O O   . HOH L 4 .   ? 20.356  5.217   -35.035 1.00 69.08  ? 161 HOH B O   1 
HETATM 2493 O O   . HOH L 4 .   ? 16.562  14.893  -18.994 1.00 51.20  ? 162 HOH B O   1 
HETATM 2494 O O   . HOH L 4 .   ? 6.159   -5.647  -45.323 1.00 32.35  ? 163 HOH B O   1 
HETATM 2495 O O   . HOH L 4 .   ? 13.775  9.243   -24.109 1.00 31.68  ? 164 HOH B O   1 
HETATM 2496 O O   . HOH L 4 .   ? 21.717  4.562   -26.929 1.00 41.61  ? 165 HOH B O   1 
HETATM 2497 O O   . HOH L 4 .   ? 4.717   -11.070 -38.983 1.00 35.64  ? 166 HOH B O   1 
HETATM 2498 O O   . HOH L 4 .   ? 4.969   3.918   -37.383 1.00 35.15  ? 167 HOH B O   1 
HETATM 2499 O O   . HOH L 4 .   ? 6.806   2.646   -36.223 1.00 34.23  ? 168 HOH B O   1 
HETATM 2500 O O   . HOH L 4 .   ? 2.182   0.342   -19.369 1.00 30.14  ? 169 HOH B O   1 
HETATM 2501 O O   . HOH L 4 .   ? 24.728  -4.491  -19.302 1.00 42.51  ? 170 HOH B O   1 
HETATM 2502 O O   . HOH L 4 .   ? 15.854  3.573   -16.521 1.00 32.99  ? 171 HOH B O   1 
HETATM 2503 O O   . HOH L 4 .   ? 10.239  -8.949  -21.867 1.00 33.89  ? 172 HOH B O   1 
HETATM 2504 O O   . HOH L 4 .   ? 2.055   3.535   -42.066 1.00 35.11  ? 173 HOH B O   1 
HETATM 2505 O O   . HOH L 4 .   ? 0.936   -9.437  -47.144 1.00 46.79  ? 174 HOH B O   1 
HETATM 2506 O O   . HOH L 4 .   ? 16.397  -1.812  -37.108 1.00 43.11  ? 175 HOH B O   1 
HETATM 2507 O O   . HOH L 4 .   ? 26.339  -5.218  -16.808 1.00 42.11  ? 176 HOH B O   1 
HETATM 2508 O O   . HOH L 4 .   ? -0.467  -7.606  -43.560 1.00 55.96  ? 177 HOH B O   1 
HETATM 2509 O O   . HOH L 4 .   ? -0.583  -0.984  -47.309 1.00 33.78  ? 178 HOH B O   1 
HETATM 2510 O O   . HOH L 4 .   ? -0.846  -14.614 -39.337 1.00 48.98  ? 179 HOH B O   1 
HETATM 2511 O O   . HOH L 4 .   ? -2.503  -5.631  -10.478 1.00 43.06  ? 180 HOH B O   1 
HETATM 2512 O O   . HOH L 4 .   ? 23.624  -5.662  -26.003 1.00 41.57  ? 181 HOH B O   1 
HETATM 2513 O O   . HOH L 4 .   ? 20.554  -14.526 -30.760 1.00 61.28  ? 182 HOH B O   1 
HETATM 2514 O O   . HOH L 4 .   ? 22.065  3.150   -18.733 1.00 39.64  ? 183 HOH B O   1 
HETATM 2515 O O   . HOH L 4 .   ? 22.717  -10.406 -38.457 1.00 50.63  ? 184 HOH B O   1 
HETATM 2516 O O   . HOH L 4 .   ? 17.383  2.024   -14.983 1.00 29.47  ? 185 HOH B O   1 
HETATM 2517 O O   . HOH L 4 .   ? 23.592  -7.059  -23.677 1.00 43.16  ? 186 HOH B O   1 
HETATM 2518 O O   . HOH L 4 .   ? 16.731  5.871   -35.140 1.00 50.43  ? 187 HOH B O   1 
HETATM 2519 O O   . HOH L 4 .   ? -10.238 6.273   -25.869 1.00 60.90  ? 188 HOH B O   1 
HETATM 2520 O O   . HOH L 4 .   ? 13.822  -2.070  -38.213 1.00 33.52  ? 189 HOH B O   1 
HETATM 2521 O O   . HOH L 4 .   ? 20.163  4.722   -16.764 1.00 48.49  ? 190 HOH B O   1 
HETATM 2522 O O   . HOH L 4 .   ? 10.029  15.321  -24.644 1.00 48.92  ? 191 HOH B O   1 
HETATM 2523 O O   . HOH L 4 .   ? 29.752  -0.493  -23.428 1.00 47.98  ? 192 HOH B O   1 
HETATM 2524 O O   . HOH L 4 .   ? 17.965  -12.622 -35.066 1.00 51.87  ? 193 HOH B O   1 
HETATM 2525 O O   . HOH L 4 .   ? -4.942  -2.208  -41.599 1.00 53.88  ? 194 HOH B O   1 
HETATM 2526 O O   . HOH L 4 .   ? 10.107  8.159   -34.030 1.00 43.39  ? 195 HOH B O   1 
HETATM 2527 O O   . HOH L 4 .   ? 27.574  -1.937  -19.137 1.00 50.14  ? 196 HOH B O   1 
HETATM 2528 O O   . HOH L 4 .   ? 19.485  -8.164  -19.559 1.00 49.68  ? 197 HOH B O   1 
HETATM 2529 O O   . HOH L 4 .   ? 17.172  5.984   -10.405 1.00 41.81  ? 198 HOH B O   1 
HETATM 2530 O O   . HOH L 4 .   ? 13.626  -12.451 -21.324 1.00 59.66  ? 199 HOH B O   1 
HETATM 2531 O O   . HOH L 4 .   ? 7.982   -6.402  -43.705 1.00 42.05  ? 200 HOH B O   1 
HETATM 2532 O O   . HOH L 4 .   ? -8.488  -5.766  -39.485 1.00 64.64  ? 201 HOH B O   1 
HETATM 2533 O O   . HOH L 4 .   ? -7.465  2.912   -25.321 1.00 73.13  ? 202 HOH B O   1 
HETATM 2534 O O   . HOH L 4 .   ? 13.996  15.993  -26.583 1.00 39.91  ? 203 HOH B O   1 
HETATM 2535 O O   . HOH L 4 .   ? 21.560  1.016   -16.847 1.00 36.81  ? 204 HOH B O   1 
HETATM 2536 O O   . HOH L 4 .   ? 9.814   -11.534 -31.186 1.00 44.82  ? 205 HOH B O   1 
HETATM 2537 O O   . HOH L 4 .   ? 18.950  6.069   -13.582 1.00 44.58  ? 206 HOH B O   1 
HETATM 2538 O O   . HOH L 4 .   ? 21.244  10.864  -32.362 1.00 51.64  ? 207 HOH B O   1 
HETATM 2539 O O   . HOH L 4 .   ? 15.033  6.342   -12.807 1.00 38.02  ? 208 HOH B O   1 
HETATM 2540 O O   . HOH L 4 .   ? -1.647  8.157   -27.158 1.00 40.51  ? 209 HOH B O   1 
HETATM 2541 O O   . HOH L 4 .   ? -4.430  8.423   -20.432 1.00 43.02  ? 210 HOH B O   1 
HETATM 2542 O O   . HOH L 4 .   ? -7.324  -11.747 -36.371 1.00 47.57  ? 211 HOH B O   1 
HETATM 2543 O O   . HOH L 4 .   ? 21.686  -9.661  -22.336 1.00 38.82  ? 212 HOH B O   1 
HETATM 2544 O O   . HOH L 4 .   ? 10.315  -10.997 -28.364 1.00 38.34  ? 213 HOH B O   1 
HETATM 2545 O O   . HOH L 4 .   ? 9.391   0.883   -42.066 1.00 47.59  ? 214 HOH B O   1 
HETATM 2546 O O   . HOH L 4 .   ? 7.756   -5.371  -47.489 1.00 37.77  ? 215 HOH B O   1 
HETATM 2547 O O   . HOH M 4 .   ? 5.254   -13.284 -25.232 1.00 36.57  ? 123 HOH D O   1 
HETATM 2548 O O   . HOH M 4 .   ? -1.181  -18.446 -33.393 1.00 41.82  ? 149 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . PRO A 9   ? 1.1205 0.8695 0.9729 -0.0214 0.0254  -0.0687 7   PRO A N   
2    C CA  . PRO A 9   ? 1.0735 0.8608 0.9356 -0.0347 0.0200  -0.0573 7   PRO A CA  
3    C C   . PRO A 9   ? 1.0210 0.8300 0.9048 -0.0229 0.0112  -0.0461 7   PRO A C   
4    O O   . PRO A 9   ? 1.0065 0.8109 0.9050 -0.0021 0.0092  -0.0483 7   PRO A O   
5    C CB  . PRO A 9   ? 1.0674 0.8845 0.9444 -0.0354 0.0285  -0.0653 7   PRO A CB  
6    C CG  . PRO A 9   ? 1.0964 0.9012 0.9837 -0.0152 0.0380  -0.0798 7   PRO A CG  
7    C CD  . PRO A 9   ? 1.1244 0.8877 0.9996 -0.0040 0.0351  -0.0814 7   PRO A CD  
8    N N   . GLU A 10  ? 0.8670 0.6996 0.7526 -0.0364 0.0058  -0.0343 8   GLU A N   
9    C CA  . GLU A 10  ? 0.8163 0.6671 0.7171 -0.0284 -0.0015 -0.0238 8   GLU A CA  
10   C C   . GLU A 10  ? 0.7524 0.6333 0.6837 -0.0107 -0.0003 -0.0278 8   GLU A C   
11   O O   . GLU A 10  ? 0.7373 0.6361 0.6801 -0.0104 0.0065  -0.0356 8   GLU A O   
12   C CB  . GLU A 10  ? 0.8183 0.6909 0.7169 -0.0469 -0.0048 -0.0120 8   GLU A CB  
13   C CG  . GLU A 10  ? 0.9317 0.7797 0.8025 -0.0677 -0.0061 -0.0076 8   GLU A CG  
14   C CD  . GLU A 10  ? 1.0160 0.8893 0.8876 -0.0885 -0.0057 -0.0027 8   GLU A CD  
15   O OE1 . GLU A 10  ? 1.0158 0.9149 0.8986 -0.0942 -0.0088 0.0079  8   GLU A OE1 
16   O OE2 . GLU A 10  ? 1.0697 0.9360 0.9299 -0.0994 -0.0025 -0.0094 8   GLU A OE2 
17   N N   . THR A 11  ? 0.5728 0.4584 0.5151 0.0023  -0.0072 -0.0218 9   THR A N   
18   C CA  . THR A 11  ? 0.4968 0.4065 0.4669 0.0196  -0.0080 -0.0254 9   THR A CA  
19   C C   . THR A 11  ? 0.4419 0.3899 0.4271 0.0127  -0.0073 -0.0207 9   THR A C   
20   O O   . THR A 11  ? 0.4324 0.3874 0.4082 -0.0020 -0.0082 -0.0126 9   THR A O   
21   C CB  . THR A 11  ? 0.4851 0.3831 0.4582 0.0348  -0.0179 -0.0200 9   THR A CB  
22   O OG1 . THR A 11  ? 0.4533 0.3536 0.4149 0.0253  -0.0236 -0.0078 9   THR A OG1 
23   C CG2 . THR A 11  ? 0.5380 0.3944 0.4955 0.0428  -0.0199 -0.0233 9   THR A CG2 
24   N N   . LEU A 12  ? 0.4557 0.4282 0.4649 0.0230  -0.0050 -0.0263 10  LEU A N   
25   C CA  . LEU A 12  ? 0.4301 0.4360 0.4549 0.0200  -0.0055 -0.0218 10  LEU A CA  
26   C C   . LEU A 12  ? 0.4077 0.4165 0.4278 0.0182  -0.0129 -0.0105 10  LEU A C   
27   O O   . LEU A 12  ? 0.4137 0.4407 0.4351 0.0082  -0.0119 -0.0043 10  LEU A O   
28   C CB  . LEU A 12  ? 0.4272 0.4529 0.4778 0.0340  -0.0044 -0.0288 10  LEU A CB  
29   C CG  . LEU A 12  ? 0.4607 0.5109 0.5251 0.0295  0.0036  -0.0349 10  LEU A CG  
30   C CD1 . LEU A 12  ? 0.4424 0.4859 0.4899 0.0136  0.0107  -0.0370 10  LEU A CD1 
31   C CD2 . LEU A 12  ? 0.4795 0.5372 0.5650 0.0437  0.0072  -0.0450 10  LEU A CD2 
32   N N   . GLU A 13  ? 0.3644 0.3553 0.3793 0.0283  -0.0199 -0.0077 11  GLU A N   
33   C CA  . GLU A 13  ? 0.3603 0.3495 0.3659 0.0260  -0.0260 0.0025  11  GLU A CA  
34   C C   . GLU A 13  ? 0.3641 0.3458 0.3503 0.0085  -0.0234 0.0101  11  GLU A C   
35   O O   . GLU A 13  ? 0.3435 0.3436 0.3319 0.0011  -0.0220 0.0165  11  GLU A O   
36   C CB  . GLU A 13  ? 0.3869 0.3527 0.3852 0.0386  -0.0352 0.0046  11  GLU A CB  
37   C CG  . GLU A 13  ? 0.4081 0.3882 0.4289 0.0552  -0.0405 0.0001  11  GLU A CG  
38   C CD  . GLU A 13  ? 0.4878 0.4628 0.5231 0.0669  -0.0384 -0.0102 11  GLU A CD  
39   O OE1 . GLU A 13  ? 0.5115 0.4936 0.5653 0.0818  -0.0446 -0.0131 11  GLU A OE1 
40   O OE2 . GLU A 13  ? 0.4598 0.4240 0.4884 0.0611  -0.0305 -0.0155 11  GLU A OE2 
41   N N   . ALA A 14  ? 0.4223 0.3783 0.3910 0.0015  -0.0220 0.0087  12  ALA A N   
42   C CA  . ALA A 14  ? 0.4299 0.3787 0.3808 -0.0170 -0.0199 0.0156  12  ALA A CA  
43   C C   . ALA A 14  ? 0.4301 0.4089 0.3924 -0.0289 -0.0149 0.0166  12  ALA A C   
44   O O   . ALA A 14  ? 0.4415 0.4321 0.4018 -0.0404 -0.0141 0.0249  12  ALA A O   
45   C CB  . ALA A 14  ? 0.4674 0.3813 0.3970 -0.0229 -0.0195 0.0123  12  ALA A CB  
46   N N   . ARG A 15  ? 0.3932 0.3841 0.3675 -0.0265 -0.0112 0.0086  13  ARG A N   
47   C CA  . ARG A 15  ? 0.3981 0.4145 0.3809 -0.0384 -0.0079 0.0102  13  ARG A CA  
48   C C   . ARG A 15  ? 0.3598 0.4043 0.3596 -0.0352 -0.0086 0.0166  13  ARG A C   
49   O O   . ARG A 15  ? 0.3599 0.4203 0.3624 -0.0463 -0.0079 0.0239  13  ARG A O   
50   C CB  . ARG A 15  ? 0.3754 0.3999 0.3670 -0.0356 -0.0036 0.0006  13  ARG A CB  
51   C CG  . ARG A 15  ? 0.4344 0.4333 0.4107 -0.0380 -0.0001 -0.0086 13  ARG A CG  
52   C CD  . ARG A 15  ? 0.5549 0.5283 0.5068 -0.0518 -0.0018 -0.0052 13  ARG A CD  
53   N NE  . ARG A 15  ? 0.5877 0.5718 0.5327 -0.0718 -0.0022 -0.0001 13  ARG A NE  
54   C CZ  . ARG A 15  ? 0.5922 0.5621 0.5200 -0.0849 -0.0001 -0.0051 13  ARG A CZ  
55   N NH1 . ARG A 15  ? 0.5444 0.5226 0.4647 -0.1045 -0.0032 0.0017  13  ARG A NH1 
56   N NH2 . ARG A 15  ? 0.6124 0.5600 0.5305 -0.0786 0.0051  -0.0170 13  ARG A NH2 
57   N N   . ILE A 16  ? 0.3946 0.4468 0.4077 -0.0202 -0.0097 0.0130  14  ILE A N   
58   C CA  . ILE A 16  ? 0.3442 0.4216 0.3731 -0.0162 -0.0096 0.0168  14  ILE A CA  
59   C C   . ILE A 16  ? 0.3421 0.4179 0.3632 -0.0196 -0.0106 0.0257  14  ILE A C   
60   O O   . ILE A 16  ? 0.3112 0.4073 0.3419 -0.0223 -0.0083 0.0306  14  ILE A O   
61   C CB  . ILE A 16  ? 0.3414 0.4257 0.3847 -0.0006 -0.0115 0.0106  14  ILE A CB  
62   C CG1 . ILE A 16  ? 0.2682 0.3784 0.3275 0.0006  -0.0100 0.0127  14  ILE A CG1 
63   C CG2 . ILE A 16  ? 0.3248 0.3923 0.3607 0.0095  -0.0173 0.0118  14  ILE A CG2 
64   C CD1 . ILE A 16  ? 0.3266 0.4535 0.3927 -0.0096 -0.0061 0.0139  14  ILE A CD1 
65   N N   . ASN A 17  ? 0.3165 0.3668 0.3196 -0.0195 -0.0135 0.0276  15  ASN A N   
66   C CA  . ASN A 17  ? 0.3047 0.3501 0.2962 -0.0245 -0.0134 0.0359  15  ASN A CA  
67   C C   . ASN A 17  ? 0.3137 0.3700 0.3040 -0.0413 -0.0089 0.0426  15  ASN A C   
68   O O   . ASN A 17  ? 0.2806 0.3530 0.2761 -0.0451 -0.0051 0.0487  15  ASN A O   
69   C CB  . ASN A 17  ? 0.3406 0.3526 0.3104 -0.0212 -0.0185 0.0372  15  ASN A CB  
70   C CG  . ASN A 17  ? 0.3525 0.3574 0.3253 -0.0041 -0.0249 0.0334  15  ASN A CG  
71   O OD1 . ASN A 17  ? 0.3962 0.4214 0.3849 0.0035  -0.0250 0.0309  15  ASN A OD1 
72   N ND2 . ASN A 17  ? 0.3406 0.3159 0.2975 0.0013  -0.0312 0.0338  15  ASN A ND2 
73   N N   . ARG A 18  ? 0.4105 0.4596 0.3953 -0.0515 -0.0090 0.0411  16  ARG A N   
74   C CA  . ARG A 18  ? 0.4184 0.4829 0.4065 -0.0684 -0.0065 0.0472  16  ARG A CA  
75   C C   . ARG A 18  ? 0.3668 0.4651 0.3786 -0.0681 -0.0046 0.0483  16  ARG A C   
76   O O   . ARG A 18  ? 0.3292 0.4488 0.3516 -0.0764 -0.0023 0.0557  16  ARG A O   
77   C CB  . ARG A 18  ? 0.4559 0.5017 0.4293 -0.0801 -0.0084 0.0443  16  ARG A CB  
78   C CG  . ARG A 18  ? 0.5860 0.6121 0.5395 -0.0947 -0.0090 0.0502  16  ARG A CG  
79   C CD  . ARG A 18  ? 0.7319 0.7376 0.6694 -0.1067 -0.0110 0.0459  16  ARG A CD  
80   N NE  . ARG A 18  ? 0.8047 0.7789 0.7287 -0.0950 -0.0121 0.0366  16  ARG A NE  
81   C CZ  . ARG A 18  ? 0.8011 0.7724 0.7275 -0.0896 -0.0111 0.0271  16  ARG A CZ  
82   N NH1 . ARG A 18  ? 0.8026 0.7465 0.7198 -0.0774 -0.0111 0.0188  16  ARG A NH1 
83   N NH2 . ARG A 18  ? 0.7251 0.7202 0.6629 -0.0964 -0.0101 0.0261  16  ARG A NH2 
84   N N   . ALA A 19  ? 0.3737 0.4765 0.3939 -0.0598 -0.0056 0.0413  17  ALA A N   
85   C CA  . ALA A 19  ? 0.3372 0.4676 0.3769 -0.0603 -0.0048 0.0425  17  ALA A CA  
86   C C   . ALA A 19  ? 0.2965 0.4469 0.3521 -0.0522 -0.0021 0.0466  17  ALA A C   
87   O O   . ALA A 19  ? 0.2705 0.4442 0.3425 -0.0547 -0.0012 0.0510  17  ALA A O   
88   C CB  . ALA A 19  ? 0.2854 0.4142 0.3283 -0.0539 -0.0053 0.0338  17  ALA A CB  
89   N N   . THR A 20  ? 0.3090 0.4488 0.3587 -0.0426 -0.0013 0.0452  18  THR A N   
90   C CA  . THR A 20  ? 0.2565 0.4107 0.3174 -0.0341 0.0018  0.0470  18  THR A CA  
91   C C   . THR A 20  ? 0.2892 0.4394 0.3410 -0.0374 0.0057  0.0528  18  THR A C   
92   O O   . THR A 20  ? 0.2596 0.4143 0.3135 -0.0305 0.0092  0.0532  18  THR A O   
93   C CB  . THR A 20  ? 0.2349 0.3827 0.2968 -0.0201 -0.0006 0.0398  18  THR A CB  
94   O OG1 . THR A 20  ? 0.2783 0.4017 0.3232 -0.0161 -0.0043 0.0372  18  THR A OG1 
95   C CG2 . THR A 20  ? 0.1920 0.3464 0.2642 -0.0181 -0.0024 0.0340  18  THR A CG2 
96   N N   . ASN A 21  ? 0.3198 0.4587 0.3588 -0.0490 0.0056  0.0568  19  ASN A N   
97   C CA  . ASN A 21  ? 0.3355 0.4686 0.3631 -0.0544 0.0101  0.0626  19  ASN A CA  
98   C C   . ASN A 21  ? 0.2936 0.4546 0.3394 -0.0556 0.0180  0.0676  19  ASN A C   
99   O O   . ASN A 21  ? 0.2533 0.4369 0.3178 -0.0618 0.0190  0.0711  19  ASN A O   
100  C CB  . ASN A 21  ? 0.3918 0.5110 0.4051 -0.0696 0.0087  0.0666  19  ASN A CB  
101  C CG  . ASN A 21  ? 0.4406 0.5459 0.4358 -0.0758 0.0127  0.0720  19  ASN A CG  
102  O OD1 . ASN A 21  ? 0.4427 0.5608 0.4426 -0.0742 0.0197  0.0751  19  ASN A OD1 
103  N ND2 . ASN A 21  ? 0.5589 0.6361 0.5316 -0.0836 0.0090  0.0730  19  ASN A ND2 
104  N N   . PRO A 22  ? 0.2821 0.4413 0.3230 -0.0485 0.0233  0.0673  20  PRO A N   
105  C CA  . PRO A 22  ? 0.2634 0.4477 0.3220 -0.0481 0.0330  0.0708  20  PRO A CA  
106  C C   . PRO A 22  ? 0.2858 0.4825 0.3484 -0.0623 0.0399  0.0787  20  PRO A C   
107  O O   . PRO A 22  ? 0.2806 0.5021 0.3629 -0.0623 0.0485  0.0820  20  PRO A O   
108  C CB  . PRO A 22  ? 0.2775 0.4500 0.3224 -0.0384 0.0371  0.0674  20  PRO A CB  
109  C CG  . PRO A 22  ? 0.3273 0.4679 0.3438 -0.0387 0.0298  0.0657  20  PRO A CG  
110  C CD  . PRO A 22  ? 0.3082 0.4422 0.3273 -0.0404 0.0204  0.0637  20  PRO A CD  
111  N N   . LEU A 23  ? 0.3220 0.5026 0.3682 -0.0745 0.0362  0.0816  21  LEU A N   
112  C CA  . LEU A 23  ? 0.3613 0.5555 0.4134 -0.0909 0.0411  0.0892  21  LEU A CA  
113  C C   . LEU A 23  ? 0.3266 0.5445 0.4023 -0.0983 0.0360  0.0923  21  LEU A C   
114  O O   . LEU A 23  ? 0.3231 0.5630 0.4140 -0.1103 0.0398  0.0992  21  LEU A O   
115  C CB  . LEU A 23  ? 0.4444 0.6088 0.4664 -0.1030 0.0392  0.0917  21  LEU A CB  
116  C CG  . LEU A 23  ? 0.4618 0.6051 0.4582 -0.1024 0.0455  0.0927  21  LEU A CG  
117  C CD1 . LEU A 23  ? 0.5057 0.6112 0.4694 -0.1111 0.0389  0.0943  21  LEU A CD1 
118  C CD2 . LEU A 23  ? 0.5236 0.6890 0.5294 -0.1109 0.0596  0.0985  21  LEU A CD2 
119  N N   . ASN A 24  ? 0.3224 0.5376 0.4021 -0.0915 0.0275  0.0875  22  ASN A N   
120  C CA  . ASN A 24  ? 0.3086 0.5408 0.4041 -0.0997 0.0209  0.0902  22  ASN A CA  
121  C C   . ASN A 24  ? 0.2764 0.5467 0.4049 -0.1000 0.0250  0.0969  22  ASN A C   
122  O O   . ASN A 24  ? 0.2166 0.4993 0.3601 -0.0862 0.0292  0.0952  22  ASN A O   
123  C CB  . ASN A 24  ? 0.2813 0.5049 0.3752 -0.0904 0.0135  0.0833  22  ASN A CB  
124  C CG  . ASN A 24  ? 0.3254 0.5149 0.3920 -0.0916 0.0083  0.0769  22  ASN A CG  
125  O OD1 . ASN A 24  ? 0.3431 0.5136 0.3909 -0.1009 0.0084  0.0784  22  ASN A OD1 
126  N ND2 . ASN A 24  ? 0.2762 0.4582 0.3414 -0.0825 0.0041  0.0698  22  ASN A ND2 
127  N N   . LYS A 25  ? 0.4038 0.6923 0.5443 -0.1157 0.0227  0.1044  23  LYS A N   
128  C CA  . LYS A 25  ? 0.3874 0.7151 0.5635 -0.1163 0.0248  0.1119  23  LYS A CA  
129  C C   . LYS A 25  ? 0.3614 0.7023 0.5537 -0.1116 0.0149  0.1127  23  LYS A C   
130  O O   . LYS A 25  ? 0.3451 0.7163 0.5682 -0.1074 0.0151  0.1186  23  LYS A O   
131  C CB  . LYS A 25  ? 0.4057 0.7508 0.5909 -0.1361 0.0249  0.1205  23  LYS A CB  
132  C CG  . LYS A 25  ? 0.5004 0.8339 0.6697 -0.1434 0.0356  0.1211  23  LYS A CG  
133  C CD  . LYS A 25  ? 0.5687 0.9339 0.7656 -0.1402 0.0492  0.1259  23  LYS A CD  
134  C CE  . LYS A 25  ? 0.5525 0.9256 0.7635 -0.1179 0.0557  0.1214  23  LYS A CE  
135  N NZ  . LYS A 25  ? 0.5467 0.9496 0.7845 -0.1142 0.0709  0.1250  23  LYS A NZ  
136  N N   . GLU A 26  ? 0.2816 0.5993 0.4530 -0.1130 0.0064  0.1072  24  GLU A N   
137  C CA  . GLU A 26  ? 0.2617 0.5866 0.4416 -0.1102 -0.0027 0.1073  24  GLU A CA  
138  C C   . GLU A 26  ? 0.2718 0.5647 0.4237 -0.1073 -0.0063 0.0976  24  GLU A C   
139  O O   . GLU A 26  ? 0.2852 0.5529 0.4144 -0.1082 -0.0033 0.0921  24  GLU A O   
140  C CB  . GLU A 26  ? 0.2805 0.6246 0.4718 -0.1273 -0.0124 0.1160  24  GLU A CB  
141  C CG  . GLU A 26  ? 0.3872 0.7087 0.5510 -0.1451 -0.0181 0.1140  24  GLU A CG  
142  C CD  . GLU A 26  ? 0.5365 0.8765 0.7106 -0.1641 -0.0210 0.1230  24  GLU A CD  
143  O OE1 . GLU A 26  ? 0.5879 0.9305 0.7639 -0.1668 -0.0123 0.1249  24  GLU A OE1 
144  O OE2 . GLU A 26  ? 0.6028 0.9546 0.7820 -0.1773 -0.0323 0.1285  24  GLU A OE2 
145  N N   . LEU A 27  ? 0.2812 0.5754 0.4354 -0.1038 -0.0124 0.0958  25  LEU A N   
146  C CA  . LEU A 27  ? 0.2830 0.5509 0.4146 -0.1004 -0.0142 0.0861  25  LEU A CA  
147  C C   . LEU A 27  ? 0.3358 0.5824 0.4429 -0.1156 -0.0181 0.0834  25  LEU A C   
148  O O   . LEU A 27  ? 0.3304 0.5858 0.4385 -0.1313 -0.0240 0.0896  25  LEU A O   
149  C CB  . LEU A 27  ? 0.2515 0.5268 0.3905 -0.0961 -0.0190 0.0857  25  LEU A CB  
150  C CG  . LEU A 27  ? 0.2398 0.5282 0.3981 -0.0800 -0.0154 0.0863  25  LEU A CG  
151  C CD1 . LEU A 27  ? 0.2322 0.5251 0.3941 -0.0794 -0.0215 0.0872  25  LEU A CD1 
152  C CD2 . LEU A 27  ? 0.2008 0.4732 0.3509 -0.0662 -0.0079 0.0775  25  LEU A CD2 
153  N N   . ASP A 28  ? 0.2777 0.4960 0.3635 -0.1107 -0.0148 0.0745  26  ASP A N   
154  C CA  . ASP A 28  ? 0.3168 0.5089 0.3770 -0.1225 -0.0171 0.0703  26  ASP A CA  
155  C C   . ASP A 28  ? 0.3219 0.4992 0.3693 -0.1210 -0.0191 0.0616  26  ASP A C   
156  O O   . ASP A 28  ? 0.3299 0.4907 0.3699 -0.1086 -0.0153 0.0528  26  ASP A O   
157  C CB  . ASP A 28  ? 0.3581 0.5264 0.4034 -0.1164 -0.0122 0.0663  26  ASP A CB  
158  C CG  . ASP A 28  ? 0.4515 0.5873 0.4690 -0.1265 -0.0141 0.0614  26  ASP A CG  
159  O OD1 . ASP A 28  ? 0.4686 0.6014 0.4772 -0.1416 -0.0186 0.0620  26  ASP A OD1 
160  O OD2 . ASP A 28  ? 0.5376 0.6493 0.5409 -0.1199 -0.0115 0.0575  26  ASP A OD2 
161  N N   . TRP A 29  ? 0.3408 0.5251 0.3858 -0.1339 -0.0250 0.0642  27  TRP A N   
162  C CA  . TRP A 29  ? 0.3620 0.5345 0.3941 -0.1341 -0.0257 0.0564  27  TRP A CA  
163  C C   . TRP A 29  ? 0.3984 0.5366 0.4034 -0.1359 -0.0221 0.0452  27  TRP A C   
164  O O   . TRP A 29  ? 0.3779 0.5044 0.3770 -0.1267 -0.0175 0.0356  27  TRP A O   
165  C CB  . TRP A 29  ? 0.3603 0.5473 0.3931 -0.1491 -0.0339 0.0629  27  TRP A CB  
166  C CG  . TRP A 29  ? 0.3110 0.5285 0.3715 -0.1421 -0.0368 0.0719  27  TRP A CG  
167  C CD1 . TRP A 29  ? 0.3180 0.5621 0.3998 -0.1473 -0.0424 0.0841  27  TRP A CD1 
168  C CD2 . TRP A 29  ? 0.2557 0.4798 0.3280 -0.1265 -0.0331 0.0690  27  TRP A CD2 
169  N NE1 . TRP A 29  ? 0.2485 0.5134 0.3539 -0.1348 -0.0423 0.0887  27  TRP A NE1 
170  C CE2 . TRP A 29  ? 0.2622 0.5139 0.3605 -0.1227 -0.0368 0.0796  27  TRP A CE2 
171  C CE3 . TRP A 29  ? 0.2711 0.4809 0.3351 -0.1163 -0.0272 0.0585  27  TRP A CE3 
172  C CZ2 . TRP A 29  ? 0.1893 0.4507 0.3022 -0.1094 -0.0350 0.0799  27  TRP A CZ2 
173  C CZ3 . TRP A 29  ? 0.2412 0.4633 0.3208 -0.1043 -0.0255 0.0590  27  TRP A CZ3 
174  C CH2 . TRP A 29  ? 0.2233 0.4690 0.3254 -0.1013 -0.0296 0.0696  27  TRP A CH2 
175  N N   . ALA A 30  ? 0.3394 0.4614 0.3291 -0.1474 -0.0236 0.0465  28  ALA A N   
176  C CA  . ALA A 30  ? 0.3960 0.4820 0.3599 -0.1480 -0.0200 0.0363  28  ALA A CA  
177  C C   . ALA A 30  ? 0.3942 0.4698 0.3628 -0.1265 -0.0136 0.0285  28  ALA A C   
178  O O   . ALA A 30  ? 0.4238 0.4829 0.3834 -0.1196 -0.0094 0.0179  28  ALA A O   
179  C CB  . ALA A 30  ? 0.4234 0.4933 0.3726 -0.1616 -0.0224 0.0405  28  ALA A CB  
180  N N   . SER A 31  ? 0.3617 0.4501 0.3466 -0.1160 -0.0129 0.0340  29  SER A N   
181  C CA  . SER A 31  ? 0.3486 0.4290 0.3386 -0.0966 -0.0091 0.0282  29  SER A CA  
182  C C   . SER A 31  ? 0.3019 0.3996 0.3088 -0.0842 -0.0069 0.0239  29  SER A C   
183  O O   . SER A 31  ? 0.3010 0.3883 0.3083 -0.0712 -0.0039 0.0154  29  SER A O   
184  C CB  . SER A 31  ? 0.3096 0.3948 0.3061 -0.0918 -0.0092 0.0355  29  SER A CB  
185  O OG  . SER A 31  ? 0.4506 0.5139 0.4280 -0.1028 -0.0104 0.0384  29  SER A OG  
186  N N   . ILE A 32  ? 0.3056 0.4304 0.3284 -0.0876 -0.0088 0.0306  30  ILE A N   
187  C CA  . ILE A 32  ? 0.2451 0.3847 0.2817 -0.0787 -0.0071 0.0273  30  ILE A CA  
188  C C   . ILE A 32  ? 0.2910 0.4184 0.3159 -0.0812 -0.0042 0.0177  30  ILE A C   
189  O O   . ILE A 32  ? 0.2975 0.4203 0.3262 -0.0695 0.0002  0.0092  30  ILE A O   
190  C CB  . ILE A 32  ? 0.1916 0.3588 0.2450 -0.0831 -0.0104 0.0368  30  ILE A CB  
191  C CG1 . ILE A 32  ? 0.1555 0.3366 0.2235 -0.0778 -0.0103 0.0447  30  ILE A CG1 
192  C CG2 . ILE A 32  ? 0.1742 0.3521 0.2380 -0.0755 -0.0088 0.0334  30  ILE A CG2 
193  C CD1 . ILE A 32  ? 0.1420 0.3499 0.2278 -0.0834 -0.0137 0.0553  30  ILE A CD1 
194  N N   . ASN A 33  ? 0.3210 0.4436 0.3314 -0.0973 -0.0065 0.0189  31  ASN A N   
195  C CA  . ASN A 33  ? 0.3439 0.4532 0.3389 -0.1020 -0.0025 0.0095  31  ASN A CA  
196  C C   . ASN A 33  ? 0.3683 0.4486 0.3485 -0.0962 0.0032  -0.0018 31  ASN A C   
197  O O   . ASN A 33  ? 0.3536 0.4255 0.3301 -0.0907 0.0101  -0.0124 31  ASN A O   
198  C CB  . ASN A 33  ? 0.3659 0.4762 0.3460 -0.1225 -0.0079 0.0144  31  ASN A CB  
199  C CG  . ASN A 33  ? 0.3897 0.5266 0.3843 -0.1257 -0.0129 0.0234  31  ASN A CG  
200  O OD1 . ASN A 33  ? 0.3874 0.5348 0.3949 -0.1151 -0.0094 0.0211  31  ASN A OD1 
201  N ND2 . ASN A 33  ? 0.3512 0.4993 0.3450 -0.1403 -0.0218 0.0340  31  ASN A ND2 
202  N N   . GLY A 34  ? 0.3616 0.4272 0.3351 -0.0961 0.0009  0.0007  32  GLY A N   
203  C CA  . GLY A 34  ? 0.4151 0.4506 0.3753 -0.0886 0.0052  -0.0088 32  GLY A CA  
204  C C   . GLY A 34  ? 0.4271 0.4660 0.4046 -0.0675 0.0089  -0.0148 32  GLY A C   
205  O O   . GLY A 34  ? 0.4583 0.4806 0.4319 -0.0589 0.0146  -0.0256 32  GLY A O   
206  N N   . PHE A 35  ? 0.3885 0.4504 0.3864 -0.0595 0.0058  -0.0081 33  PHE A N   
207  C CA  . PHE A 35  ? 0.3655 0.4359 0.3816 -0.0417 0.0077  -0.0128 33  PHE A CA  
208  C C   . PHE A 35  ? 0.3396 0.4190 0.3628 -0.0396 0.0141  -0.0216 33  PHE A C   
209  O O   . PHE A 35  ? 0.3487 0.4216 0.3780 -0.0279 0.0187  -0.0310 33  PHE A O   
210  C CB  . PHE A 35  ? 0.2684 0.3601 0.3011 -0.0364 0.0033  -0.0040 33  PHE A CB  
211  C CG  . PHE A 35  ? 0.2877 0.3870 0.3372 -0.0198 0.0034  -0.0081 33  PHE A CG  
212  C CD1 . PHE A 35  ? 0.2149 0.3348 0.2804 -0.0166 0.0057  -0.0106 33  PHE A CD1 
213  C CD2 . PHE A 35  ? 0.2793 0.3649 0.3278 -0.0086 -0.0001 -0.0085 33  PHE A CD2 
214  C CE1 . PHE A 35  ? 0.1550 0.2834 0.2366 -0.0031 0.0045  -0.0137 33  PHE A CE1 
215  C CE2 . PHE A 35  ? 0.2587 0.3527 0.3230 0.0055  -0.0021 -0.0115 33  PHE A CE2 
216  C CZ  . PHE A 35  ? 0.1806 0.2966 0.2619 0.0080  0.0003  -0.0144 33  PHE A CZ  
217  N N   . CYS A 36  ? 0.3420 0.4371 0.3653 -0.0508 0.0144  -0.0181 34  CYS A N   
218  C CA  . CYS A 36  ? 0.3415 0.4437 0.3676 -0.0516 0.0211  -0.0257 34  CYS A CA  
219  C C   . CYS A 36  ? 0.3899 0.4691 0.3992 -0.0535 0.0290  -0.0376 34  CYS A C   
220  O O   . CYS A 36  ? 0.4038 0.4841 0.4211 -0.0451 0.0371  -0.0478 34  CYS A O   
221  C CB  . CYS A 36  ? 0.3093 0.4272 0.3328 -0.0655 0.0187  -0.0186 34  CYS A CB  
222  S SG  . CYS A 36  ? 0.2963 0.4395 0.3394 -0.0632 0.0103  -0.0045 34  CYS A SG  
223  N N   . GLU A 37  ? 0.3465 0.4051 0.3328 -0.0652 0.0273  -0.0367 35  GLU A N   
224  C CA  . GLU A 37  ? 0.4221 0.4538 0.3877 -0.0685 0.0353  -0.0485 35  GLU A CA  
225  C C   . GLU A 37  ? 0.4726 0.4914 0.4485 -0.0492 0.0404  -0.0578 35  GLU A C   
226  O O   . GLU A 37  ? 0.5127 0.5200 0.4852 -0.0445 0.0507  -0.0704 35  GLU A O   
227  C CB  . GLU A 37  ? 0.4495 0.4587 0.3889 -0.0838 0.0304  -0.0448 35  GLU A CB  
228  C CG  . GLU A 37  ? 0.4718 0.4853 0.3936 -0.1055 0.0271  -0.0398 35  GLU A CG  
229  C CD  . GLU A 37  ? 0.6547 0.6401 0.5471 -0.1211 0.0243  -0.0404 35  GLU A CD  
230  O OE1 . GLU A 37  ? 0.6413 0.6101 0.5312 -0.1163 0.0219  -0.0392 35  GLU A OE1 
231  O OE2 . GLU A 37  ? 0.6722 0.6500 0.5419 -0.1389 0.0245  -0.0422 35  GLU A OE2 
232  N N   . GLN A 38  ? 0.4518 0.4700 0.4382 -0.0388 0.0329  -0.0514 36  GLN A N   
233  C CA  . GLN A 38  ? 0.4499 0.4509 0.4426 -0.0214 0.0341  -0.0577 36  GLN A CA  
234  C C   . GLN A 38  ? 0.4088 0.4302 0.4301 -0.0045 0.0377  -0.0634 36  GLN A C   
235  O O   . GLN A 38  ? 0.4243 0.4360 0.4526 0.0077  0.0444  -0.0740 36  GLN A O   
236  C CB  . GLN A 38  ? 0.4348 0.4254 0.4243 -0.0182 0.0240  -0.0478 36  GLN A CB  
237  C CG  . GLN A 38  ? 0.4662 0.4318 0.4560 -0.0020 0.0230  -0.0526 36  GLN A CG  
238  C CD  . GLN A 38  ? 0.5886 0.5201 0.5565 -0.0050 0.0299  -0.0624 36  GLN A CD  
239  O OE1 . GLN A 38  ? 0.6440 0.5604 0.6181 0.0105  0.0342  -0.0716 36  GLN A OE1 
240  N NE2 . GLN A 38  ? 0.5309 0.4496 0.4732 -0.0248 0.0306  -0.0606 36  GLN A NE2 
241  N N   . LEU A 39  ? 0.4103 0.4603 0.4491 -0.0042 0.0338  -0.0569 37  LEU A N   
242  C CA  . LEU A 39  ? 0.3919 0.4632 0.4579 0.0090  0.0368  -0.0621 37  LEU A CA  
243  C C   . LEU A 39  ? 0.4135 0.4889 0.4818 0.0069  0.0501  -0.0743 37  LEU A C   
244  O O   . LEU A 39  ? 0.4158 0.4973 0.5036 0.0202  0.0559  -0.0832 37  LEU A O   
245  C CB  . LEU A 39  ? 0.2968 0.3945 0.3777 0.0082  0.0301  -0.0529 37  LEU A CB  
246  C CG  . LEU A 39  ? 0.3001 0.4146 0.3780 -0.0060 0.0330  -0.0497 37  LEU A CG  
247  C CD1 . LEU A 39  ? 0.2807 0.4088 0.3714 -0.0042 0.0429  -0.0594 37  LEU A CD1 
248  C CD2 . LEU A 39  ? 0.2297 0.3616 0.3156 -0.0079 0.0246  -0.0382 37  LEU A CD2 
249  N N   . ASN A 40  ? 0.3369 0.4063 0.3834 -0.0101 0.0550  -0.0749 38  ASN A N   
250  C CA  . ASN A 40  ? 0.3713 0.4395 0.4114 -0.0157 0.0687  -0.0863 38  ASN A CA  
251  C C   . ASN A 40  ? 0.4857 0.5282 0.5183 -0.0076 0.0782  -0.0993 38  ASN A C   
252  O O   . ASN A 40  ? 0.4976 0.5411 0.5331 -0.0057 0.0920  -0.1115 38  ASN A O   
253  C CB  . ASN A 40  ? 0.3659 0.4311 0.3799 -0.0376 0.0688  -0.0818 38  ASN A CB  
254  C CG  . ASN A 40  ? 0.4086 0.4691 0.4092 -0.0463 0.0831  -0.0933 38  ASN A CG  
255  O OD1 . ASN A 40  ? 0.3958 0.4761 0.4108 -0.0451 0.0902  -0.0969 38  ASN A OD1 
256  N ND2 . ASN A 40  ? 0.4435 0.4762 0.4144 -0.0562 0.0881  -0.0994 38  ASN A ND2 
257  N N   . GLU A 41  ? 0.5993 0.6179 0.6221 -0.0025 0.0715  -0.0967 39  GLU A N   
258  C CA  . GLU A 41  ? 0.6882 0.6749 0.6967 0.0028  0.0796  -0.1080 39  GLU A CA  
259  C C   . GLU A 41  ? 0.7163 0.7054 0.7531 0.0266  0.0839  -0.1165 39  GLU A C   
260  O O   . GLU A 41  ? 0.7743 0.7524 0.8119 0.0331  0.0976  -0.1304 39  GLU A O   
261  C CB  . GLU A 41  ? 0.6930 0.6495 0.6760 -0.0038 0.0704  -0.1013 39  GLU A CB  
262  C CG  . GLU A 41  ? 0.8200 0.7380 0.7853 0.0016  0.0778  -0.1125 39  GLU A CG  
263  C CD  . GLU A 41  ? 0.9322 0.8209 0.8580 -0.0193 0.0771  -0.1116 39  GLU A CD  
264  O OE1 . GLU A 41  ? 0.9530 0.8281 0.8667 -0.0250 0.0656  -0.1013 39  GLU A OE1 
265  O OE2 . GLU A 41  ? 0.9778 0.8564 0.8838 -0.0309 0.0882  -0.1214 39  GLU A OE2 
266  N N   . ASP A 42  ? 0.8344 0.8377 0.8944 0.0396  0.0721  -0.1082 40  ASP A N   
267  C CA  . ASP A 42  ? 0.8696 0.8745 0.9572 0.0626  0.0718  -0.1137 40  ASP A CA  
268  C C   . ASP A 42  ? 0.8595 0.9034 0.9831 0.0706  0.0740  -0.1158 40  ASP A C   
269  O O   . ASP A 42  ? 0.8143 0.8818 0.9436 0.0625  0.0678  -0.1073 40  ASP A O   
270  C CB  . ASP A 42  ? 0.8665 0.8551 0.9521 0.0719  0.0559  -0.1034 40  ASP A CB  
271  C CG  . ASP A 42  ? 0.8589 0.8481 0.9253 0.0562  0.0447  -0.0889 40  ASP A CG  
272  O OD1 . ASP A 42  ? 0.8523 0.8702 0.9293 0.0498  0.0417  -0.0829 40  ASP A OD1 
273  O OD2 . ASP A 42  ? 0.8610 0.8219 0.9033 0.0509  0.0389  -0.0835 40  ASP A OD2 
274  N N   . PHE A 43  ? 1.0761 1.1263 1.2239 0.0858  0.0838  -0.1276 41  PHE A N   
275  C CA  . PHE A 43  ? 1.0296 1.1177 1.2134 0.0921  0.0884  -0.1315 41  PHE A CA  
276  C C   . PHE A 43  ? 0.9365 1.0481 1.1364 0.0933  0.0719  -0.1188 41  PHE A C   
277  O O   . PHE A 43  ? 0.8780 1.0179 1.0901 0.0856  0.0734  -0.1171 41  PHE A O   
278  C CB  . PHE A 43  ? 1.0780 1.1693 1.2930 0.1142  0.0951  -0.1427 41  PHE A CB  
