data_3GBN
# 
_entry.id   3GBN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3GBN         
RCSB  RCSB051664   
WWPDB D_1000051664 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3GBM 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3GBN 
_pdbx_database_status.recvd_initial_deposition_date   2009-02-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ekiert, D.C.'   1 
'Elsliger, M.A.' 2 
'Wilson, I.A.'   3 
# 
_citation.id                        primary 
_citation.title                     'Antibody recognition of a highly conserved influenza virus epitope.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            324 
_citation.page_first                246 
_citation.page_last                 251 
_citation.year                      2009 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19251591 
_citation.pdbx_database_id_DOI      10.1126/science.1171491 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ekiert, D.C.'    1 ? 
primary 'Bhabha, G.'      2 ? 
primary 'Elsliger, M.A.'  3 ? 
primary 'Friesen, R.H.'   4 ? 
primary 'Jongeneelen, M.' 5 ? 
primary 'Throsby, M.'     6 ? 
primary 'Goudsmit, J.'    7 ? 
primary 'Wilson, I.A.'    8 ? 
# 
_cell.entry_id           3GBN 
_cell.length_a           201.918 
_cell.length_b           202.249 
_cell.length_c           202.707 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3GBN 
_symmetry.space_group_name_H-M             'I 21 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                199 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man Hemagglutinin 36452.797 1   ? ? 'Receptor binding domain, HA1' ? 
2  polymer     man Hemagglutinin 20394.445 1   ? ? 'Membrane Fusion domain, HA2'  ? 
3  polymer     man 'Fab Heavy Chain' 23981.137 1   ? ? ?                              ? 
4  polymer     man 'Fab Lambda Light Chain' 23257.783 1   ? ? ?                              ? 
5  branched    man 
;alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
748.682   1   ? ? ?                              ? 
6  non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   2   ? ? ?                              ? 
7  non-polymer syn 1,2-ETHANEDIOL 62.068    5   ? ? ?                              ? 
8  non-polymer syn GLYCEROL 92.094    2   ? ? ?                              ? 
9  non-polymer syn 2-ETHOXYETHANOL 90.121    1   ? ? ?                              ? 
10 non-polymer syn 'CHLORIDE ION' 35.453    1   ? ? ?                              ? 
11 non-polymer syn 'UNKNOWN LIGAND' ?         1   ? ? ?                              ? 
12 water       nat water 18.015    293 ? ? ?                              ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Hemagglutinin HA1 chain, Hemagglutinin HA2 chain' 
2 'Hemagglutinin HA1 chain, Hemagglutinin HA2 chain' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;ADPGDTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCKLKGIAPLQLGKCNIAGWLLGNPECDLLLTASSW
SYIVETSNSENGTCYPGDFIDYEELREQLSSVSSFEKFEIFPKTSSWPNHETTKGVTAACSYAGASSFYRNLLWLTKKGS
SYPKLSKSYVNNKGKEVLVLWGVHHPPTGTDQQSLYQNADAYVSVGSSKYNRRFTPEIAARPKVRDQAGRMNYYWTLLEP
GDTITFEATGNLIAPWYAFALNRGSGSGIITSDAPVHDCNTKCQTPHGAINSSLPFQNIHPVTIGECPKYVRSTKLRMAT
GLRNIPSIQSR
;
;ADPGDTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCKLKGIAPLQLGKCNIAGWLLGNPECDLLLTASSW
SYIVETSNSENGTCYPGDFIDYEELREQLSSVSSFEKFEIFPKTSSWPNHETTKGVTAACSYAGASSFYRNLLWLTKKGS
SYPKLSKSYVNNKGKEVLVLWGVHHPPTGTDQQSLYQNADAYVSVGSSKYNRRFTPEIAARPKVRDQAGRMNYYWTLLEP
GDTITFEATGNLIAPWYAFALNRGSGSGIITSDAPVHDCNTKCQTPHGAINSSLPFQNIHPVTIGECPKYVRSTKLRMAT
GLRNIPSIQSR
;
A ? 
2 'polypeptide(L)' no no 
;GLFGAIAGFIEGGWTGMIDGWYGYHHQNEQGSGYAADQKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNNLERRIENL
NKKVDDGFLDIWTYNAELLVLLENERTLDFHDSNVRNLYEKVKSQLKNNAKEIGNGCFEFYHKCDDACMESVRNGTYDYP
KYSEESKLNREEIDGVSGR
;
;GLFGAIAGFIEGGWTGMIDGWYGYHHQNEQGSGYAADQKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNNLERRIENL
NKKVDDGFLDIWTYNAELLVLLENERTLDFHDSNVRNLYEKVKSQLKNNAKEIGNGCFEFYHKCDDACMESVRNGTYDYP
KYSEESKLNREEIDGVSGR
;
B ? 
3 'polypeptide(L)' no no 
;EVQLVESGAEVKKPGSSVKVSCKASGGPFRSYAISWVRQAPGQGPEWMGGIIPIFGTTKYAPKFQGRVTITADDFAGTVY
MELSSLRSEDTAMYYCAKHMGYQVRETMDVWGKGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTV
SWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDK
;
;EVQLVESGAEVKKPGSSVKVSCKASGGPFRSYAISWVRQAPGQGPEWMGGIIPIFGTTKYAPKFQGRVTITADDFAGTVY
MELSSLRSEDTAMYYCAKHMGYQVRETMDVWGKGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTV
SWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDK
;
H ? 
4 'polypeptide(L)' no no 
;QSVLTQPPSVSAAPGQKVTISCSGSSSNIGNDYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQ
TGDEANYYCATWDRRPTAYVVFGGGTKLTVLGAAAGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKAD
SSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
;
;QSVLTQPPSVSAAPGQKVTISCSGSSSNIGNDYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQ
TGDEANYYCATWDRRPTAYVVFGGGTKLTVLGAAAGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKAD
SSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
;
L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ASP n 
1 3   PRO n 
1 4   GLY n 
1 5   ASP n 
1 6   THR n 
1 7   ILE n 
1 8   CYS n 
1 9   ILE n 
1 10  GLY n 
1 11  TYR n 
1 12  HIS n 
1 13  ALA n 
1 14  ASN n 
1 15  ASN n 
1 16  SER n 
1 17  THR n 
1 18  ASP n 
1 19  THR n 
1 20  VAL n 
1 21  ASP n 
1 22  THR n 
1 23  VAL n 
1 24  LEU n 
1 25  GLU n 
1 26  LYS n 
1 27  ASN n 
1 28  VAL n 
1 29  THR n 
1 30  VAL n 
1 31  THR n 
1 32  HIS n 
1 33  SER n 
1 34  VAL n 
1 35  ASN n 
1 36  LEU n 
1 37  LEU n 
1 38  GLU n 
1 39  ASP n 
1 40  SER n 
1 41  HIS n 
1 42  ASN n 
1 43  GLY n 
1 44  LYS n 
1 45  LEU n 
1 46  CYS n 
1 47  LYS n 
1 48  LEU n 
1 49  LYS n 
1 50  GLY n 
1 51  ILE n 
1 52  ALA n 
1 53  PRO n 
1 54  LEU n 
1 55  GLN n 
1 56  LEU n 
1 57  GLY n 
1 58  LYS n 
1 59  CYS n 
1 60  ASN n 
1 61  ILE n 
1 62  ALA n 
1 63  GLY n 
1 64  TRP n 
1 65  LEU n 
1 66  LEU n 
1 67  GLY n 
1 68  ASN n 
1 69  PRO n 
1 70  GLU n 
1 71  CYS n 
1 72  ASP n 
1 73  LEU n 
1 74  LEU n 
1 75  LEU n 
1 76  THR n 
1 77  ALA n 
1 78  SER n 
1 79  SER n 
1 80  TRP n 
1 81  SER n 
1 82  TYR n 
1 83  ILE n 
1 84  VAL n 
1 85  GLU n 
1 86  THR n 
1 87  SER n 
1 88  ASN n 
1 89  SER n 
1 90  GLU n 
1 91  ASN n 
1 92  GLY n 
1 93  THR n 
1 94  CYS n 
1 95  TYR n 
1 96  PRO n 
1 97  GLY n 
1 98  ASP n 
1 99  PHE n 
1 100 ILE n 
1 101 ASP n 
1 102 TYR n 
1 103 GLU n 
1 104 GLU n 
1 105 LEU n 
1 106 ARG n 
1 107 GLU n 
1 108 GLN n 
1 109 LEU n 
1 110 SER n 
1 111 SER n 
1 112 VAL n 
1 113 SER n 
1 114 SER n 
1 115 PHE n 
1 116 GLU n 
1 117 LYS n 
1 118 PHE n 
1 119 GLU n 
1 120 ILE n 
1 121 PHE n 
1 122 PRO n 
1 123 LYS n 
1 124 THR n 
1 125 SER n 
1 126 SER n 
1 127 TRP n 
1 128 PRO n 
1 129 ASN n 
1 130 HIS n 
1 131 GLU n 
1 132 THR n 
1 133 THR n 
1 134 LYS n 
1 135 GLY n 
1 136 VAL n 
1 137 THR n 
1 138 ALA n 
1 139 ALA n 
1 140 CYS n 
1 141 SER n 
1 142 TYR n 
1 143 ALA n 
1 144 GLY n 
1 145 ALA n 
1 146 SER n 
1 147 SER n 
1 148 PHE n 
1 149 TYR n 
1 150 ARG n 
1 151 ASN n 
1 152 LEU n 
1 153 LEU n 
1 154 TRP n 
1 155 LEU n 
1 156 THR n 
1 157 LYS n 
1 158 LYS n 
1 159 GLY n 
1 160 SER n 
1 161 SER n 
1 162 TYR n 
1 163 PRO n 
1 164 LYS n 
1 165 LEU n 
1 166 SER n 
1 167 LYS n 
1 168 SER n 
1 169 TYR n 
1 170 VAL n 
1 171 ASN n 
1 172 ASN n 
1 173 LYS n 
1 174 GLY n 
1 175 LYS n 
1 176 GLU n 
1 177 VAL n 
1 178 LEU n 
1 179 VAL n 
1 180 LEU n 
1 181 TRP n 
1 182 GLY n 
1 183 VAL n 
1 184 HIS n 
1 185 HIS n 
1 186 PRO n 
1 187 PRO n 
1 188 THR n 
1 189 GLY n 
1 190 THR n 
1 191 ASP n 
1 192 GLN n 
1 193 GLN n 
1 194 SER n 
1 195 LEU n 
1 196 TYR n 
1 197 GLN n 
1 198 ASN n 
1 199 ALA n 
1 200 ASP n 
1 201 ALA n 
1 202 TYR n 
1 203 VAL n 
1 204 SER n 
1 205 VAL n 
1 206 GLY n 
1 207 SER n 
1 208 SER n 
1 209 LYS n 
1 210 TYR n 
1 211 ASN n 
1 212 ARG n 
1 213 ARG n 
1 214 PHE n 
1 215 THR n 
1 216 PRO n 
1 217 GLU n 
1 218 ILE n 
1 219 ALA n 
1 220 ALA n 
1 221 ARG n 
1 222 PRO n 
1 223 LYS n 
1 224 VAL n 
1 225 ARG n 
1 226 ASP n 
1 227 GLN n 
1 228 ALA n 
1 229 GLY n 
1 230 ARG n 
1 231 MET n 
1 232 ASN n 
1 233 TYR n 
1 234 TYR n 
1 235 TRP n 
1 236 THR n 
1 237 LEU n 
1 238 LEU n 
1 239 GLU n 
1 240 PRO n 
1 241 GLY n 
1 242 ASP n 
1 243 THR n 
1 244 ILE n 
1 245 THR n 
1 246 PHE n 
1 247 GLU n 
1 248 ALA n 
1 249 THR n 
1 250 GLY n 
1 251 ASN n 
1 252 LEU n 
1 253 ILE n 
1 254 ALA n 
1 255 PRO n 
1 256 TRP n 
1 257 TYR n 
1 258 ALA n 
1 259 PHE n 
1 260 ALA n 
1 261 LEU n 
1 262 ASN n 
1 263 ARG n 
1 264 GLY n 
1 265 SER n 
1 266 GLY n 
1 267 SER n 
1 268 GLY n 
1 269 ILE n 
1 270 ILE n 
1 271 THR n 
1 272 SER n 
1 273 ASP n 
1 274 ALA n 
1 275 PRO n 
1 276 VAL n 
1 277 HIS n 
1 278 ASP n 
1 279 CYS n 
1 280 ASN n 
1 281 THR n 
1 282 LYS n 
1 283 CYS n 
1 284 GLN n 
1 285 THR n 
1 286 PRO n 
1 287 HIS n 
1 288 GLY n 
1 289 ALA n 
1 290 ILE n 
1 291 ASN n 
1 292 SER n 
1 293 SER n 
1 294 LEU n 
1 295 PRO n 
1 296 PHE n 
1 297 GLN n 
1 298 ASN n 
1 299 ILE n 
1 300 HIS n 
1 301 PRO n 
1 302 VAL n 
1 303 THR n 
1 304 ILE n 
1 305 GLY n 
1 306 GLU n 
1 307 CYS n 
1 308 PRO n 
1 309 LYS n 
1 310 TYR n 
1 311 VAL n 
1 312 ARG n 
1 313 SER n 
1 314 THR n 
1 315 LYS n 
1 316 LEU n 
1 317 ARG n 
1 318 MET n 
1 319 ALA n 
1 320 THR n 
1 321 GLY n 
1 322 LEU n 
1 323 ARG n 
1 324 ASN n 
1 325 ILE n 
1 326 PRO n 
1 327 SER n 
1 328 ILE n 
1 329 GLN n 
1 330 SER n 
1 331 ARG n 
2 1   GLY n 
2 2   LEU n 
2 3   PHE n 
2 4   GLY n 
2 5   ALA n 
2 6   ILE n 
2 7   ALA n 
2 8   GLY n 
2 9   PHE n 
2 10  ILE n 
2 11  GLU n 
2 12  GLY n 
2 13  GLY n 
2 14  TRP n 
2 15  THR n 
2 16  GLY n 
2 17  MET n 
2 18  ILE n 
2 19  ASP n 
2 20  GLY n 
2 21  TRP n 
2 22  TYR n 
2 23  GLY n 
2 24  TYR n 
2 25  HIS n 
2 26  HIS n 
2 27  GLN n 
2 28  ASN n 
2 29  GLU n 
2 30  GLN n 
2 31  GLY n 
2 32  SER n 
2 33  GLY n 
2 34  TYR n 
2 35  ALA n 
2 36  ALA n 
2 37  ASP n 
2 38  GLN n 
2 39  LYS n 
2 40  SER n 
2 41  THR n 
2 42  GLN n 
2 43  ASN n 
2 44  ALA n 
2 45  ILE n 
2 46  ASP n 
2 47  GLY n 
2 48  ILE n 
2 49  THR n 
2 50  ASN n 
2 51  LYS n 
2 52  VAL n 
2 53  ASN n 
2 54  SER n 
2 55  VAL n 
2 56  ILE n 
2 57  GLU n 
2 58  LYS n 
2 59  MET n 
2 60  ASN n 
2 61  THR n 
2 62  GLN n 
2 63  PHE n 
2 64  THR n 
2 65  ALA n 
2 66  VAL n 
2 67  GLY n 
2 68  LYS n 
2 69  GLU n 
2 70  PHE n 
2 71  ASN n 
2 72  ASN n 
2 73  LEU n 
2 74  GLU n 
2 75  ARG n 
2 76  ARG n 
2 77  ILE n 
2 78  GLU n 
2 79  ASN n 
2 80  LEU n 
2 81  ASN n 
2 82  LYS n 
2 83  LYS n 
2 84  VAL n 
2 85  ASP n 
2 86  ASP n 
2 87  GLY n 
2 88  PHE n 
2 89  LEU n 
2 90  ASP n 
2 91  ILE n 
2 92  TRP n 
2 93  THR n 
2 94  TYR n 
2 95  ASN n 
2 96  ALA n 
2 97  GLU n 
2 98  LEU n 
2 99  LEU n 
2 100 VAL n 
2 101 LEU n 
2 102 LEU n 
2 103 GLU n 
2 104 ASN n 
2 105 GLU n 
2 106 ARG n 
2 107 THR n 
2 108 LEU n 
2 109 ASP n 
2 110 PHE n 
2 111 HIS n 
2 112 ASP n 
2 113 SER n 
2 114 ASN n 
2 115 VAL n 
2 116 ARG n 
2 117 ASN n 
2 118 LEU n 
2 119 TYR n 
2 120 GLU n 
2 121 LYS n 
2 122 VAL n 
2 123 LYS n 
2 124 SER n 
2 125 GLN n 
2 126 LEU n 
2 127 LYS n 
2 128 ASN n 
2 129 ASN n 
2 130 ALA n 
2 131 LYS n 
2 132 GLU n 
2 133 ILE n 
2 134 GLY n 
2 135 ASN n 
2 136 GLY n 
2 137 CYS n 
2 138 PHE n 
2 139 GLU n 
2 140 PHE n 
2 141 TYR n 
2 142 HIS n 
2 143 LYS n 
2 144 CYS n 
2 145 ASP n 
2 146 ASP n 
2 147 ALA n 
2 148 CYS n 
2 149 MET n 
2 150 GLU n 
2 151 SER n 
2 152 VAL n 
2 153 ARG n 
2 154 ASN n 
2 155 GLY n 
2 156 THR n 
2 157 TYR n 
2 158 ASP n 
2 159 TYR n 
2 160 PRO n 
2 161 LYS n 
2 162 TYR n 
2 163 SER n 
2 164 GLU n 
2 165 GLU n 
2 166 SER n 
2 167 LYS n 
2 168 LEU n 
2 169 ASN n 
2 170 ARG n 
2 171 GLU n 
2 172 GLU n 
2 173 ILE n 
2 174 ASP n 
2 175 GLY n 
2 176 VAL n 
2 177 SER n 
2 178 GLY n 
2 179 ARG n 
3 1   GLU n 
3 2   VAL n 
3 3   GLN n 
3 4   LEU n 
3 5   VAL n 
3 6   GLU n 
3 7   SER n 
3 8   GLY n 
3 9   ALA n 
3 10  GLU n 
3 11  VAL n 
3 12  LYS n 
3 13  LYS n 
3 14  PRO n 
3 15  GLY n 
3 16  SER n 
3 17  SER n 
3 18  VAL n 
3 19  LYS n 
3 20  VAL n 
3 21  SER n 
3 22  CYS n 
3 23  LYS n 
3 24  ALA n 
3 25  SER n 
3 26  GLY n 
3 27  GLY n 
3 28  PRO n 
3 29  PHE n 
3 30  ARG n 
3 31  SER n 
3 32  TYR n 
3 33  ALA n 
3 34  ILE n 
3 35  SER n 
3 36  TRP n 
3 37  VAL n 
3 38  ARG n 
3 39  GLN n 
3 40  ALA n 
3 41  PRO n 
3 42  GLY n 
3 43  GLN n 
3 44  GLY n 
3 45  PRO n 
3 46  GLU n 
3 47  TRP n 
3 48  MET n 
3 49  GLY n 
3 50  GLY n 
3 51  ILE n 
3 52  ILE n 
3 53  PRO n 
3 54  ILE n 
3 55  PHE n 
3 56  GLY n 
3 57  THR n 
3 58  THR n 
3 59  LYS n 
3 60  TYR n 
3 61  ALA n 
3 62  PRO n 
3 63  LYS n 
3 64  PHE n 
3 65  GLN n 
3 66  GLY n 
3 67  ARG n 
3 68  VAL n 
3 69  THR n 
3 70  ILE n 
3 71  THR n 
3 72  ALA n 
3 73  ASP n 
3 74  ASP n 
3 75  PHE n 
3 76  ALA n 
3 77  GLY n 
3 78  THR n 
3 79  VAL n 
3 80  TYR n 
3 81  MET n 
3 82  GLU n 
3 83  LEU n 
3 84  SER n 
3 85  SER n 
3 86  LEU n 
3 87  ARG n 
3 88  SER n 
3 89  GLU n 
3 90  ASP n 
3 91  THR n 
3 92  ALA n 
3 93  MET n 
3 94  TYR n 
3 95  TYR n 
3 96  CYS n 
3 97  ALA n 
3 98  LYS n 
3 99  HIS n 
3 100 MET n 
3 101 GLY n 
3 102 TYR n 
3 103 GLN n 
3 104 VAL n 
3 105 ARG n 
3 106 GLU n 
3 107 THR n 
3 108 MET n 
3 109 ASP n 
3 110 VAL n 
3 111 TRP n 
3 112 GLY n 
3 113 LYS n 
3 114 GLY n 
3 115 THR n 
3 116 THR n 
3 117 VAL n 
3 118 THR n 
3 119 VAL n 
3 120 SER n 
3 121 SER n 
3 122 ALA n 
3 123 SER n 
3 124 THR n 
3 125 LYS n 
3 126 GLY n 
3 127 PRO n 
3 128 SER n 
3 129 VAL n 
3 130 PHE n 
3 131 PRO n 
3 132 LEU n 
3 133 ALA n 
3 134 PRO n 
3 135 SER n 
3 136 SER n 
3 137 LYS n 
3 138 SER n 
3 139 THR n 
3 140 SER n 
3 141 GLY n 
3 142 GLY n 
3 143 THR n 
3 144 ALA n 
3 145 ALA n 
3 146 LEU n 
3 147 GLY n 
3 148 CYS n 
3 149 LEU n 
3 150 VAL n 
3 151 LYS n 
3 152 ASP n 
3 153 TYR n 
3 154 PHE n 
3 155 PRO n 
3 156 GLU n 
3 157 PRO n 
3 158 VAL n 
3 159 THR n 
3 160 VAL n 
3 161 SER n 
3 162 TRP n 
3 163 ASN n 
3 164 SER n 
3 165 GLY n 
3 166 ALA n 
3 167 LEU n 
3 168 THR n 
3 169 SER n 
3 170 GLY n 
3 171 VAL n 
3 172 HIS n 
3 173 THR n 
3 174 PHE n 
3 175 PRO n 
3 176 ALA n 
3 177 VAL n 
3 178 LEU n 
3 179 GLN n 
3 180 SER n 
3 181 SER n 
3 182 GLY n 
3 183 LEU n 
3 184 TYR n 
3 185 SER n 
3 186 LEU n 
3 187 SER n 
3 188 SER n 
3 189 VAL n 
3 190 VAL n 
3 191 THR n 
3 192 VAL n 
3 193 PRO n 
3 194 SER n 
3 195 SER n 
3 196 SER n 
3 197 LEU n 
3 198 GLY n 
3 199 THR n 
3 200 GLN n 
3 201 THR n 
3 202 TYR n 
3 203 ILE n 
3 204 CYS n 
3 205 ASN n 
3 206 VAL n 
3 207 ASN n 
3 208 HIS n 
3 209 LYS n 
3 210 PRO n 
3 211 SER n 
3 212 ASN n 
3 213 THR n 
3 214 LYS n 
3 215 VAL n 
3 216 ASP n 
3 217 LYS n 
3 218 ARG n 
3 219 VAL n 
3 220 GLU n 
3 221 PRO n 
3 222 LYS n 
3 223 SER n 
3 224 CYS n 
3 225 ASP n 
3 226 LYS n 
4 1   GLN n 
4 2   SER n 
4 3   VAL n 
4 4   LEU n 
4 5   THR n 
4 6   GLN n 
4 7   PRO n 
4 8   PRO n 
4 9   SER n 
4 10  VAL n 
4 11  SER n 
4 12  ALA n 
4 13  ALA n 
4 14  PRO n 
4 15  GLY n 
4 16  GLN n 
4 17  LYS n 
4 18  VAL n 
4 19  THR n 
4 20  ILE n 
4 21  SER n 
4 22  CYS n 
4 23  SER n 
4 24  GLY n 
4 25  SER n 
4 26  SER n 
4 27  SER n 
4 28  ASN n 
4 29  ILE n 
4 30  GLY n 
4 31  ASN n 
4 32  ASP n 
4 33  TYR n 
4 34  VAL n 
4 35  SER n 
4 36  TRP n 
4 37  TYR n 
4 38  GLN n 
4 39  GLN n 
4 40  LEU n 
4 41  PRO n 
4 42  GLY n 
4 43  THR n 
4 44  ALA n 
4 45  PRO n 
4 46  LYS n 
4 47  LEU n 
4 48  LEU n 
4 49  ILE n 
4 50  TYR n 
4 51  ASP n 
4 52  ASN n 
4 53  ASN n 
4 54  LYS n 
4 55  ARG n 
4 56  PRO n 
4 57  SER n 
4 58  GLY n 
4 59  ILE n 
4 60  PRO n 
4 61  ASP n 
4 62  ARG n 
4 63  PHE n 
4 64  SER n 
4 65  GLY n 
4 66  SER n 
4 67  LYS n 
4 68  SER n 
4 69  GLY n 
4 70  THR n 
4 71  SER n 
4 72  ALA n 
4 73  THR n 
4 74  LEU n 
4 75  GLY n 
4 76  ILE n 
4 77  THR n 
4 78  GLY n 
4 79  LEU n 
4 80  GLN n 
4 81  THR n 
4 82  GLY n 
4 83  ASP n 
4 84  GLU n 
4 85  ALA n 
4 86  ASN n 
4 87  TYR n 
4 88  TYR n 
4 89  CYS n 
4 90  ALA n 
4 91  THR n 
4 92  TRP n 
4 93  ASP n 
4 94  ARG n 
4 95  ARG n 
4 96  PRO n 
4 97  THR n 
4 98  ALA n 
4 99  TYR n 
4 100 VAL n 
4 101 VAL n 
4 102 PHE n 
4 103 GLY n 
4 104 GLY n 
4 105 GLY n 
4 106 THR n 
4 107 LYS n 
4 108 LEU n 
4 109 THR n 
4 110 VAL n 
4 111 LEU n 
4 112 GLY n 
4 113 ALA n 
4 114 ALA n 
4 115 ALA n 
4 116 GLY n 
4 117 GLN n 
4 118 PRO n 
4 119 LYS n 
4 120 ALA n 
4 121 ALA n 
4 122 PRO n 
4 123 SER n 
4 124 VAL n 
4 125 THR n 
4 126 LEU n 
4 127 PHE n 
4 128 PRO n 
4 129 PRO n 
4 130 SER n 
4 131 SER n 
4 132 GLU n 
4 133 GLU n 
4 134 LEU n 
4 135 GLN n 
4 136 ALA n 
4 137 ASN n 
4 138 LYS n 
4 139 ALA n 
4 140 THR n 
4 141 LEU n 
4 142 VAL n 
4 143 CYS n 
4 144 LEU n 
4 145 ILE n 
4 146 SER n 
4 147 ASP n 
4 148 PHE n 
4 149 TYR n 
4 150 PRO n 
4 151 GLY n 
4 152 ALA n 
4 153 VAL n 
4 154 THR n 
4 155 VAL n 
4 156 ALA n 
4 157 TRP n 
4 158 LYS n 
4 159 ALA n 
4 160 ASP n 
4 161 SER n 
4 162 SER n 
4 163 PRO n 
4 164 VAL n 
4 165 LYS n 
4 166 ALA n 
4 167 GLY n 
4 168 VAL n 
4 169 GLU n 
4 170 THR n 
4 171 THR n 
4 172 THR n 
4 173 PRO n 
4 174 SER n 
4 175 LYS n 
4 176 GLN n 
4 177 SER n 
4 178 ASN n 
4 179 ASN n 
4 180 LYS n 
4 181 TYR n 
4 182 ALA n 
4 183 ALA n 
4 184 SER n 
4 185 SER n 
4 186 TYR n 
4 187 LEU n 
4 188 SER n 
4 189 LEU n 
4 190 THR n 
4 191 PRO n 
4 192 GLU n 
4 193 GLN n 
4 194 TRP n 
4 195 LYS n 
4 196 SER n 
4 197 HIS n 
4 198 ARG n 
4 199 SER n 
4 200 TYR n 
4 201 SER n 
4 202 CYS n 
4 203 GLN n 
4 204 VAL n 
4 205 THR n 
4 206 HIS n 
4 207 GLU n 
4 208 GLY n 
4 209 SER n 
4 210 THR n 
4 211 VAL n 
4 212 GLU n 
4 213 LYS n 
4 214 THR n 
4 215 VAL n 
4 216 ALA n 
4 217 PRO n 
4 218 THR n 
4 219 GLU n 
4 220 CYS n 
4 221 SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'Influenza A virus (strain A/South Carolina/1/1918 H1N1)' ? 'HA, Hemagglutinin (HA)' ? 'A/South Carolina/1/1918' 
? ? ? ? 'Influenza A virus (A/Brevig Mission/1/1918(H1N1))' 88776 ? ? ? ? ? ? ? ?     'Trichoplusia ni' 7111 ? ? ? ? ? ? HI5 ? ? ? 
? ? ? ? BACULOVIRUS ? ? ? pFASTBAC-HT ? ? 
2 1 sample ? ? ? 'Influenza A virus (strain A/South Carolina/1/1918 H1N1)' ? 'HA, Hemagglutinin (HA)' ? 'A/South Carolina/1/1918' 
? ? ? ? 'Influenza A virus (A/Brevig Mission/1/1918(H1N1))' 88776 ? ? ? ? ? ? ? ?     'Trichoplusia ni' 7111 ? ? ? ? ? ? HI5 ? ? ? 
? ? ? ? BACULOVIRUS ? ? ? pFASTBAC-HT ? ? 
3 1 sample ? ? ? ?                                                         ? ?                        ? ?                         
? ? ? ? 'Homo sapiens'                                      9606  ? ? ? ? ? ? ? human 'Homo sapiens'    9606 ? ? ? ? ? ? ?   ? ? ? 
? ? ? ? ?           ? ? ? ?           ? ? 
4 1 sample ? ? ? ?                                                         ? ?                        ? ?                         
? ? ? ? 'Homo sapiens'                                      9606  ? ? ? ? ? ? ? human 'Homo sapiens'    9606 ? ? ? ? ? ? ?   ? ? ? 
? ? ? ? ?           ? ? ? ?           ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP HEMA_I18A0 Q9WFX3 1 
;DTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCKLKGIAPLQLGKCNIAGWLLGNPECDLLLTASSWSYIV
ETSNSENGTCYPGDFIDYEELREQLSSVSSFEKFEIFPKTSSWPNHETTKGVTAACSYAGASSFYRNLLWLTKKGSSYPK
LSKSYVNNKGKEVLVLWGVHHPPTGTDQQSLYQNADAYVSVGSSKYNRRFTPEIAARPKVRDQAGRMNYYWTLLEPGDTI
TFEATGNLIAPWYAFALNRGSGSGIITSDAPVHDCNTKCQTPHGAINSSLPFQNIHPVTIGECPKYVRSTKLRMATGLRN
IPSIQSR
;
18  ? 
2 UNP HEMA_I18A0 Q9WFX3 2 
;GLFGAIAGFIEGGWTGMIDGWYGYHHQNEQGSGYAADQKSTQNAIDGITNKVNSVIEKMNTQFTAVGKEFNNLERRIENL
NKKVDDGFLDIWTYNAELLVLLENERTLDFHDSNVRNLYEKVKSQLKNNAKEIGNGCFEFYHKCDDACMESVRNGTYDYP
KYSEESKLNREEIDGV
;
345 ? 
3 PDB 3GBN       3GBN   3 ? ?   ? 
4 PDB 3GBN       3GBN   4 ? ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3GBN A 5 ? 331 ? Q9WFX3 18  ? 344 ? 11 329 
2 2 3GBN B 1 ? 176 ? Q9WFX3 345 ? 520 ? 1  176 
3 3 3GBN H 1 ? 226 ? 3GBN   1   ? 227 ? 1  227 
4 4 3GBN L 1 ? 221 ? 3GBN   1   ? 213 ? 1  213 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3GBN ALA A 1   ? UNP Q9WFX3 ? ? 'expression tag' 7   1 
1 3GBN ASP A 2   ? UNP Q9WFX3 ? ? 'expression tag' 8   2 
1 3GBN PRO A 3   ? UNP Q9WFX3 ? ? 'expression tag' 9   3 
1 3GBN GLY A 4   ? UNP Q9WFX3 ? ? 'expression tag' 10  4 
2 3GBN SER B 177 ? UNP Q9WFX3 ? ? 'expression tag' 177 5 
2 3GBN GLY B 178 ? UNP Q9WFX3 ? ? 'expression tag' 178 6 
2 3GBN ARG B 179 ? UNP Q9WFX3 ? ? 'expression tag' 179 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                  ?                               'C3 H7 N O2'     
89.093  
ARG 'L-peptide linking'           y ARGININE                                 ?                               'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking'           y ASPARAGINE                               ?                               'C4 H8 N2 O3'    
132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                          ?                               'C4 H7 N O4'     
133.103 
BMA 'D-saccharide, beta linking'  . beta-D-mannopyranose                     ?                               'C6 H12 O6'      
180.156 
CL  non-polymer                   . 'CHLORIDE ION'                           ?                               'Cl -1'          
35.453  
CYS 'L-peptide linking'           y CYSTEINE                                 ?                               'C3 H7 N O2 S'   
121.158 
EDO non-polymer                   . 1,2-ETHANEDIOL                           'ETHYLENE GLYCOL'               'C2 H6 O2'       
62.068  
ETX non-polymer                   . 2-ETHOXYETHANOL                          ?                               'C4 H10 O2'      
90.121  
GLN 'L-peptide linking'           y GLUTAMINE                                ?                               'C5 H10 N2 O3'   
146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                          ?                               'C5 H9 N O4'     
147.129 
GLY 'peptide linking'             y GLYCINE                                  ?                               'C2 H5 N O2'     
75.067  
GOL non-polymer                   . GLYCEROL                                 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       
92.094  
HIS 'L-peptide linking'           y HISTIDINE                                ?                               'C6 H10 N3 O2 1' 
156.162 
HOH non-polymer                   . WATER                                    ?                               'H2 O'           
18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                               ?                               'C6 H13 N O2'    
131.173 
LEU 'L-peptide linking'           y LEUCINE                                  ?                               'C6 H13 N O2'    
131.173 
LYS 'L-peptide linking'           y LYSINE                                   ?                               'C6 H15 N2 O2 1' 
147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose                    ?                               'C6 H12 O6'      
180.156 
MET 'L-peptide linking'           y METHIONINE                               ?                               'C5 H11 N O2 S'  
149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose ?                               'C8 H15 N O6'    
221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                            ?                               'C9 H11 N O2'    
165.189 
PRO 'L-peptide linking'           y PROLINE                                  ?                               'C5 H9 N O2'     
115.130 
SER 'L-peptide linking'           y SERINE                                   ?                               'C3 H7 N O3'     
105.093 
THR 'L-peptide linking'           y THREONINE                                ?                               'C4 H9 N O3'     
119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                               ?                               'C11 H12 N2 O2'  
204.225 
TYR 'L-peptide linking'           y TYROSINE                                 ?                               'C9 H11 N O3'    
181.189 
UNL non-polymer                   . 'UNKNOWN LIGAND'                         ?                               ?                ? 
VAL 'L-peptide linking'           y VALINE                                   ?                               'C5 H11 N O2'    
117.146 
# 
_exptl.entry_id          3GBN 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.31 
_exptl_crystal.density_percent_sol   62.88 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.3 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'10.5% PEG 3K, 100mM NaAco 5.2, 50mM NaCl, Cryoprotectant: 25% glycerol, pH 5.3, VAPOR DIFFUSION, SITTING DROP, temperature 295K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           75 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2008-10-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Double crystal cryo-cooled Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.03333 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 23-ID-B' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-B 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.03333 
# 
_reflns.entry_id                     3GBN 
_reflns.observed_criterion_sigma_I   2 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.20 
_reflns.number_obs                   71438 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.11 
_reflns.pdbx_netI_over_sigmaI        30.9 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              20.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.257 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.79 
_reflns_shell.meanI_over_sigI_obs    2.32 
_reflns_shell.pdbx_redundancy        5.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3GBN 
_refine.ls_number_reflns_obs                     62751 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             39.72 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    95.08 
_refine.ls_R_factor_obs                          0.20674 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20487 
_refine.ls_R_factor_R_free                       0.24142 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  3391 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.950 
_refine.correlation_coeff_Fo_to_Fc_free          0.931 
_refine.B_iso_mean                               28.767 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'pdb entries 1ADQ, 1RUZ' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.199 
_refine.pdbx_overall_ESU_R_Free                  0.179 
_refine.overall_SU_ML                            0.109 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             9.108 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6167 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         131 
_refine_hist.number_atoms_solvent             293 
_refine_hist.number_atoms_total               6591 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        39.72 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.018  0.022  ? 6474  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 4276  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.685  1.964  ? 8785  'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.967  3.003  ? 10401 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       7.035  5.000  ? 808   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       35.241 24.816 ? 272   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.875 15.000 ? 982   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       16.354 15.000 ? 23    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.101  0.200  ? 977   'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.008  0.021  ? 7174  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 1262  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  2.012  3.000  ? 4034  'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.580  3.000  ? 1658  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 3.295  5.000  ? 6470  'X-RAY DIFFRACTION' ? 
r_scbond_it                  5.814  8.000  ? 2440  'X-RAY DIFFRACTION' ? 
r_scangle_it                 7.549  11.000 ? 2313  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.200 
_refine_ls_shell.d_res_low                        2.257 
_refine_ls_shell.number_reflns_R_work             4528 
_refine_ls_shell.R_factor_R_work                  0.433 
_refine_ls_shell.percent_reflns_obs               95.32 
_refine_ls_shell.R_factor_R_free                  0.403 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             221 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                  3GBN 
_struct.title                     'Crystal Structure of Fab CR6261 in Complex with the 1918 H1N1 influenza virus hemagglutinin' 
_struct.pdbx_descriptor           Hemagglutinin 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3GBN 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN/IMMUNE SYSTEM' 
_struct_keywords.text            
;hemagglutinin, Fab, neutralizing antibodies, antibody, pandemic flu, Cell membrane, Envelope protein, Fusion protein, Glycoprotein, Lipoprotein, Membrane, Palmitate, Transmembrane, Virion, VIRAL PROTEIN-IMMUNE SYSTEM COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 7  ? 
H N N 8  ? 
I N N 9  ? 
J N N 6  ? 
K N N 8  ? 
L N N 10 ? 
M N N 7  ? 
N N N 7  ? 
O N N 7  ? 
P N N 11 ? 
Q N N 7  ? 
R N N 12 ? 
S N N 12 ? 
T N N 12 ? 
U N N 12 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 60  ? GLY A 67  ? ASN A 65  GLY A 72  1 ? 8  
HELX_P HELX_P2  2  ASN A 68  ? LEU A 75  ? ASN A 73  LEU A 80  5 ? 8  
HELX_P HELX_P3  3  ASP A 101 ? SER A 110 ? ASP A 104 SER A 113 1 ? 10 
HELX_P HELX_P4  4  THR A 190 ? GLN A 197 ? THR A 189 GLN A 196 1 ? 8  
HELX_P HELX_P5  5  ASP B 37  ? MET B 59  ? ASP B 37  MET B 59  1 ? 23 
HELX_P HELX_P6  6  GLU B 74  ? LYS B 127 ? GLU B 74  LYS B 127 1 ? 54 
HELX_P HELX_P7  7  ASP B 145 ? ASN B 154 ? ASP B 145 ASN B 154 1 ? 10 
HELX_P HELX_P8  8  ASP B 158 ? ILE B 173 ? ASP B 158 ILE B 173 1 ? 16 
HELX_P HELX_P9  9  ASP C 74  ? ALA C 76  ? ASP H 73  ALA H 75  5 ? 3  
HELX_P HELX_P10 10 ARG C 87  ? THR C 91  ? ARG H 83  THR H 87  5 ? 5  
HELX_P HELX_P11 11 ASN D 28  B ASP D 32  ? ASN L 27  ASP L 31  5 ? 5  
HELX_P HELX_P12 12 GLN D 80  ? GLU D 84  ? GLN L 79  GLU L 83  5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 8   SG  ? ? ? 1_555 B CYS 137 SG ? ? A CYS 14  B CYS 137 1_555 ? ? ? ? ? ? ? 2.196 ? ?               
disulf2 disulf ?    ? A CYS 46  SG  ? ? ? 1_555 A CYS 279 SG ? ? A CYS 52  A CYS 277 1_555 ? ? ? ? ? ? ? 2.082 ? ?               
disulf3 disulf ?    ? A CYS 59  SG  ? ? ? 1_555 A CYS 71  SG ? ? A CYS 64  A CYS 76  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf4 disulf ?    ? A CYS 94  SG  ? ? ? 1_555 A CYS 140 SG ? ? A CYS 97  A CYS 139 1_555 ? ? ? ? ? ? ? 2.106 ? ?               
disulf5 disulf ?    ? A CYS 283 SG  ? ? ? 1_555 A CYS 307 SG ? ? A CYS 281 A CYS 305 1_555 ? ? ? ? ? ? ? 2.102 ? ?               
disulf6 disulf ?    ? B CYS 144 SG  ? ? ? 1_555 B CYS 148 SG ? ? B CYS 144 B CYS 148 1_555 ? ? ? ? ? ? ? 2.175 ? ?               
disulf7 disulf ?    ? C CYS 22  SG  ? ? ? 1_555 C CYS 96  SG ? ? H CYS 22  H CYS 92  1_555 ? ? ? ? ? ? ? 2.171 ? ?               
disulf8 disulf ?    ? D CYS 22  SG  ? ? ? 1_555 D CYS 89  SG ? ? L CYS 23  L CYS 88  1_555 ? ? ? ? ? ? ? 2.090 ? ?               
disulf9 disulf ?    ? D CYS 143 SG  ? ? ? 1_555 D CYS 202 SG ? ? L CYS 134 L CYS 194 1_555 ? ? ? ? ? ? ? 2.053 ? ?               
covale1 covale one  ? A ASN 15  ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 21  C NAG 1   1_555 ? ? ? ? ? ? ? 1.298 ? N-Glycosylation 
covale2 covale one  ? A ASN 91  ND2 ? ? ? 1_555 F NAG .   C1 ? ? A ASN 95  A NAG 330 1_555 ? ? ? ? ? ? ? 1.312 ? N-Glycosylation 
covale3 covale one  ? B ASN 154 ND2 ? ? ? 1_555 J NAG .   C1 ? ? B ASN 154 B NAG 180 1_555 ? ? ? ? ? ? ? 1.316 ? N-Glycosylation 
covale4 covale both ? E NAG .   O4  ? ? ? 1_555 E NAG .   C1 ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.332 ? ?               
covale5 covale both ? E NAG .   O4  ? ? ? 1_555 E BMA .   C1 ? ? C NAG 2   C BMA 3   1_555 ? ? ? ? ? ? ? 1.346 ? ?               
covale6 covale both ? E BMA .   O3  ? ? ? 1_555 E MAN .   C1 ? ? C BMA 3   C MAN 4   1_555 ? ? ? ? ? ? ? 1.325 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ALA 1   A . ? ALA 7   A ASP 2   A ? ASP 8   A 1 -16.69 
2 LYS 134 A . A LYS 133 A GLY 135 A ? GLY 134 A 1 5.51   
3 GLY 135 A . ? GLY 134 A VAL 136 A ? VAL 135 A 1 -14.75 
4 GLY 189 A . ? GLY 188 A THR 190 A ? THR 189 A 1 2.17   
5 GLY 27  C . ? GLY 27  H PRO 28  C ? PRO 28  H 1 13.64  
6 PRO 41  C . ? PRO 41  H GLY 42  C ? GLY 42  H 1 -27.77 
7 LYS 151 C . ? LYS 145 H ASP 152 C ? ASP 146 H 1 -1.25  
8 PHE 154 C . ? PHE 148 H PRO 155 C ? PRO 149 H 1 -7.31  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 2 ? 
D ? 3 ? 
E ? 2 ? 
F ? 3 ? 
G ? 5 ? 
H ? 4 ? 
I ? 2 ? 
J ? 4 ? 
K ? 3 ? 
L ? 4 ? 
M ? 6 ? 
N ? 4 ? 
O ? 4 ? 
P ? 5 ? 
Q ? 4 ? 
R ? 3 ? 
S ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? parallel      
E 1 2 ? parallel      
F 1 2 ? parallel      
F 2 3 ? parallel      
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
M 1 2 ? parallel      
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
M 4 5 ? anti-parallel 
M 5 6 ? anti-parallel 
N 1 2 ? parallel      
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
P 1 2 ? parallel      
P 2 3 ? anti-parallel 
P 3 4 ? anti-parallel 
P 4 5 ? anti-parallel 
Q 1 2 ? parallel      
Q 2 3 ? anti-parallel 
Q 3 4 ? anti-parallel 
R 1 2 ? anti-parallel 
R 2 3 ? anti-parallel 
S 1 2 ? anti-parallel 
S 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY B 31  ? ALA B 36  ? GLY B 31  ALA B 36  
A 2 TYR B 22  ? ASN B 28  ? TYR B 22  ASN B 28  
A 3 THR A 6   ? TYR A 11  ? THR A 12  TYR A 17  
A 4 CYS B 137 ? PHE B 140 ? CYS B 137 PHE B 140 
A 5 ALA B 130 ? GLU B 132 ? ALA B 130 GLU B 132 
B 1 THR A 19  ? VAL A 20  ? THR A 25  VAL A 26  
B 2 VAL A 28  ? THR A 29  ? VAL A 34  THR A 35  
C 1 SER A 33  ? ASN A 35  ? SER A 39  ASN A 41  
C 2 ARG A 317 ? ALA A 319 ? ARG A 315 ALA A 317 
D 1 LEU A 37  ? GLU A 38  ? LEU A 43  GLU A 44  
D 2 PHE A 296 ? GLN A 297 ? PHE A 294 GLN A 295 
D 3 LYS A 309 ? TYR A 310 ? LYS A 307 TYR A 308 
E 1 LEU A 45  ? LYS A 47  ? LEU A 51  LYS A 53  
E 2 VAL A 276 ? ASN A 280 ? VAL A 274 ASN A 278 
F 1 LEU A 54  ? GLY A 57  ? LEU A 59  GLY A 62  
F 2 ILE A 83  ? GLU A 85  ? ILE A 87  GLU A 89  
F 3 ILE A 269 ? THR A 271 ? ILE A 267 THR A 269 
G 1 VAL A 112 ? GLU A 119 ? VAL A 115 GLU A 122 
G 2 TYR A 257 ? ARG A 263 ? TYR A 256 ARG A 262 
G 3 VAL A 177 ? HIS A 185 ? VAL A 176 HIS A 184 
G 4 LEU A 252 ? PRO A 255 ? LEU A 251 PRO A 254 
G 5 LEU A 152 ? TRP A 154 ? LEU A 151 TRP A 153 
H 1 VAL A 112 ? GLU A 119 ? VAL A 115 GLU A 122 
H 2 TYR A 257 ? ARG A 263 ? TYR A 256 ARG A 262 
H 3 VAL A 177 ? HIS A 185 ? VAL A 176 HIS A 184 
H 4 ARG A 230 ? LEU A 238 ? ARG A 229 LEU A 237 
I 1 THR A 137 ? SER A 141 ? THR A 136 SER A 140 
I 2 SER A 146 ? SER A 147 ? SER A 145 SER A 146 
J 1 LEU A 165 ? VAL A 170 ? LEU A 164 VAL A 169 
J 2 THR A 243 ? ALA A 248 ? THR A 242 ALA A 247 
J 3 VAL A 203 ? GLY A 206 ? VAL A 202 GLY A 205 
J 4 ASN A 211 ? PHE A 214 ? ASN A 210 PHE A 213 
K 1 GLY A 288 ? ILE A 290 ? GLY A 286 ILE A 288 
K 2 CYS A 283 ? THR A 285 ? CYS A 281 THR A 283 
K 3 ILE A 304 ? GLY A 305 ? ILE A 302 GLY A 303 
L 1 LEU C 4   ? GLU C 6   ? LEU H 4   GLU H 6   
L 2 VAL C 18  ? ALA C 24  ? VAL H 18  ALA H 24  
L 3 THR C 78  ? LEU C 83  ? THR H 77  LEU H 82  
L 4 VAL C 68  ? ASP C 73  ? VAL H 67  ASP H 72  
M 1 GLU C 10  ? LYS C 12  ? GLU H 10  LYS H 12  
M 2 THR C 115 ? VAL C 119 ? THR H 107 VAL H 111 
M 3 ALA C 92  ? HIS C 99  ? ALA H 88  HIS H 95  
M 4 ILE C 34  ? GLN C 39  ? ILE H 34  GLN H 39  
M 5 GLU C 46  ? ILE C 51  ? GLU H 46  ILE H 51  
M 6 THR C 58  ? TYR C 60  ? THR H 57  TYR H 59  
N 1 GLU C 10  ? LYS C 12  ? GLU H 10  LYS H 12  
N 2 THR C 115 ? VAL C 119 ? THR H 107 VAL H 111 
N 3 ALA C 92  ? HIS C 99  ? ALA H 88  HIS H 95  
N 4 MET C 108 D TRP C 111 ? MET H 100 TRP H 103 
O 1 SER C 128 ? PHE C 130 ? SER H 120 PHE H 122 
O 2 LEU C 149 ? TYR C 153 ? LEU H 143 TYR H 147 
O 3 TYR C 184 ? LEU C 186 ? TYR H 185 LEU H 187 
O 4 VAL C 177 ? LEU C 178 ? VAL H 177 LEU H 178 
P 1 SER D 11  ? ALA D 12  ? SER L 12  ALA L 13  
P 2 THR D 106 ? VAL D 110 ? THR L 102 VAL L 106 
P 3 ALA D 85  ? ASP D 93  ? ALA L 84  ASP L 92  
P 4 VAL D 34  ? GLN D 39  ? VAL L 33  GLN L 38  
P 5 LYS D 46  ? ILE D 49  ? LYS L 45  ILE L 48  
Q 1 SER D 11  ? ALA D 12  ? SER L 12  ALA L 13  
Q 2 THR D 106 ? VAL D 110 ? THR L 102 VAL L 106 
Q 3 ALA D 85  ? ASP D 93  ? ALA L 84  ASP L 92  
Q 4 TYR D 99  C PHE D 102 ? TYR L 95  PHE L 98  
R 1 VAL D 18  ? SER D 23  ? VAL L 19  SER L 24  
R 2 SER D 71  ? ILE D 76  ? SER L 70  ILE L 75  
R 3 PHE D 63  ? SER D 68  ? PHE L 62  SER L 67  
S 1 LEU D 141 ? PHE D 148 ? LEU L 132 PHE L 139 
S 2 TYR D 181 ? LEU D 187 ? TYR L 173 LEU L 179 
S 3 VAL D 168 ? LYS D 175 ? VAL L 159 LYS L 166 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ALA B 35  ? O ALA B 35  N TYR B 24  ? N TYR B 24  
A 2 3 O HIS B 25  ? O HIS B 25  N CYS A 8   ? N CYS A 14  
A 3 4 N ILE A 7   ? N ILE A 13  O PHE B 138 ? O PHE B 138 
A 4 5 O GLU B 139 ? O GLU B 139 N LYS B 131 ? N LYS B 131 
B 1 2 N VAL A 20  ? N VAL A 26  O VAL A 28  ? O VAL A 34  
C 1 2 N VAL A 34  ? N VAL A 40  O MET A 318 ? O MET A 316 
D 1 2 N GLU A 38  ? N GLU A 44  O PHE A 296 ? O PHE A 294 
D 2 3 N GLN A 297 ? N GLN A 295 O LYS A 309 ? O LYS A 307 
E 1 2 N LYS A 47  ? N LYS A 53  O CYS A 279 ? O CYS A 277 
F 1 2 N LEU A 54  ? N LEU A 59  O VAL A 84  ? O VAL A 88  
F 2 3 N ILE A 83  ? N ILE A 87  O ILE A 270 ? O ILE A 268 
G 1 2 N SER A 114 ? N SER A 117 O ASN A 262 ? O ASN A 261 
G 2 3 O PHE A 259 ? O PHE A 258 N LEU A 178 ? N LEU A 177 
G 3 4 N GLY A 182 ? N GLY A 181 O ILE A 253 ? O ILE A 252 
G 4 5 O ALA A 254 ? O ALA A 253 N LEU A 153 ? N LEU A 152 
H 1 2 N SER A 114 ? N SER A 117 O ASN A 262 ? O ASN A 261 
H 2 3 O PHE A 259 ? O PHE A 258 N LEU A 178 ? N LEU A 177 
H 3 4 N HIS A 185 ? N HIS A 184 O ARG A 230 ? O ARG A 229 
I 1 2 N THR A 137 ? N THR A 136 O SER A 147 ? O SER A 146 
J 1 2 N LYS A 167 ? N LYS A 166 O PHE A 246 ? O PHE A 245 
J 2 3 O GLU A 247 ? O GLU A 246 N SER A 204 ? N SER A 203 
J 3 4 N VAL A 203 ? N VAL A 202 O PHE A 214 ? O PHE A 213 
K 1 2 O ILE A 290 ? O ILE A 288 N CYS A 283 ? N CYS A 281 
K 2 3 N GLN A 284 ? N GLN A 282 O ILE A 304 ? O ILE A 302 
L 1 2 N VAL C 5   ? N VAL H 5   O LYS C 23  ? O LYS H 23  
L 2 3 N VAL C 20  ? N VAL H 20  O MET C 81  ? O MET H 80  
L 3 4 O THR C 78  ? O THR H 77  N ASP C 73  ? N ASP H 72  
M 1 2 N LYS C 12  ? N LYS H 12  O THR C 118 ? O THR H 110 
M 2 3 O THR C 115 ? O THR H 107 N TYR C 94  ? N TYR H 90  
M 3 4 O TYR C 95  ? O TYR H 91  N VAL C 37  ? N VAL H 37  
M 4 5 N TRP C 36  ? N TRP H 36  O MET C 48  ? O MET H 48  
M 5 6 N GLY C 50  ? N GLY H 50  O LYS C 59  ? O LYS H 58  
N 1 2 N LYS C 12  ? N LYS H 12  O THR C 118 ? O THR H 110 
N 2 3 O THR C 115 ? O THR H 107 N TYR C 94  ? N TYR H 90  
N 3 4 N LYS C 98  ? N LYS H 94  O VAL C 110 ? O VAL H 102 
O 1 2 N SER C 128 ? N SER H 120 O LYS C 151 ? O LYS H 145 
O 2 3 N TYR C 153 ? N TYR H 147 O TYR C 184 ? O TYR H 185 
O 3 4 O SER C 185 ? O SER H 186 N VAL C 177 ? N VAL H 177 
P 1 2 N ALA D 12  ? N ALA L 13  O THR D 109 ? O THR L 105 
P 2 3 O LEU D 108 ? O LEU L 104 N ALA D 85  ? N ALA L 84  
P 3 4 O TYR D 88  ? O TYR L 87  N TYR D 37  ? N TYR L 36  
P 4 5 N GLN D 38  ? N GLN L 37  O LYS D 46  ? O LYS L 45  
Q 1 2 N ALA D 12  ? N ALA L 13  O THR D 109 ? O THR L 105 
Q 2 3 O LEU D 108 ? O LEU L 104 N ALA D 85  ? N ALA L 84  
Q 3 4 N ASP D 93  ? N ASP L 92  O TYR D 99  C O TYR L 95  
R 1 2 N CYS D 22  ? N CYS L 23  O ALA D 72  ? O ALA L 71  
R 2 3 O THR D 73  ? O THR L 72  N SER D 66  ? N SER L 65  
S 1 2 N LEU D 141 ? N LEU L 132 O LEU D 187 ? O LEU L 179 
S 2 3 O ALA D 182 ? O ALA L 174 N SER D 174 ? N SER L 165 
# 
_database_PDB_matrix.entry_id          3GBN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3GBN 
_atom_sites.fract_transf_matrix[1][1]   0.004953 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004944 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004933 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ALA A 1  1   ? -81.583 -2.422  -4.142  1.00 24.42  ? 7   ALA A N   1 
ATOM   2    C  CA  . ALA A 1  1   ? -82.902 -1.797  -4.320  1.00 28.95  ? 7   ALA A CA  1 
ATOM   3    C  C   . ALA A 1  1   ? -82.793 -0.294  -4.010  1.00 33.65  ? 7   ALA A C   1 
ATOM   4    O  O   . ALA A 1  1   ? -82.317 0.049   -2.955  1.00 44.45  ? 7   ALA A O   1 
ATOM   5    C  CB  . ALA A 1  1   ? -83.894 -2.459  -3.438  1.00 25.10  ? 7   ALA A CB  1 
ATOM   6    N  N   . ASP A 1  2   ? -83.107 0.621   -4.922  1.00 34.25  ? 8   ASP A N   1 
ATOM   7    C  CA  . ASP A 1  2   ? -83.230 0.344   -6.323  1.00 33.77  ? 8   ASP A CA  1 
ATOM   8    C  C   . ASP A 1  2   ? -81.798 -0.181  -6.725  1.00 30.55  ? 8   ASP A C   1 
ATOM   9    O  O   . ASP A 1  2   ? -81.746 -1.212  -7.372  1.00 36.85  ? 8   ASP A O   1 
ATOM   10   C  CB  . ASP A 1  2   ? -83.694 1.614   -7.141  1.00 27.06  ? 8   ASP A CB  1 
ATOM   11   C  CG  . ASP A 1  2   ? -85.038 1.411   -7.922  1.00 41.36  ? 8   ASP A CG  1 
ATOM   12   O  OD1 . ASP A 1  2   ? -85.441 0.240   -8.176  1.00 38.22  ? 8   ASP A OD1 1 
ATOM   13   O  OD2 . ASP A 1  2   ? -85.707 2.450   -8.292  1.00 29.22  ? 8   ASP A OD2 1 
ATOM   14   N  N   . PRO A 1  3   ? -80.668 0.476   -6.307  1.00 25.64  ? 9   PRO A N   1 
ATOM   15   C  CA  . PRO A 1  3   ? -79.344 0.196   -7.005  1.00 26.89  ? 9   PRO A CA  1 
ATOM   16   C  C   . PRO A 1  3   ? -78.625 -1.141  -6.665  1.00 24.16  ? 9   PRO A C   1 
ATOM   17   O  O   . PRO A 1  3   ? -77.623 -1.484  -7.294  1.00 26.57  ? 9   PRO A O   1 
ATOM   18   C  CB  . PRO A 1  3   ? -78.454 1.402   -6.609  1.00 25.42  ? 9   PRO A CB  1 
ATOM   19   C  CG  . PRO A 1  3   ? -78.993 1.823   -5.242  1.00 23.94  ? 9   PRO A CG  1 
ATOM   20   C  CD  . PRO A 1  3   ? -80.465 1.366   -5.150  1.00 27.47  ? 9   PRO A CD  1 
ATOM   21   N  N   . GLY A 1  4   ? -79.139 -1.885  -5.705  1.00 23.86  ? 10  GLY A N   1 
ATOM   22   C  CA  . GLY A 1  4   ? -78.599 -3.223  -5.361  1.00 19.17  ? 10  GLY A CA  1 
ATOM   23   C  C   . GLY A 1  4   ? -77.442 -3.271  -4.388  1.00 19.44  ? 10  GLY A C   1 
ATOM   24   O  O   . GLY A 1  4   ? -76.733 -4.269  -4.347  1.00 20.49  ? 10  GLY A O   1 
ATOM   25   N  N   . ASP A 1  5   ? -77.222 -2.244  -3.561  1.00 19.79  ? 11  ASP A N   1 
ATOM   26   C  CA  . ASP A 1  5   ? -76.161 -2.352  -2.576  1.00 16.53  ? 11  ASP A CA  1 
ATOM   27   C  C   . ASP A 1  5   ? -76.519 -3.415  -1.520  1.00 19.62  ? 11  ASP A C   1 
ATOM   28   O  O   . ASP A 1  5   ? -77.702 -3.613  -1.173  1.00 18.94  ? 11  ASP A O   1 
ATOM   29   C  CB  . ASP A 1  5   ? -75.881 -1.006  -1.892  1.00 20.50  ? 11  ASP A CB  1 
ATOM   30   C  CG  . ASP A 1  5   ? -75.518 0.070   -2.847  1.00 19.15  ? 11  ASP A CG  1 
ATOM   31   O  OD1 . ASP A 1  5   ? -75.595 1.267   -2.459  1.00 19.13  ? 11  ASP A OD1 1 
ATOM   32   O  OD2 . ASP A 1  5   ? -75.175 -0.262  -4.004  1.00 20.63  ? 11  ASP A OD2 1 
ATOM   33   N  N   . THR A 1  6   ? -75.497 -4.091  -1.004  1.00 19.79  ? 12  THR A N   1 
ATOM   34   C  CA  . THR A 1  6   ? -75.666 -5.206  -0.103  1.00 21.45  ? 12  THR A CA  1 
ATOM   35   C  C   . THR A 1  6   ? -74.631 -5.201  0.958   1.00 19.77  ? 12  THR A C   1 
ATOM   36   O  O   . THR A 1  6   ? -73.524 -4.725  0.770   1.00 21.60  ? 12  THR A O   1 
ATOM   37   C  CB  . THR A 1  6   ? -75.520 -6.610  -0.814  1.00 23.18  ? 12  THR A CB  1 
ATOM   38   O  OG1 . THR A 1  6   ? -74.216 -6.741  -1.342  1.00 24.45  ? 12  THR A OG1 1 
ATOM   39   C  CG2 . THR A 1  6   ? -76.596 -6.840  -1.924  1.00 18.22  ? 12  THR A CG2 1 
ATOM   40   N  N   . ILE A 1  7   ? -75.021 -5.730  2.094   1.00 19.55  ? 13  ILE A N   1 
ATOM   41   C  CA  . ILE A 1  7   ? -74.136 -6.103  3.134   1.00 19.49  ? 13  ILE A CA  1 
ATOM   42   C  C   . ILE A 1  7   ? -74.497 -7.505  3.588   1.00 20.86  ? 13  ILE A C   1 
ATOM   43   O  O   . ILE A 1  7   ? -75.696 -7.871  3.659   1.00 22.25  ? 13  ILE A O   1 
ATOM   44   C  CB  . ILE A 1  7   ? -74.153 -5.101  4.294   1.00 22.04  ? 13  ILE A CB  1 
ATOM   45   C  CG1 . ILE A 1  7   ? -72.928 -5.345  5.188   1.00 23.51  ? 13  ILE A CG1 1 
ATOM   46   C  CG2 . ILE A 1  7   ? -75.438 -5.164  5.072   1.00 22.63  ? 13  ILE A CG2 1 
ATOM   47   C  CD1 . ILE A 1  7   ? -72.551 -4.165  6.035   1.00 21.27  ? 13  ILE A CD1 1 
ATOM   48   N  N   . CYS A 1  8   ? -73.467 -8.294  3.895   1.00 20.67  ? 14  CYS A N   1 
ATOM   49   C  CA  . CYS A 1  8   ? -73.635 -9.692  4.309   1.00 20.86  ? 14  CYS A CA  1 
ATOM   50   C  C   . CYS A 1  8   ? -72.815 -9.905  5.550   1.00 21.60  ? 14  CYS A C   1 
ATOM   51   O  O   . CYS A 1  8   ? -71.783 -9.260  5.721   1.00 23.30  ? 14  CYS A O   1 
ATOM   52   C  CB  . CYS A 1  8   ? -73.119 -10.662 3.223   1.00 23.57  ? 14  CYS A CB  1 
ATOM   53   S  SG  . CYS A 1  8   ? -73.768 -10.431 1.614   1.00 26.30  ? 14  CYS A SG  1 
ATOM   54   N  N   . ILE A 1  9   ? -73.329 -10.753 6.432   1.00 17.83  ? 15  ILE A N   1 
ATOM   55   C  CA  . ILE A 1  9   ? -72.680 -11.187 7.649   1.00 19.10  ? 15  ILE A CA  1 
ATOM   56   C  C   . ILE A 1  9   ? -72.130 -12.579 7.410   1.00 21.48  ? 15  ILE A C   1 
ATOM   57   O  O   . ILE A 1  9   ? -72.785 -13.426 6.782   1.00 24.23  ? 15  ILE A O   1 
ATOM   58   C  CB  . ILE A 1  9   ? -73.686 -11.269 8.796   1.00 21.54  ? 15  ILE A CB  1 
ATOM   59   C  CG1 . ILE A 1  9   ? -74.410 -9.918  9.047   1.00 29.35  ? 15  ILE A CG1 1 
ATOM   60   C  CG2 . ILE A 1  9   ? -73.104 -11.974 10.068  1.00 22.79  ? 15  ILE A CG2 1 
ATOM   61   C  CD1 . ILE A 1  9   ? -73.813 -8.722  8.651   1.00 28.71  ? 15  ILE A CD1 1 
ATOM   62   N  N   . GLY A 1  10  ? -70.925 -12.822 7.904   1.00 25.24  ? 16  GLY A N   1 
ATOM   63   C  CA  . GLY A 1  10  ? -70.265 -14.111 7.664   1.00 24.04  ? 16  GLY A CA  1 
ATOM   64   C  C   . GLY A 1  10  ? -69.165 -14.389 8.617   1.00 20.33  ? 16  GLY A C   1 
ATOM   65   O  O   . GLY A 1  10  ? -68.978 -13.700 9.629   1.00 18.76  ? 16  GLY A O   1 
ATOM   66   N  N   . TYR A 1  11  ? -68.473 -15.474 8.357   1.00 20.56  ? 17  TYR A N   1 
ATOM   67   C  CA  . TYR A 1  11  ? -67.495 -15.952 9.310   1.00 20.29  ? 17  TYR A CA  1 
ATOM   68   C  C   . TYR A 1  11  ? -66.260 -16.400 8.529   1.00 20.85  ? 17  TYR A C   1 
ATOM   69   O  O   . TYR A 1  11  ? -66.334 -16.627 7.344   1.00 22.60  ? 17  TYR A O   1 
ATOM   70   C  CB  . TYR A 1  11  ? -68.059 -17.093 10.149  1.00 23.89  ? 17  TYR A CB  1 
ATOM   71   C  CG  . TYR A 1  11  ? -68.805 -18.125 9.371   1.00 21.75  ? 17  TYR A CG  1 
ATOM   72   C  CD1 . TYR A 1  11  ? -68.180 -19.306 8.974   1.00 22.87  ? 17  TYR A CD1 1 
ATOM   73   C  CD2 . TYR A 1  11  ? -70.139 -18.007 9.143   1.00 20.58  ? 17  TYR A CD2 1 
ATOM   74   C  CE1 . TYR A 1  11  ? -68.886 -20.290 8.298   1.00 20.55  ? 17  TYR A CE1 1 
ATOM   75   C  CE2 . TYR A 1  11  ? -70.845 -19.005 8.453   1.00 23.77  ? 17  TYR A CE2 1 
ATOM   76   C  CZ  . TYR A 1  11  ? -70.198 -20.136 8.025   1.00 19.78  ? 17  TYR A CZ  1 
ATOM   77   O  OH  . TYR A 1  11  ? -70.886 -21.144 7.331   1.00 24.93  ? 17  TYR A OH  1 
ATOM   78   N  N   . HIS A 1  12  ? -65.148 -16.473 9.230   1.00 24.47  ? 18  HIS A N   1 
ATOM   79   C  CA  . HIS A 1  12  ? -63.834 -16.799 8.687   1.00 23.65  ? 18  HIS A CA  1 
ATOM   80   C  C   . HIS A 1  12  ? -63.712 -18.257 8.256   1.00 23.85  ? 18  HIS A C   1 
ATOM   81   O  O   . HIS A 1  12  ? -64.223 -19.168 8.940   1.00 25.78  ? 18  HIS A O   1 
ATOM   82   C  CB  . HIS A 1  12  ? -62.870 -16.605 9.835   1.00 22.38  ? 18  HIS A CB  1 
ATOM   83   C  CG  . HIS A 1  12  ? -61.421 -16.765 9.476   1.00 23.52  ? 18  HIS A CG  1 
ATOM   84   N  ND1 . HIS A 1  12  ? -60.780 -15.890 8.637   1.00 27.07  ? 18  HIS A ND1 1 
ATOM   85   C  CD2 . HIS A 1  12  ? -60.486 -17.663 9.866   1.00 23.05  ? 18  HIS A CD2 1 
ATOM   86   C  CE1 . HIS A 1  12  ? -59.508 -16.241 8.520   1.00 27.48  ? 18  HIS A CE1 1 
ATOM   87   N  NE2 . HIS A 1  12  ? -59.307 -17.323 9.243   1.00 26.60  ? 18  HIS A NE2 1 
ATOM   88   N  N   . ALA A 1  13  ? -63.031 -18.481 7.141   1.00 25.39  ? 19  ALA A N   1 
ATOM   89   C  CA  . ALA A 1  13  ? -62.497 -19.795 6.791   1.00 23.68  ? 19  ALA A CA  1 
ATOM   90   C  C   . ALA A 1  13  ? -61.050 -19.654 6.406   1.00 23.01  ? 19  ALA A C   1 
ATOM   91   O  O   . ALA A 1  13  ? -60.601 -18.547 6.118   1.00 22.80  ? 19  ALA A O   1 
ATOM   92   C  CB  . ALA A 1  13  ? -63.281 -20.426 5.596   1.00 20.60  ? 19  ALA A CB  1 
ATOM   93   N  N   . ASN A 1  14  ? -60.314 -20.781 6.357   1.00 20.54  ? 20  ASN A N   1 
ATOM   94   C  CA  . ASN A 1  14  ? -58.923 -20.726 5.923   1.00 21.70  ? 20  ASN A CA  1 
ATOM   95   C  C   . ASN A 1  14  ? -58.576 -22.103 5.376   1.00 21.03  ? 20  ASN A C   1 
ATOM   96   O  O   . ASN A 1  14  ? -59.446 -22.962 5.206   1.00 21.50  ? 20  ASN A O   1 
ATOM   97   C  CB  . ASN A 1  14  ? -57.985 -20.239 7.049   1.00 16.49  ? 20  ASN A CB  1 
ATOM   98   C  CG  . ASN A 1  14  ? -58.075 -21.172 8.321   1.00 21.36  ? 20  ASN A CG  1 
ATOM   99   O  OD1 . ASN A 1  14  ? -58.417 -22.311 8.174   1.00 25.04  ? 20  ASN A OD1 1 
ATOM   100  N  ND2 . ASN A 1  14  ? -57.672 -20.700 9.491   1.00 16.99  ? 20  ASN A ND2 1 
ATOM   101  N  N   . ASN A 1  15  ? -57.324 -22.300 5.070   1.00 19.01  ? 21  ASN A N   1 
ATOM   102  C  CA  . ASN A 1  15  ? -56.879 -23.575 4.570   1.00 21.77  ? 21  ASN A CA  1 
ATOM   103  C  C   . ASN A 1  15  ? -56.394 -24.523 5.640   1.00 21.74  ? 21  ASN A C   1 
ATOM   104  O  O   . ASN A 1  15  ? -55.740 -25.479 5.317   1.00 21.98  ? 21  ASN A O   1 
ATOM   105  C  CB  . ASN A 1  15  ? -55.816 -23.373 3.514   1.00 21.52  ? 21  ASN A CB  1 
ATOM   106  C  CG  . ASN A 1  15  ? -54.554 -22.815 4.092   1.00 33.07  ? 21  ASN A CG  1 
ATOM   107  O  OD1 . ASN A 1  15  ? -54.442 -22.648 5.306   1.00 44.54  ? 21  ASN A OD1 1 
ATOM   108  N  ND2 . ASN A 1  15  ? -53.594 -22.521 3.237   1.00 50.46  ? 21  ASN A ND2 1 
ATOM   109  N  N   . SER A 1  16  ? -56.761 -24.319 6.910   1.00 25.03  ? 22  SER A N   1 
ATOM   110  C  CA  . SER A 1  16  ? -56.280 -25.228 7.984   1.00 25.32  ? 22  SER A CA  1 
ATOM   111  C  C   . SER A 1  16  ? -56.871 -26.636 7.744   1.00 23.42  ? 22  SER A C   1 
ATOM   112  O  O   . SER A 1  16  ? -57.974 -26.727 7.328   1.00 18.26  ? 22  SER A O   1 
ATOM   113  C  CB  . SER A 1  16  ? -56.771 -24.727 9.377   1.00 30.08  ? 22  SER A CB  1 
ATOM   114  O  OG  . SER A 1  16  ? -56.826 -25.751 10.389  1.00 31.10  ? 22  SER A OG  1 
ATOM   115  N  N   . THR A 1  17  ? -56.152 -27.712 8.032   1.00 21.57  ? 23  THR A N   1 
ATOM   116  C  CA  . THR A 1  17  ? -56.726 -29.052 7.886   1.00 22.71  ? 23  THR A CA  1 
ATOM   117  C  C   . THR A 1  17  ? -56.731 -29.801 9.229   1.00 25.05  ? 23  THR A C   1 
ATOM   118  O  O   . THR A 1  17  ? -57.009 -30.967 9.258   1.00 26.89  ? 23  THR A O   1 
ATOM   119  C  CB  . THR A 1  17  ? -55.906 -29.952 6.914   1.00 19.68  ? 23  THR A CB  1 
ATOM   120  O  OG1 . THR A 1  17  ? -54.585 -29.995 7.406   1.00 21.33  ? 23  THR A OG1 1 
ATOM   121  C  CG2 . THR A 1  17  ? -55.898 -29.417 5.408   1.00 22.80  ? 23  THR A CG2 1 
ATOM   122  N  N   . ASP A 1  18  ? -56.412 -29.153 10.334  1.00 23.79  ? 24  ASP A N   1 
ATOM   123  C  CA  . ASP A 1  18  ? -56.548 -29.790 11.656  1.00 26.01  ? 24  ASP A CA  1 
ATOM   124  C  C   . ASP A 1  18  ? -58.018 -30.070 12.053  1.00 20.94  ? 24  ASP A C   1 
ATOM   125  O  O   . ASP A 1  18  ? -58.918 -29.308 11.796  1.00 21.28  ? 24  ASP A O   1 
ATOM   126  C  CB  . ASP A 1  18  ? -55.886 -28.935 12.750  1.00 25.97  ? 24  ASP A CB  1 
ATOM   127  C  CG  . ASP A 1  18  ? -54.383 -28.689 12.472  1.00 40.57  ? 24  ASP A CG  1 
ATOM   128  O  OD1 . ASP A 1  18  ? -53.570 -29.664 12.463  1.00 37.52  ? 24  ASP A OD1 1 
ATOM   129  O  OD2 . ASP A 1  18  ? -54.048 -27.514 12.239  1.00 46.18  ? 24  ASP A OD2 1 
ATOM   130  N  N   . THR A 1  19  ? -58.207 -31.165 12.749  1.00 20.67  ? 25  THR A N   1 
ATOM   131  C  CA  . THR A 1  19  ? -59.502 -31.666 13.093  1.00 22.18  ? 25  THR A CA  1 
ATOM   132  C  C   . THR A 1  19  ? -59.559 -31.837 14.574  1.00 23.62  ? 25  THR A C   1 
ATOM   133  O  O   . THR A 1  19  ? -58.547 -32.062 15.200  1.00 21.40  ? 25  THR A O   1 
ATOM   134  C  CB  . THR A 1  19  ? -59.751 -33.016 12.429  1.00 20.66  ? 25  THR A CB  1 
ATOM   135  O  OG1 . THR A 1  19  ? -58.738 -33.953 12.850  1.00 29.01  ? 25  THR A OG1 1 
ATOM   136  C  CG2 . THR A 1  19  ? -59.686 -32.909 10.805  1.00 20.65  ? 25  THR A CG2 1 
ATOM   137  N  N   . VAL A 1  20  ? -60.778 -31.727 15.104  1.00 24.43  ? 26  VAL A N   1 
ATOM   138  C  CA  . VAL A 1  20  ? -61.086 -31.981 16.483  1.00 21.92  ? 26  VAL A CA  1 
ATOM   139  C  C   . VAL A 1  20  ? -62.309 -32.921 16.560  1.00 23.78  ? 26  VAL A C   1 
ATOM   140  O  O   . VAL A 1  20  ? -63.059 -33.077 15.601  1.00 22.17  ? 26  VAL A O   1 
ATOM   141  C  CB  . VAL A 1  20  ? -61.437 -30.699 17.233  1.00 22.98  ? 26  VAL A CB  1 
ATOM   142  C  CG1 . VAL A 1  20  ? -60.215 -29.759 17.231  1.00 23.16  ? 26  VAL A CG1 1 
ATOM   143  C  CG2 . VAL A 1  20  ? -62.697 -30.051 16.655  1.00 20.58  ? 26  VAL A CG2 1 
ATOM   144  N  N   . ASP A 1  21  ? -62.445 -33.611 17.686  1.00 22.98  ? 27  ASP A N   1 
ATOM   145  C  CA  . ASP A 1  21  ? -63.591 -34.433 17.893  1.00 23.02  ? 27  ASP A CA  1 
ATOM   146  C  C   . ASP A 1  21  ? -64.478 -33.711 18.855  1.00 23.59  ? 27  ASP A C   1 
ATOM   147  O  O   . ASP A 1  21  ? -64.005 -32.995 19.759  1.00 21.13  ? 27  ASP A O   1 
ATOM   148  C  CB  . ASP A 1  21  ? -63.203 -35.765 18.472  1.00 22.84  ? 27  ASP A CB  1 
ATOM   149  C  CG  . ASP A 1  21  ? -62.431 -36.613 17.496  1.00 21.19  ? 27  ASP A CG  1 
ATOM   150  O  OD1 . ASP A 1  21  ? -62.511 -36.406 16.271  1.00 24.41  ? 27  ASP A OD1 1 
ATOM   151  O  OD2 . ASP A 1  21  ? -61.746 -37.508 17.967  1.00 27.28  ? 27  ASP A OD2 1 
ATOM   152  N  N   . THR A 1  22  ? -65.765 -33.886 18.636  1.00 22.61  ? 28  THR A N   1 
ATOM   153  C  CA  . THR A 1  22  ? -66.784 -33.486 19.585  1.00 25.53  ? 28  THR A CA  1 
ATOM   154  C  C   . THR A 1  22  ? -67.547 -34.775 19.999  1.00 26.11  ? 28  THR A C   1 
ATOM   155  O  O   . THR A 1  22  ? -67.242 -35.889 19.553  1.00 23.97  ? 28  THR A O   1 
ATOM   156  C  CB  . THR A 1  22  ? -67.732 -32.445 18.980  1.00 28.00  ? 28  THR A CB  1 
ATOM   157  O  OG1 . THR A 1  22  ? -68.561 -33.040 17.955  1.00 28.24  ? 28  THR A OG1 1 
ATOM   158  C  CG2 . THR A 1  22  ? -66.957 -31.224 18.378  1.00 29.10  ? 28  THR A CG2 1 
ATOM   159  N  N   . VAL A 1  23  ? -68.626 -34.594 20.753  1.00 26.38  ? 29  VAL A N   1 
ATOM   160  C  CA  . VAL A 1  23  ? -69.455 -35.704 21.230  1.00 25.65  ? 29  VAL A CA  1 
ATOM   161  C  C   . VAL A 1  23  ? -70.371 -36.117 20.078  1.00 18.86  ? 29  VAL A C   1 
ATOM   162  O  O   . VAL A 1  23  ? -70.612 -37.255 19.859  1.00 15.43  ? 29  VAL A O   1 
ATOM   163  C  CB  . VAL A 1  23  ? -70.287 -35.152 22.447  1.00 32.38  ? 29  VAL A CB  1 
ATOM   164  C  CG1 . VAL A 1  23  ? -71.420 -36.073 22.872  1.00 16.86  ? 29  VAL A CG1 1 
ATOM   165  C  CG2 . VAL A 1  23  ? -69.341 -34.848 23.668  1.00 36.62  ? 29  VAL A CG2 1 
ATOM   166  N  N   . LEU A 1  24  ? -70.867 -35.156 19.319  1.00 19.15  ? 30  LEU A N   1 
ATOM   167  C  CA  . LEU A 1  24  ? -71.824 -35.466 18.283  1.00 22.05  ? 30  LEU A CA  1 
ATOM   168  C  C   . LEU A 1  24  ? -71.120 -35.896 16.944  1.00 23.59  ? 30  LEU A C   1 
ATOM   169  O  O   . LEU A 1  24  ? -71.751 -36.423 16.077  1.00 19.08  ? 30  LEU A O   1 
ATOM   170  C  CB  . LEU A 1  24  ? -72.719 -34.253 17.975  1.00 18.38  ? 30  LEU A CB  1 
ATOM   171  C  CG  . LEU A 1  24  ? -73.669 -33.774 19.088  1.00 27.61  ? 30  LEU A CG  1 
ATOM   172  C  CD1 . LEU A 1  24  ? -74.422 -32.475 18.688  1.00 15.01  ? 30  LEU A CD1 1 
ATOM   173  C  CD2 . LEU A 1  24  ? -74.713 -34.903 19.445  1.00 14.50  ? 30  LEU A CD2 1 
ATOM   174  N  N   . GLU A 1  25  ? -69.855 -35.577 16.790  1.00 22.92  ? 31  GLU A N   1 
ATOM   175  C  CA  . GLU A 1  25  ? -69.207 -35.585 15.483  1.00 24.93  ? 31  GLU A CA  1 
ATOM   176  C  C   . GLU A 1  25  ? -67.702 -35.700 15.594  1.00 22.85  ? 31  GLU A C   1 
ATOM   177  O  O   . GLU A 1  25  ? -67.042 -34.981 16.369  1.00 20.83  ? 31  GLU A O   1 
ATOM   178  C  CB  . GLU A 1  25  ? -69.574 -34.339 14.664  1.00 24.28  ? 31  GLU A CB  1 
ATOM   179  C  CG  . GLU A 1  25  ? -69.427 -34.651 13.178  1.00 28.58  ? 31  GLU A CG  1 
ATOM   180  C  CD  . GLU A 1  25  ? -69.524 -33.427 12.289  1.00 33.32  ? 31  GLU A CD  1 
ATOM   181  O  OE1 . GLU A 1  25  ? -69.003 -33.513 11.184  1.00 36.46  ? 31  GLU A OE1 1 
ATOM   182  O  OE2 . GLU A 1  25  ? -70.132 -32.418 12.675  1.00 28.35  ? 31  GLU A OE2 1 
ATOM   183  N  N   . LYS A 1  26  ? -67.152 -36.694 14.935  1.00 18.55  ? 32  LYS A N   1 
ATOM   184  C  CA  . LYS A 1  26  ? -65.701 -36.846 14.947  1.00 21.06  ? 32  LYS A CA  1 
ATOM   185  C  C   . LYS A 1  26  ? -65.084 -36.129 13.756  1.00 19.52  ? 32  LYS A C   1 
ATOM   186  O  O   . LYS A 1  26  ? -65.763 -35.892 12.747  1.00 20.86  ? 32  LYS A O   1 
ATOM   187  C  CB  . LYS A 1  26  ? -65.353 -38.309 14.846  1.00 21.41  ? 32  LYS A CB  1 
ATOM   188  C  CG  . LYS A 1  26  ? -65.672 -39.097 16.107  1.00 27.50  ? 32  LYS A CG  1 
ATOM   189  C  CD  . LYS A 1  26  ? -65.030 -40.463 16.060  1.00 37.73  ? 32  LYS A CD  1 
ATOM   190  C  CE  . LYS A 1  26  ? -65.129 -41.193 17.413  1.00 49.00  ? 32  LYS A CE  1 
ATOM   191  N  NZ  . LYS A 1  26  ? -65.534 -42.653 17.210  1.00 55.77  ? 32  LYS A NZ  1 
ATOM   192  N  N   A ASN A 1  27  ? -63.806 -35.783 13.873  0.50 21.18  ? 33  ASN A N   1 
ATOM   193  N  N   B ASN A 1  27  ? -63.809 -35.767 13.902  0.50 22.15  ? 33  ASN A N   1 
ATOM   194  C  CA  A ASN A 1  27  ? -63.018 -35.286 12.757  0.50 20.78  ? 33  ASN A CA  1 
ATOM   195  C  CA  B ASN A 1  27  ? -62.966 -35.331 12.802  0.50 22.69  ? 33  ASN A CA  1 
ATOM   196  C  C   A ASN A 1  27  ? -63.575 -34.032 12.128  0.50 20.55  ? 33  ASN A C   1 
ATOM   197  C  C   B ASN A 1  27  ? -63.531 -34.058 12.143  0.50 21.58  ? 33  ASN A C   1 
ATOM   198  O  O   A ASN A 1  27  ? -63.842 -34.010 10.950  0.50 22.20  ? 33  ASN A O   1 
ATOM   199  O  O   B ASN A 1  27  ? -63.768 -34.055 10.957  0.50 23.12  ? 33  ASN A O   1 
ATOM   200  C  CB  A ASN A 1  27  ? -62.911 -36.355 11.667  0.50 23.72  ? 33  ASN A CB  1 
ATOM   201  C  CB  B ASN A 1  27  ? -62.851 -36.480 11.765  0.50 25.62  ? 33  ASN A CB  1 
ATOM   202  C  CG  A ASN A 1  27  ? -61.892 -37.345 11.994  0.50 12.79  ? 33  ASN A CG  1 
ATOM   203  C  CG  B ASN A 1  27  ? -61.653 -36.333 10.832  0.50 26.67  ? 33  ASN A CG  1 
ATOM   204  O  OD1 A ASN A 1  27  ? -61.084 -37.084 12.862  0.50 18.64  ? 33  ASN A OD1 1 
ATOM   205  O  OD1 B ASN A 1  27  ? -60.602 -35.837 11.238  0.50 29.51  ? 33  ASN A OD1 1 
ATOM   206  N  ND2 A ASN A 1  27  ? -61.913 -38.505 11.340  0.50 27.92  ? 33  ASN A ND2 1 
ATOM   207  N  ND2 B ASN A 1  27  ? -61.799 -36.794 9.581   0.50 31.98  ? 33  ASN A ND2 1 
ATOM   208  N  N   . VAL A 1  28  ? -63.776 -33.008 12.929  1.00 21.86  ? 34  VAL A N   1 
ATOM   209  C  CA  . VAL A 1  28  ? -64.376 -31.762 12.442  1.00 21.23  ? 34  VAL A CA  1 
ATOM   210  C  C   . VAL A 1  28  ? -63.207 -30.804 12.133  1.00 22.90  ? 34  VAL A C   1 
ATOM   211  O  O   . VAL A 1  28  ? -62.394 -30.525 12.999  1.00 22.41  ? 34  VAL A O   1 
ATOM   212  C  CB  . VAL A 1  28  ? -65.307 -31.100 13.490  1.00 22.25  ? 34  VAL A CB  1 
ATOM   213  C  CG1 . VAL A 1  28  ? -65.829 -29.738 13.003  1.00 19.18  ? 34  VAL A CG1 1 
ATOM   214  C  CG2 . VAL A 1  28  ? -66.521 -32.012 13.842  1.00 19.16  ? 34  VAL A CG2 1 
ATOM   215  N  N   . THR A 1  29  ? -63.104 -30.377 10.879  1.00 21.86  ? 35  THR A N   1 
ATOM   216  C  CA  . THR A 1  29  ? -62.054 -29.437 10.473  1.00 21.85  ? 35  THR A CA  1 
ATOM   217  C  C   . THR A 1  29  ? -62.377 -28.063 11.039  1.00 19.32  ? 35  THR A C   1 
ATOM   218  O  O   . THR A 1  29  ? -63.429 -27.527 10.797  1.00 21.09  ? 35  THR A O   1 
ATOM   219  C  CB  . THR A 1  29  ? -61.914 -29.409 8.951   1.00 22.25  ? 35  THR A CB  1 
ATOM   220  O  OG1 . THR A 1  29  ? -61.627 -30.734 8.507   1.00 22.09  ? 35  THR A OG1 1 
ATOM   221  C  CG2 . THR A 1  29  ? -60.700 -28.474 8.513   1.00 21.91  ? 35  THR A CG2 1 
ATOM   222  N  N   . VAL A 1  30  ? -61.479 -27.513 11.859  1.00 21.36  ? 36  VAL A N   1 
ATOM   223  C  CA  . VAL A 1  30  ? -61.702 -26.183 12.437  1.00 19.36  ? 36  VAL A CA  1 
ATOM   224  C  C   . VAL A 1  30  ? -60.639 -25.182 11.916  1.00 22.05  ? 36  VAL A C   1 
ATOM   225  O  O   . VAL A 1  30  ? -59.598 -25.593 11.384  1.00 23.83  ? 36  VAL A O   1 
ATOM   226  C  CB  . VAL A 1  30  ? -61.689 -26.259 13.941  1.00 22.10  ? 36  VAL A CB  1 
ATOM   227  C  CG1 . VAL A 1  30  ? -62.850 -27.064 14.421  1.00 19.21  ? 36  VAL A CG1 1 
ATOM   228  C  CG2 . VAL A 1  30  ? -60.341 -26.831 14.400  1.00 17.44  ? 36  VAL A CG2 1 
ATOM   229  N  N   . THR A 1  31  ? -60.874 -23.892 12.115  1.00 22.86  ? 37  THR A N   1 
ATOM   230  C  CA  . THR A 1  31  ? -60.011 -22.820 11.582  1.00 20.63  ? 37  THR A CA  1 
ATOM   231  C  C   . THR A 1  31  ? -58.791 -22.656 12.469  1.00 22.74  ? 37  THR A C   1 
ATOM   232  O  O   . THR A 1  31  ? -57.721 -22.297 11.995  1.00 21.49  ? 37  THR A O   1 