279  C CG  . PHE A 43  ? 1.1905 1.2674 1.3974 0.1140  0.1164  -0.1587 41  PHE A CG  
280  C CD1 . PHE A 43  ? 1.2630 1.3134 1.4285 0.0961  0.1248  -0.1615 41  PHE A CD1 
281  C CD2 . PHE A 43  ? 1.2356 1.3251 1.4764 0.1320  0.1281  -0.1711 41  PHE A CD2 
282  C CE1 . PHE A 43  ? 1.3309 1.3649 1.4849 0.0950  0.1450  -0.1771 41  PHE A CE1 
283  C CE2 . PHE A 43  ? 1.3292 1.4043 1.5618 0.1324  0.1499  -0.1871 41  PHE A CE2 
284  C CZ  . PHE A 43  ? 1.3704 1.4160 1.5573 0.1135  0.1586  -0.1904 41  PHE A CZ  
285  N N   . GLU A 44  ? 0.6793 0.7770 0.8775 0.1027  0.0566  -0.1103 42  GLU A N   
286  C CA  . GLU A 44  ? 0.6079 0.7240 0.8210 0.1066  0.0409  -0.0997 42  GLU A CA  
287  C C   . GLU A 44  ? 0.5422 0.6506 0.7279 0.0914  0.0324  -0.0874 42  GLU A C   
288  O O   . GLU A 44  ? 0.4960 0.6136 0.6863 0.0928  0.0199  -0.0781 42  GLU A O   
289  C CB  . GLU A 44  ? 0.6556 0.7620 0.8840 0.1266  0.0288  -0.0975 42  GLU A CB  
290  C CG  . GLU A 44  ? 0.6783 0.8150 0.9400 0.1365  0.0179  -0.0941 42  GLU A CG  
291  C CD  . GLU A 44  ? 0.7246 0.8938 1.0217 0.1410  0.0293  -0.1050 42  GLU A CD  
292  O OE1 . GLU A 44  ? 0.7739 0.9384 1.0793 0.1476  0.0434  -0.1164 42  GLU A OE1 
293  O OE2 . GLU A 44  ? 0.6982 0.8970 1.0148 0.1379  0.0245  -0.1022 42  GLU A OE2 
294  N N   . GLY A 45  ? 0.5216 0.6150 0.6798 0.0763  0.0398  -0.0878 43  GLY A N   
295  C CA  . GLY A 45  ? 0.4464 0.5364 0.5820 0.0611  0.0334  -0.0767 43  GLY A CA  
296  C C   . GLY A 45  ? 0.3611 0.4798 0.5091 0.0555  0.0295  -0.0705 43  GLY A C   
297  O O   . GLY A 45  ? 0.3153 0.4355 0.4591 0.0542  0.0190  -0.0604 43  GLY A O   
298  N N   . PRO A 46  ? 0.3537 0.4932 0.5140 0.0507  0.0388  -0.0765 44  PRO A N   
299  C CA  . PRO A 46  ? 0.2782 0.4401 0.4451 0.0430  0.0352  -0.0699 44  PRO A CA  
300  C C   . PRO A 46  ? 0.2373 0.4133 0.4232 0.0527  0.0239  -0.0648 44  PRO A C   
301  O O   . PRO A 46  ? 0.2227 0.4023 0.4018 0.0472  0.0169  -0.0560 44  PRO A O   
302  C CB  . PRO A 46  ? 0.2599 0.4379 0.4353 0.0363  0.0479  -0.0780 44  PRO A CB  
303  C CG  . PRO A 46  ? 0.3248 0.4829 0.4839 0.0334  0.0591  -0.0868 44  PRO A CG  
304  C CD  . PRO A 46  ? 0.3861 0.5256 0.5476 0.0484  0.0539  -0.0885 44  PRO A CD  
305  N N   . PRO A 47  ? 0.2760 0.4595 0.4853 0.0670  0.0217  -0.0704 45  PRO A N   
306  C CA  . PRO A 47  ? 0.2573 0.4520 0.4813 0.0749  0.0088  -0.0651 45  PRO A CA  
307  C C   . PRO A 47  ? 0.2998 0.4742 0.5062 0.0786  -0.0035 -0.0560 45  PRO A C   
308  O O   . PRO A 47  ? 0.2969 0.4771 0.5040 0.0790  -0.0132 -0.0495 45  PRO A O   
309  C CB  . PRO A 47  ? 0.2704 0.4781 0.5248 0.0891  0.0092  -0.0734 45  PRO A CB  
310  C CG  . PRO A 47  ? 0.2592 0.4545 0.5110 0.0921  0.0215  -0.0824 45  PRO A CG  
311  C CD  . PRO A 47  ? 0.2796 0.4658 0.5055 0.0756  0.0315  -0.0821 45  PRO A CD  
312  N N   . LEU A 48  ? 0.2905 0.4397 0.4788 0.0797  -0.0024 -0.0555 46  LEU A N   
313  C CA  . LEU A 48  ? 0.3101 0.4379 0.4773 0.0798  -0.0121 -0.0463 46  LEU A CA  
314  C C   . LEU A 48  ? 0.2798 0.4081 0.4281 0.0650  -0.0109 -0.0386 46  LEU A C   
315  O O   . LEU A 48  ? 0.2713 0.3985 0.4122 0.0640  -0.0186 -0.0307 46  LEU A O   
316  C CB  . LEU A 48  ? 0.3833 0.4820 0.5360 0.0841  -0.0107 -0.0483 46  LEU A CB  
317  C CG  . LEU A 48  ? 0.4400 0.5130 0.5680 0.0825  -0.0197 -0.0387 46  LEU A CG  
318  C CD1 . LEU A 48  ? 0.4502 0.5255 0.5839 0.0917  -0.0333 -0.0323 46  LEU A CD1 
319  C CD2 . LEU A 48  ? 0.4659 0.5078 0.5801 0.0867  -0.0177 -0.0419 46  LEU A CD2 
320  N N   . ALA A 49  ? 0.3059 0.4361 0.4467 0.0536  -0.0011 -0.0409 47  ALA A N   
321  C CA  . ALA A 49  ? 0.2723 0.4058 0.3992 0.0399  -0.0001 -0.0335 47  ALA A CA  
322  C C   . ALA A 49  ? 0.2318 0.3842 0.3692 0.0402  -0.0045 -0.0289 47  ALA A C   
323  O O   . ALA A 49  ? 0.2281 0.3797 0.3563 0.0357  -0.0080 -0.0210 47  ALA A O   
324  C CB  . ALA A 49  ? 0.2463 0.3843 0.3686 0.0285  0.0097  -0.0375 47  ALA A CB  
325  N N   . THR A 50  ? 0.2639 0.4331 0.4211 0.0450  -0.0033 -0.0346 48  THR A N   
326  C CA  . THR A 50  ? 0.2394 0.4259 0.4063 0.0433  -0.0058 -0.0320 48  THR A CA  
327  C C   . THR A 50  ? 0.2408 0.4230 0.4066 0.0509  -0.0165 -0.0275 48  THR A C   
328  O O   . THR A 50  ? 0.2049 0.3889 0.3638 0.0472  -0.0191 -0.0216 48  THR A O   
329  C CB  . THR A 50  ? 0.2537 0.4584 0.4408 0.0437  0.0000  -0.0402 48  THR A CB  
330  O OG1 . THR A 50  ? 0.3142 0.5298 0.5001 0.0328  0.0051  -0.0383 48  THR A OG1 
331  C CG2 . THR A 50  ? 0.1459 0.3613 0.3533 0.0540  -0.0062 -0.0439 48  THR A CG2 
332  N N   . ARG A 51  ? 0.2040 0.3762 0.3723 0.0611  -0.0224 -0.0294 49  ARG A N   
333  C CA  . ARG A 51  ? 0.2414 0.4038 0.4024 0.0674  -0.0336 -0.0242 49  ARG A CA  
334  C C   . ARG A 51  ? 0.2356 0.3808 0.3713 0.0613  -0.0343 -0.0158 49  ARG A C   
335  O O   . ARG A 51  ? 0.2169 0.3601 0.3436 0.0606  -0.0393 -0.0107 49  ARG A O   
336  C CB  . ARG A 51  ? 0.2916 0.4448 0.4604 0.0800  -0.0404 -0.0272 49  ARG A CB  
337  C CG  . ARG A 51  ? 0.3698 0.5377 0.5595 0.0888  -0.0499 -0.0297 49  ARG A CG  
338  C CD  . ARG A 51  ? 0.5196 0.6934 0.7331 0.1002  -0.0499 -0.0370 49  ARG A CD  
339  N NE  . ARG A 51  ? 0.6053 0.7548 0.8081 0.1072  -0.0505 -0.0365 49  ARG A NE  
340  C CZ  . ARG A 51  ? 0.5982 0.7461 0.8143 0.1144  -0.0436 -0.0441 49  ARG A CZ  
341  N NH1 . ARG A 51  ? 0.6661 0.7874 0.8691 0.1203  -0.0447 -0.0433 49  ARG A NH1 
342  N NH2 . ARG A 51  ? 0.5610 0.7324 0.8021 0.1149  -0.0346 -0.0529 49  ARG A NH2 
343  N N   . LEU A 52  ? 0.2356 0.3682 0.3594 0.0563  -0.0288 -0.0148 50  LEU A N   
344  C CA  . LEU A 52  ? 0.2634 0.3820 0.3655 0.0490  -0.0286 -0.0070 50  LEU A CA  
345  C C   . LEU A 52  ? 0.2303 0.3634 0.3321 0.0401  -0.0238 -0.0028 50  LEU A C   
346  O O   . LEU A 52  ? 0.2661 0.3956 0.3569 0.0376  -0.0251 0.0033  50  LEU A O   
347  C CB  . LEU A 52  ? 0.2913 0.3932 0.3812 0.0440  -0.0243 -0.0073 50  LEU A CB  
348  C CG  . LEU A 52  ? 0.3525 0.4355 0.4413 0.0531  -0.0272 -0.0120 50  LEU A CG  
349  C CD1 . LEU A 52  ? 0.3638 0.4274 0.4354 0.0449  -0.0221 -0.0120 50  LEU A CD1 
350  C CD2 . LEU A 52  ? 0.4085 0.4763 0.4904 0.0625  -0.0382 -0.0076 50  LEU A CD2 
351  N N   . LEU A 53  ? 0.2393 0.3877 0.3524 0.0353  -0.0177 -0.0061 51  LEU A N   
352  C CA  . LEU A 53  ? 0.2160 0.3777 0.3310 0.0278  -0.0137 -0.0018 51  LEU A CA  
353  C C   . LEU A 53  ? 0.1883 0.3574 0.3077 0.0319  -0.0167 -0.0005 51  LEU A C   
354  O O   . LEU A 53  ? 0.2008 0.3716 0.3145 0.0286  -0.0149 0.0050  51  LEU A O   
355  C CB  . LEU A 53  ? 0.1732 0.3473 0.2979 0.0222  -0.0082 -0.0054 51  LEU A CB  
356  C CG  . LEU A 53  ? 0.2183 0.3856 0.3334 0.0134  -0.0041 -0.0048 51  LEU A CG  
357  C CD1 . LEU A 53  ? 0.1850 0.3616 0.3070 0.0085  0.0012  -0.0102 51  LEU A CD1 
358  C CD2 . LEU A 53  ? 0.1555 0.3241 0.2622 0.0047  -0.0038 0.0044  51  LEU A CD2 
359  N N   . ALA A 54  ? 0.1844 0.3577 0.3141 0.0390  -0.0212 -0.0059 52  ALA A N   
360  C CA  . ALA A 54  ? 0.1722 0.3508 0.3049 0.0419  -0.0251 -0.0060 52  ALA A CA  
361  C C   . ALA A 54  ? 0.2043 0.3696 0.3196 0.0436  -0.0290 -0.0010 52  ALA A C   
362  O O   . ALA A 54  ? 0.1959 0.3627 0.3060 0.0417  -0.0271 0.0013  52  ALA A O   
363  C CB  . ALA A 54  ? 0.1666 0.3526 0.3145 0.0483  -0.0309 -0.0126 52  ALA A CB  
364  N N   . HIS A 55  ? 0.1724 0.3226 0.2769 0.0467  -0.0335 0.0007  53  HIS A N   
365  C CA  . HIS A 55  ? 0.2070 0.3416 0.2904 0.0461  -0.0359 0.0064  53  HIS A CA  
366  C C   . HIS A 55  ? 0.2128 0.3475 0.2866 0.0379  -0.0270 0.0122  53  HIS A C   
367  O O   . HIS A 55  ? 0.2267 0.3593 0.2904 0.0363  -0.0245 0.0151  53  HIS A O   
368  C CB  . HIS A 55  ? 0.2589 0.3748 0.3317 0.0509  -0.0437 0.0078  53  HIS A CB  
369  C CG  . HIS A 55  ? 0.3137 0.4118 0.3623 0.0499  -0.0477 0.0137  53  HIS A CG  
370  N ND1 . HIS A 55  ? 0.3488 0.4320 0.3790 0.0440  -0.0440 0.0197  53  HIS A ND1 
371  C CD2 . HIS A 55  ? 0.2586 0.3513 0.2963 0.0521  -0.0542 0.0147  53  HIS A CD2 
372  C CE1 . HIS A 55  ? 0.3171 0.3861 0.3259 0.0430  -0.0475 0.0242  53  HIS A CE1 
373  N NE2 . HIS A 55  ? 0.3351 0.4087 0.3468 0.0480  -0.0539 0.0211  53  HIS A NE2 
374  N N   . LYS A 56  ? 0.2073 0.3447 0.2844 0.0323  -0.0218 0.0137  54  LYS A N   
375  C CA  . LYS A 56  ? 0.2070 0.3488 0.2798 0.0241  -0.0143 0.0196  54  LYS A CA  
376  C C   . LYS A 56  ? 0.1834 0.3416 0.2672 0.0236  -0.0092 0.0200  54  LYS A C   
377  O O   . LYS A 56  ? 0.1978 0.3580 0.2769 0.0214  -0.0039 0.0242  54  LYS A O   
378  C CB  . LYS A 56  ? 0.2026 0.3462 0.2784 0.0170  -0.0115 0.0207  54  LYS A CB  
379  C CG  . LYS A 56  ? 0.2475 0.3712 0.3099 0.0160  -0.0149 0.0208  54  LYS A CG  
380  C CD  . LYS A 56  ? 0.3137 0.4213 0.3566 0.0138  -0.0159 0.0267  54  LYS A CD  
381  C CE  . LYS A 56  ? 0.3277 0.4140 0.3567 0.0106  -0.0185 0.0276  54  LYS A CE  
382  N NZ  . LYS A 56  ? 0.3334 0.4013 0.3408 0.0066  -0.0195 0.0342  54  LYS A NZ  
383  N N   . ILE A 57  ? 0.2309 0.3997 0.3291 0.0261  -0.0102 0.0154  55  ILE A N   
384  C CA  . ILE A 57  ? 0.1998 0.3813 0.3084 0.0258  -0.0062 0.0157  55  ILE A CA  
385  C C   . ILE A 57  ? 0.2081 0.3846 0.3094 0.0302  -0.0060 0.0148  55  ILE A C   
386  O O   . ILE A 57  ? 0.2360 0.4180 0.3404 0.0300  -0.0003 0.0168  55  ILE A O   
387  C CB  . ILE A 57  ? 0.1783 0.3690 0.3009 0.0262  -0.0078 0.0108  55  ILE A CB  
388  C CG1 . ILE A 57  ? 0.1330 0.3296 0.2606 0.0195  -0.0054 0.0124  55  ILE A CG1 
389  C CG2 . ILE A 57  ? 0.1381 0.3361 0.2681 0.0273  -0.0057 0.0102  55  ILE A CG2 
390  C CD1 . ILE A 57  ? 0.1738 0.3773 0.3117 0.0187  -0.0058 0.0068  55  ILE A CD1 
391  N N   . GLN A 58  ? 0.2272 0.3922 0.3182 0.0343  -0.0125 0.0118  56  GLN A N   
392  C CA  . GLN A 58  ? 0.2719 0.4284 0.3504 0.0371  -0.0137 0.0105  56  GLN A CA  
393  C C   . GLN A 58  ? 0.2886 0.4331 0.3473 0.0351  -0.0099 0.0151  56  GLN A C   
394  O O   . GLN A 58  ? 0.2961 0.4300 0.3389 0.0364  -0.0104 0.0139  56  GLN A O   
395  C CB  . GLN A 58  ? 0.2873 0.4383 0.3643 0.0414  -0.0245 0.0055  56  GLN A CB  
396  C CG  . GLN A 58  ? 0.3341 0.4985 0.4312 0.0422  -0.0267 0.0005  56  GLN A CG  
397  C CD  . GLN A 58  ? 0.3890 0.5523 0.4893 0.0460  -0.0377 -0.0042 56  GLN A CD  
398  O OE1 . GLN A 58  ? 0.4371 0.6106 0.5511 0.0456  -0.0398 -0.0087 56  GLN A OE1 
399  N NE2 . GLN A 58  ? 0.4679 0.6194 0.5564 0.0493  -0.0455 -0.0026 56  GLN A NE2 
400  N N   . SER A 59  ? 0.2398 0.3863 0.2984 0.0304  -0.0049 0.0202  57  SER A N   
401  C CA  . SER A 59  ? 0.2781 0.4151 0.3189 0.0266  0.0006  0.0252  57  SER A CA  
402  C C   . SER A 59  ? 0.2732 0.4152 0.3125 0.0265  0.0112  0.0256  57  SER A C   
403  O O   . SER A 59  ? 0.2601 0.4172 0.3175 0.0276  0.0167  0.0254  57  SER A O   
404  C CB  . SER A 59  ? 0.2727 0.4122 0.3155 0.0198  0.0035  0.0306  57  SER A CB  
405  O OG  . SER A 59  ? 0.3249 0.4556 0.3505 0.0147  0.0092  0.0355  57  SER A OG  
406  N N   . PRO A 60  ? 0.2974 0.4251 0.3140 0.0256  0.0142  0.0261  58  PRO A N   
407  C CA  . PRO A 60  ? 0.3134 0.4458 0.3287 0.0254  0.0274  0.0261  58  PRO A CA  
408  C C   . PRO A 60  ? 0.3228 0.4697 0.3496 0.0201  0.0382  0.0324  58  PRO A C   
409  O O   . PRO A 60  ? 0.3411 0.4977 0.3753 0.0213  0.0503  0.0327  58  PRO A O   
410  C CB  . PRO A 60  ? 0.3468 0.4576 0.3303 0.0242  0.0277  0.0247  58  PRO A CB  
411  C CG  . PRO A 60  ? 0.3542 0.4500 0.3229 0.0224  0.0146  0.0269  58  PRO A CG  
412  C CD  . PRO A 60  ? 0.3061 0.4123 0.2972 0.0251  0.0057  0.0264  58  PRO A CD  
413  N N   . GLN A 61  ? 0.3114 0.4597 0.3404 0.0144  0.0340  0.0371  59  GLN A N   
414  C CA  . GLN A 61  ? 0.2927 0.4565 0.3345 0.0076  0.0420  0.0434  59  GLN A CA  
415  C C   . GLN A 61  ? 0.2570 0.4412 0.3271 0.0091  0.0399  0.0441  59  GLN A C   
416  O O   . GLN A 61  ? 0.2125 0.3956 0.2868 0.0079  0.0308  0.0435  59  GLN A O   
417  C CB  . GLN A 61  ? 0.3295 0.4818 0.3570 -0.0011 0.0379  0.0481  59  GLN A CB  
418  C CG  . GLN A 61  ? 0.3561 0.4865 0.3525 -0.0043 0.0401  0.0492  59  GLN A CG  
419  C CD  . GLN A 61  ? 0.4203 0.5388 0.4025 -0.0144 0.0379  0.0552  59  GLN A CD  
420  O OE1 . GLN A 61  ? 0.4731 0.6050 0.4668 -0.0228 0.0438  0.0601  59  GLN A OE1 
421  N NE2 . GLN A 61  ? 0.4902 0.5823 0.4466 -0.0140 0.0290  0.0553  59  GLN A NE2 
422  N N   . GLU A 62  ? 0.3110 0.5120 0.3992 0.0124  0.0483  0.0450  60  GLU A N   
423  C CA  . GLU A 62  ? 0.2530 0.4700 0.3653 0.0154  0.0452  0.0457  60  GLU A CA  
424  C C   . GLU A 62  ? 0.2324 0.4598 0.3556 0.0074  0.0393  0.0509  60  GLU A C   
425  O O   . GLU A 62  ? 0.2142 0.4453 0.3464 0.0082  0.0322  0.0498  60  GLU A O   
426  C CB  . GLU A 62  ? 0.2605 0.4929 0.3913 0.0208  0.0553  0.0473  60  GLU A CB  
427  C CG  . GLU A 62  ? 0.2464 0.4921 0.4000 0.0244  0.0506  0.0489  60  GLU A CG  
428  C CD  . GLU A 62  ? 0.2903 0.5535 0.4667 0.0299  0.0597  0.0528  60  GLU A CD  
429  O OE1 . GLU A 62  ? 0.3173 0.5987 0.5087 0.0254  0.0637  0.0596  60  GLU A OE1 
430  O OE2 . GLU A 62  ? 0.3528 0.6114 0.5328 0.0389  0.0627  0.0489  60  GLU A OE2 
431  N N   . TRP A 63  ? 0.2003 0.4329 0.3223 -0.0013 0.0427  0.0566  61  TRP A N   
432  C CA  . TRP A 63  ? 0.2094 0.4517 0.3407 -0.0107 0.0369  0.0616  61  TRP A CA  
433  C C   . TRP A 63  ? 0.2073 0.4306 0.3219 -0.0133 0.0275  0.0576  61  TRP A C   
434  O O   . TRP A 63  ? 0.2123 0.4389 0.3322 -0.0179 0.0214  0.0582  61  TRP A O   
435  C CB  . TRP A 63  ? 0.2269 0.4803 0.3620 -0.0211 0.0429  0.0688  61  TRP A CB  
436  C CG  . TRP A 63  ? 0.2377 0.5014 0.3813 -0.0331 0.0365  0.0745  61  TRP A CG  
437  C CD1 . TRP A 63  ? 0.2492 0.5089 0.3831 -0.0460 0.0362  0.0786  61  TRP A CD1 
438  C CD2 . TRP A 63  ? 0.2047 0.4833 0.3661 -0.0347 0.0294  0.0772  61  TRP A CD2 
439  N NE1 . TRP A 63  ? 0.2872 0.5580 0.4312 -0.0558 0.0292  0.0829  61  TRP A NE1 
440  C CE2 . TRP A 63  ? 0.2224 0.5047 0.3824 -0.0492 0.0246  0.0822  61  TRP A CE2 
441  C CE3 . TRP A 63  ? 0.2000 0.4867 0.3754 -0.0265 0.0262  0.0760  61  TRP A CE3 
442  C CZ2 . TRP A 63  ? 0.2118 0.5061 0.3831 -0.0558 0.0164  0.0861  61  TRP A CZ2 
443  C CZ3 . TRP A 63  ? 0.1769 0.4756 0.3640 -0.0328 0.0182  0.0805  61  TRP A CZ3 
444  C CH2 . TRP A 63  ? 0.1677 0.4704 0.3523 -0.0473 0.0132  0.0855  61  TRP A CH2 
445  N N   . GLU A 64  ? 0.2125 0.4150 0.3065 -0.0099 0.0264  0.0534  62  GLU A N   
446  C CA  . GLU A 64  ? 0.1989 0.3837 0.2804 -0.0088 0.0177  0.0488  62  GLU A CA  
447  C C   . GLU A 64  ? 0.1665 0.3559 0.2592 -0.0018 0.0130  0.0432  62  GLU A C   
448  O O   . GLU A 64  ? 0.1735 0.3620 0.2687 -0.0045 0.0083  0.0414  62  GLU A O   
449  C CB  . GLU A 64  ? 0.2356 0.3984 0.2947 -0.0053 0.0160  0.0466  62  GLU A CB  
450  C CG  . GLU A 64  ? 0.2587 0.4029 0.3071 -0.0027 0.0066  0.0424  62  GLU A CG  
451  C CD  . GLU A 64  ? 0.3775 0.4987 0.4023 -0.0007 0.0033  0.0429  62  GLU A CD  
452  O OE1 . GLU A 64  ? 0.4002 0.5050 0.4113 -0.0057 0.0003  0.0454  62  GLU A OE1 
453  O OE2 . GLU A 64  ? 0.3604 0.4783 0.3782 0.0046  0.0040  0.0414  62  GLU A OE2 
454  N N   . ALA A 65  ? 0.2117 0.4052 0.3097 0.0060  0.0152  0.0404  63  ALA A N   
455  C CA  . ALA A 65  ? 0.1806 0.3784 0.2888 0.0114  0.0114  0.0354  63  ALA A CA  
456  C C   . ALA A 65  ? 0.1787 0.3926 0.3038 0.0073  0.0115  0.0387  63  ALA A C   
457  O O   . ALA A 65  ? 0.1679 0.3822 0.2966 0.0065  0.0072  0.0355  63  ALA A O   
458  C CB  . ALA A 65  ? 0.1766 0.3728 0.2843 0.0190  0.0141  0.0322  63  ALA A CB  
459  N N   . ILE A 66  ? 0.2100 0.4377 0.3458 0.0042  0.0162  0.0454  64  ILE A N   
460  C CA  . ILE A 66  ? 0.1999 0.4433 0.3516 -0.0002 0.0144  0.0504  64  ILE A CA  
461  C C   . ILE A 66  ? 0.1975 0.4392 0.3443 -0.0101 0.0090  0.0514  64  ILE A C   
462  O O   . ILE A 66  ? 0.2208 0.4668 0.3723 -0.0132 0.0050  0.0515  64  ILE A O   
463  C CB  . ILE A 66  ? 0.1870 0.4476 0.3541 -0.0007 0.0199  0.0581  64  ILE A CB  
464  C CG1 . ILE A 66  ? 0.1833 0.4455 0.3578 0.0101  0.0259  0.0562  64  ILE A CG1 
465  C CG2 . ILE A 66  ? 0.2050 0.4821 0.3874 -0.0077 0.0151  0.0654  64  ILE A CG2 
466  C CD1 . ILE A 66  ? 0.1773 0.4387 0.3584 0.0149  0.0218  0.0539  64  ILE A CD1 
467  N N   . GLN A 67  ? 0.1644 0.3977 0.2993 -0.0159 0.0092  0.0523  65  GLN A N   
468  C CA  . GLN A 67  ? 0.1752 0.4019 0.3014 -0.0257 0.0048  0.0521  65  GLN A CA  
469  C C   . GLN A 67  ? 0.1734 0.3860 0.2909 -0.0214 0.0018  0.0434  65  GLN A C   
470  O O   . GLN A 67  ? 0.2000 0.4106 0.3147 -0.0273 -0.0008 0.0415  65  GLN A O   
471  C CB  . GLN A 67  ? 0.2123 0.4292 0.3256 -0.0327 0.0060  0.0547  65  GLN A CB  
472  C CG  . GLN A 67  ? 0.2008 0.4353 0.3247 -0.0418 0.0084  0.0639  65  GLN A CG  
473  C CD  . GLN A 67  ? 0.1691 0.3928 0.2788 -0.0507 0.0102  0.0666  65  GLN A CD  
474  O OE1 . GLN A 67  ? 0.2548 0.4759 0.3589 -0.0630 0.0067  0.0693  65  GLN A OE1 
475  N NE2 . GLN A 67  ? 0.2368 0.4511 0.3373 -0.0455 0.0153  0.0657  65  GLN A NE2 
476  N N   . ALA A 68  ? 0.2043 0.4075 0.3175 -0.0117 0.0023  0.0381  66  ALA A N   
477  C CA  . ALA A 68  ? 0.2077 0.4019 0.3181 -0.0064 -0.0004 0.0299  66  ALA A CA  
478  C C   . ALA A 68  ? 0.1689 0.3745 0.2907 -0.0067 -0.0005 0.0280  66  ALA A C   
479  O O   . ALA A 68  ? 0.1681 0.3701 0.2884 -0.0080 -0.0012 0.0225  66  ALA A O   
480  C CB  . ALA A 68  ? 0.1816 0.3670 0.2880 0.0037  -0.0016 0.0258  66  ALA A CB  
481  N N   . LEU A 69  ? 0.1731 0.3905 0.3055 -0.0044 0.0010  0.0318  67  LEU A N   
482  C CA  . LEU A 69  ? 0.1537 0.3796 0.2954 -0.0051 0.0004  0.0314  67  LEU A CA  
483  C C   . LEU A 69  ? 0.1731 0.4044 0.3142 -0.0158 -0.0014 0.0357  67  LEU A C   
484  O O   . LEU A 69  ? 0.1821 0.4144 0.3232 -0.0193 -0.0021 0.0333  67  LEU A O   
485  C CB  . LEU A 69  ? 0.1260 0.3597 0.2779 0.0005  0.0023  0.0351  67  LEU A CB  
486  C CG  . LEU A 69  ? 0.1433 0.3697 0.2928 0.0096  0.0033  0.0293  67  LEU A CG  
487  C CD1 . LEU A 69  ? 0.1148 0.3451 0.2705 0.0149  0.0069  0.0326  67  LEU A CD1 
488  C CD2 . LEU A 69  ? 0.0980 0.3223 0.2493 0.0107  0.0010  0.0221  67  LEU A CD2 
489  N N   . THR A 70  ? 0.1771 0.4118 0.3167 -0.0222 -0.0022 0.0422  68  THR A N   
490  C CA  . THR A 70  ? 0.1946 0.4322 0.3301 -0.0343 -0.0055 0.0461  68  THR A CA  
491  C C   . THR A 70  ? 0.2068 0.4294 0.3264 -0.0396 -0.0053 0.0386  68  THR A C   
492  O O   . THR A 70  ? 0.2282 0.4502 0.3423 -0.0471 -0.0065 0.0374  68  THR A O   
493  C CB  . THR A 70  ? 0.2147 0.4615 0.3543 -0.0411 -0.0070 0.0552  68  THR A CB  
494  O OG1 . THR A 70  ? 0.2387 0.5020 0.3964 -0.0361 -0.0066 0.0623  68  THR A OG1 
495  C CG2 . THR A 70  ? 0.2171 0.4650 0.3494 -0.0556 -0.0122 0.0590  68  THR A CG2 
496  N N   . VAL A 71  ? 0.1444 0.3537 0.2556 -0.0355 -0.0035 0.0334  69  VAL A N   
497  C CA  . VAL A 71  ? 0.1871 0.3805 0.2859 -0.0363 -0.0021 0.0244  69  VAL A CA  
498  C C   . VAL A 71  ? 0.1818 0.3777 0.2860 -0.0316 0.0003  0.0170  69  VAL A C   
499  O O   . VAL A 71  ? 0.1904 0.3824 0.2874 -0.0382 0.0023  0.0127  69  VAL A O   
500  C CB  . VAL A 71  ? 0.2174 0.3948 0.3087 -0.0294 -0.0017 0.0204  69  VAL A CB  
501  C CG1 . VAL A 71  ? 0.2302 0.3910 0.3114 -0.0286 0.0002  0.0109  69  VAL A CG1 
502  C CG2 . VAL A 71  ? 0.1789 0.3524 0.2629 -0.0360 -0.0031 0.0277  69  VAL A CG2 
503  N N   . LEU A 72  ? 0.1979 0.4008 0.3139 -0.0217 0.0006  0.0158  70  LEU A N   
504  C CA  . LEU A 72  ? 0.1778 0.3853 0.3009 -0.0184 0.0029  0.0096  70  LEU A CA  
505  C C   . LEU A 72  ? 0.1597 0.3750 0.2825 -0.0280 0.0034  0.0129  70  LEU A C   
506  O O   . LEU A 72  ? 0.1740 0.3875 0.2929 -0.0322 0.0069  0.0069  70  LEU A O   
507  C CB  . LEU A 72  ? 0.1635 0.3765 0.2979 -0.0083 0.0017  0.0090  70  LEU A CB  
508  C CG  . LEU A 72  ? 0.1448 0.3645 0.2887 -0.0059 0.0034  0.0035  70  LEU A CG  
509  C CD1 . LEU A 72  ? 0.0997 0.3165 0.2453 -0.0038 0.0064  -0.0064 70  LEU A CD1 
510  C CD2 . LEU A 72  ? 0.0832 0.3058 0.2348 0.0022  0.0010  0.0039  70  LEU A CD2 
511  N N   . GLU A 73  ? 0.1343 0.3577 0.2607 -0.0316 -0.0001 0.0226  71  GLU A N   
512  C CA  . GLU A 73  ? 0.1401 0.3691 0.2646 -0.0409 -0.0020 0.0279  71  GLU A CA  
513  C C   . GLU A 73  ? 0.1769 0.3983 0.2852 -0.0529 -0.0016 0.0259  71  GLU A C   
514  O O   . GLU A 73  ? 0.1760 0.3959 0.2768 -0.0602 0.0000  0.0237  71  GLU A O   
515  C CB  . GLU A 73  ? 0.1281 0.3677 0.2616 -0.0417 -0.0070 0.0397  71  GLU A CB  
516  C CG  . GLU A 73  ? 0.1499 0.3941 0.2815 -0.0506 -0.0110 0.0464  71  GLU A CG  
517  C CD  . GLU A 73  ? 0.2710 0.5269 0.4158 -0.0492 -0.0168 0.0587  71  GLU A CD  
518  O OE1 . GLU A 73  ? 0.1763 0.4385 0.3330 -0.0414 -0.0160 0.0617  71  GLU A OE1 
519  O OE2 . GLU A 73  ? 0.2981 0.5568 0.4411 -0.0562 -0.0221 0.0657  71  GLU A OE2 
520  N N   . THR A 74  ? 0.1765 0.3914 0.2773 -0.0559 -0.0029 0.0265  72  THR A N   
521  C CA  . THR A 74  ? 0.2176 0.4227 0.3002 -0.0688 -0.0034 0.0251  72  THR A CA  
522  C C   . THR A 74  ? 0.2421 0.4346 0.3142 -0.0685 0.0041  0.0126  72  THR A C   
523  O O   . THR A 74  ? 0.2621 0.4499 0.3206 -0.0789 0.0061  0.0101  72  THR A O   
524  C CB  . THR A 74  ? 0.2318 0.4306 0.3083 -0.0726 -0.0062 0.0283  72  THR A CB  
525  O OG1 . THR A 74  ? 0.2228 0.4368 0.3125 -0.0727 -0.0115 0.0397  72  THR A OG1 
526  C CG2 . THR A 74  ? 0.3133 0.5001 0.3683 -0.0884 -0.0078 0.0272  72  THR A CG2 
527  N N   . CYS A 75  ? 0.1843 0.3714 0.2627 -0.0565 0.0083  0.0047  73  CYS A N   
528  C CA  . CYS A 75  ? 0.2055 0.3825 0.2784 -0.0540 0.0160  -0.0076 73  CYS A CA  
529  C C   . CYS A 75  ? 0.1898 0.3763 0.2698 -0.0538 0.0212  -0.0120 73  CYS A C   
530  O O   . CYS A 75  ? 0.2386 0.4191 0.3103 -0.0579 0.0289  -0.0207 73  CYS A O   
531  C CB  . CYS A 75  ? 0.2235 0.3925 0.3031 -0.0404 0.0173  -0.0137 73  CYS A CB  
532  S SG  . CYS A 75  ? 0.2768 0.4308 0.3456 -0.0410 0.0119  -0.0085 73  CYS A SG  
533  N N   . MET A 76  ? 0.2390 0.4393 0.3330 -0.0501 0.0178  -0.0062 74  MET A N   
534  C CA  . MET A 76  ? 0.2246 0.4329 0.3229 -0.0531 0.0220  -0.0085 74  MET A CA  
535  C C   . MET A 76  ? 0.2801 0.4848 0.3602 -0.0690 0.0226  -0.0052 74  MET A C   
536  O O   . MET A 76  ? 0.3010 0.5046 0.3747 -0.0750 0.0300  -0.0114 74  MET A O   
537  C CB  . MET A 76  ? 0.2019 0.4216 0.3159 -0.0470 0.0175  -0.0024 74  MET A CB  
538  C CG  . MET A 76  ? 0.1709 0.3944 0.3011 -0.0332 0.0179  -0.0079 74  MET A CG  
539  S SD  . MET A 76  ? 0.1747 0.4023 0.3141 -0.0300 0.0267  -0.0213 74  MET A SD  
540  C CE  . MET A 76  ? 0.1149 0.3533 0.2609 -0.0362 0.0280  -0.0188 74  MET A CE  
541  N N   . LYS A 77  ? 0.2934 0.4965 0.3647 -0.0765 0.0148  0.0047  75  LYS A N   
542  C CA  . LYS A 77  ? 0.3614 0.5602 0.4135 -0.0925 0.0127  0.0093  75  LYS A CA  
543  C C   . LYS A 77  ? 0.4198 0.6032 0.4500 -0.1013 0.0191  0.0001  75  LYS A C   
544  O O   . LYS A 77  ? 0.4476 0.6246 0.4590 -0.1139 0.0227  -0.0021 75  LYS A O   
545  C CB  . LYS A 77  ? 0.3768 0.5812 0.4293 -0.0978 0.0009  0.0234  75  LYS A CB  
546  C CG  . LYS A 77  ? 0.4061 0.6227 0.4738 -0.0936 -0.0048 0.0334  75  LYS A CG  
547  C CD  . LYS A 77  ? 0.5437 0.7678 0.6143 -0.0986 -0.0163 0.0474  75  LYS A CD  
548  C CE  . LYS A 77  ? 0.5072 0.7430 0.6019 -0.0850 -0.0192 0.0533  75  LYS A CE  
549  N NZ  . LYS A 77  ? 0.5477 0.7935 0.6518 -0.0864 -0.0283 0.0669  75  LYS A NZ  
550  N N   . SER A 78  ? 0.3222 0.4970 0.3520 -0.0955 0.0204  -0.0051 76  SER A N   
551  C CA  . SER A 78  ? 0.3641 0.5204 0.3705 -0.1046 0.0250  -0.0126 76  SER A CA  
552  C C   . SER A 78  ? 0.3814 0.5294 0.3870 -0.0981 0.0387  -0.0282 76  SER A C   
553  O O   . SER A 78  ? 0.3939 0.5292 0.3784 -0.1081 0.0466  -0.0360 76  SER A O   
554  C CB  . SER A 78  ? 0.3268 0.4742 0.3287 -0.1049 0.0188  -0.0093 76  SER A CB  
555  O OG  . SER A 78  ? 0.3981 0.5488 0.4194 -0.0886 0.0189  -0.0106 76  SER A OG  
556  N N   . CYS A 79  ? 0.3293 0.4850 0.3581 -0.0815 0.0416  -0.0327 77  CYS A N   
557  C CA  . CYS A 79  ? 0.3873 0.5372 0.4215 -0.0722 0.0533  -0.0471 77  CYS A CA  
558  C C   . CYS A 79  ? 0.3726 0.5354 0.4155 -0.0732 0.0625  -0.0526 77  CYS A C   
559  O O   . CYS A 79  ? 0.3638 0.5354 0.4033 -0.0826 0.0594  -0.0451 77  CYS A O   
560  C CB  . CYS A 79  ? 0.3433 0.4949 0.3982 -0.0542 0.0499  -0.0483 77  CYS A CB  
561  S SG  . CYS A 79  ? 0.4149 0.5439 0.4545 -0.0537 0.0437  -0.0459 77  CYS A SG  
562  N N   . GLY A 80  ? 0.5950 0.7581 0.6479 -0.0649 0.0743  -0.0656 78  GLY A N   
563  C CA  . GLY A 80  ? 0.5943 0.7778 0.6756 -0.0547 0.0776  -0.0688 78  GLY A CA  
564  C C   . GLY A 80  ? 0.6175 0.8104 0.6995 -0.0625 0.0903  -0.0758 78  GLY A C   
565  O O   . GLY A 80  ? 0.6879 0.8787 0.7507 -0.0781 0.0911  -0.0710 78  GLY A O   
566  N N   . LYS A 81  ? 0.4557 0.6559 0.5563 -0.0527 0.1016  -0.0881 79  LYS A N   
567  C CA  . LYS A 81  ? 0.3833 0.6067 0.5111 -0.0481 0.1055  -0.0908 79  LYS A CA  
568  C C   . LYS A 81  ? 0.3366 0.5676 0.4926 -0.0286 0.0981  -0.0920 79  LYS A C   
569  O O   . LYS A 81  ? 0.2781 0.5243 0.4535 -0.0236 0.0899  -0.0867 79  LYS A O   
570  C CB  . LYS A 81  ? 0.4380 0.6672 0.5683 -0.0525 0.1250  -0.1043 79  LYS A CB  
571  C CG  . LYS A 81  ? 0.4171 0.6732 0.5794 -0.0484 0.1302  -0.1081 79  LYS A CG  
572  C CD  . LYS A 81  ? 0.5373 0.8000 0.6961 -0.0590 0.1506  -0.1191 79  LYS A CD  
573  C CE  . LYS A 81  ? 0.5487 0.8398 0.7383 -0.0589 0.1554  -0.1214 79  LYS A CE  
574  N NZ  . LYS A 81  ? 0.4969 0.8056 0.7254 -0.0396 0.1478  -0.1234 79  LYS A NZ  
575  N N   . ARG A 82  ? 0.3507 0.5677 0.5052 -0.0185 0.0996  -0.0981 80  ARG A N   
576  C CA  . ARG A 82  ? 0.3459 0.5663 0.5239 0.0001  0.0914  -0.0986 80  ARG A CA  
577  C C   . ARG A 82  ? 0.2995 0.5198 0.4776 0.0029  0.0740  -0.0855 80  ARG A C   
578  O O   . ARG A 82  ? 0.2623 0.4961 0.4630 0.0130  0.0666  -0.0836 80  ARG A O   
579  C CB  . ARG A 82  ? 0.4106 0.6102 0.5821 0.0096  0.0956  -0.1063 80  ARG A CB  
580  C CG  . ARG A 82  ? 0.5238 0.7255 0.7038 0.0130  0.1140  -0.1217 80  ARG A CG  
581  C CD  . ARG A 82  ? 0.6728 0.8473 0.8397 0.0207  0.1192  -0.1296 80  ARG A CD  
582  N NE  . ARG A 82  ? 0.7339 0.8828 0.8715 0.0149  0.1080  -0.1208 80  ARG A NE  
583  C CZ  . ARG A 82  ? 0.7779 0.9092 0.9149 0.0265  0.0991  -0.1185 80  ARG A CZ  
584  N NH1 . ARG A 82  ? 0.8068 0.9413 0.9699 0.0459  0.0991  -0.1242 80  ARG A NH1 
585  N NH2 . ARG A 82  ? 0.7781 0.8887 0.8887 0.0185  0.0897  -0.1099 80  ARG A NH2 
586  N N   . PHE A 83  ? 0.3025 0.5079 0.4557 -0.0062 0.0679  -0.0768 81  PHE A N   
587  C CA  . PHE A 83  ? 0.2496 0.4563 0.4022 -0.0052 0.0541  -0.0646 81  PHE A CA  
588  C C   . PHE A 83  ? 0.2001 0.4247 0.3625 -0.0103 0.0513  -0.0592 81  PHE A C   
589  O O   . PHE A 83  ? 0.1520 0.3841 0.3269 -0.0034 0.0428  -0.0544 81  PHE A O   
590  C CB  . PHE A 83  ? 0.2576 0.4475 0.3844 -0.0147 0.0492  -0.0566 81  PHE A CB  
591  C CG  . PHE A 83  ? 0.2316 0.4214 0.3595 -0.0110 0.0370  -0.0457 81  PHE A CG  
592  C CD1 . PHE A 83  ? 0.2417 0.4273 0.3786 0.0022  0.0310  -0.0458 81  PHE A CD1 
593  C CD2 . PHE A 83  ? 0.2389 0.4337 0.3599 -0.0201 0.0318  -0.0354 81  PHE A CD2 
594  C CE1 . PHE A 83  ? 0.1806 0.3659 0.3168 0.0047  0.0216  -0.0365 81  PHE A CE1 
595  C CE2 . PHE A 83  ? 0.1765 0.3727 0.3003 -0.0161 0.0230  -0.0265 81  PHE A CE2 
596  C CZ  . PHE A 83  ? 0.1899 0.3810 0.3199 -0.0044 0.0186  -0.0274 81  PHE A CZ  
597  N N   . HIS A 84  ? 0.2185 0.4466 0.3713 -0.0235 0.0579  -0.0590 82  HIS A N   
598  C CA  . HIS A 84  ? 0.1844 0.4262 0.3448 -0.0291 0.0559  -0.0540 82  HIS A CA  
599  C C   . HIS A 84  ? 0.1802 0.4390 0.3679 -0.0201 0.0566  -0.0597 82  HIS A C   
600  O O   . HIS A 84  ? 0.1508 0.4173 0.3479 -0.0184 0.0491  -0.0543 82  HIS A O   
601  C CB  . HIS A 84  ? 0.2276 0.4686 0.3724 -0.0450 0.0643  -0.0543 82  HIS A CB  
602  C CG  . HIS A 84  ? 0.2215 0.4481 0.3399 -0.0558 0.0603  -0.0465 82  HIS A CG  
603  N ND1 . HIS A 84  ? 0.2714 0.4907 0.3681 -0.0705 0.0674  -0.0479 82  HIS A ND1 
604  C CD2 . HIS A 84  ? 0.2322 0.4508 0.3426 -0.0546 0.0500  -0.0375 82  HIS A CD2 
605  C CE1 . HIS A 84  ? 0.4002 0.6082 0.4773 -0.0780 0.0598  -0.0393 82  HIS A CE1 
606  N NE2 . HIS A 84  ? 0.2894 0.4982 0.3761 -0.0685 0.0496  -0.0328 82  HIS A NE2 
607  N N   . ASP A 85  ? 0.2062 0.4705 0.4069 -0.0142 0.0655  -0.0707 83  ASP A N   
608  C CA  . ASP A 85  ? 0.2232 0.5070 0.4536 -0.0059 0.0662  -0.0768 83  ASP A CA  
609  C C   . ASP A 85  ? 0.1967 0.4817 0.4404 0.0076  0.0525  -0.0730 83  ASP A C   
610  O O   . ASP A 85  ? 0.1689 0.4689 0.4312 0.0101  0.0475  -0.0728 83  ASP A O   
611  C CB  . ASP A 85  ? 0.2407 0.5313 0.4848 -0.0013 0.0797  -0.0897 83  ASP A CB  
612  C CG  . ASP A 85  ? 0.2902 0.5873 0.5279 -0.0158 0.0950  -0.0949 83  ASP A CG  
613  O OD1 . ASP A 85  ? 0.3593 0.6591 0.6026 -0.0142 0.1091  -0.1060 83  ASP A OD1 
614  O OD2 . ASP A 85  ? 0.3036 0.6015 0.5292 -0.0289 0.0934  -0.0879 83  ASP A OD2 
615  N N   . GLU A 86  ? 0.2052 0.4734 0.4378 0.0151  0.0465  -0.0703 84  GLU A N   
616  C CA  . GLU A 86  ? 0.1760 0.4415 0.4158 0.0271  0.0335  -0.0661 84  GLU A CA  