ATOM   233  C  CB  . THR A 1  31  ? -60.732 -21.467 11.493  1.00 26.13  ? 37  THR A CB  1 
ATOM   234  O  OG1 . THR A 1  31  ? -61.137 -21.027 12.809  1.00 25.21  ? 37  THR A OG1 1 
ATOM   235  C  CG2 . THR A 1  31  ? -61.924 -21.507 10.589  1.00 19.07  ? 37  THR A CG2 1 
ATOM   236  N  N   . HIS A 1  32  ? -58.956 -22.879 13.774  1.00 20.19  ? 38  HIS A N   1 
ATOM   237  C  CA  . HIS A 1  32  ? -57.869 -22.731 14.720  1.00 15.39  ? 38  HIS A CA  1 
ATOM   238  C  C   . HIS A 1  32  ? -58.033 -23.738 15.850  1.00 15.17  ? 38  HIS A C   1 
ATOM   239  O  O   . HIS A 1  32  ? -59.156 -24.031 16.227  1.00 21.81  ? 38  HIS A O   1 
ATOM   240  C  CB  . HIS A 1  32  ? -57.851 -21.328 15.333  1.00 19.13  ? 38  HIS A CB  1 
ATOM   241  C  CG  . HIS A 1  32  ? -57.727 -20.240 14.335  1.00 16.40  ? 38  HIS A CG  1 
ATOM   242  N  ND1 . HIS A 1  32  ? -58.830 -19.759 13.673  1.00 17.71  ? 38  HIS A ND1 1 
ATOM   243  C  CD2 . HIS A 1  32  ? -56.643 -19.690 13.733  1.00 17.43  ? 38  HIS A CD2 1 
ATOM   244  C  CE1 . HIS A 1  32  ? -58.442 -18.850 12.796  1.00 20.24  ? 38  HIS A CE1 1 
ATOM   245  N  NE2 . HIS A 1  32  ? -57.130 -18.783 12.815  1.00 15.14  ? 38  HIS A NE2 1 
ATOM   246  N  N   . SER A 1  33  ? -56.922 -24.251 16.389  1.00 18.94  ? 39  SER A N   1 
ATOM   247  C  CA  . SER A 1  33  ? -57.012 -25.272 17.450  1.00 18.90  ? 39  SER A CA  1 
ATOM   248  C  C   . SER A 1  33  ? -55.641 -25.366 18.087  1.00 19.35  ? 39  SER A C   1 
ATOM   249  O  O   . SER A 1  33  ? -54.675 -24.831 17.550  1.00 18.68  ? 39  SER A O   1 
ATOM   250  C  CB  . SER A 1  33  ? -57.446 -26.627 16.836  1.00 22.18  ? 39  SER A CB  1 
ATOM   251  O  OG  . SER A 1  33  ? -56.385 -27.192 16.052  1.00 25.59  ? 39  SER A OG  1 
ATOM   252  N  N   . VAL A 1  34  ? -55.558 -26.009 19.248  1.00 18.69  ? 40  VAL A N   1 
ATOM   253  C  CA  . VAL A 1  34  ? -54.325 -26.165 19.956  1.00 19.16  ? 40  VAL A CA  1 
ATOM   254  C  C   . VAL A 1  34  ? -54.220 -27.600 20.406  1.00 20.13  ? 40  VAL A C   1 
ATOM   255  O  O   . VAL A 1  34  ? -55.173 -28.203 20.840  1.00 20.78  ? 40  VAL A O   1 
ATOM   256  C  CB  . VAL A 1  34  ? -54.154 -25.205 21.191  1.00 24.02  ? 40  VAL A CB  1 
ATOM   257  C  CG1 . VAL A 1  34  ? -54.139 -23.730 20.736  1.00 28.20  ? 40  VAL A CG1 1 
ATOM   258  C  CG2 . VAL A 1  34  ? -55.272 -25.435 22.256  1.00 19.76  ? 40  VAL A CG2 1 
ATOM   259  N  N   . ASN A 1  35  ? -53.000 -28.105 20.378  1.00 20.68  ? 41  ASN A N   1 
ATOM   260  C  CA  . ASN A 1  35  ? -52.685 -29.398 20.860  1.00 20.94  ? 41  ASN A CA  1 
ATOM   261  C  C   . ASN A 1  35  ? -52.275 -29.299 22.345  1.00 19.83  ? 41  ASN A C   1 
ATOM   262  O  O   . ASN A 1  35  ? -51.390 -28.597 22.651  1.00 17.88  ? 41  ASN A O   1 
ATOM   263  C  CB  . ASN A 1  35  ? -51.490 -29.902 20.052  1.00 20.27  ? 41  ASN A CB  1 
ATOM   264  C  CG  . ASN A 1  35  ? -51.097 -31.299 20.404  1.00 24.66  ? 41  ASN A CG  1 
ATOM   265  O  OD1 . ASN A 1  35  ? -51.861 -32.030 20.945  1.00 20.12  ? 41  ASN A OD1 1 
ATOM   266  N  ND2 . ASN A 1  35  ? -49.912 -31.678 20.043  1.00 34.06  ? 41  ASN A ND2 1 
ATOM   267  N  N   . LEU A 1  36  ? -52.902 -30.098 23.202  1.00 20.21  ? 42  LEU A N   1 
ATOM   268  C  CA  . LEU A 1  36  ? -52.643 -30.161 24.623  1.00 20.52  ? 42  LEU A CA  1 
ATOM   269  C  C   . LEU A 1  36  ? -51.699 -31.253 25.014  1.00 17.83  ? 42  LEU A C   1 
ATOM   270  O  O   . LEU A 1  36  ? -51.284 -31.294 26.152  1.00 14.87  ? 42  LEU A O   1 
ATOM   271  C  CB  . LEU A 1  36  ? -53.966 -30.446 25.331  1.00 20.04  ? 42  LEU A CB  1 
ATOM   272  C  CG  . LEU A 1  36  ? -55.104 -29.453 25.080  1.00 26.68  ? 42  LEU A CG  1 
ATOM   273  C  CD1 . LEU A 1  36  ? -56.248 -29.710 26.056  1.00 24.79  ? 42  LEU A CD1 1 
ATOM   274  C  CD2 . LEU A 1  36  ? -54.598 -28.122 25.284  1.00 18.68  ? 42  LEU A CD2 1 
ATOM   275  N  N   . LEU A 1  37  ? -51.298 -32.105 24.060  1.00 19.01  ? 43  LEU A N   1 
ATOM   276  C  CA  . LEU A 1  37  ? -50.581 -33.342 24.370  1.00 16.52  ? 43  LEU A CA  1 
ATOM   277  C  C   . LEU A 1  37  ? -49.141 -33.432 23.856  1.00 20.62  ? 43  LEU A C   1 
ATOM   278  O  O   . LEU A 1  37  ? -48.923 -33.489 22.668  1.00 19.09  ? 43  LEU A O   1 
ATOM   279  C  CB  . LEU A 1  37  ? -51.380 -34.487 23.776  1.00 15.18  ? 43  LEU A CB  1 
ATOM   280  C  CG  . LEU A 1  37  ? -50.894 -35.916 23.949  1.00 20.10  ? 43  LEU A CG  1 
ATOM   281  C  CD1 . LEU A 1  37  ? -50.822 -36.353 25.396  1.00 16.65  ? 43  LEU A CD1 1 
ATOM   282  C  CD2 . LEU A 1  37  ? -51.882 -36.780 23.192  1.00 16.27  ? 43  LEU A CD2 1 
ATOM   283  N  N   . GLU A 1  38  ? -48.156 -33.476 24.764  1.00 19.37  ? 44  GLU A N   1 
ATOM   284  C  CA  . GLU A 1  38  ? -46.749 -33.523 24.347  1.00 20.02  ? 44  GLU A CA  1 
ATOM   285  C  C   . GLU A 1  38  ? -46.396 -34.980 24.111  1.00 21.19  ? 44  GLU A C   1 
ATOM   286  O  O   . GLU A 1  38  ? -46.603 -35.835 24.998  1.00 19.22  ? 44  GLU A O   1 
ATOM   287  C  CB  . GLU A 1  38  ? -45.815 -32.983 25.443  1.00 20.00  ? 44  GLU A CB  1 
ATOM   288  C  CG  . GLU A 1  38  ? -44.381 -32.963 25.063  1.00 21.83  ? 44  GLU A CG  1 
ATOM   289  C  CD  . GLU A 1  38  ? -44.202 -32.069 23.872  1.00 30.10  ? 44  GLU A CD  1 
ATOM   290  O  OE1 . GLU A 1  38  ? -44.406 -30.846 24.023  1.00 26.96  ? 44  GLU A OE1 1 
ATOM   291  O  OE2 . GLU A 1  38  ? -44.001 -32.607 22.775  1.00 26.09  ? 44  GLU A OE2 1 
ATOM   292  N  N   . ASP A 1  39  ? -45.896 -35.262 22.920  1.00 23.95  ? 45  ASP A N   1 
ATOM   293  C  CA  . ASP A 1  39  ? -45.455 -36.598 22.568  1.00 24.82  ? 45  ASP A CA  1 
ATOM   294  C  C   . ASP A 1  39  ? -44.028 -36.644 22.060  1.00 25.40  ? 45  ASP A C   1 
ATOM   295  O  O   . ASP A 1  39  ? -43.656 -37.637 21.477  1.00 27.67  ? 45  ASP A O   1 
ATOM   296  C  CB  . ASP A 1  39  ? -46.432 -37.244 21.581  1.00 27.75  ? 45  ASP A CB  1 
ATOM   297  C  CG  . ASP A 1  39  ? -46.602 -36.442 20.268  1.00 32.57  ? 45  ASP A CG  1 
ATOM   298  O  OD1 . ASP A 1  39  ? -45.716 -35.643 19.936  1.00 29.45  ? 45  ASP A OD1 1 
ATOM   299  O  OD2 . ASP A 1  39  ? -47.614 -36.666 19.567  1.00 40.57  ? 45  ASP A OD2 1 
ATOM   300  N  N   . SER A 1  40  ? -43.226 -35.608 22.328  1.00 23.49  ? 46  SER A N   1 
ATOM   301  C  CA  . SER A 1  40  ? -41.840 -35.573 21.897  1.00 29.18  ? 46  SER A CA  1 
ATOM   302  C  C   . SER A 1  40  ? -40.883 -35.372 23.069  1.00 29.85  ? 46  SER A C   1 
ATOM   303  O  O   . SER A 1  40  ? -41.153 -34.590 23.978  1.00 27.14  ? 46  SER A O   1 
ATOM   304  C  CB  . SER A 1  40  ? -41.592 -34.388 20.938  1.00 29.60  ? 46  SER A CB  1 
ATOM   305  O  OG  . SER A 1  40  ? -42.132 -34.707 19.667  1.00 45.78  ? 46  SER A OG  1 
ATOM   306  N  N   . HIS A 1  41  ? -39.730 -36.030 22.969  1.00 29.68  ? 47  HIS A N   1 
ATOM   307  C  CA  . HIS A 1  41  ? -38.637 -35.936 23.953  1.00 28.78  ? 47  HIS A CA  1 
ATOM   308  C  C   . HIS A 1  41  ? -37.336 -35.963 23.176  1.00 30.37  ? 47  HIS A C   1 
ATOM   309  O  O   . HIS A 1  41  ? -37.353 -36.289 21.996  1.00 26.39  ? 47  HIS A O   1 
ATOM   310  C  CB  . HIS A 1  41  ? -38.671 -37.101 24.944  1.00 28.58  ? 47  HIS A CB  1 
ATOM   311  C  CG  . HIS A 1  41  ? -38.593 -38.458 24.307  1.00 27.38  ? 47  HIS A CG  1 
ATOM   312  N  ND1 . HIS A 1  41  ? -37.398 -39.065 23.991  1.00 25.61  ? 47  HIS A ND1 1 
ATOM   313  C  CD2 . HIS A 1  41  ? -39.565 -39.323 23.926  1.00 21.05  ? 47  HIS A CD2 1 
ATOM   314  C  CE1 . HIS A 1  41  ? -37.638 -40.247 23.440  1.00 23.30  ? 47  HIS A CE1 1 
ATOM   315  N  NE2 . HIS A 1  41  ? -38.945 -40.423 23.378  1.00 22.57  ? 47  HIS A NE2 1 
ATOM   316  N  N   . ASN A 1  42  ? -36.223 -35.601 23.816  1.00 27.34  ? 48  ASN A N   1 
ATOM   317  C  CA  . ASN A 1  42  ? -34.960 -35.478 23.086  1.00 28.70  ? 48  ASN A CA  1 
ATOM   318  C  C   . ASN A 1  42  ? -34.078 -36.733 23.199  1.00 29.41  ? 48  ASN A C   1 
ATOM   319  O  O   . ASN A 1  42  ? -32.913 -36.692 22.830  1.00 34.03  ? 48  ASN A O   1 
ATOM   320  C  CB  . ASN A 1  42  ? -34.180 -34.268 23.593  1.00 27.36  ? 48  ASN A CB  1 
ATOM   321  C  CG  . ASN A 1  42  ? -33.686 -34.454 25.032  1.00 32.29  ? 48  ASN A CG  1 
ATOM   322  O  OD1 . ASN A 1  42  ? -33.894 -35.520 25.659  1.00 21.25  ? 48  ASN A OD1 1 
ATOM   323  N  ND2 . ASN A 1  42  ? -33.003 -33.442 25.544  1.00 27.69  ? 48  ASN A ND2 1 
ATOM   324  N  N   . GLY A 1  43  ? -34.592 -37.808 23.785  1.00 27.24  ? 49  GLY A N   1 
ATOM   325  C  CA  . GLY A 1  43  ? -33.879 -39.061 23.781  1.00 26.59  ? 49  GLY A CA  1 
ATOM   326  C  C   . GLY A 1  43  ? -32.617 -39.104 24.627  1.00 26.85  ? 49  GLY A C   1 
ATOM   327  O  O   . GLY A 1  43  ? -31.860 -40.053 24.525  1.00 26.19  ? 49  GLY A O   1 
ATOM   328  N  N   . LYS A 1  44  ? -32.426 -38.098 25.480  1.00 26.62  ? 50  LYS A N   1 
ATOM   329  C  CA  . LYS A 1  44  ? -31.278 -37.989 26.376  1.00 25.67  ? 50  LYS A CA  1 
ATOM   330  C  C   . LYS A 1  44  ? -31.676 -37.871 27.857  1.00 25.80  ? 50  LYS A C   1 
ATOM   331  O  O   . LYS A 1  44  ? -32.827 -37.512 28.196  1.00 25.86  ? 50  LYS A O   1 
ATOM   332  C  CB  . LYS A 1  44  ? -30.462 -36.750 26.004  1.00 26.78  ? 50  LYS A CB  1 
ATOM   333  C  CG  . LYS A 1  44  ? -30.000 -36.711 24.542  1.00 29.61  ? 50  LYS A CG  1 
ATOM   334  C  CD  . LYS A 1  44  ? -29.453 -35.311 24.184  1.00 36.26  ? 50  LYS A CD  1 
ATOM   335  C  CE  . LYS A 1  44  ? -29.214 -35.133 22.664  1.00 44.29  ? 50  LYS A CE  1 
ATOM   336  N  NZ  . LYS A 1  44  ? -28.802 -33.717 22.266  1.00 36.69  ? 50  LYS A NZ  1 
ATOM   337  N  N   . LEU A 1  45  ? -30.710 -38.150 28.728  1.00 24.52  ? 51  LEU A N   1 
ATOM   338  C  CA  . LEU A 1  45  ? -30.821 -37.912 30.159  1.00 27.03  ? 51  LEU A CA  1 
ATOM   339  C  C   . LEU A 1  45  ? -30.016 -36.648 30.447  1.00 29.59  ? 51  LEU A C   1 
ATOM   340  O  O   . LEU A 1  45  ? -28.836 -36.572 30.123  1.00 29.64  ? 51  LEU A O   1 
ATOM   341  C  CB  . LEU A 1  45  ? -30.245 -39.085 30.958  1.00 29.36  ? 51  LEU A CB  1 
ATOM   342  C  CG  . LEU A 1  45  ? -30.924 -40.444 30.739  1.00 25.60  ? 51  LEU A CG  1 
ATOM   343  C  CD1 . LEU A 1  45  ? -30.319 -41.519 31.630  1.00 19.11  ? 51  LEU A CD1 1 
ATOM   344  C  CD2 . LEU A 1  45  ? -32.401 -40.353 31.001  1.00 24.12  ? 51  LEU A CD2 1 
ATOM   345  N  N   . CYS A 1  46  ? -30.663 -35.666 31.058  1.00 28.88  ? 52  CYS A N   1 
ATOM   346  C  CA  . CYS A 1  46  ? -30.139 -34.347 31.141  1.00 28.07  ? 52  CYS A CA  1 
ATOM   347  C  C   . CYS A 1  46  ? -30.023 -33.980 32.598  1.00 28.35  ? 52  CYS A C   1 
ATOM   348  O  O   . CYS A 1  46  ? -30.539 -34.671 33.483  1.00 29.01  ? 52  CYS A O   1 
ATOM   349  C  CB  . CYS A 1  46  ? -31.074 -33.357 30.429  1.00 30.28  ? 52  CYS A CB  1 
ATOM   350  S  SG  . CYS A 1  46  ? -31.299 -33.574 28.625  1.00 33.87  ? 52  CYS A SG  1 
ATOM   351  N  N   . LYS A 1  47  ? -29.313 -32.893 32.815  1.00 29.25  ? 53  LYS A N   1 
ATOM   352  C  CA  . LYS A 1  47  ? -29.261 -32.214 34.100  1.00 33.84  ? 53  LYS A CA  1 
ATOM   353  C  C   . LYS A 1  47  ? -30.578 -31.541 34.446  1.00 32.43  ? 53  LYS A C   1 
ATOM   354  O  O   . LYS A 1  47  ? -31.293 -31.074 33.545  1.00 31.59  ? 53  LYS A O   1 
ATOM   355  C  CB  . LYS A 1  47  ? -28.224 -31.086 34.038  1.00 31.65  ? 53  LYS A CB  1 
ATOM   356  C  CG  . LYS A 1  47  ? -26.854 -31.489 33.572  1.00 35.99  ? 53  LYS A CG  1 
ATOM   357  C  CD  . LYS A 1  47  ? -25.905 -30.306 33.570  1.00 28.14  ? 53  LYS A CD  1 
ATOM   358  C  CE  . LYS A 1  47  ? -24.534 -30.744 33.159  1.00 39.37  ? 53  LYS A CE  1 
ATOM   359  N  NZ  . LYS A 1  47  ? -23.500 -29.710 33.499  1.00 47.31  ? 53  LYS A NZ  1 
ATOM   360  N  N   . LEU A 1  48  ? -30.835 -31.439 35.749  1.00 36.37  ? 54  LEU A N   1 
ATOM   361  C  CA  . LEU A 1  48  ? -31.870 -30.549 36.340  1.00 37.47  ? 54  LEU A CA  1 
ATOM   362  C  C   . LEU A 1  48  ? -31.217 -29.544 37.289  1.00 40.99  ? 54  LEU A C   1 
ATOM   363  O  O   . LEU A 1  48  ? -30.433 -29.937 38.149  1.00 42.51  ? 54  LEU A O   1 
ATOM   364  C  CB  . LEU A 1  48  ? -32.860 -31.370 37.159  1.00 38.17  ? 54  LEU A CB  1 
ATOM   365  C  CG  . LEU A 1  48  ? -33.913 -32.229 36.448  1.00 41.20  ? 54  LEU A CG  1 
ATOM   366  C  CD1 . LEU A 1  48  ? -34.663 -33.052 37.486  1.00 48.87  ? 54  LEU A CD1 1 
ATOM   367  C  CD2 . LEU A 1  48  ? -34.920 -31.371 35.706  1.00 44.98  ? 54  LEU A CD2 1 
ATOM   368  N  N   . LYS A 1  49  A -31.552 -28.259 37.158  1.00 46.33  ? 54  LYS A N   1 
ATOM   369  C  CA  . LYS A 1  49  A -30.915 -27.161 37.941  1.00 49.54  ? 54  LYS A CA  1 
ATOM   370  C  C   . LYS A 1  49  A -29.375 -27.154 37.851  1.00 49.63  ? 54  LYS A C   1 
ATOM   371  O  O   . LYS A 1  49  A -28.677 -26.845 38.824  1.00 51.28  ? 54  LYS A O   1 
ATOM   372  C  CB  . LYS A 1  49  A -31.371 -27.190 39.413  1.00 52.17  ? 54  LYS A CB  1 
ATOM   373  C  CG  . LYS A 1  49  A -32.858 -26.885 39.631  1.00 57.87  ? 54  LYS A CG  1 
ATOM   374  C  CD  . LYS A 1  49  A -33.269 -27.035 41.103  1.00 64.79  ? 54  LYS A CD  1 
ATOM   375  C  CE  . LYS A 1  49  A -34.804 -26.961 41.259  1.00 70.21  ? 54  LYS A CE  1 
ATOM   376  N  NZ  . LYS A 1  49  A -35.278 -27.139 42.674  1.00 70.18  ? 54  LYS A NZ  1 
ATOM   377  N  N   . GLY A 1  50  ? -28.857 -27.498 36.673  1.00 49.08  ? 55  GLY A N   1 
ATOM   378  C  CA  . GLY A 1  50  ? -27.420 -27.574 36.437  1.00 46.39  ? 55  GLY A CA  1 
ATOM   379  C  C   . GLY A 1  50  ? -26.737 -28.780 37.067  1.00 45.34  ? 55  GLY A C   1 
ATOM   380  O  O   . GLY A 1  50  ? -25.495 -28.878 37.039  1.00 45.05  ? 55  GLY A O   1 
ATOM   381  N  N   . ILE A 1  51  ? -27.516 -29.696 37.647  1.00 40.37  ? 56  ILE A N   1 
ATOM   382  C  CA  . ILE A 1  51  ? -26.924 -30.854 38.294  1.00 38.83  ? 56  ILE A CA  1 
ATOM   383  C  C   . ILE A 1  51  ? -27.159 -32.111 37.472  1.00 37.62  ? 56  ILE A C   1 
ATOM   384  O  O   . ILE A 1  51  ? -28.304 -32.440 37.126  1.00 34.02  ? 56  ILE A O   1 
ATOM   385  C  CB  . ILE A 1  51  ? -27.453 -31.063 39.715  1.00 37.23  ? 56  ILE A CB  1 
ATOM   386  C  CG1 . ILE A 1  51  ? -27.137 -29.843 40.587  1.00 48.19  ? 56  ILE A CG1 1 
ATOM   387  C  CG2 . ILE A 1  51  ? -26.776 -32.234 40.319  1.00 40.09  ? 56  ILE A CG2 1 
ATOM   388  C  CD1 . ILE A 1  51  ? -27.597 -29.994 42.037  1.00 53.19  ? 56  ILE A CD1 1 
ATOM   389  N  N   . ALA A 1  52  ? -26.060 -32.804 37.175  1.00 36.27  ? 57  ALA A N   1 
ATOM   390  C  CA  . ALA A 1  52  ? -26.097 -34.054 36.440  1.00 35.74  ? 57  ALA A CA  1 
ATOM   391  C  C   . ALA A 1  52  ? -26.647 -35.167 37.301  1.00 32.92  ? 57  ALA A C   1 
ATOM   392  O  O   . ALA A 1  52  ? -26.484 -35.169 38.521  1.00 32.33  ? 57  ALA A O   1 
ATOM   393  C  CB  . ALA A 1  52  ? -24.696 -34.441 35.942  1.00 35.95  ? 57  ALA A CB  1 
ATOM   394  N  N   . PRO A 1  53  ? -27.314 -36.127 36.668  1.00 28.68  ? 58  PRO A N   1 
ATOM   395  C  CA  . PRO A 1  53  ? -27.713 -37.296 37.406  1.00 28.13  ? 58  PRO A CA  1 
ATOM   396  C  C   . PRO A 1  53  ? -26.509 -38.108 37.822  1.00 28.53  ? 58  PRO A C   1 
ATOM   397  O  O   . PRO A 1  53  ? -25.419 -37.825 37.382  1.00 30.02  ? 58  PRO A O   1 
ATOM   398  C  CB  . PRO A 1  53  ? -28.515 -38.095 36.394  1.00 26.56  ? 58  PRO A CB  1 
ATOM   399  C  CG  . PRO A 1  53  ? -27.965 -37.684 35.071  1.00 24.81  ? 58  PRO A CG  1 
ATOM   400  C  CD  . PRO A 1  53  ? -27.611 -36.238 35.236  1.00 29.92  ? 58  PRO A CD  1 
ATOM   401  N  N   . LEU A 1  54  ? -26.726 -39.131 38.635  1.00 28.98  ? 59  LEU A N   1 
ATOM   402  C  CA  . LEU A 1  54  ? -25.680 -40.083 38.987  1.00 30.60  ? 59  LEU A CA  1 
ATOM   403  C  C   . LEU A 1  54  ? -25.954 -41.318 38.139  1.00 30.43  ? 59  LEU A C   1 
ATOM   404  O  O   . LEU A 1  54  ? -27.003 -41.946 38.281  1.00 32.41  ? 59  LEU A O   1 
ATOM   405  C  CB  . LEU A 1  54  ? -25.723 -40.413 40.476  1.00 28.67  ? 59  LEU A CB  1 
ATOM   406  C  CG  . LEU A 1  54  ? -24.738 -41.420 41.066  1.00 35.26  ? 59  LEU A CG  1 
ATOM   407  C  CD1 . LEU A 1  54  ? -23.303 -40.942 40.876  1.00 30.59  ? 59  LEU A CD1 1 
ATOM   408  C  CD2 . LEU A 1  54  ? -25.071 -41.631 42.535  1.00 31.23  ? 59  LEU A CD2 1 
ATOM   409  N  N   A GLN A 1  55  ? -25.023 -41.661 37.248  0.50 28.92  ? 60  GLN A N   1 
ATOM   410  N  N   B GLN A 1  55  ? -25.025 -41.603 37.231  0.50 29.89  ? 60  GLN A N   1 
ATOM   411  C  CA  A GLN A 1  55  ? -25.158 -42.823 36.365  0.50 27.48  ? 60  GLN A CA  1 
ATOM   412  C  CA  B GLN A 1  55  ? -25.041 -42.797 36.418  0.50 29.14  ? 60  GLN A CA  1 
ATOM   413  C  C   A GLN A 1  55  ? -24.375 -43.983 36.977  0.50 29.28  ? 60  GLN A C   1 
ATOM   414  C  C   B GLN A 1  55  ? -24.376 -43.883 37.229  0.50 29.88  ? 60  GLN A C   1 
ATOM   415  O  O   A GLN A 1  55  ? -23.151 -44.005 36.965  0.50 30.34  ? 60  GLN A O   1 
ATOM   416  O  O   B GLN A 1  55  ? -23.229 -43.732 37.640  0.50 29.81  ? 60  GLN A O   1 
ATOM   417  C  CB  A GLN A 1  55  ? -24.660 -42.476 34.946  0.50 27.47  ? 60  GLN A CB  1 
ATOM   418  C  CB  B GLN A 1  55  ? -24.218 -42.574 35.153  0.50 29.97  ? 60  GLN A CB  1 
ATOM   419  C  CG  A GLN A 1  55  ? -24.575 -43.646 33.926  0.50 23.38  ? 60  GLN A CG  1 
ATOM   420  C  CG  B GLN A 1  55  ? -24.925 -41.869 34.037  0.50 30.63  ? 60  GLN A CG  1 
ATOM   421  C  CD  A GLN A 1  55  ? -25.907 -44.350 33.678  0.50 23.32  ? 60  GLN A CD  1 
ATOM   422  C  CD  B GLN A 1  55  ? -24.215 -42.066 32.714  0.50 31.02  ? 60  GLN A CD  1 
ATOM   423  O  OE1 A GLN A 1  55  ? -26.560 -44.109 32.682  0.50 20.47  ? 60  GLN A OE1 1 
ATOM   424  O  OE1 B GLN A 1  55  ? -23.212 -41.412 32.440  0.50 31.06  ? 60  GLN A OE1 1 
ATOM   425  N  NE2 A GLN A 1  55  ? -26.302 -45.221 34.590  0.50 13.83  ? 60  GLN A NE2 1 
ATOM   426  N  NE2 B GLN A 1  55  ? -24.740 -42.967 31.883  0.50 26.95  ? 60  GLN A NE2 1 
ATOM   427  N  N   . LEU A 1  56  ? -25.099 -44.955 37.509  1.00 31.29  ? 61  LEU A N   1 
ATOM   428  C  CA  . LEU A 1  56  ? -24.510 -46.068 38.194  1.00 32.73  ? 61  LEU A CA  1 
ATOM   429  C  C   . LEU A 1  56  ? -23.987 -47.087 37.198  1.00 34.12  ? 61  LEU A C   1 
ATOM   430  O  O   . LEU A 1  56  ? -23.174 -47.917 37.543  1.00 33.46  ? 61  LEU A O   1 
ATOM   431  C  CB  . LEU A 1  56  ? -25.532 -46.697 39.129  1.00 30.44  ? 61  LEU A CB  1 
ATOM   432  C  CG  . LEU A 1  56  ? -26.011 -45.804 40.262  1.00 30.19  ? 61  LEU A CG  1 
ATOM   433  C  CD1 . LEU A 1  56  ? -27.050 -46.581 41.038  1.00 28.57  ? 61  LEU A CD1 1 
ATOM   434  C  CD2 . LEU A 1  56  ? -24.900 -45.396 41.156  1.00 28.28  ? 61  LEU A CD2 1 
ATOM   435  N  N   . GLY A 1  57  ? -24.535 -47.052 35.987  1.00 36.92  ? 62  GLY A N   1 
ATOM   436  C  CA  . GLY A 1  57  ? -23.979 -47.739 34.826  1.00 37.48  ? 62  GLY A CA  1 
ATOM   437  C  C   . GLY A 1  57  ? -24.047 -49.222 35.030  1.00 38.69  ? 62  GLY A C   1 
ATOM   438  O  O   . GLY A 1  57  ? -25.135 -49.775 35.198  1.00 41.28  ? 62  GLY A O   1 
ATOM   439  N  N   . LYS A 1  58  ? -22.883 -49.864 35.050  1.00 40.37  ? 63  LYS A N   1 
ATOM   440  C  CA  . LYS A 1  58  ? -22.794 -51.315 35.277  1.00 40.79  ? 63  LYS A CA  1 
ATOM   441  C  C   . LYS A 1  58  ? -23.161 -51.745 36.715  1.00 38.18  ? 63  LYS A C   1 
ATOM   442  O  O   . LYS A 1  58  ? -23.494 -52.914 36.934  1.00 32.46  ? 63  LYS A O   1 
ATOM   443  C  CB  . LYS A 1  58  ? -21.417 -51.846 34.862  1.00 41.67  ? 63  LYS A CB  1 
ATOM   444  C  CG  . LYS A 1  58  ? -20.228 -51.438 35.749  1.00 46.39  ? 63  LYS A CG  1 
ATOM   445  C  CD  . LYS A 1  58  ? -18.884 -51.688 34.987  1.00 46.85  ? 63  LYS A CD  1 
ATOM   446  C  CE  . LYS A 1  58  ? -17.661 -51.664 35.903  1.00 51.29  ? 63  LYS A CE  1 
ATOM   447  N  NZ  . LYS A 1  58  ? -16.430 -52.335 35.314  1.00 43.43  ? 63  LYS A NZ  1 
ATOM   448  N  N   . CYS A 1  59  ? -23.176 -50.787 37.657  1.00 38.43  ? 64  CYS A N   1 
ATOM   449  C  CA  . CYS A 1  59  ? -23.584 -51.032 39.071  1.00 38.00  ? 64  CYS A CA  1 
ATOM   450  C  C   . CYS A 1  59  ? -25.041 -50.661 39.444  1.00 36.43  ? 64  CYS A C   1 
ATOM   451  O  O   . CYS A 1  59  ? -25.709 -49.863 38.764  1.00 33.21  ? 64  CYS A O   1 
ATOM   452  C  CB  . CYS A 1  59  ? -22.627 -50.292 40.014  1.00 38.99  ? 64  CYS A CB  1 
ATOM   453  S  SG  . CYS A 1  59  ? -20.890 -50.772 39.772  1.00 43.38  ? 64  CYS A SG  1 
ATOM   454  N  N   . ASN A 1  60  ? -25.511 -51.271 40.530  1.00 34.20  ? 65  ASN A N   1 
ATOM   455  C  CA  . ASN A 1  60  ? -26.832 -51.011 41.094  1.00 33.41  ? 65  ASN A CA  1 
ATOM   456  C  C   . ASN A 1  60  ? -26.627 -50.374 42.467  1.00 32.65  ? 65  ASN A C   1 
ATOM   457  O  O   . ASN A 1  60  ? -25.478 -50.181 42.911  1.00 34.30  ? 65  ASN A O   1 
ATOM   458  C  CB  . ASN A 1  60  ? -27.709 -52.287 41.162  1.00 32.11  ? 65  ASN A CB  1 
ATOM   459  C  CG  . ASN A 1  60  ? -27.188 -53.327 42.167  1.00 36.59  ? 65  ASN A CG  1 
ATOM   460  O  OD1 . ASN A 1  60  ? -26.402 -53.010 43.059  1.00 34.69  ? 65  ASN A OD1 1 
ATOM   461  N  ND2 . ASN A 1  60  ? -27.635 -54.571 42.019  1.00 34.21  ? 65  ASN A ND2 1 
ATOM   462  N  N   . ILE A 1  61  ? -27.720 -50.033 43.134  1.00 30.03  ? 66  ILE A N   1 
ATOM   463  C  CA  . ILE A 1  61  ? -27.624 -49.182 44.328  1.00 27.97  ? 66  ILE A CA  1 
ATOM   464  C  C   . ILE A 1  61  ? -26.757 -49.872 45.367  1.00 26.26  ? 66  ILE A C   1 
ATOM   465  O  O   . ILE A 1  61  ? -26.002 -49.213 46.045  1.00 26.59  ? 66  ILE A O   1 
ATOM   466  C  CB  . ILE A 1  61  ? -29.022 -48.832 44.918  1.00 28.61  ? 66  ILE A CB  1 
ATOM   467  C  CG1 . ILE A 1  61  ? -29.729 -47.832 43.976  1.00 27.56  ? 66  ILE A CG1 1 
ATOM   468  C  CG2 . ILE A 1  61  ? -28.909 -48.206 46.360  1.00 22.38  ? 66  ILE A CG2 1 
ATOM   469  C  CD1 . ILE A 1  61  ? -29.402 -46.378 44.296  1.00 34.77  ? 66  ILE A CD1 1 
ATOM   470  N  N   . ALA A 1  62  ? -26.872 -51.199 45.446  1.00 26.64  ? 67  ALA A N   1 
ATOM   471  C  CA  . ALA A 1  62  ? -26.202 -52.015 46.458  1.00 28.78  ? 67  ALA A CA  1 
ATOM   472  C  C   . ALA A 1  62  ? -24.678 -52.020 46.249  1.00 32.55  ? 67  ALA A C   1 
ATOM   473  O  O   . ALA A 1  62  ? -23.914 -51.790 47.191  1.00 33.24  ? 67  ALA A O   1 
ATOM   474  C  CB  . ALA A 1  62  ? -26.779 -53.455 46.467  1.00 27.00  ? 67  ALA A CB  1 
ATOM   475  N  N   . GLY A 1  63  ? -24.252 -52.221 45.001  1.00 36.07  ? 68  GLY A N   1 
ATOM   476  C  CA  . GLY A 1  63  ? -22.843 -52.152 44.632  1.00 36.06  ? 68  GLY A CA  1 
ATOM   477  C  C   . GLY A 1  63  ? -22.275 -50.771 44.863  1.00 38.33  ? 68  GLY A C   1 
ATOM   478  O  O   . GLY A 1  63  ? -21.092 -50.622 45.209  1.00 38.18  ? 68  GLY A O   1 
ATOM   479  N  N   . TRP A 1  64  ? -23.103 -49.749 44.670  1.00 38.79  ? 69  TRP A N   1 
ATOM   480  C  CA  . TRP A 1  64  ? -22.679 -48.361 44.922  1.00 38.26  ? 69  TRP A CA  1 
ATOM   481  C  C   . TRP A 1  64  ? -22.409 -48.078 46.405  1.00 38.74  ? 69  TRP A C   1 
ATOM   482  O  O   . TRP A 1  64  ? -21.341 -47.594 46.770  1.00 37.41  ? 69  TRP A O   1 
ATOM   483  C  CB  . TRP A 1  64  ? -23.731 -47.388 44.399  1.00 36.39  ? 69  TRP A CB  1 
ATOM   484  C  CG  . TRP A 1  64  ? -23.532 -45.952 44.770  1.00 33.12  ? 69  TRP A CG  1 
ATOM   485  C  CD1 . TRP A 1  64  ? -22.351 -45.272 44.840  1.00 39.31  ? 69  TRP A CD1 1 
ATOM   486  C  CD2 . TRP A 1  64  ? -24.563 -45.000 45.098  1.00 31.69  ? 69  TRP A CD2 1 
ATOM   487  N  NE1 . TRP A 1  64  ? -22.579 -43.953 45.198  1.00 37.35  ? 69  TRP A NE1 1 
ATOM   488  C  CE2 . TRP A 1  64  ? -23.931 -43.765 45.355  1.00 39.02  ? 69  TRP A CE2 1 
ATOM   489  C  CE3 . TRP A 1  64  ? -25.955 -45.076 45.197  1.00 33.06  ? 69  TRP A CE3 1 
ATOM   490  C  CZ2 . TRP A 1  64  ? -24.647 -42.618 45.702  1.00 32.59  ? 69  TRP A CZ2 1 
ATOM   491  C  CZ3 . TRP A 1  64  ? -26.668 -43.933 45.569  1.00 32.74  ? 69  TRP A CZ3 1 
ATOM   492  C  CH2 . TRP A 1  64  ? -26.010 -42.732 45.828  1.00 37.16  ? 69  TRP A CH2 1 
ATOM   493  N  N   . LEU A 1  65  ? -23.381 -48.373 47.261  1.00 39.07  ? 70  LEU A N   1 
ATOM   494  C  CA  . LEU A 1  65  ? -23.271 -47.967 48.664  1.00 37.27  ? 70  LEU A CA  1 
ATOM   495  C  C   . LEU A 1  65  ? -22.274 -48.836 49.423  1.00 36.96  ? 70  LEU A C   1 
ATOM   496  O  O   . LEU A 1  65  ? -21.540 -48.331 50.247  1.00 34.59  ? 70  LEU A O   1 
ATOM   497  C  CB  . LEU A 1  65  ? -24.640 -47.992 49.350  1.00 35.75  ? 70  LEU A CB  1 
ATOM   498  C  CG  . LEU A 1  65  ? -25.670 -47.030 48.741  1.00 31.35  ? 70  LEU A CG  1 
ATOM   499  C  CD1 . LEU A 1  65  ? -27.001 -47.125 49.477  1.00 29.09  ? 70  LEU A CD1 1 
ATOM   500  C  CD2 . LEU A 1  65  ? -25.160 -45.639 48.722  1.00 25.65  ? 70  LEU A CD2 1 
ATOM   501  N  N   . LEU A 1  66  ? -22.270 -50.137 49.137  1.00 38.54  ? 71  LEU A N   1 
ATOM   502  C  CA  . LEU A 1  66  ? -21.337 -51.064 49.756  1.00 38.56  ? 71  LEU A CA  1 
ATOM   503  C  C   . LEU A 1  66  ? -19.919 -50.813 49.274  1.00 41.43  ? 71  LEU A C   1 
ATOM   504  O  O   . LEU A 1  66  ? -18.969 -50.973 50.037  1.00 41.69  ? 71  LEU A O   1 
ATOM   505  C  CB  . LEU A 1  66  ? -21.704 -52.496 49.414  1.00 38.39  ? 71  LEU A CB  1 
ATOM   506  C  CG  . LEU A 1  66  ? -23.007 -53.047 49.977  1.00 39.58  ? 71  LEU A CG  1 
ATOM   507  C  CD1 . LEU A 1  66  ? -23.137 -54.459 49.466  1.00 29.31  ? 71  LEU A CD1 1 
ATOM   508  C  CD2 . LEU A 1  66  ? -23.052 -53.000 51.504  1.00 36.73  ? 71  LEU A CD2 1 
ATOM   509  N  N   . GLY A 1  67  ? -19.785 -50.434 48.004  1.00 43.13  ? 72  GLY A N   1 
ATOM   510  C  CA  . GLY A 1  67  ? -18.493 -50.142 47.404  1.00 42.27  ? 72  GLY A CA  1 
ATOM   511  C  C   . GLY A 1  67  ? -17.873 -51.339 46.717  1.00 41.99  ? 72  GLY A C   1 
ATOM   512  O  O   . GLY A 1  67  ? -16.667 -51.569 46.832  1.00 45.49  ? 72  GLY A O   1 
ATOM   513  N  N   . ASN A 1  68  ? -18.696 -52.105 46.014  1.00 40.92  ? 73  ASN A N   1 
ATOM   514  C  CA  . ASN A 1  68  ? -18.229 -53.102 45.064  1.00 42.08  ? 73  ASN A CA  1 
ATOM   515  C  C   . ASN A 1  68  ? -17.031 -52.541 44.253  1.00 44.50  ? 73  ASN A C   1 
ATOM   516  O  O   . ASN A 1  68  ? -17.053 -51.370 43.803  1.00 44.68  ? 73  ASN A O   1 
ATOM   517  C  CB  . ASN A 1  68  ? -19.379 -53.561 44.150  1.00 39.76  ? 73  ASN A CB  1 
ATOM   518  C  CG  . ASN A 1  68  ? -18.948 -54.605 43.110  1.00 43.34  ? 73  ASN A CG  1 
ATOM   519  O  OD1 . ASN A 1  68  ? -17.984 -54.406 42.363  1.00 46.23  ? 73  ASN A OD1 1 
ATOM   520  N  ND2 . ASN A 1  68  ? -19.683 -55.712 43.046  1.00 40.04  ? 73  ASN A ND2 1 
ATOM   521  N  N   . PRO A 1  69  ? -15.966 -53.358 44.114  1.00 45.39  ? 74  PRO A N   1 
ATOM   522  C  CA  . PRO A 1  69  ? -14.705 -52.967 43.450  1.00 45.64  ? 74  PRO A CA  1 
ATOM   523  C  C   . PRO A 1  69  ? -14.842 -52.596 41.965  1.00 45.37  ? 74  PRO A C   1 
ATOM   524  O  O   . PRO A 1  69  ? -14.029 -51.819 41.454  1.00 45.14  ? 74  PRO A O   1 
ATOM   525  C  CB  . PRO A 1  69  ? -13.826 -54.214 43.602  1.00 45.98  ? 74  PRO A CB  1 
ATOM   526  C  CG  . PRO A 1  69  ? -14.477 -55.061 44.639  1.00 44.47  ? 74  PRO A CG  1 
ATOM   527  C  CD  . PRO A 1  69  ? -15.899 -54.719 44.689  1.00 45.79  ? 74  PRO A CD  1 
ATOM   528  N  N   . GLU A 1  70  ? -15.848 -53.169 41.295  1.00 45.73  ? 75  GLU A N   1 
ATOM   529  C  CA  . GLU A 1  70  ? -16.252 -52.772 39.932  1.00 46.66  ? 75  GLU A CA  1 
ATOM   530  C  C   . GLU A 1  70  ? -16.963 -51.384 39.840  1.00 45.62  ? 75  GLU A C   1 
ATOM   531  O  O   . GLU A 1  70  ? -17.286 -50.932 38.736  1.00 45.24  ? 75  GLU A O   1 
ATOM   532  C  CB  . GLU A 1  70  ? -17.200 -53.833 39.323  1.00 46.42  ? 75  GLU A CB  1 
ATOM   533  C  CG  . GLU A 1  70  ? -16.586 -55.198 39.007  1.00 53.17  ? 75  GLU A CG  1 
ATOM   534  C  CD  . GLU A 1  70  ? -15.629 -55.198 37.792  1.00 57.92  ? 75  GLU A CD  1 
ATOM   535  O  OE1 . GLU A 1  70  ? -15.739 -54.314 36.909  1.00 60.37  ? 75  GLU A OE1 1 
ATOM   536  O  OE2 . GLU A 1  70  ? -14.764 -56.097 37.726  1.00 57.87  ? 75  GLU A OE2 1 
ATOM   537  N  N   . CYS A 1  71  ? -17.210 -50.723 40.972  1.00 42.21  ? 76  CYS A N   1 
ATOM   538  C  CA  . CYS A 1  71  ? -17.947 -49.458 40.977  1.00 42.74  ? 76  CYS A CA  1 
ATOM   539  C  C   . CYS A 1  71  ? -17.084 -48.281 41.379  1.00 40.91  ? 76  CYS A C   1 
ATOM   540  O  O   . CYS A 1  71  ? -17.600 -47.224 41.749  1.00 42.62  ? 76  CYS A O   1 
ATOM   541  C  CB  . CYS A 1  71  ? -19.152 -49.554 41.924  1.00 41.01  ? 76  CYS A CB  1 
ATOM   542  S  SG  . CYS A 1  71  ? -20.155 -51.019 41.655  1.00 41.57  ? 76  CYS A SG  1 
ATOM   543  N  N   . ASP A 1  72  ? -15.775 -48.453 41.280  1.00 39.90  ? 77  ASP A N   1 
ATOM   544  C  CA  . ASP A 1  72  ? -14.820 -47.460 41.760  1.00 39.48  ? 77  ASP A CA  1 
ATOM   545  C  C   . ASP A 1  72  ? -15.024 -46.089 41.146  1.00 36.83  ? 77  ASP A C   1 
ATOM   546  O  O   . ASP A 1  72  ? -14.714 -45.074 41.772  1.00 34.02  ? 77  ASP A O   1 
ATOM   547  C  CB  . ASP A 1  72  ? -13.370 -47.924 41.494  1.00 40.64  ? 77  ASP A CB  1 
ATOM   548  C  CG  . ASP A 1  72  ? -12.892 -48.953 42.485  1.00 43.06  ? 77  ASP A CG  1 
ATOM   549  O  OD1 . ASP A 1  72  ? -13.723 -49.524 43.226  1.00 46.77  ? 77  ASP A OD1 1 
ATOM   550  O  OD2 . ASP A 1  72  ? -11.663 -49.210 42.508  1.00 49.90  ? 77  ASP A OD2 1 
ATOM   551  N  N   . LEU A 1  73  ? -15.513 -46.059 39.911  1.00 39.16  ? 78  LEU A N   1 
ATOM   552  C  CA  . LEU A 1  73  ? -15.978 -44.808 39.292  1.00 40.14  ? 78  LEU A CA  1 
ATOM   553  C  C   . LEU A 1  73  ? -16.964 -43.993 40.179  1.00 39.75  ? 78  LEU A C   1 
ATOM   554  O  O   . LEU A 1  73  ? -17.036 -42.765 40.072  1.00 37.90  ? 78  LEU A O   1 
ATOM   555  C  CB  . LEU A 1  73  ? -16.625 -45.102 37.931  1.00 41.76  ? 78  LEU A CB  1 
ATOM   556  C  CG  . LEU A 1  73  ? -15.893 -44.680 36.648  1.00 46.08  ? 78  LEU A CG  1 
ATOM   557  C  CD1 . LEU A 1  73  ? -14.685 -45.592 36.307  1.00 41.50  ? 78  LEU A CD1 1 
ATOM   558  C  CD2 . LEU A 1  73  ? -16.915 -44.652 35.487  1.00 44.83  ? 78  LEU A CD2 1 
ATOM   559  N  N   . LEU A 1  74  ? -17.712 -44.665 41.051  1.00 39.57  ? 79  LEU A N   1 
ATOM   560  C  CA  . LEU A 1  74  ? -18.745 -43.976 41.852  1.00 41.29  ? 79  LEU A CA  1 
ATOM   561  C  C   . LEU A 1  74  ? -18.225 -43.346 43.150  1.00 41.51  ? 79  LEU A C   1 
ATOM   562  O  O   . LEU A 1  74  ? -18.934 -42.562 43.787  1.00 39.06  ? 79  LEU A O   1 
ATOM   563  C  CB  . LEU A 1  74  ? -19.884 -44.958 42.173  1.00 40.92  ? 79  LEU A CB  1 
ATOM   564  C  CG  . LEU A 1  74  ? -20.475 -45.618 40.924  1.00 37.28  ? 79  LEU A CG  1 
ATOM   565  C  CD1 . LEU A 1  74  ? -21.663 -46.501 41.254  1.00 33.55  ? 79  LEU A CD1 1 
ATOM   566  C  CD2 . LEU A 1  74  ? -20.861 -44.549 39.915  1.00 31.03  ? 79  LEU A CD2 1 
ATOM   567  N  N   . LEU A 1  75  ? -16.978 -43.670 43.519  1.00 41.04  ? 80  LEU A N   1 
ATOM   568  C  CA  . LEU A 1  75  ? -16.447 -43.325 44.837  1.00 38.91  ? 80  LEU A CA  1 
ATOM   569  C  C   . LEU A 1  75  ? -16.460 -41.836 45.104  1.00 37.92  ? 80  LEU A C   1 
ATOM   570  O  O   . LEU A 1  75  ? -16.717 -41.408 46.237  1.00 34.04  ? 80  LEU A O   1 
ATOM   571  C  CB  . LEU A 1  75  ? -15.025 -43.861 45.001  1.00 40.40  ? 80  LEU A CB  1 
ATOM   572  C  CG  . LEU A 1  75  ? -14.951 -45.386 45.112  1.00 41.42  ? 80  LEU A CG  1 
ATOM   573  C  CD1 . LEU A 1  75  ? -13.501 -45.882 44.934  1.00 42.69  ? 80  LEU A CD1 1 
ATOM   574  C  CD2 . LEU A 1  75  ? -15.543 -45.869 46.414  1.00 34.41  ? 80  LEU A CD2 1 
ATOM   575  N  N   . THR A 1  76  ? -16.208 -41.049 44.061  1.00 37.99  ? 81  THR A N   1 
ATOM   576  C  CA  . THR A 1  76  ? -16.116 -39.595 44.190  1.00 39.15  ? 81  THR A CA  1 
ATOM   577  C  C   . THR A 1  76  ? -17.451 -38.862 44.047  1.00 38.99  ? 81  THR A C   1 
ATOM   578  O  O   . THR A 1  76  ? -17.509 -37.648 44.289  1.00 38.44  ? 81  THR A O   1 
ATOM   579  C  CB  . THR A 1  76  ? -15.147 -39.042 43.142  1.00 41.10  ? 81  THR A CB  1 
ATOM   580  O  OG1 . THR A 1  76  ? -15.505 -39.578 41.866  1.00 45.05  ? 81  THR A OG1 1 
ATOM   581  C  CG2 . THR A 1  76  ? -13.691 -39.449 43.496  1.00 40.53  ? 81  THR A CG2 1 
ATOM   582  N  N   . ALA A 1  77  ? -18.512 -39.585 43.667  1.00 38.36  ? 82  ALA A N   1 
ATOM   583  C  CA  . ALA A 1  77  ? -19.861 -38.993 43.582  1.00 39.56  ? 82  ALA A CA  1 
ATOM   584  C  C   . ALA A 1  77  ? -20.379 -38.519 44.946  1.00 37.61  ? 82  ALA A C   1 
ATOM   585  O  O   . ALA A 1  77  ? -20.435 -39.291 45.905  1.00 33.84  ? 82  ALA A O   1 
ATOM   586  C  CB  . ALA A 1  77  ? -20.858 -39.987 42.953  1.00 39.69  ? 82  ALA A CB  1 
ATOM   587  N  N   . SER A 1  78  ? -20.768 -37.243 45.006  1.00 40.98  ? 83  SER A N   1 
ATOM   588  C  CA  . SER A 1  78  ? -21.343 -36.637 46.232  1.00 41.25  ? 83  SER A CA  1 
ATOM   589  C  C   . SER A 1  78  ? -22.684 -35.912 46.047  1.00 39.56  ? 83  SER A C   1 
ATOM   590  O  O   . SER A 1  78  ? -23.405 -35.691 47.020  1.00 40.68  ? 83  SER A O   1 
ATOM   591  C  CB  . SER A 1  78  ? -20.341 -35.644 46.821  1.00 41.28  ? 83  SER A CB  1 
ATOM   592  O  OG  . SER A 1  78  ? -20.259 -34.525 45.971  1.00 39.33  ? 83  SER A OG  1 
ATOM   593  N  N   . SER A 1  79  A -23.019 -35.507 44.828  1.00 39.28  ? 83  SER A N   1 
ATOM   594  C  CA  . SER A 1  79  A -24.325 -34.916 44.580  1.00 38.79  ? 83  SER A CA  1 
ATOM   595  C  C   . SER A 1  79  A -24.830 -35.120 43.131  1.00 40.90  ? 83  SER A C   1 
ATOM   596  O  O   . SER A 1  79  A -24.033 -35.199 42.165  1.00 40.08  ? 83  SER A O   1 
ATOM   597  C  CB  . SER A 1  79  A -24.295 -33.441 44.931  1.00 38.22  ? 83  SER A CB  1 
ATOM   598  O  OG  . SER A 1  79  A -23.723 -32.725 43.879  1.00 40.80  ? 83  SER A OG  1 
ATOM   599  N  N   . TRP A 1  80  ? -26.161 -35.189 43.003  1.00 38.39  ? 84  TRP A N   1 
ATOM   600  C  CA  . TRP A 1  80  ? -26.830 -35.592 41.765  1.00 37.41  ? 84  TRP A CA  1 
ATOM   601  C  C   . TRP A 1  80  ? -28.245 -35.044 41.764  1.00 37.98  ? 84  TRP A C   1 
ATOM   602  O  O   . TRP A 1  80  ? -28.773 -34.734 42.818  1.00 42.12  ? 84  TRP A O   1 
ATOM   603  C  CB  . TRP A 1  80  ? -26.868 -37.110 41.703  1.00 35.78  ? 84  TRP A CB  1 
ATOM   604  C  CG  . TRP A 1  80  ? -27.426 -37.690 42.946  1.00 35.86  ? 84  TRP A CG  1 
ATOM   605  C  CD1 . TRP A 1  80  ? -28.745 -37.867 43.244  1.00 37.20  ? 84  TRP A CD1 1 
ATOM   606  C  CD2 . TRP A 1  80  ? -26.694 -38.151 44.088  1.00 35.38  ? 84  TRP A CD2 1 
ATOM   607  N  NE1 . TRP A 1  80  ? -28.878 -38.402 44.504  1.00 40.49  ? 84  TRP A NE1 1 
ATOM   608  C  CE2 . TRP A 1  80  ? -27.632 -38.573 45.046  1.00 28.67  ? 84  TRP A CE2 1 
ATOM   609  C  CE3 . TRP A 1  80  ? -25.337 -38.232 44.398  1.00 39.93  ? 84  TRP A CE3 1 
ATOM   610  C  CZ2 . TRP A 1  80  ? -27.262 -39.096 46.263  1.00 33.16  ? 84  TRP A CZ2 1 
ATOM   611  C  CZ3 . TRP A 1  80  ? -24.969 -38.734 45.625  1.00 38.79  ? 84  TRP A CZ3 1 
ATOM   612  C  CH2 . TRP A 1  80  ? -25.925 -39.168 46.537  1.00 35.39  ? 84  TRP A CH2 1 
ATOM   613  N  N   . SER A 1  81  ? -28.866 -34.913 40.602  1.00 37.56  ? 85  SER A N   1 
ATOM   614  C  CA  . SER A 1  81  ? -30.278 -34.495 40.515  1.00 35.71  ? 85  SER A CA  1 
ATOM   615  C  C   . SER A 1  81  ? -31.225 -35.703 40.450  1.00 35.48  ? 85  SER A C   1 
ATOM   616  O  O   . SER A 1  81  ? -32.396 -35.612 40.772  1.00 37.06  ? 85  SER A O   1 
ATOM   617  C  CB  . SER A 1  81  ? -30.460 -33.656 39.278  1.00 36.32  ? 85  SER A CB  1 
ATOM   618  O  OG  . SER A 1  81  ? -29.916 -34.362 38.177  1.00 41.36  ? 85  SER A OG  1 
ATOM   619  N  N   . TYR A 1  82  ? -30.734 -36.833 39.971  1.00 33.80  ? 86  TYR A N   1 
ATOM   620  C  CA  . TYR A 1  82  ? -31.446 -38.091 40.121  1.00 30.30  ? 86  TYR A CA  1 
ATOM   621  C  C   . TYR A 1  82  ? -30.424 -39.228 39.933  1.00 27.31  ? 86  TYR A C   1 
ATOM   622  O  O   . TYR A 1  82  ? -29.289 -38.980 39.616  1.00 27.41  ? 86  TYR A O   1 
ATOM   623  C  CB  . TYR A 1  82  ? -32.649 -38.206 39.146  1.00 30.19  ? 86  TYR A CB  1 
ATOM   624  C  CG  . TYR A 1  82  ? -32.302 -37.926 37.714  1.00 26.32  ? 86  TYR A CG  1 
ATOM   625  C  CD1 . TYR A 1  82  ? -32.064 -38.974 36.811  1.00 22.79  ? 86  TYR A CD1 1 
ATOM   626  C  CD2 . TYR A 1  82  ? -32.182 -36.632 37.256  1.00 18.88  ? 86  TYR A CD2 1 
ATOM   627  C  CE1 . TYR A 1  82  ? -31.756 -38.727 35.501  1.00 23.14  ? 86  TYR A CE1 1 
ATOM   628  C  CE2 . TYR A 1  82  ? -31.841 -36.385 35.937  1.00 19.83  ? 86  TYR A CE2 1 
ATOM   629  C  CZ  . TYR A 1  82  ? -31.627 -37.439 35.064  1.00 24.52  ? 86  TYR A CZ  1 
ATOM   630  O  OH  . TYR A 1  82  ? -31.280 -37.193 33.736  1.00 28.94  ? 86  TYR A OH  1 
ATOM   631  N  N   . ILE A 1  83  ? -30.834 -40.452 40.215  1.00 27.04  ? 87  ILE A N   1 
ATOM   632  C  CA  . ILE A 1  83  ? -29.971 -41.623 40.157  1.00 27.72  ? 87  ILE A CA  1 
ATOM   633  C  C   . ILE A 1  83  ? -30.498 -42.533 39.059  1.00 27.09  ? 87  ILE A C   1 
ATOM   634  O  O   . ILE A 1  83  ? -31.721 -42.761 38.972  1.00 27.91  ? 87  ILE A O   1 
ATOM   635  C  CB  . ILE A 1  83  ? -30.031 -42.388 41.503  1.00 26.69  ? 87  ILE A CB  1 
ATOM   636  C  CG1 . ILE A 1  83  ? -29.644 -41.458 42.674  1.00 33.83  ? 87  ILE A CG1 1 
ATOM   637  C  CG2 . ILE A 1  83  ? -29.104 -43.591 41.472  1.00 28.92  ? 87  ILE A CG2 1 
ATOM   638  C  CD1 . ILE A 1  83  ? -29.771 -42.110 44.040  1.00 27.84  ? 87  ILE A CD1 1 
ATOM   639  N  N   . VAL A 1  84  ? -29.596 -43.042 38.223  1.00 27.84  ? 88  VAL A N   1 
ATOM   640  C  CA  . VAL A 1  84  ? -29.952 -43.857 37.057  1.00 24.88  ? 88  VAL A CA  1 
ATOM   641  C  C   . VAL A 1  84  ? -29.330 -45.233 37.145  1.00 25.04  ? 88  VAL A C   1 
ATOM   642  O  O   . VAL A 1  84  ? -28.116 -45.358 37.213  1.00 27.95  ? 88  VAL A O   1 
ATOM   643  C  CB  . VAL A 1  84  ? -29.431 -43.183 35.802  1.00 24.92  ? 88  VAL A CB  1 
ATOM   644  C  CG1 . VAL A 1  84  ? -29.600 -44.097 34.529  1.00 27.38  ? 88  VAL A CG1 1 
ATOM   645  C  CG2 . VAL A 1  84  ? -30.092 -41.840 35.626  1.00 22.41  ? 88  VAL A CG2 1 
ATOM   646  N  N   . GLU A 1  85  ? -30.160 -46.258 37.166  1.00 26.11  ? 89  GLU A N   1 
ATOM   647  C  CA  . GLU A 1  85  ? -29.724 -47.604 36.917  1.00 28.34  ? 89  GLU A CA  1 
ATOM   648  C  C   . GLU A 1  85  ? -30.008 -47.887 35.432  1.00 30.57  ? 89  GLU A C   1 
ATOM   649  O  O   . GLU A 1  85  ? -30.905 -47.288 34.839  1.00 25.78  ? 89  GLU A O   1 
ATOM   650  C  CB  . GLU A 1  85  ? -30.472 -48.602 37.805  1.00 29.37  ? 89  GLU A CB  1 
ATOM   651  C  CG  . GLU A 1  85  ? -30.146 -48.450 39.319  1.00 34.24  ? 89  GLU A CG  1 
ATOM   652  C  CD  . GLU A 1  85  ? -30.737 -49.562 40.188  1.00 36.08  ? 89  GLU A CD  1 
ATOM   653  O  OE1 . GLU A 1  85  ? -30.140 -49.856 41.266  1.00 28.81  ? 89  GLU A OE1 1 
ATOM   654  O  OE2 . GLU A 1  85  ? -31.781 -50.149 39.791  1.00 32.56  ? 89  GLU A OE2 1 
ATOM   655  N  N   . THR A 1  86  ? -29.228 -48.789 34.840  1.00 30.83  ? 90  THR A N   1 
ATOM   656  C  CA  . THR A 1  86  ? -29.402 -49.159 33.448  1.00 32.61  ? 90  THR A CA  1 
ATOM   657  C  C   . THR A 1  86  ? -29.938 -50.598 33.441  1.00 31.95  ? 90  THR A C   1 
ATOM   658  O  O   . THR A 1  86  ? -29.992 -51.259 34.486  1.00 31.45  ? 90  THR A O   1 
ATOM   659  C  CB  . THR A 1  86  ? -28.053 -49.094 32.667  1.00 29.87  ? 90  THR A CB  1 
ATOM   660  O  OG1 . THR A 1  86  ? -27.208 -50.132 33.146  1.00 30.09  ? 90  THR A OG1 1 
ATOM   661  C  CG2 . THR A 1  86  ? -27.325 -47.765 32.886  1.00 30.24  ? 90  THR A CG2 1 
ATOM   662  N  N   . SER A 1  87  ? -30.303 -51.093 32.263  1.00 32.48  ? 91  SER A N   1 
ATOM   663  C  CA  . SER A 1  87  ? -30.660 -52.518 32.116  1.00 32.64  ? 91  SER A CA  1 
ATOM   664  C  C   . SER A 1  87  ? -29.449 -53.454 32.277  1.00 35.51  ? 91  SER A C   1 
ATOM   665  O  O   . SER A 1  87  ? -29.597 -54.679 32.266  1.00 39.39  ? 91  SER A O   1 
ATOM   666  C  CB  . SER A 1  87  ? -31.352 -52.757 30.772  1.00 33.27  ? 91  SER A CB  1 
ATOM   667  O  OG  . SER A 1  87  ? -30.556 -52.291 29.675  1.00 31.55  ? 91  SER A OG  1 
ATOM   668  N  N   . ASN A 1  88  ? -28.258 -52.891 32.446  1.00 34.77  ? 92  ASN A N   1 
ATOM   669  C  CA  . ASN A 1  88  ? -27.084 -53.685 32.786  1.00 37.05  ? 92  ASN A CA  1 
ATOM   670  C  C   . ASN A 1  88  ? -26.501 -53.372 34.186  1.00 40.13  ? 92  ASN A C   1 
ATOM   671  O  O   . ASN A 1  88  ? -25.295 -53.577 34.449  1.00 40.59  ? 92  ASN A O   1 
ATOM   672  C  CB  . ASN A 1  88  ? -26.047 -53.504 31.682  1.00 36.11  ? 92  ASN A CB  1 
ATOM   673  C  CG  . ASN A 1  88  ? -26.464 -54.202 30.383  1.00 40.26  ? 92  ASN A CG  1 
ATOM   674  O  OD1 . ASN A 1  88  ? -26.520 -53.577 29.328  1.00 43.90  ? 92  ASN A OD1 1 
ATOM   675  N  ND2 . ASN A 1  88  ? -26.780 -55.505 30.468  1.00 42.85  ? 92  ASN A ND2 1 
ATOM   676  N  N   . SER A 1  89  ? -27.354 -52.885 35.090  1.00 40.25  ? 93  SER A N   1 
ATOM   677  C  CA  . SER A 1  89  ? -26.919 -52.646 36.477  1.00 40.26  ? 93  SER A CA  1 
ATOM   678  C  C   . SER A 1  89  ? -26.902 -53.955 37.264  1.00 41.51  ? 93  SER A C   1 
ATOM   679  O  O   . SER A 1  89  ? -27.880 -54.296 37.910  1.00 42.44  ? 93  SER A O   1 
ATOM   680  C  CB  . SER A 1  89  ? -27.813 -51.608 37.141  1.00 37.62  ? 93  SER A CB  1 
ATOM   681  O  OG  . SER A 1  89  ? -27.625 -50.352 36.516  1.00 29.66  ? 93  SER A OG  1 
ATOM   682  N  N   . GLU A 1  90  ? -25.781 -54.684 37.202  1.00 43.49  ? 94  GLU A N   1 
ATOM   683  C  CA  . GLU A 1  90  ? -25.693 -56.035 37.793  1.00 44.24  ? 94  GLU A CA  1 
ATOM   684  C  C   . GLU A 1  90  ? -24.612 -56.221 38.875  1.00 41.41  ? 94  GLU A C   1 
ATOM   685  O  O   . GLU A 1  90  ? -24.683 -57.184 39.619  1.00 39.61  ? 94  GLU A O   1 
ATOM   686  C  CB  . GLU A 1  90  ? -25.489 -57.096 36.692  1.00 45.78  ? 94  GLU A CB  1 
ATOM   687  C  CG  . GLU A 1  90  ? -26.731 -57.355 35.801  1.00 59.12  ? 94  GLU A CG  1 
ATOM   688  C  CD  . GLU A 1  90  ? -27.675 -58.454 36.340  1.00 73.55  ? 94  GLU A CD  1 
ATOM   689  O  OE1 . GLU A 1  90  ? -28.164 -59.284 35.530  1.00 74.19  ? 94  GLU A OE1 1 
ATOM   690  O  OE2 . GLU A 1  90  ? -27.936 -58.484 37.566  1.00 81.55  ? 94  GLU A OE2 1 
ATOM   691  N  N   . ASN A 1  91  ? -23.622 -55.335 38.956  1.00 38.98  ? 95  ASN A N   1 
ATOM   692  C  CA  . ASN A 1  91  ? -22.633 -55.408 40.014  1.00 40.57  ? 95  ASN A CA  1 
ATOM   693  C  C   . ASN A 1  91  ? -23.164 -54.826 41.331  1.00 40.85  ? 95  ASN A C   1 
ATOM   694  O  O   . ASN A 1  91  ? -23.106 -53.612 41.565  1.00 40.01  ? 95  ASN A O   1 
ATOM   695  C  CB  . ASN A 1  91  ? -21.334 -54.718 39.592  1.00 43.05  ? 95  ASN A CB  1 
ATOM   696  C  CG  . ASN A 1  91  ? -20.605 -55.448 38.442  1.00 47.41  ? 95  ASN A CG  1 
ATOM   697  O  OD1 . ASN A 1  91  ? -20.011 -54.796 37.578  1.00 51.94  ? 95  ASN A OD1 1 
ATOM   698  N  ND2 . ASN A 1  91  ? -20.666 -56.793 38.419  1.00 54.77  ? 95  ASN A ND2 1 
ATOM   699  N  N   . GLY A 1  92  A -23.706 -55.706 42.176  1.00 39.57  ? 95  GLY A N   1 
ATOM   700  C  CA  . GLY A 1  92  A -24.233 -55.319 43.485  1.00 38.41  ? 95  GLY A CA  1 
ATOM   701  C  C   . GLY A 1  92  A -23.474 -55.960 44.644  1.00 37.62  ? 95  GLY A C   1 
ATOM   702  O  O   . GLY A 1  92  A -22.418 -55.489 45.033  1.00 38.23  ? 95  GLY A O   1 
ATOM   703  N  N   . THR A 1  93  ? -24.022 -57.026 45.208  1.00 36.69  ? 96  THR A N   1 
ATOM   704  C  CA  . THR A 1  93  ? -23.346 -57.759 46.251  1.00 37.56  ? 96  THR A CA  1 
ATOM   705  C  C   . THR A 1  93  ? -22.456 -58.803 45.582  1.00 38.16  ? 96  THR A C   1 
ATOM   706  O  O   . THR A 1  93  ? -22.938 -59.835 45.116  1.00 37.08  ? 96  THR A O   1 
ATOM   707  C  CB  . THR A 1  93  ? -24.354 -58.464 47.143  1.00 37.20  ? 96  THR A CB  1 
ATOM   708  O  OG1 . THR A 1  93  ? -25.379 -59.023 46.336  1.00 30.23  ? 96  THR A OG1 1 
ATOM   709  C  CG2 . THR A 1  93  ? -24.988 -57.516 48.097  1.00 44.15  ? 96  THR A CG2 1 
ATOM   710  N  N   . CYS A 1  94  ? -21.158 -58.546 45.515  1.00 39.85  ? 97  CYS A N   1 
ATOM   711  C  CA  . CYS A 1  94  ? -20.265 -59.521 44.884  1.00 40.19  ? 97  CYS A CA  1 
ATOM   712  C  C   . CYS A 1  94  ? -20.111 -60.805 45.737  1.00 41.60  ? 97  CYS A C   1 
ATOM   713  O  O   . CYS A 1  94  ? -20.161 -61.910 45.190  1.00 43.79  ? 97  CYS A O   1 
ATOM   714  C  CB  . CYS A 1  94  ? -18.938 -58.889 44.501  1.00 39.37  ? 97  CYS A CB  1 
ATOM   715  S  SG  . CYS A 1  94  ? -18.211 -57.869 45.763  1.00 41.27  ? 97  CYS A SG  1 
ATOM   716  N  N   . TYR A 1  95  ? -19.982 -60.680 47.057  1.00 41.21  ? 98  TYR A N   1 
ATOM   717  C  CA  . TYR A 1  95  ? -20.116 -61.851 47.948  1.00 42.06  ? 98  TYR A CA  1 
ATOM   718  C  C   . TYR A 1  95  ? -21.589 -62.077 48.286  1.00 40.83  ? 98  TYR A C   1 
ATOM   719  O  O   . TYR A 1  95  ? -22.197 -61.250 48.955  1.00 44.12  ? 98  TYR A O   1 
ATOM   720  C  CB  . TYR A 1  95  ? -19.304 -61.665 49.240  1.00 42.08  ? 98  TYR A CB  1 
ATOM   721  C  CG  . TYR A 1  95  ? -18.975 -62.934 50.046  1.00 48.01  ? 98  TYR A CG  1 
ATOM   722  C  CD1 . TYR A 1  95  ? -17.644 -63.345 50.218  1.00 51.66  ? 98  TYR A CD1 1 
ATOM   723  C  CD2 . TYR A 1  95  ? -19.973 -63.683 50.677  1.00 49.45  ? 98  TYR A CD2 1 
ATOM   724  C  CE1 . TYR A 1  95  ? -17.317 -64.477 50.972  1.00 53.07  ? 98  TYR A CE1 1 
ATOM   725  C  CE2 . TYR A 1  95  ? -19.658 -64.821 51.434  1.00 55.71  ? 98  TYR A CE2 1 
ATOM   726  C  CZ  . TYR A 1  95  ? -18.323 -65.219 51.574  1.00 57.19  ? 98  TYR A CZ  1 
ATOM   727  O  OH  . TYR A 1  95  ? -17.989 -66.341 52.320  1.00 54.90  ? 98  TYR A OH  1 
ATOM   728  N  N   . PRO A 1  96  ? -22.153 -63.221 47.876  1.00 42.26  ? 99  PRO A N   1 
ATOM   729  C  CA  . PRO A 1  96  ? -23.596 -63.483 47.922  1.00 43.25  ? 99  PRO A CA  1 
ATOM   730  C  C   . PRO A 1  96  ? -24.229 -63.474 49.327  1.00 46.03  ? 99  PRO A C   1 
ATOM   731  O  O   . PRO A 1  96  ? -23.527 -63.640 50.330  1.00 46.68  ? 99  PRO A O   1 
ATOM   732  C  CB  . PRO A 1  96  ? -23.698 -64.893 47.340  1.00 43.05  ? 99  PRO A CB  1 
ATOM   733  C  CG  . PRO A 1  96  ? -22.434 -65.545 47.796  1.00 42.87  ? 99  PRO A CG  1 
ATOM   734  C  CD  . PRO A 1  96  ? -21.392 -64.468 47.630  1.00 42.58  ? 99  PRO A CD  1 
ATOM   735  N  N   . GLY A 1  97  ? -25.555 -63.320 49.356  1.00 48.04  ? 100 GLY A N   1 
ATOM   736  C  CA  . GLY A 1  97  ? -26.365 -63.205 50.583  1.00 48.90  ? 100 GLY A CA  1 
ATOM   737  C  C   . GLY A 1  97  ? -27.418 -62.104 50.419  1.00 48.67  ? 100 GLY A C   1 
ATOM   738  O  O   . GLY A 1  97  ? -27.400 -61.375 49.433  1.00 50.28  ? 100 GLY A O   1 
ATOM   739  N  N   . ASP A 1  98  ? -28.321 -61.965 51.385  1.00 46.57  ? 101 ASP A N   1 
ATOM   740  C  CA  . ASP A 1  98  ? -29.478 -61.077 51.236  1.00 45.22  ? 101 ASP A CA  1 
ATOM   741  C  C   . ASP A 1  98  ? -29.164 -59.673 51.734  1.00 42.34  ? 101 ASP A C   1 
ATOM   742  O  O   . ASP A 1  98  ? -28.584 -59.512 52.807  1.00 42.03  ? 101 ASP A O   1 
ATOM   743  C  CB  . ASP A 1  98  ? -30.678 -61.611 52.018  1.00 45.61  ? 101 ASP A CB  1 
ATOM   744  C  CG  . ASP A 1  98  ? -30.916 -63.102 51.804  1.00 52.68  ? 101 ASP A CG  1 
ATOM   745  O  OD1 . ASP A 1  98  ? -30.847 -63.555 50.639  1.00 59.78  ? 101 ASP A OD1 1 
ATOM   746  O  OD2 . ASP A 1  98  ? -31.187 -63.817 52.805  1.00 53.56  ? 101 ASP A OD2 1 
ATOM   747  N  N   . PHE A 1  99  ? -29.554 -58.663 50.961  1.00 38.52  ? 102 PHE A N   1 
ATOM   748  C  CA  . PHE A 1  99  ? -29.522 -57.279 51.430  1.00 38.03  ? 102 PHE A CA  1 
ATOM   749  C  C   . PHE A 1  99  ? -30.860 -56.987 52.130  1.00 35.37  ? 102 PHE A C   1 
ATOM   750  O  O   . PHE A 1  99  ? -31.874 -56.744 51.461  1.00 37.08  ? 102 PHE A O   1 
ATOM   751  C  CB  . PHE A 1  99  ? -29.311 -56.322 50.262  1.00 37.85  ? 102 PHE A CB  1 
ATOM   752  C  CG  . PHE A 1  99  ? -28.692 -55.006 50.642  1.00 41.85  ? 102 PHE A CG  1 
ATOM   753  C  CD1 . PHE A 1  99  ? -27.598 -54.518 49.940  1.00 43.10  ? 102 PHE A CD1 1 
ATOM   754  C  CD2 . PHE A 1  99  ? -29.190 -54.251 51.685  1.00 48.37  ? 102 PHE A CD2 1 
ATOM   755  C  CE1 . PHE A 1  99  ? -27.021 -53.323 50.270  1.00 40.22  ? 102 PHE A CE1 1 
ATOM   756  C  CE2 . PHE A 1  99  ? -28.599 -53.037 52.016  1.00 45.47  ? 102 PHE A CE2 1 
ATOM   757  C  CZ  . PHE A 1  99  ? -27.516 -52.587 51.312  1.00 43.18  ? 102 PHE A CZ  1 
ATOM   758  N  N   . ILE A 1  100 ? -30.839 -56.992 53.466  1.00 34.06  ? 103 ILE A N   1 
ATOM   759  C  CA  . ILE A 1  100 ? -32.053 -56.843 54.303  1.00 32.78  ? 103 ILE A CA  1 
ATOM   760  C  C   . ILE A 1  100 ? -32.717 -55.441 54.130  1.00 28.91  ? 103 ILE A C   1 
ATOM   761  O  O   . ILE A 1  100 ? -32.038 -54.407 54.129  1.00 26.85  ? 103 ILE A O   1 
ATOM   762  C  CB  . ILE A 1  100 ? -31.734 -57.162 55.799  1.00 33.09  ? 103 ILE A CB  1 
ATOM   763  C  CG1 . ILE A 1  100 ? -31.156 -58.601 55.943  1.00 36.05  ? 103 ILE A CG1 1 
ATOM   764  C  CG2 . ILE A 1  100 ? -32.963 -56.982 56.711  1.00 31.99  ? 103 ILE A CG2 1 
ATOM   765  C  CD1 . ILE A 1  100 ? -31.937 -59.709 55.246  1.00 40.96  ? 103 ILE A CD1 1 
ATOM   766  N  N   . ASP A 1  101 ? -34.043 -55.431 53.946  1.00 27.92  ? 104 ASP A N   1 
ATOM   767  C  CA  . ASP A 1  101 ? -34.840 -54.194 53.719  1.00 22.53  ? 104 ASP A CA  1 
ATOM   768  C  C   . ASP A 1  101 ? -34.262 -53.292 52.638  1.00 20.71  ? 104 ASP A C   1 
ATOM   769  O  O   . ASP A 1  101 ? -34.250 -52.078 52.751  1.00 23.87  ? 104 ASP A O   1 
ATOM   770  C  CB  . ASP A 1  101 ? -35.003 -53.392 55.007  1.00 22.89  ? 104 ASP A CB  1 
ATOM   771  C  CG  . ASP A 1  101 ? -35.741 -54.172 56.087  1.00 24.81  ? 104 ASP A CG  1 
ATOM   772  O  OD1 . ASP A 1  101 ? -36.750 -54.834 55.770  1.00 37.92  ? 104 ASP A OD1 1 
ATOM   773  O  OD2 . ASP A 1  101 ? -35.317 -54.127 57.261  1.00 30.09  ? 104 ASP A OD2 1 
ATOM   774  N  N   . TYR A 1  102 ? -33.820 -53.908 51.565  1.00 25.53  ? 105 TYR A N   1 
ATOM   775  C  CA  . TYR A 1  102 ? -33.233 -53.231 50.433  1.00 23.76  ? 105 TYR A CA  1 
ATOM   776  C  C   . TYR A 1  102 ? -34.260 -52.316 49.734  1.00 24.48  ? 105 TYR A C   1 
ATOM   777  O  O   . TYR A 1  102 ? -33.924 -51.219 49.279  1.00 25.76  ? 105 TYR A O   1 
ATOM   778  C  CB  . TYR A 1  102 ? -32.740 -54.320 49.472  1.00 26.96  ? 105 TYR A CB  1 
ATOM   779  C  CG  . TYR A 1  102 ? -31.997 -53.800 48.255  1.00 17.88  ? 105 TYR A CG  1 
ATOM   780  C  CD1 . TYR A 1  102 ? -30.930 -52.964 48.408  1.00 20.00  ? 105 TYR A CD1 1 
ATOM   781  C  CD2 . TYR A 1  102 ? -32.424 -54.093 46.975  1.00 27.56  ? 105 TYR A CD2 1 
ATOM   782  C  CE1 . TYR A 1  102 ? -30.254 -52.455 47.312  1.00 30.40  ? 105 TYR A CE1 1 
ATOM   783  C  CE2 . TYR A 1  102 ? -31.761 -53.596 45.857  1.00 31.97  ? 105 TYR A CE2 1 
ATOM   784  C  CZ  . TYR A 1  102 ? -30.674 -52.767 46.034  1.00 27.30  ? 105 TYR A CZ  1 
ATOM   785  O  OH  . TYR A 1  102 ? -29.959 -52.283 44.955  1.00 34.29  ? 105 TYR A OH  1 
ATOM   786  N  N   . GLU A 1  103 ? -35.503 -52.771 49.608  1.00 23.69  ? 106 GLU A N   1 
ATOM   787  C  CA  . GLU A 1  103 ? -36.520 -51.945 48.891  1.00 22.94  ? 106 GLU A CA  1 
ATOM   788  C  C   . GLU A 1  103 ? -36.797 -50.699 49.712  1.00 22.99  ? 106 GLU A C   1 
ATOM   789  O  O   . GLU A 1  103 ? -36.893 -49.625 49.175  1.00 23.75  ? 106 GLU A O   1 
ATOM   790  C  CB  . GLU A 1  103 ? -37.797 -52.724 48.589  1.00 23.12  ? 106 GLU A CB  1 
ATOM   791  C  CG  . GLU A 1  103 ? -37.612 -53.869 47.622  1.00 18.60  ? 106 GLU A CG  1 
ATOM   792  C  CD  . GLU A 1  103 ? -37.013 -55.136 48.282  1.00 25.25  ? 106 GLU A CD  1 
ATOM   793  O  OE1 . GLU A 1  103 ? -36.874 -55.190 49.508  1.00 27.40  ? 106 GLU A OE1 1 
ATOM   794  O  OE2 . GLU A 1  103 ? -36.694 -56.089 47.577  1.00 36.00  ? 106 GLU A OE2 1 
ATOM   795  N  N   . GLU A 1  104 ? -36.810 -50.825 51.041  1.00 23.38  ? 107 GLU A N   1 
ATOM   796  C  CA  . GLU A 1  104 ? -36.872 -49.654 51.870  1.00 21.64  ? 107 GLU A CA  1 
ATOM   797  C  C   . GLU A 1  104 ? -35.668 -48.734 51.717  1.00 25.32  ? 107 GLU A C   1 
ATOM   798  O  O   . GLU A 1  104 ? -35.837 -47.498 51.675  1.00 28.11  ? 107 GLU A O   1 
ATOM   799  C  CB  . GLU A 1  104 ? -37.076 -50.020 53.342  1.00 22.00  ? 107 GLU A CB  1 
ATOM   800  C  CG  . GLU A 1  104 ? -38.495 -50.543 53.645  1.00 19.40  ? 107 GLU A CG  1 
ATOM   801  C  CD  . GLU A 1  104 ? -39.555 -49.430 53.708  1.00 26.65  ? 107 GLU A CD  1 
ATOM   802  O  OE1 . GLU A 1  104 ? -39.255 -48.422 54.369  1.00 24.68  ? 107 GLU A OE1 1 
ATOM   803  O  OE2 . GLU A 1  104 ? -40.659 -49.569 53.093  1.00 20.96  ? 107 GLU A OE2 1 
ATOM   804  N  N   . LEU A 1  105 ? -34.454 -49.283 51.635  1.00 27.14  ? 108 LEU A N   1 
ATOM   805  C  CA  . LEU A 1  105 ? -33.280 -48.405 51.464  1.00 25.39  ? 108 LEU A CA  1 
ATOM   806  C  C   . LEU A 1  105 ? -33.433 -47.591 50.194  1.00 25.27  ? 108 LEU A C   1 
ATOM   807  O  O   . LEU A 1  105 ? -33.190 -46.398 50.204  1.00 27.41  ? 108 LEU A O   1 
ATOM   808  C  CB  . LEU A 1  105 ? -31.935 -49.166 51.432  1.00 28.93  ? 108 LEU A CB  1 
ATOM   809  C  CG  . LEU A 1  105 ? -30.654 -48.278 51.367  1.00 27.16  ? 108 LEU A CG  1 
ATOM   810  C  CD1 . LEU A 1  105 ? -30.669 -47.086 52.314  1.00 20.57  ? 108 LEU A CD1 1 
ATOM   811  C  CD2 . LEU A 1  105 ? -29.453 -49.084 51.651  1.00 36.34  ? 108 LEU A CD2 1 
ATOM   812  N  N   . ARG A 1  106 ? -33.900 -48.228 49.125  1.00 24.38  ? 109 ARG A N   1 
ATOM   813  C  CA  . ARG A 1  106 ? -34.130 -47.546 47.863  1.00 26.64  ? 109 ARG A CA  1 
ATOM   814  C  C   . ARG A 1  106 ? -35.182 -46.447 47.978  1.00 30.43  ? 109 ARG A C   1 
ATOM   815  O  O   . ARG A 1  106 ? -35.023 -45.382 47.379  1.00 30.13  ? 109 ARG A O   1 
ATOM   816  C  CB  . ARG A 1  106 ? -34.545 -48.544 46.778  1.00 27.37  ? 109 ARG A CB  1 
ATOM   817  C  CG  . ARG A 1  106 ? -33.440 -49.564 46.436  1.00 31.86  ? 109 ARG A CG  1 
ATOM   818  C  CD  . ARG A 1  106 ? -33.969 -50.603 45.481  1.00 36.02  ? 109 ARG A CD  1 
ATOM   819  N  NE  . ARG A 1  106 ? -34.215 -50.024 44.164  1.00 42.33  ? 109 ARG A NE  1 
ATOM   820  C  CZ  . ARG A 1  106 ? -33.335 -50.074 43.165  1.00 46.75  ? 109 ARG A CZ  1 
ATOM   821  N  NH1 . ARG A 1  106 ? -32.153 -50.685 43.326  1.00 54.27  ? 109 ARG A NH1 1 
ATOM   822  N  NH2 . ARG A 1  106 ? -33.623 -49.511 42.004  1.00 31.64  ? 109 ARG A NH2 1 
ATOM   823  N  N   . GLU A 1  107 ? -36.226 -46.678 48.777  1.00 26.18  ? 110 GLU A N   1 
ATOM   824  C  CA  . GLU A 1  107 ? -37.226 -45.671 48.978  1.00 23.77  ? 110 GLU A CA  1 
ATOM   825  C  C   . GLU A 1  107 ? -36.621 -44.490 49.722  1.00 25.45  ? 110 GLU A C   1 
ATOM   826  O  O   . GLU A 1  107 ? -36.907 -43.351 49.402  1.00 26.78  ? 110 GLU A O   1 
ATOM   827  C  CB  . GLU A 1  107 ? -38.407 -46.282 49.762  1.00 26.78  ? 110 GLU A CB  1 
ATOM   828  C  CG  . GLU A 1  107 ? -39.619 -45.385 49.845  1.00 27.89  ? 110 GLU A CG  1 
ATOM   829  C  CD  . GLU A 1  107 ? -40.410 -45.394 48.527  1.00 30.40  ? 110 GLU A CD  1 
ATOM   830  O  OE1 . GLU A 1  107 ? -39.977 -46.046 47.547  1.00 34.08  ? 110 GLU A OE1 1 
ATOM   831  O  OE2 . GLU A 1  107 ? -41.472 -44.789 48.508  1.00 28.67  ? 110 GLU A OE2 1 
ATOM   832  N  N   . GLN A 1  108 ? -35.784 -44.748 50.720  1.00 27.47  ? 111 GLN A N   1 
ATOM   833  C  CA  . GLN A 1  108 ? -35.082 -43.661 51.448  1.00 27.76  ? 111 GLN A CA  1 
ATOM   834  C  C   . GLN A 1  108 ? -34.164 -42.832 50.551  1.00 29.46  ? 111 GLN A C   1 
ATOM   835  O  O   . GLN A 1  108 ? -34.116 -41.603 50.660  1.00 30.69  ? 111 GLN A O   1 
ATOM   836  C  CB  . GLN A 1  108 ? -34.222 -44.220 52.564  1.00 28.59  ? 111 GLN A CB  1 
ATOM   837  C  CG  . GLN A 1  108 ? -34.963 -44.912 53.682  1.00 36.08  ? 111 GLN A CG  1 
ATOM   838  C  CD  . GLN A 1  108 ? -35.697 -43.935 54.544  1.00 36.48  ? 111 GLN A CD  1 
ATOM   839  O  OE1 . GLN A 1  108 ? -35.409 -42.743 54.521  1.00 30.34  ? 111 GLN A OE1 1 
ATOM   840  N  NE2 . GLN A 1  108 ? -36.674 -44.425 55.287  1.00 30.48  ? 111 GLN A NE2 1 
ATOM   841  N  N   . LEU A 1  109 ? -33.426 -43.502 49.671  1.00 29.70  ? 112 LEU A N   1 
ATOM   842  C  CA  . LEU A 1  109 ? -32.429 -42.824 48.820  1.00 29.74  ? 112 LEU A CA  1 
ATOM   843  C  C   . LEU A 1  109 ? -33.021 -41.930 47.760  1.00 30.36  ? 112 LEU A C   1 
ATOM   844  O  O   . LEU A 1  109 ? -32.385 -41.019 47.269  1.00 30.67  ? 112 LEU A O   1 
ATOM   845  C  CB  . LEU A 1  109 ? -31.554 -43.855 48.153  1.00 30.98  ? 112 LEU A CB  1 
ATOM   846  C  CG  . LEU A 1  109 ? -30.504 -44.340 49.132  1.00 38.10  ? 112 LEU A CG  1 
ATOM   847  C  CD1 . LEU A 1  109 ? -29.872 -45.597 48.561  1.00 44.96  ? 112 LEU A CD1 1 
ATOM   848  C  CD2 . LEU A 1  109 ? -29.481 -43.225 49.397  1.00 29.24  ? 112 LEU A CD2 1 
ATOM   849  N  N   . SER A 1  110 ? -34.268 -42.223 47.432  1.00 34.04  ? 113 SER A N   1 
ATOM   850  C  CA  . SER A 1  110 ? -35.042 -41.526 46.461  1.00 35.02  ? 113 SER A CA  1 
ATOM   851  C  C   . SER A 1  110 ? -35.234 -40.072 46.870  1.00 35.19  ? 113 SER A C   1 
ATOM   852  O  O   . SER A 1  110 ? -35.482 -39.247 46.025  1.00 36.27  ? 113 SER A O   1 
ATOM   853  C  CB  . SER A 1  110 ? -36.415 -42.236 46.359  1.00 36.32  ? 113 SER A CB  1 
ATOM   854  O  OG  . SER A 1  110 ? -37.023 -41.910 45.144  1.00 51.27  ? 113 SER A OG  1 
ATOM   855  N  N   . SER A 1  111 ? -35.184 -39.771 48.162  1.00 35.48  ? 114 SER A N   1 
ATOM   856  C  CA  . SER A 1  111 ? -35.219 -38.383 48.611  1.00 38.95  ? 114 SER A CA  1 