617  C C   . GLU A 86  ? 0.1522 0.4162 0.3830 0.0226  0.0243  -0.0562 84  GLU A C   
618  O O   . GLU A 86  ? 0.1237 0.3934 0.3648 0.0284  0.0152  -0.0542 84  GLU A O   
619  C CB  . GLU A 86  ? 0.2074 0.4522 0.4338 0.0342  0.0307  -0.0654 84  GLU A CB  
620  C CG  . GLU A 86  ? 0.3081 0.5508 0.5467 0.0445  0.0368  -0.0752 84  GLU A CG  
621  C CD  . GLU A 86  ? 0.3141 0.5756 0.5844 0.0566  0.0324  -0.0796 84  GLU A CD  
622  O OE1 . GLU A 86  ? 0.3303 0.5942 0.6063 0.0624  0.0190  -0.0737 84  GLU A OE1 
623  O OE2 . GLU A 86  ? 0.3897 0.6638 0.6792 0.0600  0.0424  -0.0892 84  GLU A OE2 
624  N N   . VAL A 87  ? 0.1683 0.4230 0.3789 0.0127  0.0260  -0.0500 85  VAL A N   
625  C CA  . VAL A 87  ? 0.1622 0.4158 0.3655 0.0086  0.0195  -0.0410 85  VAL A CA  
626  C C   . VAL A 87  ? 0.1494 0.4171 0.3652 0.0041  0.0203  -0.0423 85  VAL A C   
627  O O   . VAL A 87  ? 0.1364 0.4055 0.3553 0.0063  0.0133  -0.0386 85  VAL A O   
628  C CB  . VAL A 87  ? 0.1737 0.4174 0.3567 -0.0009 0.0211  -0.0338 85  VAL A CB  
629  C CG1 . VAL A 87  ? 0.1314 0.3759 0.3107 -0.0044 0.0159  -0.0248 85  VAL A CG1 
630  C CG2 . VAL A 87  ? 0.1757 0.4052 0.3467 0.0026  0.0189  -0.0320 85  VAL A CG2 
631  N N   . GLY A 88  ? 0.1596 0.4371 0.3830 -0.0019 0.0294  -0.0486 86  GLY A N   
632  C CA  . GLY A 88  ? 0.1604 0.4508 0.3945 -0.0087 0.0315  -0.0499 86  GLY A CA  
633  C C   . GLY A 88  ? 0.1627 0.4688 0.4216 -0.0019 0.0282  -0.0560 86  GLY A C   
634  O O   . GLY A 88  ? 0.1990 0.5188 0.4703 -0.0087 0.0322  -0.0594 86  GLY A O   
635  N N   . LYS A 89  ? 0.1584 0.4627 0.4246 0.0106  0.0205  -0.0572 87  LYS A N   
636  C CA  . LYS A 89  ? 0.1445 0.4621 0.4325 0.0177  0.0127  -0.0606 87  LYS A CA  
637  C C   . LYS A 89  ? 0.1289 0.4387 0.4087 0.0193  0.0004  -0.0542 87  LYS A C   
638  O O   . LYS A 89  ? 0.1138 0.4066 0.3731 0.0203  -0.0027 -0.0477 87  LYS A O   
639  C CB  . LYS A 89  ? 0.1704 0.4900 0.4717 0.0311  0.0108  -0.0656 87  LYS A CB  
640  C CG  . LYS A 89  ? 0.1695 0.4981 0.4826 0.0310  0.0245  -0.0742 87  LYS A CG  
641  C CD  . LYS A 89  ? 0.2469 0.5770 0.5764 0.0462  0.0221  -0.0794 87  LYS A CD  
642  C CE  . LYS A 89  ? 0.3064 0.6375 0.6397 0.0465  0.0380  -0.0882 87  LYS A CE  
643  N NZ  . LYS A 89  ? 0.3561 0.6936 0.7138 0.0626  0.0373  -0.0949 87  LYS A NZ  
644  N N   . PHE A 90  ? 0.0934 0.4156 0.3888 0.0189  -0.0063 -0.0564 88  PHE A N   
645  C CA  . PHE A 90  ? 0.1283 0.4416 0.4143 0.0200  -0.0180 -0.0519 88  PHE A CA  
646  C C   . PHE A 90  ? 0.1356 0.4366 0.4131 0.0316  -0.0271 -0.0492 88  PHE A C   
647  O O   . PHE A 90  ? 0.1654 0.4511 0.4241 0.0324  -0.0328 -0.0440 88  PHE A O   
648  C CB  . PHE A 90  ? 0.0873 0.4164 0.3914 0.0156  -0.0243 -0.0556 88  PHE A CB  
649  C CG  . PHE A 90  ? 0.0922 0.4278 0.3983 0.0018  -0.0163 -0.0565 88  PHE A CG  
650  C CD1 . PHE A 90  ? 0.1175 0.4365 0.4014 -0.0050 -0.0116 -0.0510 88  PHE A CD1 
651  C CD2 . PHE A 90  ? 0.1011 0.4595 0.4318 -0.0043 -0.0127 -0.0625 88  PHE A CD2 
652  C CE1 . PHE A 90  ? 0.0947 0.4163 0.3779 -0.0177 -0.0047 -0.0508 88  PHE A CE1 
653  C CE2 . PHE A 90  ? 0.0915 0.4537 0.4212 -0.0185 -0.0042 -0.0628 88  PHE A CE2 
654  C CZ  . PHE A 90  ? 0.0505 0.3925 0.3548 -0.0251 -0.0006 -0.0567 88  PHE A CZ  
655  N N   . ARG A 91  ? 0.1616 0.4671 0.4507 0.0402  -0.0266 -0.0525 89  ARG A N   
656  C CA  . ARG A 91  ? 0.1871 0.4786 0.4673 0.0510  -0.0348 -0.0495 89  ARG A CA  
657  C C   . ARG A 91  ? 0.1865 0.4566 0.4384 0.0489  -0.0320 -0.0430 89  ARG A C   
658  O O   . ARG A 91  ? 0.2084 0.4641 0.4452 0.0534  -0.0400 -0.0383 89  ARG A O   
659  C CB  . ARG A 91  ? 0.2046 0.5013 0.5006 0.0598  -0.0311 -0.0546 89  ARG A CB  
660  C CG  . ARG A 91  ? 0.2769 0.5599 0.5681 0.0721  -0.0415 -0.0518 89  ARG A CG  
661  C CD  . ARG A 91  ? 0.2946 0.5836 0.6059 0.0822  -0.0376 -0.0579 89  ARG A CD  
662  N NE  . ARG A 91  ? 0.3356 0.6498 0.6807 0.0873  -0.0421 -0.0632 89  ARG A NE  
663  C CZ  . ARG A 91  ? 0.3636 0.6972 0.7349 0.0889  -0.0313 -0.0715 89  ARG A CZ  
664  N NH1 . ARG A 91  ? 0.3160 0.6436 0.6795 0.0854  -0.0154 -0.0757 89  ARG A NH1 
665  N NH2 . ARG A 91  ? 0.3550 0.7142 0.7601 0.0937  -0.0364 -0.0756 89  ARG A NH2 
666  N N   . PHE A 92  ? 0.1172 0.3857 0.3622 0.0419  -0.0208 -0.0425 90  PHE A N   
667  C CA  . PHE A 92  ? 0.1319 0.3848 0.3543 0.0383  -0.0183 -0.0358 90  PHE A CA  
668  C C   . PHE A 92  ? 0.1294 0.3808 0.3434 0.0315  -0.0183 -0.0315 90  PHE A C   
669  O O   . PHE A 92  ? 0.1288 0.3688 0.3282 0.0329  -0.0214 -0.0263 90  PHE A O   
670  C CB  . PHE A 92  ? 0.1280 0.3781 0.3449 0.0338  -0.0084 -0.0363 90  PHE A CB  
671  C CG  . PHE A 92  ? 0.1919 0.4286 0.3886 0.0300  -0.0073 -0.0289 90  PHE A CG  
672  C CD1 . PHE A 92  ? 0.1688 0.3916 0.3536 0.0352  -0.0117 -0.0253 90  PHE A CD1 
673  C CD2 . PHE A 92  ? 0.1137 0.3520 0.3042 0.0210  -0.0026 -0.0247 90  PHE A CD2 
674  C CE1 . PHE A 92  ? 0.1504 0.3639 0.3193 0.0308  -0.0103 -0.0183 90  PHE A CE1 
675  C CE2 . PHE A 92  ? 0.1497 0.3794 0.3259 0.0178  -0.0021 -0.0174 90  PHE A CE2 
676  C CZ  . PHE A 92  ? 0.1328 0.3514 0.2993 0.0224  -0.0054 -0.0145 90  PHE A CZ  
677  N N   . LEU A 93  ? 0.1392 0.4013 0.3621 0.0242  -0.0138 -0.0339 91  LEU A N   
678  C CA  . LEU A 93  ? 0.1416 0.4001 0.3568 0.0177  -0.0128 -0.0299 91  LEU A CA  
679  C C   . LEU A 93  ? 0.1577 0.4089 0.3668 0.0213  -0.0210 -0.0288 91  LEU A C   
680  O O   . LEU A 93  ? 0.1407 0.3820 0.3376 0.0197  -0.0202 -0.0245 91  LEU A O   
681  C CB  . LEU A 93  ? 0.1355 0.4058 0.3620 0.0090  -0.0082 -0.0333 91  LEU A CB  
682  C CG  . LEU A 93  ? 0.1933 0.4650 0.4160 -0.0005 0.0007  -0.0313 91  LEU A CG  
683  C CD1 . LEU A 93  ? 0.1204 0.3826 0.3285 -0.0014 0.0040  -0.0252 91  LEU A CD1 
684  C CD2 . LEU A 93  ? 0.1197 0.4062 0.3571 -0.0060 0.0072  -0.0381 91  LEU A CD2 
685  N N   . ASN A 94  ? 0.1398 0.3961 0.3578 0.0259  -0.0289 -0.0330 92  ASN A N   
686  C CA  . ASN A 94  ? 0.1610 0.4083 0.3694 0.0281  -0.0380 -0.0323 92  ASN A CA  
687  C C   . ASN A 94  ? 0.1622 0.3925 0.3498 0.0328  -0.0388 -0.0271 92  ASN A C   
688  O O   . ASN A 94  ? 0.1773 0.3962 0.3504 0.0324  -0.0411 -0.0257 92  ASN A O   
689  C CB  . ASN A 94  ? 0.1515 0.4084 0.3737 0.0321  -0.0485 -0.0367 92  ASN A CB  
690  C CG  . ASN A 94  ? 0.1814 0.4557 0.4235 0.0254  -0.0489 -0.0418 92  ASN A CG  
691  O OD1 . ASN A 94  ? 0.1758 0.4504 0.4164 0.0169  -0.0423 -0.0418 92  ASN A OD1 
692  N ND2 . ASN A 94  ? 0.1762 0.4651 0.4379 0.0288  -0.0571 -0.0457 92  ASN A ND2 
693  N N   . GLU A 95  ? 0.1688 0.3965 0.3539 0.0367  -0.0361 -0.0248 93  GLU A N   
694  C CA  . GLU A 95  ? 0.1906 0.4034 0.3568 0.0397  -0.0358 -0.0195 93  GLU A CA  
695  C C   . GLU A 95  ? 0.1880 0.3965 0.3454 0.0355  -0.0275 -0.0150 93  GLU A C   
696  O O   . GLU A 95  ? 0.2428 0.4405 0.3854 0.0369  -0.0266 -0.0117 93  GLU A O   
697  C CB  . GLU A 95  ? 0.1791 0.3890 0.3449 0.0437  -0.0355 -0.0183 93  GLU A CB  
698  C CG  . GLU A 95  ? 0.2036 0.4167 0.3801 0.0502  -0.0440 -0.0222 93  GLU A CG  
699  C CD  . GLU A 95  ? 0.2949 0.5001 0.4624 0.0538  -0.0555 -0.0214 93  GLU A CD  
700  O OE1 . GLU A 95  ? 0.3597 0.5745 0.5416 0.0563  -0.0639 -0.0252 93  GLU A OE1 
701  O OE2 . GLU A 95  ? 0.3276 0.5177 0.4735 0.0533  -0.0562 -0.0169 93  GLU A OE2 
702  N N   . LEU A 96  ? 0.1584 0.3755 0.3251 0.0305  -0.0214 -0.0147 94  LEU A N   
703  C CA  . LEU A 96  ? 0.1395 0.3542 0.3017 0.0272  -0.0152 -0.0099 94  LEU A CA  
704  C C   . LEU A 96  ? 0.1547 0.3639 0.3134 0.0267  -0.0161 -0.0112 94  LEU A C   
705  O O   . LEU A 96  ? 0.1752 0.3766 0.3256 0.0282  -0.0124 -0.0077 94  LEU A O   
706  C CB  . LEU A 96  ? 0.1358 0.3595 0.3068 0.0211  -0.0104 -0.0086 94  LEU A CB  
707  C CG  . LEU A 96  ? 0.1374 0.3642 0.3092 0.0199  -0.0084 -0.0081 94  LEU A CG  
708  C CD1 . LEU A 96  ? 0.1120 0.3454 0.2879 0.0121  -0.0035 -0.0069 94  LEU A CD1 
709  C CD2 . LEU A 96  ? 0.0874 0.3072 0.2489 0.0219  -0.0076 -0.0025 94  LEU A CD2 
710  N N   . ILE A 97  ? 0.1513 0.3647 0.3172 0.0242  -0.0203 -0.0165 95  ILE A N   
711  C CA  . ILE A 97  ? 0.1818 0.3875 0.3426 0.0223  -0.0224 -0.0190 95  ILE A CA  
712  C C   . ILE A 97  ? 0.2210 0.4128 0.3648 0.0269  -0.0255 -0.0195 95  ILE A C   
713  O O   . ILE A 97  ? 0.2413 0.4209 0.3742 0.0270  -0.0223 -0.0194 95  ILE A O   
714  C CB  . ILE A 97  ? 0.1876 0.4028 0.3606 0.0172  -0.0279 -0.0250 95  ILE A CB  
715  C CG1 . ILE A 97  ? 0.1694 0.3950 0.3548 0.0103  -0.0223 -0.0246 95  ILE A CG1 
716  C CG2 . ILE A 97  ? 0.2059 0.4102 0.3698 0.0146  -0.0326 -0.0283 95  ILE A CG2 
717  C CD1 . ILE A 97  ? 0.1204 0.3610 0.3226 0.0047  -0.0253 -0.0305 95  ILE A CD1 
718  N N   . LYS A 98  ? 0.2021 0.3936 0.3420 0.0307  -0.0309 -0.0198 96  LYS A N   
719  C CA  . LYS A 98  ? 0.2504 0.4272 0.3703 0.0341  -0.0337 -0.0194 96  LYS A CA  
720  C C   . LYS A 98  ? 0.2543 0.4221 0.3624 0.0360  -0.0239 -0.0151 96  LYS A C   
721  O O   . LYS A 98  ? 0.2944 0.4486 0.3864 0.0366  -0.0218 -0.0166 96  LYS A O   
722  C CB  . LYS A 98  ? 0.2536 0.4303 0.3708 0.0378  -0.0413 -0.0186 96  LYS A CB  
723  C CG  . LYS A 98  ? 0.2632 0.4465 0.3898 0.0376  -0.0533 -0.0231 96  LYS A CG  
724  C CD  . LYS A 98  ? 0.3348 0.5181 0.4621 0.0432  -0.0612 -0.0215 96  LYS A CD  
725  C CE  . LYS A 98  ? 0.3873 0.5843 0.5343 0.0444  -0.0721 -0.0255 96  LYS A CE  
726  N NZ  . LYS A 98  ? 0.4531 0.6466 0.5994 0.0516  -0.0815 -0.0233 96  LYS A NZ  
727  N N   . VAL A 99  ? 0.2287 0.4047 0.3456 0.0363  -0.0177 -0.0103 97  VAL A N   
728  C CA  . VAL A 99  ? 0.2310 0.4040 0.3425 0.0381  -0.0087 -0.0051 97  VAL A CA  
729  C C   . VAL A 99  ? 0.2426 0.4135 0.3574 0.0384  -0.0019 -0.0045 97  VAL A C   
730  O O   . VAL A 99  ? 0.2381 0.4021 0.3452 0.0415  0.0052  -0.0030 97  VAL A O   
731  C CB  . VAL A 99  ? 0.2214 0.4051 0.3425 0.0367  -0.0062 0.0003  97  VAL A CB  
732  C CG1 . VAL A 99  ? 0.1659 0.3515 0.2868 0.0373  0.0026  0.0064  97  VAL A CG1 
733  C CG2 . VAL A 99  ? 0.1875 0.3687 0.3029 0.0374  -0.0118 -0.0001 97  VAL A CG2 
734  N N   . VAL A 100 ? 0.2462 0.4224 0.3728 0.0353  -0.0035 -0.0056 98  VAL A N   
735  C CA  . VAL A 100 ? 0.2641 0.4359 0.3939 0.0361  0.0021  -0.0039 98  VAL A CA  
736  C C   . VAL A 100 ? 0.3122 0.4683 0.4308 0.0362  0.0013  -0.0100 98  VAL A C   
737  O O   . VAL A 100 ? 0.3556 0.5033 0.4742 0.0382  0.0064  -0.0093 98  VAL A O   
738  C CB  . VAL A 100 ? 0.2519 0.4332 0.3962 0.0316  0.0014  -0.0006 98  VAL A CB  
739  C CG1 . VAL A 100 ? 0.1969 0.3911 0.3498 0.0306  0.0031  0.0060  98  VAL A CG1 
740  C CG2 . VAL A 100 ? 0.2099 0.3947 0.3582 0.0255  -0.0048 -0.0059 98  VAL A CG2 
741  N N   . SER A 101 ? 0.2886 0.4404 0.3987 0.0336  -0.0061 -0.0158 99  SER A N   
742  C CA  . SER A 101 ? 0.3397 0.4778 0.4401 0.0305  -0.0092 -0.0219 99  SER A CA  
743  C C   . SER A 101 ? 0.3941 0.5141 0.4711 0.0332  -0.0077 -0.0259 99  SER A C   
744  O O   . SER A 101 ? 0.3817 0.5017 0.4492 0.0345  -0.0110 -0.0257 99  SER A O   
745  C CB  . SER A 101 ? 0.3197 0.4668 0.4281 0.0239  -0.0195 -0.0259 99  SER A CB  
746  O OG  . SER A 101 ? 0.4462 0.5800 0.5425 0.0195  -0.0248 -0.0321 99  SER A OG  
747  N N   . PRO A 102 ? 0.4262 0.5286 0.4921 0.0345  -0.0015 -0.0290 100 PRO A N   
748  C CA  . PRO A 102 ? 0.5004 0.5820 0.5404 0.0360  0.0018  -0.0343 100 PRO A CA  
749  C C   . PRO A 102 ? 0.5452 0.6196 0.5680 0.0298  -0.0104 -0.0396 100 PRO A C   
750  O O   . PRO A 102 ? 0.5825 0.6439 0.5825 0.0305  -0.0095 -0.0418 100 PRO A O   
751  C CB  . PRO A 102 ? 0.5275 0.5908 0.5621 0.0371  0.0090  -0.0379 100 PRO A CB  
752  C CG  . PRO A 102 ? 0.5116 0.5860 0.5687 0.0352  0.0073  -0.0337 100 PRO A CG  
753  C CD  . PRO A 102 ? 0.4349 0.5347 0.5116 0.0353  0.0041  -0.0270 100 PRO A CD  
754  N N   . LYS A 103 ? 0.5470 0.6304 0.5809 0.0233  -0.0219 -0.0413 101 LYS A N   
755  C CA  . LYS A 103 ? 0.5901 0.6723 0.6139 0.0178  -0.0361 -0.0450 101 LYS A CA  
756  C C   . LYS A 103 ? 0.5638 0.6547 0.5863 0.0217  -0.0410 -0.0408 101 LYS A C   
757  O O   . LYS A 103 ? 0.5855 0.6681 0.5905 0.0194  -0.0509 -0.0425 101 LYS A O   
758  C CB  . LYS A 103 ? 0.5706 0.6672 0.6139 0.0106  -0.0465 -0.0469 101 LYS A CB  
759  C CG  . LYS A 103 ? 0.6576 0.7423 0.6983 0.0038  -0.0447 -0.0513 101 LYS A CG  
760  C CD  . LYS A 103 ? 0.7219 0.8259 0.7868 -0.0042 -0.0524 -0.0519 101 LYS A CD  
761  C CE  . LYS A 103 ? 0.7315 0.8521 0.8051 -0.0072 -0.0671 -0.0531 101 LYS A CE  
762  N NZ  . LYS A 103 ? 0.7570 0.8665 0.8157 -0.0165 -0.0792 -0.0590 101 LYS A NZ  
763  N N   . TYR A 104 ? 0.5232 0.6295 0.5632 0.0268  -0.0352 -0.0349 102 TYR A N   
764  C CA  . TYR A 104 ? 0.5004 0.6143 0.5415 0.0299  -0.0401 -0.0306 102 TYR A CA  
765  C C   . TYR A 104 ? 0.5041 0.6117 0.5336 0.0345  -0.0290 -0.0262 102 TYR A C   
766  O O   . TYR A 104 ? 0.5283 0.6183 0.5322 0.0343  -0.0257 -0.0278 102 TYR A O   
767  C CB  . TYR A 104 ? 0.4462 0.5825 0.5155 0.0304  -0.0446 -0.0284 102 TYR A CB  
768  C CG  . TYR A 104 ? 0.4437 0.5889 0.5262 0.0251  -0.0544 -0.0330 102 TYR A CG  
769  C CD1 . TYR A 104 ? 0.4397 0.5936 0.5387 0.0211  -0.0499 -0.0344 102 TYR A CD1 
770  C CD2 . TYR A 104 ? 0.5378 0.6806 0.6135 0.0229  -0.0685 -0.0357 102 TYR A CD2 
771  C CE1 . TYR A 104 ? 0.4598 0.6216 0.5700 0.0145  -0.0578 -0.0387 102 TYR A CE1 
772  C CE2 . TYR A 104 ? 0.4977 0.6502 0.5868 0.0168  -0.0777 -0.0400 102 TYR A CE2 
773  C CZ  . TYR A 104 ? 0.4654 0.6277 0.5720 0.0122  -0.0715 -0.0418 102 TYR A CZ  
774  O OH  . TYR A 104 ? 0.4726 0.6459 0.5933 0.0045  -0.0796 -0.0459 102 TYR A OH  
775  N N   . LEU A 105 ? 0.4102 0.5317 0.4571 0.0374  -0.0227 -0.0209 103 LEU A N   
776  C CA  . LEU A 105 ? 0.4247 0.5438 0.4640 0.0402  -0.0128 -0.0161 103 LEU A CA  
777  C C   . LEU A 105 ? 0.4097 0.5303 0.4555 0.0428  0.0013  -0.0145 103 LEU A C   
778  O O   . LEU A 105 ? 0.3956 0.5157 0.4367 0.0448  0.0109  -0.0109 103 LEU A O   
779  C CB  . LEU A 105 ? 0.3811 0.5125 0.4323 0.0410  -0.0155 -0.0107 103 LEU A CB  
780  C CG  . LEU A 105 ? 0.4247 0.5557 0.4740 0.0409  -0.0291 -0.0112 103 LEU A CG  
781  C CD1 . LEU A 105 ? 0.3972 0.5388 0.4602 0.0422  -0.0293 -0.0069 103 LEU A CD1 
782  C CD2 . LEU A 105 ? 0.4971 0.6097 0.5181 0.0405  -0.0340 -0.0111 103 LEU A CD2 
783  N N   . GLY A 106 ? 0.3502 0.4731 0.4081 0.0425  0.0023  -0.0167 104 GLY A N   
784  C CA  . GLY A 106 ? 0.3307 0.4565 0.3995 0.0461  0.0135  -0.0139 104 GLY A CA  
785  C C   . GLY A 106 ? 0.4024 0.5161 0.4571 0.0505  0.0258  -0.0151 104 GLY A C   
786  O O   . GLY A 106 ? 0.3862 0.5087 0.4530 0.0547  0.0356  -0.0102 104 GLY A O   
787  N N   . SER A 107 ? 0.4549 0.5494 0.4844 0.0492  0.0253  -0.0216 105 SER A N   
788  C CA  . SER A 107 ? 0.5356 0.6155 0.5470 0.0527  0.0386  -0.0245 105 SER A CA  
789  C C   . SER A 107 ? 0.5361 0.6249 0.5479 0.0545  0.0480  -0.0190 105 SER A C   
790  O O   . SER A 107 ? 0.5754 0.6615 0.5857 0.0591  0.0627  -0.0196 105 SER A O   
791  C CB  . SER A 107 ? 0.5708 0.6271 0.5493 0.0483  0.0343  -0.0323 105 SER A CB  
792  O OG  . SER A 107 ? 0.6444 0.6885 0.6196 0.0464  0.0299  -0.0385 105 SER A OG  
793  N N   . ARG A 108 ? 0.5919 0.6900 0.6049 0.0507  0.0398  -0.0142 106 ARG A N   
794  C CA  . ARG A 108 ? 0.6051 0.7089 0.6144 0.0498  0.0470  -0.0089 106 ARG A CA  
795  C C   . ARG A 108 ? 0.5437 0.6702 0.5799 0.0495  0.0456  -0.0009 106 ARG A C   
796  O O   . ARG A 108 ? 0.5461 0.6782 0.5806 0.0467  0.0481  0.0042  106 ARG A O   
797  C CB  . ARG A 108 ? 0.6346 0.7244 0.6162 0.0446  0.0388  -0.0094 106 ARG A CB  
798  C CG  . ARG A 108 ? 0.6507 0.7445 0.6379 0.0422  0.0210  -0.0080 106 ARG A CG  
799  C CD  . ARG A 108 ? 0.7671 0.8462 0.7276 0.0383  0.0124  -0.0068 106 ARG A CD  
800  N NE  . ARG A 108 ? 0.7985 0.8728 0.7558 0.0373  -0.0051 -0.0095 106 ARG A NE  
801  C CZ  . ARG A 108 ? 0.8523 0.9166 0.7993 0.0360  -0.0108 -0.0159 106 ARG A CZ  
802  N NH1 . ARG A 108 ? 0.8836 0.9386 0.8212 0.0363  0.0003  -0.0209 106 ARG A NH1 
803  N NH2 . ARG A 108 ? 0.8332 0.8970 0.7809 0.0346  -0.0276 -0.0175 106 ARG A NH2 
804  N N   . THR A 109 ? 0.4746 0.6120 0.5327 0.0510  0.0407  0.0001  107 THR A N   
805  C CA  . THR A 109 ? 0.3932 0.5502 0.4744 0.0496  0.0388  0.0071  107 THR A CA  
806  C C   . THR A 109 ? 0.3697 0.5382 0.4707 0.0541  0.0487  0.0109  107 THR A C   
807  O O   . THR A 109 ? 0.3538 0.5161 0.4580 0.0588  0.0518  0.0077  107 THR A O   
808  C CB  . THR A 109 ? 0.3679 0.5297 0.4596 0.0473  0.0270  0.0061  107 THR A CB  
809  O OG1 . THR A 109 ? 0.3964 0.5500 0.4743 0.0446  0.0171  0.0027  107 THR A OG1 
810  C CG2 . THR A 109 ? 0.2900 0.4696 0.4017 0.0447  0.0256  0.0128  107 THR A CG2 
811  N N   . SER A 110 ? 0.3989 0.5839 0.5140 0.0526  0.0527  0.0182  108 SER A N   
812  C CA  . SER A 110 ? 0.3715 0.5711 0.5097 0.0572  0.0603  0.0233  108 SER A CA  
813  C C   . SER A 110 ? 0.3513 0.5549 0.5049 0.0586  0.0530  0.0250  108 SER A C   
814  O O   . SER A 110 ? 0.3196 0.5223 0.4711 0.0535  0.0427  0.0244  108 SER A O   
815  C CB  . SER A 110 ? 0.3389 0.5579 0.4908 0.0532  0.0634  0.0315  108 SER A CB  
816  O OG  . SER A 110 ? 0.2744 0.5018 0.4328 0.0464  0.0526  0.0358  108 SER A OG  
817  N N   . GLU A 111 ? 0.3930 0.6004 0.5621 0.0657  0.0590  0.0273  109 GLU A N   
818  C CA  . GLU A 111 ? 0.3892 0.5996 0.5730 0.0670  0.0526  0.0310  109 GLU A CA  
819  C C   . GLU A 111 ? 0.3182 0.5465 0.5156 0.0599  0.0441  0.0393  109 GLU A C   
820  O O   . GLU A 111 ? 0.3084 0.5352 0.5067 0.0557  0.0355  0.0403  109 GLU A O   
821  C CB  . GLU A 111 ? 0.4157 0.6266 0.6149 0.0775  0.0612  0.0332  109 GLU A CB  
822  C CG  . GLU A 111 ? 0.5527 0.7419 0.7439 0.0825  0.0612  0.0272  109 GLU A CG  
823  C CD  . GLU A 111 ? 0.6568 0.8239 0.8200 0.0801  0.0621  0.0160  109 GLU A CD  
824  O OE1 . GLU A 111 ? 0.6702 0.8353 0.8190 0.0783  0.0668  0.0122  109 GLU A OE1 
825  O OE2 . GLU A 111 ? 0.7020 0.8524 0.8566 0.0793  0.0577  0.0114  109 GLU A OE2 
826  N N   . LYS A 112 ? 0.3012 0.5450 0.5063 0.0570  0.0467  0.0447  110 LYS A N   
827  C CA  . LYS A 112 ? 0.2459 0.5041 0.4592 0.0483  0.0385  0.0517  110 LYS A CA  
828  C C   . LYS A 112 ? 0.2112 0.4604 0.4087 0.0406  0.0301  0.0472  110 LYS A C   
829  O O   . LYS A 112 ? 0.1978 0.4509 0.3992 0.0353  0.0227  0.0500  110 LYS A O   
830  C CB  . LYS A 112 ? 0.2276 0.5008 0.4473 0.0445  0.0431  0.0567  110 LYS A CB  
831  C CG  . LYS A 112 ? 0.2125 0.4993 0.4392 0.0342  0.0345  0.0640  110 LYS A CG  
832  C CD  . LYS A 112 ? 0.3360 0.6344 0.5647 0.0280  0.0388  0.0679  110 LYS A CD  
833  C CE  . LYS A 112 ? 0.4080 0.7223 0.6477 0.0175  0.0305  0.0764  110 LYS A CE  
834  N NZ  . LYS A 112 ? 0.4524 0.7773 0.6932 0.0092  0.0341  0.0803  110 LYS A NZ  
835  N N   . VAL A 113 ? 0.2055 0.4439 0.3855 0.0397  0.0315  0.0408  111 VAL A N   
836  C CA  . VAL A 113 ? 0.1860 0.4160 0.3531 0.0347  0.0242  0.0358  111 VAL A CA  
837  C C   . VAL A 113 ? 0.1820 0.4051 0.3489 0.0357  0.0195  0.0312  111 VAL A C   
838  O O   . VAL A 113 ? 0.1608 0.3862 0.3288 0.0304  0.0137  0.0307  111 VAL A O   
839  C CB  . VAL A 113 ? 0.2018 0.4195 0.3502 0.0355  0.0256  0.0305  111 VAL A CB  
840  C CG1 . VAL A 113 ? 0.1949 0.4038 0.3336 0.0333  0.0173  0.0246  111 VAL A CG1 
841  C CG2 . VAL A 113 ? 0.2038 0.4268 0.3497 0.0313  0.0292  0.0354  111 VAL A CG2 
842  N N   . LYS A 114 ? 0.1768 0.3908 0.3414 0.0416  0.0229  0.0276  112 LYS A N   
843  C CA  . LYS A 114 ? 0.1640 0.3702 0.3274 0.0410  0.0186  0.0234  112 LYS A CA  
844  C C   . LYS A 114 ? 0.1465 0.3603 0.3229 0.0381  0.0158  0.0296  112 LYS A C   
845  O O   . LYS A 114 ? 0.1295 0.3432 0.3053 0.0323  0.0108  0.0280  112 LYS A O   
846  C CB  . LYS A 114 ? 0.1716 0.3631 0.3269 0.0469  0.0229  0.0180  112 LYS A CB  
847  C CG  . LYS A 114 ? 0.2124 0.3938 0.3499 0.0477  0.0236  0.0116  112 LYS A CG  
848  C CD  . LYS A 114 ? 0.2274 0.3913 0.3520 0.0518  0.0274  0.0051  112 LYS A CD  
849  C CE  . LYS A 114 ? 0.2544 0.4167 0.3848 0.0589  0.0382  0.0076  112 LYS A CE  
850  N NZ  . LYS A 114 ? 0.3574 0.5007 0.4687 0.0626  0.0446  0.0002  112 LYS A NZ  
851  N N   . ASN A 115 ? 0.1582 0.3793 0.3467 0.0417  0.0190  0.0371  113 ASN A N   
852  C CA  . ASN A 115 ? 0.1527 0.3803 0.3526 0.0389  0.0146  0.0448  113 ASN A CA  
853  C C   . ASN A 115 ? 0.1144 0.3513 0.3130 0.0287  0.0086  0.0476  113 ASN A C   
854  O O   . ASN A 115 ? 0.1047 0.3409 0.3028 0.0228  0.0039  0.0497  113 ASN A O   
855  C CB  . ASN A 115 ? 0.1700 0.4071 0.3864 0.0454  0.0178  0.0534  113 ASN A CB  
856  C CG  . ASN A 115 ? 0.2593 0.4846 0.4784 0.0562  0.0242  0.0511  113 ASN A CG  
857  O OD1 . ASN A 115 ? 0.2277 0.4603 0.4618 0.0642  0.0292  0.0563  113 ASN A OD1 
858  N ND2 . ASN A 115 ? 0.2148 0.4222 0.4207 0.0563  0.0240  0.0435  113 ASN A ND2 
859  N N   . LYS A 116 ? 0.1281 0.3718 0.3240 0.0260  0.0094  0.0473  114 LYS A N   
860  C CA  . LYS A 116 ? 0.1084 0.3574 0.3003 0.0164  0.0047  0.0486  114 LYS A CA  
861  C C   . LYS A 116 ? 0.1125 0.3535 0.2948 0.0125  0.0026  0.0406  114 LYS A C   
862  O O   . LYS A 116 ? 0.1141 0.3564 0.2952 0.0054  -0.0005 0.0418  114 LYS A O   
863  C CB  . LYS A 116 ? 0.0831 0.3367 0.2717 0.0142  0.0063  0.0492  114 LYS A CB  
864  C CG  . LYS A 116 ? 0.1153 0.3723 0.2988 0.0038  0.0019  0.0508  114 LYS A CG  
865  C CD  . LYS A 116 ? 0.1353 0.4014 0.3265 -0.0023 -0.0030 0.0594  114 LYS A CD  
866  C CE  . LYS A 116 ? 0.2053 0.4722 0.3873 -0.0141 -0.0072 0.0603  114 LYS A CE  
867  N NZ  . LYS A 116 ? 0.2069 0.4840 0.3958 -0.0210 -0.0135 0.0709  114 LYS A NZ  
868  N N   . ILE A 117 ? 0.0842 0.3171 0.2604 0.0172  0.0044  0.0327  115 ILE A N   
869  C CA  . ILE A 117 ? 0.1194 0.3479 0.2911 0.0145  0.0023  0.0250  115 ILE A CA  
870  C C   . ILE A 117 ? 0.1409 0.3679 0.3157 0.0109  0.0012  0.0256  115 ILE A C   
871  O O   . ILE A 117 ? 0.1474 0.3764 0.3212 0.0043  0.0002  0.0227  115 ILE A O   
872  C CB  . ILE A 117 ? 0.1349 0.3556 0.3007 0.0203  0.0024  0.0176  115 ILE A CB  
873  C CG1 . ILE A 117 ? 0.1428 0.3627 0.3023 0.0218  0.0021  0.0168  115 ILE A CG1 
874  C CG2 . ILE A 117 ? 0.1002 0.3194 0.2666 0.0180  -0.0005 0.0102  115 ILE A CG2 
875  C CD1 . ILE A 117 ? 0.1623 0.3730 0.3127 0.0275  0.0018  0.0126  115 ILE A CD1 
876  N N   . LEU A 118 ? 0.1406 0.3627 0.3186 0.0152  0.0023  0.0289  116 LEU A N   
877  C CA  . LEU A 118 ? 0.1513 0.3676 0.3299 0.0118  0.0009  0.0298  116 LEU A CA  
878  C C   . LEU A 118 ? 0.1603 0.3820 0.3405 0.0042  -0.0017 0.0376  116 LEU A C   
879  O O   . LEU A 118 ? 0.1863 0.4057 0.3629 -0.0036 -0.0029 0.0368  116 LEU A O   
880  C CB  . LEU A 118 ? 0.1608 0.3670 0.3412 0.0194  0.0029  0.0316  116 LEU A CB  
881  C CG  . LEU A 118 ? 0.1953 0.3915 0.3692 0.0249  0.0053  0.0232  116 LEU A CG  
882  C CD1 . LEU A 118 ? 0.1983 0.3820 0.3725 0.0322  0.0086  0.0249  116 LEU A CD1 
883  C CD2 . LEU A 118 ? 0.2287 0.4217 0.3979 0.0186  0.0023  0.0154  116 LEU A CD2 
884  N N   . GLU A 119 ? 0.1714 0.4008 0.3563 0.0052  -0.0029 0.0453  117 GLU A N   
885  C CA  . GLU A 119 ? 0.1845 0.4194 0.3686 -0.0034 -0.0072 0.0532  117 GLU A CA  
886  C C   . GLU A 119 ? 0.1841 0.4205 0.3585 -0.0132 -0.0068 0.0475  117 GLU A C   
887  O O   . GLU A 119 ? 0.1615 0.3961 0.3291 -0.0228 -0.0086 0.0498  117 GLU A O   
888  C CB  . GLU A 119 ? 0.1765 0.4220 0.3686 -0.0016 -0.0094 0.0618  117 GLU A CB  
889  C CG  . GLU A 119 ? 0.2691 0.5204 0.4583 -0.0124 -0.0161 0.0707  117 GLU A CG  
890  C CD  . GLU A 119 ? 0.3053 0.5680 0.4966 -0.0161 -0.0179 0.0743  117 GLU A CD  
891  O OE1 . GLU A 119 ? 0.3053 0.5720 0.4918 -0.0263 -0.0240 0.0807  117 GLU A OE1 
892  O OE2 . GLU A 119 ? 0.2683 0.5350 0.4651 -0.0097 -0.0136 0.0714  117 GLU A OE2 
893  N N   . LEU A 120 ? 0.1509 0.3900 0.3236 -0.0111 -0.0042 0.0409  118 LEU A N   
894  C CA  . LEU A 120 ? 0.1457 0.3855 0.3107 -0.0183 -0.0027 0.0346  118 LEU A CA  
895  C C   . LEU A 120 ? 0.1748 0.4118 0.3384 -0.0217 -0.0001 0.0275  118 LEU A C   
896  O O   . LEU A 120 ? 0.1718 0.4093 0.3290 -0.0307 0.0017  0.0257  118 LEU A O   
897  C CB  . LEU A 120 ? 0.1376 0.3776 0.3016 -0.0136 -0.0010 0.0287  118 LEU A CB  
898  C CG  . LEU A 120 ? 0.1476 0.3907 0.3108 -0.0137 -0.0025 0.0348  118 LEU A CG  
899  C CD1 . LEU A 120 ? 0.1346 0.3738 0.2937 -0.0096 -0.0008 0.0287  118 LEU A CD1 
900  C CD2 . LEU A 120 ? 0.1539 0.3995 0.3106 -0.0250 -0.0052 0.0401  118 LEU A CD2 
901  N N   . LEU A 121 ? 0.1566 0.3906 0.3255 -0.0152 0.0005  0.0232  119 LEU A N   
902  C CA  . LEU A 121 ? 0.1585 0.3917 0.3286 -0.0193 0.0025  0.0169  119 LEU A CA  
903  C C   . LEU A 121 ? 0.1853 0.4148 0.3505 -0.0288 0.0023  0.0224  119 LEU A C   
904  O O   . LEU A 121 ? 0.2122 0.4440 0.3743 -0.0376 0.0057  0.0185  119 LEU A O   
905  C CB  . LEU A 121 ? 0.1634 0.3926 0.3383 -0.0120 0.0015  0.0123  119 LEU A CB  
906  C CG  . LEU A 121 ? 0.1271 0.3587 0.3045 -0.0046 0.0007  0.0056  119 LEU A CG  
907  C CD1 . LEU A 121 ? 0.1574 0.3819 0.3348 0.0012  -0.0013 0.0033  119 LEU A CD1 
908  C CD2 . LEU A 121 ? 0.0721 0.3115 0.2543 -0.0074 0.0022  -0.0025 119 LEU A CD2 
909  N N   . TYR A 122 ? 0.1235 0.3470 0.2883 -0.0268 -0.0012 0.0316  120 TYR A N   
910  C CA  . TYR A 122 ? 0.1307 0.3482 0.2888 -0.0356 -0.0032 0.0389  120 TYR A CA  
911  C C   . TYR A 122 ? 0.1553 0.3769 0.3035 -0.0466 -0.0029 0.0412  120 TYR A C   
912  O O   . TYR A 122 ? 0.1634 0.3823 0.3030 -0.0575 -0.0004 0.0400  120 TYR A O   
913  C CB  . TYR A 122 ? 0.1787 0.3898 0.3400 -0.0294 -0.0083 0.0497  120 TYR A CB  
914  C CG  . TYR A 122 ? 0.2047 0.4078 0.3580 -0.0382 -0.0125 0.0594  120 TYR A CG  
915  C CD1 . TYR A 122 ? 0.2518 0.4429 0.3994 -0.0436 -0.0117 0.0587  120 TYR A CD1 
916  C CD2 . TYR A 122 ? 0.1701 0.3769 0.3194 -0.0431 -0.0180 0.0693  120 TYR A CD2 
917  C CE1 . TYR A 122 ? 0.3146 0.4957 0.4517 -0.0527 -0.0160 0.0684  120 TYR A CE1 
918  C CE2 . TYR A 122 ? 0.2693 0.4671 0.4087 -0.0517 -0.0236 0.0793  120 TYR A CE2 
919  C CZ  . TYR A 122 ? 0.2916 0.4757 0.4243 -0.0563 -0.0223 0.0789  120 TYR A CZ  
920  O OH  . TYR A 122 ? 0.3689 0.5412 0.4893 -0.0654 -0.0282 0.0896  120 TYR A OH  
921  N N   . SER A 123 ? 0.1820 0.4091 0.3298 -0.0450 -0.0051 0.0444  121 SER A N   
922  C CA  . SER A 123 ? 0.2108 0.4393 0.3461 -0.0564 -0.0056 0.0465  121 SER A CA  
923  C C   . SER A 123 ? 0.2183 0.4480 0.3465 -0.0634 0.0024  0.0352  121 SER A C   
924  O O   . SER A 123 ? 0.2298 0.4564 0.3439 -0.0757 0.0044  0.0358  121 SER A O   
925  C CB  . SER A 123 ? 0.1865 0.4203 0.3231 -0.0542 -0.0101 0.0518  121 SER A CB  
926  O OG  . SER A 123 ? 0.3124 0.5499 0.4529 -0.0482 -0.0059 0.0432  121 SER A OG  
927  N N   . TRP A 124 ? 0.2278 0.4619 0.3660 -0.0557 0.0072  0.0249  122 TRP A N   
928  C CA  . TRP A 124 ? 0.2244 0.4620 0.3613 -0.0602 0.0154  0.0138  122 TRP A CA  
929  C C   . TRP A 124 ? 0.2493 0.4872 0.3867 -0.0675 0.0198  0.0109  122 TRP A C   
930  O O   . TRP A 124 ? 0.2460 0.4863 0.3777 -0.0765 0.0275  0.0048  122 TRP A O   
931  C CB  . TRP A 124 ? 0.1921 0.4350 0.3409 -0.0492 0.0174  0.0046  122 TRP A CB  
932  C CG  . TRP A 124 ? 0.1518 0.3926 0.2985 -0.0432 0.0138  0.0072  122 TRP A CG  
933  C CD1 . TRP A 124 ? 0.2087 0.4459 0.3433 -0.0496 0.0122  0.0120  122 TRP A CD1 
934  C CD2 . TRP A 124 ? 0.1358 0.3773 0.2909 -0.0315 0.0115  0.0046  122 TRP A CD2 
935  N NE1 . TRP A 124 ? 0.1862 0.4224 0.3227 -0.0427 0.0093  0.0130  122 TRP A NE1 
936  C CE2 . TRP A 124 ? 0.1882 0.4263 0.3363 -0.0315 0.0091  0.0087  122 TRP A CE2 
937  C CE3 . TRP A 124 ? 0.1331 0.3770 0.2992 -0.0223 0.0106  -0.0007 122 TRP A CE3 
938  C CZ2 . TRP A 124 ? 0.1462 0.3824 0.2973 -0.0226 0.0069  0.0082  122 TRP A CZ2 
939  C CZ3 . TRP A 124 ? 0.1452 0.3864 0.3129 -0.0131 0.0074  -0.0007 122 TRP A CZ3 
940  C CH2 . TRP A 124 ? 0.1364 0.3735 0.2964 -0.0134 0.0062  0.0036  122 TRP A CH2 
941  N N   . THR A 125 ? 0.1706 0.4051 0.3138 -0.0646 0.0159  0.0151  123 THR A N   
942  C CA  . THR A 125 ? 0.2112 0.4436 0.3526 -0.0740 0.0193  0.0140  123 THR A CA  
943  C C   . THR A 125 ? 0.2747 0.4995 0.3973 -0.0882 0.0201  0.0212  123 THR A C   
944  O O   . THR A 125 ? 0.3054 0.5310 0.4215 -0.1000 0.0273  0.0172  123 THR A O   
945  C CB  . THR A 125 ? 0.2018 0.4273 0.3496 -0.0691 0.0145  0.0173  123 THR A CB  
946  O OG1 . THR A 125 ? 0.2440 0.4587 0.3854 -0.0664 0.0073  0.0292  123 THR A OG1 
947  C CG2 . THR A 125 ? 0.1560 0.3869 0.3182 -0.0565 0.0130  0.0104  123 THR A CG2 
948  N N   . VAL A 126 ? 0.3125 0.5308 0.4260 -0.0879 0.0126  0.0318  124 VAL A N   
949  C CA  . VAL A 126 ? 0.3639 0.5735 0.4571 -0.1018 0.0103  0.0405  124 VAL A CA  
950  C C   . VAL A 126 ? 0.3779 0.5905 0.4579 -0.1106 0.0165  0.0347  124 VAL A C   
951  O O   . VAL A 126 ? 0.4107 0.6181 0.4728 -0.1252 0.0216  0.0343  124 VAL A O   
952  C CB  . VAL A 126 ? 0.3604 0.5640 0.4517 -0.0977 -0.0019 0.0550  124 VAL A CB  
953  C CG1 . VAL A 126 ? 0.4930 0.6870 0.5619 -0.1126 -0.0069 0.0654  124 VAL A CG1 
954  C CG2 . VAL A 126 ? 0.4082 0.6064 0.5120 -0.0876 -0.0066 0.0599  124 VAL A CG2 