ATOM   857  C  C   . SER A 1  111 ? -33.859 -37.896 49.122  1.00 37.69  ? 114 SER A C   1 
ATOM   858  O  O   . SER A 1  111 ? -33.823 -37.022 49.980  1.00 42.13  ? 114 SER A O   1 
ATOM   859  C  CB  . SER A 1  111 ? -36.289 -38.159 49.710  1.00 39.48  ? 114 SER A CB  1 
ATOM   860  O  OG  . SER A 1  111 ? -35.896 -38.706 50.969  1.00 41.12  ? 114 SER A OG  1 
ATOM   861  N  N   . VAL A 1  112 ? -32.762 -38.443 48.605  1.00 34.21  ? 115 VAL A N   1 
ATOM   862  C  CA  . VAL A 1  112 ? -31.418 -37.957 48.950  1.00 32.21  ? 115 VAL A CA  1 
ATOM   863  C  C   . VAL A 1  112 ? -30.812 -37.309 47.725  1.00 32.18  ? 115 VAL A C   1 
ATOM   864  O  O   . VAL A 1  112 ? -30.705 -37.950 46.693  1.00 35.18  ? 115 VAL A O   1 
ATOM   865  C  CB  . VAL A 1  112 ? -30.523 -39.107 49.479  1.00 32.57  ? 115 VAL A CB  1 
ATOM   866  C  CG1 . VAL A 1  112 ? -29.001 -38.681 49.607  1.00 26.00  ? 115 VAL A CG1 1 
ATOM   867  C  CG2 . VAL A 1  112 ? -31.073 -39.596 50.841  1.00 34.07  ? 115 VAL A CG2 1 
ATOM   868  N  N   . SER A 1  113 ? -30.443 -36.031 47.829  1.00 31.73  ? 116 SER A N   1 
ATOM   869  C  CA  . SER A 1  113 ? -29.847 -35.271 46.697  1.00 33.30  ? 116 SER A CA  1 
ATOM   870  C  C   . SER A 1  113 ? -28.331 -35.160 46.722  1.00 33.58  ? 116 SER A C   1 
ATOM   871  O  O   . SER A 1  113 ? -27.716 -34.902 45.696  1.00 36.33  ? 116 SER A O   1 
ATOM   872  C  CB  . SER A 1  113 ? -30.405 -33.864 46.630  1.00 31.68  ? 116 SER A CB  1 
ATOM   873  O  OG  . SER A 1  113 ? -30.464 -33.292 47.938  1.00 42.77  ? 116 SER A OG  1 
ATOM   874  N  N   . SER A 1  114 ? -27.736 -35.336 47.890  1.00 33.22  ? 117 SER A N   1 
ATOM   875  C  CA  . SER A 1  114 ? -26.293 -35.365 48.014  1.00 36.06  ? 117 SER A CA  1 
ATOM   876  C  C   . SER A 1  114 ? -25.915 -36.011 49.331  1.00 35.44  ? 117 SER A C   1 
ATOM   877  O  O   . SER A 1  114 ? -26.758 -36.177 50.217  1.00 38.16  ? 117 SER A O   1 
ATOM   878  C  CB  . SER A 1  114 ? -25.748 -33.931 47.972  1.00 36.15  ? 117 SER A CB  1 
ATOM   879  O  OG  . SER A 1  114 ? -26.279 -33.161 49.025  1.00 34.17  ? 117 SER A OG  1 
ATOM   880  N  N   . PHE A 1  115 ? -24.658 -36.386 49.471  1.00 35.30  ? 118 PHE A N   1 
ATOM   881  C  CA  . PHE A 1  115 ? -24.146 -36.759 50.777  1.00 35.11  ? 118 PHE A CA  1 
ATOM   882  C  C   . PHE A 1  115 ? -22.690 -36.328 51.026  1.00 38.22  ? 118 PHE A C   1 
ATOM   883  O  O   . PHE A 1  115 ? -22.052 -35.739 50.143  1.00 40.43  ? 118 PHE A O   1 
ATOM   884  C  CB  . PHE A 1  115 ? -24.383 -38.260 51.086  1.00 34.17  ? 118 PHE A CB  1 
ATOM   885  C  CG  . PHE A 1  115 ? -23.773 -39.226 50.103  1.00 27.89  ? 118 PHE A CG  1 
ATOM   886  C  CD1 . PHE A 1  115 ? -22.518 -39.030 49.561  1.00 41.79  ? 118 PHE A CD1 1 
ATOM   887  C  CD2 . PHE A 1  115 ? -24.435 -40.386 49.792  1.00 31.04  ? 118 PHE A CD2 1 
ATOM   888  C  CE1 . PHE A 1  115 ? -21.963 -39.969 48.697  1.00 38.00  ? 118 PHE A CE1 1 
ATOM   889  C  CE2 . PHE A 1  115 ? -23.896 -41.314 48.926  1.00 35.47  ? 118 PHE A CE2 1 
ATOM   890  C  CZ  . PHE A 1  115 ? -22.667 -41.116 48.387  1.00 39.14  ? 118 PHE A CZ  1 
ATOM   891  N  N   . GLU A 1  116 ? -22.224 -36.564 52.257  1.00 37.60  ? 119 GLU A N   1 
ATOM   892  C  CA  . GLU A 1  116 ? -20.816 -36.454 52.628  1.00 40.68  ? 119 GLU A CA  1 
ATOM   893  C  C   . GLU A 1  116 ? -20.371 -37.803 53.141  1.00 38.62  ? 119 GLU A C   1 
ATOM   894  O  O   . GLU A 1  116 ? -20.734 -38.189 54.241  1.00 36.58  ? 119 GLU A O   1 
ATOM   895  C  CB  . GLU A 1  116 ? -20.598 -35.396 53.716  1.00 40.72  ? 119 GLU A CB  1 
ATOM   896  C  CG  . GLU A 1  116 ? -20.738 -33.957 53.201  1.00 44.99  ? 119 GLU A CG  1 
ATOM   897  C  CD  . GLU A 1  116 ? -22.176 -33.439 53.222  1.00 44.87  ? 119 GLU A CD  1 
ATOM   898  O  OE1 . GLU A 1  116 ? -22.836 -33.574 54.280  1.00 43.20  ? 119 GLU A OE1 1 
ATOM   899  O  OE2 . GLU A 1  116 ? -22.633 -32.865 52.200  1.00 50.14  ? 119 GLU A OE2 1 
ATOM   900  N  N   . LYS A 1  117 ? -19.612 -38.516 52.314  1.00 38.26  ? 120 LYS A N   1 
ATOM   901  C  CA  . LYS A 1  117 ? -18.968 -39.769 52.698  1.00 37.53  ? 120 LYS A CA  1 
ATOM   902  C  C   . LYS A 1  117 ? -17.840 -39.453 53.678  1.00 37.22  ? 120 LYS A C   1 
ATOM   903  O  O   . LYS A 1  117 ? -17.204 -38.410 53.595  1.00 37.61  ? 120 LYS A O   1 
ATOM   904  C  CB  . LYS A 1  117 ? -18.390 -40.454 51.454  1.00 35.35  ? 120 LYS A CB  1 
ATOM   905  C  CG  . LYS A 1  117 ? -17.866 -41.877 51.641  1.00 34.10  ? 120 LYS A CG  1 
ATOM   906  C  CD  . LYS A 1  117 ? -16.956 -42.244 50.430  1.00 38.78  ? 120 LYS A CD  1 
ATOM   907  C  CE  . LYS A 1  117 ? -16.979 -43.727 50.103  1.00 47.06  ? 120 LYS A CE  1 
ATOM   908  N  NZ  . LYS A 1  117 ? -15.770 -44.194 49.320  1.00 44.82  ? 120 LYS A NZ  1 
ATOM   909  N  N   . PHE A 1  118 ? -17.598 -40.351 54.611  1.00 37.51  ? 121 PHE A N   1 
ATOM   910  C  CA  . PHE A 1  118 ? -16.488 -40.174 55.535  1.00 39.92  ? 121 PHE A CA  1 
ATOM   911  C  C   . PHE A 1  118 ? -16.170 -41.508 56.140  1.00 39.20  ? 121 PHE A C   1 
ATOM   912  O  O   . PHE A 1  118 ? -16.981 -42.424 56.075  1.00 40.01  ? 121 PHE A O   1 
ATOM   913  C  CB  . PHE A 1  118 ? -16.801 -39.120 56.618  1.00 39.63  ? 121 PHE A CB  1 
ATOM   914  C  CG  . PHE A 1  118 ? -17.976 -39.473 57.505  1.00 43.68  ? 121 PHE A CG  1 
ATOM   915  C  CD1 . PHE A 1  118 ? -17.782 -39.799 58.842  1.00 40.05  ? 121 PHE A CD1 1 
ATOM   916  C  CD2 . PHE A 1  118 ? -19.276 -39.476 57.004  1.00 45.95  ? 121 PHE A CD2 1 
ATOM   917  C  CE1 . PHE A 1  118 ? -18.845 -40.123 59.666  1.00 36.49  ? 121 PHE A CE1 1 
ATOM   918  C  CE2 . PHE A 1  118 ? -20.355 -39.808 57.822  1.00 41.51  ? 121 PHE A CE2 1 
ATOM   919  C  CZ  . PHE A 1  118 ? -20.138 -40.129 59.153  1.00 42.52  ? 121 PHE A CZ  1 
ATOM   920  N  N   . GLU A 1  119 ? -14.980 -41.604 56.714  1.00 41.40  ? 122 GLU A N   1 
ATOM   921  C  CA  . GLU A 1  119 ? -14.447 -42.850 57.239  1.00 42.49  ? 122 GLU A CA  1 
ATOM   922  C  C   . GLU A 1  119 ? -14.903 -42.992 58.686  1.00 44.41  ? 122 GLU A C   1 
ATOM   923  O  O   . GLU A 1  119 ? -14.302 -42.414 59.608  1.00 47.05  ? 122 GLU A O   1 
ATOM   924  C  CB  . GLU A 1  119 ? -12.916 -42.848 57.142  1.00 42.09  ? 122 GLU A CB  1 
ATOM   925  N  N   . ILE A 1  120 ? -15.956 -43.773 58.886  1.00 43.57  ? 123 ILE A N   1 
ATOM   926  C  CA  . ILE A 1  120 ? -16.615 -43.844 60.185  1.00 43.40  ? 123 ILE A CA  1 
ATOM   927  C  C   . ILE A 1  120 ? -15.758 -44.570 61.253  1.00 42.92  ? 123 ILE A C   1 
ATOM   928  O  O   . ILE A 1  120 ? -15.606 -44.070 62.375  1.00 40.65  ? 123 ILE A O   1 
ATOM   929  C  CB  . ILE A 1  120 ? -18.030 -44.475 60.048  1.00 43.66  ? 123 ILE A CB  1 
ATOM   930  C  CG1 . ILE A 1  120 ? -18.833 -44.297 61.349  1.00 40.33  ? 123 ILE A CG1 1 
ATOM   931  C  CG2 . ILE A 1  120 ? -17.940 -45.957 59.602  1.00 43.86  ? 123 ILE A CG2 1 
ATOM   932  C  CD1 . ILE A 1  120 ? -20.337 -44.575 61.189  1.00 36.71  ? 123 ILE A CD1 1 
ATOM   933  N  N   . PHE A 1  121 ? -15.238 -45.747 60.893  1.00 41.42  ? 124 PHE A N   1 
ATOM   934  C  CA  . PHE A 1  121 ? -14.258 -46.475 61.689  1.00 41.78  ? 124 PHE A CA  1 
ATOM   935  C  C   . PHE A 1  121 ? -13.034 -46.672 60.810  1.00 41.35  ? 124 PHE A C   1 
ATOM   936  O  O   . PHE A 1  121 ? -12.939 -47.686 60.086  1.00 39.25  ? 124 PHE A O   1 
ATOM   937  C  CB  . PHE A 1  121 ? -14.790 -47.842 62.128  1.00 41.29  ? 124 PHE A CB  1 
ATOM   938  C  CG  . PHE A 1  121 ? -16.056 -47.774 62.924  1.00 42.32  ? 124 PHE A CG  1 
ATOM   939  C  CD1 . PHE A 1  121 ? -17.085 -48.684 62.692  1.00 43.48  ? 124 PHE A CD1 1 
ATOM   940  C  CD2 . PHE A 1  121 ? -16.234 -46.799 63.901  1.00 42.88  ? 124 PHE A CD2 1 
ATOM   941  C  CE1 . PHE A 1  121 ? -18.266 -48.633 63.423  1.00 37.21  ? 124 PHE A CE1 1 
ATOM   942  C  CE2 . PHE A 1  121 ? -17.406 -46.745 64.638  1.00 47.77  ? 124 PHE A CE2 1 
ATOM   943  C  CZ  . PHE A 1  121 ? -18.434 -47.668 64.391  1.00 42.08  ? 124 PHE A CZ  1 
ATOM   944  N  N   . PRO A 1  122 ? -12.109 -45.692 60.837  1.00 41.57  ? 125 PRO A N   1 
ATOM   945  C  CA  . PRO A 1  122 ? -10.915 -45.768 60.000  1.00 42.49  ? 125 PRO A CA  1 
ATOM   946  C  C   . PRO A 1  122 ? -10.222 -47.119 60.150  1.00 42.95  ? 125 PRO A C   1 
ATOM   947  O  O   . PRO A 1  122 ? -10.117 -47.635 61.253  1.00 41.18  ? 125 PRO A O   1 
ATOM   948  C  CB  . PRO A 1  122 ? -10.050 -44.630 60.534  1.00 41.55  ? 125 PRO A CB  1 
ATOM   949  C  CG  . PRO A 1  122 ? -11.026 -43.633 61.008  1.00 40.49  ? 125 PRO A CG  1 
ATOM   950  C  CD  . PRO A 1  122 ? -12.130 -44.446 61.625  1.00 41.65  ? 125 PRO A CD  1 
ATOM   951  N  N   . LYS A 1  123 A -9.809  -47.698 59.030  1.00 45.81  ? 125 LYS A N   1 
ATOM   952  C  CA  . LYS A 1  123 A -9.149  -48.996 59.022  1.00 49.13  ? 125 LYS A CA  1 
ATOM   953  C  C   . LYS A 1  123 A -7.776  -48.800 59.642  1.00 50.64  ? 125 LYS A C   1 
ATOM   954  O  O   . LYS A 1  123 A -7.143  -47.769 59.400  1.00 51.99  ? 125 LYS A O   1 
ATOM   955  C  CB  . LYS A 1  123 A -9.018  -49.529 57.585  1.00 49.52  ? 125 LYS A CB  1 
ATOM   956  C  CG  . LYS A 1  123 A -8.050  -50.708 57.387  1.00 53.22  ? 125 LYS A CG  1 
ATOM   957  C  CD  . LYS A 1  123 A -7.834  -51.002 55.897  1.00 54.16  ? 125 LYS A CD  1 
ATOM   958  C  CE  . LYS A 1  123 A -7.004  -52.260 55.688  1.00 53.46  ? 125 LYS A CE  1 
ATOM   959  N  NZ  . LYS A 1  123 A -6.608  -52.450 54.262  1.00 51.38  ? 125 LYS A NZ  1 
ATOM   960  N  N   . THR A 1  124 B -7.339  -49.785 60.434  1.00 51.94  ? 125 THR A N   1 
ATOM   961  C  CA  . THR A 1  124 B -6.007  -49.796 61.095  1.00 52.20  ? 125 THR A CA  1 
ATOM   962  C  C   . THR A 1  124 B -5.775  -48.595 62.049  1.00 54.37  ? 125 THR A C   1 
ATOM   963  O  O   . THR A 1  124 B -4.725  -47.964 62.015  1.00 53.98  ? 125 THR A O   1 
ATOM   964  C  CB  . THR A 1  124 B -4.828  -49.933 60.048  1.00 51.56  ? 125 THR A CB  1 
ATOM   965  O  OG1 . THR A 1  124 B -4.839  -48.844 59.113  1.00 41.72  ? 125 THR A OG1 1 
ATOM   966  C  CG2 . THR A 1  124 B -4.919  -51.243 59.279  1.00 48.06  ? 125 THR A CG2 1 
ATOM   967  N  N   . SER A 1  125 C -6.763  -48.300 62.897  1.00 56.54  ? 125 SER A N   1 
ATOM   968  C  CA  . SER A 1  125 C -6.741  -47.114 63.790  1.00 57.19  ? 125 SER A CA  1 
ATOM   969  C  C   . SER A 1  125 C -7.812  -47.255 64.858  1.00 57.07  ? 125 SER A C   1 
ATOM   970  O  O   . SER A 1  125 C -7.564  -47.058 66.040  1.00 57.16  ? 125 SER A O   1 
ATOM   971  C  CB  . SER A 1  125 C -7.017  -45.814 63.016  1.00 57.59  ? 125 SER A CB  1 
ATOM   972  O  OG  . SER A 1  125 C -6.022  -45.525 62.045  1.00 59.62  ? 125 SER A OG  1 
ATOM   973  N  N   . SER A 1  126 ? -9.024  -47.563 64.414  1.00 56.37  ? 126 SER A N   1 
ATOM   974  C  CA  . SER A 1  126 ? -10.118 -47.908 65.310  1.00 56.15  ? 126 SER A CA  1 
ATOM   975  C  C   . SER A 1  126 ? -10.043 -49.372 65.748  1.00 55.17  ? 126 SER A C   1 
ATOM   976  O  O   . SER A 1  126 ? -10.706 -49.758 66.715  1.00 52.96  ? 126 SER A O   1 
ATOM   977  C  CB  . SER A 1  126 ? -11.455 -47.631 64.620  1.00 56.55  ? 126 SER A CB  1 
ATOM   978  O  OG  . SER A 1  126 ? -11.426 -48.083 63.270  1.00 56.63  ? 126 SER A OG  1 
ATOM   979  N  N   . TRP A 1  127 ? -9.223  -50.178 65.062  1.00 55.54  ? 127 TRP A N   1 
ATOM   980  C  CA  . TRP A 1  127 ? -9.097  -51.611 65.384  1.00 57.26  ? 127 TRP A CA  1 
ATOM   981  C  C   . TRP A 1  127 ? -7.661  -52.044 65.799  1.00 58.84  ? 127 TRP A C   1 
ATOM   982  O  O   . TRP A 1  127 ? -7.027  -52.868 65.118  1.00 60.23  ? 127 TRP A O   1 
ATOM   983  C  CB  . TRP A 1  127 ? -9.601  -52.454 64.205  1.00 56.12  ? 127 TRP A CB  1 
ATOM   984  C  CG  . TRP A 1  127 ? -10.863 -51.897 63.555  1.00 57.23  ? 127 TRP A CG  1 
ATOM   985  C  CD1 . TRP A 1  127 ? -10.935 -51.155 62.407  1.00 48.48  ? 127 TRP A CD1 1 
ATOM   986  C  CD2 . TRP A 1  127 ? -12.213 -52.034 64.027  1.00 52.01  ? 127 TRP A CD2 1 
ATOM   987  N  NE1 . TRP A 1  127 ? -12.235 -50.832 62.135  1.00 58.10  ? 127 TRP A NE1 1 
ATOM   988  C  CE2 . TRP A 1  127 ? -13.044 -51.360 63.108  1.00 54.80  ? 127 TRP A CE2 1 
ATOM   989  C  CE3 . TRP A 1  127 ? -12.798 -52.668 65.133  1.00 49.66  ? 127 TRP A CE3 1 
ATOM   990  C  CZ2 . TRP A 1  127 ? -14.439 -51.296 63.258  1.00 50.12  ? 127 TRP A CZ2 1 
ATOM   991  C  CZ3 . TRP A 1  127 ? -14.179 -52.605 65.287  1.00 53.44  ? 127 TRP A CZ3 1 
ATOM   992  C  CH2 . TRP A 1  127 ? -14.988 -51.921 64.349  1.00 44.79  ? 127 TRP A CH2 1 
ATOM   993  N  N   . PRO A 1  128 ? -7.153  -51.509 66.934  1.00 58.93  ? 128 PRO A N   1 
ATOM   994  C  CA  . PRO A 1  128 ? -5.795  -51.839 67.408  1.00 58.25  ? 128 PRO A CA  1 
ATOM   995  C  C   . PRO A 1  128 ? -5.490  -53.323 67.591  1.00 56.78  ? 128 PRO A C   1 
ATOM   996  O  O   . PRO A 1  128 ? -4.354  -53.731 67.361  1.00 56.30  ? 128 PRO A O   1 
ATOM   997  C  CB  . PRO A 1  128 ? -5.711  -51.137 68.769  1.00 58.27  ? 128 PRO A CB  1 
ATOM   998  C  CG  . PRO A 1  128 ? -6.634  -49.998 68.665  1.00 60.80  ? 128 PRO A CG  1 
ATOM   999  C  CD  . PRO A 1  128 ? -7.762  -50.440 67.752  1.00 59.07  ? 128 PRO A CD  1 
ATOM   1000 N  N   . ASN A 1  129 ? -6.472  -54.121 68.005  1.00 55.79  ? 129 ASN A N   1 
ATOM   1001 C  CA  . ASN A 1  129 ? -6.212  -55.540 68.282  1.00 54.78  ? 129 ASN A CA  1 
ATOM   1002 C  C   . ASN A 1  129 ? -7.105  -56.528 67.528  1.00 52.83  ? 129 ASN A C   1 
ATOM   1003 O  O   . ASN A 1  129 ? -7.490  -57.572 68.067  1.00 52.45  ? 129 ASN A O   1 
ATOM   1004 C  CB  . ASN A 1  129 ? -6.206  -55.815 69.800  1.00 55.84  ? 129 ASN A CB  1 
ATOM   1005 C  CG  . ASN A 1  129 ? -7.549  -55.570 70.456  1.00 54.54  ? 129 ASN A CG  1 
ATOM   1006 O  OD1 . ASN A 1  129 ? -8.488  -55.087 69.833  1.00 50.94  ? 129 ASN A OD1 1 
ATOM   1007 N  ND2 . ASN A 1  129 ? -7.641  -55.908 71.734  1.00 58.08  ? 129 ASN A ND2 1 
ATOM   1008 N  N   . HIS A 1  130 ? -7.413  -56.196 66.275  1.00 50.78  ? 130 HIS A N   1 
ATOM   1009 C  CA  . HIS A 1  130 ? -7.950  -57.172 65.332  1.00 48.99  ? 130 HIS A CA  1 
ATOM   1010 C  C   . HIS A 1  130 ? -7.211  -57.073 64.005  1.00 48.58  ? 130 HIS A C   1 
ATOM   1011 O  O   . HIS A 1  130 ? -6.628  -56.025 63.695  1.00 47.68  ? 130 HIS A O   1 
ATOM   1012 C  CB  . HIS A 1  130 ? -9.449  -56.951 65.142  1.00 49.59  ? 130 HIS A CB  1 
ATOM   1013 C  CG  . HIS A 1  130 ? -10.247 -57.218 66.378  1.00 46.28  ? 130 HIS A CG  1 
ATOM   1014 N  ND1 . HIS A 1  130 ? -10.855 -58.433 66.623  1.00 31.35  ? 130 HIS A ND1 1 
ATOM   1015 C  CD2 . HIS A 1  130 ? -10.514 -56.435 67.451  1.00 43.15  ? 130 HIS A CD2 1 
ATOM   1016 C  CE1 . HIS A 1  130 ? -11.470 -58.383 67.791  1.00 40.68  ? 130 HIS A CE1 1 
ATOM   1017 N  NE2 . HIS A 1  130 ? -11.278 -57.182 68.314  1.00 47.69  ? 130 HIS A NE2 1 
ATOM   1018 N  N   . GLU A 1  131 ? -7.225  -58.165 63.236  1.00 48.36  ? 131 GLU A N   1 
ATOM   1019 C  CA  . GLU A 1  131 ? -6.571  -58.208 61.918  1.00 49.18  ? 131 GLU A CA  1 
ATOM   1020 C  C   . GLU A 1  131 ? -7.388  -57.419 60.877  1.00 51.45  ? 131 GLU A C   1 
ATOM   1021 O  O   . GLU A 1  131 ? -8.625  -57.346 60.939  1.00 50.45  ? 131 GLU A O   1 
ATOM   1022 C  CB  . GLU A 1  131 ? -6.331  -59.673 61.480  1.00 49.74  ? 131 GLU A CB  1 
ATOM   1023 C  CG  . GLU A 1  131 ? -5.713  -59.928 60.061  1.00 50.10  ? 131 GLU A CG  1 
ATOM   1024 C  CD  . GLU A 1  131 ? -4.307  -59.344 59.845  1.00 52.28  ? 131 GLU A CD  1 
ATOM   1025 O  OE1 . GLU A 1  131 ? -3.296  -59.993 60.230  1.00 47.66  ? 131 GLU A OE1 1 
ATOM   1026 O  OE2 . GLU A 1  131 ? -4.220  -58.246 59.249  1.00 46.77  ? 131 GLU A OE2 1 
ATOM   1027 N  N   . THR A 1  132 ? -6.673  -56.785 59.951  1.00 52.87  ? 132 THR A N   1 
ATOM   1028 C  CA  . THR A 1  132 ? -7.291  -56.059 58.844  1.00 51.90  ? 132 THR A CA  1 
ATOM   1029 C  C   . THR A 1  132 ? -6.631  -56.496 57.517  1.00 53.05  ? 132 THR A C   1 
ATOM   1030 O  O   . THR A 1  132 ? -5.923  -55.724 56.855  1.00 52.31  ? 132 THR A O   1 
ATOM   1031 C  CB  . THR A 1  132 ? -7.248  -54.510 59.065  1.00 51.60  ? 132 THR A CB  1 
ATOM   1032 O  OG1 . THR A 1  132 ? -5.921  -54.013 58.858  1.00 45.10  ? 132 THR A OG1 1 
ATOM   1033 C  CG2 . THR A 1  132 ? -7.710  -54.145 60.477  1.00 48.36  ? 132 THR A CG2 1 
ATOM   1034 N  N   . THR A 1  133 ? -6.844  -57.771 57.180  1.00 53.76  ? 133 THR A N   1 
ATOM   1035 C  CA  . THR A 1  133 ? -6.679  -58.280 55.812  1.00 54.20  ? 133 THR A CA  1 
ATOM   1036 C  C   . THR A 1  133 ? -7.141  -59.740 55.703  1.00 55.81  ? 133 THR A C   1 
ATOM   1037 O  O   . THR A 1  133 ? -7.276  -60.420 56.717  1.00 56.83  ? 133 THR A O   1 
ATOM   1038 C  CB  . THR A 1  133 ? -5.252  -58.104 55.258  1.00 54.59  ? 133 THR A CB  1 
ATOM   1039 O  OG1 . THR A 1  133 ? -5.308  -58.161 53.829  1.00 48.97  ? 133 THR A OG1 1 
ATOM   1040 C  CG2 . THR A 1  133 ? -4.262  -59.184 55.821  1.00 55.54  ? 133 THR A CG2 1 
ATOM   1041 N  N   . LYS A 1  134 A -7.439  -60.171 54.473  1.00 57.79  ? 133 LYS A N   1 
ATOM   1042 C  CA  . LYS A 1  134 A -7.734  -61.581 54.117  1.00 58.84  ? 133 LYS A CA  1 
ATOM   1043 C  C   . LYS A 1  134 A -8.846  -62.289 54.943  1.00 58.98  ? 133 LYS A C   1 
ATOM   1044 O  O   . LYS A 1  134 A -8.548  -63.005 55.904  1.00 60.29  ? 133 LYS A O   1 
ATOM   1045 C  CB  . LYS A 1  134 A -6.437  -62.408 54.161  1.00 58.53  ? 133 LYS A CB  1 
ATOM   1046 N  N   . GLY A 1  135 ? -10.112 -62.143 54.562  1.00 59.19  ? 134 GLY A N   1 
ATOM   1047 C  CA  . GLY A 1  135 ? -10.521 -61.452 53.346  1.00 58.82  ? 134 GLY A CA  1 
ATOM   1048 C  C   . GLY A 1  135 ? -10.469 -59.940 53.406  1.00 57.31  ? 134 GLY A C   1 
ATOM   1049 O  O   . GLY A 1  135 ? -10.364 -59.375 54.506  1.00 57.46  ? 134 GLY A O   1 
ATOM   1050 N  N   . VAL A 1  136 ? -10.487 -59.254 52.256  1.00 54.97  ? 135 VAL A N   1 
ATOM   1051 C  CA  . VAL A 1  136 ? -10.252 -59.774 50.875  1.00 52.53  ? 135 VAL A CA  1 
ATOM   1052 C  C   . VAL A 1  136 ? -10.881 -61.107 50.377  1.00 50.11  ? 135 VAL A C   1 
ATOM   1053 O  O   . VAL A 1  136 ? -11.062 -62.049 51.135  1.00 48.05  ? 135 VAL A O   1 
ATOM   1054 C  CB  . VAL A 1  136 ? -8.742  -59.732 50.578  1.00 53.11  ? 135 VAL A CB  1 
ATOM   1055 C  CG1 . VAL A 1  136 ? -8.419  -60.423 49.273  1.00 55.89  ? 135 VAL A CG1 1 
ATOM   1056 C  CG2 . VAL A 1  136 ? -8.264  -58.275 50.557  1.00 52.08  ? 135 VAL A CG2 1 
ATOM   1057 N  N   . THR A 1  137 ? -11.224 -61.167 49.087  1.00 48.97  ? 136 THR A N   1 
ATOM   1058 C  CA  . THR A 1  137 ? -11.751 -62.396 48.471  1.00 49.56  ? 136 THR A CA  1 
ATOM   1059 C  C   . THR A 1  137 ? -11.843 -62.282 46.946  1.00 49.48  ? 136 THR A C   1 
ATOM   1060 O  O   . THR A 1  137 ? -12.007 -61.189 46.402  1.00 50.52  ? 136 THR A O   1 
ATOM   1061 C  CB  . THR A 1  137 ? -13.126 -62.808 49.080  1.00 49.85  ? 136 THR A CB  1 
ATOM   1062 O  OG1 . THR A 1  137 ? -12.916 -63.796 50.097  1.00 57.59  ? 136 THR A OG1 1 
ATOM   1063 C  CG2 . THR A 1  137 ? -14.054 -63.398 48.051  1.00 50.70  ? 136 THR A CG2 1 
ATOM   1064 N  N   . ALA A 1  138 ? -11.703 -63.418 46.268  1.00 49.08  ? 137 ALA A N   1 
ATOM   1065 C  CA  . ALA A 1  138 ? -11.758 -63.473 44.802  1.00 48.80  ? 137 ALA A CA  1 
ATOM   1066 C  C   . ALA A 1  138 ? -13.172 -63.197 44.268  1.00 47.39  ? 137 ALA A C   1 
ATOM   1067 O  O   . ALA A 1  138 ? -13.341 -62.681 43.149  1.00 46.57  ? 137 ALA A O   1 
ATOM   1068 C  CB  . ALA A 1  138 ? -11.252 -64.832 44.300  1.00 48.15  ? 137 ALA A CB  1 
ATOM   1069 N  N   . ALA A 1  139 ? -14.184 -63.559 45.053  1.00 45.01  ? 138 ALA A N   1 
ATOM   1070 C  CA  . ALA A 1  139 ? -15.567 -63.183 44.732  1.00 44.66  ? 138 ALA A CA  1 
ATOM   1071 C  C   . ALA A 1  139 ? -15.682 -61.694 44.383  1.00 42.43  ? 138 ALA A C   1 
ATOM   1072 O  O   . ALA A 1  139 ? -16.441 -61.332 43.502  1.00 39.61  ? 138 ALA A O   1 
ATOM   1073 C  CB  . ALA A 1  139 ? -16.492 -63.525 45.870  1.00 43.82  ? 138 ALA A CB  1 
ATOM   1074 N  N   . CYS A 1  140 ? -14.900 -60.854 45.060  1.00 43.03  ? 139 CYS A N   1 
ATOM   1075 C  CA  . CYS A 1  140 ? -14.880 -59.415 44.810  1.00 44.19  ? 139 CYS A CA  1 
ATOM   1076 C  C   . CYS A 1  140 ? -13.515 -58.985 44.315  1.00 45.46  ? 139 CYS A C   1 
ATOM   1077 O  O   . CYS A 1  140 ? -12.764 -58.327 45.042  1.00 45.20  ? 139 CYS A O   1 
ATOM   1078 C  CB  . CYS A 1  140 ? -15.239 -58.658 46.095  1.00 43.57  ? 139 CYS A CB  1 
ATOM   1079 S  SG  . CYS A 1  140 ? -16.854 -59.133 46.762  1.00 42.89  ? 139 CYS A SG  1 
ATOM   1080 N  N   . SER A 1  141 ? -13.206 -59.337 43.068  1.00 46.95  ? 140 SER A N   1 
ATOM   1081 C  CA  . SER A 1  141 ? -11.846 -59.155 42.522  1.00 47.20  ? 140 SER A CA  1 
ATOM   1082 C  C   . SER A 1  141 ? -11.617 -57.784 41.909  1.00 48.22  ? 140 SER A C   1 
ATOM   1083 O  O   . SER A 1  141 ? -12.556 -57.122 41.484  1.00 48.47  ? 140 SER A O   1 
ATOM   1084 C  CB  . SER A 1  141 ? -11.550 -60.210 41.458  1.00 46.19  ? 140 SER A CB  1 
ATOM   1085 O  OG  . SER A 1  141 ? -11.392 -61.475 42.053  1.00 44.25  ? 140 SER A OG  1 
ATOM   1086 N  N   . TYR A 1  142 ? -10.352 -57.383 41.855  1.00 49.81  ? 141 TYR A N   1 
ATOM   1087 C  CA  . TYR A 1  142 ? -9.928  -56.172 41.159  1.00 51.36  ? 141 TYR A CA  1 
ATOM   1088 C  C   . TYR A 1  142 ? -8.540  -56.344 40.527  1.00 53.02  ? 141 TYR A C   1 
ATOM   1089 O  O   . TYR A 1  142 ? -7.538  -56.499 41.242  1.00 53.52  ? 141 TYR A O   1 
ATOM   1090 C  CB  . TYR A 1  142 ? -9.891  -54.999 42.128  1.00 51.28  ? 141 TYR A CB  1 
ATOM   1091 C  CG  . TYR A 1  142 ? -9.583  -53.691 41.441  1.00 54.76  ? 141 TYR A CG  1 
ATOM   1092 C  CD1 . TYR A 1  142 ? -10.467 -53.155 40.511  1.00 54.20  ? 141 TYR A CD1 1 
ATOM   1093 C  CD2 . TYR A 1  142 ? -8.398  -52.996 41.708  1.00 58.34  ? 141 TYR A CD2 1 
ATOM   1094 C  CE1 . TYR A 1  142 ? -10.199 -51.961 39.872  1.00 58.33  ? 141 TYR A CE1 1 
ATOM   1095 C  CE2 . TYR A 1  142 ? -8.118  -51.799 41.071  1.00 58.40  ? 141 TYR A CE2 1 
ATOM   1096 C  CZ  . TYR A 1  142 ? -9.028  -51.287 40.157  1.00 58.44  ? 141 TYR A CZ  1 
ATOM   1097 O  OH  . TYR A 1  142 ? -8.768  -50.100 39.520  1.00 63.41  ? 141 TYR A OH  1 
ATOM   1098 N  N   . ALA A 1  143 ? -8.484  -56.311 39.197  1.00 53.86  ? 142 ALA A N   1 
ATOM   1099 C  CA  . ALA A 1  143 ? -7.238  -56.537 38.458  1.00 54.96  ? 142 ALA A CA  1 
ATOM   1100 C  C   . ALA A 1  143 ? -6.648  -57.923 38.745  1.00 55.33  ? 142 ALA A C   1 
ATOM   1101 O  O   . ALA A 1  143 ? -5.448  -58.048 39.006  1.00 54.79  ? 142 ALA A O   1 
ATOM   1102 C  CB  . ALA A 1  143 ? -6.208  -55.434 38.769  1.00 55.56  ? 142 ALA A CB  1 
ATOM   1103 N  N   . GLY A 1  144 ? -7.509  -58.946 38.717  1.00 55.40  ? 143 GLY A N   1 
ATOM   1104 C  CA  . GLY A 1  144 ? -7.094  -60.347 38.864  1.00 55.42  ? 143 GLY A CA  1 
ATOM   1105 C  C   . GLY A 1  144 ? -6.415  -60.694 40.181  1.00 54.88  ? 143 GLY A C   1 
ATOM   1106 O  O   . GLY A 1  144 ? -5.447  -61.461 40.213  1.00 56.38  ? 143 GLY A O   1 
ATOM   1107 N  N   . ALA A 1  145 ? -6.923  -60.108 41.259  1.00 53.88  ? 144 ALA A N   1 
ATOM   1108 C  CA  . ALA A 1  145 ? -6.492  -60.413 42.616  1.00 52.10  ? 144 ALA A CA  1 
ATOM   1109 C  C   . ALA A 1  145 ? -7.661  -60.124 43.551  1.00 51.48  ? 144 ALA A C   1 
ATOM   1110 O  O   . ALA A 1  145 ? -8.398  -59.150 43.371  1.00 48.38  ? 144 ALA A O   1 
ATOM   1111 C  CB  . ALA A 1  145 ? -5.284  -59.576 43.008  1.00 51.67  ? 144 ALA A CB  1 
ATOM   1112 N  N   . SER A 1  146 ? -7.816  -60.986 44.544  1.00 50.96  ? 145 SER A N   1 
ATOM   1113 C  CA  . SER A 1  146 ? -8.894  -60.884 45.502  1.00 50.41  ? 145 SER A CA  1 
ATOM   1114 C  C   . SER A 1  146 ? -8.893  -59.523 46.189  1.00 49.79  ? 145 SER A C   1 
ATOM   1115 O  O   . SER A 1  146 ? -7.844  -59.038 46.612  1.00 48.05  ? 145 SER A O   1 
ATOM   1116 C  CB  . SER A 1  146 ? -8.752  -62.001 46.533  1.00 50.88  ? 145 SER A CB  1 
ATOM   1117 O  OG  . SER A 1  146 ? -8.966  -63.270 45.932  1.00 52.08  ? 145 SER A OG  1 
ATOM   1118 N  N   . SER A 1  147 ? -10.079 -58.914 46.280  1.00 49.01  ? 146 SER A N   1 
ATOM   1119 C  CA  . SER A 1  147 ? -10.247 -57.577 46.856  1.00 47.85  ? 146 SER A CA  1 
ATOM   1120 C  C   . SER A 1  147 ? -11.561 -57.538 47.647  1.00 46.87  ? 146 SER A C   1 
ATOM   1121 O  O   . SER A 1  147 ? -12.166 -58.592 47.886  1.00 48.23  ? 146 SER A O   1 
ATOM   1122 C  CB  . SER A 1  147 ? -10.230 -56.530 45.736  1.00 48.25  ? 146 SER A CB  1 
ATOM   1123 O  OG  . SER A 1  147 ? -9.923  -55.236 46.223  1.00 49.77  ? 146 SER A OG  1 
ATOM   1124 N  N   . PHE A 1  148 ? -12.007 -56.339 48.040  1.00 43.97  ? 147 PHE A N   1 
ATOM   1125 C  CA  . PHE A 1  148 ? -13.245 -56.186 48.823  1.00 38.45  ? 147 PHE A CA  1 
ATOM   1126 C  C   . PHE A 1  148 ? -13.933 -54.857 48.592  1.00 37.79  ? 147 PHE A C   1 
ATOM   1127 O  O   . PHE A 1  148 ? -13.415 -53.974 47.886  1.00 35.34  ? 147 PHE A O   1 
ATOM   1128 C  CB  . PHE A 1  148 ? -12.956 -56.299 50.326  1.00 37.12  ? 147 PHE A CB  1 
ATOM   1129 C  CG  . PHE A 1  148 ? -14.110 -56.858 51.136  1.00 34.24  ? 147 PHE A CG  1 
ATOM   1130 C  CD1 . PHE A 1  148 ? -14.688 -58.073 50.795  1.00 21.08  ? 147 PHE A CD1 1 
ATOM   1131 C  CD2 . PHE A 1  148 ? -14.610 -56.171 52.247  1.00 38.25  ? 147 PHE A CD2 1 
ATOM   1132 C  CE1 . PHE A 1  148 ? -15.740 -58.601 51.536  1.00 27.98  ? 147 PHE A CE1 1 
ATOM   1133 C  CE2 . PHE A 1  148 ? -15.663 -56.700 53.011  1.00 36.17  ? 147 PHE A CE2 1 
ATOM   1134 C  CZ  . PHE A 1  148 ? -16.235 -57.914 52.650  1.00 33.81  ? 147 PHE A CZ  1 
ATOM   1135 N  N   . TYR A 1  149 ? -15.106 -54.734 49.223  1.00 33.80  ? 148 TYR A N   1 
ATOM   1136 C  CA  . TYR A 1  149 ? -15.863 -53.503 49.253  1.00 33.61  ? 148 TYR A CA  1 
ATOM   1137 C  C   . TYR A 1  149 ? -15.014 -52.342 49.782  1.00 33.14  ? 148 TYR A C   1 
ATOM   1138 O  O   . TYR A 1  149 ? -14.325 -52.486 50.780  1.00 29.85  ? 148 TYR A O   1 
ATOM   1139 C  CB  . TYR A 1  149 ? -17.098 -53.691 50.146  1.00 32.18  ? 148 TYR A CB  1 
ATOM   1140 C  CG  . TYR A 1  149 ? -18.068 -54.775 49.690  1.00 28.02  ? 148 TYR A CG  1 
ATOM   1141 C  CD1 . TYR A 1  149 ? -18.860 -54.608 48.550  1.00 30.01  ? 148 TYR A CD1 1 
ATOM   1142 C  CD2 . TYR A 1  149 ? -18.222 -55.951 50.423  1.00 25.53  ? 148 TYR A CD2 1 
ATOM   1143 C  CE1 . TYR A 1  149 ? -19.758 -55.611 48.139  1.00 25.27  ? 148 TYR A CE1 1 
ATOM   1144 C  CE2 . TYR A 1  149 ? -19.100 -56.956 50.017  1.00 28.85  ? 148 TYR A CE2 1 
ATOM   1145 C  CZ  . TYR A 1  149 ? -19.864 -56.781 48.877  1.00 29.22  ? 148 TYR A CZ  1 
ATOM   1146 O  OH  . TYR A 1  149 ? -20.755 -57.763 48.510  1.00 27.44  ? 148 TYR A OH  1 
ATOM   1147 N  N   . ARG A 1  150 ? -15.111 -51.184 49.147  1.00 33.75  ? 149 ARG A N   1 
ATOM   1148 C  CA  . ARG A 1  150 ? -14.376 -49.997 49.609  1.00 36.45  ? 149 ARG A CA  1 
ATOM   1149 C  C   . ARG A 1  150 ? -15.018 -49.332 50.830  1.00 38.26  ? 149 ARG A C   1 
ATOM   1150 O  O   . ARG A 1  150 ? -14.403 -48.478 51.462  1.00 40.17  ? 149 ARG A O   1 
ATOM   1151 C  CB  . ARG A 1  150 ? -14.249 -48.937 48.497  1.00 35.11  ? 149 ARG A CB  1 
ATOM   1152 C  CG  . ARG A 1  150 ? -13.300 -49.291 47.346  1.00 35.53  ? 149 ARG A CG  1 
ATOM   1153 C  CD  . ARG A 1  150 ? -13.513 -50.706 46.792  1.00 41.11  ? 149 ARG A CD  1 
ATOM   1154 N  NE  . ARG A 1  150 ? -12.633 -50.968 45.655  1.00 47.88  ? 149 ARG A NE  1 
ATOM   1155 C  CZ  . ARG A 1  150 ? -11.732 -51.952 45.570  1.00 49.03  ? 149 ARG A CZ  1 
ATOM   1156 N  NH1 . ARG A 1  150 ? -11.560 -52.841 46.546  1.00 54.60  ? 149 ARG A NH1 1 
ATOM   1157 N  NH2 . ARG A 1  150 ? -10.996 -52.054 44.472  1.00 45.46  ? 149 ARG A NH2 1 
ATOM   1158 N  N   . ASN A 1  151 ? -16.251 -49.696 51.170  1.00 39.68  ? 150 ASN A N   1 
ATOM   1159 C  CA  . ASN A 1  151 ? -16.925 -49.039 52.284  1.00 38.32  ? 150 ASN A CA  1 
ATOM   1160 C  C   . ASN A 1  151 ? -17.072 -49.898 53.502  1.00 37.07  ? 150 ASN A C   1 
ATOM   1161 O  O   . ASN A 1  151 ? -17.239 -49.354 54.585  1.00 38.97  ? 150 ASN A O   1 
ATOM   1162 C  CB  . ASN A 1  151 ? -18.281 -48.515 51.835  1.00 41.12  ? 150 ASN A CB  1 
ATOM   1163 C  CG  . ASN A 1  151 ? -18.161 -47.614 50.649  1.00 43.81  ? 150 ASN A CG  1 
ATOM   1164 O  OD1 . ASN A 1  151 ? -17.104 -47.005 50.439  1.00 47.02  ? 150 ASN A OD1 1 
ATOM   1165 N  ND2 . ASN A 1  151 ? -19.217 -47.533 49.846  1.00 36.27  ? 150 ASN A ND2 1 
ATOM   1166 N  N   . LEU A 1  152 ? -17.042 -51.225 53.326  1.00 36.57  ? 151 LEU A N   1 
ATOM   1167 C  CA  . LEU A 1  152 ? -17.008 -52.168 54.449  1.00 36.85  ? 151 LEU A CA  1 
ATOM   1168 C  C   . LEU A 1  152 ? -15.558 -52.685 54.688  1.00 39.54  ? 151 LEU A C   1 