955  N N   . GLY A 127 ? 0.2761 0.4950 0.3627 -0.1023 0.0166  0.0300  125 GLY A N   
956  C CA  . GLY A 127 ? 0.3145 0.5323 0.3864 -0.1098 0.0210  0.0252  125 GLY A CA  
957  C C   . GLY A 127 ? 0.3163 0.5393 0.3908 -0.1107 0.0346  0.0100  125 GLY A C   
958  O O   . GLY A 127 ? 0.3511 0.5697 0.4087 -0.1206 0.0417  0.0049  125 GLY A O   
959  N N   . LEU A 128 ? 0.3000 0.5323 0.3961 -0.1002 0.0381  0.0026  126 LEU A N   
960  C CA  . LEU A 128 ? 0.2987 0.5396 0.4044 -0.0982 0.0499  -0.0115 126 LEU A CA  
961  C C   . LEU A 128 ? 0.2775 0.5275 0.3985 -0.0990 0.0543  -0.0154 126 LEU A C   
962  O O   . LEU A 128 ? 0.2182 0.4774 0.3604 -0.0879 0.0527  -0.0202 126 LEU A O   
963  C CB  . LEU A 128 ? 0.2606 0.5055 0.3800 -0.0834 0.0483  -0.0173 126 LEU A CB  
964  C CG  . LEU A 128 ? 0.3037 0.5394 0.4091 -0.0832 0.0447  -0.0147 126 LEU A CG  
965  C CD1 . LEU A 128 ? 0.2755 0.5130 0.3947 -0.0683 0.0391  -0.0157 126 LEU A CD1 
966  C CD2 . LEU A 128 ? 0.3934 0.6238 0.4839 -0.0912 0.0554  -0.0239 126 LEU A CD2 
967  N N   . PRO A 129 ? 0.3305 0.5764 0.4388 -0.1135 0.0582  -0.0120 127 PRO A N   
968  C CA  . PRO A 129 ? 0.3361 0.5891 0.4571 -0.1168 0.0616  -0.0145 127 PRO A CA  
969  C C   . PRO A 129 ? 0.3248 0.5957 0.4662 -0.1143 0.0733  -0.0288 127 PRO A C   
970  O O   . PRO A 129 ? 0.3059 0.5867 0.4644 -0.1145 0.0743  -0.0318 127 PRO A O   
971  C CB  . PRO A 129 ? 0.4084 0.6504 0.5059 -0.1352 0.0645  -0.0076 127 PRO A CB  
972  C CG  . PRO A 129 ? 0.4335 0.6672 0.5074 -0.1426 0.0674  -0.0067 127 PRO A CG  
973  C CD  . PRO A 129 ? 0.3676 0.6006 0.4474 -0.1286 0.0584  -0.0048 127 PRO A CD  
974  N N   . GLU A 130 ? 0.3294 0.6042 0.4698 -0.1122 0.0820  -0.0375 128 GLU A N   
975  C CA  . GLU A 130 ? 0.3298 0.6229 0.4928 -0.1082 0.0938  -0.0512 128 GLU A CA  
976  C C   . GLU A 130 ? 0.2506 0.5552 0.4417 -0.0906 0.0863  -0.0549 128 GLU A C   
977  O O   . GLU A 130 ? 0.2208 0.5435 0.4365 -0.0866 0.0922  -0.0640 128 GLU A O   
978  C CB  . GLU A 130 ? 0.3811 0.6730 0.5351 -0.1099 0.1068  -0.0607 128 GLU A CB  
979  C CG  . GLU A 130 ? 0.4990 0.7707 0.6180 -0.1205 0.1065  -0.0549 128 GLU A CG  
980  C CD  . GLU A 130 ? 0.3934 0.6528 0.5044 -0.1119 0.0914  -0.0458 128 GLU A CD  
981  O OE1 . GLU A 130 ? 0.4759 0.7257 0.5730 -0.1178 0.0810  -0.0333 128 GLU A OE1 
982  O OE2 . GLU A 130 ? 0.4208 0.6790 0.5373 -0.1007 0.0907  -0.0510 128 GLU A OE2 
983  N N   . GLU A 131 ? 0.2558 0.5502 0.4429 -0.0807 0.0734  -0.0477 129 GLU A N   
984  C CA  . GLU A 131 ? 0.2117 0.5127 0.4192 -0.0653 0.0646  -0.0495 129 GLU A CA  
985  C C   . GLU A 131 ? 0.1809 0.4846 0.3968 -0.0665 0.0568  -0.0449 129 GLU A C   
986  O O   . GLU A 131 ? 0.1616 0.4534 0.3685 -0.0634 0.0470  -0.0362 129 GLU A O   
987  C CB  . GLU A 131 ? 0.1904 0.4781 0.3870 -0.0559 0.0555  -0.0436 129 GLU A CB  
988  C CG  . GLU A 131 ? 0.2359 0.5169 0.4214 -0.0549 0.0614  -0.0477 129 GLU A CG  
989  C CD  . GLU A 131 ? 0.2885 0.5793 0.4925 -0.0450 0.0679  -0.0596 129 GLU A CD  
990  O OE1 . GLU A 131 ? 0.2948 0.5797 0.4897 -0.0461 0.0764  -0.0654 129 GLU A OE1 
991  O OE2 . GLU A 131 ? 0.1929 0.4963 0.4201 -0.0360 0.0641  -0.0629 129 GLU A OE2 
992  N N   . VAL A 132 ? 0.1560 0.4748 0.3886 -0.0719 0.0621  -0.0508 130 VAL A N   
993  C CA  . VAL A 132 ? 0.1627 0.4816 0.3997 -0.0770 0.0561  -0.0470 130 VAL A CA  
994  C C   . VAL A 132 ? 0.1351 0.4525 0.3817 -0.0646 0.0431  -0.0455 130 VAL A C   
995  O O   . VAL A 132 ? 0.1358 0.4445 0.3775 -0.0677 0.0364  -0.0406 130 VAL A O   
996  C CB  . VAL A 132 ? 0.1684 0.5058 0.4224 -0.0876 0.0649  -0.0541 130 VAL A CB  
997  C CG1 . VAL A 132 ? 0.1903 0.5242 0.4276 -0.1036 0.0778  -0.0536 130 VAL A CG1 
998  C CG2 . VAL A 132 ? 0.1029 0.4628 0.3857 -0.0777 0.0680  -0.0647 130 VAL A CG2 
999  N N   . LYS A 133 ? 0.1387 0.4620 0.3966 -0.0512 0.0398  -0.0499 131 LYS A N   
1000 C CA  . LYS A 133 ? 0.1401 0.4603 0.4033 -0.0398 0.0275  -0.0485 131 LYS A CA  
1001 C C   . LYS A 133 ? 0.1497 0.4492 0.3920 -0.0358 0.0210  -0.0395 131 LYS A C   
1002 O O   . LYS A 133 ? 0.1175 0.4090 0.3564 -0.0334 0.0132  -0.0362 131 LYS A O   
1003 C CB  . LYS A 133 ? 0.1039 0.4343 0.3833 -0.0270 0.0254  -0.0547 131 LYS A CB  
1004 C CG  . LYS A 133 ? 0.1317 0.4862 0.4388 -0.0281 0.0302  -0.0638 131 LYS A CG  
1005 C CD  . LYS A 133 ? 0.1173 0.4796 0.4409 -0.0131 0.0264  -0.0687 131 LYS A CD  
1006 C CE  . LYS A 133 ? 0.1266 0.5161 0.4827 -0.0124 0.0313  -0.0777 131 LYS A CE  
1007 N NZ  . LYS A 133 ? 0.0789 0.4751 0.4530 0.0040  0.0267  -0.0819 131 LYS A NZ  
1008 N N   . ILE A 134 ? 0.1150 0.4060 0.3430 -0.0362 0.0248  -0.0355 132 ILE A N   
1009 C CA  . ILE A 134 ? 0.1466 0.4215 0.3575 -0.0347 0.0198  -0.0260 132 ILE A CA  
1010 C C   . ILE A 134 ? 0.1765 0.4429 0.3805 -0.0424 0.0179  -0.0201 132 ILE A C   
1011 O O   . ILE A 134 ? 0.1692 0.4256 0.3690 -0.0373 0.0118  -0.0157 132 ILE A O   
1012 C CB  . ILE A 134 ? 0.1206 0.3896 0.3177 -0.0377 0.0236  -0.0220 132 ILE A CB  
1013 C CG1 . ILE A 134 ? 0.0980 0.3709 0.2990 -0.0308 0.0261  -0.0281 132 ILE A CG1 
1014 C CG2 . ILE A 134 ? 0.1342 0.3907 0.3189 -0.0356 0.0176  -0.0116 132 ILE A CG2 
1015 C CD1 . ILE A 134 ? 0.0959 0.3604 0.2806 -0.0347 0.0287  -0.0244 132 ILE A CD1 
1016 N N   . ALA A 135 ? 0.1728 0.4414 0.3740 -0.0549 0.0240  -0.0202 133 ALA A N   
1017 C CA  . ALA A 135 ? 0.2126 0.4714 0.4067 -0.0637 0.0226  -0.0149 133 ALA A CA  
1018 C C   . ALA A 135 ? 0.2077 0.4668 0.4113 -0.0618 0.0177  -0.0185 133 ALA A C   
1019 O O   . ALA A 135 ? 0.2242 0.4684 0.4197 -0.0624 0.0133  -0.0134 133 ALA A O   
1020 C CB  . ALA A 135 ? 0.2432 0.5055 0.4324 -0.0790 0.0310  -0.0156 133 ALA A CB  
1021 N N   . GLU A 136 ? 0.2233 0.4987 0.4442 -0.0602 0.0183  -0.0274 134 GLU A N   
1022 C CA  . GLU A 136 ? 0.2323 0.5088 0.4616 -0.0599 0.0120  -0.0310 134 GLU A CA  
1023 C C   . GLU A 136 ? 0.2466 0.5105 0.4690 -0.0477 0.0035  -0.0287 134 GLU A C   
1024 O O   . GLU A 136 ? 0.2602 0.5114 0.4762 -0.0487 -0.0014 -0.0276 134 GLU A O   
1025 C CB  . GLU A 136 ? 0.2266 0.5265 0.4790 -0.0602 0.0130  -0.0402 134 GLU A CB  
1026 C CG  . GLU A 136 ? 0.2328 0.5363 0.4944 -0.0647 0.0063  -0.0438 134 GLU A CG  
1027 C CD  . GLU A 136 ? 0.1247 0.4552 0.4134 -0.0647 0.0063  -0.0521 134 GLU A CD  
1028 O OE1 . GLU A 136 ? 0.1935 0.5396 0.4938 -0.0645 0.0153  -0.0556 134 GLU A OE1 
1029 O OE2 . GLU A 136 ? 0.1529 0.4888 0.4514 -0.0643 -0.0029 -0.0552 134 GLU A OE2 
1030 N N   . ALA A 137 ? 0.1900 0.4561 0.4124 -0.0370 0.0026  -0.0285 135 ALA A N   
1031 C CA  . ALA A 137 ? 0.2183 0.4724 0.4321 -0.0261 -0.0036 -0.0258 135 ALA A CA  
1032 C C   . ALA A 137 ? 0.2407 0.4762 0.4392 -0.0259 -0.0033 -0.0181 135 ALA A C   
1033 O O   . ALA A 137 ? 0.2599 0.4829 0.4515 -0.0219 -0.0072 -0.0176 135 ALA A O   
1034 C CB  . ALA A 137 ? 0.1483 0.4070 0.3632 -0.0167 -0.0035 -0.0260 135 ALA A CB  
1035 N N   . TYR A 138 ? 0.2552 0.4887 0.4485 -0.0304 0.0011  -0.0121 136 TYR A N   
1036 C CA  . TYR A 138 ? 0.2729 0.4907 0.4553 -0.0299 0.0007  -0.0037 136 TYR A CA  
1037 C C   . TYR A 138 ? 0.3205 0.5244 0.4981 -0.0355 -0.0007 -0.0030 136 TYR A C   
1038 O O   . TYR A 138 ? 0.3492 0.5381 0.5202 -0.0291 -0.0028 -0.0003 136 TYR A O   
1039 C CB  . TYR A 138 ? 0.2444 0.4638 0.4220 -0.0346 0.0036  0.0033  136 TYR A CB  
1040 C CG  . TYR A 138 ? 0.2515 0.4582 0.4217 -0.0312 0.0014  0.0134  136 TYR A CG  
1041 C CD1 . TYR A 138 ? 0.2090 0.4147 0.3800 -0.0204 -0.0002 0.0168  136 TYR A CD1 
1042 C CD2 . TYR A 138 ? 0.2793 0.4753 0.4427 -0.0387 0.0009  0.0200  136 TYR A CD2 
1043 C CE1 . TYR A 138 ? 0.2327 0.4305 0.4016 -0.0163 -0.0019 0.0262  136 TYR A CE1 
1044 C CE2 . TYR A 138 ? 0.2795 0.4647 0.4391 -0.0339 -0.0022 0.0301  136 TYR A CE2 
1045 C CZ  . TYR A 138 ? 0.2601 0.4478 0.4244 -0.0223 -0.0034 0.0329  136 TYR A CZ  
1046 O OH  . TYR A 138 ? 0.2930 0.4734 0.4581 -0.0165 -0.0062 0.0427  136 TYR A OH  
1047 N N   . GLN A 139 ? 0.2546 0.4619 0.4345 -0.0476 0.0012  -0.0057 137 GLN A N   
1048 C CA  . GLN A 139 ? 0.3136 0.5048 0.4873 -0.0540 -0.0007 -0.0054 137 GLN A CA  
1049 C C   . GLN A 139 ? 0.3215 0.5091 0.4969 -0.0505 -0.0054 -0.0126 137 GLN A C   
1050 O O   . GLN A 139 ? 0.3578 0.5254 0.5233 -0.0508 -0.0075 -0.0119 137 GLN A O   
1051 C CB  . GLN A 139 ? 0.3796 0.5709 0.5515 -0.0702 0.0028  -0.0041 137 GLN A CB  
1052 C CG  . GLN A 139 ? 0.4107 0.5893 0.5788 -0.0811 0.0009  -0.0069 137 GLN A CG  
1053 C CD  . GLN A 139 ? 0.4908 0.6392 0.6442 -0.0769 -0.0029 -0.0024 137 GLN A CD  
1054 O OE1 . GLN A 139 ? 0.2775 0.4070 0.4196 -0.0832 -0.0025 0.0047  137 GLN A OE1 
1055 N NE2 . GLN A 139 ? 0.6087 0.7514 0.7618 -0.0682 -0.0067 -0.0078 137 GLN A NE2 
1056 N N   . MET A 140 ? 0.2578 0.4614 0.4433 -0.0458 -0.0076 -0.0191 138 MET A N   
1057 C CA  . MET A 140 ? 0.2778 0.4754 0.4608 -0.0411 -0.0138 -0.0245 138 MET A CA  
1058 C C   . MET A 140 ? 0.2694 0.4478 0.4383 -0.0299 -0.0142 -0.0213 138 MET A C   
1059 O O   . MET A 140 ? 0.2970 0.4572 0.4549 -0.0298 -0.0164 -0.0235 138 MET A O   
1060 C CB  . MET A 140 ? 0.2290 0.4464 0.4250 -0.0372 -0.0178 -0.0307 138 MET A CB  
1061 C CG  . MET A 140 ? 0.2513 0.4606 0.4413 -0.0346 -0.0259 -0.0355 138 MET A CG  
1062 S SD  . MET A 140 ? 0.2783 0.5018 0.4760 -0.0246 -0.0328 -0.0391 138 MET A SD  
1063 C CE  . MET A 140 ? 0.2380 0.4481 0.4206 -0.0120 -0.0284 -0.0331 138 MET A CE  
1064 N N   . LEU A 141 ? 0.2789 0.4612 0.4480 -0.0213 -0.0112 -0.0163 139 LEU A N   
1065 C CA  . LEU A 141 ? 0.2776 0.4455 0.4369 -0.0109 -0.0095 -0.0126 139 LEU A CA  
1066 C C   . LEU A 141 ? 0.3434 0.4921 0.4953 -0.0120 -0.0071 -0.0076 139 LEU A C   
1067 O O   . LEU A 141 ? 0.3981 0.5293 0.5408 -0.0050 -0.0057 -0.0078 139 LEU A O   
1068 C CB  . LEU A 141 ? 0.2456 0.4244 0.4092 -0.0041 -0.0069 -0.0074 139 LEU A CB  
1069 C CG  . LEU A 141 ? 0.2055 0.3979 0.3737 -0.0007 -0.0092 -0.0116 139 LEU A CG  
1070 C CD1 . LEU A 141 ? 0.1491 0.3500 0.3200 0.0035  -0.0063 -0.0062 139 LEU A CD1 
1071 C CD2 . LEU A 141 ? 0.1644 0.3478 0.3237 0.0051  -0.0127 -0.0164 139 LEU A CD2 
1072 N N   . LYS A 142 ? 0.3103 0.4607 0.4652 -0.0205 -0.0061 -0.0030 140 LYS A N   
1073 C CA  . LYS A 142 ? 0.3566 0.4875 0.5044 -0.0216 -0.0050 0.0035  140 LYS A CA  
1074 C C   . LYS A 142 ? 0.4036 0.5156 0.5425 -0.0276 -0.0068 -0.0020 140 LYS A C   
1075 O O   . LYS A 142 ? 0.4456 0.5347 0.5751 -0.0223 -0.0058 -0.0007 140 LYS A O   
1076 C CB  . LYS A 142 ? 0.3455 0.4825 0.4956 -0.0309 -0.0043 0.0107  140 LYS A CB  
1077 C CG  . LYS A 142 ? 0.4389 0.5543 0.5803 -0.0356 -0.0051 0.0177  140 LYS A CG  
1078 C CD  . LYS A 142 ? 0.4414 0.5624 0.5812 -0.0477 -0.0048 0.0245  140 LYS A CD  
1079 C CE  . LYS A 142 ? 0.3820 0.5226 0.5277 -0.0450 -0.0041 0.0285  140 LYS A CE  
1080 N NZ  . LYS A 142 ? 0.4152 0.5548 0.5539 -0.0555 -0.0046 0.0373  140 LYS A NZ  
1081 N N   . LYS A 143 ? 0.3257 0.4475 0.4680 -0.0379 -0.0093 -0.0090 141 LYS A N   
1082 C CA  . LYS A 143 ? 0.3807 0.4864 0.5145 -0.0457 -0.0123 -0.0151 141 LYS A CA  
1083 C C   . LYS A 143 ? 0.3913 0.4823 0.5144 -0.0368 -0.0140 -0.0210 141 LYS A C   
1084 O O   . LYS A 143 ? 0.4435 0.5102 0.5531 -0.0399 -0.0149 -0.0242 141 LYS A O   
1085 C CB  . LYS A 143 ? 0.3749 0.4998 0.5191 -0.0591 -0.0151 -0.0209 141 LYS A CB  
1086 C CG  . LYS A 143 ? 0.4485 0.5605 0.5871 -0.0747 -0.0158 -0.0215 141 LYS A CG  
1087 C CD  . LYS A 143 ? 0.4402 0.5778 0.5945 -0.0879 -0.0171 -0.0269 141 LYS A CD  
1088 C CE  . LYS A 143 ? 0.4799 0.6075 0.6297 -0.1016 -0.0218 -0.0326 141 LYS A CE  
1089 N NZ  . LYS A 143 ? 0.4522 0.6115 0.6231 -0.1107 -0.0244 -0.0388 141 LYS A NZ  
1090 N N   . GLN A 144 ? 0.3519 0.4552 0.4783 -0.0268 -0.0140 -0.0225 142 GLN A N   
1091 C CA  . GLN A 144 ? 0.3949 0.4845 0.5083 -0.0188 -0.0147 -0.0279 142 GLN A CA  
1092 C C   . GLN A 144 ? 0.4175 0.4874 0.5220 -0.0068 -0.0076 -0.0239 142 GLN A C   
1093 O O   . GLN A 144 ? 0.4606 0.5140 0.5511 -0.0006 -0.0055 -0.0287 142 GLN A O   
1094 C CB  . GLN A 144 ? 0.3380 0.4472 0.4569 -0.0136 -0.0176 -0.0304 142 GLN A CB  
1095 C CG  . GLN A 144 ? 0.3739 0.5009 0.5021 -0.0229 -0.0257 -0.0358 142 GLN A CG  
1096 C CD  . GLN A 144 ? 0.4140 0.5605 0.5503 -0.0163 -0.0288 -0.0363 142 GLN A CD  
1097 O OE1 . GLN A 144 ? 0.4390 0.5899 0.5768 -0.0075 -0.0240 -0.0316 142 GLN A OE1 
1098 N NE2 . GLN A 144 ? 0.3450 0.5035 0.4876 -0.0210 -0.0374 -0.0415 142 GLN A NE2 
1099 N N   . GLY A 145 ? 0.4044 0.4764 0.5172 -0.0038 -0.0040 -0.0151 143 GLY A N   
1100 C CA  . GLY A 145 ? 0.4125 0.4708 0.5233 0.0086  0.0022  -0.0101 143 GLY A CA  
1101 C C   . GLY A 145 ? 0.3877 0.4627 0.5065 0.0195  0.0059  -0.0068 143 GLY A C   
1102 O O   . GLY A 145 ? 0.4028 0.4708 0.5230 0.0306  0.0118  -0.0033 143 GLY A O   
1103 N N   . ILE A 146 ? 0.4391 0.5363 0.5643 0.0163  0.0027  -0.0080 144 ILE A N   
1104 C CA  . ILE A 146 ? 0.4144 0.5274 0.5467 0.0243  0.0057  -0.0042 144 ILE A CA  
1105 C C   . ILE A 146 ? 0.3909 0.5156 0.5366 0.0259  0.0067  0.0063  144 ILE A C   
1106 O O   . ILE A 146 ? 0.3699 0.4991 0.5215 0.0346  0.0109  0.0115  144 ILE A O   
1107 C CB  . ILE A 146 ? 0.3775 0.5068 0.5107 0.0210  0.0014  -0.0086 144 ILE A CB  
1108 C CG1 . ILE A 146 ? 0.4372 0.5544 0.5554 0.0213  -0.0006 -0.0173 144 ILE A CG1 
1109 C CG2 . ILE A 146 ? 0.3109 0.4556 0.4511 0.0267  0.0039  -0.0036 144 ILE A CG2 
1110 C CD1 . ILE A 146 ? 0.4507 0.5817 0.5707 0.0167  -0.0081 -0.0216 144 ILE A CD1 
1111 N N   . VAL A 147 ? 0.4416 0.5709 0.5915 0.0166  0.0030  0.0095  145 VAL A N   
1112 C CA  . VAL A 147 ? 0.4801 0.6105 0.6368 0.0166  0.0027  0.0200  145 VAL A CA  
1113 C C   . VAL A 147 ? 0.5584 0.6668 0.7089 0.0138  0.0018  0.0222  145 VAL A C   
1114 O O   . VAL A 147 ? 0.5862 0.6858 0.7292 0.0045  -0.0001 0.0166  145 VAL A O   
1115 C CB  . VAL A 147 ? 0.4495 0.5990 0.6120 0.0079  -0.0002 0.0240  145 VAL A CB  
1116 C CG1 . VAL A 147 ? 0.3732 0.5366 0.5362 0.0044  -0.0006 0.0159  145 VAL A CG1 
1117 C CG2 . VAL A 147 ? 0.4783 0.6219 0.6377 -0.0031 -0.0027 0.0284  145 VAL A CG2 
1118 N N   . LYS A 148 ? 0.7523 0.8509 0.9066 0.0222  0.0030  0.0301  146 LYS A N   
1119 C CA  . LYS A 148 ? 0.7386 0.8478 0.9025 0.0225  -0.0001 0.0419  146 LYS A CA  
1120 C C   . LYS A 148 ? 0.7225 0.8413 0.8988 0.0360  0.0030  0.0466  146 LYS A C   
1121 O O   . LYS A 148 ? 1.0469 1.1857 1.2318 0.0351  0.0012  0.0518  146 LYS A O   
1122 C CB  . LYS A 148 ? 0.7915 0.8826 0.9515 0.0190  -0.0041 0.0501  146 LYS A CB  
1123 C CG  . LYS A 148 ? 0.8186 0.8913 0.9650 0.0082  -0.0048 0.0442  146 LYS A CG  
1124 C CD  . LYS A 148 ? 0.8321 0.9027 0.9732 -0.0053 -0.0095 0.0516  146 LYS A CD  
1125 C CE  . LYS A 148 ? 0.8621 0.9100 1.0004 -0.0009 -0.0130 0.0621  146 LYS A CE  
1126 N NZ  . LYS A 148 ? 0.8703 0.9028 1.0125 0.0154  -0.0092 0.0598  146 LYS A NZ  
1127 N N   . ASP B 5   ? 0.6127 0.6630 0.7700 0.1004  0.1371  -0.0060 4   ASP C N   
1128 C CA  . ASP B 5   ? 0.5977 0.6823 0.8055 0.1076  0.1079  -0.0140 4   ASP C CA  
1129 C C   . ASP B 5   ? 0.5610 0.6617 0.7811 0.0925  0.0958  -0.0222 4   ASP C C   
1130 O O   . ASP B 5   ? 0.5605 0.6435 0.7338 0.0800  0.0973  -0.0214 4   ASP C O   
1131 C CB  . ASP B 5   ? 0.6459 0.7275 0.8294 0.1233  0.0804  -0.0120 4   ASP C CB  
1132 C CG  . ASP B 5   ? 0.6367 0.7522 0.8674 0.1302  0.0494  -0.0197 4   ASP C CG  
1133 O OD1 . ASP B 5   ? 0.7060 0.8409 0.9852 0.1433  0.0457  -0.0200 4   ASP C OD1 
1134 O OD2 . ASP B 5   ? 0.6292 0.7504 0.8445 0.1233  0.0275  -0.0248 4   ASP C OD2 
1135 N N   . ASP B 6   ? 0.4155 0.5502 0.6997 0.0939  0.0841  -0.0299 5   ASP C N   
1136 C CA  . ASP B 6   ? 0.3617 0.5155 0.6747 0.0786  0.0815  -0.0379 5   ASP C CA  
1137 C C   . ASP B 6   ? 0.3583 0.5279 0.6702 0.0791  0.0462  -0.0448 5   ASP C C   
1138 O O   . ASP B 6   ? 0.3415 0.5236 0.6657 0.0661  0.0395  -0.0516 5   ASP C O   
1139 C CB  . ASP B 6   ? 0.3568 0.5393 0.7455 0.0798  0.0921  -0.0424 5   ASP C CB  
1140 C CG  . ASP B 6   ? 0.3882 0.5936 0.8209 0.0982  0.0737  -0.0438 5   ASP C CG  
1141 O OD1 . ASP B 6   ? 0.3757 0.5670 0.7838 0.1124  0.0706  -0.0374 5   ASP C OD1 
1142 O OD2 . ASP B 6   ? 0.4046 0.6423 0.8958 0.0986  0.0614  -0.0513 5   ASP C OD2 
1143 N N   . SEP B 7   ? 0.3673 0.5382 0.6688 0.0944  0.0236  -0.0432 6   SEP C N   
1144 C CA  . SEP B 7   ? 0.3700 0.5580 0.6747 0.0967  -0.0110 -0.0497 6   SEP C CA  
1145 C CB  . SEP B 7   ? 0.3824 0.5810 0.7014 0.1164  -0.0321 -0.0479 6   SEP C CB  
1146 O OG  . SEP B 7   ? 0.3964 0.6130 0.7732 0.1252  -0.0200 -0.0473 6   SEP C OG  
1147 C C   . SEP B 7   ? 0.3748 0.5403 0.6139 0.0876  -0.0210 -0.0490 6   SEP C C   
1148 O O   . SEP B 7   ? 0.3748 0.5087 0.5582 0.0851  -0.0059 -0.0417 6   SEP C O   
1149 P P   . SEP B 7   ? 0.4812 0.7316 0.9100 0.1387  -0.0493 -0.0521 6   SEP C P   
1150 O O1P . SEP B 7   ? 0.4863 0.7571 0.9830 0.1459  -0.0320 -0.0517 6   SEP C O1P 
1151 O O2P . SEP B 7   ? 0.4344 0.7109 0.8878 0.1287  -0.0742 -0.0628 6   SEP C O2P 
1152 O O3P . SEP B 7   ? 0.5310 0.7685 0.9201 0.1548  -0.0702 -0.0463 6   SEP C O3P 
1153 N N   . ASP B 8   ? 0.3614 0.5433 0.6069 0.0836  -0.0477 -0.0566 7   ASP C N   
1154 C CA  . ASP B 8   ? 0.3628 0.5278 0.5557 0.0717  -0.0559 -0.0579 7   ASP C CA  
1155 C C   . ASP B 8   ? 0.3600 0.5476 0.5683 0.0722  -0.0902 -0.0665 7   ASP C C   
1156 O O   . ASP B 8   ? 0.3679 0.5861 0.6332 0.0783  -0.1034 -0.0723 7   ASP C O   
1157 C CB  . ASP B 8   ? 0.3454 0.5052 0.5399 0.0530  -0.0320 -0.0593 7   ASP C CB  
1158 C CG  . ASP B 8   ? 0.3452 0.4767 0.4729 0.0414  -0.0296 -0.0563 7   ASP C CG  
1159 O OD1 . ASP B 8   ? 0.3430 0.4587 0.4223 0.0476  -0.0467 -0.0536 7   ASP C OD1 
1160 O OD2 . ASP B 8   ? 0.3189 0.4450 0.4440 0.0258  -0.0109 -0.0568 7   ASP C OD2 
1161 N N   . GLU B 9   ? 0.4550 0.6277 0.6128 0.0655  -0.1041 -0.0675 8   GLU C N   
1162 C CA  . GLU B 9   ? 0.4700 0.6623 0.6390 0.0619  -0.1340 -0.0766 8   GLU C CA  
1163 C C   . GLU B 9   ? 0.4178 0.6289 0.6258 0.0460  -0.1277 -0.0847 8   GLU C C   
1164 O O   . GLU B 9   ? 0.4022 0.6064 0.6169 0.0363  -0.1004 -0.0826 8   GLU C O   
1165 C CB  . GLU B 9   ? 0.4644 0.6326 0.5647 0.0589  -0.1487 -0.0749 8   GLU C CB  
1166 C CG  . GLU B 9   ? 0.5923 0.7433 0.6529 0.0745  -0.1590 -0.0677 8   GLU C CG  
1167 C CD  . GLU B 9   ? 0.6953 0.8214 0.6866 0.0709  -0.1722 -0.0659 8   GLU C CD  
1168 O OE1 . GLU B 9   ? 0.7014 0.8269 0.6789 0.0568  -0.1775 -0.0712 8   GLU C OE1 
1169 O OE2 . GLU B 9   ? 0.7642 0.8717 0.7154 0.0826  -0.1778 -0.0591 8   GLU C OE2 
1170 N N   . ASP B 10  ? 0.3384 0.5732 0.5717 0.0430  -0.1530 -0.0940 9   ASP C N   
1171 C CA  . ASP B 10  ? 0.3083 0.5560 0.5636 0.0262  -0.1509 -0.1020 9   ASP C CA  
1172 C C   . ASP B 10  ? 0.2971 0.5167 0.4907 0.0132  -0.1450 -0.0998 9   ASP C C   
1173 O O   . ASP B 10  ? 0.3165 0.5174 0.4574 0.0171  -0.1591 -0.0968 9   ASP C O   
1174 C CB  . ASP B 10  ? 0.3075 0.5850 0.5977 0.0266  -0.1817 -0.1124 9   ASP C CB  
1175 C CG  . ASP B 10  ? 0.3847 0.6925 0.7381 0.0391  -0.1903 -0.1150 9   ASP C CG  
1176 O OD1 . ASP B 10  ? 0.4442 0.7716 0.8141 0.0448  -0.2191 -0.1207 9   ASP C OD1 
1177 O OD2 . ASP B 10  ? 0.4178 0.7301 0.8045 0.0427  -0.1685 -0.1114 9   ASP C OD2 
1178 N N   . LEU B 11  ? 0.3641 0.5831 0.5669 -0.0026 -0.1265 -0.1019 10  LEU C N   
1179 C CA  . LEU B 11  ? 0.3759 0.5752 0.5307 -0.0169 -0.1247 -0.1019 10  LEU C CA  
1180 C C   . LEU B 11  ? 0.4121 0.6195 0.5537 -0.0178 -0.1571 -0.1094 10  LEU C C   
1181 O O   . LEU B 11  ? 0.4084 0.6448 0.5969 -0.0187 -0.1740 -0.1186 10  LEU C O   
1182 C CB  . LEU B 11  ? 0.3509 0.5569 0.5328 -0.0335 -0.1040 -0.1051 10  LEU C CB  
1183 C CG  . LEU B 11  ? 0.3035 0.4947 0.4472 -0.0499 -0.1028 -0.1065 10  LEU C CG  
1184 C CD1 . LEU B 11  ? 0.2977 0.4518 0.3697 -0.0504 -0.0917 -0.0963 10  LEU C CD1 
1185 C CD2 . LEU B 11  ? 0.2953 0.4968 0.4744 -0.0650 -0.0820 -0.1095 10  LEU C CD2 
1186 N N   . LEU B 12  ? 0.4896 0.6713 0.5674 -0.0173 -0.1657 -0.1052 11  LEU C N   
1187 C CA  . LEU B 12  ? 0.5333 0.7180 0.5896 -0.0193 -0.1947 -0.1116 11  LEU C CA  
1188 C C   . LEU B 12  ? 0.5433 0.7334 0.6056 -0.0375 -0.1934 -0.1186 11  LEU C C   
1189 O O   . LEU B 12  ? 0.5472 0.7145 0.5692 -0.0484 -0.1789 -0.1146 11  LEU C O   
1190 C CB  . LEU B 12  ? 0.5473 0.7009 0.5315 -0.0141 -0.2015 -0.1044 11  LEU C CB  
1191 C CG  . LEU B 12  ? 0.5672 0.7208 0.5227 -0.0144 -0.2321 -0.1100 11  LEU C CG  
1192 C CD1 . LEU B 12  ? 0.5915 0.7740 0.5892 -0.0028 -0.2589 -0.1165 11  LEU C CD1 
1193 C CD2 . LEU B 12  ? 0.5289 0.6492 0.4121 -0.0092 -0.2343 -0.1016 11  LEU C CD2 
1194 N N   . GLU B 13  ? 0.7042 0.9250 0.8190 -0.0408 -0.2075 -0.1289 12  GLU C N   
1195 C CA  . GLU B 13  ? 0.7252 0.9533 0.8486 -0.0574 -0.2092 -0.1366 12  GLU C CA  
1196 C C   . GLU B 13  ? 0.7698 1.0054 0.8798 -0.0578 -0.2414 -0.1445 12  GLU C C   
1197 O O   . GLU B 13  ? 0.7875 1.0013 0.8423 -0.0538 -0.2526 -0.1407 12  GLU C O   
1198 C CB  . GLU B 13  ? 0.7133 0.9697 0.9061 -0.0635 -0.1983 -0.1427 12  GLU C CB  
1199 C CG  . GLU B 13  ? 0.7282 0.9753 0.9307 -0.0670 -0.1643 -0.1355 12  GLU C CG  
1200 C CD  . GLU B 13  ? 0.7809 1.0573 1.0556 -0.0687 -0.1547 -0.1407 12  GLU C CD  
1201 O OE1 . GLU B 13  ? 0.7666 1.0477 1.0610 -0.0828 -0.1390 -0.1435 12  GLU C OE1 
1202 O OE2 . GLU B 13  ? 0.8060 1.1004 1.1176 -0.0558 -0.1621 -0.1415 12  GLU C OE2 
1203 O OXT . GLU B 13  ? 0.7812 1.0440 0.9355 -0.0618 -0.2560 -0.1545 12  GLU C OXT 
1204 N N   . PRO C 9   ? 0.9444 1.9379 1.1408 -0.1077 0.0794  0.1033  7   PRO B N   
1205 C CA  . PRO C 9   ? 0.9289 1.8102 1.1055 -0.0834 0.0799  0.0968  7   PRO B CA  
1206 C C   . PRO C 9   ? 0.8906 1.7375 1.0723 -0.0410 0.0748  0.0905  7   PRO B C   
1207 O O   . PRO C 9   ? 0.8945 1.8093 1.0959 -0.0121 0.0753  0.0892  7   PRO B O   
1208 C CB  . PRO C 9   ? 0.9347 1.8312 1.1108 -0.0569 0.0945  0.0927  7   PRO B CB  
1209 C CG  . PRO C 9   ? 0.9705 1.9566 1.1538 -0.0930 0.1005  0.1003  7   PRO B CG  
1210 C CD  . PRO C 9   ? 0.9640 2.0299 1.1665 -0.1168 0.0922  0.1064  7   PRO B CD  
1211 N N   . GLU C 10  ? 0.4799 1.2258 0.6430 -0.0383 0.0696  0.0875  8   GLU B N   
1212 C CA  . GLU C 10  ? 0.4273 1.1340 0.5905 -0.0083 0.0635  0.0836  8   GLU B CA  
1213 C C   . GLU C 10  ? 0.4020 1.0400 0.5538 0.0297  0.0689  0.0772  8   GLU B C   
1214 O O   . GLU C 10  ? 0.4031 1.0147 0.5455 0.0299  0.0760  0.0753  8   GLU B O   
1215 C CB  . GLU C 10  ? 0.4325 1.0855 0.5825 -0.0390 0.0517  0.0855  8   GLU B CB  
1216 C CG  . GLU C 10  ? 0.4570 1.1571 0.6174 -0.0432 0.0421  0.0876  8   GLU B CG  
1217 C CD  . GLU C 10  ? 0.4249 1.1394 0.5959 0.0056  0.0421  0.0847  8   GLU B CD  
1218 O OE1 . GLU C 10  ? 0.4629 1.2546 0.6507 0.0137  0.0380  0.0874  8   GLU B OE1 
1219 O OE2 . GLU C 10  ? 0.3834 1.0319 0.5436 0.0346  0.0451  0.0807  8   GLU B OE2 
1220 N N   . THR C 11  ? 0.3639 0.9704 0.5135 0.0578  0.0645  0.0747  9   THR B N   
1221 C CA  . THR C 11  ? 0.3531 0.8915 0.4880 0.0897  0.0677  0.0697  9   THR B CA  
1222 C C   . THR C 11  ? 0.3300 0.7890 0.4493 0.0687  0.0666  0.0693  9   THR B C   
1223 O O   . THR C 11  ? 0.3298 0.7740 0.4468 0.0354  0.0615  0.0723  9   THR B O   
1224 C CB  . THR C 11  ? 0.3503 0.8701 0.4821 0.1167  0.0616  0.0696  9   THR B CB  
1225 O OG1 . THR C 11  ? 0.3502 0.8468 0.4806 0.0904  0.0531  0.0727  9   THR B OG1 
1226 C CG2 . THR C 11  ? 0.3356 0.9348 0.4819 0.1437  0.0610  0.0706  9   THR B CG2 
1227 N N   . LEU C 12  ? 0.2971 0.7034 0.4030 0.0896  0.0704  0.0652  10  LEU B N   
1228 C CA  . LEU C 12  ? 0.2923 0.6279 0.3855 0.0755  0.0684  0.0650  10  LEU B CA  
1229 C C   . LEU C 12  ? 0.2713 0.5737 0.3628 0.0677  0.0610  0.0669  10  LEU B C   
1230 O O   . LEU C 12  ? 0.2478 0.5146 0.3339 0.0465  0.0579  0.0679  10  LEU B O   
1231 C CB  . LEU C 12  ? 0.3138 0.6047 0.3920 0.0985  0.0726  0.0605  10  LEU B CB  
1232 C CG  . LEU C 12  ? 0.4023 0.6821 0.4722 0.0905  0.0778  0.0585  10  LEU B CG  
1233 C CD1 . LEU C 12  ? 0.3733 0.7121 0.4529 0.0728  0.0818  0.0608  10  LEU B CD1 
1234 C CD2 . LEU C 12  ? 0.4051 0.6597 0.4576 0.1190  0.0823  0.0522  10  LEU B CD2 
1235 N N   . GLU C 13  ? 0.2393 0.5540 0.3331 0.0866  0.0581  0.0674  11  GLU B N   
1236 C CA  . GLU C 13  ? 0.2581 0.5455 0.3482 0.0798  0.0519  0.0690  11  GLU B CA  
1237 C C   . GLU C 13  ? 0.2413 0.5488 0.3358 0.0490  0.0467  0.0705  11  GLU B C   
1238 O O   . GLU C 13  ? 0.2621 0.5295 0.3478 0.0332  0.0437  0.0698  11  GLU B O   
1239 C CB  . GLU C 13  ? 0.2788 0.5754 0.3666 0.1062  0.0490  0.0704  11  GLU B CB  
1240 C CG  . GLU C 13  ? 0.3021 0.5566 0.3742 0.1338  0.0519  0.0694  11  GLU B CG  
1241 C CD  . GLU C 13  ? 0.3946 0.6765 0.4654 0.1602  0.0563  0.0667  11  GLU B CD  
1242 O OE1 . GLU C 13  ? 0.4283 0.6837 0.4817 0.1894  0.0558  0.0662  11  GLU B OE1 
1243 O OE2 . GLU C 13  ? 0.3520 0.6812 0.4361 0.1523  0.0601  0.0651  11  GLU B OE2 
1244 N N   . ALA C 14  ? 0.2459 0.6151 0.3515 0.0397  0.0455  0.0723  12  ALA B N   
1245 C CA  . ALA C 14  ? 0.2715 0.6566 0.3754 0.0052  0.0390  0.0741  12  ALA B CA  
1246 C C   . ALA C 14  ? 0.2789 0.6205 0.3695 -0.0210 0.0392  0.0740  12  ALA B C   
1247 O O   . ALA C 14  ? 0.2961 0.5980 0.3719 -0.0394 0.0333  0.0730  12  ALA B O   
1248 C CB  . ALA C 14  ? 0.2641 0.7327 0.3832 -0.0042 0.0378  0.0773  12  ALA B CB  
1249 N N   . ARG C 15  ? 0.2500 0.5965 0.3425 -0.0201 0.0456  0.0747  13  ARG B N   
1250 C CA  . ARG C 15  ? 0.2795 0.5867 0.3575 -0.0429 0.0450  0.0761  13  ARG B CA  
1251 C C   . ARG C 15  ? 0.2735 0.5098 0.3389 -0.0357 0.0431  0.0735  13  ARG B C   
1252 O O   . ARG C 15  ? 0.3093 0.5066 0.3580 -0.0549 0.0381  0.0742  13  ARG B O   
1253 C CB  . ARG C 15  ? 0.2616 0.5894 0.3427 -0.0403 0.0527  0.0775  13  ARG B CB  
1254 C CG  . ARG C 15  ? 0.2779 0.6845 0.3717 -0.0485 0.0564  0.0803  13  ARG B CG  
1255 C CD  . ARG C 15  ? 0.3588 0.7792 0.4503 -0.0493 0.0646  0.0813  13  ARG B CD  
1256 N NE  . ARG C 15  ? 0.4913 0.9630 0.5821 -0.0832 0.0652  0.0876  13  ARG B NE  
1257 C CZ  . ARG C 15  ? 0.5182 1.0732 0.6254 -0.0795 0.0719  0.0887  13  ARG B CZ  
1258 N NH1 . ARG C 15  ? 0.5778 1.1822 0.6835 -0.1160 0.0723  0.0957  13  ARG B NH1 
1259 N NH2 . ARG C 15  ? 0.5807 1.1694 0.7033 -0.0386 0.0781  0.0831  13  ARG B NH2 
1260 N N   . ILE C 16  ? 0.2654 0.4853 0.3364 -0.0083 0.0472  0.0709  14  ILE B N   
1261 C CA  . ILE C 16  ? 0.2825 0.4480 0.3453 -0.0017 0.0461  0.0691  14  ILE B CA  
1262 C C   . ILE C 16  ? 0.2977 0.4445 0.3533 -0.0071 0.0407  0.0674  14  ILE B C   
1263 O O   . ILE C 16  ? 0.3505 0.4572 0.3946 -0.0113 0.0382  0.0659  14  ILE B O   
1264 C CB  . ILE C 16  ? 0.2722 0.4247 0.3392 0.0235  0.0509  0.0677  14  ILE B CB  
1265 C CG1 . ILE C 16  ? 0.2693 0.3772 0.3299 0.0238  0.0503  0.0672  14  ILE B CG1 
1266 C CG2 . ILE C 16  ? 0.2477 0.4098 0.3179 0.0402  0.0505  0.0672  14  ILE B CG2 
1267 C CD1 . ILE C 16  ? 0.3155 0.4092 0.3694 0.0096  0.0489  0.0687  14  ILE B CD1 
1268 N N   . ASN C 17  ? 0.2327 0.4103 0.2931 -0.0058 0.0384  0.0673  15  ASN B N   
1269 C CA  . ASN C 17  ? 0.2498 0.4108 0.2999 -0.0113 0.0331  0.0648  15  ASN B CA  
1270 C C   . ASN C 17  ? 0.3096 0.4504 0.3413 -0.0387 0.0267  0.0638  15  ASN B C   
1271 O O   . ASN C 17  ? 0.3243 0.4235 0.3384 -0.0411 0.0234  0.0599  15  ASN B O   
1272 C CB  . ASN C 17  ? 0.2359 0.4376 0.2936 -0.0046 0.0307  0.0658  15  ASN B CB  
1273 C CG  . ASN C 17  ? 0.2398 0.4428 0.3050 0.0239  0.0351  0.0671  15  ASN B CG  
1274 O OD1 . ASN C 17  ? 0.2514 0.4202 0.3140 0.0350  0.0395  0.0667  15  ASN B OD1 
1275 N ND2 . ASN C 17  ? 0.1895 0.4317 0.2614 0.0352  0.0329  0.0693  15  ASN B ND2 
1276 N N   . ARG C 18  ? 0.3195 0.4874 0.3515 -0.0590 0.0251  0.0672  16  ARG B N   
1277 C CA  . ARG C 18  ? 0.4155 0.5561 0.4233 -0.0892 0.0181  0.0679  16  ARG B CA  
1278 C C   . ARG C 18  ? 0.4192 0.5034 0.4118 -0.0861 0.0186  0.0677  16  ARG B C   
1279 O O   . ARG C 18  ? 0.4571 0.4901 0.4232 -0.0936 0.0125  0.0649  16  ARG B O   
1280 C CB  . ARG C 18  ? 0.4378 0.6281 0.4498 -0.1151 0.0169  0.0736  16  ARG B CB  
1281 C CG  . ARG C 18  ? 0.5579 0.7861 0.5669 -0.1373 0.0095  0.0740  16  ARG B CG  
1282 C CD  . ARG C 18  ? 0.6829 0.9614 0.6929 -0.1704 0.0078  0.0808  16  ARG B CD  
1283 N NE  . ARG C 18  ? 0.7015 1.0614 0.7454 -0.1536 0.0156  0.0836  16  ARG B NE  
1284 C CZ  . ARG C 18  ? 0.7065 1.0917 0.7630 -0.1452 0.0245  0.0864  16  ARG B CZ  
1285 N NH1 . ARG C 18  ? 0.6716 1.1291 0.7552 -0.1245 0.0314  0.0872  16  ARG B NH1 
1286 N NH2 . ARG C 18  ? 0.7455 1.0837 0.7849 -0.1555 0.0262  0.0884  16  ARG B NH2 
1287 N N   . ALA C 19  ? 0.3765 0.4686 0.3837 -0.0720 0.0253  0.0702  17  ALA B N   
1288 C CA  . ALA C 19  ? 0.3746 0.4231 0.3695 -0.0698 0.0248  0.0715  17  ALA B CA  
1289 C C   . ALA C 19  ? 0.3737 0.3799 0.3629 -0.0498 0.0240  0.0669  17  ALA B C   
1290 O O   . ALA C 19  ? 0.4035 0.3702 0.3776 -0.0477 0.0209  0.0676  17  ALA B O   
1291 C CB  . ALA C 19  ? 0.3346 0.4066 0.3455 -0.0607 0.0317  0.0747  17  ALA B CB  
1292 N N   . THR C 20  ? 0.3867 0.4065 0.3895 -0.0326 0.0275  0.0632  18  THR B N   