ATOM   1169 O  O   . LEU A 1  152 ? -14.721 -52.622 53.780  1.00 37.59  ? 151 LEU A O   1 
ATOM   1170 C  CB  . LEU A 1  152 ? -17.961 -53.338 54.199  1.00 36.22  ? 151 LEU A CB  1 
ATOM   1171 C  CG  . LEU A 1  152 ? -19.483 -53.039 54.075  1.00 34.74  ? 151 LEU A CG  1 
ATOM   1172 C  CD1 . LEU A 1  152 ? -20.304 -54.289 54.323  1.00 31.13  ? 151 LEU A CD1 1 
ATOM   1173 C  CD2 . LEU A 1  152 ? -19.938 -51.942 55.020  1.00 30.90  ? 151 LEU A CD2 1 
ATOM   1174 N  N   . LEU A 1  153 ? -15.283 -53.180 55.902  1.00 39.63  ? 152 LEU A N   1 
ATOM   1175 C  CA  . LEU A 1  153 ? -13.965 -53.757 56.275  1.00 40.58  ? 152 LEU A CA  1 
ATOM   1176 C  C   . LEU A 1  153 ? -14.138 -55.130 56.927  1.00 40.14  ? 152 LEU A C   1 
ATOM   1177 O  O   . LEU A 1  153 ? -14.667 -55.240 58.042  1.00 41.30  ? 152 LEU A O   1 
ATOM   1178 C  CB  . LEU A 1  153 ? -13.203 -52.852 57.255  1.00 41.26  ? 152 LEU A CB  1 
ATOM   1179 C  CG  . LEU A 1  153 ? -11.791 -53.338 57.683  1.00 42.70  ? 152 LEU A CG  1 
ATOM   1180 C  CD1 . LEU A 1  153 ? -10.682 -52.694 56.853  1.00 41.65  ? 152 LEU A CD1 1 
ATOM   1181 C  CD2 . LEU A 1  153 ? -11.525 -53.086 59.171  1.00 41.14  ? 152 LEU A CD2 1 
ATOM   1182 N  N   . TRP A 1  154 ? -13.663 -56.165 56.241  1.00 38.68  ? 153 TRP A N   1 
ATOM   1183 C  CA  . TRP A 1  154 ? -13.806 -57.533 56.702  1.00 38.93  ? 153 TRP A CA  1 
ATOM   1184 C  C   . TRP A 1  154 ? -12.799 -57.843 57.832  1.00 41.78  ? 153 TRP A C   1 
ATOM   1185 O  O   . TRP A 1  154 ? -11.616 -58.021 57.560  1.00 38.61  ? 153 TRP A O   1 
ATOM   1186 C  CB  . TRP A 1  154 ? -13.564 -58.496 55.530  1.00 38.35  ? 153 TRP A CB  1 
ATOM   1187 C  CG  . TRP A 1  154 ? -13.991 -59.870 55.830  1.00 34.62  ? 153 TRP A CG  1 
ATOM   1188 C  CD1 . TRP A 1  154 ? -14.173 -60.429 57.066  1.00 31.94  ? 153 TRP A CD1 1 
ATOM   1189 C  CD2 . TRP A 1  154 ? -14.281 -60.886 54.884  1.00 32.32  ? 153 TRP A CD2 1 
ATOM   1190 N  NE1 . TRP A 1  154 ? -14.595 -61.728 56.943  1.00 38.12  ? 153 TRP A NE1 1 
ATOM   1191 C  CE2 . TRP A 1  154 ? -14.661 -62.042 55.613  1.00 29.79  ? 153 TRP A CE2 1 
ATOM   1192 C  CE3 . TRP A 1  154 ? -14.272 -60.936 53.490  1.00 33.08  ? 153 TRP A CE3 1 
ATOM   1193 C  CZ2 . TRP A 1  154 ? -15.032 -63.231 54.996  1.00 32.15  ? 153 TRP A CZ2 1 
ATOM   1194 C  CZ3 . TRP A 1  154 ? -14.651 -62.121 52.870  1.00 36.32  ? 153 TRP A CZ3 1 
ATOM   1195 C  CH2 . TRP A 1  154 ? -15.021 -63.257 53.627  1.00 39.02  ? 153 TRP A CH2 1 
ATOM   1196 N  N   . LEU A 1  155 ? -13.280 -57.928 59.079  1.00 44.11  ? 154 LEU A N   1 
ATOM   1197 C  CA  . LEU A 1  155 ? -12.420 -58.183 60.246  1.00 44.75  ? 154 LEU A CA  1 
ATOM   1198 C  C   . LEU A 1  155 ? -12.143 -59.679 60.435  1.00 48.40  ? 154 LEU A C   1 
ATOM   1199 O  O   . LEU A 1  155 ? -13.010 -60.533 60.175  1.00 48.95  ? 154 LEU A O   1 
ATOM   1200 C  CB  . LEU A 1  155 ? -13.021 -57.602 61.538  1.00 42.49  ? 154 LEU A CB  1 
ATOM   1201 C  CG  . LEU A 1  155 ? -13.118 -56.078 61.696  1.00 38.98  ? 154 LEU A CG  1 
ATOM   1202 C  CD1 . LEU A 1  155 ? -13.502 -55.707 63.139  1.00 41.82  ? 154 LEU A CD1 1 
ATOM   1203 C  CD2 . LEU A 1  155 ? -11.856 -55.361 61.315  1.00 28.22  ? 154 LEU A CD2 1 
ATOM   1204 N  N   . THR A 1  156 ? -10.928 -59.970 60.912  1.00 50.68  ? 155 THR A N   1 
ATOM   1205 C  CA  . THR A 1  156 ? -10.416 -61.338 61.067  1.00 51.88  ? 155 THR A CA  1 
ATOM   1206 C  C   . THR A 1  156 ? -9.565  -61.519 62.338  1.00 52.15  ? 155 THR A C   1 
ATOM   1207 O  O   . THR A 1  156 ? -9.116  -60.539 62.956  1.00 51.92  ? 155 THR A O   1 
ATOM   1208 C  CB  . THR A 1  156 ? -9.579  -61.704 59.847  1.00 52.23  ? 155 THR A CB  1 
ATOM   1209 O  OG1 . THR A 1  156 ? -8.733  -60.594 59.505  1.00 52.92  ? 155 THR A OG1 1 
ATOM   1210 C  CG2 . THR A 1  156 ? -10.495 -62.017 58.674  1.00 51.35  ? 155 THR A CG2 1 
ATOM   1211 N  N   . LYS A 1  157 ? -9.353  -62.778 62.722  1.00 53.06  ? 156 LYS A N   1 
ATOM   1212 C  CA  . LYS A 1  157 ? -8.569  -63.113 63.935  1.00 52.64  ? 156 LYS A CA  1 
ATOM   1213 C  C   . LYS A 1  157 ? -7.156  -62.538 63.890  1.00 53.37  ? 156 LYS A C   1 
ATOM   1214 O  O   . LYS A 1  157 ? -6.532  -62.499 62.825  1.00 52.98  ? 156 LYS A O   1 
ATOM   1215 C  CB  . LYS A 1  157 ? -8.516  -64.637 64.189  1.00 51.13  ? 156 LYS A CB  1 
ATOM   1216 C  CG  . LYS A 1  157 ? -7.918  -65.476 63.064  1.00 50.38  ? 156 LYS A CG  1 
ATOM   1217 C  CD  . LYS A 1  157 ? -7.852  -66.974 63.418  1.00 52.29  ? 156 LYS A CD  1 
ATOM   1218 C  CE  . LYS A 1  157 ? -6.594  -67.668 62.821  1.00 48.81  ? 156 LYS A CE  1 
ATOM   1219 N  NZ  . LYS A 1  157 ? -6.616  -69.155 62.957  1.00 47.91  ? 156 LYS A NZ  1 
ATOM   1220 N  N   . LYS A 1  158 ? -6.683  -62.065 65.046  1.00 54.79  ? 157 LYS A N   1 
ATOM   1221 C  CA  . LYS A 1  158 ? -5.281  -61.672 65.228  1.00 56.40  ? 157 LYS A CA  1 
ATOM   1222 C  C   . LYS A 1  158 ? -4.512  -62.870 65.792  1.00 55.94  ? 157 LYS A C   1 
ATOM   1223 O  O   . LYS A 1  158 ? -4.076  -62.854 66.945  1.00 55.76  ? 157 LYS A O   1 
ATOM   1224 C  CB  . LYS A 1  158 ? -5.168  -60.468 66.172  1.00 57.11  ? 157 LYS A CB  1 
ATOM   1225 C  CG  . LYS A 1  158 ? -3.784  -59.797 66.193  1.00 57.41  ? 157 LYS A CG  1 
ATOM   1226 C  CD  . LYS A 1  158 ? -3.665  -58.711 65.122  1.00 57.44  ? 157 LYS A CD  1 
ATOM   1227 C  CE  . LYS A 1  158 ? -2.639  -57.636 65.492  1.00 58.38  ? 157 LYS A CE  1 
ATOM   1228 N  NZ  . LYS A 1  158 ? -3.008  -56.316 64.879  1.00 54.00  ? 157 LYS A NZ  1 
ATOM   1229 N  N   . GLY A 1  159 ? -4.378  -63.911 64.969  1.00 56.07  ? 158 GLY A N   1 
ATOM   1230 C  CA  . GLY A 1  159 ? -3.719  -65.153 65.362  1.00 56.59  ? 158 GLY A CA  1 
ATOM   1231 C  C   . GLY A 1  159 ? -4.388  -65.881 66.518  1.00 57.13  ? 158 GLY A C   1 
ATOM   1232 O  O   . GLY A 1  159 ? -3.960  -65.749 67.673  1.00 57.27  ? 158 GLY A O   1 
ATOM   1233 N  N   . SER A 1  160 ? -5.450  -66.631 66.213  1.00 56.91  ? 159 SER A N   1 
ATOM   1234 C  CA  . SER A 1  160 ? -6.068  -67.579 67.166  1.00 56.69  ? 159 SER A CA  1 
ATOM   1235 C  C   . SER A 1  160 ? -6.966  -66.933 68.237  1.00 55.87  ? 159 SER A C   1 
ATOM   1236 O  O   . SER A 1  160 ? -7.880  -67.593 68.748  1.00 55.78  ? 159 SER A O   1 
ATOM   1237 C  CB  . SER A 1  160 ? -4.994  -68.465 67.836  1.00 55.73  ? 159 SER A CB  1 
ATOM   1238 N  N   . SER A 1  161 ? -6.699  -65.665 68.578  1.00 54.82  ? 160 SER A N   1 
ATOM   1239 C  CA  . SER A 1  161 ? -7.547  -64.883 69.486  1.00 54.23  ? 160 SER A CA  1 
ATOM   1240 C  C   . SER A 1  161 ? -8.454  -63.911 68.721  1.00 54.98  ? 160 SER A C   1 
ATOM   1241 O  O   . SER A 1  161 ? -8.158  -63.518 67.583  1.00 54.11  ? 160 SER A O   1 
ATOM   1242 C  CB  . SER A 1  161 ? -6.691  -64.081 70.461  1.00 51.96  ? 160 SER A CB  1 
ATOM   1243 N  N   . TYR A 1  162 ? -9.556  -63.527 69.365  1.00 55.52  ? 161 TYR A N   1 
ATOM   1244 C  CA  . TYR A 1  162 ? -10.436 -62.458 68.870  1.00 55.95  ? 161 TYR A CA  1 
ATOM   1245 C  C   . TYR A 1  162 ? -11.278 -61.967 70.055  1.00 55.52  ? 161 TYR A C   1 
ATOM   1246 O  O   . TYR A 1  162 ? -12.265 -62.617 70.429  1.00 54.54  ? 161 TYR A O   1 
ATOM   1247 C  CB  . TYR A 1  162 ? -11.310 -62.965 67.716  1.00 56.13  ? 161 TYR A CB  1 
ATOM   1248 C  CG  . TYR A 1  162 ? -12.157 -61.919 66.982  1.00 60.87  ? 161 TYR A CG  1 
ATOM   1249 C  CD1 . TYR A 1  162 ? -13.360 -61.467 67.512  1.00 60.64  ? 161 TYR A CD1 1 
ATOM   1250 C  CD2 . TYR A 1  162 ? -11.776 -61.431 65.729  1.00 63.54  ? 161 TYR A CD2 1 
ATOM   1251 C  CE1 . TYR A 1  162 ? -14.143 -60.538 66.837  1.00 64.58  ? 161 TYR A CE1 1 
ATOM   1252 C  CE2 . TYR A 1  162 ? -12.560 -60.500 65.046  1.00 66.51  ? 161 TYR A CE2 1 
ATOM   1253 C  CZ  . TYR A 1  162 ? -13.744 -60.062 65.608  1.00 65.21  ? 161 TYR A CZ  1 
ATOM   1254 O  OH  . TYR A 1  162 ? -14.532 -59.145 64.955  1.00 64.94  ? 161 TYR A OH  1 
ATOM   1255 N  N   . PRO A 1  163 ? -10.859 -60.843 70.681  1.00 54.82  ? 162 PRO A N   1 
ATOM   1256 C  CA  . PRO A 1  163 ? -11.570 -60.281 71.841  1.00 55.02  ? 162 PRO A CA  1 
ATOM   1257 C  C   . PRO A 1  163 ? -12.858 -59.509 71.488  1.00 54.71  ? 162 PRO A C   1 
ATOM   1258 O  O   . PRO A 1  163 ? -12.900 -58.813 70.476  1.00 54.45  ? 162 PRO A O   1 
ATOM   1259 C  CB  . PRO A 1  163 ? -10.530 -59.336 72.462  1.00 54.96  ? 162 PRO A CB  1 
ATOM   1260 C  CG  . PRO A 1  163 ? -9.663  -58.920 71.311  1.00 53.92  ? 162 PRO A CG  1 
ATOM   1261 C  CD  . PRO A 1  163 ? -9.621  -60.092 70.376  1.00 53.55  ? 162 PRO A CD  1 
ATOM   1262 N  N   . LYS A 1  164 ? -13.880 -59.635 72.340  1.00 54.88  ? 163 LYS A N   1 
ATOM   1263 C  CA  . LYS A 1  164 ? -15.173 -58.961 72.158  1.00 54.68  ? 163 LYS A CA  1 
ATOM   1264 C  C   . LYS A 1  164 ? -15.032 -57.441 71.973  1.00 54.82  ? 163 LYS A C   1 
ATOM   1265 O  O   . LYS A 1  164 ? -14.884 -56.696 72.950  1.00 54.60  ? 163 LYS A O   1 
ATOM   1266 C  CB  . LYS A 1  164 ? -16.106 -59.252 73.345  1.00 54.36  ? 163 LYS A CB  1 
ATOM   1267 N  N   . LEU A 1  165 ? -15.096 -56.995 70.714  1.00 54.41  ? 164 LEU A N   1 
ATOM   1268 C  CA  . LEU A 1  165 ? -14.939 -55.576 70.381  1.00 52.54  ? 164 LEU A CA  1 
ATOM   1269 C  C   . LEU A 1  165 ? -16.161 -54.775 70.780  1.00 51.99  ? 164 LEU A C   1 
ATOM   1270 O  O   . LEU A 1  165 ? -17.247 -55.322 70.975  1.00 52.56  ? 164 LEU A O   1 
ATOM   1271 C  CB  . LEU A 1  165 ? -14.620 -55.370 68.893  1.00 51.70  ? 164 LEU A CB  1 
ATOM   1272 C  CG  . LEU A 1  165 ? -15.448 -56.026 67.776  1.00 51.64  ? 164 LEU A CG  1 
ATOM   1273 C  CD1 . LEU A 1  165 ? -16.829 -55.392 67.652  1.00 44.89  ? 164 LEU A CD1 1 
ATOM   1274 C  CD2 . LEU A 1  165 ? -14.706 -55.926 66.445  1.00 44.86  ? 164 LEU A CD2 1 
ATOM   1275 N  N   . SER A 1  166 ? -15.964 -53.475 70.941  1.00 51.11  ? 165 SER A N   1 
ATOM   1276 C  CA  . SER A 1  166 ? -17.064 -52.572 71.202  1.00 50.54  ? 165 SER A CA  1 
ATOM   1277 C  C   . SER A 1  166 ? -16.704 -51.205 70.629  1.00 51.90  ? 165 SER A C   1 
ATOM   1278 O  O   . SER A 1  166 ? -16.086 -50.385 71.316  1.00 53.35  ? 165 SER A O   1 
ATOM   1279 C  CB  . SER A 1  166 ? -17.377 -52.503 72.696  1.00 50.18  ? 165 SER A CB  1 
ATOM   1280 O  OG  . SER A 1  166 ? -18.614 -51.849 72.933  1.00 44.56  ? 165 SER A OG  1 
ATOM   1281 N  N   . LYS A 1  167 ? -17.082 -50.985 69.358  1.00 50.98  ? 166 LYS A N   1 
ATOM   1282 C  CA  . LYS A 1  167 ? -16.792 -49.741 68.637  1.00 49.57  ? 166 LYS A CA  1 
ATOM   1283 C  C   . LYS A 1  167 ? -18.065 -48.919 68.498  1.00 49.31  ? 166 LYS A C   1 
ATOM   1284 O  O   . LYS A 1  167 ? -19.102 -49.435 68.068  1.00 51.06  ? 166 LYS A O   1 
ATOM   1285 C  CB  . LYS A 1  167 ? -16.208 -50.036 67.256  1.00 48.08  ? 166 LYS A CB  1 
ATOM   1286 N  N   . SER A 1  168 ? -17.975 -47.638 68.842  1.00 47.16  ? 167 SER A N   1 
ATOM   1287 C  CA  . SER A 1  168 ? -19.137 -46.776 68.934  1.00 46.83  ? 167 SER A CA  1 
ATOM   1288 C  C   . SER A 1  168 ? -18.893 -45.451 68.238  1.00 46.72  ? 167 SER A C   1 
ATOM   1289 O  O   . SER A 1  168 ? -17.857 -44.821 68.441  1.00 47.37  ? 167 SER A O   1 
ATOM   1290 C  CB  . SER A 1  168 ? -19.478 -46.537 70.404  1.00 47.40  ? 167 SER A CB  1 
ATOM   1291 O  OG  . SER A 1  168 ? -20.054 -47.705 70.966  1.00 46.08  ? 167 SER A OG  1 
ATOM   1292 N  N   . TYR A 1  169 ? -19.847 -45.025 67.417  1.00 45.85  ? 168 TYR A N   1 
ATOM   1293 C  CA  . TYR A 1  169 ? -19.741 -43.736 66.752  1.00 45.65  ? 168 TYR A CA  1 
ATOM   1294 C  C   . TYR A 1  169 ? -20.902 -42.834 67.129  1.00 46.25  ? 168 TYR A C   1 
ATOM   1295 O  O   . TYR A 1  169 ? -22.053 -43.292 67.196  1.00 48.13  ? 168 TYR A O   1 
ATOM   1296 C  CB  . TYR A 1  169 ? -19.694 -43.907 65.232  1.00 45.19  ? 168 TYR A CB  1 
ATOM   1297 C  CG  . TYR A 1  169 ? -20.014 -42.624 64.490  1.00 44.34  ? 168 TYR A CG  1 
ATOM   1298 C  CD1 . TYR A 1  169 ? -19.083 -41.578 64.419  1.00 39.97  ? 168 TYR A CD1 1 
ATOM   1299 C  CD2 . TYR A 1  169 ? -21.265 -42.437 63.891  1.00 31.39  ? 168 TYR A CD2 1 
ATOM   1300 C  CE1 . TYR A 1  169 ? -19.379 -40.394 63.734  1.00 43.10  ? 168 TYR A CE1 1 
ATOM   1301 C  CE2 . TYR A 1  169 ? -21.562 -41.266 63.221  1.00 37.53  ? 168 TYR A CE2 1 
ATOM   1302 C  CZ  . TYR A 1  169 ? -20.628 -40.252 63.133  1.00 37.93  ? 168 TYR A CZ  1 
ATOM   1303 O  OH  . TYR A 1  169 ? -20.961 -39.087 62.464  1.00 44.47  ? 168 TYR A OH  1 
ATOM   1304 N  N   . VAL A 1  170 ? -20.584 -41.553 67.337  1.00 46.22  ? 169 VAL A N   1 
ATOM   1305 C  CA  . VAL A 1  170 ? -21.554 -40.521 67.702  1.00 46.20  ? 169 VAL A CA  1 
ATOM   1306 C  C   . VAL A 1  170 ? -21.796 -39.598 66.517  1.00 46.74  ? 169 VAL A C   1 
ATOM   1307 O  O   . VAL A 1  170 ? -20.853 -39.114 65.889  1.00 45.11  ? 169 VAL A O   1 
ATOM   1308 C  CB  . VAL A 1  170 ? -21.055 -39.656 68.873  1.00 45.92  ? 169 VAL A CB  1 
ATOM   1309 C  CG1 . VAL A 1  170 ? -22.201 -38.803 69.415  1.00 45.93  ? 169 VAL A CG1 1 
ATOM   1310 C  CG2 . VAL A 1  170 ? -20.449 -40.529 69.979  1.00 47.40  ? 169 VAL A CG2 1 
ATOM   1311 N  N   . ASN A 1  171 ? -23.059 -39.340 66.212  1.00 47.51  ? 170 ASN A N   1 
ATOM   1312 C  CA  . ASN A 1  171 ? -23.372 -38.550 65.043  1.00 48.81  ? 170 ASN A CA  1 
ATOM   1313 C  C   . ASN A 1  171 ? -23.268 -37.042 65.287  1.00 47.61  ? 170 ASN A C   1 
ATOM   1314 O  O   . ASN A 1  171 ? -24.240 -36.386 65.653  1.00 45.92  ? 170 ASN A O   1 
ATOM   1315 C  CB  . ASN A 1  171 ? -24.748 -38.936 64.500  1.00 49.74  ? 170 ASN A CB  1 
ATOM   1316 C  CG  . ASN A 1  171 ? -25.106 -38.182 63.231  1.00 51.55  ? 170 ASN A CG  1 
ATOM   1317 O  OD1 . ASN A 1  171 ? -24.440 -37.208 62.859  1.00 44.44  ? 170 ASN A OD1 1 
ATOM   1318 N  ND2 . ASN A 1  171 ? -26.170 -38.625 62.559  1.00 57.15  ? 170 ASN A ND2 1 
ATOM   1319 N  N   . ASN A 1  172 ? -22.082 -36.494 65.045  1.00 48.61  ? 171 ASN A N   1 
ATOM   1320 C  CA  . ASN A 1  172 ? -21.890 -35.040 65.066  1.00 49.85  ? 171 ASN A CA  1 
ATOM   1321 C  C   . ASN A 1  172 ? -21.718 -34.445 63.674  1.00 49.70  ? 171 ASN A C   1 
ATOM   1322 O  O   . ASN A 1  172 ? -20.901 -33.536 63.467  1.00 51.33  ? 171 ASN A O   1 
ATOM   1323 C  CB  . ASN A 1  172 ? -20.707 -34.670 65.960  1.00 49.78  ? 171 ASN A CB  1 
ATOM   1324 C  CG  . ASN A 1  172 ? -21.017 -34.866 67.414  1.00 52.43  ? 171 ASN A CG  1 
ATOM   1325 O  OD1 . ASN A 1  172 ? -22.153 -34.671 67.851  1.00 55.81  ? 171 ASN A OD1 1 
ATOM   1326 N  ND2 . ASN A 1  172 ? -20.012 -35.251 68.181  1.00 61.37  ? 171 ASN A ND2 1 
ATOM   1327 N  N   . LYS A 1  173 ? -22.513 -34.951 62.730  1.00 47.68  ? 172 LYS A N   1 
ATOM   1328 C  CA  . LYS A 1  173 ? -22.544 -34.435 61.366  1.00 44.21  ? 172 LYS A CA  1 
ATOM   1329 C  C   . LYS A 1  173 ? -23.717 -33.458 61.163  1.00 42.09  ? 172 LYS A C   1 
ATOM   1330 O  O   . LYS A 1  173 ? -23.760 -32.731 60.166  1.00 42.10  ? 172 LYS A O   1 
ATOM   1331 C  CB  . LYS A 1  173 ? -22.622 -35.607 60.371  1.00 44.94  ? 172 LYS A CB  1 
ATOM   1332 C  CG  . LYS A 1  173 ? -21.379 -36.512 60.338  1.00 44.93  ? 172 LYS A CG  1 
ATOM   1333 C  CD  . LYS A 1  173 ? -20.152 -35.775 59.759  1.00 44.35  ? 172 LYS A CD  1 
ATOM   1334 C  CE  . LYS A 1  173 ? -18.945 -36.689 59.691  1.00 44.21  ? 172 LYS A CE  1 
ATOM   1335 N  NZ  . LYS A 1  173 ? -17.678 -35.980 59.996  1.00 52.54  ? 172 LYS A NZ  1 
ATOM   1336 N  N   . GLY A 1  174 ? -24.661 -33.427 62.106  1.00 40.63  ? 173 GLY A N   1 
ATOM   1337 C  CA  . GLY A 1  174 ? -25.808 -32.518 62.011  1.00 38.81  ? 173 GLY A CA  1 
ATOM   1338 C  C   . GLY A 1  174 ? -26.860 -32.975 61.011  1.00 38.66  ? 173 GLY A C   1 
ATOM   1339 O  O   . GLY A 1  174 ? -27.632 -32.169 60.496  1.00 37.85  ? 173 GLY A O   1 
ATOM   1340 N  N   . LYS A 1  175 ? -26.904 -34.279 60.748  1.00 38.80  ? 174 LYS A N   1 
ATOM   1341 C  CA  . LYS A 1  175 ? -27.871 -34.857 59.813  1.00 37.69  ? 174 LYS A CA  1 
ATOM   1342 C  C   . LYS A 1  175 ? -27.822 -36.364 59.939  1.00 38.26  ? 174 LYS A C   1 
ATOM   1343 O  O   . LYS A 1  175 ? -26.947 -36.911 60.619  1.00 37.60  ? 174 LYS A O   1 
ATOM   1344 C  CB  . LYS A 1  175 ? -27.570 -34.447 58.366  1.00 37.09  ? 174 LYS A CB  1 
ATOM   1345 C  CG  . LYS A 1  175 ? -26.226 -34.946 57.832  1.00 37.19  ? 174 LYS A CG  1 
ATOM   1346 C  CD  . LYS A 1  175 ? -25.840 -34.263 56.518  1.00 40.87  ? 174 LYS A CD  1 
ATOM   1347 C  CE  . LYS A 1  175 ? -24.868 -33.115 56.735  1.00 40.92  ? 174 LYS A CE  1 
ATOM   1348 N  NZ  . LYS A 1  175 ? -24.769 -32.179 55.573  1.00 33.23  ? 174 LYS A NZ  1 
ATOM   1349 N  N   . GLU A 1  176 ? -28.764 -37.041 59.278  1.00 38.16  ? 175 GLU A N   1 
ATOM   1350 C  CA  . GLU A 1  176 ? -28.808 -38.498 59.307  1.00 35.45  ? 175 GLU A CA  1 
ATOM   1351 C  C   . GLU A 1  176 ? -27.520 -39.047 58.723  1.00 34.10  ? 175 GLU A C   1 
ATOM   1352 O  O   . GLU A 1  176 ? -26.936 -38.468 57.803  1.00 34.01  ? 175 GLU A O   1 
ATOM   1353 C  CB  . GLU A 1  176 ? -29.984 -39.036 58.492  1.00 34.69  ? 175 GLU A CB  1 
ATOM   1354 C  CG  . GLU A 1  176 ? -31.323 -38.657 59.015  1.00 41.49  ? 175 GLU A CG  1 
ATOM   1355 C  CD  . GLU A 1  176 ? -32.428 -38.949 58.019  1.00 46.96  ? 175 GLU A CD  1 
ATOM   1356 O  OE1 . GLU A 1  176 ? -32.423 -38.355 56.912  1.00 46.37  ? 175 GLU A OE1 1 
ATOM   1357 O  OE2 . GLU A 1  176 ? -33.294 -39.776 58.357  1.00 52.81  ? 175 GLU A OE2 1 
ATOM   1358 N  N   . VAL A 1  177 ? -27.076 -40.164 59.275  1.00 33.09  ? 176 VAL A N   1 
ATOM   1359 C  CA  . VAL A 1  177 ? -25.934 -40.864 58.756  1.00 31.39  ? 176 VAL A CA  1 
ATOM   1360 C  C   . VAL A 1  177 ? -26.416 -42.237 58.440  1.00 30.97  ? 176 VAL A C   1 
ATOM   1361 O  O   . VAL A 1  177 ? -27.049 -42.875 59.276  1.00 33.23  ? 176 VAL A O   1 
ATOM   1362 C  CB  . VAL A 1  177 ? -24.807 -40.954 59.796  1.00 34.40  ? 176 VAL A CB  1 
ATOM   1363 C  CG1 . VAL A 1  177 ? -23.748 -42.019 59.381  1.00 28.51  ? 176 VAL A CG1 1 
ATOM   1364 C  CG2 . VAL A 1  177 ? -24.176 -39.553 60.025  1.00 34.79  ? 176 VAL A CG2 1 
ATOM   1365 N  N   . LEU A 1  178 ? -26.149 -42.674 57.217  1.00 31.63  ? 177 LEU A N   1 
ATOM   1366 C  CA  . LEU A 1  178 ? -26.516 -44.001 56.772  1.00 30.61  ? 177 LEU A CA  1 
ATOM   1367 C  C   . LEU A 1  178 ? -25.315 -44.874 57.085  1.00 31.30  ? 177 LEU A C   1 
ATOM   1368 O  O   . LEU A 1  178 ? -24.208 -44.602 56.645  1.00 31.84  ? 177 LEU A O   1 
ATOM   1369 C  CB  . LEU A 1  178 ? -26.813 -43.994 55.280  1.00 30.13  ? 177 LEU A CB  1 
ATOM   1370 C  CG  . LEU A 1  178 ? -26.983 -45.338 54.597  1.00 25.98  ? 177 LEU A CG  1 
ATOM   1371 C  CD1 . LEU A 1  178 ? -28.228 -46.005 55.070  1.00 27.25  ? 177 LEU A CD1 1 
ATOM   1372 C  CD2 . LEU A 1  178 ? -27.010 -45.138 53.099  1.00 25.09  ? 177 LEU A CD2 1 
ATOM   1373 N  N   . VAL A 1  179 ? -25.548 -45.908 57.878  1.00 32.07  ? 178 VAL A N   1 
ATOM   1374 C  CA  . VAL A 1  179 ? -24.521 -46.821 58.266  1.00 29.22  ? 178 VAL A CA  1 
ATOM   1375 C  C   . VAL A 1  179 ? -24.855 -48.219 57.780  1.00 29.86  ? 178 VAL A C   1 
ATOM   1376 O  O   . VAL A 1  179 ? -25.927 -48.769 58.106  1.00 29.38  ? 178 VAL A O   1 
ATOM   1377 C  CB  . VAL A 1  179 ? -24.384 -46.884 59.768  1.00 30.43  ? 178 VAL A CB  1 
ATOM   1378 C  CG1 . VAL A 1  179 ? -23.352 -47.975 60.120  1.00 32.95  ? 178 VAL A CG1 1 
ATOM   1379 C  CG2 . VAL A 1  179 ? -23.974 -45.501 60.334  1.00 30.52  ? 178 VAL A CG2 1 
ATOM   1380 N  N   . LEU A 1  180 ? -23.899 -48.788 57.045  1.00 29.00  ? 179 LEU A N   1 
ATOM   1381 C  CA  . LEU A 1  180 ? -23.979 -50.115 56.462  1.00 32.19  ? 179 LEU A CA  1 
ATOM   1382 C  C   . LEU A 1  180 ? -22.954 -51.066 57.088  1.00 33.61  ? 179 LEU A C   1 
ATOM   1383 O  O   . LEU A 1  180 ? -21.800 -50.705 57.279  1.00 31.41  ? 179 LEU A O   1 
ATOM   1384 C  CB  . LEU A 1  180 ? -23.697 -49.999 54.971  1.00 34.10  ? 179 LEU A CB  1 
ATOM   1385 C  CG  . LEU A 1  180 ? -24.596 -49.010 54.207  1.00 38.66  ? 179 LEU A CG  1 
ATOM   1386 C  CD1 . LEU A 1  180 ? -23.809 -48.165 53.276  1.00 37.94  ? 179 LEU A CD1 1 
ATOM   1387 C  CD2 . LEU A 1  180 ? -25.663 -49.723 53.442  1.00 36.69  ? 179 LEU A CD2 1 
ATOM   1388 N  N   . TRP A 1  181 ? -23.388 -52.279 57.410  1.00 35.05  ? 180 TRP A N   1 
ATOM   1389 C  CA  . TRP A 1  181 ? -22.472 -53.319 57.814  1.00 36.31  ? 180 TRP A CA  1 
ATOM   1390 C  C   . TRP A 1  181 ? -22.933 -54.615 57.200  1.00 38.66  ? 180 TRP A C   1 
ATOM   1391 O  O   . TRP A 1  181 ? -23.971 -54.664 56.540  1.00 38.88  ? 180 TRP A O   1 
ATOM   1392 C  CB  . TRP A 1  181 ? -22.428 -53.435 59.342  1.00 35.95  ? 180 TRP A CB  1 
ATOM   1393 C  CG  . TRP A 1  181 ? -23.668 -53.963 59.970  1.00 36.52  ? 180 TRP A CG  1 
ATOM   1394 C  CD1 . TRP A 1  181 ? -23.920 -55.257 60.315  1.00 36.75  ? 180 TRP A CD1 1 
ATOM   1395 C  CD2 . TRP A 1  181 ? -24.825 -53.206 60.373  1.00 30.15  ? 180 TRP A CD2 1 
ATOM   1396 N  NE1 . TRP A 1  181 ? -25.176 -55.360 60.888  1.00 30.82  ? 180 TRP A NE1 1 
ATOM   1397 C  CE2 . TRP A 1  181 ? -25.739 -54.113 60.951  1.00 26.39  ? 180 TRP A CE2 1 
ATOM   1398 C  CE3 . TRP A 1  181 ? -25.177 -51.862 60.289  1.00 31.49  ? 180 TRP A CE3 1 
ATOM   1399 C  CZ2 . TRP A 1  181 ? -27.002 -53.720 61.421  1.00 32.40  ? 180 TRP A CZ2 1 
ATOM   1400 C  CZ3 . TRP A 1  181 ? -26.439 -51.469 60.763  1.00 33.91  ? 180 TRP A CZ3 1 
ATOM   1401 C  CH2 . TRP A 1  181 ? -27.326 -52.398 61.326  1.00 28.61  ? 180 TRP A CH2 1 
ATOM   1402 N  N   . GLY A 1  182 ? -22.154 -55.668 57.401  1.00 38.49  ? 181 GLY A N   1 
ATOM   1403 C  CA  . GLY A 1  182 ? -22.561 -56.998 56.982  1.00 38.84  ? 181 GLY A CA  1 
ATOM   1404 C  C   . GLY A 1  182 ? -22.354 -57.974 58.119  1.00 40.63  ? 181 GLY A C   1 
ATOM   1405 O  O   . GLY A 1  182 ? -21.651 -57.674 59.087  1.00 41.22  ? 181 GLY A O   1 
ATOM   1406 N  N   . VAL A 1  183 ? -22.966 -59.144 58.012  1.00 41.77  ? 182 VAL A N   1 
ATOM   1407 C  CA  . VAL A 1  183 ? -22.679 -60.219 58.940  1.00 41.96  ? 182 VAL A CA  1 
ATOM   1408 C  C   . VAL A 1  183 ? -22.469 -61.479 58.124  1.00 44.61  ? 182 VAL A C   1 
ATOM   1409 O  O   . VAL A 1  183 ? -23.301 -61.838 57.301  1.00 42.91  ? 182 VAL A O   1 
ATOM   1410 C  CB  . VAL A 1  183 ? -23.777 -60.375 59.978  1.00 42.81  ? 182 VAL A CB  1 
ATOM   1411 C  CG1 . VAL A 1  183 ? -23.481 -61.541 60.914  1.00 36.73  ? 182 VAL A CG1 1 
ATOM   1412 C  CG2 . VAL A 1  183 ? -23.939 -59.059 60.760  1.00 43.11  ? 182 VAL A CG2 1 
ATOM   1413 N  N   . HIS A 1  184 ? -21.323 -62.129 58.357  1.00 47.90  ? 183 HIS A N   1 
ATOM   1414 C  CA  . HIS A 1  184 ? -20.849 -63.260 57.545  1.00 47.88  ? 183 HIS A CA  1 
ATOM   1415 C  C   . HIS A 1  184 ? -21.287 -64.599 58.147  1.00 46.99  ? 183 HIS A C   1 
ATOM   1416 O  O   . HIS A 1  184 ? -21.148 -64.825 59.350  1.00 44.61  ? 183 HIS A O   1 
ATOM   1417 C  CB  . HIS A 1  184 ? -19.318 -63.164 57.400  1.00 48.15  ? 183 HIS A CB  1 
ATOM   1418 C  CG  . HIS A 1  184 ? -18.694 -64.302 56.657  1.00 53.80  ? 183 HIS A CG  1 
ATOM   1419 N  ND1 . HIS A 1  184 ? -17.412 -64.741 56.917  1.00 58.17  ? 183 HIS A ND1 1 
ATOM   1420 C  CD2 . HIS A 1  184 ? -19.172 -65.098 55.670  1.00 58.95  ? 183 HIS A CD2 1 
ATOM   1421 C  CE1 . HIS A 1  184 ? -17.128 -65.753 56.118  1.00 59.72  ? 183 HIS A CE1 1 
ATOM   1422 N  NE2 . HIS A 1  184 ? -18.179 -65.992 55.353  1.00 61.91  ? 183 HIS A NE2 1 
ATOM   1423 N  N   . HIS A 1  185 ? -21.840 -65.464 57.300  1.00 47.28  ? 184 HIS A N   1 
ATOM   1424 C  CA  . HIS A 1  185 ? -22.335 -66.772 57.708  1.00 47.67  ? 184 HIS A CA  1 
ATOM   1425 C  C   . HIS A 1  185 ? -21.541 -67.895 56.994  1.00 48.60  ? 184 HIS A C   1 
ATOM   1426 O  O   . HIS A 1  185 ? -22.031 -68.473 56.009  1.00 48.14  ? 184 HIS A O   1 
ATOM   1427 C  CB  . HIS A 1  185 ? -23.833 -66.894 57.376  1.00 47.23  ? 184 HIS A CB  1 
ATOM   1428 C  CG  . HIS A 1  185 ? -24.700 -65.860 58.030  1.00 51.11  ? 184 HIS A CG  1 
ATOM   1429 N  ND1 . HIS A 1  185 ? -24.566 -65.495 59.351  1.00 57.57  ? 184 HIS A ND1 1 
ATOM   1430 C  CD2 . HIS A 1  185 ? -25.738 -65.136 57.548  1.00 54.52  ? 184 HIS A CD2 1 
ATOM   1431 C  CE1 . HIS A 1  185 ? -25.466 -64.575 59.649  1.00 55.79  ? 184 HIS A CE1 1 
ATOM   1432 N  NE2 . HIS A 1  185 ? -26.194 -64.342 58.573  1.00 53.62  ? 184 HIS A NE2 1 
ATOM   1433 N  N   . PRO A 1  186 ? -20.322 -68.231 57.496  1.00 49.05  ? 185 PRO A N   1 
ATOM   1434 C  CA  . PRO A 1  186 ? -19.473 -69.200 56.771  1.00 48.57  ? 185 PRO A CA  1 
ATOM   1435 C  C   . PRO A 1  186 ? -20.127 -70.567 56.569  1.00 48.92  ? 185 PRO A C   1 
ATOM   1436 O  O   . PRO A 1  186 ? -21.115 -70.880 57.245  1.00 48.64  ? 185 PRO A O   1 
ATOM   1437 C  CB  . PRO A 1  186 ? -18.238 -69.340 57.670  1.00 48.05  ? 185 PRO A CB  1 
ATOM   1438 C  CG  . PRO A 1  186 ? -18.707 -68.958 59.018  1.00 49.83  ? 185 PRO A CG  1 
ATOM   1439 C  CD  . PRO A 1  186 ? -19.762 -67.904 58.821  1.00 47.87  ? 185 PRO A CD  1 
ATOM   1440 N  N   . PRO A 1  187 ? -19.589 -71.380 55.633  1.00 49.19  ? 186 PRO A N   1 
ATOM   1441 C  CA  . PRO A 1  187 ? -20.088 -72.749 55.479  1.00 49.46  ? 186 PRO A CA  1 
ATOM   1442 C  C   . PRO A 1  187 ? -19.364 -73.695 56.466  1.00 50.53  ? 186 PRO A C   1 
ATOM   1443 O  O   . PRO A 1  187 ? -18.535 -73.225 57.257  1.00 51.36  ? 186 PRO A O   1 
ATOM   1444 C  CB  . PRO A 1  187 ? -19.756 -73.071 54.016  1.00 48.97  ? 186 PRO A CB  1 
ATOM   1445 C  CG  . PRO A 1  187 ? -18.547 -72.187 53.684  1.00 47.99  ? 186 PRO A CG  1 
ATOM   1446 C  CD  . PRO A 1  187 ? -18.422 -71.127 54.764  1.00 48.30  ? 186 PRO A CD  1 
ATOM   1447 N  N   . THR A 1  188 ? -19.672 -74.995 56.441  1.00 51.32  ? 187 THR A N   1 
ATOM   1448 C  CA  . THR A 1  188 ? -18.948 -75.981 57.280  1.00 51.48  ? 187 THR A CA  1 
ATOM   1449 C  C   . THR A 1  188 ? -17.630 -75.390 57.804  1.00 50.91  ? 187 THR A C   1 
ATOM   1450 O  O   . THR A 1  188 ? -16.606 -75.435 57.112  1.00 50.01  ? 187 THR A O   1 
ATOM   1451 C  CB  . THR A 1  188 ? -18.630 -77.279 56.494  1.00 51.12  ? 187 THR A CB  1 
ATOM   1452 N  N   . GLY A 1  189 ? -17.675 -74.818 59.010  1.00 50.58  ? 188 GLY A N   1 
ATOM   1453 C  CA  . GLY A 1  189 ? -16.553 -74.042 59.558  1.00 49.63  ? 188 GLY A CA  1 
ATOM   1454 C  C   . GLY A 1  189 ? -16.169 -74.441 60.978  1.00 47.30  ? 188 GLY A C   1 
ATOM   1455 O  O   . GLY A 1  189 ? -17.039 -74.443 61.844  1.00 46.31  ? 188 GLY A O   1 
ATOM   1456 N  N   . THR A 1  190 ? -14.903 -74.765 61.273  1.00 45.34  ? 189 THR A N   1 
ATOM   1457 C  CA  . THR A 1  190 ? -13.710 -74.758 60.374  1.00 44.80  ? 189 THR A CA  1 
ATOM   1458 C  C   . THR A 1  190 ? -13.282 -73.333 59.953  1.00 44.04  ? 189 THR A C   1 
ATOM   1459 O  O   . THR A 1  190 ? -12.534 -72.664 60.682  1.00 43.12  ? 189 THR A O   1 
ATOM   1460 C  CB  . THR A 1  190 ? -13.795 -75.788 59.164  1.00 45.37  ? 189 THR A CB  1 
ATOM   1461 O  OG1 . THR A 1  190 ? -13.892 -77.130 59.661  1.00 40.51  ? 189 THR A OG1 1 
ATOM   1462 C  CG2 . THR A 1  190 ? -12.557 -75.696 58.253  1.00 43.14  ? 189 THR A CG2 1 
ATOM   1463 N  N   . ASP A 1  191 ? -13.731 -72.885 58.783  1.00 43.66  ? 190 ASP A N   1 
ATOM   1464 C  CA  . ASP A 1  191 ? -13.622 -71.478 58.384  1.00 42.63  ? 190 ASP A CA  1 
ATOM   1465 C  C   . ASP A 1  191 ? -13.934 -70.516 59.532  1.00 39.65  ? 190 ASP A C   1 
ATOM   1466 O  O   . ASP A 1  191 ? -13.209 -69.532 59.737  1.00 40.41  ? 190 ASP A O   1 
ATOM   1467 C  CB  . ASP A 1  191 ? -14.571 -71.185 57.218  1.00 44.31  ? 190 ASP A CB  1 
ATOM   1468 C  CG  . ASP A 1  191 ? -14.057 -71.720 55.894  1.00 49.43  ? 190 ASP A CG  1 
ATOM   1469 O  OD1 . ASP A 1  191 ? -13.795 -70.891 54.992  1.00 55.98  ? 190 ASP A OD1 1 
ATOM   1470 O  OD2 . ASP A 1  191 ? -13.912 -72.960 55.760  1.00 57.92  ? 190 ASP A OD2 1 
ATOM   1471 N  N   . GLN A 1  192 ? -15.020 -70.792 60.260  1.00 35.66  ? 191 GLN A N   1 
ATOM   1472 C  CA  . GLN A 1  192 ? -15.418 -69.962 61.393  1.00 33.67  ? 191 GLN A CA  1 
ATOM   1473 C  C   . GLN A 1  192 ? -14.215 -69.665 62.274  1.00 33.76  ? 191 GLN A C   1 
ATOM   1474 O  O   . GLN A 1  192 ? -13.938 -68.495 62.581  1.00 32.63  ? 191 GLN A O   1 
ATOM   1475 C  CB  . GLN A 1  192 ? -16.523 -70.637 62.216  1.00 32.02  ? 191 GLN A CB  1 
ATOM   1476 C  CG  . GLN A 1  192 ? -17.015 -69.799 63.411  1.00 33.73  ? 191 GLN A CG  1 
ATOM   1477 C  CD  . GLN A 1  192 ? -17.559 -68.418 63.014  1.00 39.69  ? 191 GLN A CD  1 
ATOM   1478 O  OE1 . GLN A 1  192 ? -18.403 -68.313 62.128  1.00 42.26  ? 191 GLN A OE1 1 
ATOM   1479 N  NE2 . GLN A 1  192 ? -17.081 -67.360 63.680  1.00 40.34  ? 191 GLN A NE2 1 
ATOM   1480 N  N   . GLN A 1  193 ? -13.507 -70.737 62.659  1.00 35.32  ? 192 GLN A N   1 
ATOM   1481 C  CA  . GLN A 1  193 ? -12.283 -70.653 63.472  1.00 33.60  ? 192 GLN A CA  1 
ATOM   1482 C  C   . GLN A 1  193 ? -11.170 -69.968 62.680  1.00 33.22  ? 192 GLN A C   1 
ATOM   1483 O  O   . GLN A 1  193 ? -10.576 -68.988 63.140  1.00 31.48  ? 192 GLN A O   1 
ATOM   1484 C  CB  . GLN A 1  193 ? -11.843 -72.045 63.918  1.00 34.22  ? 192 GLN A CB  1 
ATOM   1485 N  N   . SER A 1  194 ? -10.938 -70.454 61.464  1.00 33.70  ? 193 SER A N   1 
ATOM   1486 C  CA  . SER A 1  194 ? -9.898  -69.907 60.584  1.00 35.57  ? 193 SER A CA  1 
ATOM   1487 C  C   . SER A 1  194 ? -9.987  -68.378 60.352  1.00 37.26  ? 193 SER A C   1 
ATOM   1488 O  O   . SER A 1  194 ? -8.976  -67.727 60.070  1.00 37.37  ? 193 SER A O   1 
ATOM   1489 C  CB  . SER A 1  194 ? -9.908  -70.663 59.241  1.00 35.33  ? 193 SER A CB  1 
ATOM   1490 O  OG  . SER A 1  194 ? -8.825  -70.283 58.406  1.00 32.95  ? 193 SER A OG  1 
ATOM   1491 N  N   . LEU A 1  195 ? -11.186 -67.806 60.454  1.00 39.40  ? 194 LEU A N   1 
ATOM   1492 C  CA  . LEU A 1  195 ? -11.354 -66.359 60.285  1.00 40.46  ? 194 LEU A CA  1 
ATOM   1493 C  C   . LEU A 1  195 ? -11.545 -65.638 61.628  1.00 41.43  ? 194 LEU A C   1 
ATOM   1494 O  O   . LEU A 1  195 ? -10.983 -64.554 61.838  1.00 39.45  ? 194 LEU A O   1 
ATOM   1495 C  CB  . LEU A 1  195 ? -12.532 -66.054 59.333  1.00 41.46  ? 194 LEU A CB  1 
ATOM   1496 C  CG  . LEU A 1  195 ? -12.316 -66.339 57.832  1.00 41.07  ? 194 LEU A CG  1 
ATOM   1497 C  CD1 . LEU A 1  195 ? -13.618 -66.739 57.110  1.00 37.38  ? 194 LEU A CD1 1 
ATOM   1498 C  CD2 . LEU A 1  195 ? -11.656 -65.147 57.129  1.00 38.65  ? 194 LEU A CD2 1 
ATOM   1499 N  N   . TYR A 1  196 ? -12.333 -66.233 62.528  1.00 43.08  ? 195 TYR A N   1 
ATOM   1500 C  CA  . TYR A 1  196 ? -12.791 -65.528 63.736  1.00 45.96  ? 195 TYR A CA  1 
ATOM   1501 C  C   . TYR A 1  196 ? -12.248 -66.076 65.062  1.00 47.42  ? 195 TYR A C   1 
ATOM   1502 O  O   . TYR A 1  196 ? -12.471 -65.466 66.115  1.00 47.73  ? 195 TYR A O   1 
ATOM   1503 C  CB  . TYR A 1  196 ? -14.330 -65.488 63.780  1.00 47.18  ? 195 TYR A CB  1 
ATOM   1504 N  N   . GLN A 1  197 ? -11.571 -67.230 65.017  1.00 48.58  ? 196 GLN A N   1 
ATOM   1505 C  CA  . GLN A 1  197 ? -10.877 -67.799 66.184  1.00 48.99  ? 196 GLN A CA  1 
ATOM   1506 C  C   . GLN A 1  197 ? -11.776 -68.218 67.367  1.00 49.80  ? 196 GLN A C   1 
ATOM   1507 O  O   . GLN A 1  197 ? -11.271 -68.720 68.379  1.00 50.81  ? 196 GLN A O   1 
ATOM   1508 C  CB  . GLN A 1  197 ? -9.816  -66.812 66.677  1.00 48.77  ? 196 GLN A CB  1 
ATOM   1509 N  N   . ASN A 1  198 ? -13.089 -68.004 67.225  1.00 50.75  ? 197 ASN A N   1 
ATOM   1510 C  CA  . ASN A 1  198 ? -14.101 -68.287 68.253  1.00 49.91  ? 197 ASN A CA  1 
ATOM   1511 C  C   . ASN A 1  198 ? -15.326 -68.911 67.564  1.00 50.10  ? 197 ASN A C   1 
ATOM   1512 O  O   . ASN A 1  198 ? -15.813 -68.359 66.579  1.00 50.07  ? 197 ASN A O   1 
ATOM   1513 C  CB  . ASN A 1  198 ? -14.523 -66.994 68.973  1.00 49.39  ? 197 ASN A CB  1 
ATOM   1514 C  CG  . ASN A 1  198 ? -13.338 -66.179 69.494  1.00 48.31  ? 197 ASN A CG  1 
ATOM   1515 O  OD1 . ASN A 1  198 ? -12.398 -66.721 70.088  1.00 50.80  ? 197 ASN A OD1 1 
ATOM   1516 N  ND2 . ASN A 1  198 ? -13.394 -64.864 69.293  1.00 35.37  ? 197 ASN A ND2 1 
ATOM   1517 N  N   . ALA A 1  199 ? -15.828 -70.035 68.078  1.00 50.47  ? 198 ALA A N   1 
ATOM   1518 C  CA  . ALA A 1  199 ? -16.875 -70.820 67.389  1.00 50.71  ? 198 ALA A CA  1 
ATOM   1519 C  C   . ALA A 1  199 ? -18.319 -70.487 67.806  1.00 51.09  ? 198 ALA A C   1 
ATOM   1520 O  O   . ALA A 1  199 ? -19.234 -70.650 67.005  1.00 49.93  ? 198 ALA A O   1 
ATOM   1521 C  CB  . ALA A 1  199 ? -16.610 -72.321 67.557  1.00 50.33  ? 198 ALA A CB  1 
ATOM   1522 N  N   . ASP A 1  200 ? -18.523 -70.052 69.051  1.00 51.59  ? 199 ASP A N   1 
ATOM   1523 C  CA  . ASP A 1  200 ? -19.850 -69.645 69.530  1.00 51.98  ? 199 ASP A CA  1 
ATOM   1524 C  C   . ASP A 1  200 ? -19.876 -68.123 69.648  1.00 51.20  ? 199 ASP A C   1 
ATOM   1525 O  O   . ASP A 1  200 ? -19.899 -67.570 70.753  1.00 51.46  ? 199 ASP A O   1 
ATOM   1526 C  CB  . ASP A 1  200 ? -20.189 -70.320 70.873  1.00 52.32  ? 199 ASP A CB  1 
ATOM   1527 C  CG  . ASP A 1  200 ? -20.461 -71.832 70.735  1.00 57.05  ? 199 ASP A CG  1 
ATOM   1528 O  OD1 . ASP A 1  200 ? -20.467 -72.540 71.774  1.00 56.38  ? 199 ASP A OD1 1 
ATOM   1529 O  OD2 . ASP A 1  200 ? -20.670 -72.315 69.593  1.00 60.91  ? 199 ASP A OD2 1 
ATOM   1530 N  N   . ALA A 1  201 ? -19.872 -67.464 68.485  1.00 50.05  ? 200 ALA A N   1 
ATOM   1531 C  CA  . ALA A 1  201 ? -19.751 -66.001 68.376  1.00 48.23  ? 200 ALA A CA  1 
ATOM   1532 C  C   . ALA A 1  201 ? -21.090 -65.299 68.133  1.00 45.50  ? 200 ALA A C   1 
ATOM   1533 O  O   . ALA A 1  201 ? -22.123 -65.946 67.949  1.00 44.82  ? 200 ALA A O   1 
ATOM   1534 C  CB  . ALA A 1  201 ? -18.765 -65.634 67.256  1.00 47.32  ? 200 ALA A CB  1 
ATOM   1535 N  N   . TYR A 1  202 ? -21.048 -63.968 68.139  1.00 43.31  ? 201 TYR A N   1 
ATOM   1536 C  CA  . TYR A 1  202 ? -22.228 -63.137 67.878  1.00 42.48  ? 201 TYR A CA  1 
ATOM   1537 C  C   . TYR A 1  202 ? -21.856 -61.737 67.383  1.00 41.74  ? 201 TYR A C   1 
ATOM   1538 O  O   . TYR A 1  202 ? -20.724 -61.271 67.569  1.00 41.40  ? 201 TYR A O   1 
ATOM   1539 C  CB  . TYR A 1  202 ? -23.105 -63.017 69.133  1.00 42.30  ? 201 TYR A CB  1 
ATOM   1540 C  CG  . TYR A 1  202 ? -22.530 -62.137 70.227  1.00 44.36  ? 201 TYR A CG  1 
ATOM   1541 C  CD1 . TYR A 1  202 ? -22.917 -60.805 70.355  1.00 45.14  ? 201 TYR A CD1 1 
ATOM   1542 C  CD2 . TYR A 1  202 ? -21.597 -62.642 71.139  1.00 45.78  ? 201 TYR A CD2 1 
ATOM   1543 C  CE1 . TYR A 1  202 ? -22.394 -59.991 71.369  1.00 49.03  ? 201 TYR A CE1 1 
ATOM   1544 C  CE2 . TYR A 1  202 ? -21.065 -61.843 72.153  1.00 48.48  ? 201 TYR A CE2 1 
ATOM   1545 C  CZ  . TYR A 1  202 ? -21.465 -60.519 72.263  1.00 51.65  ? 201 TYR A CZ  1 
ATOM   1546 O  OH  . TYR A 1  202 ? -20.940 -59.729 73.264  1.00 54.44  ? 201 TYR A OH  1 
ATOM   1547 N  N   . VAL A 1  203 ? -22.813 -61.082 66.728  1.00 40.32  ? 202 VAL A N   1 
ATOM   1548 C  CA  . VAL A 1  203 ? -22.726 -59.644 66.475  1.00 39.05  ? 202 VAL A CA  1 
ATOM   1549 C  C   . VAL A 1  203 ? -23.950 -58.984 67.085  1.00 38.44  ? 202 VAL A C   1 
ATOM   1550 O  O   . VAL A 1  203 ? -25.040 -59.559 67.081  1.00 39.68  ? 202 VAL A O   1 
ATOM   1551 C  CB  . VAL A 1  203 ? -22.650 -59.289 64.972  1.00 38.26  ? 202 VAL A CB  1 
ATOM   1552 C  CG1 . VAL A 1  203 ? -22.554 -57.786 64.801  1.00 35.65  ? 202 VAL A CG1 1 
ATOM   1553 C  CG2 . VAL A 1  203 ? -21.457 -59.961 64.326  1.00 34.35  ? 202 VAL A CG2 1 
ATOM   1554 N  N   . SER A 1  204 ? -23.754 -57.787 67.620  1.00 35.83  ? 203 SER A N   1 
ATOM   1555 C  CA  . SER A 1  204 ? -24.843 -57.001 68.161  1.00 35.65  ? 203 SER A CA  1 
ATOM   1556 C  C   . SER A 1  204 ? -24.623 -55.553 67.742  1.00 35.12  ? 203 SER A C   1 
ATOM   1557 O  O   . SER A 1  204 ? -23.504 -55.030 67.823  1.00 34.65  ? 203 SER A O   1 
ATOM   1558 C  CB  . SER A 1  204 ? -24.894 -57.131 69.683  1.00 36.88  ? 203 SER A CB  1 
ATOM   1559 O  OG  . SER A 1  204 ? -25.738 -56.149 70.265  1.00 40.51  ? 203 SER A OG  1 
ATOM   1560 N  N   . VAL A 1  205 ? -25.694 -54.925 67.268  1.00 33.76  ? 204 VAL A N   1 
ATOM   1561 C  CA  . VAL A 1  205 ? -25.667 -53.536 66.832  1.00 32.39  ? 204 VAL A CA  1 
ATOM   1562 C  C   . VAL A 1  205 ? -26.797 -52.823 67.552  1.00 33.90  ? 204 VAL A C   1 
ATOM   1563 O  O   . VAL A 1  205 ? -27.940 -53.284 67.525  1.00 34.79  ? 204 VAL A O   1 
ATOM   1564 C  CB  . VAL A 1  205 ? -25.856 -53.436 65.307  1.00 31.40  ? 204 VAL A CB  1 
ATOM   1565 C  CG1 . VAL A 1  205 ? -25.839 -51.985 64.849  1.00 27.02  ? 204 VAL A CG1 1 
ATOM   1566 C  CG2 . VAL A 1  205 ? -24.785 -54.241 64.608  1.00 22.22  ? 204 VAL A CG2 1 
ATOM   1567 N  N   . GLY A 1  206 ? -26.479 -51.711 68.203  1.00 34.44  ? 205 GLY A N   1 
ATOM   1568 C  CA  . GLY A 1  206 ? -27.450 -51.012 69.028  1.00 34.66  ? 205 GLY A CA  1 
ATOM   1569 C  C   . GLY A 1  206 ? -27.446 -49.520 68.815  1.00 35.54  ? 205 GLY A C   1 
ATOM   1570 O  O   . GLY A 1  206 ? -26.409 -48.920 68.595  1.00 35.08  ? 205 GLY A O   1 
ATOM   1571 N  N   . SER A 1  207 ? -28.641 -48.948 68.838  1.00 38.40  ? 206 SER A N   1 
ATOM   1572 C  CA  . SER A 1  207 ? -28.860 -47.523 69.036  1.00 39.45  ? 206 SER A CA  1 
ATOM   1573 C  C   . SER A 1  207 ? -30.301 -47.400 69.553  1.00 42.69  ? 206 SER A C   1 
ATOM   1574 O  O   . SER A 1  207 ? -30.954 -48.417 69.825  1.00 44.16  ? 206 SER A O   1 
ATOM   1575 C  CB  . SER A 1  207 ? -28.642 -46.743 67.739  1.00 39.25  ? 206 SER A CB  1 
ATOM   1576 O  OG  . SER A 1  207 ? -29.702 -46.949 66.820  1.00 37.24  ? 206 SER A OG  1 
ATOM   1577 N  N   . SER A 1  208 ? -30.799 -46.175 69.702  1.00 44.86  ? 207 SER A N   1 
ATOM   1578 C  CA  . SER A 1  208 ? -32.169 -45.955 70.188  1.00 46.45  ? 207 SER A CA  1 
ATOM   1579 C  C   . SER A 1  208 ? -33.220 -46.401 69.164  1.00 48.67  ? 207 SER A C   1 
ATOM   1580 O  O   . SER A 1  208 ? -34.307 -46.857 69.520  1.00 50.70  ? 207 SER A O   1 
ATOM   1581 C  CB  . SER A 1  208 ? -32.381 -44.473 70.494  1.00 46.75  ? 207 SER A CB  1 
ATOM   1582 O  OG  . SER A 1  208 ? -31.166 -43.865 70.893  1.00 44.84  ? 207 SER A OG  1 
ATOM   1583 N  N   . LYS A 1  209 ? -32.879 -46.256 67.889  1.00 48.93  ? 208 LYS A N   1 
ATOM   1584 C  CA  . LYS A 1  209 ? -33.814 -46.458 66.792  1.00 49.10  ? 208 LYS A CA  1 
ATOM   1585 C  C   . LYS A 1  209 ? -33.815 -47.923 66.353  1.00 48.83  ? 208 LYS A C   1 
ATOM   1586 O  O   . LYS A 1  209 ? -34.746 -48.372 65.666  1.00 49.48  ? 208 LYS A O   1 
ATOM   1587 C  CB  . LYS A 1  209 ? -33.406 -45.540 65.623  1.00 49.09  ? 208 LYS A CB  1 
ATOM   1588 C  CG  . LYS A 1  209 ? -34.232 -45.667 64.352  1.00 51.55  ? 208 LYS A CG  1 
ATOM   1589 C  CD  . LYS A 1  209 ? -33.592 -44.936 63.154  1.00 54.17  ? 208 LYS A CD  1 
ATOM   1590 C  CE  . LYS A 1  209 ? -33.867 -43.432 63.179  1.00 54.71  ? 208 LYS A CE  1 
ATOM   1591 N  NZ  . LYS A 1  209 ? -35.322 -43.118 63.109  1.00 50.85  ? 208 LYS A NZ  1 
ATOM   1592 N  N   . TYR A 1  210 ? -32.774 -48.656 66.760  1.00 46.47  ? 209 TYR A N   1 
ATOM   1593 C  CA  . TYR A 1  210 ? -32.447 -49.955 66.179  1.00 43.76  ? 209 TYR A CA  1 
ATOM   1594 C  C   . TYR A 1  210 ? -31.675 -50.800 67.184  1.00 42.83  ? 209 TYR A C   1 
ATOM   1595 O  O   . TYR A 1  210 ? -30.776 -50.297 67.848  1.00 42.43  ? 209 TYR A O   1 
ATOM   1596 C  CB  . TYR A 1  210 ? -31.590 -49.747 64.927  1.00 43.00  ? 209 TYR A CB  1 
ATOM   1597 C  CG  . TYR A 1  210 ? -31.219 -51.013 64.187  1.00 36.62  ? 209 TYR A CG  1 
ATOM   1598 C  CD1 . TYR A 1  210 ? -31.950 -51.428 63.084  1.00 39.36  ? 209 TYR A CD1 1 
ATOM   1599 C  CD2 . TYR A 1  210 ? -30.139 -51.787 64.580  1.00 33.57  ? 209 TYR A CD2 1 
ATOM   1600 C  CE1 . TYR A 1  210 ? -31.629 -52.585 62.407  1.00 34.15  ? 209 TYR A CE1 1 
ATOM   1601 C  CE2 . TYR A 1  210 ? -29.795 -52.937 63.894  1.00 31.29  ? 209 TYR A CE2 1 
ATOM   1602 C  CZ  . TYR A 1  210 ? -30.552 -53.328 62.807  1.00 27.92  ? 209 TYR A CZ  1 
ATOM   1603 O  OH  . TYR A 1  210 ? -30.239 -54.461 62.119  1.00 18.07  ? 209 TYR A OH  1 
ATOM   1604 N  N   . ASN A 1  211 ? -32.024 -52.080 67.280  1.00 42.73  ? 210 ASN A N   1 
ATOM   1605 C  CA  . ASN A 1  211 ? -31.365 -53.012 68.197  1.00 42.60  ? 210 ASN A CA  1 
ATOM   1606 C  C   . ASN A 1  211 ? -31.596 -54.445 67.737  1.00 42.37  ? 210 ASN A C   1 
ATOM   1607 O  O   . ASN A 1  211 ? -32.735 -54.897 67.655  1.00 40.50  ? 210 ASN A O   1 
ATOM   1608 C  CB  . ASN A 1  211 ? -31.869 -52.829 69.639  1.00 42.20  ? 210 ASN A CB  1 
ATOM   1609 C  CG  . ASN A 1  211 ? -31.115 -53.716 70.655  1.00 46.27  ? 210 ASN A CG  1 
ATOM   1610 O  OD1 . ASN A 1  211 ? -30.113 -54.362 70.328  1.00 42.76  ? 210 ASN A OD1 1 
ATOM   1611 N  ND2 . ASN A 1  211 ? -31.602 -53.735 71.897  1.00 49.75  ? 210 ASN A ND2 1 
ATOM   1612 N  N   . ARG A 1  212 ? -30.507 -55.151 67.444  1.00 43.46  ? 211 ARG A N   1 
ATOM   1613 C  CA  . ARG A 1  212 ? -30.587 -56.504 66.897  1.00 45.22  ? 211 ARG A CA  1 
ATOM   1614 C  C   . ARG A 1  212 ? -29.297 -57.259 67.171  1.00 45.02  ? 211 ARG A C   1 
ATOM   1615 O  O   . ARG A 1  212 ? -28.218 -56.671 67.101  1.00 44.76  ? 211 ARG A O   1 
ATOM   1616 C  CB  . ARG A 1  212 ? -30.861 -56.464 65.385  1.00 45.52  ? 211 ARG A CB  1 
ATOM   1617 C  CG  . ARG A 1  212 ? -31.317 -57.799 64.791  1.00 48.69  ? 211 ARG A CG  1 
ATOM   1618 C  CD  . ARG A 1  212 ? -32.144 -57.591 63.500  1.00 55.63  ? 211 ARG A CD  1 
ATOM   1619 N  NE  . ARG A 1  212 ? -32.297 -58.830 62.728  1.00 58.42  ? 211 ARG A NE  1 
ATOM   1620 C  CZ  . ARG A 1  212 ? -32.852 -58.920 61.515  1.00 60.53  ? 211 ARG A CZ  1 
ATOM   1621 N  NH1 . ARG A 1  212 ? -33.337 -57.844 60.894  1.00 61.54  ? 211 ARG A NH1 1 
ATOM   1622 N  NH2 . ARG A 1  212 ? -32.924 -60.103 60.909  1.00 61.59  ? 211 ARG A NH2 1 
ATOM   1623 N  N   . ARG A 1  213 ? -29.423 -58.546 67.506  1.00 44.84  ? 212 ARG A N   1 
ATOM   1624 C  CA  . ARG A 1  213 ? -28.275 -59.440 67.652  1.00 44.09  ? 212 ARG A CA  1 
ATOM   1625 C  C   . ARG A 1  213 ? -28.268 -60.399 66.472  1.00 44.24  ? 212 ARG A C   1 
ATOM   1626 O  O   . ARG A 1  213 ? -29.321 -60.688 65.904  1.00 43.98  ? 212 ARG A O   1 
ATOM   1627 C  CB  . ARG A 1  213 ? -28.350 -60.222 68.966  1.00 43.67  ? 212 ARG A CB  1 
ATOM   1628 N  N   . PHE A 1  214 ? -27.085 -60.884 66.100  1.00 44.10  ? 213 PHE A N   1 
ATOM   1629 C  CA  . PHE A 1  214 ? -26.950 -61.853 65.013  1.00 44.13  ? 213 PHE A CA  1 
ATOM   1630 C  C   . PHE A 1  214 ? -26.076 -63.036 65.425  1.00 45.00  ? 213 PHE A C   1 
ATOM   1631 O  O   . PHE A 1  214 ? -24.935 -62.847 65.845  1.00 45.61  ? 213 PHE A O   1 
ATOM   1632 C  CB  . PHE A 1  214 ? -26.357 -61.179 63.772  1.00 43.18  ? 213 PHE A CB  1 
ATOM   1633 C  CG  . PHE A 1  214 ? -27.195 -60.053 63.244  1.00 42.66  ? 213 PHE A CG  1 
ATOM   1634 C  CD1 . PHE A 1  214 ? -26.832 -58.733 63.470  1.00 41.68  ? 213 PHE A CD1 1 
ATOM   1635 C  CD2 . PHE A 1  214 ? -28.366 -60.310 62.544  1.00 40.26  ? 213 PHE A CD2 1 
ATOM   1636 C  CE1 . PHE A 1  214 ? -27.607 -57.695 62.997  1.00 37.06  ? 213 PHE A CE1 1 
ATOM   1637 C  CE2 . PHE A 1  214 ? -29.140 -59.277 62.068  1.00 41.18  ? 213 PHE A CE2 1 
ATOM   1638 C  CZ  . PHE A 1  214 ? -28.757 -57.968 62.292  1.00 44.02  ? 213 PHE A CZ  1 
ATOM   1639 N  N   . THR A 1  215 ? -26.619 -64.245 65.301  1.00 45.27  ? 214 THR A N   1 
ATOM   1640 C  CA  . THR A 1  215 ? -25.864 -65.474 65.529  1.00 46.58  ? 214 THR A CA  1 
ATOM   1641 C  C   . THR A 1  215 ? -25.442 -66.050 64.169  1.00 47.78  ? 214 THR A C   1 
ATOM   1642 O  O   . THR A 1  215 ? -26.281 -66.177 63.273  1.00 48.08  ? 214 THR A O   1 
ATOM   1643 C  CB  . THR A 1  215 ? -26.714 -66.540 66.272  1.00 46.72  ? 214 THR A CB  1 
ATOM   1644 O  OG1 . THR A 1  215 ? -27.491 -67.285 65.328  1.00 47.83  ? 214 THR A OG1 1 
ATOM   1645 C  CG2 . THR A 1  215 ? -27.660 -65.897 67.315  1.00 48.10  ? 214 THR A CG2 1 
ATOM   1646 N  N   . PRO A 1  216 ? -24.157 -66.424 64.007  1.00 48.63  ? 215 PRO A N   1 
ATOM   1647 C  CA  . PRO A 1  216 ? -23.767 -66.980 62.708  1.00 49.41  ? 215 PRO A CA  1 
ATOM   1648 C  C   . PRO A 1  216 ? -24.536 -68.260 62.420  1.00 50.12  ? 215 PRO A C   1 
ATOM   1649 O  O   . PRO A 1  216 ? -24.763 -69.053 63.322  1.00 50.07  ? 215 PRO A O   1 
ATOM   1650 C  CB  . PRO A 1  216 ? -22.276 -67.272 62.877  1.00 49.78  ? 215 PRO A CB  1 
ATOM   1651 C  CG  . PRO A 1  216 ? -22.093 -67.480 64.344  1.00 49.81  ? 215 PRO A CG  1 
ATOM   1652 C  CD  . PRO A 1  216 ? -23.088 -66.566 65.012  1.00 49.42  ? 215 PRO A CD  1 
ATOM   1653 N  N   . GLU A 1  217 ? -24.978 -68.434 61.183  1.00 51.77  ? 216 GLU A N   1 
ATOM   1654 C  CA  . GLU A 1  217 ? -25.636 -69.669 60.785  1.00 52.85  ? 216 GLU A CA  1 
ATOM   1655 C  C   . GLU A 1  217 ? -24.669 -70.407 59.875  1.00 53.20  ? 216 GLU A C   1 
ATOM   1656 O  O   . GLU A 1  217 ? -24.631 -70.198 58.670  1.00 54.27  ? 216 GLU A O   1 
ATOM   1657 C  CB  . GLU A 1  217 ? -26.984 -69.395 60.112  1.00 53.55  ? 216 GLU A CB  1 
ATOM   1658 C  CG  . GLU A 1  217 ? -28.099 -69.038 61.101  1.00 55.29  ? 216 GLU A CG  1 
ATOM   1659 C  CD  . GLU A 1  217 ? -29.474 -68.940 60.449  1.00 59.58  ? 216 GLU A CD  1 
ATOM   1660 O  OE1 . GLU A 1  217 ? -29.571 -69.177 59.223  1.00 63.74  ? 216 GLU A OE1 1 
ATOM   1661 O  OE2 . GLU A 1  217 ? -30.457 -68.624 61.162  1.00 54.94  ? 216 GLU A OE2 1 
ATOM   1662 N  N   . ILE A 1  218 ? -23.857 -71.254 60.490  1.00 54.32  ? 217 ILE A N   1 
ATOM   1663 C  CA  . ILE A 1  218 ? -22.790 -71.942 59.797  1.00 53.81  ? 217 ILE A CA  1 
ATOM   1664 C  C   . ILE A 1  218 ? -23.413 -73.162 59.115  1.00 53.01  ? 217 ILE A C   1 
ATOM   1665 O  O   . ILE A 1  218 ? -23.951 -74.044 59.792  1.00 52.13  ? 217 ILE A O   1 
ATOM   1666 C  CB  . ILE A 1  218 ? -21.649 -72.292 60.805  1.00 54.34  ? 217 ILE A CB  1 
ATOM   1667 C  CG1 . ILE A 1  218 ? -20.389 -72.787 60.091  1.00 55.49  ? 217 ILE A CG1 1 
ATOM   1668 C  CG2 . ILE A 1  218 ? -22.121 -73.303 61.861  1.00 56.91  ? 217 ILE A CG2 1 
ATOM   1669 C  CD1 . ILE A 1  218 ? -19.151 -72.714 60.969  1.00 56.61  ? 217 ILE A CD1 1 
ATOM   1670 N  N   . ALA A 1  219 ? -23.390 -73.193 57.782  1.00 52.10  ? 218 ALA A N   1 
ATOM   1671 C  CA  . ALA A 1  219 ? -24.064 -74.272 57.058  1.00 52.67  ? 218 ALA A CA  1 
ATOM   1672 C  C   . ALA A 1  219 ? -23.663 -74.430 55.588  1.00 53.59  ? 218 ALA A C   1 
ATOM   1673 O  O   . ALA A 1  219 ? -23.159 -73.494 54.947  1.00 52.72  ? 218 ALA A O   1 
ATOM   1674 C  CB  . ALA A 1  219 ? -25.587 -74.108 57.169  1.00 51.80  ? 218 ALA A CB  1 
ATOM   1675 N  N   . ALA A 1  220 ? -23.920 -75.635 55.075  1.00 54.01  ? 219 ALA A N   1 
ATOM   1676 C  CA  . ALA A 1  220 ? -23.687 -75.984 53.670  1.00 54.26  ? 219 ALA A CA  1 
ATOM   1677 C  C   . ALA A 1  220 ? -24.689 -75.290 52.739  1.00 54.13  ? 219 ALA A C   1 
ATOM   1678 O  O   . ALA A 1  220 ? -25.895 -75.564 52.792  1.00 53.04  ? 219 ALA A O   1 
ATOM   1679 C  CB  . ALA A 1  220 ? -23.765 -77.515 53.488  1.00 53.78  ? 219 ALA A CB  1 
ATOM   1680 N  N   . ARG A 1  221 ? -24.182 -74.395 51.891  1.00 54.27  ? 220 ARG A N   1 
ATOM   1681 C  CA  . ARG A 1  221 ? -25.017 -73.630 50.965  1.00 54.77  ? 220 ARG A CA  1 
ATOM   1682 C  C   . ARG A 1  221 ? -24.396 -73.657 49.568  1.00 54.92  ? 220 ARG A C   1 
ATOM   1683 O  O   . ARG A 1  221 ? -23.171 -73.523 49.450  1.00 54.36  ? 220 ARG A O   1 
ATOM   1684 C  CB  . ARG A 1  221 ? -25.163 -72.181 51.451  1.00 54.98  ? 220 ARG A CB  1 
ATOM   1685 N  N   . PRO A 1  222 ? -25.228 -73.842 48.509  1.00 54.98  ? 221 PRO A N   1 
ATOM   1686 C  CA  . PRO A 1  222 ? -24.750 -73.852 47.118  1.00 54.75  ? 221 PRO A CA  1 
ATOM   1687 C  C   . PRO A 1  222 ? -23.688 -72.795 46.781  1.00 54.80  ? 221 PRO A C   1 
ATOM   1688 O  O   . PRO A 1  222 ? -23.664 -71.713 47.374  1.00 55.19  ? 221 PRO A O   1 
ATOM   1689 C  CB  . PRO A 1  222 ? -26.033 -73.607 46.317  1.00 54.06  ? 221 PRO A CB  1 
ATOM   1690 C  CG  . PRO A 1  222 ? -27.085 -74.308 47.108  1.00 54.10  ? 221 PRO A CG  1 
ATOM   1691 C  CD  . PRO A 1  222 ? -26.661 -74.209 48.572  1.00 54.92  ? 221 PRO A CD  1 
ATOM   1692 N  N   . LYS A 1  223 ? -22.803 -73.123 45.845  1.00 54.44  ? 222 LYS A N   1 
ATOM   1693 C  CA  . LYS A 1  223 ? -21.827 -72.156 45.356  1.00 54.13  ? 222 LYS A CA  1 
ATOM   1694 C  C   . LYS A 1  223 ? -22.578 -71.042 44.619  1.00 53.62  ? 222 LYS A C   1 
ATOM   1695 O  O   . LYS A 1  223 ? -23.553 -71.316 43.907  1.00 53.49  ? 222 LYS A O   1 
ATOM   1696 C  CB  . LYS A 1  223 ? -20.813 -72.835 44.425  1.00 54.00  ? 222 LYS A CB  1 
ATOM   1697 N  N   . VAL A 1  224 ? -22.158 -69.791 44.810  1.00 52.06  ? 223 VAL A N   1 
ATOM   1698 C  CA  . VAL A 1  224 ? -22.761 -68.684 44.076  1.00 50.04  ? 223 VAL A CA  1 
ATOM   1699 C  C   . VAL A 1  224 ? -21.756 -68.083 43.099  1.00 48.28  ? 223 VAL A C   1 
ATOM   1700 O  O   . VAL A 1  224 ? -22.001 -68.084 41.889  1.00 47.34  ? 223 VAL A O   1 
ATOM   1701 C  CB  . VAL A 1  224 ? -23.321 -67.602 44.999  1.00 50.75  ? 223 VAL A CB  1 
ATOM   1702 C  CG1 . VAL A 1  224 ? -24.235 -66.659 44.207  1.00 48.90  ? 223 VAL A CG1 1 
ATOM   1703 C  CG2 . VAL A 1  224 ? -24.078 -68.236 46.151  1.00 53.29  ? 223 VAL A CG2 1 
ATOM   1704 N  N   . ARG A 1  225 ? -20.640 -67.562 43.606  1.00 46.03  ? 224 ARG A N   1 
ATOM   1705 C  CA  . ARG A 1  225 ? -19.557 -67.104 42.719  1.00 45.42  ? 224 ARG A CA  1 
ATOM   1706 C  C   . ARG A 1  225 ? -18.232 -67.759 43.131  1.00 45.51  ? 224 ARG A C   1 
ATOM   1707 O  O   . ARG A 1  225 ? -17.189 -67.106 43.266  1.00 44.81  ? 224 ARG A O   1 
ATOM   1708 C  CB  . ARG A 1  225 ? -19.506 -65.578 42.672  1.00 44.20  ? 224 ARG A CB  1 
ATOM   1709 C  CG  . ARG A 1  225 ? -20.768 -65.002 42.007  1.00 43.06  ? 224 ARG A CG  1 
ATOM   1710 C  CD  . ARG A 1  225 ? -20.897 -63.492 42.102  1.00 34.61  ? 224 ARG A CD  1 
ATOM   1711 N  NE  . ARG A 1  225 ? -20.041 -62.813 41.122  1.00 29.74  ? 224 ARG A NE  1 
ATOM   1712 C  CZ  . ARG A 1  225 ? -19.019 -62.025 41.429  1.00 22.71  ? 224 ARG A CZ  1 
ATOM   1713 N  NH1 . ARG A 1  225 ? -18.703 -61.789 42.698  1.00 26.23  ? 224 ARG A NH1 1 
ATOM   1714 N  NH2 . ARG A 1  225 ? -18.319 -61.452 40.467  1.00 23.38  ? 224 ARG A NH2 1 
ATOM   1715 N  N   . ASP A 1  226 ? -18.318 -69.080 43.294  1.00 45.33  ? 225 ASP A N   1 
ATOM   1716 C  CA  . ASP A 1  226 ? -17.262 -69.918 43.865  1.00 46.17  ? 225 ASP A CA  1 
ATOM   1717 C  C   . ASP A 1  226 ? -17.319 -69.960 45.407  1.00 45.00  ? 225 ASP A C   1 
ATOM   1718 O  O   . ASP A 1  226 ? -16.543 -70.684 46.030  1.00 46.15  ? 225 ASP A O   1 
ATOM   1719 C  CB  . ASP A 1  226 ? -15.865 -69.504 43.357  1.00 46.52  ? 225 ASP A CB  1 
ATOM   1720 N  N   . GLN A 1  227 ? -18.258 -69.221 46.004  1.00 44.33  ? 226 GLN A N   1 
ATOM   1721 C  CA  . GLN A 1  227 ? -18.395 -69.115 47.465  1.00 42.40  ? 226 GLN A CA  1 
ATOM   1722 C  C   . GLN A 1  227 ? -19.652 -69.856 47.942  1.00 42.10  ? 226 GLN A C   1 
ATOM   1723 O  O   . GLN A 1  227 ? -20.735 -69.665 47.378  1.00 41.63  ? 226 GLN A O   1 
ATOM   1724 C  CB  . GLN A 1  227 ? -18.479 -67.651 47.893  1.00 41.37  ? 226 GLN A CB  1 
ATOM   1725 C  CG  . GLN A 1  227 ? -17.553 -66.692 47.131  1.00 41.18  ? 226 GLN A CG  1 
ATOM   1726 C  CD  . GLN A 1  227 ? -16.082 -66.795 47.518  1.00 38.96  ? 226 GLN A CD  1 
ATOM   1727 O  OE1 . GLN A 1  227 ? -15.734 -67.174 48.646  1.00 30.46  ? 226 GLN A OE1 1 
ATOM   1728 N  NE2 . GLN A 1  227 ? -15.207 -66.425 46.580  1.00 37.58  ? 226 GLN A NE2 1 
ATOM   1729 N  N   . ALA A 1  228 ? -19.481 -70.692 48.975  1.00 41.40  ? 227 ALA A N   1 
ATOM   1730 C  CA  . ALA A 1  228 ? -20.559 -71.463 49.613  1.00 40.40  ? 227 ALA A CA  1 
ATOM   1731 C  C   . ALA A 1  228 ? -21.011 -70.797 50.922  1.00 39.90  ? 227 ALA A C   1 
ATOM   1732 O  O   . ALA A 1  228 ? -22.053 -71.149 51.506  1.00 38.03  ? 227 ALA A O   1 
ATOM   1733 C  CB  . ALA A 1  228 ? -20.083 -72.891 49.896  1.00 40.26  ? 227 ALA A CB  1 
ATOM   1734 N  N   . GLY A 1  229 ? -20.200 -69.865 51.405  1.00 39.78  ? 228 GLY A N   1 
ATOM   1735 C  CA  . GLY A 1  229 ? -20.603 -69.024 52.518  1.00 41.50  ? 228 GLY A CA  1 
ATOM   1736 C  C   . GLY A 1  229 ? -21.512 -67.931 51.984  1.00 41.52  ? 228 GLY A C   1 
ATOM   1737 O  O   . GLY A 1  229 ? -21.553 -67.690 50.775  1.00 41.96  ? 228 GLY A O   1 
ATOM   1738 N  N   . ARG A 1  230 ? -22.253 -67.284 52.876  1.00 40.71  ? 229 ARG A N   1 
ATOM   1739 C  CA  . ARG A 1  230 ? -23.132 -66.179 52.488  1.00 41.03  ? 229 ARG A CA  1 
ATOM   1740 C  C   . ARG A 1  230 ? -22.903 -65.009 53.411  1.00 39.52  ? 229 ARG A C   1 
ATOM   1741 O  O   . ARG A 1  230 ? -22.405 -65.171 54.525  1.00 38.56  ? 229 ARG A O   1 
ATOM   1742 C  CB  . ARG A 1  230 ? -24.607 -66.591 52.530  1.00 40.51  ? 229 ARG A CB  1 
ATOM   1743 C  CG  . ARG A 1  230 ? -24.954 -67.793 51.652  1.00 43.66  ? 229 ARG A CG  1 
ATOM   1744 C  CD  . ARG A 1  230 ? -24.881 -67.484 50.151  1.00 46.31  ? 229 ARG A CD  1 
ATOM   1745 N  NE  . ARG A 1  230 ? -25.061 -68.694 49.340  1.00 49.05  ? 229 ARG A NE  1 
ATOM   1746 C  CZ  . ARG A 1  230 ? -26.234 -69.304 49.134  1.00 53.24  ? 229 ARG A CZ  1 
ATOM   1747 N  NH1 . ARG A 1  230 ? -27.367 -68.847 49.676  1.00 50.37  ? 229 ARG A NH1 1 
ATOM   1748 N  NH2 . ARG A 1  230 ? -26.280 -70.393 48.383  1.00 54.56  ? 229 ARG A NH2 1 
ATOM   1749 N  N   . MET A 1  231 ? -23.271 -63.827 52.938  1.00 37.62  ? 230 MET A N   1 
ATOM   1750 C  CA  . MET A 1  231 ? -23.051 -62.601 53.692  1.00 37.82  ? 230 MET A CA  1 
ATOM   1751 C  C   . MET A 1  231 ? -24.307 -61.706 53.637  1.00 36.35  ? 230 MET A C   1 
ATOM   1752 O  O   . MET A 1  231 ? -24.802 -61.381 52.563  1.00 35.95  ? 230 MET A O   1 
ATOM   1753 C  CB  . MET A 1  231 ? -21.824 -61.889 53.124  1.00 37.31  ? 230 MET A CB  1 
ATOM   1754 C  CG  . MET A 1  231 ? -21.053 -61.058 54.120  1.00 38.46  ? 230 MET A CG  1 
ATOM   1755 S  SD  . MET A 1  231 ? -19.523 -60.448 53.393  1.00 45.33  ? 230 MET A SD  1 
ATOM   1756 C  CE  . MET A 1  231 ? -18.558 -61.959 53.253  1.00 34.01  ? 230 MET A CE  1 
ATOM   1757 N  N   . ASN A 1  232 ? -24.834 -61.342 54.794  1.00 33.51  ? 231 ASN A N   1 
ATOM   1758 C  CA  . ASN A 1  232 ? -26.027 -60.527 54.849  1.00 33.03  ? 231 ASN A CA  1 
ATOM   1759 C  C   . ASN A 1  232 ? -25.665 -59.094 55.098  1.00 32.20  ? 231 ASN A C   1 
ATOM   1760 O  O   . ASN A 1  232 ? -24.815 -58.806 55.936  1.00 33.58  ? 231 ASN A O   1 
ATOM   1761 C  CB  . ASN A 1  232 ? -26.978 -61.035 55.925  1.00 32.43  ? 231 ASN A CB  1 
ATOM   1762 C  CG  . ASN A 1  232 ? -27.717 -62.268 55.485  1.00 34.95  ? 231 ASN A CG  1 
ATOM   1763 O  OD1 . ASN A 1  232 ? -27.591 -62.696 54.330  1.00 41.19  ? 231 ASN A OD1 1 
ATOM   1764 N  ND2 . ASN A 1  232 ? -28.501 -62.848 56.385  1.00 34.88  ? 231 ASN A ND2 1 
ATOM   1765 N  N   . TYR A 1  233 ? -26.313 -58.199 54.361  1.00 30.46  ? 232 TYR A N   1 
ATOM   1766 C  CA  . TYR A 1  233 ? -26.002 -56.772 54.423  1.00 28.79  ? 232 TYR A CA  1 
ATOM   1767 C  C   . TYR A 1  233 ? -27.135 -56.044 55.117  1.00 25.54  ? 232 TYR A C   1 
ATOM   1768 O  O   . TYR A 1  233 ? -28.289 -56.441 55.008  1.00 26.24  ? 232 TYR A O   1 
ATOM   1769 C  CB  . TYR A 1  233 ? -25.739 -56.252 53.021  1.00 29.14  ? 232 TYR A CB  1 
ATOM   1770 C  CG  . TYR A 1  233 ? -24.685 -57.082 52.304  1.00 28.67  ? 232 TYR A CG  1 
ATOM   1771 C  CD1 . TYR A 1  233 ? -25.041 -58.170 51.496  1.00 29.37  ? 232 TYR A CD1 1 
ATOM   1772 C  CD2 . TYR A 1  233 ? -23.325 -56.797 52.463  1.00 25.69  ? 232 TYR A CD2 1 
ATOM   1773 C  CE1 . TYR A 1  233 ? -24.056 -58.934 50.834  1.00 30.35  ? 232 TYR A CE1 1 
ATOM   1774 C  CE2 . TYR A 1  233 ? -22.346 -57.548 51.824  1.00 27.67  ? 232 TYR A CE2 1 
ATOM   1775 C  CZ  . TYR A 1  233 ? -22.708 -58.617 51.018  1.00 33.16  ? 232 TYR A CZ  1 
ATOM   1776 O  OH  . TYR A 1  233 ? -21.710 -59.339 50.382  1.00 26.37  ? 232 TYR A OH  1 
ATOM   1777 N  N   . TYR A 1  234 ? -26.785 -55.019 55.880  1.00 22.02  ? 233 TYR A N   1 
ATOM   1778 C  CA  . TYR A 1  234 ? -27.704 -54.370 56.793  1.00 20.39  ? 233 TYR A CA  1 
ATOM   1779 C  C   . TYR A 1  234 ? -27.387 -52.906 56.746  1.00 20.72  ? 233 TYR A C   1 
ATOM   1780 O  O   . TYR A 1  234 ? -26.260 -52.549 56.449  1.00 21.09  ? 233 TYR A O   1 
ATOM   1781 C  CB  . TYR A 1  234 ? -27.546 -54.884 58.232  1.00 17.84  ? 233 TYR A CB  1 
ATOM   1782 C  CG  . TYR A 1  234 ? -27.993 -56.317 58.413  1.00 21.70  ? 233 TYR A CG  1 
ATOM   1783 C  CD1 . TYR A 1  234 ? -27.098 -57.374 58.237  1.00 27.28  ? 233 TYR A CD1 1 
ATOM   1784 C  CD2 . TYR A 1  234 ? -29.298 -56.622 58.752  1.00 19.59  ? 233 TYR A CD2 1 
ATOM   1785 C  CE1 . TYR A 1  234 ? -27.500 -58.698 58.383  1.00 29.31  ? 233 TYR A CE1 1 
ATOM   1786 C  CE2 . TYR A 1  234 ? -29.709 -57.933 58.917  1.00 27.91  ? 233 TYR A CE2 1 
ATOM   1787 C  CZ  . TYR A 1  234 ? -28.799 -58.978 58.723  1.00 32.22  ? 233 TYR A CZ  1 
ATOM   1788 O  OH  . TYR A 1  234 ? -29.206 -60.294 58.859  1.00 28.68  ? 233 TYR A OH  1 
ATOM   1789 N  N   . TRP A 1  235 ? -28.388 -52.067 57.021  1.00 19.70  ? 234 TRP A N   1 
ATOM   1790 C  CA  . TRP A 1  235 ? -28.215 -50.605 57.052  1.00 16.59  ? 234 TRP A CA  1 
ATOM   1791 C  C   . TRP A 1  235 ? -29.073 -50.032 58.169  1.00 14.57  ? 234 TRP A C   1 