1293 C CA  . THR C 20  ? 0.3563 0.3497 0.3578 -0.0134 0.0289  0.0595  18  THR B CA  
1294 C C   . THR C 20  ? 0.3944 0.3761 0.3832 -0.0125 0.0263  0.0539  18  THR B C   
1295 O O   . THR C 20  ? 0.3926 0.3648 0.3826 0.0042  0.0293  0.0505  18  THR B O   
1296 C CB  . THR C 20  ? 0.3280 0.3412 0.3517 0.0051  0.0360  0.0607  18  THR B CB  
1297 O OG1 . THR C 20  ? 0.2472 0.2907 0.2815 0.0090  0.0387  0.0609  18  THR B OG1 
1298 C CG2 . THR C 20  ? 0.2870 0.3067 0.3183 0.0044  0.0381  0.0647  18  THR B CG2 
1299 N N   . ASN C 21  ? 0.3926 0.3772 0.3673 -0.0323 0.0205  0.0531  19  ASN B N   
1300 C CA  . ASN C 21  ? 0.4094 0.3846 0.3690 -0.0337 0.0172  0.0472  19  ASN B CA  
1301 C C   . ASN C 21  ? 0.4380 0.3625 0.3733 -0.0218 0.0156  0.0405  19  ASN B C   
1302 O O   . ASN C 21  ? 0.4414 0.3253 0.3541 -0.0272 0.0105  0.0400  19  ASN B O   
1303 C CB  . ASN C 21  ? 0.4433 0.4266 0.3867 -0.0627 0.0089  0.0475  19  ASN B CB  
1304 C CG  . ASN C 21  ? 0.5154 0.5134 0.4535 -0.0644 0.0060  0.0432  19  ASN B CG  
1305 O OD1 . ASN C 21  ? 0.5420 0.5076 0.4613 -0.0546 0.0053  0.0361  19  ASN B OD1 
1306 N ND2 . ASN C 21  ? 0.5757 0.6264 0.5300 -0.0750 0.0044  0.0473  19  ASN B ND2 
1307 N N   . PRO C 22  ? 0.4214 0.3484 0.3592 -0.0037 0.0200  0.0356  20  PRO B N   
1308 C CA  . PRO C 22  ? 0.4464 0.3331 0.3611 0.0120  0.0200  0.0278  20  PRO B CA  
1309 C C   . PRO C 22  ? 0.5128 0.3532 0.3846 -0.0023 0.0104  0.0205  20  PRO B C   
1310 O O   . PRO C 22  ? 0.5334 0.3285 0.3770 0.0116  0.0085  0.0132  20  PRO B O   
1311 C CB  . PRO C 22  ? 0.4535 0.3655 0.3808 0.0289  0.0277  0.0253  20  PRO B CB  
1312 C CG  . PRO C 22  ? 0.3898 0.3470 0.3477 0.0253  0.0317  0.0335  20  PRO B CG  
1313 C CD  . PRO C 22  ? 0.3794 0.3465 0.3385 0.0042  0.0255  0.0375  20  PRO B CD  
1314 N N   . LEU C 23  ? 0.5376 0.3889 0.4023 -0.0300 0.0037  0.0226  21  LEU B N   
1315 C CA  . LEU C 23  ? 0.6211 0.4263 0.4407 -0.0516 -0.0073 0.0165  21  LEU B CA  
1316 C C   . LEU C 23  ? 0.6620 0.4230 0.4556 -0.0694 -0.0152 0.0201  21  LEU B C   
1317 O O   . LEU C 23  ? 0.7419 0.4445 0.4878 -0.0843 -0.0252 0.0147  21  LEU B O   
1318 C CB  . LEU C 23  ? 0.6456 0.4869 0.4669 -0.0779 -0.0127 0.0178  21  LEU B CB  
1319 C CG  . LEU C 23  ? 0.5955 0.4644 0.4241 -0.0665 -0.0095 0.0131  21  LEU B CG  
1320 C CD1 . LEU C 23  ? 0.6229 0.5284 0.4509 -0.0952 -0.0178 0.0157  21  LEU B CD1 
1321 C CD2 . LEU C 23  ? 0.7110 0.5268 0.5016 -0.0516 -0.0101 0.0006  21  LEU B CD2 
1322 N N   . ASN C 24  ? 0.5897 0.3745 0.4099 -0.0694 -0.0114 0.0294  22  ASN B N   
1323 C CA  . ASN C 24  ? 0.6342 0.3803 0.4298 -0.0877 -0.0185 0.0350  22  ASN B CA  
1324 C C   . ASN C 24  ? 0.6925 0.3579 0.4423 -0.0724 -0.0249 0.0287  22  ASN B C   
1325 O O   . ASN C 24  ? 0.6757 0.3341 0.4339 -0.0371 -0.0193 0.0241  22  ASN B O   
1326 C CB  . ASN C 24  ? 0.5417 0.3255 0.3730 -0.0825 -0.0119 0.0447  22  ASN B CB  
1327 C CG  . ASN C 24  ? 0.5507 0.4060 0.4169 -0.0994 -0.0073 0.0511  22  ASN B CG  
1328 O OD1 . ASN C 24  ? 0.5503 0.4294 0.4133 -0.1204 -0.0110 0.0504  22  ASN B OD1 
1329 N ND2 . ASN C 24  ? 0.4401 0.3314 0.3386 -0.0883 0.0003  0.0569  22  ASN B ND2 
1330 N N   . LYS C 25  ? 0.8373 0.4425 0.5365 -0.0993 -0.0372 0.0289  23  LYS B N   
1331 C CA  . LYS C 25  ? 0.9001 0.4165 0.5458 -0.0846 -0.0455 0.0236  23  LYS B CA  
1332 C C   . LYS C 25  ? 0.8817 0.3845 0.5323 -0.0724 -0.0456 0.0327  23  LYS B C   
1333 O O   . LYS C 25  ? 0.9120 0.3605 0.5356 -0.0433 -0.0492 0.0291  23  LYS B O   
1334 C CB  . LYS C 25  ? 1.0061 0.4530 0.5875 -0.1223 -0.0605 0.0218  23  LYS B CB  
1335 C CG  . LYS C 25  ? 1.0660 0.5247 0.6366 -0.1416 -0.0632 0.0134  23  LYS B CG  
1336 C CD  . LYS C 25  ? 1.1815 0.5710 0.7048 -0.1153 -0.0669 -0.0025 23  LYS B CD  
1337 C CE  . LYS C 25  ? 1.1603 0.6080 0.7239 -0.0848 -0.0544 -0.0108 23  LYS B CE  
1338 N NZ  . LYS C 25  ? 1.2073 0.6030 0.7211 -0.0795 -0.0597 -0.0264 23  LYS B NZ  
1339 N N   . GLU C 26  ? 0.8538 0.4073 0.5369 -0.0936 -0.0421 0.0443  24  GLU B N   
1340 C CA  . GLU C 26  ? 0.8479 0.3954 0.5367 -0.0867 -0.0423 0.0539  24  GLU B CA  
1341 C C   . GLU C 26  ? 0.7888 0.4199 0.5319 -0.0973 -0.0322 0.0619  24  GLU B C   
1342 O O   . GLU C 26  ? 0.7526 0.4358 0.5190 -0.1148 -0.0278 0.0614  24  GLU B O   
1343 C CB  . GLU C 26  ? 0.9393 0.4152 0.5701 -0.1171 -0.0559 0.0611  24  GLU B CB  
1344 C CG  . GLU C 26  ? 1.0034 0.4973 0.6233 -0.1689 -0.0598 0.0664  24  GLU B CG  
1345 C CD  . GLU C 26  ? 1.1288 0.5659 0.6979 -0.2053 -0.0715 0.0775  24  GLU B CD  
1346 O OE1 . GLU C 26  ? 1.2365 0.6495 0.7687 -0.2477 -0.0803 0.0790  24  GLU B OE1 
1347 O OE2 . GLU C 26  ? 1.1637 0.5818 0.7284 -0.1946 -0.0724 0.0857  24  GLU B OE2 
1348 N N   . LEU C 27  ? 0.7753 0.4177 0.5352 -0.0855 -0.0294 0.0691  25  LEU B N   
1349 C CA  . LEU C 27  ? 0.7250 0.4379 0.5289 -0.0932 -0.0202 0.0756  25  LEU B CA  
1350 C C   . LEU C 27  ? 0.7570 0.4959 0.5554 -0.1346 -0.0214 0.0815  25  LEU B C   
1351 O O   . LEU C 27  ? 0.8190 0.5145 0.5761 -0.1634 -0.0307 0.0871  25  LEU B O   
1352 C CB  . LEU C 27  ? 0.7208 0.4284 0.5293 -0.0818 -0.0202 0.0829  25  LEU B CB  
1353 C CG  . LEU C 27  ? 0.7288 0.4326 0.5530 -0.0420 -0.0181 0.0789  25  LEU B CG  
1354 C CD1 . LEU C 27  ? 0.6766 0.3654 0.4939 -0.0363 -0.0223 0.0875  25  LEU B CD1 
1355 C CD2 . LEU C 27  ? 0.6313 0.3986 0.5046 -0.0252 -0.0063 0.0740  25  LEU B CD2 
1356 N N   . ASP C 28  ? 0.5953 0.4044 0.4326 -0.1372 -0.0127 0.0802  26  ASP B N   
1357 C CA  . ASP C 28  ? 0.6112 0.4690 0.4551 -0.1710 -0.0116 0.0859  26  ASP B CA  
1358 C C   . ASP C 28  ? 0.5852 0.4847 0.4502 -0.1736 -0.0043 0.0936  26  ASP B C   
1359 O O   . ASP C 28  ? 0.5226 0.4806 0.4261 -0.1573 0.0056  0.0919  26  ASP B O   
1360 C CB  . ASP C 28  ? 0.5671 0.4828 0.4423 -0.1652 -0.0063 0.0802  26  ASP B CB  
1361 C CG  . ASP C 28  ? 0.5681 0.5431 0.4516 -0.1975 -0.0061 0.0854  26  ASP B CG  
1362 O OD1 . ASP C 28  ? 0.6122 0.5934 0.4826 -0.2254 -0.0076 0.0938  26  ASP B OD1 
1363 O OD2 . ASP C 28  ? 0.5575 0.5797 0.4627 -0.1937 -0.0039 0.0817  26  ASP B OD2 
1364 N N   . TRP C 29  ? 0.6503 0.5156 0.4854 -0.1936 -0.0095 0.1020  27  TRP B N   
1365 C CA  . TRP C 29  ? 0.6424 0.5409 0.4914 -0.1956 -0.0029 0.1091  27  TRP B CA  
1366 C C   . TRP C 29  ? 0.6194 0.6002 0.4944 -0.2138 0.0060  0.1119  27  TRP B C   
1367 O O   . TRP C 29  ? 0.5758 0.6013 0.4759 -0.2006 0.0156  0.1124  27  TRP B O   
1368 C CB  . TRP C 29  ? 0.7206 0.5609 0.5259 -0.2153 -0.0116 0.1188  27  TRP B CB  
1369 C CG  . TRP C 29  ? 0.7212 0.4995 0.5121 -0.1848 -0.0174 0.1169  27  TRP B CG  
1370 C CD1 . TRP C 29  ? 0.7530 0.4529 0.5027 -0.1804 -0.0293 0.1158  27  TRP B CD1 
1371 C CD2 . TRP C 29  ? 0.6577 0.4520 0.4764 -0.1515 -0.0119 0.1147  27  TRP B CD2 
1372 N NE1 . TRP C 29  ? 0.7117 0.3854 0.4654 -0.1439 -0.0310 0.1136  27  TRP B NE1 
1373 C CE2 . TRP C 29  ? 0.6281 0.3602 0.4243 -0.1288 -0.0208 0.1135  27  TRP B CE2 
1374 C CE3 . TRP C 29  ? 0.5412 0.3944 0.3977 -0.1391 -0.0009 0.1134  27  TRP B CE3 
1375 C CZ2 . TRP C 29  ? 0.6092 0.3460 0.4244 -0.0975 -0.0193 0.1122  27  TRP B CZ2 
1376 C CZ3 . TRP C 29  ? 0.5706 0.4186 0.4412 -0.1104 0.0000  0.1115  27  TRP B CZ3 
1377 C CH2 . TRP C 29  ? 0.5640 0.3590 0.4165 -0.0912 -0.0092 0.1113  27  TRP B CH2 
1378 N N   . ALA C 30  ? 0.6438 0.6451 0.5096 -0.2445 0.0021  0.1136  28  ALA B N   
1379 C CA  . ALA C 30  ? 0.6214 0.7127 0.5154 -0.2588 0.0101  0.1158  28  ALA B CA  
1380 C C   . ALA C 30  ? 0.5228 0.6682 0.4621 -0.2190 0.0206  0.1076  28  ALA B C   
1381 O O   . ALA C 30  ? 0.4753 0.6765 0.4380 -0.2083 0.0307  0.1084  28  ALA B O   
1382 C CB  . ALA C 30  ? 0.6753 0.7821 0.5538 -0.2973 0.0021  0.1181  28  ALA B CB  
1383 N N   . SER C 31  ? 0.5237 0.6462 0.4706 -0.1957 0.0181  0.0996  29  SER B N   
1384 C CA  . SER C 31  ? 0.4489 0.6100 0.4313 -0.1594 0.0262  0.0930  29  SER B CA  
1385 C C   . SER C 31  ? 0.4071 0.5507 0.3997 -0.1295 0.0327  0.0909  29  SER B C   
1386 O O   . SER C 31  ? 0.3517 0.5375 0.3671 -0.1093 0.0413  0.0886  29  SER B O   
1387 C CB  . SER C 31  ? 0.4377 0.5792 0.4212 -0.1470 0.0215  0.0864  29  SER B CB  
1388 O OG  . SER C 31  ? 0.5155 0.6762 0.4886 -0.1757 0.0145  0.0876  29  SER B OG  
1389 N N   . ILE C 32  ? 0.4273 0.5082 0.4000 -0.1264 0.0278  0.0915  30  ILE B N   
1390 C CA  . ILE C 32  ? 0.4049 0.4687 0.3837 -0.1041 0.0316  0.0907  30  ILE B CA  
1391 C C   . ILE C 32  ? 0.4031 0.5049 0.3876 -0.1091 0.0388  0.0944  30  ILE B C   
1392 O O   . ILE C 32  ? 0.3626 0.4889 0.3650 -0.0870 0.0463  0.0903  30  ILE B O   
1393 C CB  . ILE C 32  ? 0.4324 0.4295 0.3857 -0.1039 0.0232  0.0929  30  ILE B CB  
1394 C CG1 . ILE C 32  ? 0.4292 0.3938 0.3813 -0.0868 0.0191  0.0867  30  ILE B CG1 
1395 C CG2 . ILE C 32  ? 0.3955 0.3847 0.3524 -0.0894 0.0256  0.0946  30  ILE B CG2 
1396 C CD1 . ILE C 32  ? 0.4882 0.3888 0.4093 -0.0864 0.0096  0.0880  30  ILE B CD1 
1397 N N   . ASN C 33  ? 0.4220 0.5261 0.3868 -0.1390 0.0364  0.1019  31  ASN B N   
1398 C CA  . ASN C 33  ? 0.4280 0.5700 0.3937 -0.1470 0.0438  0.1060  31  ASN B CA  
1399 C C   . ASN C 33  ? 0.4081 0.6270 0.4004 -0.1383 0.0543  0.1022  31  ASN B C   
1400 O O   . ASN C 33  ? 0.4057 0.6544 0.4062 -0.1239 0.0631  0.1000  31  ASN B O   
1401 C CB  . ASN C 33  ? 0.4911 0.6192 0.4259 -0.1863 0.0385  0.1167  31  ASN B CB  
1402 C CG  . ASN C 33  ? 0.5329 0.5852 0.4371 -0.1883 0.0289  0.1214  31  ASN B CG  
1403 O OD1 . ASN C 33  ? 0.4825 0.5117 0.3926 -0.1619 0.0291  0.1180  31  ASN B OD1 
1404 N ND2 . ASN C 33  ? 0.6027 0.6154 0.4711 -0.2201 0.0194  0.1299  31  ASN B ND2 
1405 N N   . GLY C 34  ? 0.4805 0.7329 0.4823 -0.1485 0.0525  0.1019  32  GLY B N   
1406 C CA  . GLY C 34  ? 0.4461 0.7748 0.4748 -0.1344 0.0607  0.0982  32  GLY B CA  
1407 C C   . GLY C 34  ? 0.3884 0.7155 0.4347 -0.0911 0.0662  0.0894  32  GLY B C   
1408 O O   . GLY C 34  ? 0.3685 0.7451 0.4284 -0.0708 0.0751  0.0859  32  GLY B O   
1409 N N   . PHE C 35  ? 0.4026 0.6722 0.4455 -0.0770 0.0608  0.0860  33  PHE B N   
1410 C CA  . PHE C 35  ? 0.3530 0.6093 0.4057 -0.0419 0.0646  0.0792  33  PHE B CA  
1411 C C   . PHE C 35  ? 0.3612 0.6112 0.4079 -0.0291 0.0709  0.0770  33  PHE B C   
1412 O O   . PHE C 35  ? 0.3379 0.6117 0.3906 -0.0048 0.0777  0.0717  33  PHE B O   
1413 C CB  . PHE C 35  ? 0.3553 0.5555 0.4040 -0.0353 0.0578  0.0775  33  PHE B CB  
1414 C CG  . PHE C 35  ? 0.2959 0.4803 0.3510 -0.0061 0.0607  0.0723  33  PHE B CG  
1415 C CD1 . PHE C 35  ? 0.2935 0.4444 0.3414 0.0023  0.0615  0.0709  33  PHE B CD1 
1416 C CD2 . PHE C 35  ? 0.2475 0.4499 0.3127 0.0110  0.0615  0.0697  33  PHE B CD2 
1417 C CE1 . PHE C 35  ? 0.2957 0.4272 0.3445 0.0232  0.0628  0.0671  33  PHE B CE1 
1418 C CE2 . PHE C 35  ? 0.2813 0.4611 0.3456 0.0347  0.0631  0.0663  33  PHE B CE2 
1419 C CZ  . PHE C 35  ? 0.2792 0.4224 0.3346 0.0389  0.0638  0.0650  33  PHE B CZ  
1420 N N   . CYS C 36  ? 0.3623 0.5789 0.3934 -0.0450 0.0680  0.0810  34  CYS B N   
1421 C CA  . CYS C 36  ? 0.3937 0.6023 0.4153 -0.0370 0.0726  0.0793  34  CYS B CA  
1422 C C   . CYS C 36  ? 0.4092 0.6766 0.4323 -0.0373 0.0825  0.0785  34  CYS B C   
1423 O O   . CYS C 36  ? 0.4046 0.6811 0.4250 -0.0155 0.0895  0.0721  34  CYS B O   
1424 C CB  . CYS C 36  ? 0.4198 0.5856 0.4226 -0.0561 0.0658  0.0856  34  CYS B CB  
1425 S SG  . CYS C 36  ? 0.4793 0.5832 0.4795 -0.0522 0.0545  0.0864  34  CYS B SG  
1426 N N   . GLU C 37  ? 0.5123 0.8195 0.5369 -0.0630 0.0830  0.0850  35  GLU B N   
1427 C CA  . GLU C 37  ? 0.5526 0.9325 0.5831 -0.0653 0.0933  0.0852  35  GLU B CA  
1428 C C   . GLU C 37  ? 0.5147 0.9365 0.5633 -0.0292 0.1002  0.0764  35  GLU B C   
1429 O O   . GLU C 37  ? 0.5337 0.9788 0.5794 -0.0059 0.1095  0.0701  35  GLU B O   
1430 C CB  . GLU C 37  ? 0.5819 1.0014 0.6129 -0.1035 0.0908  0.0947  35  GLU B CB  
1431 C CG  . GLU C 37  ? 0.6779 1.1946 0.7261 -0.1038 0.1008  0.0948  35  GLU B CG  
1432 C CD  . GLU C 37  ? 0.7408 1.3000 0.8107 -0.1019 0.0970  0.0943  35  GLU B CD  
1433 O OE1 . GLU C 37  ? 0.7355 1.3729 0.8252 -0.0832 0.1049  0.0911  35  GLU B OE1 
1434 O OE2 . GLU C 37  ? 0.7796 1.2968 0.8451 -0.1182 0.0859  0.0971  35  GLU B OE2 
1435 N N   . GLN C 38  ? 0.4080 0.8354 0.4712 -0.0232 0.0950  0.0759  36  GLN B N   
1436 C CA  . GLN C 38  ? 0.3923 0.8634 0.4711 0.0098  0.0995  0.0699  36  GLN B CA  
1437 C C   . GLN C 38  ? 0.4074 0.8381 0.4759 0.0484  0.1028  0.0607  36  GLN B C   
1438 O O   . GLN C 38  ? 0.4146 0.8807 0.4843 0.0795  0.1101  0.0544  36  GLN B O   
1439 C CB  . GLN C 38  ? 0.3748 0.8490 0.4666 0.0064  0.0911  0.0721  36  GLN B CB  
1440 C CG  . GLN C 38  ? 0.3863 0.9020 0.4922 0.0420  0.0933  0.0674  36  GLN B CG  
1441 C CD  . GLN C 38  ? 0.4608 1.0751 0.5830 0.0440  0.1002  0.0687  36  GLN B CD  
1442 O OE1 . GLN C 38  ? 0.5071 1.1621 0.6378 0.0810  0.1043  0.0639  36  GLN B OE1 
1443 N NE2 . GLN C 38  ? 0.4556 1.1100 0.5804 0.0043  0.1010  0.0758  36  GLN B NE2 
1444 N N   . LEU C 39  ? 0.3525 0.7096 0.4081 0.0463  0.0969  0.0599  37  LEU B N   
1445 C CA  . LEU C 39  ? 0.4134 0.7248 0.4554 0.0763  0.0977  0.0523  37  LEU B CA  
1446 C C   . LEU C 39  ? 0.4877 0.8055 0.5125 0.0923  0.1063  0.0454  37  LEU B C   
1447 O O   . LEU C 39  ? 0.5338 0.8248 0.5430 0.1219  0.1082  0.0373  37  LEU B O   
1448 C CB  . LEU C 39  ? 0.3840 0.6254 0.4184 0.0666  0.0892  0.0540  37  LEU B CB  
1449 C CG  . LEU C 39  ? 0.3836 0.5885 0.4053 0.0471  0.0864  0.0563  37  LEU B CG  
1450 C CD1 . LEU C 39  ? 0.4084 0.5917 0.4096 0.0625  0.0903  0.0494  37  LEU B CD1 
1451 C CD2 . LEU C 39  ? 0.3145 0.4723 0.3380 0.0371  0.0773  0.0599  37  LEU B CD2 
1452 N N   . ASN C 40  ? 0.6184 0.9696 0.6418 0.0723  0.1113  0.0486  38  ASN B N   
1453 C CA  . ASN C 40  ? 0.7093 1.0728 0.7146 0.0857  0.1207  0.0419  38  ASN B CA  
1454 C C   . ASN C 40  ? 0.7433 1.1852 0.7564 0.1075  0.1322  0.0374  38  ASN B C   
1455 O O   . ASN C 40  ? 0.7926 1.2482 0.7888 0.1267  0.1415  0.0294  38  ASN B O   
1456 C CB  . ASN C 40  ? 0.7070 1.0617 0.7011 0.0537  0.1204  0.0479  38  ASN B CB  
1457 C CG  . ASN C 40  ? 0.7355 1.0142 0.7153 0.0446  0.1106  0.0489  38  ASN B CG  
1458 O OD1 . ASN C 40  ? 0.7787 1.0353 0.7623 0.0183  0.1024  0.0578  38  ASN B OD1 
1459 N ND2 . ASN C 40  ? 0.7743 1.0115 0.7358 0.0674  0.1104  0.0397  38  ASN B ND2 
1460 N N   . GLU C 41  ? 0.7315 1.2276 0.7695 0.1054  0.1313  0.0421  39  GLU B N   
1461 C CA  . GLU C 41  ? 0.7686 1.3548 0.8202 0.1249  0.1413  0.0395  39  GLU B CA  
1462 C C   . GLU C 41  ? 0.8187 1.3962 0.8611 0.1788  0.1440  0.0282  39  GLU B C   
1463 O O   . GLU C 41  ? 0.8412 1.4838 0.8863 0.2088  0.1539  0.0224  39  GLU B O   
1464 C CB  . GLU C 41  ? 0.7278 1.3760 0.8082 0.1000  0.1371  0.0494  39  GLU B CB  
1465 C CG  . GLU C 41  ? 0.7589 1.5025 0.8521 0.0760  0.1459  0.0553  39  GLU B CG  
1466 C CD  . GLU C 41  ? 0.7814 1.6012 0.9030 0.0621  0.1421  0.0624  39  GLU B CD  
1467 O OE1 . GLU C 41  ? 0.7883 1.7084 0.9262 0.0712  0.1512  0.0624  39  GLU B OE1 
1468 O OE2 . GLU C 41  ? 0.7370 1.5195 0.8638 0.0430  0.1299  0.0676  39  GLU B OE2 
1469 N N   . ASP C 42  ? 1.0302 1.5267 1.0592 0.1914  0.1349  0.0256  40  ASP B N   
1470 C CA  . ASP C 42  ? 1.0873 1.5578 1.0997 0.2396  0.1346  0.0166  40  ASP B CA  
1471 C C   . ASP C 42  ? 1.1257 1.4997 1.1002 0.2501  0.1317  0.0089  40  ASP B C   
1472 O O   . ASP C 42  ? 1.0935 1.4158 1.0629 0.2186  0.1258  0.0129  40  ASP B O   
1473 C CB  . ASP C 42  ? 1.0662 1.5328 1.0945 0.2447  0.1250  0.0223  40  ASP B CB  
1474 C CG  . ASP C 42  ? 1.0325 1.5701 1.0963 0.2124  0.1228  0.0328  40  ASP B CG  
1475 O OD1 . ASP C 42  ? 1.0011 1.5047 1.0723 0.1790  0.1143  0.0400  40  ASP B OD1 
1476 O OD2 . ASP C 42  ? 1.0466 1.6749 1.1289 0.2203  0.1292  0.0335  40  ASP B OD2 
1477 N N   . PHE C 43  ? 0.9442 1.2934 0.8898 0.2947  0.1347  -0.0021 41  PHE B N   
1478 C CA  . PHE C 43  ? 0.9594 1.2096 0.8623 0.3048  0.1297  -0.0097 41  PHE B CA  
1479 C C   . PHE C 43  ? 0.9171 1.1006 0.8159 0.2968  0.1171  -0.0037 41  PHE B C   
1480 O O   . PHE C 43  ? 0.9042 1.0140 0.7811 0.2793  0.1105  -0.0040 41  PHE B O   
1481 C CB  . PHE C 43  ? 1.0672 1.3022 0.9318 0.3563  0.1359  -0.0241 41  PHE B CB  
1482 C CG  . PHE C 43  ? 1.1511 1.2784 0.9635 0.3633  0.1299  -0.0327 41  PHE B CG  
1483 C CD1 . PHE C 43  ? 1.1660 1.2599 0.9597 0.3380  0.1308  -0.0365 41  PHE B CD1 
1484 C CD2 . PHE C 43  ? 1.2429 1.3006 1.0215 0.3929  0.1221  -0.0363 41  PHE B CD2 
1485 C CE1 . PHE C 43  ? 1.2272 1.2242 0.9712 0.3399  0.1238  -0.0443 41  PHE B CE1 
1486 C CE2 . PHE C 43  ? 1.3113 1.2660 1.0368 0.3937  0.1153  -0.0436 41  PHE B CE2 
1487 C CZ  . PHE C 43  ? 1.2946 1.2210 1.0036 0.3662  0.1161  -0.0479 41  PHE B CZ  
1488 N N   . GLU C 44  ? 0.8294 1.0437 0.7490 0.3084  0.1136  0.0021  42  GLU B N   
1489 C CA  . GLU C 44  ? 0.7903 0.9540 0.7100 0.2975  0.1027  0.0095  42  GLU B CA  
1490 C C   . GLU C 44  ? 0.6828 0.8455 0.6286 0.2493  0.0984  0.0188  42  GLU B C   
1491 O O   . GLU C 44  ? 0.6479 0.7590 0.5888 0.2341  0.0905  0.0235  42  GLU B O   
1492 C CB  . GLU C 44  ? 0.8109 1.0156 0.7462 0.3222  0.1000  0.0137  42  GLU B CB  
1493 C CG  . GLU C 44  ? 0.7603 1.0028 0.7340 0.2899  0.0949  0.0251  42  GLU B CG  
1494 C CD  . GLU C 44  ? 0.7490 1.0944 0.7584 0.2893  0.0995  0.0281  42  GLU B CD  
1495 O OE1 . GLU C 44  ? 0.7852 1.1770 0.7943 0.3274  0.1026  0.0246  42  GLU B OE1 
1496 O OE2 . GLU C 44  ? 0.6126 0.9920 0.6482 0.2506  0.0992  0.0344  42  GLU B OE2 
1497 N N   . GLY C 45  ? 0.5976 0.8180 0.5684 0.2263  0.1035  0.0216  43  GLY B N   
1498 C CA  . GLY C 45  ? 0.5100 0.7394 0.5058 0.1861  0.0990  0.0309  43  GLY B CA  
1499 C C   . GLY C 45  ? 0.4687 0.6292 0.4524 0.1649  0.0924  0.0329  43  GLY B C   
1500 O O   . GLY C 45  ? 0.4395 0.5787 0.4323 0.1522  0.0857  0.0386  43  GLY B O   
1501 N N   . PRO C 46  ? 0.4898 0.6217 0.4539 0.1596  0.0941  0.0284  44  PRO B N   
1502 C CA  . PRO C 46  ? 0.4632 0.5455 0.4213 0.1352  0.0873  0.0316  44  PRO B CA  
1503 C C   . PRO C 46  ? 0.4583 0.4865 0.4050 0.1376  0.0799  0.0329  44  PRO B C   
1504 O O   . PRO C 46  ? 0.4229 0.4383 0.3820 0.1163  0.0745  0.0392  44  PRO B O   
1505 C CB  . PRO C 46  ? 0.4780 0.5431 0.4121 0.1344  0.0902  0.0252  44  PRO B CB  
1506 C CG  . PRO C 46  ? 0.4920 0.6159 0.4314 0.1461  0.1002  0.0220  44  PRO B CG  
1507 C CD  . PRO C 46  ? 0.5119 0.6657 0.4610 0.1726  0.1027  0.0208  44  PRO B CD  
1508 N N   . PRO C 47  ? 0.5333 0.5296 0.4538 0.1637  0.0798  0.0275  45  PRO B N   
1509 C CA  . PRO C 47  ? 0.5476 0.4949 0.4547 0.1640  0.0728  0.0310  45  PRO B CA  
1510 C C   . PRO C 47  ? 0.4864 0.4602 0.4202 0.1605  0.0707  0.0389  45  PRO B C   
1511 O O   . PRO C 47  ? 0.4595 0.4082 0.3953 0.1448  0.0656  0.0445  45  PRO B O   
1512 C CB  . PRO C 47  ? 0.6124 0.5219 0.4805 0.1975  0.0733  0.0234  45  PRO B CB  
1513 C CG  . PRO C 47  ? 0.6661 0.5920 0.5223 0.2108  0.0801  0.0141  45  PRO B CG  
1514 C CD  . PRO C 47  ? 0.5784 0.5751 0.4735 0.1943  0.0857  0.0177  45  PRO B CD  
1515 N N   . LEU C 48  ? 0.4471 0.4752 0.4005 0.1736  0.0745  0.0392  46  LEU B N   
1516 C CA  . LEU C 48  ? 0.4084 0.4654 0.3857 0.1677  0.0719  0.0459  46  LEU B CA  
1517 C C   . LEU C 48  ? 0.3463 0.4134 0.3460 0.1353  0.0700  0.0509  46  LEU B C   
1518 O O   . LEU C 48  ? 0.3286 0.3829 0.3347 0.1251  0.0659  0.0556  46  LEU B O   
1519 C CB  . LEU C 48  ? 0.4144 0.5349 0.4077 0.1860  0.0754  0.0452  46  LEU B CB  
1520 C CG  . LEU C 48  ? 0.3826 0.5415 0.4001 0.1775  0.0718  0.0515  46  LEU B CG  
1521 C CD1 . LEU C 48  ? 0.4626 0.5800 0.4679 0.1834  0.0656  0.0556  46  LEU B CD1 
1522 C CD2 . LEU C 48  ? 0.3367 0.5641 0.3677 0.1970  0.0746  0.0505  46  LEU B CD2 
1523 N N   . ALA C 49  ? 0.3505 0.4381 0.3585 0.1208  0.0728  0.0498  47  ALA B N   
1524 C CA  . ALA C 49  ? 0.2925 0.3845 0.3160 0.0934  0.0701  0.0545  47  ALA B CA  
1525 C C   . ALA C 49  ? 0.3041 0.3524 0.3220 0.0835  0.0653  0.0567  47  ALA B C   
1526 O O   . ALA C 49  ? 0.2934 0.3404 0.3226 0.0716  0.0621  0.0605  47  ALA B O   
1527 C CB  . ALA C 49  ? 0.2639 0.3718 0.2870 0.0811  0.0730  0.0537  47  ALA B CB  
1528 N N   . THR C 50  ? 0.4078 0.4220 0.4059 0.0889  0.0648  0.0538  48  THR B N   
1529 C CA  . THR C 50  ? 0.4005 0.3806 0.3920 0.0758  0.0602  0.0560  48  THR B CA  
1530 C C   . THR C 50  ? 0.3942 0.3590 0.3849 0.0774  0.0579  0.0598  48  THR B C   
1531 O O   . THR C 50  ? 0.3465 0.3106 0.3479 0.0641  0.0555  0.0640  48  THR B O   
1532 C CB  . THR C 50  ? 0.4613 0.4104 0.4258 0.0793  0.0598  0.0508  48  THR B CB  
1533 O OG1 . THR C 50  ? 0.4854 0.4391 0.4529 0.0640  0.0582  0.0510  48  THR B OG1 
1534 C CG2 . THR C 50  ? 0.4561 0.3608 0.3972 0.0787  0.0558  0.0510  48  THR B CG2 
1535 N N   . ARG C 51  ? 0.4143 0.3741 0.3937 0.0957  0.0591  0.0588  49  ARG B N   
1536 C CA  . ARG C 51  ? 0.4496 0.3979 0.4259 0.0987  0.0570  0.0635  49  ARG B CA  
1537 C C   . ARG C 51  ? 0.3989 0.3808 0.4009 0.0906  0.0572  0.0668  49  ARG B C   
1538 O O   . ARG C 51  ? 0.3623 0.3369 0.3675 0.0809  0.0559  0.0707  49  ARG B O   
1539 C CB  . ARG C 51  ? 0.4785 0.4190 0.4366 0.1247  0.0572  0.0618  49  ARG B CB  
1540 C CG  . ARG C 51  ? 0.6538 0.5447 0.5816 0.1296  0.0532  0.0655  49  ARG B CG  
1541 C CD  . ARG C 51  ? 0.7664 0.6184 0.6577 0.1530  0.0522  0.0603  49  ARG B CD  
1542 N NE  . ARG C 51  ? 0.8468 0.7349 0.7444 0.1823  0.0555  0.0555  49  ARG B NE  
1543 C CZ  . ARG C 51  ? 0.9165 0.7999 0.7974 0.2024  0.0585  0.0474  49  ARG B CZ  
1544 N NH1 . ARG C 51  ? 0.9077 0.8356 0.7977 0.2299  0.0622  0.0437  49  ARG B NH1 
1545 N NH2 . ARG C 51  ? 0.9015 0.7397 0.7559 0.1949  0.0578  0.0425  49  ARG B NH2 
1546 N N   . LEU C 52  ? 0.3728 0.3917 0.3904 0.0934  0.0589  0.0649  50  LEU B N   
1547 C CA  . LEU C 52  ? 0.3299 0.3740 0.3647 0.0845  0.0579  0.0669  50  LEU B CA  
1548 C C   . LEU C 52  ? 0.3118 0.3484 0.3547 0.0668  0.0567  0.0677  50  LEU B C   
1549 O O   . LEU C 52  ? 0.3033 0.3387 0.3509 0.0615  0.0556  0.0692  50  LEU B O   
1550 C CB  . LEU C 52  ? 0.2953 0.3808 0.3410 0.0864  0.0588  0.0653  50  LEU B CB  
1551 C CG  . LEU C 52  ? 0.3260 0.4339 0.3679 0.1082  0.0601  0.0642  50  LEU B CG  
1552 C CD1 . LEU C 52  ? 0.2276 0.3867 0.2830 0.1045  0.0622  0.0630  50  LEU B CD1 
1553 C CD2 . LEU C 52  ? 0.3173 0.4262 0.3564 0.1187  0.0566  0.0674  50  LEU B CD2 
1554 N N   . LEU C 53  ? 0.3343 0.3662 0.3767 0.0603  0.0569  0.0664  51  LEU B N   
1555 C CA  . LEU C 53  ? 0.3309 0.3550 0.3787 0.0481  0.0545  0.0677  51  LEU B CA  
1556 C C   . LEU C 53  ? 0.3331 0.3422 0.3802 0.0460  0.0536  0.0700  51  LEU B C   
1557 O O   . LEU C 53  ? 0.3374 0.3505 0.3922 0.0422  0.0525  0.0710  51  LEU B O   
1558 C CB  . LEU C 53  ? 0.3327 0.3535 0.3767 0.0424  0.0538  0.0670  51  LEU B CB  
1559 C CG  . LEU C 53  ? 0.3527 0.3922 0.3985 0.0366  0.0544  0.0668  51  LEU B CG  
1560 C CD1 . LEU C 53  ? 0.3387 0.3754 0.3759 0.0336  0.0551  0.0661  51  LEU B CD1 
1561 C CD2 . LEU C 53  ? 0.3340 0.3703 0.3833 0.0264  0.0504  0.0690  51  LEU B CD2 
1562 N N   . ALA C 54  ? 0.3310 0.3225 0.3660 0.0478  0.0538  0.0708  52  ALA B N   
1563 C CA  . ALA C 54  ? 0.3301 0.3119 0.3629 0.0401  0.0529  0.0745  52  ALA B CA  
1564 C C   . ALA C 54  ? 0.3269 0.3187 0.3656 0.0418  0.0548  0.0768  52  ALA B C   
1565 O O   . ALA C 54  ? 0.3241 0.3267 0.3714 0.0359  0.0553  0.0787  52  ALA B O   
1566 C CB  . ALA C 54  ? 0.3442 0.2968 0.3547 0.0380  0.0516  0.0755  52  ALA B CB  
1567 N N   . HIS C 55  ? 0.3474 0.3398 0.3810 0.0513  0.0558  0.0763  53  HIS B N   
1568 C CA  . HIS C 55  ? 0.3440 0.3473 0.3812 0.0532  0.0571  0.0777  53  HIS B CA  
1569 C C   . HIS C 55  ? 0.3235 0.3437 0.3738 0.0509  0.0573  0.0745  53  HIS B C   
1570 O O   . HIS C 55  ? 0.3379 0.3639 0.3906 0.0494  0.0592  0.0751  53  HIS B O   
1571 C CB  . HIS C 55  ? 0.3617 0.3665 0.3909 0.0647  0.0564  0.0780  53  HIS B CB  
1572 C CG  . HIS C 55  ? 0.3373 0.3465 0.3629 0.0654  0.0570  0.0808  53  HIS B CG  
1573 N ND1 . HIS C 55  ? 0.3256 0.3542 0.3571 0.0678  0.0560  0.0782  53  HIS B ND1 
1574 C CD2 . HIS C 55  ? 0.3178 0.3162 0.3334 0.0603  0.0586  0.0859  53  HIS B CD2 
1575 C CE1 . HIS C 55  ? 0.3566 0.3844 0.3806 0.0675  0.0569  0.0811  53  HIS B CE1 
1576 N NE2 . HIS C 55  ? 0.3751 0.3859 0.3898 0.0631  0.0590  0.0862  53  HIS B NE2 
1577 N N   . LYS C 56  ? 0.3015 0.3278 0.3563 0.0508  0.0555  0.0711  54  LYS B N   
1578 C CA  . LYS C 56  ? 0.3067 0.3363 0.3648 0.0481  0.0539  0.0680  54  LYS B CA  
1579 C C   . LYS C 56  ? 0.3065 0.3325 0.3690 0.0477  0.0538  0.0682  54  LYS B C   
1580 O O   . LYS C 56  ? 0.3172 0.3437 0.3790 0.0516  0.0541  0.0658  54  LYS B O   
1581 C CB  . LYS C 56  ? 0.2828 0.3150 0.3398 0.0426  0.0509  0.0662  54  LYS B CB  
1582 C CG  . LYS C 56  ? 0.3221 0.3715 0.3787 0.0432  0.0508  0.0662  54  LYS B CG  
1583 C CD  . LYS C 56  ? 0.3413 0.3984 0.3946 0.0441  0.0495  0.0650  54  LYS B CD  
1584 C CE  . LYS C 56  ? 0.3470 0.4308 0.4019 0.0411  0.0471  0.0651  54  LYS B CE  
1585 N NZ  . LYS C 56  ? 0.3157 0.4083 0.3655 0.0390  0.0439  0.0639  54  LYS B NZ  
1586 N N   . ILE C 57  ? 0.3119 0.3354 0.3772 0.0445  0.0529  0.0705  55  ILE B N   
1587 C CA  . ILE C 57  ? 0.3216 0.3494 0.3931 0.0445  0.0514  0.0717  55  ILE B CA  
1588 C C   . ILE C 57  ? 0.3257 0.3688 0.4026 0.0462  0.0550  0.0734  55  ILE B C   
1589 O O   . ILE C 57  ? 0.3334 0.3897 0.4171 0.0521  0.0547  0.0728  55  ILE B O   
1590 C CB  . ILE C 57  ? 0.3071 0.3315 0.3786 0.0379  0.0487  0.0742  55  ILE B CB  
1591 C CG1 . ILE C 57  ? 0.3100 0.3250 0.3762 0.0364  0.0458  0.0729  55  ILE B CG1 
1592 C CG2 . ILE C 57  ? 0.2706 0.3091 0.3507 0.0368  0.0465  0.0768  55  ILE B CG2 
1593 C CD1 . ILE C 57  ? 0.2953 0.3044 0.3558 0.0304  0.0442  0.0739  55  ILE B CD1 
1594 N N   . GLN C 58  ? 0.2980 0.3404 0.3700 0.0421  0.0582  0.0760  56  GLN B N   
1595 C CA  . GLN C 58  ? 0.3077 0.3663 0.3817 0.0395  0.0624  0.0792  56  GLN B CA  
1596 C C   . GLN C 58  ? 0.3138 0.3791 0.3851 0.0479  0.0662  0.0759  56  GLN B C   
1597 O O   . GLN C 58  ? 0.2984 0.3785 0.3685 0.0457  0.0710  0.0786  56  GLN B O   
1598 C CB  . GLN C 58  ? 0.3496 0.3967 0.4122 0.0278  0.0629  0.0852  56  GLN B CB  
1599 C CG  . GLN C 58  ? 0.3868 0.4216 0.4457 0.0182  0.0586  0.0871  56  GLN B CG  
1600 C CD  . GLN C 58  ? 0.4686 0.4792 0.5069 0.0062  0.0577  0.0923  56  GLN B CD  
1601 O OE1 . GLN C 58  ? 0.4719 0.4701 0.5017 -0.0057 0.0539  0.0941  56  GLN B OE1 
1602 N NE2 . GLN C 58  ? 0.4588 0.4573 0.4841 0.0090  0.0599  0.0949  56  GLN B NE2 
1603 N N   . SER C 59  ? 0.3461 0.4008 0.4138 0.0555  0.0639  0.0701  57  SER B N   
1604 C CA  . SER C 59  ? 0.3692 0.4246 0.4289 0.0624  0.0659  0.0653  57  SER B CA  
1605 C C   . SER C 59  ? 0.3747 0.4471 0.4371 0.0720  0.0703  0.0623  57  SER B C   
1606 O O   . SER C 59  ? 0.3790 0.4564 0.4482 0.0787  0.0687  0.0609  57  SER B O   
1607 C CB  . SER C 59  ? 0.3747 0.4119 0.4258 0.0638  0.0608  0.0597  57  SER B CB  
1608 O OG  . SER C 59  ? 0.4138 0.4478 0.4521 0.0671  0.0615  0.0547  57  SER B OG  
1609 N N   . PRO C 60  ? 0.3149 0.3986 0.3706 0.0746  0.0758  0.0613  58  PRO B N   
1610 C CA  . PRO C 60  ? 0.3434 0.4448 0.3977 0.0883  0.0811  0.0559  58  PRO B CA  
1611 C C   . PRO C 60  ? 0.3805 0.4559 0.4201 0.1022  0.0768  0.0456  58  PRO B C   
1612 O O   . PRO C 60  ? 0.4211 0.5033 0.4557 0.1195  0.0798  0.0393  58  PRO B O   
1613 C CB  . PRO C 60  ? 0.3576 0.4709 0.4022 0.0851  0.0875  0.0573  58  PRO B CB  
1614 C CG  . PRO C 60  ? 0.3450 0.4508 0.3894 0.0689  0.0855  0.0665  58  PRO B CG  
1615 C CD  . PRO C 60  ? 0.3211 0.4026 0.3678 0.0668  0.0775  0.0655  58  PRO B CD  
1616 N N   . GLN C 61  ? 0.3834 0.4289 0.4130 0.0945  0.0697  0.0440  59  GLN B N   
1617 C CA  . GLN C 61  ? 0.4210 0.4335 0.4298 0.1013  0.0639  0.0354  59  GLN B CA  
1618 C C   . GLN C 61  ? 0.4104 0.4079 0.4227 0.1030  0.0580  0.0371  59  GLN B C   
1619 O O   . GLN C 61  ? 0.3665 0.3600 0.3862 0.0894  0.0540  0.0426  59  GLN B O   
1620 C CB  . GLN C 61  ? 0.4309 0.4245 0.4246 0.0876  0.0588  0.0335  59  GLN B CB  
1621 C CG  . GLN C 61  ? 0.4073 0.4122 0.3918 0.0876  0.0630  0.0311  59  GLN B CG  
1622 C CD  . GLN C 61  ? 0.4688 0.4653 0.4426 0.0730  0.0565  0.0310  59  GLN B CD  
1623 O OE1 . GLN C 61  ? 0.4482 0.4187 0.4026 0.0666  0.0493  0.0250  59  GLN B OE1 
1624 N NE2 . GLN C 61  ? 0.3788 0.3972 0.3631 0.0671  0.0579  0.0382  59  GLN B NE2 
1625 N N   . GLU C 62  ? 0.4473 0.4388 0.4532 0.1222  0.0576  0.0327  60  GLU B N   
1626 C CA  . GLU C 62  ? 0.4474 0.4317 0.4585 0.1273  0.0521  0.0362  60  GLU B CA  
1627 C C   . GLU C 62  ? 0.4306 0.3764 0.4267 0.1124  0.0430  0.0379  60  GLU B C   
1628 O O   . GLU C 62  ? 0.4157 0.3670 0.4241 0.1032  0.0401  0.0447  60  GLU B O   
1629 C CB  . GLU C 62  ? 0.4997 0.4797 0.5004 0.1559  0.0516  0.0303  60  GLU B CB  
1630 C CG  . GLU C 62  ? 0.5195 0.5075 0.5322 0.1633  0.0462  0.0363  60  GLU B CG  
1631 C CD  . GLU C 62  ? 0.6571 0.6262 0.6509 0.1949  0.0418  0.0307  60  GLU B CD  
1632 O OE1 . GLU C 62  ? 0.7476 0.6858 0.7127 0.2112  0.0422  0.0207  60  GLU B OE1 
1633 O OE2 . GLU C 62  ? 0.7221 0.7048 0.7267 0.2049  0.0370  0.0360  60  GLU B OE2 
1634 N N   . TRP C 63  ? 0.4955 0.4033 0.4627 0.1081  0.0384  0.0318  61  TRP B N   
1635 C CA  . TRP C 63  ? 0.4994 0.3715 0.4479 0.0901  0.0295  0.0340  61  TRP B CA  
1636 C C   . TRP C 63  ? 0.4573 0.3552 0.4254 0.0668  0.0309  0.0408  61  TRP B C   
1637 O O   . TRP C 63  ? 0.4492 0.3376 0.4143 0.0526  0.0262  0.0457  61  TRP B O   
1638 C CB  . TRP C 63  ? 0.5315 0.3561 0.4400 0.0868  0.0235  0.0257  61  TRP B CB  
1639 C CG  . TRP C 63  ? 0.5700 0.3580 0.4537 0.0605  0.0137  0.0285  61  TRP B CG  
1640 C CD1 . TRP C 63  ? 0.6141 0.3880 0.4778 0.0379  0.0093  0.0257  61  TRP B CD1 
1641 C CD2 . TRP C 63  ? 0.5669 0.3269 0.4380 0.0527  0.0064  0.0349  61  TRP B CD2 
1642 N NE1 . TRP C 63  ? 0.6121 0.3564 0.4543 0.0138  0.0006  0.0304  61  TRP B NE1 
1643 C CE2 . TRP C 63  ? 0.5849 0.3178 0.4298 0.0226  -0.0011 0.0363  61  TRP B CE2 
1644 C CE3 . TRP C 63  ? 0.5713 0.3327 0.4522 0.0655  0.0052  0.0408  61  TRP B CE3 
1645 C CZ2 . TRP C 63  ? 0.5820 0.2864 0.4080 0.0042  -0.0087 0.0438  61  TRP B CZ2 
1646 C CZ3 . TRP C 63  ? 0.5816 0.3116 0.4428 0.0500  -0.0030 0.0477  61  TRP B CZ3 
1647 C CH2 . TRP C 63  ? 0.6286 0.3293 0.4617 0.0192  -0.0094 0.0494  61  TRP B CH2 
1648 N N   . GLU C 64  ? 0.4307 0.3617 0.4168 0.0649  0.0375  0.0414  62  GLU B N   
1649 C CA  . GLU C 64  ? 0.3889 0.3455 0.3929 0.0506  0.0392  0.0475  62  GLU B CA  
1650 C C   . GLU C 64  ? 0.3603 0.3322 0.3834 0.0526  0.0412  0.0536  62  GLU B C   
1651 O O   . GLU C 64  ? 0.3327 0.3089 0.3602 0.0420  0.0397  0.0575  62  GLU B O   
1652 C CB  . GLU C 64  ? 0.3859 0.3662 0.3980 0.0516  0.0442  0.0472  62  GLU B CB  
1653 C CG  . GLU C 64  ? 0.3550 0.3584 0.3813 0.0437  0.0455  0.0528  62  GLU B CG  
1654 C CD  . GLU C 64  ? 0.3502 0.3695 0.3769 0.0457  0.0479  0.0531  62  GLU B CD  
1655 O OE1 . GLU C 64  ? 0.3819 0.4113 0.4055 0.0382  0.0445  0.0532  62  GLU B OE1 
1656 O OE2 . GLU C 64  ? 0.3574 0.3814 0.3859 0.0540  0.0528  0.0535  62  GLU B OE2 
1657 N N   . ALA C 65  ? 0.3649 0.3485 0.3984 0.0652  0.0448  0.0541  63  ALA B N   
1658 C CA  . ALA C 65  ? 0.3528 0.3505 0.4015 0.0653  0.0452  0.0594  63  ALA B CA  
1659 C C   . ALA C 65  ? 0.3699 0.3492 0.4113 0.0645  0.0386  0.0613  63  ALA B C   
1660 O O   . ALA C 65  ? 0.3945 0.3796 0.4427 0.0569  0.0374  0.0657  63  ALA B O   
1661 C CB  . ALA C 65  ? 0.3391 0.3605 0.4000 0.0757  0.0496  0.0601  63  ALA B CB  
1662 N N   . ILE C 66  ? 0.3789 0.3325 0.4025 0.0737  0.0338  0.0579  64  ILE B N   
1663 C CA  . ILE C 66  ? 0.4050 0.3321 0.4141 0.0744  0.0259  0.0607  64  ILE B CA  
1664 C C   . ILE C 66  ? 0.4140 0.3256 0.4117 0.0528  0.0226  0.0639  64  ILE B C   
1665 O O   . ILE C 66  ? 0.4116 0.3220 0.4095 0.0462  0.0196  0.0693  64  ILE B O   
1666 C CB  . ILE C 66  ? 0.4554 0.3476 0.4390 0.0920  0.0206  0.0557  64  ILE B CB  
1667 C CG1 . ILE C 66  ? 0.4754 0.3939 0.4730 0.1174  0.0240  0.0534  64  ILE B CG1 
1668 C CG2 . ILE C 66  ? 0.4832 0.3347 0.4416 0.0898  0.0105  0.0598  64  ILE B CG2 
1669 C CD1 . ILE C 66  ? 0.4899 0.4311 0.5038 0.1244  0.0207  0.0600  64  ILE B CD1 
1670 N N   . GLN C 67  ? 0.4080 0.3136 0.3963 0.0408  0.0234  0.0610  65  GLN B N   
1671 C CA  . GLN C 67  ? 0.4114 0.3183 0.3938 0.0186  0.0219  0.0644  65  GLN B CA  
1672 C C   . GLN C 67  ? 0.3787 0.3218 0.3843 0.0146  0.0277  0.0679  65  GLN B C   
1673 O O   . GLN C 67  ? 0.4038 0.3504 0.4065 0.0029  0.0268  0.0720  65  GLN B O   
1674 C CB  . GLN C 67  ? 0.4288 0.3339 0.4005 0.0067  0.0212  0.0605  65  GLN B CB  
1675 C CG  . GLN C 67  ? 0.4372 0.2937 0.3731 0.0021  0.0131  0.0571  65  GLN B CG  
1676 C CD  . GLN C 67  ? 0.4966 0.3531 0.4200 -0.0137 0.0112  0.0531  65  GLN B CD  
1677 O OE1 . GLN C 67  ? 0.5899 0.4355 0.4947 -0.0389 0.0054  0.0557  65  GLN B OE1 
1678 N NE2 . GLN C 67  ? 0.4390 0.3092 0.3707 -0.0011 0.0154  0.0472  65  GLN B NE2 
1679 N N   . ALA C 68  ? 0.3565 0.3230 0.3806 0.0244  0.0336  0.0661  66  ALA B N   
1680 C CA  . ALA C 68  ? 0.3398 0.3296 0.3785 0.0238  0.0382  0.0683  66  ALA B CA  
1681 C C   . ALA C 68  ? 0.3272 0.3127 0.3670 0.0243  0.0363  0.0716  66  ALA B C   
1682 O O   . ALA C 68  ? 0.3380 0.3311 0.3773 0.0179  0.0375  0.0734  66  ALA B O   
1683 C CB  . ALA C 68  ? 0.3080 0.3118 0.3582 0.0331  0.0431  0.0669  66  ALA B CB  
1684 N N   . LEU C 69  ? 0.3405 0.3175 0.3810 0.0332  0.0331  0.0722  67  LEU B N   
1685 C CA  . LEU C 69  ? 0.3370 0.3120 0.3775 0.0338  0.0290  0.0760  67  LEU B CA  
1686 C C   . LEU C 69  ? 0.3701 0.3251 0.3928 0.0249  0.0235  0.0795  67  LEU B C   
1687 O O   . LEU C 69  ? 0.3649 0.3220 0.3853 0.0197  0.0217  0.0829  67  LEU B O   
1688 C CB  . LEU C 69  ? 0.3574 0.3365 0.4043 0.0477  0.0262  0.0763  67  LEU B CB  
1689 C CG  . LEU C 69  ? 0.3240 0.3299 0.3885 0.0513  0.0310  0.0757  67  LEU B CG  
1690 C CD1 . LEU C 69  ? 0.3164 0.3355 0.3877 0.0669  0.0289  0.0758  67  LEU B CD1 
1691 C CD2 . LEU C 69  ? 0.2637 0.2796 0.3331 0.0410  0.0308  0.0786  67  LEU B CD2 
1692 N N   . THR C 70  ? 0.3789 0.3120 0.3851 0.0205  0.0205  0.0790  68  THR B N   
1693 C CA  . THR C 70  ? 0.4224 0.3356 0.4072 0.0050  0.0159  0.0836  68  THR B CA  
1694 C C   . THR C 70  ? 0.4177 0.3566 0.4075 -0.0109 0.0218  0.0847  68  THR B C   
1695 O O   . THR C 70  ? 0.4288 0.3677 0.4097 -0.0207 0.0207  0.0892  68  THR B O   
1696 C CB  . THR C 70  ? 0.4734 0.3501 0.4321 -0.0005 0.0099  0.0830  68  THR B CB  
1697 O OG1 . THR C 70  ? 0.5257 0.3770 0.4760 0.0202  0.0046  0.0811  68  THR B OG1 
1698 C CG2 . THR C 70  ? 0.4816 0.3337 0.4129 -0.0216 0.0041  0.0899  68  THR B CG2 
1699 N N   . VAL C 71  ? 0.3411 0.3045 0.3442 -0.0112 0.0280  0.0806  69  VAL B N   
1700 C CA  . VAL C 71  ? 0.3379 0.3330 0.3484 -0.0182 0.0344  0.0805  69  VAL B CA  
1701 C C   . VAL C 71  ? 0.3398 0.3419 0.3560 -0.0104 0.0372  0.0804  69  VAL B C   
1702 O O   . VAL C 71  ? 0.3497 0.3623 0.3595 -0.0178 0.0394  0.0821  69  VAL B O   
1703 C CB  . VAL C 71  ? 0.3259 0.3470 0.3505 -0.0124 0.0397  0.0762  69  VAL B CB  
1704 C CG1 . VAL C 71  ? 0.2630 0.3191 0.2941 -0.0129 0.0462  0.0756  69  VAL B CG1 
1705 C CG2 . VAL C 71  ? 0.3548 0.3711 0.3715 -0.0231 0.0361  0.0758  69  VAL B CG2 
1706 N N   . LEU C 72  ? 0.3253 0.3224 0.3511 0.0026  0.0370  0.0782  70  LEU B N   
1707 C CA  . LEU C 72  ? 0.3244 0.3234 0.3515 0.0067  0.0378  0.0776  70  LEU B CA  
1708 C C   . LEU C 72  ? 0.3454 0.3337 0.3602 -0.0003 0.0326  0.0819  70  LEU B C   
1709 O O   . LEU C 72  ? 0.3599 0.3543 0.3673 -0.0043 0.0350  0.0814  70  LEU B O   
1710 C CB  . LEU C 72  ? 0.3060 0.3026 0.3432 0.0156  0.0370  0.0763  70  LEU B CB  
1711 C CG  . LEU C 72  ? 0.3034 0.2980 0.3380 0.0146  0.0354  0.0762  70  LEU B CG  
1712 C CD1 . LEU C 72  ? 0.2719 0.2667 0.2972 0.0153  0.0406  0.0721  70  LEU B CD1 
1713 C CD2 . LEU C 72  ? 0.2524 0.2501 0.2969 0.0176  0.0337  0.0768  70  LEU B CD2 
1714 N N   . GLU C 73  ? 0.3514 0.3220 0.3606 -0.0002 0.0252  0.0860  71  GLU B N   
1715 C CA  . GLU C 73  ? 0.3634 0.3194 0.3570 -0.0055 0.0183  0.0919  71  GLU B CA  
1716 C C   . GLU C 73  ? 0.4006 0.3584 0.3784 -0.0214 0.0209  0.0948  71  GLU B C   
1717 O O   . GLU C 73  ? 0.4047 0.3648 0.3726 -0.0269 0.0203  0.0971  71  GLU B O   
1718 C CB  . GLU C 73  ? 0.3736 0.3041 0.3578 0.0010  0.0095  0.0958  71  GLU B CB  
1719 C CG  . GLU C 73  ? 0.4025 0.3130 0.3667 -0.0017 0.0002  0.1033  71  GLU B CG  
1720 C CD  . GLU C 73  ? 0.4939 0.3749 0.4454 0.0121  -0.0097 0.1067  71  GLU B CD  
1721 O OE1 . GLU C 73  ? 0.4515 0.3240 0.4057 0.0213  -0.0085 0.1024  71  GLU B OE1 
1722 O OE2 . GLU C 73  ? 0.5916 0.4561 0.5271 0.0155  -0.0190 0.1134  71  GLU B OE2 
1723 N N   . THR C 74  ? 0.3839 0.3430 0.3578 -0.0306 0.0234  0.0950  72  THR B N   
1724 C CA  . THR C 74  ? 0.4053 0.3736 0.3646 -0.0500 0.0260  0.0991  72  THR B CA  
1725 C C   . THR C 74  ? 0.3794 0.3836 0.3462 -0.0495 0.0357  0.0953  72  THR B C   
1726 O O   . THR C 74  ? 0.3902 0.3999 0.3429 -0.0595 0.0369  0.0988  72  THR B O   
1727 C CB  . THR C 74  ? 0.4297 0.3995 0.3855 -0.0626 0.0263  0.0995  72  THR B CB  
1728 O OG1 . THR C 74  ? 0.4462 0.3727 0.3862 -0.0616 0.0166  0.1019  72  THR B OG1 
1729 C CG2 . THR C 74  ? 0.4635 0.4512 0.4046 -0.0880 0.0289  0.1053  72  THR B CG2 
1730 N N   . CYS C 75  ? 0.3583 0.3838 0.3434 -0.0360 0.0423  0.0880  73  CYS B N   
1731 C CA  . CYS C 75  ? 0.3527 0.4069 0.3401 -0.0295 0.0513  0.0828  73  CYS B CA  
1732 C C   . CYS C 75  ? 0.3361 0.3763 0.3131 -0.0242 0.0501  0.0809  73  CYS B C   
1733 O O   . CYS C 75  ? 0.3569 0.4128 0.3237 -0.0247 0.0559  0.0786  73  CYS B O   
1734 C CB  . CYS C 75  ? 0.3475 0.4183 0.3508 -0.0130 0.0567  0.0759  73  CYS B CB  
1735 S SG  . CYS C 75  ? 0.3620 0.4562 0.3779 -0.0184 0.0575  0.0771  73  CYS B SG  
1736 N N   . MET C 76  ? 0.3168 0.3313 0.2956 -0.0193 0.0425  0.0817  74  MET B N   
1737 C CA  . MET C 76  ? 0.3386 0.3412 0.3066 -0.0182 0.0389  0.0808  74  MET B CA  
1738 C C   . MET C 76  ? 0.3609 0.3578 0.3103 -0.0312 0.0346  0.0877  74  MET B C   
1739 O O   . MET C 76  ? 0.3655 0.3601 0.3005 -0.0330 0.0340  0.0863  74  MET B O   
1740 C CB  . MET C 76  ? 0.3298 0.3169 0.3070 -0.0126 0.0312  0.0812  74  MET B CB  
1741 C CG  . MET C 76  ? 0.3478 0.3351 0.3344 -0.0031 0.0349  0.0748  74  MET B CG  
1742 S SD  . MET C 76  ? 0.3907 0.3697 0.3577 0.0002  0.0389  0.0665  74  MET B SD  
1743 C CE  . MET C 76  ? 0.4635 0.4286 0.4211 -0.0100 0.0278  0.0692  74  MET B CE  
1744 N N   . LYS C 77  ? 0.4041 0.3938 0.3491 -0.0413 0.0307  0.0954  75  LYS B N   
1745 C CA  . LYS C 77  ? 0.4656 0.4449 0.3874 -0.0558 0.0261  0.1038  75  LYS B CA  
1746 C C   . LYS C 77  ? 0.4728 0.4793 0.3833 -0.0680 0.0361  0.1036  75  LYS B C   
1747 O O   . LYS C 77  ? 0.5159 0.5181 0.4043 -0.0810 0.0341  0.1100  75  LYS B O   
1748 C CB  . LYS C 77  ? 0.5081 0.4592 0.4198 -0.0630 0.0168  0.1128  75  LYS B CB  
1749 C CG  . LYS C 77  ? 0.5698 0.4949 0.4827 -0.0494 0.0049  0.1155  75  LYS B CG  
1750 C CD  . LYS C 77  ? 0.6784 0.5725 0.5820 -0.0484 -0.0026 0.1205  75  LYS B CD  
1751 C CE  . LYS C 77  ? 0.7437 0.6082 0.6335 -0.0369 -0.0163 0.1273  75  LYS B CE  
1752 N NZ  . LYS C 77  ? 0.8275 0.6535 0.7014 -0.0317 -0.0236 0.1304  75  LYS B NZ  
1753 N N   . SER C 78  ? 0.4581 0.4958 0.3829 -0.0632 0.0467  0.0968  76  SER B N   
1754 C CA  . SER C 78  ? 0.4972 0.5738 0.4153 -0.0691 0.0582  0.0948  76  SER B CA  
1755 C C   . SER C 78  ? 0.4924 0.5716 0.4011 -0.0552 0.0629  0.0862  76  SER B C   
1756 O O   . SER C 78  ? 0.4954 0.5536 0.4089 -0.0401 0.0594  0.0797  76  SER B O   
1757 C CB  . SER C 78  ? 0.4939 0.6080 0.4319 -0.0631 0.0669  0.0899  76  SER B CB  
1758 O OG  . SER C 78  ? 0.5547 0.6617 0.4988 -0.0766 0.0613  0.0962  76  SER B OG  
1759 N N   . CYS C 79  ? 0.5184 0.6247 0.4117 -0.0605 0.0716  0.0852  77  CYS B N   
1760 C CA  . CYS C 79  ? 0.5491 0.6469 0.4238 -0.0498 0.0739  0.0773  77  CYS B CA  
1761 C C   . CYS C 79  ? 0.5572 0.6685 0.4337 -0.0240 0.0839  0.0625  77  CYS B C   
1762 O O   . CYS C 79  ? 0.5871 0.6845 0.4418 -0.0144 0.0857  0.0540  77  CYS B O   
1763 C CB  . CYS C 79  ? 0.5918 0.7032 0.4411 -0.0669 0.0770  0.0831  77  CYS B CB  
1764 S SG  . CYS C 79  ? 0.6300 0.8060 0.4829 -0.0758 0.0928  0.0847  77  CYS B SG  
1765 N N   . GLY C 80  ? 0.4904 0.6202 0.3887 -0.0117 0.0883  0.0593  78  GLY B N   
1766 C CA  . GLY C 80  ? 0.4851 0.6230 0.3824 0.0167  0.0964  0.0464  78  GLY B CA  
1767 C C   . GLY C 80  ? 0.4865 0.5732 0.3707 0.0308  0.0900  0.0382  78  GLY B C   
1768 O O   . GLY C 80  ? 0.4668 0.5256 0.3632 0.0269  0.0808  0.0418  78  GLY B O   
1769 N N   . LYS C 81  ? 0.5472 0.6222 0.4037 0.0467  0.0951  0.0269  79  LYS B N   
1770 C CA  . LYS C 81  ? 0.5796 0.6002 0.4132 0.0557  0.0884  0.0184  79  LYS B CA  
1771 C C   . LYS C 81  ? 0.5731 0.5723 0.4147 0.0724  0.0865  0.0150  79  LYS B C   
1772 O O   . LYS C 81  ? 0.5692 0.5274 0.4072 0.0651  0.0766  0.0162  79  LYS B O   
1773 C CB  . LYS C 81  ? 0.6497 0.6599 0.4445 0.0712  0.0953  0.0052  79  LYS B CB  
1774 C CG  . LYS C 81  ? 0.7471 0.6933 0.5073 0.0748  0.0869  -0.0041 79  LYS B CG  
1775 C CD  . LYS C 81  ? 0.8724 0.8063 0.5886 0.0878  0.0935  -0.0176 79  LYS B CD  
1776 C CE  . LYS C 81  ? 0.9575 0.8299 0.6365 0.0748  0.0813  -0.0232 79  LYS B CE  
1777 N NZ  . LYS C 81  ? 0.9714 0.7890 0.6379 0.0797  0.0728  -0.0273 79  LYS B NZ  
1778 N N   . ARG C 82  ? 0.5496 0.5778 0.3987 0.0951  0.0957  0.0108  80  ARG B N   
1779 C CA  . ARG C 82  ? 0.5775 0.5831 0.4283 0.1140  0.0937  0.0078  80  ARG B CA  
1780 C C   . ARG C 82  ? 0.5285 0.5218 0.4051 0.0958  0.0843  0.0182  80  ARG B C   
1781 O O   . ARG C 82  ? 0.5437 0.4929 0.4099 0.0961  0.0774  0.0173  80  ARG B O   
1782 C CB  . ARG C 82  ? 0.5924 0.6441 0.4533 0.1414  0.1041  0.0041  80  ARG B CB  
1783 C CG  . ARG C 82  ? 0.7013 0.7565 0.5301 0.1713  0.1137  -0.0094 80  ARG B CG  
1784 C CD  . ARG C 82  ? 0.8113 0.9057 0.6480 0.2064  0.1216  -0.0138 80  ARG B CD  
1785 N NE  . ARG C 82  ? 0.8565 1.0328 0.7335 0.1959  0.1276  -0.0050 80  ARG B NE  
1786 C CZ  . ARG C 82  ? 0.9001 1.1162 0.8017 0.2095  0.1286  -0.0014 80  ARG B CZ  
1787 N NH1 . ARG C 82  ? 0.9575 1.1379 0.8473 0.2373  0.1243  -0.0055 80  ARG B NH1 
1788 N NH2 . ARG C 82  ? 0.8656 1.1561 0.8005 0.1937  0.1329  0.0068  80  ARG B NH2 
1789 N N   . PHE C 83  ? 0.4937 0.5236 0.4001 0.0783  0.0839  0.0280  81  PHE B N   
1790 C CA  . PHE C 83  ? 0.4474 0.4665 0.3755 0.0637  0.0757  0.0365  81  PHE B CA  
1791 C C   . PHE C 83  ? 0.4351 0.4174 0.3552 0.0472  0.0659  0.0392  81  PHE B C   
1792 O O   . PHE C 83  ? 0.4393 0.4011 0.3664 0.0435  0.0598  0.0420  81  PHE B O   
1793 C CB  . PHE C 83  ? 0.4216 0.4792 0.3755 0.0494  0.0765  0.0452  81  PHE B CB  
1794 C CG  . PHE C 83  ? 0.3771 0.4240 0.3503 0.0408  0.0695  0.0517  81  PHE B CG  
1795 C CD1 . PHE C 83  ? 0.3960 0.4411 0.3779 0.0533  0.0700  0.0503  81  PHE B CD1 
1796 C CD2 . PHE C 83  ? 0.4043 0.4410 0.3834 0.0229  0.0623  0.0588  81  PHE B CD2 
1797 C CE1 . PHE C 83  ? 0.3708 0.4079 0.3680 0.0461  0.0647  0.0554  81  PHE B CE1 
1798 C CE2 . PHE C 83  ? 0.3684 0.3967 0.3628 0.0191  0.0570  0.0632  81  PHE B CE2 
1799 C CZ  . PHE C 83  ? 0.3667 0.3965 0.3704 0.0297  0.0588  0.0612  81  PHE B CZ  
1800 N N   . HIS C 84  ? 0.4242 0.4049 0.3313 0.0359  0.0640  0.0396  82  HIS B N   
1801 C CA  . HIS C 84  ? 0.4257 0.3787 0.3239 0.0210  0.0536  0.0420  82  HIS B CA  
1802 C C   . HIS C 84  ? 0.4614 0.3748 0.3382 0.0259  0.0501  0.0351  82  HIS B C   
1803 O O   . HIS C 84  ? 0.4437 0.3413 0.3260 0.0142  0.0417  0.0392  82  HIS B O   
1804 C CB  . HIS C 84  ? 0.4538 0.4099 0.3336 0.0112  0.0524  0.0421  82  HIS B CB  
1805 C CG  . HIS C 84  ? 0.3906 0.3733 0.2848 -0.0007 0.0519  0.0521  82  HIS B CG  
1806 N ND1 . HIS C 84  ? 0.3970 0.3906 0.2746 -0.0087 0.0539  0.0537  82  HIS B ND1 
1807 C CD2 . HIS C 84  ? 0.3351 0.3299 0.2530 -0.0066 0.0492  0.0609  82  HIS B CD2 
1808 C CE1 . HIS C 84  ? 0.4406 0.4492 0.3298 -0.0207 0.0517  0.0643  82  HIS B CE1 
1809 N NE2 . HIS C 84  ? 0.3628 0.3698 0.2753 -0.0190 0.0485  0.0682  82  HIS B NE2 
1810 N N   . ASP C 85  ? 0.4872 0.3853 0.3379 0.0437  0.0566  0.0248  83  ASP B N   
1811 C CA  . ASP C 85  ? 0.5466 0.3945 0.3654 0.0493  0.0528  0.0174  83  ASP B CA  
1812 C C   . ASP C 85  ? 0.5552 0.3910 0.3867 0.0519  0.0505  0.0218  83  ASP B C   
1813 O O   . ASP C 85  ? 0.5685 0.3665 0.3834 0.0405  0.0429  0.0223  83  ASP B O   
1814 C CB  . ASP C 85  ? 0.5908 0.4226 0.3749 0.0750  0.0611  0.0045  83  ASP B CB  
1815 C CG  . ASP C 85  ? 0.6401 0.4669 0.3967 0.0709  0.0620  -0.0024 83  ASP B CG  
1816 O OD1 . ASP C 85  ? 0.7282 0.5456 0.4546 0.0939  0.0698  -0.0141 83  ASP B OD1 
1817 O OD2 . ASP C 85  ? 0.6330 0.4653 0.3957 0.0469  0.0547  0.0036  83  ASP B OD2 
1818 N N   . GLU C 86  ? 0.5765 0.4444 0.4337 0.0654  0.0570  0.0249  84  GLU B N   
1819 C CA  . GLU C 86  ? 0.5792 0.4372 0.4458 0.0701  0.0555  0.0289  84  GLU B CA  
1820 C C   . GLU C 86  ? 0.5439 0.4081 0.4341 0.0471  0.0485  0.0384  84  GLU B C   
1821 O O   . GLU C 86  ? 0.5619 0.4025 0.4465 0.0413  0.0444  0.0413  84  GLU B O   
1822 C CB  . GLU C 86  ? 0.5503 0.4470 0.4389 0.0889  0.0630  0.0299  84  GLU B CB  
1823 C CG  . GLU C 86  ? 0.6344 0.5262 0.4997 0.1188  0.0696  0.0208  84  GLU B CG  
1824 C CD  . GLU C 86  ? 0.6391 0.4704 0.4676 0.1314  0.0651  0.0167  84  GLU B CD  
1825 O OE1 . GLU C 86  ? 0.6147 0.4270 0.4482 0.1210  0.0596  0.0236  84  GLU B OE1 
1826 O OE2 . GLU C 86  ? 0.7762 0.5760 0.5669 0.1511  0.0671  0.0067  84  GLU B OE2 
1827 N N   . VAL C 87  ? 0.4915 0.3880 0.4059 0.0352  0.0474  0.0435  85  VAL B N   
1828 C CA  . VAL C 87  ? 0.4596 0.3668 0.3957 0.0184  0.0409  0.0516  85  VAL B CA  
1829 C C   . VAL C 87  ? 0.4877 0.3726 0.4075 0.0011  0.0323  0.0521  85  VAL B C   
1830 O O   . VAL C 87  ? 0.4636 0.3533 0.3954 -0.0111 0.0272  0.0578  85  VAL B O   
1831 C CB  . VAL C 87  ? 0.4251 0.3645 0.3838 0.0140  0.0407  0.0568  85  VAL B CB  
1832 C CG1 . VAL C 87  ? 0.4005 0.3480 0.3746 0.0012  0.0326  0.0637  85  VAL B CG1 
1833 C CG2 . VAL C 87  ? 0.3837 0.3455 0.3605 0.0235  0.0468  0.0582  85  VAL B CG2 
1834 N N   . GLY C 88  ? 0.4723 0.3346 0.3625 -0.0002 0.0309  0.0455  86  GLY B N   
1835 C CA  . GLY C 88  ? 0.5081 0.3468 0.3768 -0.0196 0.0214  0.0449  86  GLY B CA  
1836 C C   . GLY C 88  ? 0.5535 0.3434 0.3877 -0.0231 0.0189  0.0404  86  GLY B C   
1837 O O   . GLY C 88  ? 0.6231 0.3796 0.4238 -0.0373 0.0119  0.0362  86  GLY B O   
1838 N N   . LYS C 89  ? 0.5679 0.3492 0.4058 -0.0115 0.0236  0.0418  87  LYS B N   
1839 C CA  . LYS C 89  ? 0.5997 0.3304 0.4036 -0.0173 0.0198  0.0408  87  LYS B CA  
1840 C C   . LYS C 89  ? 0.5750 0.3247 0.4028 -0.0349 0.0169  0.0516  87  LYS B C   
1841 O O   . LYS C 89  ? 0.5101 0.3051 0.3778 -0.0289 0.0213  0.0571  87  LYS B O   
1842 C CB  . LYS C 89  ? 0.6100 0.3135 0.3939 0.0126  0.0268  0.0348  87  LYS B CB  
1843 C CG  . LYS C 89  ? 0.6834 0.3708 0.4401 0.0342  0.0313  0.0229  87  LYS B CG  
1844 C CD  . LYS C 89  ? 0.7159 0.3878 0.4571 0.0687  0.0383  0.0173  87  LYS B CD  
1845 C CE  . LYS C 89  ? 0.8250 0.4702 0.5269 0.0915  0.0421  0.0038  87  LYS B CE  
1846 N NZ  . LYS C 89  ? 0.9199 0.5685 0.6152 0.1309  0.0498  -0.0012 87  LYS B NZ  
1847 N N   . PHE C 90  ? 0.5923 0.3068 0.3923 -0.0579 0.0095  0.0545  88  PHE B N   
1848 C CA  . PHE C 90  ? 0.5967 0.3315 0.4154 -0.0763 0.0078  0.0651  88  PHE B CA  
1849 C C   . PHE C 90  ? 0.5682 0.3050 0.3978 -0.0563 0.0155  0.0679  88  PHE B C   
1850 O O   . PHE C 90  ? 0.5561 0.3285 0.4142 -0.0633 0.0176  0.0759  88  PHE B O   
1851 C CB  . PHE C 90  ? 0.6555 0.3478 0.4349 -0.1091 -0.0018 0.0684  88  PHE B CB  
1852 C CG  . PHE C 90  ? 0.6943 0.3943 0.4666 -0.1340 -0.0110 0.0671  88  PHE B CG  
1853 C CD1 . PHE C 90  ? 0.6134 0.3818 0.4312 -0.1394 -0.0122 0.0716  88  PHE B CD1 
1854 C CD2 . PHE C 90  ? 0.7563 0.3923 0.4731 -0.1479 -0.0191 0.0602  88  PHE B CD2 
1855 C CE1 . PHE C 90  ? 0.7088 0.4886 0.5203 -0.1610 -0.0221 0.0712  88  PHE B CE1 
1856 C CE2 . PHE C 90  ? 0.7999 0.4446 0.5086 -0.1723 -0.0288 0.0587  88  PHE B CE2 
1857 C CZ  . PHE C 90  ? 0.7040 0.4239 0.4619 -0.1785 -0.0304 0.0645  88  PHE B CZ  
1858 N N   . ARG C 91  ? 0.6817 0.3839 0.4880 -0.0299 0.0195  0.0611  89  ARG B N   
1859 C CA  . ARG C 91  ? 0.6692 0.3767 0.4851 -0.0077 0.0256  0.0634  89  ARG B CA  
1860 C C   . ARG C 91  ? 0.5868 0.3606 0.4556 -0.0012 0.0316  0.0668  89  ARG B C   
1861 O O   . ARG C 91  ? 0.5529 0.3436 0.4377 0.0016  0.0345  0.0725  89  ARG B O   
1862 C CB  . ARG C 91  ? 0.7021 0.3784 0.4914 0.0248  0.0290  0.0543  89  ARG B CB  
1863 C CG  . ARG C 91  ? 0.7437 0.4139 0.5308 0.0467  0.0322  0.0575  89  ARG B CG  
1864 C CD  . ARG C 91  ? 0.8681 0.5148 0.6294 0.0827  0.0351  0.0484  89  ARG B CD  
1865 N NE  . ARG C 91  ? 0.9785 0.5461 0.6786 0.0855  0.0289  0.0435  89  ARG B NE  
1866 C CZ  . ARG C 91  ? 1.0451 0.5852 0.7161 0.0949  0.0286  0.0325  89  ARG B CZ  
1867 N NH1 . ARG C 91  ? 1.0268 0.6173 0.7267 0.1011  0.0347  0.0265  89  ARG B NH1 
1868 N NH2 . ARG C 91  ? 1.1265 0.5849 0.7347 0.0974  0.0219  0.0274  89  ARG B NH2 
1869 N N   . PHE C 92  ? 0.4947 0.3006 0.3851 0.0008  0.0328  0.0634  90  PHE B N   
1870 C CA  . PHE C 92  ? 0.4538 0.3119 0.3861 0.0036  0.0363  0.0666  90  PHE B CA  
1871 C C   . PHE C 92  ? 0.4438 0.3293 0.3964 -0.0172 0.0319  0.0726  90  PHE B C   
1872 O O   . PHE C 92  ? 0.4395 0.3550 0.4169 -0.0176 0.0340  0.0774  90  PHE B O   
1873 C CB  . PHE C 92  ? 0.4174 0.2944 0.3594 0.0168  0.0397  0.0614  90  PHE B CB  
1874 C CG  . PHE C 92  ? 0.3755 0.2937 0.3513 0.0178  0.0416  0.0648  90  PHE B CG  
1875 C CD1 . PHE C 92  ? 0.3134 0.2479 0.3047 0.0275  0.0457  0.0665  90  PHE B CD1 
1876 C CD2 . PHE C 92  ? 0.3399 0.2757 0.3278 0.0086  0.0379  0.0667  90  PHE B CD2 
1877 C CE1 . PHE C 92  ? 0.2932 0.2556 0.3076 0.0274  0.0464  0.0686  90  PHE B CE1 
1878 C CE2 . PHE C 92  ? 0.3325 0.2949 0.3436 0.0109  0.0383  0.0698  90  PHE B CE2 
1879 C CZ  . PHE C 92  ? 0.3182 0.2912 0.3411 0.0197  0.0426  0.0703  90  PHE B CZ  
1880 N N   . LEU C 93  ? 0.4064 0.2853 0.3480 -0.0322 0.0256  0.0718  91  LEU B N   
1881 C CA  . LEU C 93  ? 0.4277 0.3410 0.3895 -0.0498 0.0201  0.0776  91  LEU B CA  
1882 C C   . LEU C 93  ? 0.4467 0.3751 0.4171 -0.0631 0.0204  0.0848  91  LEU B C   
1883 O O   . LEU C 93  ? 0.4487 0.4224 0.4476 -0.0672 0.0198  0.0898  91  LEU B O   
1884 C CB  . LEU C 93  ? 0.4691 0.3657 0.4084 -0.0685 0.0115  0.0759  91  LEU B CB  
1885 C CG  . LEU C 93  ? 0.5174 0.4306 0.4623 -0.0687 0.0066  0.0741  91  LEU B CG  
1886 C CD1 . LEU C 93  ? 0.4012 0.3395 0.3706 -0.0478 0.0115  0.0739  91  LEU B CD1 
1887 C CD2 . LEU C 93  ? 0.4821 0.3515 0.3870 -0.0742 0.0030  0.0666  91  LEU B CD2 
1888 N N   . ASN C 94  ? 0.5003 0.3899 0.4424 -0.0701 0.0208  0.0857  92  ASN B N   
1889 C CA  . ASN C 94  ? 0.5315 0.4310 0.4750 -0.0863 0.0216  0.0937  92  ASN B CA  
1890 C C   . ASN C 94  ? 0.5031 0.4403 0.4779 -0.0702 0.0294  0.0961  92  ASN B C   
1891 O O   . ASN C 94  ? 0.5389 0.5086 0.5281 -0.0815 0.0313  0.1026  92  ASN B O   
1892 C CB  . ASN C 94  ? 0.5701 0.4082 0.4690 -0.0941 0.0199  0.0946  92  ASN B CB  
1893 C CG  . ASN C 94  ? 0.6304 0.4324 0.4932 -0.1232 0.0104  0.0953  92  ASN B CG  
1894 O OD1 . ASN C 94  ? 0.6016 0.4312 0.4763 -0.1381 0.0050  0.0951  92  ASN B OD1 
1895 N ND2 . ASN C 94  ? 0.6431 0.3792 0.4576 -0.1312 0.0070  0.0959  92  ASN B ND2 
1896 N N   . GLU C 95  ? 0.4902 0.4240 0.4729 -0.0450 0.0340  0.0906  93  GLU B N   
1897 C CA  . GLU C 95  ? 0.4548 0.4141 0.4592 -0.0300 0.0403  0.0913  93  GLU B CA  
1898 C C   . GLU C 95  ? 0.4222 0.4266 0.4581 -0.0252 0.0406  0.0912  93  GLU B C   
1899 O O   . GLU C 95  ? 0.4023 0.4350 0.4553 -0.0198 0.0446  0.0929  93  GLU B O   
1900 C CB  . GLU C 95  ? 0.4242 0.3648 0.4227 -0.0082 0.0436  0.0859  93  GLU B CB  
1901 C CG  . GLU C 95  ? 0.4671 0.3618 0.4320 -0.0046 0.0427  0.0851  93  GLU B CG  
1902 C CD  . GLU C 95  ? 0.5477 0.4284 0.4986 -0.0111 0.0436  0.0918  93  GLU B CD  
1903 O OE1 . GLU C 95  ? 0.6193 0.4550 0.5351 -0.0191 0.0398  0.0942  93  GLU B OE1 
1904 O OE2 . GLU C 95  ? 0.5095 0.4206 0.4802 -0.0092 0.0476  0.0948  93  GLU B OE2 
1905 N N   . LEU C 96  ? 0.3785 0.3865 0.4178 -0.0258 0.0358  0.0889  94  LEU B N   
1906 C CA  . LEU C 96  ? 0.3412 0.3861 0.4041 -0.0211 0.0334  0.0900  94  LEU B CA  
1907 C C   . LEU C 96  ? 0.3590 0.4403 0.4336 -0.0358 0.0312  0.0961  94  LEU B C   
1908 O O   . LEU C 96  ? 0.3371 0.4566 0.4330 -0.0264 0.0333  0.0976  94  LEU B O   
1909 C CB  . LEU C 96  ? 0.3344 0.3714 0.3935 -0.0193 0.0277  0.0876  94  LEU B CB  
1910 C CG  . LEU C 96  ? 0.3124 0.3254 0.3625 -0.0068 0.0303  0.0825  94  LEU B CG  
1911 C CD1 . LEU C 96  ? 0.3020 0.3139 0.3484 -0.0080 0.0245  0.0820  94  LEU B CD1 
1912 C CD2 . LEU C 96  ? 0.3232 0.3447 0.3856 0.0080  0.0349  0.0814  94  LEU B CD2 
1913 N N   . ILE C 97  ? 0.3660 0.4358 0.4240 -0.0593 0.0270  0.0993  95  ILE B N   
1914 C CA  . ILE C 97  ? 0.3965 0.5070 0.4644 -0.0802 0.0243  0.1063  95  ILE B CA  
1915 C C   . ILE C 97  ? 0.3830 0.5208 0.4621 -0.0796 0.0324  0.1104  95  ILE B C   
1916 O O   . ILE C 97  ? 0.3620 0.5565 0.4651 -0.0799 0.0338  0.1142  95  ILE B O   
1917 C CB  . ILE C 97  ? 0.4667 0.5489 0.5056 -0.1117 0.0171  0.1092  95  ILE B CB  
1918 C CG1 . ILE C 97  ? 0.4778 0.5482 0.5088 -0.1142 0.0083  0.1054  95  ILE B CG1 
1919 C CG2 . ILE C 97  ? 0.5035 0.6294 0.5498 -0.1399 0.0155  0.1183  95  ILE B CG2 
1920 C CD1 . ILE C 97  ? 0.5638 0.5815 0.5537 -0.1380 0.0016  0.1038  95  ILE B CD1 
1921 N N   . LYS C 98  ? 0.4632 0.5641 0.5247 -0.0762 0.0379  0.1094  96  LYS B N   
1922 C CA  . LYS C 98  ? 0.4611 0.5841 0.5294 -0.0744 0.0459  0.1130  96  LYS B CA  
1923 C C   . LYS C 98  ? 0.3922 0.5583 0.4896 -0.0491 0.0510  0.1092  96  LYS B C   
1924 O O   . LYS C 98  ? 0.3811 0.5929 0.4931 -0.0498 0.0564  0.1124  96  LYS B O   
1925 C CB  . LYS C 98  ? 0.4876 0.5612 0.5314 -0.0687 0.0494  0.1119  96  LYS B CB  
1926 C CG  . LYS C 98  ? 0.5976 0.6178 0.6040 -0.0888 0.0443  0.1154  96  LYS B CG  
1927 C CD  . LYS C 98  ? 0.6290 0.6011 0.6125 -0.0728 0.0464  0.1131  96  LYS B CD  
1928 C CE  . LYS C 98  ? 0.7080 0.6244 0.6479 -0.0910 0.0419  0.1186  96  LYS B CE  
1929 N NZ  . LYS C 98  ? 0.7084 0.5767 0.6249 -0.0682 0.0420  0.1150  96  LYS B NZ  
1930 N N   . VAL C 99  ? 0.3784 0.5274 0.4800 -0.0269 0.0496  0.1022  97  VAL B N   
1931 C CA  . VAL C 99  ? 0.3460 0.5206 0.4656 -0.0023 0.0527  0.0977  97  VAL B CA  
1932 C C   . VAL C 99  ? 0.3430 0.5724 0.4847 0.0021  0.0505  0.1001  97  VAL B C   
1933 O O   . VAL C 99  ? 0.3277 0.5923 0.4823 0.0180  0.0559  0.0986  97  VAL B O   
1934 C CB  . VAL C 99  ? 0.3337 0.4741 0.4478 0.0151  0.0497  0.0912  97  VAL B CB  
1935 C CG1 . VAL C 99  ? 0.3054 0.4611 0.4293 0.0387  0.0510  0.0867  97  VAL B CG1 
1936 C CG2 . VAL C 99  ? 0.3054 0.4071 0.4027 0.0149  0.0527  0.0887  97  VAL B CG2 
1937 N N   . VAL C 100 ? 0.3476 0.5863 0.4923 -0.0103 0.0423  0.1034  98  VAL B N   
1938 C CA  . VAL C 100 ? 0.3356 0.6289 0.5020 -0.0026 0.0379  0.1060  98  VAL B CA  
1939 C C   . VAL C 100 ? 0.3677 0.7211 0.5478 -0.0243 0.0394  0.1137  98  VAL B C   
1940 O O   . VAL C 100 ? 0.3543 0.7704 0.5574 -0.0129 0.0390  0.1157  98  VAL B O   
1941 C CB  . VAL C 100 ? 0.3456 0.6258 0.5092 -0.0032 0.0267  0.1062  98  VAL B CB  
1942 C CG1 . VAL C 100 ? 0.3270 0.5608 0.4796 0.0189  0.0255  0.1001  98  VAL B CG1 
1943 C CG2 . VAL C 100 ? 0.3595 0.6140 0.5055 -0.0351 0.0216  0.1092  98  VAL B CG2 
1944 N N   . SER C 101 ? 0.4225 0.7575 0.5862 -0.0548 0.0412  0.1183  99  SER B N   
1945 C CA  . SER C 101 ? 0.4623 0.8467 0.6319 -0.0861 0.0405  0.1274  99  SER B CA  
1946 C C   . SER C 101 ? 0.4654 0.8930 0.6450 -0.0847 0.0524  0.1304  99  SER B C   
1947 O O   . SER C 101 ? 0.4729 0.8623 0.6365 -0.0802 0.0595  0.1282  99  SER B O   
1948 C CB  . SER C 101 ? 0.5322 0.8647 0.6698 -0.1229 0.0347  0.1315  99  SER B CB  
1949 O OG  . SER C 101 ? 0.5912 0.9623 0.7267 -0.1599 0.0342  0.1414  99  SER B OG  
1950 N N   . PRO C 102 ? 0.4451 0.9577 0.6511 -0.0880 0.0545  0.1355  100 PRO B N   
1951 C CA  . PRO C 102 ? 0.4583 1.0252 0.6750 -0.0876 0.0670  0.1387  100 PRO B CA  
1952 C C   . PRO C 102 ? 0.5108 1.0538 0.7018 -0.1282 0.0706  0.1475  100 PRO B C   
1953 O O   . PRO C 102 ? 0.5152 1.0709 0.7025 -0.1260 0.0818  0.1488  100 PRO B O   
1954 C CB  . PRO C 102 ? 0.4442 1.1135 0.6943 -0.0894 0.0656  0.1441  100 PRO B CB  
1955 C CG  . PRO C 102 ? 0.4390 1.1016 0.6982 -0.0735 0.0529  0.1407  100 PRO B CG  
1956 C CD  . PRO C 102 ? 0.4370 1.0060 0.6646 -0.0918 0.0449  0.1390  100 PRO B CD  
1957 N N   . LYS C 103 ? 0.5003 1.0040 0.6689 -0.1644 0.0606  0.1533  101 LYS B N   
1958 C CA  . LYS C 103 ? 0.5788 1.0376 0.7114 -0.2031 0.0609  0.1618  101 LYS B CA  
1959 C C   . LYS C 103 ? 0.5822 0.9664 0.6890 -0.1852 0.0662  0.1570  101 LYS B C   
1960 O O   . LYS C 103 ? 0.6379 0.9954 0.7175 -0.2072 0.0697  0.1644  101 LYS B O   
1961 C CB  . LYS C 103 ? 0.6435 1.0559 0.7489 -0.2385 0.0470  0.1656  101 LYS B CB  
1962 C CG  . LYS C 103 ? 0.6872 1.1729 0.8093 -0.2721 0.0401  0.1740  101 LYS B CG  
1963 C CD  . LYS C 103 ? 0.7736 1.2173 0.8783 -0.2879 0.0247  0.1716  101 LYS B CD  
1964 C CE  . LYS C 103 ? 0.9006 1.3208 0.9676 -0.3474 0.0156  0.1822  101 LYS B CE  
1965 N NZ  . LYS C 103 ? 0.9048 1.3390 0.9724 -0.3678 0.0003  0.1817  101 LYS B NZ  
1966 N N   . TYR C 104 ? 0.4778 0.8290 0.5912 -0.1471 0.0659  0.1456  102 TYR B N   
1967 C CA  . TYR C 104 ? 0.4779 0.7595 0.5678 -0.1303 0.0683  0.1405  102 TYR B CA  
1968 C C   . TYR C 104 ? 0.4172 0.7176 0.5261 -0.0920 0.0766  0.1318  102 TYR B C   
1969 O O   . TYR C 104 ? 0.3969 0.7359 0.5124 -0.0889 0.0860  0.1338  102 TYR B O   
1970 C CB  . TYR C 104 ? 0.4946 0.7071 0.5648 -0.1267 0.0587  0.1352  102 TYR B CB  
1971 C CG  . TYR C 104 ? 0.5684 0.7547 0.6138 -0.1629 0.0493  0.1416  102 TYR B CG  
1972 C CD1 . TYR C 104 ? 0.5609 0.7593 0.6153 -0.1690 0.0406  0.1394  102 TYR B CD1 
1973 C CD2 . TYR C 104 ? 0.6985 0.8478 0.7079 -0.1931 0.0483  0.1504  102 TYR B CD2 
1974 C CE1 . TYR C 104 ? 0.6528 0.8272 0.6808 -0.2052 0.0310  0.1446  102 TYR B CE1 
1975 C CE2 . TYR C 104 ? 0.7878 0.9064 0.7675 -0.2296 0.0384  0.1560  102 TYR B CE2 
1976 C CZ  . TYR C 104 ? 0.7645 0.8961 0.7537 -0.2359 0.0298  0.1524  102 TYR B CZ  
1977 O OH  . TYR C 104 ? 0.8147 0.9143 0.7706 -0.2749 0.0190  0.1572  102 TYR B OH  
1978 N N   . LEU C 105 ? 0.4632 0.7376 0.5784 -0.0645 0.0730  0.1222  103 LEU B N   
1979 C CA  . LEU C 105 ? 0.4341 0.7138 0.5591 -0.0313 0.0789  0.1134  103 LEU B CA  
1980 C C   . LEU C 105 ? 0.4020 0.7321 0.5534 -0.0080 0.0796  0.1084  103 LEU B C   
1981 O O   . LEU C 105 ? 0.4008 0.7308 0.5550 0.0199  0.0837  0.1005  103 LEU B O   
1982 C CB  . LEU C 105 ? 0.4066 0.6251 0.5174 -0.0160 0.0750  0.1063  103 LEU B CB  
1983 C CG  . LEU C 105 ? 0.4643 0.6309 0.5480 -0.0268 0.0742  0.1091  103 LEU B CG  
1984 C CD1 . LEU C 105 ? 0.4202 0.5422 0.4965 -0.0121 0.0692  0.1023  103 LEU B CD1 
1985 C CD2 . LEU C 105 ? 0.4281 0.5998 0.5032 -0.0235 0.0819  0.1106  103 LEU B CD2 
1986 N N   . GLY C 106 ? 0.4523 0.8223 0.6196 -0.0184 0.0744  0.1130  104 GLY B N   
1987 C CA  . GLY C 106 ? 0.4372 0.8450 0.6262 0.0078  0.0713  0.1086  104 GLY B CA  
1988 C C   . GLY C 106 ? 0.4480 0.9040 0.6503 0.0363  0.0806  0.1038  104 GLY B C   
1989 O O   . GLY C 106 ? 0.4479 0.9026 0.6547 0.0696  0.0787  0.0963  104 GLY B O   
1990 N N   . SER C 107 ? 0.4892 0.9837 0.6933 0.0241  0.0907  0.1080  105 SER B N   
1991 C CA  . SER C 107 ? 0.5128 1.0700 0.7317 0.0500  0.1007  0.1039  105 SER B CA  
1992 C C   . SER C 107 ? 0.5292 1.0474 0.7303 0.0779  0.1075  0.0930  105 SER B C   
1993 O O   . SER C 107 ? 0.5373 1.0939 0.7434 0.1063  0.1158  0.0863  105 SER B O   
1994 C CB  . SER C 107 ? 0.5329 1.1614 0.7626 0.0222  0.1093  0.1141  105 SER B CB  
1995 O OG  . SER C 107 ? 0.5821 1.2596 0.8307 -0.0006 0.1019  0.1232  105 SER B OG  
1996 N N   . ARG C 108 ? 0.5508 0.9943 0.7296 0.0706  0.1036  0.0906  106 ARG B N   
1997 C CA  . ARG C 108 ? 0.5757 0.9775 0.7350 0.0924  0.1073  0.0804  106 ARG B CA  
1998 C C   . ARG C 108 ? 0.5596 0.8952 0.7067 0.1021  0.0970  0.0744  106 ARG B C   
1999 O O   . ARG C 108 ? 0.5860 0.8741 0.7137 0.1059  0.0967  0.0689  106 ARG B O   
2000 C CB  . ARG C 108 ? 0.6038 0.9891 0.7461 0.0722  0.1138  0.0843  106 ARG B CB  
2001 C CG  . ARG C 108 ? 0.6279 0.9663 0.7583 0.0429  0.1068  0.0923  106 ARG B CG  
2002 C CD  . ARG C 108 ? 0.7349 1.0577 0.8451 0.0272  0.1124  0.0972  106 ARG B CD  
2003 N NE  . ARG C 108 ? 0.8021 1.1016 0.9009 -0.0044 0.1077  0.1087  106 ARG B NE  
2004 C CZ  . ARG C 108 ? 0.8470 1.1797 0.9504 -0.0311 0.1086  0.1192  106 ARG B CZ  
2005 N NH1 . ARG C 108 ? 0.8593 1.2624 0.9849 -0.0296 0.1147  0.1203  106 ARG B NH1 
2006 N NH2 . ARG C 108 ? 0.8739 1.1693 0.9573 -0.0593 0.1029  0.1285  106 ARG B NH2 
2007 N N   . THR C 109 ? 0.4339 0.7695 0.5918 0.1020  0.0882  0.0770  107 THR B N   
2008 C CA  . THR C 109 ? 0.4084 0.6890 0.5550 0.1108  0.0786  0.0725  107 THR B CA  
2009 C C   . THR C 109 ? 0.4249 0.7170 0.5752 0.1417  0.0743  0.0674  107 THR B C   
2010 O O   . THR C 109 ? 0.4047 0.7520 0.5747 0.1486  0.0743  0.0711  107 THR B O   
2011 C CB  . THR C 109 ? 0.3851 0.6481 0.5345 0.0861  0.0707  0.0797  107 THR B CB  
2012 O OG1 . THR C 109 ? 0.4011 0.6538 0.5436 0.0602  0.0741  0.0850  107 THR B OG1 
2013 C CG2 . THR C 109 ? 0.3654 0.5737 0.5009 0.0919  0.0627  0.0757  107 THR B CG2 
2014 N N   . SER C 110 ? 0.4243 0.6637 0.5536 0.1595  0.0694  0.0598  108 SER B N   
2015 C CA  . SER C 110 ? 0.4729 0.7077 0.5962 0.1914  0.0636  0.0551  108 SER B CA  
2016 C C   . SER C 110 ? 0.4626 0.7105 0.5994 0.1879  0.0537  0.0627  108 SER B C   
2017 O O   . SER C 110 ? 0.4065 0.6460 0.5491 0.1601  0.0499  0.0693  108 SER B O   
2018 C CB  . SER C 110 ? 0.5284 0.6913 0.6181 0.2035  0.0586  0.0467  108 SER B CB  
2019 O OG  . SER C 110 ? 0.5133 0.6339 0.5956 0.1825  0.0503  0.0512  108 SER B OG  
2020 N N   . GLU C 111 ? 0.5207 0.7867 0.6591 0.2188  0.0489  0.0611  109 GLU B N   
2021 C CA  . GLU C 111 ? 0.5255 0.8065 0.6748 0.2194  0.0380  0.0685  109 GLU B CA  
2022 C C   . GLU C 111 ? 0.5382 0.7464 0.6624 0.2120  0.0276  0.0693  109 GLU B C   
2023 O O   . GLU C 111 ? 0.5141 0.7231 0.6445 0.1956  0.0198  0.0766  109 GLU B O   
2024 C CB  . GLU C 111 ? 0.5724 0.8953 0.7286 0.2598  0.0350  0.0669  109 GLU B CB  
2025 C CG  . GLU C 111 ? 0.6161 1.0091 0.8030 0.2538  0.0290  0.0767  109 GLU B CG  
2026 C CD  . GLU C 111 ? 0.6222 1.0967 0.8409 0.2313  0.0390  0.0814  109 GLU B CD  
2027 O OE1 . GLU C 111 ? 0.6091 1.0938 0.8269 0.2301  0.0517  0.0766  109 GLU B OE1 
2028 O OE2 . GLU C 111 ? 0.6130 1.1409 0.8548 0.2128  0.0336  0.0905  109 GLU B OE2 
2029 N N   . LYS C 112 ? 0.5783 0.7249 0.6722 0.2213  0.0275  0.0619  110 LYS B N   
2030 C CA  . LYS C 112 ? 0.6042 0.6835 0.6719 0.2086  0.0192  0.0631  110 LYS B CA  
2031 C C   . LYS C 112 ? 0.5233 0.6016 0.6015 0.1711  0.0210  0.0684  110 LYS B C   
2032 O O   . LYS C 112 ? 0.5175 0.5815 0.5927 0.1590  0.0136  0.0742  110 LYS B O   
2033 C CB  . LYS C 112 ? 0.6951 0.7132 0.7273 0.2180  0.0194  0.0543  110 LYS B CB  
2034 C CG  . LYS C 112 ? 0.7559 0.7048 0.7546 0.2099  0.0085  0.0564  110 LYS B CG  
2035 C CD  . LYS C 112 ? 0.8509 0.7384 0.8113 0.2113  0.0077  0.0479  110 LYS B CD  
2036 C CE  . LYS C 112 ? 0.8772 0.7021 0.8057 0.1912  -0.0023 0.0522  110 LYS B CE  
2037 N NZ  . LYS C 112 ? 0.9297 0.6965 0.8197 0.1828  -0.0042 0.0449  110 LYS B NZ  
2038 N N   . VAL C 113 ? 0.4785 0.5715 0.5663 0.1551  0.0306  0.0664  111 VAL B N   
2039 C CA  . VAL C 113 ? 0.4081 0.4987 0.5027 0.1249  0.0326  0.0705  111 VAL B CA  
2040 C C   . VAL C 113 ? 0.3794 0.5061 0.4933 0.1120  0.0297  0.0778  111 VAL B C   
2041 O O   . VAL C 113 ? 0.3709 0.4806 0.4805 0.0957  0.0252  0.0812  111 VAL B O   
2042 C CB  . VAL C 113 ? 0.3890 0.4886 0.4873 0.1145  0.0425  0.0679  111 VAL B CB  
2043 C CG1 . VAL C 113 ? 0.2728 0.3729 0.3768 0.0888  0.0439  0.0726  111 VAL B CG1 
2044 C CG2 . VAL C 113 ? 0.4254 0.4858 0.5016 0.1205  0.0437  0.0607  111 VAL B CG2 
2045 N N   . LYS C 114 ? 0.4388 0.6177 0.5723 0.1180  0.0322  0.0800  112 LYS B N   
2046 C CA  . LYS C 114 ? 0.4019 0.6187 0.5521 0.1006  0.0286  0.0872  112 LYS B CA  
2047 C C   . LYS C 114 ? 0.4099 0.6193 0.5567 0.1052  0.0168  0.0909  112 LYS B C   
2048 O O   . LYS C 114 ? 0.4054 0.6067 0.5497 0.0840  0.0121  0.0947  112 LYS B O   
2049 C CB  . LYS C 114 ? 0.3968 0.6807 0.5696 0.1039  0.0335  0.0897  112 LYS B CB  
2050 C CG  . LYS C 114 ? 0.3697 0.6640 0.5439 0.0912  0.0450  0.0887  112 LYS B CG  
2051 C CD  . LYS C 114 ? 0.3327 0.7008 0.5292 0.0850  0.0499  0.0937  112 LYS B CD  
2052 C CE  . LYS C 114 ? 0.3588 0.7649 0.5638 0.1193  0.0556  0.0886  112 LYS B CE  
2053 N NZ  . LYS C 114 ? 0.3415 0.8331 0.5713 0.1143  0.0615  0.0939  112 LYS B NZ  
2054 N N   . ASN C 115 ? 0.3349 0.5406 0.4764 0.1342  0.0115  0.0895  113 ASN B N   
2055 C CA  . ASN C 115 ? 0.3650 0.5600 0.4988 0.1420  -0.0010 0.0942  113 ASN B CA  
2056 C C   . ASN C 115 ? 0.3711 0.5066 0.4810 0.1264  -0.0050 0.0948  113 ASN B C   
2057 O O   . ASN C 115 ? 0.3685 0.5008 0.4742 0.1170  -0.0134 0.1001  113 ASN B O   
2058 C CB  . ASN C 115 ? 0.4531 0.6479 0.5794 0.1810  -0.0064 0.0926  113 ASN B CB  
2059 C CG  . ASN C 115 ? 0.4716 0.7424 0.6255 0.2000  -0.0040 0.0933  113 ASN B CG  
2060 O OD1 . ASN C 115 ? 0.5867 0.8643 0.7358 0.2361  -0.0038 0.0891  113 ASN B OD1 
2061 N ND2 . ASN C 115 ? 0.4483 0.7765 0.6283 0.1753  -0.0021 0.0986  113 ASN B ND2 
2062 N N   . LYS C 116 ? 0.3785 0.4721 0.4725 0.1229  0.0011  0.0895  114 LYS B N   
2063 C CA  . LYS C 116 ? 0.4039 0.4516 0.4778 0.1055  -0.0003 0.0900  114 LYS B CA  
2064 C C   . LYS C 116 ? 0.3452 0.4066 0.4280 0.0799  0.0024  0.0920  114 LYS B C   
2065 O O   . LYS C 116 ? 0.3649 0.4113 0.4371 0.0690  -0.0026 0.0951  114 LYS B O   
2066 C CB  . LYS C 116 ? 0.4253 0.4385 0.4844 0.1046  0.0059  0.0840  114 LYS B CB  
2067 C CG  . LYS C 116 ? 0.4570 0.4344 0.4980 0.0854  0.0054  0.0849  114 LYS B CG  
2068 C CD  . LYS C 116 ? 0.5726 0.5237 0.5938 0.0859  -0.0049 0.0907  114 LYS B CD  
2069 C CE  . LYS C 116 ? 0.5951 0.5083 0.5922 0.0686  -0.0053 0.0917  114 LYS B CE  
2070 N NZ  . LYS C 116 ? 0.6518 0.5378 0.6257 0.0676  -0.0157 0.0991  114 LYS B NZ  
2071 N N   . ILE C 117 ? 0.3324 0.4206 0.4309 0.0711  0.0097  0.0903  115 ILE B N   
2072 C CA  . ILE C 117 ? 0.3091 0.4020 0.4092 0.0485  0.0113  0.0915  115 ILE B CA  
2073 C C   . ILE C 117 ? 0.3205 0.4335 0.4239 0.0402  0.0024  0.0964  115 ILE B C   
2074 O O   . ILE C 117 ? 0.3322 0.4266 0.4227 0.0268  -0.0005 0.0968  115 ILE B O   
2075 C CB  . ILE C 117 ? 0.2830 0.3939 0.3929 0.0397  0.0194  0.0902  115 ILE B CB  
2076 C CG1 . ILE C 117 ? 0.2974 0.3810 0.3982 0.0409  0.0270  0.0857  115 ILE B CG1 
2077 C CG2 . ILE C 117 ? 0.2555 0.3714 0.3627 0.0170  0.0178  0.0927  115 ILE B CG2 
2078 C CD1 . ILE C 117 ? 0.3148 0.4148 0.4228 0.0391  0.0345  0.0851  115 ILE B CD1 
2079 N N   . LEU C 118 ? 0.3354 0.4897 0.4553 0.0496  -0.0021 0.1000  116 LEU B N   
2080 C CA  . LEU C 118 ? 0.3445 0.5267 0.4693 0.0423  -0.0125 0.1055  116 LEU B CA  
2081 C C   . LEU C 118 ? 0.3862 0.5398 0.4936 0.0490  -0.0217 0.1079  116 LEU B C   
2082 O O   . LEU C 118 ? 0.3911 0.5427 0.4901 0.0334  -0.0283 0.1103  116 LEU B O   
2083 C CB  . LEU C 118 ? 0.3386 0.5814 0.4875 0.0556  -0.0156 0.1092  116 LEU B CB  
2084 C CG  . LEU C 118 ? 0.3198 0.5998 0.4856 0.0447  -0.0064 0.1087  116 LEU B CG  
2085 C CD1 . LEU C 118 ? 0.2961 0.6468 0.4877 0.0609  -0.0078 0.1123  116 LEU B CD1 
2086 C CD2 . LEU C 118 ? 0.3409 0.6183 0.5004 0.0086  -0.0069 0.1106  116 LEU B CD2 
2087 N N   . GLU C 119 ? 0.3538 0.4810 0.4512 0.0705  -0.0224 0.1072  117 GLU B N   
2088 C CA  . GLU C 119 ? 0.4122 0.5015 0.4860 0.0738  -0.0301 0.1105  117 GLU B CA  
2089 C C   . GLU C 119 ? 0.3780 0.4379 0.4355 0.0503  -0.0264 0.1087  117 GLU B C   
2090 O O   . GLU C 119 ? 0.4064 0.4576 0.4501 0.0418  -0.0334 0.1124  117 GLU B O   
2091 C CB  . GLU C 119 ? 0.4555 0.5078 0.5131 0.0942  -0.0300 0.1091  117 GLU B CB  
2092 C CG  . GLU C 119 ? 0.6017 0.6635 0.6585 0.1248  -0.0391 0.1124  117 GLU B CG  
2093 C CD  . GLU C 119 ? 0.7885 0.7897 0.8110 0.1388  -0.0446 0.1135  117 GLU B CD  
2094 O OE1 . GLU C 119 ? 0.8913 0.8796 0.8977 0.1555  -0.0571 0.1201  117 GLU B OE1 
2095 O OE2 . GLU C 119 ? 0.7982 0.7627 0.8067 0.1302  -0.0375 0.1088  117 GLU B OE2 
2096 N N   . LEU C 120 ? 0.3533 0.3981 0.4102 0.0428  -0.0155 0.1030  118 LEU B N   
2097 C CA  . LEU C 120 ? 0.3326 0.3548 0.3749 0.0261  -0.0104 0.1002  118 LEU B CA  
2098 C C   . LEU C 120 ? 0.3157 0.3497 0.3567 0.0102  -0.0121 0.0994  118 LEU B C   
2099 O O   . LEU C 120 ? 0.3737 0.3942 0.3974 0.0013  -0.0149 0.1000  118 LEU B O   
2100 C CB  . LEU C 120 ? 0.2884 0.3002 0.3329 0.0247  0.0007  0.0945  118 LEU B CB  
2101 C CG  . LEU C 120 ? 0.3275 0.3177 0.3639 0.0330  0.0024  0.0940  118 LEU B CG  
2102 C CD1 . LEU C 120 ? 0.3322 0.3212 0.3729 0.0292  0.0123  0.0885  118 LEU B CD1 
2103 C CD2 . LEU C 120 ? 0.3079 0.2724 0.3214 0.0266  -0.0023 0.0982  118 LEU B CD2 
2104 N N   . LEU C 121 ? 0.2906 0.3476 0.3458 0.0048  -0.0107 0.0982  119 LEU B N   
2105 C CA  . LEU C 121 ? 0.3182 0.3811 0.3668 -0.0138 -0.0142 0.0975  119 LEU B CA  
2106 C C   . LEU C 121 ? 0.3548 0.4274 0.3962 -0.0180 -0.0262 0.1021  119 LEU B C   
2107 O O   . LEU C 121 ? 0.3920 0.4484 0.4133 -0.0316 -0.0288 0.0999  119 LEU B O   
2108 C CB  . LEU C 121 ? 0.3054 0.3971 0.3701 -0.0219 -0.0135 0.0985  119 LEU B CB  
2109 C CG  . LEU C 121 ? 0.3093 0.3883 0.3745 -0.0241 -0.0029 0.0946  119 LEU B CG  
2110 C CD1 . LEU C 121 ? 0.2915 0.4071 0.3743 -0.0314 -0.0027 0.0983  119 LEU B CD1 
2111 C CD2 . LEU C 121 ? 0.3549 0.3967 0.3947 -0.0370 0.0001  0.0894  119 LEU B CD2 
2112 N N   . TYR C 122 ? 0.3075 0.4070 0.3631 -0.0046 -0.0341 0.1083  120 TYR B N   
2113 C CA  . TYR C 122 ? 0.3351 0.4455 0.3833 -0.0054 -0.0472 0.1142  120 TYR B CA  
2114 C C   . TYR C 122 ? 0.3758 0.4475 0.3966 -0.0071 -0.0481 0.1144  120 TYR B C   
2115 O O   . TYR C 122 ? 0.3899 0.4585 0.3941 -0.0200 -0.0550 0.1154  120 TYR B O   
2116 C CB  . TYR C 122 ? 0.3350 0.4780 0.4003 0.0170  -0.0558 0.1210  120 TYR B CB  
2117 C CG  . TYR C 122 ? 0.3830 0.5381 0.4392 0.0185  -0.0711 0.1283  120 TYR B CG  
2118 C CD1 . TYR C 122 ? 0.4296 0.6223 0.4918 0.0006  -0.0803 0.1307  120 TYR B CD1 
2119 C CD2 . TYR C 122 ? 0.4129 0.5378 0.4495 0.0339  -0.0772 0.1333  120 TYR B CD2 
2120 C CE1 . TYR C 122 ? 0.4205 0.6275 0.4736 0.0017  -0.0957 0.1378  120 TYR B CE1 
2121 C CE2 . TYR C 122 ? 0.5080 0.6407 0.5324 0.0352  -0.0920 0.1410  120 TYR B CE2 
2122 C CZ  . TYR C 122 ? 0.4899 0.6657 0.5238 0.0202  -0.1013 0.1430  120 TYR B CZ  
2123 O OH  . TYR C 122 ? 0.5669 0.7536 0.5883 0.0222  -0.1174 0.1511  120 TYR B OH  
2124 N N   . SER C 123 ? 0.4187 0.4627 0.4327 0.0037  -0.0415 0.1137  121 SER B N   
2125 C CA  . SER C 123 ? 0.4389 0.4513 0.4266 -0.0006 -0.0417 0.1156  121 SER B CA  
2126 C C   . SER C 123 ? 0.4259 0.4277 0.3981 -0.0183 -0.0348 0.1089  121 SER B C   
2127 O O   . SER C 123 ? 0.4688 0.4588 0.4186 -0.0262 -0.0378 0.1107  121 SER B O   
2128 C CB  . SER C 123 ? 0.4155 0.4019 0.3972 0.0083  -0.0358 0.1163  121 SER B CB  
2129 O OG  . SER C 123 ? 0.4261 0.4097 0.4158 0.0041  -0.0227 0.1086  121 SER B OG  
2130 N N   . TRP C 124 ? 0.4267 0.4307 0.4075 -0.0228 -0.0258 0.1013  122 TRP B N   
2131 C CA  . TRP C 124 ? 0.4130 0.4018 0.3752 -0.0338 -0.0193 0.0935  122 TRP B CA  
2132 C C   . TRP C 124 ? 0.4488 0.4400 0.3969 -0.0480 -0.0279 0.0919  122 TRP B C   
2133 O O   . TRP C 124 ? 0.4568 0.4300 0.3789 -0.0553 -0.0259 0.0865  122 TRP B O   
2134 C CB  . TRP C 124 ? 0.4080 0.3909 0.3777 -0.0312 -0.0081 0.0864  122 TRP B CB  
2135 C CG  . TRP C 124 ? 0.3345 0.3167 0.3161 -0.0200 -0.0003 0.0872  122 TRP B CG  
2136 C CD1 . TRP C 124 ? 0.3697 0.3462 0.3451 -0.0173 0.0010  0.0907  122 TRP B CD1 
2137 C CD2 . TRP C 124 ? 0.3182 0.3042 0.3160 -0.0135 0.0062  0.0847  122 TRP B CD2 
2138 N NE1 . TRP C 124 ? 0.3803 0.3569 0.3672 -0.0106 0.0071  0.0901  122 TRP B NE1 
2139 C CE2 . TRP C 124 ? 0.3255 0.3089 0.3269 -0.0067 0.0106  0.0861  122 TRP B CE2 
2140 C CE3 . TRP C 124 ? 0.3494 0.3395 0.3558 -0.0152 0.0081  0.0822  122 TRP B CE3 
2141 C CZ2 . TRP C 124 ? 0.3539 0.3404 0.3685 0.0003  0.0165  0.0842  122 TRP B CZ2 
2142 C CZ3 . TRP C 124 ? 0.3636 0.3564 0.3829 -0.0073 0.0149  0.0810  122 TRP B CZ3 
2143 C CH2 . TRP C 124 ? 0.3099 0.3022 0.3341 0.0012  0.0187  0.0817  122 TRP B CH2 
2144 N N   . THR C 125 ? 0.3782 0.3938 0.3418 -0.0527 -0.0373 0.0960  123 THR B N   
2145 C CA  . THR C 125 ? 0.4080 0.4312 0.3581 -0.0703 -0.0486 0.0961  123 THR B CA  
2146 C C   . THR C 125 ? 0.4065 0.4284 0.3393 -0.0705 -0.0576 0.1009  123 THR B C   
2147 O O   . THR C 125 ? 0.4342 0.4474 0.3423 -0.0853 -0.0639 0.0979  123 THR B O   
2148 C CB  . THR C 125 ? 0.4111 0.4756 0.3859 -0.0769 -0.0580 0.1018  123 THR B CB  
2149 O OG1 . THR C 125 ? 0.4096 0.5051 0.4049 -0.0600 -0.0655 0.1111  123 THR B OG1 
2150 C CG2 . THR C 125 ? 0.3888 0.4573 0.3802 -0.0775 -0.0489 0.0992  123 THR B CG2 
2151 N N   . VAL C 126 ? 0.4267 0.4521 0.3675 -0.0546 -0.0589 0.1084  124 VAL B N   
2152 C CA  . VAL C 126 ? 0.4281 0.4472 0.3489 -0.0539 -0.0676 0.1151  124 VAL B CA  
2153 C C   . VAL C 126 ? 0.4271 0.4156 0.3212 -0.0576 -0.0570 0.1108  124 VAL B C   
2154 O O   . VAL C 126 ? 0.4623 0.4418 0.3292 -0.0678 -0.0603 0.1099  124 VAL B O   
2155 C CB  . VAL C 126 ? 0.4542 0.4829 0.3874 -0.0349 -0.0759 0.1264  124 VAL B CB  
2156 C CG1 . VAL C 126 ? 0.4476 0.4622 0.3532 -0.0353 -0.0861 0.1350  124 VAL B CG1 
2157 C CG2 . VAL C 126 ? 0.4920 0.5625 0.4532 -0.0275 -0.0858 0.1304  124 VAL B CG2 
2158 N N   . GLY C 127 ? 0.4263 0.4037 0.3279 -0.0501 -0.0441 0.1080  125 GLY B N   
2159 C CA  . GLY C 127 ? 0.4240 0.3846 0.3051 -0.0530 -0.0334 0.1056  125 GLY B CA  
2160 C C   . GLY C 127 ? 0.4352 0.3887 0.3012 -0.0586 -0.0227 0.0931  125 GLY B C   
2161 O O   . GLY C 127 ? 0.4514 0.3987 0.2928 -0.0632 -0.0170 0.0905  125 GLY B O   
2162 N N   . LEU C 128 ? 0.4419 0.3949 0.3188 -0.0576 -0.0202 0.0856  126 LEU B N   
2163 C CA  . LEU C 128 ? 0.4632 0.3998 0.3210 -0.0584 -0.0112 0.0730  126 LEU B CA  
2164 C C   . LEU C 128 ? 0.4906 0.4164 0.3373 -0.0698 -0.0201 0.0681  126 LEU B C   
2165 O O   . LEU C 128 ? 0.5186 0.4349 0.3705 -0.0696 -0.0174 0.0633  126 LEU B O   
2166 C CB  . LEU C 128 ? 0.4271 0.3636 0.3008 -0.0463 0.0015  0.0684  126 LEU B CB  
2167 C CG  . LEU C 128 ? 0.4430 0.3927 0.3263 -0.0401 0.0097  0.0732  126 LEU B CG  
2168 C CD1 . LEU C 128 ? 0.3950 0.3517 0.3026 -0.0305 0.0167  0.0726  126 LEU B CD1 
2169 C CD2 . LEU C 128 ? 0.4832 0.4349 0.3420 -0.0397 0.0194  0.0680  126 LEU B CD2 
2170 N N   . PRO C 129 ? 0.4900 0.4158 0.3178 -0.0824 -0.0317 0.0700  127 PRO B N   
2171 C CA  . PRO C 129 ? 0.5479 0.4651 0.3628 -0.0990 -0.0421 0.0661  127 PRO B CA  
2172 C C   . PRO C 129 ? 0.5942 0.4703 0.3734 -0.1023 -0.0360 0.0515  127 PRO B C   
2173 O O   . PRO C 129 ? 0.6458 0.5060 0.4102 -0.1191 -0.0445 0.0482  127 PRO B O   
2174 C CB  . PRO C 129 ? 0.5722 0.5006 0.3718 -0.1108 -0.0562 0.0716  127 PRO B CB  
2175 C CG  . PRO C 129 ? 0.5470 0.4736 0.3355 -0.1010 -0.0497 0.0739  127 PRO B CG  
2176 C CD  . PRO C 129 ? 0.4822 0.4151 0.2966 -0.0846 -0.0368 0.0766  127 PRO B CD  
2177 N N   . GLU C 130 ? 0.6390 0.4980 0.4022 -0.0864 -0.0218 0.0432  128 GLU B N   
2178 C CA  . GLU C 130 ? 0.6887 0.5047 0.4142 -0.0820 -0.0157 0.0285  128 GLU B CA  
2179 C C   . GLU C 130 ? 0.6752 0.4784 0.4142 -0.0720 -0.0089 0.0264  128 GLU B C   
2180 O O   . GLU C 130 ? 0.7141 0.4755 0.4207 -0.0657 -0.0052 0.0154  128 GLU B O   
2181 C CB  . GLU C 130 ? 0.7059 0.5144 0.4037 -0.0664 -0.0036 0.0191  128 GLU B CB  
2182 C CG  . GLU C 130 ? 0.7639 0.5708 0.4316 -0.0789 -0.0109 0.0180  128 GLU B CG  
2183 C CD  . GLU C 130 ? 0.7741 0.5799 0.4132 -0.0640 0.0026  0.0088  128 GLU B CD  
2184 O OE1 . GLU C 130 ? 0.7944 0.6065 0.4394 -0.0428 0.0178  0.0035  128 GLU B OE1 
2185 O OE2 . GLU C 130 ? 0.8052 0.6101 0.4169 -0.0736 -0.0020 0.0077  128 GLU B OE2 
2186 N N   . GLU C 131 ? 0.6209 0.4569 0.4038 -0.0684 -0.0076 0.0369  129 GLU B N   
2187 C CA  . GLU C 131 ? 0.6141 0.4430 0.4125 -0.0648 -0.0046 0.0379  129 GLU B CA  
2188 C C   . GLU C 131 ? 0.6257 0.4578 0.4302 -0.0885 -0.0176 0.0439  129 GLU B C   
2189 O O   . GLU C 131 ? 0.5885 0.4583 0.4302 -0.0918 -0.0210 0.0541  129 GLU B O   
2190 C CB  . GLU C 131 ? 0.5511 0.4137 0.3901 -0.0499 0.0035  0.0450  129 GLU B CB  
2191 C CG  . GLU C 131 ? 0.5297 0.4023 0.3675 -0.0320 0.0154  0.0415  129 GLU B CG  
2192 C CD  . GLU C 131 ? 0.6010 0.4483 0.4152 -0.0145 0.0254  0.0302  129 GLU B CD  
2193 O OE1 . GLU C 131 ? 0.5449 0.4045 0.3521 -0.0002 0.0353  0.0255  129 GLU B OE1 
2194 O OE2 . GLU C 131 ? 0.5978 0.4142 0.3990 -0.0145 0.0232  0.0266  129 GLU B OE2 
2195 N N   . VAL C 132 ? 0.6177 0.4115 0.3827 -0.1055 -0.0251 0.0373  130 VAL B N   
2196 C CA  . VAL C 132 ? 0.6522 0.4524 0.4162 -0.1354 -0.0392 0.0429  130 VAL B CA  
2197 C C   . VAL C 132 ? 0.6427 0.4540 0.4301 -0.1430 -0.0387 0.0500  130 VAL B C   
2198 O O   . VAL C 132 ? 0.6434 0.4921 0.4529 -0.1631 -0.0478 0.0592  130 VAL B O   
2199 C CB  . VAL C 132 ? 0.7378 0.4838 0.4443 -0.1555 -0.0479 0.0329  130 VAL B CB  
2200 C CG1 . VAL C 132 ? 0.7683 0.5072 0.4496 -0.1500 -0.0489 0.0259  130 VAL B CG1 
2201 C CG2 . VAL C 132 ? 0.8188 0.5002 0.4864 -0.1466 -0.0411 0.0230  130 VAL B CG2 
2202 N N   . LYS C 133 ? 0.6657 0.4487 0.4473 -0.1264 -0.0281 0.0462  131 LYS B N   
2203 C CA  . LYS C 133 ? 0.6477 0.4403 0.4495 -0.1315 -0.0261 0.0533  131 LYS B CA  
2204 C C   . LYS C 133 ? 0.5817 0.4395 0.4393 -0.1231 -0.0232 0.0635  131 LYS B C   
2205 O O   . LYS C 133 ? 0.5823 0.4675 0.4615 -0.1351 -0.0253 0.0714  131 LYS B O   
2206 C CB  . LYS C 133 ? 0.6158 0.3646 0.3981 -0.1108 -0.0158 0.0473  131 LYS B CB  
2207 C CG  . LYS C 133 ? 0.6962 0.3697 0.4161 -0.1151 -0.0191 0.0369  131 LYS B CG  
2208 C CD  . LYS C 133 ? 0.6922 0.3278 0.3945 -0.0852 -0.0089 0.0309  131 LYS B CD  
2209 C CE  . LYS C 133 ? 0.7923 0.3433 0.4259 -0.0860 -0.0134 0.0207  131 LYS B CE  
2210 N NZ  . LYS C 133 ? 0.7610 0.2789 0.3778 -0.0507 -0.0042 0.0153  131 LYS B NZ  
2211 N N   . ILE C 134 ? 0.5230 0.4036 0.4003 -0.1025 -0.0185 0.0634  132 ILE B N   
2212 C CA  . ILE C 134 ? 0.4826 0.4145 0.4042 -0.0931 -0.0175 0.0721  132 ILE B CA  
2213 C C   . ILE C 134 ? 0.4913 0.4641 0.4292 -0.1102 -0.0298 0.0799  132 ILE B C   
2214 O O   . ILE C 134 ? 0.4741 0.4870 0.4426 -0.1101 -0.0306 0.0871  132 ILE B O   
2215 C CB  . ILE C 134 ? 0.4421 0.3822 0.3737 -0.0719 -0.0118 0.0713  132 ILE B CB  
2216 C CG1 . ILE C 134 ? 0.4252 0.3395 0.3463 -0.0550 0.0004  0.0645  132 ILE B CG1 
2217 C CG2 . ILE C 134 ? 0.4090 0.3898 0.3771 -0.0624 -0.0129 0.0798  132 ILE B CG2 
2218 C CD1 . ILE C 134 ? 0.3551 0.2795 0.2820 -0.0396 0.0067  0.0639  132 ILE B CD1 
2219 N N   . ALA C 135 ? 0.4949 0.4601 0.4107 -0.1240 -0.0394 0.0781  133 ALA B N   
2220 C CA  . ALA C 135 ? 0.5209 0.5285 0.4494 -0.1408 -0.0531 0.0855  133 ALA B CA  
2221 C C   . ALA C 135 ? 0.5742 0.5968 0.5045 -0.1679 -0.0585 0.0893  133 ALA B C   
2222 O O   . ALA C 135 ? 0.5897 0.6704 0.5518 -0.1735 -0.0640 0.0981  133 ALA B O   
2223 C CB  . ALA C 135 ? 0.5492 0.5396 0.4472 -0.1515 -0.0625 0.0818  133 ALA B CB  
2224 N N   . GLU C 136 ? 0.5673 0.5377 0.4609 -0.1844 -0.0569 0.0830  134 GLU B N   
2225 C CA  . GLU C 136 ? 0.6264 0.6019 0.5142 -0.2148 -0.0617 0.0876  134 GLU B CA  
2226 C C   . GLU C 136 ? 0.5801 0.5960 0.5071 -0.2044 -0.0528 0.0950  134 GLU B C   
2227 O O   . GLU C 136 ? 0.5969 0.6641 0.5455 -0.2235 -0.0574 0.1036  134 GLU B O   
2228 C CB  . GLU C 136 ? 0.6908 0.5867 0.5231 -0.2306 -0.0616 0.0793  134 GLU B CB  
2229 C CG  . GLU C 136 ? 0.7934 0.6839 0.6107 -0.2674 -0.0674 0.0855  134 GLU B CG  
2230 C CD  . GLU C 136 ? 0.9369 0.7345 0.6881 -0.2831 -0.0699 0.0773  134 GLU B CD  
2231 O OE1 . GLU C 136 ? 0.9441 0.6862 0.6633 -0.2609 -0.0661 0.0655  134 GLU B OE1 
2232 O OE2 . GLU C 136 ? 0.9355 0.7154 0.6639 -0.3177 -0.0759 0.0828  134 GLU B OE2 
2233 N N   . ALA C 137 ? 0.5817 0.5806 0.5184 -0.1741 -0.0401 0.0915  135 ALA B N   
2234 C CA  . ALA C 137 ? 0.5521 0.5819 0.5198 -0.1633 -0.0313 0.0969  135 ALA B CA  
2235 C C   . ALA C 137 ? 0.4980 0.6016 0.5101 -0.1528 -0.0340 0.1041  135 ALA B C   
2236 O O   . ALA C 137 ? 0.4635 0.6145 0.5005 -0.1581 -0.0322 0.1107  135 ALA B O   
2237 C CB  . ALA C 137 ? 0.5016 0.4976 0.4676 -0.1340 -0.0188 0.0912  135 ALA B CB  
2238 N N   . TYR C 138 ? 0.5372 0.6504 0.5552 -0.1382 -0.0390 0.1031  136 TYR B N   
2239 C CA  . TYR C 138 ? 0.4723 0.6454 0.5256 -0.1214 -0.0431 0.1094  136 TYR B CA  
2240 C C   . TYR C 138 ? 0.4850 0.7177 0.5522 -0.1442 -0.0552 0.1170  136 TYR B C   
2241 O O   . TYR C 138 ? 0.4400 0.7355 0.5405 -0.1353 -0.0552 0.1233  136 TYR B O   
2242 C CB  . TYR C 138 ? 0.4723 0.6289 0.5205 -0.1003 -0.0459 0.1074  136 TYR B CB  
2243 C CG  . TYR C 138 ? 0.4328 0.6361 0.5093 -0.0769 -0.0508 0.1138  136 TYR B CG  
2244 C CD1 . TYR C 138 ? 0.3872 0.5948 0.4813 -0.0497 -0.0423 0.1137  136 TYR B CD1 
2245 C CD2 . TYR C 138 ? 0.4557 0.6968 0.5379 -0.0809 -0.0648 0.1197  136 TYR B CD2 
2246 C CE1 . TYR C 138 ? 0.3525 0.5935 0.4653 -0.0246 -0.0474 0.1186  136 TYR B CE1 
2247 C CE2 . TYR C 138 ? 0.4526 0.7341 0.5574 -0.0545 -0.0703 0.1258  136 TYR B CE2 
2248 C CZ  . TYR C 138 ? 0.4061 0.6839 0.5244 -0.0253 -0.0613 0.1248  136 TYR B CZ  
2249 O OH  . TYR C 138 ? 0.4105 0.7183 0.5439 0.0048  -0.0674 0.1298  136 TYR B OH  
2250 N N   . GLN C 139 ? 0.5182 0.7333 0.5582 -0.1740 -0.0654 0.1160  137 GLN B N   
2251 C CA  . GLN C 139 ? 0.5517 0.8234 0.6005 -0.2036 -0.0784 0.1233  137 GLN B CA  
2252 C C   . GLN C 139 ? 0.5629 0.8701 0.6251 -0.2259 -0.0740 0.1290  137 GLN B C   
2253 O O   . GLN C 139 ? 0.5313 0.9176 0.6224 -0.2373 -0.0800 0.1375  137 GLN B O   
2254 C CB  . GLN C 139 ? 0.6441 0.8749 0.6510 -0.2346 -0.0902 0.1192  137 GLN B CB  
2255 C CG  . GLN C 139 ? 0.7611 1.0297 0.7628 -0.2795 -0.1027 0.1254  137 GLN B CG  
2256 C CD  . GLN C 139 ? 0.7863 1.1411 0.8196 -0.2808 -0.1167 0.1341  137 GLN B CD  
2257 O OE1 . GLN C 139 ? 0.7724 1.1263 0.8034 -0.2637 -0.1242 0.1330  137 GLN B OE1 
2258 N NE2 . GLN C 139 ? 0.7764 1.2095 0.8382 -0.3016 -0.1206 0.1435  137 GLN B NE2 
2259 N N   . MET C 140 ? 0.6053 0.8575 0.6458 -0.2315 -0.0635 0.1250  138 MET B N   
2260 C CA  . MET C 140 ? 0.6388 0.9149 0.6855 -0.2537 -0.0583 0.1311  138 MET B CA  
2261 C C   . MET C 140 ? 0.5609 0.9045 0.6542 -0.2258 -0.0484 0.1357  138 MET B C   
2262 O O   . MET C 140 ? 0.5728 0.9829 0.6879 -0.2430 -0.0480 0.1438  138 MET B O   
2263 C CB  . MET C 140 ? 0.6885 0.8797 0.6947 -0.2619 -0.0507 0.1259  138 MET B CB  
2264 C CG  . MET C 140 ? 0.7469 0.9478 0.7460 -0.2933 -0.0477 0.1336  138 MET B CG  
2265 S SD  . MET C 140 ? 0.7304 0.8774 0.7189 -0.2698 -0.0316 0.1305  138 MET B SD  
2266 C CE  . MET C 140 ? 0.6175 0.8384 0.6647 -0.2254 -0.0208 0.1311  138 MET B CE  
2267 N N   . LEU C 141 ? 0.5683 0.8929 0.6730 -0.1842 -0.0400 0.1302  139 LEU B N   
2268 C CA  . LEU C 141 ? 0.5000 0.8794 0.6426 -0.1525 -0.0319 0.1324  139 LEU B CA  
2269 C C   . LEU C 141 ? 0.4842 0.9477 0.6593 -0.1445 -0.0410 0.1385  139 LEU B C   
2270 O O   . LEU C 141 ? 0.4636 0.9970 0.6690 -0.1352 -0.0364 0.1431  139 LEU B O   
2271 C CB  . LEU C 141 ? 0.4444 0.7783 0.5851 -0.1136 -0.0245 0.1250  139 LEU B CB  
2272 C CG  . LEU C 141 ? 0.4433 0.7091 0.5601 -0.1125 -0.0142 0.1191  139 LEU B CG  
2273 C CD1 . LEU C 141 ? 0.3646 0.5942 0.4796 -0.0796 -0.0098 0.1127  139 LEU B CD1 
2274 C CD2 . LEU C 141 ? 0.4255 0.7126 0.5517 -0.1174 -0.0040 0.1222  139 LEU B CD2 
2275 N N   . LYS C 142 ? 0.5543 1.0125 0.7218 -0.1447 -0.0538 0.1384  140 LYS B N   
2276 C CA  . LYS C 142 ? 0.5520 1.0900 0.7466 -0.1388 -0.0656 0.1453  140 LYS B CA  
2277 C C   . LYS C 142 ? 0.5799 1.1854 0.7850 -0.1805 -0.0717 0.1534  140 LYS B C   
2278 O O   . LYS C 142 ? 0.5577 1.2568 0.7982 -0.1733 -0.0748 0.1604  140 LYS B O   
2279 C CB  . LYS C 142 ? 0.5814 1.0915 0.7590 -0.1343 -0.0791 0.1441  140 LYS B CB  
2280 C CG  . LYS C 142 ? 0.5861 1.1549 0.7899 -0.1008 -0.0883 0.1493  140 LYS B CG  
2281 C CD  . LYS C 142 ? 0.6705 1.2488 0.8621 -0.1158 -0.1067 0.1531  140 LYS B CD  
2282 C CE  . LYS C 142 ? 0.6863 1.1821 0.8448 -0.1039 -0.1082 0.1475  140 LYS B CE  
2283 N NZ  . LYS C 142 ? 0.7310 1.2434 0.8796 -0.1105 -0.1266 0.1521  140 LYS B NZ  
2284 N N   . LYS C 143 ? 0.5304 1.0886 0.7022 -0.2241 -0.0736 0.1526  141 LYS B N   
2285 C CA  . LYS C 143 ? 0.5690 1.1783 0.7414 -0.2729 -0.0798 0.1609  141 LYS B CA  
2286 C C   . LYS C 143 ? 0.5373 1.2104 0.7389 -0.2723 -0.0672 0.1668  141 LYS B C   
2287 O O   . LYS C 143 ? 0.5420 1.3112 0.7711 -0.2913 -0.0714 0.1759  141 LYS B O   
2288 C CB  . LYS C 143 ? 0.6578 1.1813 0.7771 -0.3170 -0.0839 0.1576  141 LYS B CB  
2289 C CG  . LYS C 143 ? 0.7360 1.2929 0.8410 -0.3715 -0.1002 0.1644  141 LYS B CG  
2290 C CD  . LYS C 143 ? 0.7563 1.3451 0.8594 -0.4140 -0.0963 0.1733  141 LYS B CD  
2291 C CE  . LYS C 143 ? 0.8543 1.4942 0.9485 -0.4718 -0.1136 0.1820  141 LYS B CE  
2292 N NZ  . LYS C 143 ? 0.8719 1.5282 0.9533 -0.5217 -0.1103 0.1915  141 LYS B NZ  
2293 N N   . GLN C 144 ? 0.5176 1.1440 0.7143 -0.2492 -0.0517 0.1616  142 GLN B N   
2294 C CA  . GLN C 144 ? 0.4975 1.1793 0.7187 -0.2444 -0.0382 0.1660  142 GLN B CA  
2295 C C   . GLN C 144 ? 0.4282 1.1831 0.6929 -0.1936 -0.0325 0.1651  142 GLN B C   
2296 O O   . GLN C 144 ? 0.4094 1.2203 0.6966 -0.1838 -0.0208 0.1676  142 GLN B O   
2297 C CB  . GLN C 144 ? 0.5096 1.1106 0.7032 -0.2436 -0.0251 0.1614  142 GLN B CB  
2298 C CG  . GLN C 144 ? 0.5942 1.1073 0.7373 -0.2841 -0.0308 0.1607  142 GLN B CG  
2299 C CD  . GLN C 144 ? 0.6156 1.0595 0.7325 -0.2825 -0.0189 0.1582  142 GLN B CD  
2300 O OE1 . GLN C 144 ? 0.5598 1.0224 0.6968 -0.2536 -0.0062 0.1569  142 GLN B OE1 
2301 N NE2 . GLN C 144 ? 0.7364 1.0960 0.8045 -0.3110 -0.0237 0.1569  142 GLN B NE2 
2302 N N   . GLY C 145 ? 0.5284 1.2784 0.8004 -0.1603 -0.0409 0.1613  143 GLY B N   
2303 C CA  . GLY C 145 ? 0.4725 1.2830 0.7782 -0.1096 -0.0387 0.1605  143 GLY B CA  
2304 C C   . GLY C 145 ? 0.4450 1.1971 0.7439 -0.0663 -0.0263 0.1513  143 GLY B C   
2305 O O   . GLY C 145 ? 0.4211 1.2102 0.7402 -0.0223 -0.0226 0.1491  143 GLY B O   
2306 N N   . ILE C 146 ? 0.4632 1.1237 0.7310 -0.0780 -0.0204 0.1458  144 ILE B N   
2307 C CA  . ILE C 146 ? 0.4423 1.0431 0.7001 -0.0427 -0.0104 0.1372  144 ILE B CA  
2308 C C   . ILE C 146 ? 0.4467 1.0099 0.6973 -0.0102 -0.0186 0.1331  144 ILE B C   
2309 O O   . ILE C 146 ? 0.4429 0.9974 0.6972 0.0290  -0.0144 0.1286  144 ILE B O   
2310 C CB  . ILE C 146 ? 0.4451 0.9669 0.6732 -0.0640 -0.0028 0.1333  144 ILE B CB  
2311 C CG1 . ILE C 146 ? 0.4327 0.9860 0.6646 -0.0885 0.0070  0.1378  144 ILE B CG1 
2312 C CG2 . ILE C 146 ? 0.4334 0.8917 0.6492 -0.0309 0.0041  0.1246  144 ILE B CG2 
2313 C CD1 . ILE C 146 ? 0.4582 0.9381 0.6565 -0.1161 0.0105  0.1369  144 ILE B CD1 
2314 N N   . VAL C 147 ? 0.4511 0.9896 0.6872 -0.0278 -0.0308 0.1350  145 VAL B N   
2315 C CA  . VAL C 147 ? 0.4702 0.9961 0.7027 -0.0016 -0.0417 0.1350  145 VAL B CA  
2316 C C   . VAL C 147 ? 0.4892 1.1035 0.7500 0.0134  -0.0518 0.1421  145 VAL B C   
2317 O O   . VAL C 147 ? 0.4897 1.1585 0.7614 -0.0161 -0.0601 0.1485  145 VAL B O   
2318 C CB  . VAL C 147 ? 0.4980 0.9672 0.7021 -0.0251 -0.0507 0.1343  145 VAL B CB  
2319 C CG1 . VAL C 147 ? 0.4958 0.9593 0.6952 -0.0008 -0.0630 0.1366  145 VAL B CG1 
2320 C CG2 . VAL C 147 ? 0.4881 0.8754 0.6653 -0.0317 -0.0407 0.1269  145 VAL B CG2 
2321 N N   . LYS C 148 ? 0.9830 1.6053 1.2513 0.0596  -0.0520 0.1406  146 LYS B N   
2322 C CA  . LYS C 148 ? 0.9861 1.5277 1.2317 0.0837  -0.0442 0.1329  146 LYS B CA  
2323 C C   . LYS C 148 ? 0.9686 1.5141 1.2214 0.1014  -0.0288 0.1270  146 LYS B C   
2324 O O   . LYS C 148 ? 1.3744 1.8760 1.6135 0.1329  -0.0251 0.1212  146 LYS B O   
2325 C CB  . LYS C 148 ? 1.0269 1.5316 1.2561 0.1181  -0.0548 0.1334  146 LYS B CB  
2326 C CG  . LYS C 148 ? 1.0448 1.4635 1.2403 0.1042  -0.0585 0.1318  146 LYS B CG  
2327 C CD  . LYS C 148 ? 1.1014 1.4822 1.2762 0.1369  -0.0695 0.1344  146 LYS B CD  
2328 C CE  . LYS C 148 ? 1.1318 1.5012 1.2916 0.1216  -0.0842 0.1411  146 LYS B CE  
2329 N NZ  . LYS C 148 ? 1.1654 1.4535 1.2887 0.1150  -0.0860 0.1405  146 LYS B NZ  
2330 N N   . SEP D 7   ? 1.3805 0.9217 1.2586 0.0392  0.1073  0.2422  6   SEP D N   
2331 C CA  . SEP D 7   ? 1.3268 0.9072 1.2533 0.0560  0.1191  0.2712  6   SEP D CA  
2332 C CB  . SEP D 7   ? 1.3335 0.8915 1.2552 0.1025  0.1417  0.2813  6   SEP D CB  
2333 O OG  . SEP D 7   ? 1.3711 0.9658 1.2914 0.1168  0.1423  0.2698  6   SEP D OG  
2334 C C   . SEP D 7   ? 1.2331 0.8989 1.2024 0.0417  0.1099  0.2735  6   SEP D C   
2335 O O   . SEP D 7   ? 1.1961 0.8993 1.2044 0.0391  0.1118  0.2967  6   SEP D O   
2336 P P   . SEP D 7   ? 1.5550 1.0926 1.4176 0.1327  0.1500  0.2445  6   SEP D P   
2337 O O1P . SEP D 7   ? 1.4562 1.0415 1.3227 0.1445  0.1476  0.2363  6   SEP D O1P 
2338 O O2P . SEP D 7   ? 1.5797 1.0562 1.4236 0.1702  0.1750  0.2552  6   SEP D O2P 
2339 O O3P . SEP D 7   ? 1.5959 1.0907 1.4166 0.0974  0.1324  0.2183  6   SEP D O3P 
2340 N N   . ASP D 8   ? 0.8493 0.5433 0.8115 0.0310  0.0985  0.2494  7   ASP D N   
2341 C CA  . ASP D 8   ? 0.7537 0.5266 0.7572 0.0162  0.0867  0.2446  7   ASP D CA  
2342 C C   . ASP D 8   ? 0.7572 0.5559 0.7680 -0.0266 0.0719  0.2356  7   ASP D C   
2343 O O   . ASP D 8   ? 0.8103 0.5650 0.7879 -0.0465 0.0656  0.2294  7   ASP D O   
2344 C CB  . ASP D 8   ? 0.7216 0.5135 0.7207 0.0248  0.0795  0.2240  7   ASP D CB  
2345 C CG  . ASP D 8   ? 0.6201 0.4922 0.6692 0.0187  0.0667  0.2195  7   ASP D CG  
2346 O OD1 . ASP D 8   ? 0.6257 0.5371 0.7100 0.0170  0.0678  0.2348  7   ASP D OD1 
2347 O OD2 . ASP D 8   ? 0.6684 0.5620 0.7220 0.0147  0.0542  0.2006  7   ASP D OD2 
2348 N N   . GLU D 9   ? 0.7534 0.6243 0.8069 -0.0407 0.0652  0.2352  8   GLU D N   
2349 C CA  . GLU D 9   ? 0.7624 0.6745 0.8271 -0.0809 0.0521  0.2235  8   GLU D CA  
2350 C C   . GLU D 9   ? 0.7882 0.6970 0.8327 -0.0965 0.0392  0.1975  8   GLU D C   
2351 O O   . GLU D 9   ? 0.7750 0.6685 0.8089 -0.0776 0.0386  0.1862  8   GLU D O   
2352 C CB  . GLU D 9   ? 0.7059 0.6989 0.8204 -0.0874 0.0497  0.2229  8   GLU D CB  
2353 C CG  . GLU D 9   ? 0.7390 0.7473 0.8720 -0.0979 0.0560  0.2481  8   GLU D CG  
2354 C CD  . GLU D 9   ? 0.7686 0.8551 0.9448 -0.1061 0.0530  0.2433  8   GLU D CD  
2355 O OE1 . GLU D 9   ? 0.7318 0.8706 0.9230 -0.1275 0.0439  0.2179  8   GLU D OE1 
2356 O OE2 . GLU D 9   ? 0.7574 0.8526 0.9526 -0.0903 0.0593  0.2650  8   GLU D OE2 
2357 N N   . ASP D 10  ? 0.6626 0.5880 0.7023 -0.1337 0.0272  0.1908  9   ASP D N   
2358 C CA  . ASP D 10  ? 0.6875 0.6267 0.7192 -0.1534 0.0128  0.1694  9   ASP D CA  
2359 C C   . ASP D 10  ? 0.6156 0.6361 0.6995 -0.1519 0.0096  0.1536  9   ASP D C   
2360 O O   . ASP D 10  ? 0.5679 0.6406 0.6894 -0.1493 0.0150  0.1579  9   ASP D O   
2361 C CB  . ASP D 10  ? 0.7419 0.6839 0.7569 -0.1949 -0.0009 0.1711  9   ASP D CB  
2362 C CG  . ASP D 10  ? 0.8264 0.6860 0.7926 -0.1992 -0.0037 0.1868  9   ASP D CG  
2363 O OD1 . ASP D 10  ? 0.8892 0.7576 0.8542 -0.2291 -0.0132 0.1992  9   ASP D OD1 
2364 O OD2 . ASP D 10  ? 0.8491 0.6372 0.7795 -0.1737 0.0023  0.1862  9   ASP D OD2 
2365 N N   . LEU D 11  ? 0.5857 0.6148 0.6722 -0.1556 -0.0012 0.1356  10  LEU D N   
2366 C CA  . LEU D 11  ? 0.5174 0.6223 0.6580 -0.1570 -0.0085 0.1178  10  LEU D CA  
2367 C C   . LEU D 11  ? 0.4967 0.6696 0.6664 -0.1868 -0.0112 0.1110  10  LEU D C   
2368 O O   . LEU D 11  ? 0.5445 0.7136 0.6934 -0.2173 -0.0185 0.1112  10  LEU D O   
2369 C CB  . LEU D 11  ? 0.5582 0.6532 0.6959 -0.1618 -0.0224 0.1028  10  LEU D CB  
2370 C CG  . LEU D 11  ? 0.4588 0.6297 0.6569 -0.1684 -0.0348 0.0824  10  LEU D CG  
2371 C CD1 . LEU D 11  ? 0.3364 0.5488 0.5824 -0.1388 -0.0336 0.0793  10  LEU D CD1 
2372 C CD2 . LEU D 11  ? 0.4582 0.6082 0.6484 -0.1804 -0.0505 0.0735  10  LEU D CD2 
2373 N N   . LEU D 12  ? 0.5776 0.8138 0.7938 -0.1786 -0.0063 0.1057  11  LEU D N   
2374 C CA  . LEU D 12  ? 0.5504 0.8640 0.8001 -0.2046 -0.0071 0.0934  11  LEU D CA  
2375 C C   . LEU D 12  ? 0.5575 0.9146 0.8340 -0.2196 -0.0195 0.0698  11  LEU D C   
2376 O O   . LEU D 12  ? 0.4972 0.8784 0.8116 -0.2018 -0.0264 0.0536  11  LEU D O   
2377 C CB  . LEU D 12  ? 0.4420 0.8074 0.7334 -0.1883 0.0002  0.0901  11  LEU D CB  
2378 C CG  . LEU D 12  ? 0.4148 0.8570 0.7339 -0.2137 0.0047  0.0798  11  LEU D CG  
2379 C CD1 . LEU D 12  ? 0.4698 0.8982 0.7536 -0.2470 0.0089  0.0995  11  LEU D CD1 
2380 C CD2 . LEU D 12  ? 0.3310 0.8084 0.6828 -0.1940 0.0106  0.0783  11  LEU D CD2 
2381 N N   . GLU D 13  ? 0.9265 1.2944 1.1861 -0.2538 -0.0249 0.0705  12  GLU D N   
2382 C CA  . GLU D 13  ? 0.9617 1.3619 1.2415 -0.2710 -0.0375 0.0545  12  GLU D CA  
2383 C C   . GLU D 13  ? 0.8827 1.3844 1.2254 -0.2782 -0.0354 0.0305  12  GLU D C   
2384 O O   . GLU D 13  ? 0.8312 1.3764 1.1999 -0.2686 -0.0246 0.0238  12  GLU D O   
2385 C CB  . GLU D 13  ? 1.0731 1.4408 1.3063 -0.3051 -0.0474 0.0690  12  GLU D CB  
2386 C CG  . GLU D 13  ? 1.2256 1.4874 1.3939 -0.2983 -0.0518 0.0880  12  GLU D CG  
2387 C CD  . GLU D 13  ? 1.2918 1.5114 1.4519 -0.2880 -0.0619 0.0816  12  GLU D CD  
2388 O OE1 . GLU D 13  ? 1.2847 1.5474 1.4779 -0.3018 -0.0726 0.0695  12  GLU D OE1 
2389 O OE2 . GLU D 13  ? 1.3536 1.4973 1.4740 -0.2683 -0.0592 0.0896  12  GLU D OE2 
2390 O OXT . GLU D 13  ? 0.8774 1.4195 1.2474 -0.2932 -0.0444 0.0167  12  GLU D OXT 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -1  ?   ?   ?   A . n 
A 1 2   SER 2   0   ?   ?   ?   A . n 
A 1 3   MET 3   1   ?   ?   ?   A . n 
A 1 4   GLU 4   2   ?   ?   ?   A . n 
A 1 5   PRO 5   3   ?   ?   ?   A . n 
A 1 6   ALA 6   4   ?   ?   ?   A . n 
A 1 7   MET 7   5   ?   ?   ?   A . n 
A 1 8   GLU 8   6   ?   ?   ?   A . n 
A 1 9   PRO 9   7   7   PRO PRO A . n 
A 1 10  GLU 10  8   8   GLU GLU A . n 
A 1 11  THR 11  9   9   THR THR A . n 
A 1 12  LEU 12  10  10  LEU LEU A . n 
A 1 13  GLU 13  11  11  GLU GLU A . n 
A 1 14  ALA 14  12  12  ALA ALA A . n 
A 1 15  ARG 15  13  13  ARG ARG A . n 
A 1 16  ILE 16  14  14  ILE ILE A . n 
A 1 17  ASN 17  15  15  ASN ASN A . n 
A 1 18  ARG 18  16  16  ARG ARG A . n 
A 1 19  ALA 19  17  17  ALA ALA A . n 
A 1 20  THR 20  18  18  THR THR A . n 
A 1 21  ASN 21  19  19  ASN ASN A . n 
A 1 22  PRO 22  20  20  PRO PRO A . n 
A 1 23  LEU 23  21  21  LEU LEU A . n 
A 1 24  ASN 24  22  22  ASN ASN A . n 
A 1 25  LYS 25  23  23  LYS LYS A . n 
A 1 26  GLU 26  24  24  GLU GLU A . n 
A 1 27  LEU 27  25  25  LEU LEU A . n 
A 1 28  ASP 28  26  26  ASP ASP A . n 
A 1 29  TRP 29  27  27  TRP TRP A . n 
A 1 30  ALA 30  28  28  ALA ALA A . n 
A 1 31  SER 31  29  29  SER SER A . n 
A 1 32  ILE 32  30  30  ILE ILE A . n 
A 1 33  ASN 33  31  31  ASN ASN A . n 
A 1 34  GLY 34  32  32  GLY GLY A . n 
A 1 35  PHE 35  33  33  PHE PHE A . n 
A 1 36  CYS 36  34  34  CYS CYS A . n 
A 1 37  GLU 37  35  35  GLU GLU A . n 
A 1 38  GLN 38  36  36  GLN GLN A . n 
A 1 39  LEU 39  37  37  LEU LEU A . n 
A 1 40  ASN 40  38  38  ASN ASN A . n 
A 1 41  GLU 41  39  39  GLU GLU A . n 
A 1 42  ASP 42  40  40  ASP ASP A . n 
A 1 43  PHE 43  41  41  PHE PHE A . n 
A 1 44  GLU 44  42  42  GLU GLU A . n 
A 1 45  GLY 45  43  43  GLY GLY A . n 
A 1 46  PRO 46  44  44  PRO PRO A . n 
A 1 47  PRO 47  45  45  PRO PRO A . n 
A 1 48  LEU 48  46  46  LEU LEU A . n 
A 1 49  ALA 49  47  47  ALA ALA A . n 
A 1 50  THR 50  48  48  THR THR A . n 
A 1 51  ARG 51  49  49  ARG ARG A . n 
A 1 52  LEU 52  50  50  LEU LEU A . n 
A 1 53  LEU 53  51  51  LEU LEU A . n 
A 1 54  ALA 54  52  52  ALA ALA A . n 
A 1 55  HIS 55  53  53  HIS HIS A . n 
A 1 56  LYS 56  54  54  LYS LYS A . n 
A 1 57  ILE 57  55  55  ILE ILE A . n 
A 1 58  GLN 58  56  56  GLN GLN A . n 
A 1 59  SER 59  57  57  SER SER A . n 
A 1 60  PRO 60  58  58  PRO PRO A . n 
A 1 61  GLN 61  59  59  GLN GLN A . n 
A 1 62  GLU 62  60  60  GLU GLU A . n 
A 1 63  TRP 63  61  61  TRP TRP A . n 
A 1 64  GLU 64  62  62  GLU GLU A . n 
A 1 65  ALA 65  63  63  ALA ALA A . n 
A 1 66  ILE 66  64  64  ILE ILE A . n 
A 1 67  GLN 67  65  65  GLN GLN A . n 
A 1 68  ALA 68  66  66  ALA ALA A . n 
A 1 69  LEU 69  67  67  LEU LEU A . n 
A 1 70  THR 70  68  68  THR THR A . n 
A 1 71  VAL 71  69  69  VAL VAL A . n 
A 1 72  LEU 72  70  70  LEU LEU A . n 
A 1 73  GLU 73  71  71  GLU GLU A . n 
A 1 74  THR 74  72  72  THR THR A . n 
A 1 75  CYS 75  73  73  CYS CYS A . n 
A 1 76  MET 76  74  74  MET MET A . n 
A 1 77  LYS 77  75  75  LYS LYS A . n 
A 1 78  SER 78  76  76  SER SER A . n 
A 1 79  CYS 79  77  77  CYS CYS A . n 
A 1 80  GLY 80  78  78  GLY GLY A . n 
A 1 81  LYS 81  79  79  LYS LYS A . n 
A 1 82  ARG 82  80  80  ARG ARG A . n 
A 1 83  PHE 83  81  81  PHE PHE A . n 
A 1 84  HIS 84  82  82  HIS HIS A . n 
A 1 85  ASP 85  83  83  ASP ASP A . n 
A 1 86  GLU 86  84  84  GLU GLU A . n 
A 1 87  VAL 87  85  85  VAL VAL A . n 
A 1 88  GLY 88  86  86  GLY GLY A . n 
A 1 89  LYS 89  87  87  LYS LYS A . n 
A 1 90  PHE 90  88  88  PHE PHE A . n 
A 1 91  ARG 91  89  89  ARG ARG A . n 
A 1 92  PHE 92  90  90  PHE PHE A . n 
A 1 93  LEU 93  91  91  LEU LEU A . n 
A 1 94  ASN 94  92  92  ASN ASN A . n 
A 1 95  GLU 95  93  93  GLU GLU A . n 
A 1 96  LEU 96  94  94  LEU LEU A . n 
A 1 97  ILE 97  95  95  ILE ILE A . n 
A 1 98  LYS 98  96  96  LYS LYS A . n 
A 1 99  VAL 99  97  97  VAL VAL A . n 
A 1 100 VAL 100 98  98  VAL VAL A . n 
A 1 101 SER 101 99  99  SER SER A . n 
A 1 102 PRO 102 100 100 PRO PRO A . n 
A 1 103 LYS 103 101 101 LYS LYS A . n 
A 1 104 TYR 104 102 102 TYR TYR A . n 
A 1 105 LEU 105 103 103 LEU LEU A . n 
A 1 106 GLY 106 104 104 GLY GLY A . n 
A 1 107 SER 107 105 105 SER SER A . n 
A 1 108 ARG 108 106 106 ARG ARG A . n 
A 1 109 THR 109 107 107 THR THR A . n 
A 1 110 SER 110 108 108 SER SER A . n 
A 1 111 GLU 111 109 109 GLU GLU A . n 
A 1 112 LYS 112 110 110 LYS LYS A . n 
A 1 113 VAL 113 111 111 VAL VAL A . n 
A 1 114 LYS 114 112 112 LYS LYS A . n 
A 1 115 ASN 115 113 113 ASN ASN A . n 
A 1 116 LYS 116 114 114 LYS LYS A . n 
A 1 117 ILE 117 115 115 ILE ILE A . n 
A 1 118 LEU 118 116 116 LEU LEU A . n 
A 1 119 GLU 119 117 117 GLU GLU A . n 
A 1 120 LEU 120 118 118 LEU LEU A . n 
A 1 121 LEU 121 119 119 LEU LEU A . n 
A 1 122 TYR 122 120 120 TYR TYR A . n 
A 1 123 SER 123 121 121 SER SER A . n 
A 1 124 TRP 124 122 122 TRP TRP A . n 
A 1 125 THR 125 123 123 THR THR A . n 
A 1 126 VAL 126 124 124 VAL VAL A . n 
A 1 127 GLY 127 125 125 GLY GLY A . n 
A 1 128 LEU 128 126 126 LEU LEU A . n 
A 1 129 PRO 129 127 127 PRO PRO A . n 
A 1 130 GLU 130 128 128 GLU GLU A . n 
A 1 131 GLU 131 129 129 GLU GLU A . n 
A 1 132 VAL 132 130 130 VAL VAL A . n 
A 1 133 LYS 133 131 131 LYS LYS A . n 
A 1 134 ILE 134 132 132 ILE ILE A . n 
A 1 135 ALA 135 133 133 ALA ALA A . n 
A 1 136 GLU 136 134 134 GLU GLU A . n 
A 1 137 ALA 137 135 135 ALA ALA A . n 
A 1 138 TYR 138 136 136 TYR TYR A . n 
A 1 139 GLN 139 137 137 GLN GLN A . n 
A 1 140 MET 140 138 138 MET MET A . n 
A 1 141 LEU 141 139 139 LEU LEU A . n 
A 1 142 LYS 142 140 140 LYS LYS A . n 
A 1 143 LYS 143 141 141 LYS LYS A . n 
A 1 144 GLN 144 142 142 GLN GLN A . n 
A 1 145 GLY 145 143 143 GLY GLY A . n 
A 1 146 ILE 146 144 144 ILE ILE A . n 
A 1 147 VAL 147 145 145 VAL VAL A . n 
A 1 148 LYS 148 146 146 LYS LYS A . n 
A 1 149 SER 149 147 ?   ?   ?   A . n 
B 2 1   SER 1   0   ?   ?   ?   C . n 
B 2 2   GLY 2   1   ?   ?   ?   C . n 
B 2 3   TYR 3   2   ?   ?   ?   C . n 
B 2 4   HIS 4   3   ?   ?   ?   C . n 
B 2 5   ASP 5   4   4   ASP ASP C . n 
B 2 6   ASP 6   5   5   ASP ASP C . n 
B 2 7   SEP 7   6   6   SEP SEP C . n 
B 2 8   ASP 8   7   7   ASP ASP C . n 
B 2 9   GLU 9   8   8   GLU GLU C . n 
B 2 10  ASP 10  9   9   ASP ASP C . n 
B 2 11  LEU 11  10  10  LEU LEU C . n 
B 2 12  LEU 12  11  11  LEU LEU C . n 
B 2 13  GLU 13  12  12  GLU GLU C . n 
C 1 1   GLY 1   -1  ?   ?   ?   B . n 
C 1 2   SER 2   0   ?   ?   ?   B . n 
C 1 3   MET 3   1   ?   ?   ?   B . n 
C 1 4   GLU 4   2   ?   ?   ?   B . n 
C 1 5   PRO 5   3   ?   ?   ?   B . n 
C 1 6   ALA 6   4   ?   ?   ?   B . n 
C 1 7   MET 7   5   ?   ?   ?   B . n 
C 1 8   GLU 8   6   ?   ?   ?   B . n 
C 1 9   PRO 9   7   7   PRO PRO B . n 
C 1 10  GLU 10  8   8   GLU GLU B . n 
C 1 11  THR 11  9   9   THR THR B . n 
C 1 12  LEU 12  10  10  LEU LEU B . n 
C 1 13  GLU 13  11  11  GLU GLU B . n 
C 1 14  ALA 14  12  12  ALA ALA B . n 
C 1 15  ARG 15  13  13  ARG ARG B . n 
C 1 16  ILE 16  14  14  ILE ILE B . n 
C 1 17  ASN 17  15  15  ASN ASN B . n 
C 1 18  ARG 18  16  16  ARG ARG B . n 
C 1 19  ALA 19  17  17  ALA ALA B . n 
C 1 20  THR 20  18  18  THR THR B . n 
C 1 21  ASN 21  19  19  ASN ASN B . n 
C 1 22  PRO 22  20  20  PRO PRO B . n 
C 1 23  LEU 23  21  21  LEU LEU B . n 
C 1 24  ASN 24  22  22  ASN ASN B . n 
C 1 25  LYS 25  23  23  LYS LYS B . n 
C 1 26  GLU 26  24  24  GLU GLU B . n 
C 1 27  LEU 27  25  25  LEU LEU B . n 
C 1 28  ASP 28  26  26  ASP ASP B . n 
C 1 29  TRP 29  27  27  TRP TRP B . n 
C 1 30  ALA 30  28  28  ALA ALA B . n 
C 1 31  SER 31  29  29  SER SER B . n 
C 1 32  ILE 32  30  30  ILE ILE B . n 
C 1 33  ASN 33  31  31  ASN ASN B . n 
C 1 34  GLY 34  32  32  GLY GLY B . n 
C 1 35  PHE 35  33  33  PHE PHE B . n 
C 1 36  CYS 36  34  34  CYS CYS B . n 
C 1 37  GLU 37  35  35  GLU GLU B . n 
C 1 38  GLN 38  36  36  GLN GLN B . n 
C 1 39  LEU 39  37  37  LEU LEU B . n 
C 1 40  ASN 40  38  38  ASN ASN B . n 
C 1 41  GLU 41  39  39  GLU GLU B . n 
C 1 42  ASP 42  40  40  ASP ASP B . n 
C 1 43  PHE 43  41  41  PHE PHE B . n 
C 1 44  GLU 44  42  42  GLU GLU B . n 
C 1 45  GLY 45  43  43  GLY GLY B . n 
C 1 46  PRO 46  44  44  PRO PRO B . n 
C 1 47  PRO 47  45  45  PRO PRO B . n 
C 1 48  LEU 48  46  46  LEU LEU B . n 
C 1 49  ALA 49  47  47  ALA ALA B . n 
C 1 50  THR 50  48  48  THR THR B . n 
C 1 51  ARG 51  49  49  ARG ARG B . n 
C 1 52  LEU 52  50  50  LEU LEU B . n 
C 1 53  LEU 53  51  51  LEU LEU B . n 
C 1 54  ALA 54  52  52  ALA ALA B . n 
C 1 55  HIS 55  53  53  HIS HIS B . n 
C 1 56  LYS 56  54  54  LYS LYS B . n 
C 1 57  ILE 57  55  55  ILE ILE B . n 
C 1 58  GLN 58  56  56  GLN GLN B . n 
C 1 59  SER 59  57  57  SER SER B . n 
C 1 60  PRO 60  58  58  PRO PRO B . n 
C 1 61  GLN 61  59  59  GLN GLN B . n 
C 1 62  GLU 62  60  60  GLU GLU B . n 
C 1 63  TRP 63  61  61  TRP TRP B . n 
C 1 64  GLU 64  62  62  GLU GLU B . n 
C 1 65  ALA 65  63  63  ALA ALA B . n 
C 1 66  ILE 66  64  64  ILE ILE B . n 
C 1 67  GLN 67  65  65  GLN GLN B . n 
C 1 68  ALA 68  66  66  ALA ALA B . n 
C 1 69  LEU 69  67  67  LEU LEU B . n 
C 1 70  THR 70  68  68  THR THR B . n 
C 1 71  VAL 71  69  69  VAL VAL B . n 
C 1 72  LEU 72  70  70  LEU LEU B . n 
C 1 73  GLU 73  71  71  GLU GLU B . n 
C 1 74  THR 74  72  72  THR THR B . n 
C 1 75  CYS 75  73  73  CYS CYS B . n 
C 1 76  MET 76  74  74  MET MET B . n 
C 1 77  LYS 77  75  75  LYS LYS B . n 
C 1 78  SER 78  76  76  SER SER B . n 
C 1 79  CYS 79  77  77  CYS CYS B . n 
C 1 80  GLY 80  78  78  GLY GLY B . n 
C 1 81  LYS 81  79  79  LYS LYS B . n 
C 1 82  ARG 82  80  80  ARG ARG B . n 
C 1 83  PHE 83  81  81  PHE PHE B . n 
C 1 84  HIS 84  82  82  HIS HIS B . n 
C 1 85  ASP 85  83  83  ASP ASP B . n 
C 1 86  GLU 86  84  84  GLU GLU B . n 
C 1 87  VAL 87  85  85  VAL VAL B . n 
C 1 88  GLY 88  86  86  GLY GLY B . n 
C 1 89  LYS 89  87  87  LYS LYS B . n 
C 1 90  PHE 90  88  88  PHE PHE B . n 
C 1 91  ARG 91  89  89  ARG ARG B . n 
C 1 92  PHE 92  90  90  PHE PHE B . n 
C 1 93  LEU 93  91  91  LEU LEU B . n 
C 1 94  ASN 94  92  92  ASN ASN B . n 
C 1 95  GLU 95  93  93  GLU GLU B . n 
C 1 96  LEU 96  94  94  LEU LEU B . n 
C 1 97  ILE 97  95  95  ILE ILE B . n 
C 1 98  LYS 98  96  96  LYS LYS B . n 
C 1 99  VAL 99  97  97  VAL VAL B . n 
C 1 100 VAL 100 98  98  VAL VAL B . n 
C 1 101 SER 101 99  99  SER SER B . n 
C 1 102 PRO 102 100 100 PRO PRO B . n 
C 1 103 LYS 103 101 101 LYS LYS B . n 
C 1 104 TYR 104 102 102 TYR TYR B . n 
C 1 105 LEU 105 103 103 LEU LEU B . n 
C 1 106 GLY 106 104 104 GLY GLY B . n 
C 1 107 SER 107 105 105 SER SER B . n 
C 1 108 ARG 108 106 106 ARG ARG B . n 
C 1 109 THR 109 107 107 THR THR B . n 
C 1 110 SER 110 108 108 SER SER B . n 
C 1 111 GLU 111 109 109 GLU GLU B . n 
C 1 112 LYS 112 110 110 LYS LYS B . n 
C 1 113 VAL 113 111 111 VAL VAL B . n 
C 1 114 LYS 114 112 112 LYS LYS B . n 
C 1 115 ASN 115 113 113 ASN ASN B . n 
C 1 116 LYS 116 114 114 LYS LYS B . n 
C 1 117 ILE 117 115 115 ILE ILE B . n 
C 1 118 LEU 118 116 116 LEU LEU B . n 
C 1 119 GLU 119 117 117 GLU GLU B . n 
C 1 120 LEU 120 118 118 LEU LEU B . n 
C 1 121 LEU 121 119 119 LEU LEU B . n 
C 1 122 TYR 122 120 120 TYR TYR B . n 
C 1 123 SER 123 121 121 SER SER B . n 
C 1 124 TRP 124 122 122 TRP TRP B . n 
C 1 125 THR 125 123 123 THR THR B . n 
C 1 126 VAL 126 124 124 VAL VAL B . n 
C 1 127 GLY 127 125 125 GLY GLY B . n 
C 1 128 LEU 128 126 126 LEU LEU B . n 
C 1 129 PRO 129 127 127 PRO PRO B . n 
C 1 130 GLU 130 128 128 GLU GLU B . n 
C 1 131 GLU 131 129 129 GLU GLU B . n 
C 1 132 VAL 132 130 130 VAL VAL B . n 
C 1 133 LYS 133 131 131 LYS LYS B . n 
C 1 134 ILE 134 132 132 ILE ILE B . n 
C 1 135 ALA 135 133 133 ALA ALA B . n 
C 1 136 GLU 136 134 134 GLU GLU B . n 
C 1 137 ALA 137 135 135 ALA ALA B . n 
C 1 138 TYR 138 136 136 TYR TYR B . n 
C 1 139 GLN 139 137 137 GLN GLN B . n 
C 1 140 MET 140 138 138 MET MET B . n 
C 1 141 LEU 141 139 139 LEU LEU B . n 
C 1 142 LYS 142 140 140 LYS LYS B . n 
C 1 143 LYS 143 141 141 LYS LYS B . n 
C 1 144 GLN 144 142 142 GLN GLN B . n 
C 1 145 GLY 145 143 143 GLY GLY B . n 
C 1 146 ILE 146 144 144 ILE ILE B . n 
C 1 147 VAL 147 145 145 VAL VAL B . n 
C 1 148 LYS 148 146 146 LYS LYS B . n 
C 1 149 SER 149 147 ?   ?   ?   B . n 
D 2 1   SER 1   0   ?   ?   ?   D . n 
D 2 2   GLY 2   1   ?   ?   ?   D . n 
D 2 3   TYR 3   2   ?   ?   ?   D . n 
D 2 4   HIS 4   3   ?   ?   ?   D . n 
D 2 5   ASP 5   4   ?   ?   ?   D . n 
D 2 6   ASP 6   5   ?   ?   ?   D . n 
D 2 7   SEP 7   6   6   SEP SEP D . n 
D 2 8   ASP 8   7   7   ASP ASP D . n 
D 2 9   GLU 9   8   8   GLU GLU D . n 
D 2 10  ASP 10  9   9   ASP ASP D . n 
D 2 11  LEU 11  10  10  LEU LEU D . n 
D 2 12  LEU 12  11  11  LEU LEU D . n 
D 2 13  GLU 13  12  12  GLU GLU D . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 B SEP 7 C SEP 6 ? SER PHOSPHOSERINE 
2 D SEP 7 D SEP 6 ? SER PHOSPHOSERINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F,G,J,K 
2 1 C,D,H,I,L,M   
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 980  ? 
1 MORE         -2   ? 
1 'SSA (A^2)'  8010 ? 
2 'ABSA (A^2)' 930  ? 
2 MORE         -3   ? 
2 'SSA (A^2)'  7860 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-12-15 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2014-02-05 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Database references'       
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 8.3888  -9.3470  -4.2942  0.0606 0.2754 0.2077 0.0077  -0.0010 0.0024  1.0642 2.1844 1.9351 0.7337 0.0435  -0.1132 
0.1019  -0.2158 0.1214  -0.0748 0.0246  0.1289 -0.0104 -0.1789 -0.0152 'X-RAY DIFFRACTION' 
2 ? refined 7.3207  -1.5953  -28.8138 0.1964 0.1958 0.2430 0.0221  0.0398  0.0740  1.6214 1.5301 6.1543 0.2489 0.7410  -0.2853 
-0.1072 0.1053  -0.0074 0.0744  0.0210  0.1141 -0.1719 0.0691  -0.0113 'X-RAY DIFFRACTION' 
3 ? refined -8.1520 -13.6475 -6.9545  0.3225 0.5189 0.5326 0.0438  -0.0918 -0.0774 0.2582 0.2475 0.1351 0.2425 -0.1825 -0.1367 
0.1247  -0.1408 -0.1944 0.3424  -0.1909 1.3551 -0.1275 -0.3416 -0.6048 'X-RAY DIFFRACTION' 
4 ? refined 1.3447  -17.2937 -30.4173 0.5041 0.4831 0.5782 -0.1170 0.0232  0.1696  2.5867 1.5916 1.4205 2.1087 2.5236  -1.8002 
0.2295  -0.5064 0.3880  -0.3983 -0.3151 0.0536 -0.5845 1.2200  -0.5876 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.pdbx_refine_id 
1 1 ? ? ? ? ? ? ? ? ? 'chain A' 'X-RAY DIFFRACTION' 
2 2 ? ? ? ? ? ? ? ? ? 'chain B' 'X-RAY DIFFRACTION' 
3 3 ? ? ? ? ? ? ? ? ? 'chain C' 'X-RAY DIFFRACTION' 
4 4 ? ? ? ? ? ? ? ? ? 'chain D' 'X-RAY DIFFRACTION' 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
PHENIX      ?     ?               package 'Paul D. Adams' PDAdams@lbl.gov       refinement        http://www.phenix-online.org/ 
C++ ? 1 
PDB_EXTRACT 3.006 'June 11, 2008' package PDB             help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 2 
XDS         .     ?               ?       ?               ?                     'data scaling'    ? ?   ? 3 
XDS         .     ?               ?       ?               ?                     'data reduction'  ? ?   ? 4 
XSCALE      .     ?               ?       ?               ?                     'data scaling'    ? ?   ? 5 
PHASER      .     ?               ?       ?               ?                     phasing           ? ?   ? 6 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR A 102 ? ? -112.04 -103.20 
2 1 TYR B 102 ? ? -123.09 -101.46 
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 CYS A 77  ? ? GLY A 78  ? ? 128.75 
2 1 GLY A 78  ? ? LYS A 79  ? ? 119.18 
3 1 VAL A 145 ? ? LYS A 146 ? ? 68.00  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -1  ? A GLY 1   
2  1 Y 1 A SER 0   ? A SER 2   
3  1 Y 1 A MET 1   ? A MET 3   
4  1 Y 1 A GLU 2   ? A GLU 4   
5  1 Y 1 A PRO 3   ? A PRO 5   
6  1 Y 1 A ALA 4   ? A ALA 6   
7  1 Y 1 A MET 5   ? A MET 7   
8  1 Y 1 A GLU 6   ? A GLU 8   
9  1 Y 1 A SER 147 ? A SER 149 
10 1 Y 1 C SER 0   ? B SER 1   
11 1 Y 1 C GLY 1   ? B GLY 2   
12 1 Y 1 C TYR 2   ? B TYR 3   
13 1 Y 1 C HIS 3   ? B HIS 4   
14 1 Y 1 B GLY -1  ? C GLY 1   
15 1 Y 1 B SER 0   ? C SER 2   
16 1 Y 1 B MET 1   ? C MET 3   
17 1 Y 1 B GLU 2   ? C GLU 4   
18 1 Y 1 B PRO 3   ? C PRO 5   
19 1 Y 1 B ALA 4   ? C ALA 6   
20 1 Y 1 B MET 5   ? C MET 7   
21 1 Y 1 B GLU 6   ? C GLU 8   
22 1 Y 1 B SER 147 ? C SER 149 
23 1 Y 1 D SER 0   ? D SER 1   
24 1 Y 1 D GLY 1   ? D GLY 2   
25 1 Y 1 D TYR 2   ? D TYR 3   
26 1 Y 1 D HIS 3   ? D HIS 4   
27 1 Y 1 D ASP 4   ? D ASP 5   
28 1 Y 1 D ASP 5   ? D ASP 6   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'IODIDE ION' IOD 
4 water        HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 IOD 1  148 2   IOD IOD A . 
F 3 IOD 1  149 3   IOD IOD A . 
G 3 IOD 1  150 4   IOD IOD A . 
H 3 IOD 1  148 1   IOD IOD B . 
I 3 IOD 1  149 5   IOD IOD B . 
J 4 HOH 1  151 1   HOH HOH A . 
J 4 HOH 2  152 152 HOH HOH A . 
J 4 HOH 3  153 2   HOH HOH A . 
J 4 HOH 4  154 5   HOH HOH A . 
J 4 HOH 5  155 6   HOH HOH A . 
J 4 HOH 6  156 9   HOH HOH A . 
J 4 HOH 7  157 12  HOH HOH A . 
J 4 HOH 8  158 14  HOH HOH A . 
J 4 HOH 9  159 16  HOH HOH A . 
J 4 HOH 10 160 19  HOH HOH A . 
J 4 HOH 11 161 20  HOH HOH A . 
J 4 HOH 12 162 21  HOH HOH A . 
J 4 HOH 13 163 23  HOH HOH A . 
J 4 HOH 14 164 24  HOH HOH A . 
J 4 HOH 15 165 26  HOH HOH A . 
J 4 HOH 16 166 27  HOH HOH A . 
J 4 HOH 17 167 28  HOH HOH A . 
J 4 HOH 18 168 29  HOH HOH A . 
J 4 HOH 19 169 32  HOH HOH A . 
J 4 HOH 20 170 33  HOH HOH A . 
J 4 HOH 21 171 34  HOH HOH A . 
J 4 HOH 22 172 35  HOH HOH A . 
J 4 HOH 23 173 38  HOH HOH A . 
J 4 HOH 24 174 41  HOH HOH A . 
J 4 HOH 25 175 44  HOH HOH A . 
J 4 HOH 26 176 45  HOH HOH A . 
J 4 HOH 27 177 47  HOH HOH A . 
J 4 HOH 28 178 49  HOH HOH A . 
J 4 HOH 29 179 51  HOH HOH A . 
J 4 HOH 30 180 53  HOH HOH A . 
J 4 HOH 31 181 56  HOH HOH A . 
J 4 HOH 32 182 58  HOH HOH A . 
J 4 HOH 33 183 60  HOH HOH A . 
J 4 HOH 34 184 61  HOH HOH A . 
J 4 HOH 35 185 63  HOH HOH A . 
J 4 HOH 36 186 64  HOH HOH A . 
J 4 HOH 37 187 65  HOH HOH A . 
J 4 HOH 38 188 69  HOH HOH A . 
J 4 HOH 39 189 70  HOH HOH A . 
J 4 HOH 40 190 71  HOH HOH A . 
J 4 HOH 41 191 72  HOH HOH A . 
J 4 HOH 42 192 73  HOH HOH A . 
J 4 HOH 43 193 76  HOH HOH A . 
J 4 HOH 44 194 83  HOH HOH A . 
J 4 HOH 45 195 84  HOH HOH A . 
J 4 HOH 46 196 87  HOH HOH A . 
J 4 HOH 47 197 89  HOH HOH A . 
J 4 HOH 48 198 92  HOH HOH A . 
J 4 HOH 49 199 93  HOH HOH A . 
J 4 HOH 50 200 96  HOH HOH A . 
J 4 HOH 51 201 97  HOH HOH A . 
J 4 HOH 52 202 98  HOH HOH A . 
J 4 HOH 53 203 100 HOH HOH A . 
J 4 HOH 54 204 102 HOH HOH A . 
J 4 HOH 55 205 104 HOH HOH A . 
J 4 HOH 56 206 105 HOH HOH A . 
J 4 HOH 57 207 106 HOH HOH A . 
J 4 HOH 58 208 107 HOH HOH A . 
J 4 HOH 59 209 109 HOH HOH A . 
J 4 HOH 60 210 111 HOH HOH A . 
J 4 HOH 61 211 112 HOH HOH A . 
J 4 HOH 62 212 114 HOH HOH A . 
J 4 HOH 63 213 115 HOH HOH A . 
J 4 HOH 64 214 116 HOH HOH A . 
J 4 HOH 65 215 117 HOH HOH A . 
J 4 HOH 66 216 124 HOH HOH A . 
J 4 HOH 67 217 126 HOH HOH A . 
J 4 HOH 68 218 129 HOH HOH A . 
J 4 HOH 69 219 130 HOH HOH A . 
J 4 HOH 70 220 131 HOH HOH A . 
J 4 HOH 71 221 132 HOH HOH A . 
J 4 HOH 72 222 133 HOH HOH A . 
J 4 HOH 73 223 137 HOH HOH A . 
J 4 HOH 74 224 138 HOH HOH A . 
J 4 HOH 75 225 140 HOH HOH A . 
J 4 HOH 76 226 143 HOH HOH A . 
J 4 HOH 77 227 144 HOH HOH A . 
J 4 HOH 78 228 147 HOH HOH A . 
J 4 HOH 79 229 148 HOH HOH A . 
K 4 HOH 1  55  55  HOH HOH C . 
K 4 HOH 2  81  81  HOH HOH C . 
K 4 HOH 3  82  82  HOH HOH C . 
K 4 HOH 4  86  86  HOH HOH C . 
K 4 HOH 5  95  95  HOH HOH C . 
K 4 HOH 6  145 145 HOH HOH C . 
L 4 HOH 1  150 150 HOH HOH B . 
L 4 HOH 2  151 151 HOH HOH B . 
L 4 HOH 3  152 3   HOH HOH B . 
L 4 HOH 4  153 153 HOH HOH B . 
L 4 HOH 5  154 154 HOH HOH B . 
L 4 HOH 6  155 4   HOH HOH B . 
L 4 HOH 7  156 7   HOH HOH B . 
L 4 HOH 8  157 10  HOH HOH B . 
L 4 HOH 9  158 11  HOH HOH B . 
L 4 HOH 10 159 13  HOH HOH B . 
L 4 HOH 11 160 15  HOH HOH B . 
L 4 HOH 12 161 17  HOH HOH B . 
L 4 HOH 13 162 18  HOH HOH B . 
L 4 HOH 14 163 22  HOH HOH B . 
L 4 HOH 15 164 25  HOH HOH B . 
L 4 HOH 16 165 30  HOH HOH B . 
L 4 HOH 17 166 31  HOH HOH B . 
L 4 HOH 18 167 36  HOH HOH B . 
L 4 HOH 19 168 37  HOH HOH B . 
L 4 HOH 20 169 39  HOH HOH B . 
L 4 HOH 21 170 40  HOH HOH B . 
L 4 HOH 22 171 42  HOH HOH B . 
L 4 HOH 23 172 43  HOH HOH B . 
L 4 HOH 24 173 46  HOH HOH B . 
L 4 HOH 25 174 48  HOH HOH B . 
L 4 HOH 26 175 50  HOH HOH B . 
L 4 HOH 27 176 52  HOH HOH B . 
L 4 HOH 28 177 54  HOH HOH B . 
L 4 HOH 29 178 57  HOH HOH B . 
L 4 HOH 30 179 59  HOH HOH B . 
L 4 HOH 31 180 62  HOH HOH B . 
L 4 HOH 32 181 66  HOH HOH B . 
L 4 HOH 33 182 67  HOH HOH B . 
L 4 HOH 34 183 68  HOH HOH B . 
L 4 HOH 35 184 74  HOH HOH B . 
L 4 HOH 36 185 75  HOH HOH B . 
L 4 HOH 37 186 77  HOH HOH B . 
L 4 HOH 38 187 78  HOH HOH B . 
L 4 HOH 39 188 79  HOH HOH B . 
L 4 HOH 40 189 80  HOH HOH B . 
L 4 HOH 41 190 85  HOH HOH B . 
L 4 HOH 42 191 88  HOH HOH B . 
L 4 HOH 43 192 90  HOH HOH B . 
L 4 HOH 44 193 91  HOH HOH B . 
L 4 HOH 45 194 94  HOH HOH B . 
L 4 HOH 46 195 99  HOH HOH B . 
L 4 HOH 47 196 101 HOH HOH B . 
L 4 HOH 48 197 103 HOH HOH B . 
L 4 HOH 49 198 108 HOH HOH B . 
L 4 HOH 50 199 110 HOH HOH B . 
L 4 HOH 51 200 113 HOH HOH B . 
L 4 HOH 52 201 118 HOH HOH B . 
L 4 HOH 53 202 119 HOH HOH B . 
L 4 HOH 54 203 120 HOH HOH B . 
L 4 HOH 55 204 121 HOH HOH B . 
L 4 HOH 56 205 122 HOH HOH B . 
L 4 HOH 57 206 125 HOH HOH B . 
L 4 HOH 58 207 127 HOH HOH B . 
L 4 HOH 59 208 128 HOH HOH B . 
L 4 HOH 60 209 134 HOH HOH B . 
L 4 HOH 61 210 135 HOH HOH B . 
L 4 HOH 62 211 136 HOH HOH B . 
L 4 HOH 63 212 139 HOH HOH B . 
L 4 HOH 64 213 141 HOH HOH B . 
L 4 HOH 65 214 142 HOH HOH B . 
L 4 HOH 66 215 146 HOH HOH B . 
M 4 HOH 1  123 123 HOH HOH D . 
M 4 HOH 2  149 149 HOH HOH D . 
#