ATOM   1792 O  O   . TRP A 1  235 ? -30.016 -50.668 58.634  1.00 15.70  ? 234 TRP A O   1 
ATOM   1793 C  CB  . TRP A 1  235 ? -28.622 -49.986 55.718  1.00 18.87  ? 234 TRP A CB  1 
ATOM   1794 C  CG  . TRP A 1  235 ? -30.076 -50.224 55.368  1.00 20.88  ? 234 TRP A CG  1 
ATOM   1795 C  CD1 . TRP A 1  235 ? -30.597 -51.329 54.786  1.00 23.09  ? 234 TRP A CD1 1 
ATOM   1796 C  CD2 . TRP A 1  235 ? -31.179 -49.357 55.632  1.00 16.63  ? 234 TRP A CD2 1 
ATOM   1797 N  NE1 . TRP A 1  235 ? -31.949 -51.197 54.625  1.00 18.52  ? 234 TRP A NE1 1 
ATOM   1798 C  CE2 . TRP A 1  235 ? -32.336 -49.995 55.143  1.00 16.15  ? 234 TRP A CE2 1 
ATOM   1799 C  CE3 . TRP A 1  235 ? -31.300 -48.092 56.210  1.00 17.69  ? 234 TRP A CE3 1 
ATOM   1800 C  CZ2 . TRP A 1  235 ? -33.601 -49.425 55.230  1.00 11.86  ? 234 TRP A CZ2 1 
ATOM   1801 C  CZ3 . TRP A 1  235 ? -32.574 -47.506 56.281  1.00 19.55  ? 234 TRP A CZ3 1 
ATOM   1802 C  CH2 . TRP A 1  235 ? -33.702 -48.184 55.800  1.00 12.95  ? 234 TRP A CH2 1 
ATOM   1803 N  N   . THR A 1  236 ? -28.735 -48.846 58.639  1.00 14.99  ? 235 THR A N   1 
ATOM   1804 C  CA  . THR A 1  236 ? -29.648 -48.095 59.492  1.00 13.03  ? 235 THR A CA  1 
ATOM   1805 C  C   . THR A 1  236 ? -29.321 -46.643 59.350  1.00 16.77  ? 235 THR A C   1 
ATOM   1806 O  O   . THR A 1  236 ? -28.228 -46.297 58.888  1.00 16.76  ? 235 THR A O   1 
ATOM   1807 C  CB  . THR A 1  236 ? -29.620 -48.520 60.962  1.00 17.16  ? 235 THR A CB  1 
ATOM   1808 O  OG1 . THR A 1  236 ? -30.737 -47.937 61.621  1.00 12.92  ? 235 THR A OG1 1 
ATOM   1809 C  CG2 . THR A 1  236 ? -28.313 -48.078 61.694  1.00 12.61  ? 235 THR A CG2 1 
ATOM   1810 N  N   . LEU A 1  237 ? -30.297 -45.795 59.690  1.00 20.96  ? 236 LEU A N   1 
ATOM   1811 C  CA  . LEU A 1  237 ? -30.153 -44.343 59.589  1.00 22.88  ? 236 LEU A CA  1 
ATOM   1812 C  C   . LEU A 1  237 ? -29.977 -43.784 60.992  1.00 24.86  ? 236 LEU A C   1 
ATOM   1813 O  O   . LEU A 1  237 ? -30.945 -43.682 61.746  1.00 22.84  ? 236 LEU A O   1 
ATOM   1814 C  CB  . LEU A 1  237 ? -31.365 -43.693 58.887  1.00 24.47  ? 236 LEU A CB  1 
ATOM   1815 C  CG  . LEU A 1  237 ? -31.474 -43.805 57.358  1.00 25.67  ? 236 LEU A CG  1 
ATOM   1816 C  CD1 . LEU A 1  237 ? -32.840 -43.314 56.899  1.00 26.37  ? 236 LEU A CD1 1 
ATOM   1817 C  CD2 . LEU A 1  237 ? -30.370 -43.069 56.609  1.00 18.30  ? 236 LEU A CD2 1 
ATOM   1818 N  N   . LEU A 1  238 ? -28.726 -43.465 61.353  1.00 27.66  ? 237 LEU A N   1 
ATOM   1819 C  CA  . LEU A 1  238 ? -28.413 -42.924 62.687  1.00 26.83  ? 237 LEU A CA  1 
ATOM   1820 C  C   . LEU A 1  238 ? -28.823 -41.468 62.811  1.00 27.75  ? 237 LEU A C   1 
ATOM   1821 O  O   . LEU A 1  238 ? -28.404 -40.625 62.023  1.00 29.27  ? 237 LEU A O   1 
ATOM   1822 C  CB  . LEU A 1  238 ? -26.928 -43.029 62.960  1.00 28.23  ? 237 LEU A CB  1 
ATOM   1823 C  CG  . LEU A 1  238 ? -26.474 -42.495 64.317  1.00 30.60  ? 237 LEU A CG  1 
ATOM   1824 C  CD1 . LEU A 1  238 ? -27.231 -43.201 65.422  1.00 25.02  ? 237 LEU A CD1 1 
ATOM   1825 C  CD2 . LEU A 1  238 ? -24.974 -42.686 64.459  1.00 28.39  ? 237 LEU A CD2 1 
ATOM   1826 N  N   . GLU A 1  239 ? -29.630 -41.163 63.813  1.00 29.08  ? 238 GLU A N   1 
ATOM   1827 C  CA  . GLU A 1  239 ? -30.227 -39.835 63.919  1.00 31.37  ? 238 GLU A CA  1 
ATOM   1828 C  C   . GLU A 1  239 ? -29.180 -38.812 64.408  1.00 32.89  ? 238 GLU A C   1 
ATOM   1829 O  O   . GLU A 1  239 ? -28.172 -39.194 64.997  1.00 29.46  ? 238 GLU A O   1 
ATOM   1830 C  CB  . GLU A 1  239 ? -31.449 -39.892 64.837  1.00 30.89  ? 238 GLU A CB  1 
ATOM   1831 C  CG  . GLU A 1  239 ? -32.641 -39.058 64.388  1.00 38.26  ? 238 GLU A CG  1 
ATOM   1832 C  CD  . GLU A 1  239 ? -33.165 -39.451 63.025  1.00 43.98  ? 238 GLU A CD  1 
ATOM   1833 O  OE1 . GLU A 1  239 ? -33.913 -40.450 62.954  1.00 48.96  ? 238 GLU A OE1 1 
ATOM   1834 O  OE2 . GLU A 1  239 ? -32.833 -38.755 62.031  1.00 43.87  ? 238 GLU A OE2 1 
ATOM   1835 N  N   . PRO A 1  240 ? -29.386 -37.513 64.112  1.00 35.27  ? 239 PRO A N   1 
ATOM   1836 C  CA  . PRO A 1  240 ? -28.409 -36.532 64.595  1.00 37.30  ? 239 PRO A CA  1 
ATOM   1837 C  C   . PRO A 1  240 ? -28.281 -36.497 66.119  1.00 38.10  ? 239 PRO A C   1 
ATOM   1838 O  O   . PRO A 1  240 ? -29.268 -36.265 66.823  1.00 37.25  ? 239 PRO A O   1 
ATOM   1839 C  CB  . PRO A 1  240 ? -28.959 -35.199 64.069  1.00 37.17  ? 239 PRO A CB  1 
ATOM   1840 C  CG  . PRO A 1  240 ? -29.733 -35.573 62.869  1.00 37.49  ? 239 PRO A CG  1 
ATOM   1841 C  CD  . PRO A 1  240 ? -30.328 -36.913 63.150  1.00 33.79  ? 239 PRO A CD  1 
ATOM   1842 N  N   . GLY A 1  241 ? -27.064 -36.733 66.606  1.00 40.75  ? 240 GLY A N   1 
ATOM   1843 C  CA  . GLY A 1  241 ? -26.761 -36.692 68.052  1.00 41.02  ? 240 GLY A CA  1 
ATOM   1844 C  C   . GLY A 1  241 ? -26.762 -38.064 68.708  1.00 41.22  ? 240 GLY A C   1 
ATOM   1845 O  O   . GLY A 1  241 ? -26.223 -38.237 69.808  1.00 39.84  ? 240 GLY A O   1 
ATOM   1846 N  N   . ASP A 1  242 ? -27.362 -39.044 68.037  1.00 39.85  ? 241 ASP A N   1 
ATOM   1847 C  CA  . ASP A 1  242 ? -27.474 -40.395 68.583  1.00 40.94  ? 241 ASP A CA  1 
ATOM   1848 C  C   . ASP A 1  242 ? -26.171 -41.195 68.392  1.00 40.95  ? 241 ASP A C   1 
ATOM   1849 O  O   . ASP A 1  242 ? -25.275 -40.784 67.640  1.00 39.96  ? 241 ASP A O   1 
ATOM   1850 C  CB  . ASP A 1  242 ? -28.667 -41.128 67.925  1.00 41.75  ? 241 ASP A CB  1 
ATOM   1851 C  CG  . ASP A 1  242 ? -29.076 -42.399 68.679  1.00 44.90  ? 241 ASP A CG  1 
ATOM   1852 O  OD1 . ASP A 1  242 ? -29.900 -43.165 68.149  1.00 49.94  ? 241 ASP A OD1 1 
ATOM   1853 O  OD2 . ASP A 1  242 ? -28.566 -42.647 69.801  1.00 51.71  ? 241 ASP A OD2 1 
ATOM   1854 N  N   . THR A 1  243 ? -26.095 -42.344 69.067  1.00 41.57  ? 242 THR A N   1 
ATOM   1855 C  CA  . THR A 1  243 ? -24.901 -43.172 69.114  1.00 43.58  ? 242 THR A CA  1 
ATOM   1856 C  C   . THR A 1  243 ? -25.208 -44.590 68.640  1.00 45.23  ? 242 THR A C   1 
ATOM   1857 O  O   . THR A 1  243 ? -26.148 -45.220 69.130  1.00 46.22  ? 242 THR A O   1 
ATOM   1858 C  CB  . THR A 1  243 ? -24.349 -43.232 70.563  1.00 43.94  ? 242 THR A CB  1 
ATOM   1859 O  OG1 . THR A 1  243 ? -23.557 -42.064 70.819  1.00 48.20  ? 242 THR A OG1 1 
ATOM   1860 C  CG2 . THR A 1  243 ? -23.491 -44.485 70.800  1.00 41.56  ? 242 THR A CG2 1 
ATOM   1861 N  N   . ILE A 1  244 ? -24.404 -45.091 67.702  1.00 44.88  ? 243 ILE A N   1 
ATOM   1862 C  CA  . ILE A 1  244 ? -24.492 -46.489 67.291  1.00 44.73  ? 243 ILE A CA  1 
ATOM   1863 C  C   . ILE A 1  244 ? -23.293 -47.246 67.832  1.00 45.35  ? 243 ILE A C   1 
ATOM   1864 O  O   . ILE A 1  244 ? -22.185 -46.723 67.844  1.00 48.31  ? 243 ILE A O   1 
ATOM   1865 C  CB  . ILE A 1  244 ? -24.610 -46.659 65.735  1.00 44.17  ? 243 ILE A CB  1 
ATOM   1866 C  CG1 . ILE A 1  244 ? -24.787 -48.143 65.375  1.00 42.94  ? 243 ILE A CG1 1 
ATOM   1867 C  CG2 . ILE A 1  244 ? -23.416 -46.059 65.019  1.00 42.04  ? 243 ILE A CG2 1 
ATOM   1868 C  CD1 . ILE A 1  244 ? -25.306 -48.383 63.932  1.00 44.54  ? 243 ILE A CD1 1 
ATOM   1869 N  N   . THR A 1  245 ? -23.537 -48.481 68.268  1.00 45.74  ? 244 THR A N   1 
ATOM   1870 C  CA  . THR A 1  245 ? -22.562 -49.308 68.976  1.00 45.60  ? 244 THR A CA  1 
ATOM   1871 C  C   . THR A 1  245 ? -22.507 -50.715 68.390  1.00 45.58  ? 244 THR A C   1 
ATOM   1872 O  O   . THR A 1  245 ? -23.486 -51.455 68.467  1.00 45.65  ? 244 THR A O   1 
ATOM   1873 C  CB  . THR A 1  245 ? -22.950 -49.494 70.482  1.00 45.35  ? 244 THR A CB  1 
ATOM   1874 O  OG1 . THR A 1  245 ? -23.066 -48.224 71.139  1.00 45.28  ? 244 THR A OG1 1 
ATOM   1875 C  CG2 . THR A 1  245 ? -21.918 -50.364 71.197  1.00 43.92  ? 244 THR A CG2 1 
ATOM   1876 N  N   . PHE A 1  246 ? -21.357 -51.100 67.854  1.00 46.28  ? 245 PHE A N   1 
ATOM   1877 C  CA  . PHE A 1  246 ? -21.151 -52.460 67.395  1.00 47.91  ? 245 PHE A CA  1 
ATOM   1878 C  C   . PHE A 1  246 ? -20.420 -53.296 68.450  1.00 50.06  ? 245 PHE A C   1 
ATOM   1879 O  O   . PHE A 1  246 ? -19.391 -52.882 68.985  1.00 49.94  ? 245 PHE A O   1 
ATOM   1880 C  CB  . PHE A 1  246 ? -20.343 -52.457 66.105  1.00 48.62  ? 245 PHE A CB  1 
ATOM   1881 C  CG  . PHE A 1  246 ? -21.147 -52.109 64.882  1.00 49.92  ? 245 PHE A CG  1 
ATOM   1882 C  CD1 . PHE A 1  246 ? -21.496 -53.090 63.968  1.00 47.60  ? 245 PHE A CD1 1 
ATOM   1883 C  CD2 . PHE A 1  246 ? -21.533 -50.800 64.641  1.00 45.97  ? 245 PHE A CD2 1 
ATOM   1884 C  CE1 . PHE A 1  246 ? -22.216 -52.775 62.837  1.00 53.31  ? 245 PHE A CE1 1 
ATOM   1885 C  CE2 . PHE A 1  246 ? -22.264 -50.475 63.506  1.00 53.65  ? 245 PHE A CE2 1 
ATOM   1886 C  CZ  . PHE A 1  246 ? -22.608 -51.462 62.603  1.00 51.52  ? 245 PHE A CZ  1 
ATOM   1887 N  N   . GLU A 1  247 ? -20.952 -54.480 68.729  1.00 50.95  ? 246 GLU A N   1 
ATOM   1888 C  CA  . GLU A 1  247 ? -20.312 -55.416 69.623  1.00 52.34  ? 246 GLU A CA  1 
ATOM   1889 C  C   . GLU A 1  247 ? -20.289 -56.784 68.955  1.00 52.17  ? 246 GLU A C   1 
ATOM   1890 O  O   . GLU A 1  247 ? -21.301 -57.213 68.411  1.00 54.79  ? 246 GLU A O   1 
ATOM   1891 C  CB  . GLU A 1  247 ? -21.083 -55.465 70.939  1.00 53.00  ? 246 GLU A CB  1 
ATOM   1892 C  CG  . GLU A 1  247 ? -20.332 -56.140 72.077  1.00 57.23  ? 246 GLU A CG  1 
ATOM   1893 C  CD  . GLU A 1  247 ? -21.119 -56.116 73.371  1.00 61.80  ? 246 GLU A CD  1 
ATOM   1894 O  OE1 . GLU A 1  247 ? -21.486 -55.001 73.823  1.00 59.00  ? 246 GLU A OE1 1 
ATOM   1895 O  OE2 . GLU A 1  247 ? -21.369 -57.211 73.927  1.00 61.55  ? 246 GLU A OE2 1 
ATOM   1896 N  N   . ALA A 1  248 ? -19.139 -57.459 68.970  1.00 51.36  ? 247 ALA A N   1 
ATOM   1897 C  CA  . ALA A 1  248 ? -19.035 -58.808 68.393  1.00 49.86  ? 247 ALA A CA  1 
ATOM   1898 C  C   . ALA A 1  248 ? -17.786 -59.612 68.833  1.00 50.21  ? 247 ALA A C   1 
ATOM   1899 O  O   . ALA A 1  248 ? -16.809 -59.063 69.354  1.00 50.51  ? 247 ALA A O   1 
ATOM   1900 C  CB  . ALA A 1  248 ? -19.095 -58.732 66.876  1.00 47.86  ? 247 ALA A CB  1 
ATOM   1901 N  N   . THR A 1  249 ? -17.852 -60.922 68.598  1.00 49.22  ? 248 THR A N   1 
ATOM   1902 C  CA  . THR A 1  249 ? -16.758 -61.850 68.843  1.00 48.50  ? 248 THR A CA  1 
ATOM   1903 C  C   . THR A 1  249 ? -16.388 -62.624 67.565  1.00 47.35  ? 248 THR A C   1 
ATOM   1904 O  O   . THR A 1  249 ? -15.737 -63.668 67.639  1.00 44.81  ? 248 THR A O   1 
ATOM   1905 C  CB  . THR A 1  249 ? -17.164 -62.853 69.928  1.00 48.80  ? 248 THR A CB  1 
ATOM   1906 O  OG1 . THR A 1  249 ? -18.352 -63.540 69.508  1.00 47.86  ? 248 THR A OG1 1 
ATOM   1907 C  CG2 . THR A 1  249 ? -17.431 -62.134 71.243  1.00 48.39  ? 248 THR A CG2 1 
ATOM   1908 N  N   . GLY A 1  250 ? -16.786 -62.090 66.404  1.00 45.79  ? 249 GLY A N   1 
ATOM   1909 C  CA  . GLY A 1  250 ? -16.542 -62.723 65.100  1.00 44.48  ? 249 GLY A CA  1 
ATOM   1910 C  C   . GLY A 1  250 ? -17.588 -62.317 64.065  1.00 43.55  ? 249 GLY A C   1 
ATOM   1911 O  O   . GLY A 1  250 ? -18.517 -61.588 64.380  1.00 43.34  ? 249 GLY A O   1 
ATOM   1912 N  N   . ASN A 1  251 ? -17.409 -62.772 62.826  1.00 42.54  ? 250 ASN A N   1 
ATOM   1913 C  CA  . ASN A 1  251 ? -18.418 -62.667 61.759  1.00 42.51  ? 250 ASN A CA  1 
ATOM   1914 C  C   . ASN A 1  251 ? -18.974 -61.255 61.440  1.00 41.78  ? 250 ASN A C   1 
ATOM   1915 O  O   . ASN A 1  251 ? -20.022 -61.135 60.820  1.00 41.74  ? 250 ASN A O   1 
ATOM   1916 C  CB  . ASN A 1  251 ? -19.596 -63.591 62.058  1.00 42.19  ? 250 ASN A CB  1 
ATOM   1917 C  CG  . ASN A 1  251 ? -19.172 -64.955 62.506  1.00 46.74  ? 250 ASN A CG  1 
ATOM   1918 O  OD1 . ASN A 1  251 ? -18.688 -65.130 63.629  1.00 51.87  ? 250 ASN A OD1 1 
ATOM   1919 N  ND2 . ASN A 1  251 ? -19.381 -65.950 61.651  1.00 39.82  ? 250 ASN A ND2 1 
ATOM   1920 N  N   . LEU A 1  252 ? -18.269 -60.209 61.856  1.00 40.83  ? 251 LEU A N   1 
ATOM   1921 C  CA  . LEU A 1  252 ? -18.653 -58.838 61.578  1.00 40.62  ? 251 LEU A CA  1 
ATOM   1922 C  C   . LEU A 1  252 ? -17.940 -58.355 60.333  1.00 41.91  ? 251 LEU A C   1 
ATOM   1923 O  O   . LEU A 1  252 ? -16.708 -58.389 60.273  1.00 41.48  ? 251 LEU A O   1 
ATOM   1924 C  CB  . LEU A 1  252 ? -18.265 -57.923 62.743  1.00 39.12  ? 251 LEU A CB  1 
ATOM   1925 C  CG  . LEU A 1  252 ? -18.662 -56.448 62.642  1.00 43.43  ? 251 LEU A CG  1 
ATOM   1926 C  CD1 . LEU A 1  252 ? -20.189 -56.293 62.499  1.00 44.83  ? 251 LEU A CD1 1 
ATOM   1927 C  CD2 . LEU A 1  252 ? -18.177 -55.668 63.830  1.00 40.14  ? 251 LEU A CD2 1 
ATOM   1928 N  N   . ILE A 1  253 ? -18.712 -57.922 59.335  1.00 41.53  ? 252 ILE A N   1 
ATOM   1929 C  CA  . ILE A 1  253 ? -18.176 -57.128 58.241  1.00 39.76  ? 252 ILE A CA  1 
ATOM   1930 C  C   . ILE A 1  253 ? -18.547 -55.711 58.637  1.00 41.37  ? 252 ILE A C   1 
ATOM   1931 O  O   . ILE A 1  253 ? -19.719 -55.332 58.565  1.00 40.44  ? 252 ILE A O   1 
ATOM   1932 C  CB  . ILE A 1  253 ? -18.790 -57.486 56.884  1.00 38.23  ? 252 ILE A CB  1 
ATOM   1933 C  CG1 . ILE A 1  253 ? -18.709 -58.981 56.619  1.00 39.54  ? 252 ILE A CG1 1 
ATOM   1934 C  CG2 . ILE A 1  253 ? -18.063 -56.782 55.790  1.00 33.61  ? 252 ILE A CG2 1 
ATOM   1935 C  CD1 . ILE A 1  253 ? -17.298 -59.554 56.747  1.00 41.81  ? 252 ILE A CD1 1 
ATOM   1936 N  N   . ALA A 1  254 ? -17.544 -54.948 59.071  1.00 39.95  ? 253 ALA A N   1 
ATOM   1937 C  CA  . ALA A 1  254 ? -17.749 -53.689 59.771  1.00 38.99  ? 253 ALA A CA  1 
ATOM   1938 C  C   . ALA A 1  254 ? -17.815 -52.471 58.871  1.00 38.38  ? 253 ALA A C   1 
ATOM   1939 O  O   . ALA A 1  254 ? -17.160 -52.419 57.842  1.00 37.92  ? 253 ALA A O   1 
ATOM   1940 C  CB  . ALA A 1  254 ? -16.628 -53.476 60.752  1.00 37.56  ? 253 ALA A CB  1 
ATOM   1941 N  N   . PRO A 1  255 ? -18.539 -51.439 59.310  1.00 38.81  ? 254 PRO A N   1 
ATOM   1942 C  CA  . PRO A 1  255 ? -18.494 -50.187 58.582  1.00 40.10  ? 254 PRO A CA  1 
ATOM   1943 C  C   . PRO A 1  255 ? -17.081 -49.609 58.545  1.00 40.07  ? 254 PRO A C   1 
ATOM   1944 O  O   . PRO A 1  255 ? -16.425 -49.557 59.572  1.00 41.55  ? 254 PRO A O   1 
ATOM   1945 C  CB  . PRO A 1  255 ? -19.419 -49.266 59.390  1.00 39.73  ? 254 PRO A CB  1 
ATOM   1946 C  CG  . PRO A 1  255 ? -20.172 -50.145 60.310  1.00 39.48  ? 254 PRO A CG  1 
ATOM   1947 C  CD  . PRO A 1  255 ? -19.335 -51.341 60.541  1.00 38.89  ? 254 PRO A CD  1 
ATOM   1948 N  N   . TRP A 1  256 ? -16.635 -49.183 57.369  1.00 40.40  ? 255 TRP A N   1 
ATOM   1949 C  CA  . TRP A 1  256 ? -15.406 -48.418 57.224  1.00 39.65  ? 255 TRP A CA  1 
ATOM   1950 C  C   . TRP A 1  256 ? -15.750 -46.992 56.813  1.00 40.01  ? 255 TRP A C   1 
ATOM   1951 O  O   . TRP A 1  256 ? -15.231 -46.024 57.380  1.00 42.08  ? 255 TRP A O   1 
ATOM   1952 C  CB  . TRP A 1  256 ? -14.483 -49.106 56.206  1.00 40.93  ? 255 TRP A CB  1 
ATOM   1953 C  CG  . TRP A 1  256 ? -13.105 -48.458 55.986  1.00 42.98  ? 255 TRP A CG  1 
ATOM   1954 C  CD1 . TRP A 1  256 ? -12.566 -47.388 56.651  1.00 39.85  ? 255 TRP A CD1 1 
ATOM   1955 C  CD2 . TRP A 1  256 ? -12.108 -48.881 55.041  1.00 44.18  ? 255 TRP A CD2 1 
ATOM   1956 N  NE1 . TRP A 1  256 ? -11.316 -47.108 56.161  1.00 46.83  ? 255 TRP A NE1 1 
ATOM   1957 C  CE2 . TRP A 1  256 ? -11.007 -48.013 55.178  1.00 47.64  ? 255 TRP A CE2 1 
ATOM   1958 C  CE3 . TRP A 1  256 ? -12.045 -49.907 54.085  1.00 38.25  ? 255 TRP A CE3 1 
ATOM   1959 C  CZ2 . TRP A 1  256 ? -9.859  -48.134 54.386  1.00 48.77  ? 255 TRP A CZ2 1 
ATOM   1960 C  CZ3 . TRP A 1  256 ? -10.918 -50.023 53.303  1.00 43.64  ? 255 TRP A CZ3 1 
ATOM   1961 C  CH2 . TRP A 1  256 ? -9.837  -49.143 53.456  1.00 46.38  ? 255 TRP A CH2 1 
ATOM   1962 N  N   . TYR A 1  257 ? -16.632 -46.864 55.829  1.00 39.78  ? 256 TYR A N   1 
ATOM   1963 C  CA  . TYR A 1  257 ? -17.157 -45.575 55.406  1.00 39.03  ? 256 TYR A CA  1 
ATOM   1964 C  C   . TYR A 1  257 ? -18.705 -45.558 55.556  1.00 38.44  ? 256 TYR A C   1 
ATOM   1965 O  O   . TYR A 1  257 ? -19.376 -46.590 55.560  1.00 35.94  ? 256 TYR A O   1 
ATOM   1966 C  CB  . TYR A 1  257 ? -16.730 -45.276 53.960  1.00 40.90  ? 256 TYR A CB  1 
ATOM   1967 C  CG  . TYR A 1  257 ? -15.262 -44.911 53.792  1.00 42.75  ? 256 TYR A CG  1 
ATOM   1968 C  CD1 . TYR A 1  257 ? -14.268 -45.894 53.797  1.00 49.00  ? 256 TYR A CD1 1 
ATOM   1969 C  CD2 . TYR A 1  257 ? -14.869 -43.590 53.603  1.00 48.32  ? 256 TYR A CD2 1 
ATOM   1970 C  CE1 . TYR A 1  257 ? -12.903 -45.563 53.633  1.00 52.94  ? 256 TYR A CE1 1 
ATOM   1971 C  CE2 . TYR A 1  257 ? -13.509 -43.246 53.431  1.00 54.80  ? 256 TYR A CE2 1 
ATOM   1972 C  CZ  . TYR A 1  257 ? -12.532 -44.237 53.450  1.00 56.47  ? 256 TYR A CZ  1 
ATOM   1973 O  OH  . TYR A 1  257 ? -11.193 -43.897 53.293  1.00 57.55  ? 256 TYR A OH  1 
ATOM   1974 N  N   . ALA A 1  258 ? -19.241 -44.366 55.760  1.00 37.83  ? 257 ALA A N   1 
ATOM   1975 C  CA  . ALA A 1  258 ? -20.653 -44.160 55.998  1.00 37.36  ? 257 ALA A CA  1 
ATOM   1976 C  C   . ALA A 1  258 ? -20.940 -42.851 55.336  1.00 36.17  ? 257 ALA A C   1 
ATOM   1977 O  O   . ALA A 1  258 ? -20.014 -42.170 54.901  1.00 34.93  ? 257 ALA A O   1 
ATOM   1978 C  CB  . ALA A 1  258 ? -20.966 -44.087 57.504  1.00 38.10  ? 257 ALA A CB  1 
ATOM   1979 N  N   . PHE A 1  259 ? -22.213 -42.487 55.283  1.00 35.99  ? 258 PHE A N   1 
ATOM   1980 C  CA  . PHE A 1  259 ? -22.667 -41.409 54.430  1.00 35.95  ? 258 PHE A CA  1 
ATOM   1981 C  C   . PHE A 1  259 ? -23.569 -40.491 55.215  1.00 36.80  ? 258 PHE A C   1 
ATOM   1982 O  O   . PHE A 1  259 ? -24.493 -40.947 55.894  1.00 37.03  ? 258 PHE A O   1 
ATOM   1983 C  CB  . PHE A 1  259 ? -23.456 -42.002 53.275  1.00 38.24  ? 258 PHE A CB  1 
ATOM   1984 C  CG  . PHE A 1  259 ? -22.682 -42.988 52.442  1.00 34.46  ? 258 PHE A CG  1 
ATOM   1985 C  CD1 . PHE A 1  259 ? -22.758 -44.335 52.708  1.00 32.16  ? 258 PHE A CD1 1 
ATOM   1986 C  CD2 . PHE A 1  259 ? -21.912 -42.556 51.365  1.00 31.17  ? 258 PHE A CD2 1 
ATOM   1987 C  CE1 . PHE A 1  259 ? -22.060 -45.243 51.934  1.00 30.75  ? 258 PHE A CE1 1 
ATOM   1988 C  CE2 . PHE A 1  259 ? -21.218 -43.464 50.587  1.00 31.50  ? 258 PHE A CE2 1 
ATOM   1989 C  CZ  . PHE A 1  259 ? -21.291 -44.797 50.867  1.00 32.06  ? 258 PHE A CZ  1 
ATOM   1990 N  N   . ALA A 1  260 ? -23.302 -39.198 55.112  1.00 36.95  ? 259 ALA A N   1 
ATOM   1991 C  CA  . ALA A 1  260 ? -24.033 -38.197 55.858  1.00 37.88  ? 259 ALA A CA  1 
ATOM   1992 C  C   . ALA A 1  260 ? -24.959 -37.572 54.852  1.00 36.44  ? 259 ALA A C   1 
ATOM   1993 O  O   . ALA A 1  260 ? -24.502 -37.058 53.842  1.00 38.09  ? 259 ALA A O   1 
ATOM   1994 C  CB  . ALA A 1  260 ? -23.084 -37.173 56.439  1.00 36.88  ? 259 ALA A CB  1 
ATOM   1995 N  N   . LEU A 1  261 ? -26.256 -37.613 55.115  1.00 35.01  ? 260 LEU A N   1 
ATOM   1996 C  CA  . LEU A 1  261 ? -27.247 -37.470 54.036  1.00 34.25  ? 260 LEU A CA  1 
ATOM   1997 C  C   . LEU A 1  261 ? -27.885 -36.103 53.986  1.00 34.33  ? 260 LEU A C   1 
ATOM   1998 O  O   . LEU A 1  261 ? -28.323 -35.561 55.015  1.00 33.71  ? 260 LEU A O   1 
ATOM   1999 C  CB  . LEU A 1  261 ? -28.340 -38.535 54.182  1.00 34.22  ? 260 LEU A CB  1 
ATOM   2000 C  CG  . LEU A 1  261 ? -27.948 -40.027 54.262  1.00 38.37  ? 260 LEU A CG  1 
ATOM   2001 C  CD1 . LEU A 1  261 ? -29.225 -40.912 54.306  1.00 30.94  ? 260 LEU A CD1 1 
ATOM   2002 C  CD2 . LEU A 1  261 ? -27.030 -40.449 53.084  1.00 38.02  ? 260 LEU A CD2 1 
ATOM   2003 N  N   . ASN A 1  262 ? -27.943 -35.541 52.782  1.00 34.29  ? 261 ASN A N   1 
ATOM   2004 C  CA  . ASN A 1  262 ? -28.751 -34.361 52.541  1.00 36.31  ? 261 ASN A CA  1 
ATOM   2005 C  C   . ASN A 1  262 ? -30.055 -34.724 51.841  1.00 37.11  ? 261 ASN A C   1 
ATOM   2006 O  O   . ASN A 1  262 ? -30.057 -35.248 50.732  1.00 40.08  ? 261 ASN A O   1 
ATOM   2007 C  CB  . ASN A 1  262 ? -27.953 -33.349 51.734  1.00 37.22  ? 261 ASN A CB  1 
ATOM   2008 C  CG  . ASN A 1  262 ? -26.588 -33.068 52.361  1.00 43.50  ? 261 ASN A CG  1 
ATOM   2009 O  OD1 . ASN A 1  262 ? -26.485 -32.832 53.580  1.00 31.69  ? 261 ASN A OD1 1 
ATOM   2010 N  ND2 . ASN A 1  262 ? -25.532 -33.149 51.548  1.00 39.40  ? 261 ASN A ND2 1 
ATOM   2011 N  N   . ARG A 1  263 ? -31.160 -34.454 52.510  1.00 39.44  ? 262 ARG A N   1 
ATOM   2012 C  CA  . ARG A 1  263 ? -32.483 -34.709 51.966  1.00 41.58  ? 262 ARG A CA  1 
ATOM   2013 C  C   . ARG A 1  263 ? -32.843 -33.632 50.997  1.00 43.17  ? 262 ARG A C   1 
ATOM   2014 O  O   . ARG A 1  263 ? -32.456 -32.486 51.167  1.00 46.86  ? 262 ARG A O   1 
ATOM   2015 C  CB  . ARG A 1  263 ? -33.518 -34.705 53.089  1.00 42.18  ? 262 ARG A CB  1 
ATOM   2016 C  CG  . ARG A 1  263 ? -33.411 -35.894 54.032  1.00 44.25  ? 262 ARG A CG  1 
ATOM   2017 C  CD  . ARG A 1  263 ? -33.857 -37.201 53.350  1.00 37.98  ? 262 ARG A CD  1 
ATOM   2018 N  NE  . ARG A 1  263 ? -33.737 -38.312 54.278  1.00 34.56  ? 262 ARG A NE  1 
ATOM   2019 C  CZ  . ARG A 1  263 ? -33.961 -39.584 53.992  1.00 37.24  ? 262 ARG A CZ  1 
ATOM   2020 N  NH1 . ARG A 1  263 ? -34.377 -39.964 52.786  1.00 43.22  ? 262 ARG A NH1 1 
ATOM   2021 N  NH2 . ARG A 1  263 ? -33.807 -40.483 54.942  1.00 41.04  ? 262 ARG A NH2 1 
ATOM   2022 N  N   . GLY A 1  264 ? -33.597 -34.008 49.983  1.00 46.47  ? 263 GLY A N   1 
ATOM   2023 C  CA  . GLY A 1  264 ? -34.215 -33.061 49.061  1.00 50.43  ? 263 GLY A CA  1 
ATOM   2024 C  C   . GLY A 1  264 ? -35.408 -33.682 48.326  1.00 53.99  ? 263 GLY A C   1 
ATOM   2025 O  O   . GLY A 1  264 ? -35.359 -34.836 47.886  1.00 55.28  ? 263 GLY A O   1 
ATOM   2026 N  N   . SER A 1  265 ? -36.479 -32.908 48.185  1.00 56.89  ? 264 SER A N   1 
ATOM   2027 C  CA  . SER A 1  265 ? -37.611 -33.299 47.339  1.00 56.71  ? 264 SER A CA  1 
ATOM   2028 C  C   . SER A 1  265 ? -37.226 -33.201 45.869  1.00 54.89  ? 264 SER A C   1 
ATOM   2029 O  O   . SER A 1  265 ? -36.207 -32.590 45.513  1.00 56.49  ? 264 SER A O   1 
ATOM   2030 C  CB  . SER A 1  265 ? -38.798 -32.355 47.566  1.00 58.59  ? 264 SER A CB  1 
ATOM   2031 O  OG  . SER A 1  265 ? -38.673 -31.189 46.759  1.00 57.31  ? 264 SER A OG  1 
ATOM   2032 N  N   . GLY A 1  266 A -38.072 -33.759 45.015  1.00 50.75  ? 264 GLY A N   1 
ATOM   2033 C  CA  . GLY A 1  266 A -37.861 -33.670 43.575  1.00 49.37  ? 264 GLY A CA  1 
ATOM   2034 C  C   . GLY A 1  266 A -36.835 -34.617 42.971  1.00 48.29  ? 264 GLY A C   1 
ATOM   2035 O  O   . GLY A 1  266 A -36.494 -34.466 41.798  1.00 48.21  ? 264 GLY A O   1 
ATOM   2036 N  N   . SER A 1  267 ? -36.342 -35.588 43.753  1.00 47.83  ? 265 SER A N   1 
ATOM   2037 C  CA  . SER A 1  267 ? -35.250 -36.501 43.312  1.00 45.08  ? 265 SER A CA  1 
ATOM   2038 C  C   . SER A 1  267 ? -35.791 -37.910 43.278  1.00 41.21  ? 265 SER A C   1 
ATOM   2039 O  O   . SER A 1  267 ? -36.917 -38.137 43.665  1.00 44.55  ? 265 SER A O   1 
ATOM   2040 C  CB  . SER A 1  267 ? -34.044 -36.409 44.246  1.00 44.23  ? 265 SER A CB  1 
ATOM   2041 O  OG  . SER A 1  267 ? -33.042 -37.339 43.893  1.00 43.92  ? 265 SER A OG  1 
ATOM   2042 N  N   . GLY A 1  268 ? -35.006 -38.867 42.820  1.00 37.22  ? 266 GLY A N   1 
ATOM   2043 C  CA  . GLY A 1  268 ? -35.511 -40.224 42.676  1.00 34.53  ? 266 GLY A CA  1 
ATOM   2044 C  C   . GLY A 1  268 ? -34.593 -41.121 41.872  1.00 33.13  ? 266 GLY A C   1 
ATOM   2045 O  O   . GLY A 1  268 ? -33.614 -40.667 41.324  1.00 33.16  ? 266 GLY A O   1 
ATOM   2046 N  N   . ILE A 1  269 ? -34.962 -42.393 41.798  1.00 35.07  ? 267 ILE A N   1 
ATOM   2047 C  CA  . ILE A 1  269 ? -34.197 -43.410 41.119  1.00 36.55  ? 267 ILE A CA  1 
ATOM   2048 C  C   . ILE A 1  269 ? -34.973 -43.843 39.863  1.00 33.56  ? 267 ILE A C   1 
ATOM   2049 O  O   . ILE A 1  269 ? -36.144 -44.125 39.942  1.00 34.70  ? 267 ILE A O   1 
ATOM   2050 C  CB  . ILE A 1  269 ? -33.958 -44.631 42.051  1.00 35.80  ? 267 ILE A CB  1 
ATOM   2051 C  CG1 . ILE A 1  269 ? -33.211 -44.194 43.312  1.00 40.89  ? 267 ILE A CG1 1 
ATOM   2052 C  CG2 . ILE A 1  269 ? -33.173 -45.709 41.347  1.00 26.48  ? 267 ILE A CG2 1 
ATOM   2053 C  CD1 . ILE A 1  269 ? -33.356 -45.205 44.471  1.00 39.53  ? 267 ILE A CD1 1 
ATOM   2054 N  N   . ILE A 1  270 ? -34.323 -43.852 38.702  1.00 31.88  ? 268 ILE A N   1 
ATOM   2055 C  CA  . ILE A 1  270 ? -34.985 -44.326 37.505  1.00 33.88  ? 268 ILE A CA  1 
ATOM   2056 C  C   . ILE A 1  270 ? -34.163 -45.373 36.781  1.00 34.52  ? 268 ILE A C   1 
ATOM   2057 O  O   . ILE A 1  270 ? -32.942 -45.399 36.911  1.00 37.13  ? 268 ILE A O   1 
ATOM   2058 C  CB  . ILE A 1  270 ? -35.313 -43.190 36.527  1.00 32.91  ? 268 ILE A CB  1 
ATOM   2059 C  CG1 . ILE A 1  270 ? -34.065 -42.656 35.893  1.00 26.14  ? 268 ILE A CG1 1 
ATOM   2060 C  CG2 . ILE A 1  270 ? -36.118 -42.076 37.193  1.00 33.77  ? 268 ILE A CG2 1 
ATOM   2061 C  CD1 . ILE A 1  270 ? -34.327 -41.479 34.948  1.00 26.74  ? 268 ILE A CD1 1 
ATOM   2062 N  N   . THR A 1  271 ? -34.842 -46.220 36.005  1.00 34.45  ? 269 THR A N   1 
ATOM   2063 C  CA  . THR A 1  271 ? -34.168 -47.148 35.125  1.00 33.06  ? 269 THR A CA  1 
ATOM   2064 C  C   . THR A 1  271 ? -34.269 -46.648 33.672  1.00 31.26  ? 269 THR A C   1 
ATOM   2065 O  O   . THR A 1  271 ? -35.350 -46.480 33.136  1.00 32.08  ? 269 THR A O   1 
ATOM   2066 C  CB  . THR A 1  271 ? -34.714 -48.569 35.287  1.00 34.60  ? 269 THR A CB  1 
ATOM   2067 O  OG1 . THR A 1  271 ? -34.774 -48.912 36.684  1.00 35.00  ? 269 THR A OG1 1 
ATOM   2068 C  CG2 . THR A 1  271 ? -33.793 -49.547 34.588  1.00 36.99  ? 269 THR A CG2 1 
ATOM   2069 N  N   . SER A 1  272 ? -33.131 -46.378 33.061  1.00 27.60  ? 270 SER A N   1 
ATOM   2070 C  CA  . SER A 1  272 ? -33.101 -45.896 31.710  1.00 29.75  ? 270 SER A CA  1 
ATOM   2071 C  C   . SER A 1  272 ? -31.810 -46.300 31.045  1.00 30.39  ? 270 SER A C   1 
ATOM   2072 O  O   . SER A 1  272 ? -30.760 -46.256 31.655  1.00 32.44  ? 270 SER A O   1 
ATOM   2073 C  CB  . SER A 1  272 ? -33.176 -44.380 31.683  1.00 28.22  ? 270 SER A CB  1 
ATOM   2074 O  OG  . SER A 1  272 ? -32.951 -43.940 30.360  1.00 34.62  ? 270 SER A OG  1 
ATOM   2075 N  N   . ASP A 1  273 ? -31.893 -46.670 29.773  1.00 32.71  ? 271 ASP A N   1 
ATOM   2076 C  CA  . ASP A 1  273 ? -30.705 -46.899 28.962  1.00 33.42  ? 271 ASP A CA  1 
ATOM   2077 C  C   . ASP A 1  273 ? -30.407 -45.705 28.035  1.00 33.69  ? 271 ASP A C   1 
ATOM   2078 O  O   . ASP A 1  273 ? -29.489 -45.751 27.240  1.00 35.30  ? 271 ASP A O   1 
ATOM   2079 C  CB  . ASP A 1  273 ? -30.872 -48.180 28.138  1.00 34.48  ? 271 ASP A CB  1 
ATOM   2080 C  CG  . ASP A 1  273 ? -30.869 -49.437 28.992  1.00 35.75  ? 271 ASP A CG  1 
ATOM   2081 O  OD1 . ASP A 1  273 ? -30.118 -49.508 29.987  1.00 36.57  ? 271 ASP A OD1 1 
ATOM   2082 O  OD2 . ASP A 1  273 ? -31.591 -50.385 28.634  1.00 34.00  ? 271 ASP A OD2 1 
ATOM   2083 N  N   . ALA A 1  274 ? -31.170 -44.630 28.127  1.00 31.90  ? 272 ALA A N   1 
ATOM   2084 C  CA  . ALA A 1  274 ? -30.865 -43.448 27.321  1.00 33.03  ? 272 ALA A CA  1 
ATOM   2085 C  C   . ALA A 1  274 ? -29.512 -42.869 27.746  1.00 32.45  ? 272 ALA A C   1 
ATOM   2086 O  O   . ALA A 1  274 ? -29.020 -43.098 28.878  1.00 34.60  ? 272 ALA A O   1 
ATOM   2087 C  CB  . ALA A 1  274 ? -31.998 -42.365 27.435  1.00 32.12  ? 272 ALA A CB  1 
ATOM   2088 N  N   . PRO A 1  275 ? -28.874 -42.143 26.828  1.00 31.55  ? 273 PRO A N   1 
ATOM   2089 C  CA  . PRO A 1  275 ? -27.563 -41.630 27.167  1.00 32.41  ? 273 PRO A CA  1 
ATOM   2090 C  C   . PRO A 1  275 ? -27.623 -40.276 27.890  1.00 34.42  ? 273 PRO A C   1 
ATOM   2091 O  O   . PRO A 1  275 ? -28.478 -39.436 27.579  1.00 31.79  ? 273 PRO A O   1 
ATOM   2092 C  CB  . PRO A 1  275 ? -26.873 -41.523 25.791  1.00 28.73  ? 273 PRO A CB  1 
ATOM   2093 C  CG  . PRO A 1  275 ? -27.980 -41.358 24.844  1.00 30.43  ? 273 PRO A CG  1 
ATOM   2094 C  CD  . PRO A 1  275 ? -29.125 -42.124 25.376  1.00 29.20  ? 273 PRO A CD  1 
ATOM   2095 N  N   . VAL A 1  276 ? -26.704 -40.076 28.832  1.00 36.21  ? 274 VAL A N   1 
ATOM   2096 C  CA  . VAL A 1  276 ? -26.548 -38.802 29.508  1.00 36.14  ? 274 VAL A CA  1 
ATOM   2097 C  C   . VAL A 1  276 ? -25.812 -37.857 28.588  1.00 38.58  ? 274 VAL A C   1 
ATOM   2098 O  O   . VAL A 1  276 ? -24.931 -38.263 27.868  1.00 42.93  ? 274 VAL A O   1 
ATOM   2099 C  CB  . VAL A 1  276 ? -25.780 -38.942 30.831  1.00 37.69  ? 274 VAL A CB  1 
ATOM   2100 C  CG1 . VAL A 1  276 ? -25.292 -37.580 31.351  1.00 36.10  ? 274 VAL A CG1 1 
ATOM   2101 C  CG2 . VAL A 1  276 ? -26.629 -39.615 31.872  1.00 30.23  ? 274 VAL A CG2 1 
ATOM   2102 N  N   . HIS A 1  277 ? -26.202 -36.591 28.599  1.00 39.09  ? 275 HIS A N   1 
ATOM   2103 C  CA  . HIS A 1  277 ? -25.586 -35.577 27.764  1.00 38.49  ? 275 HIS A CA  1 
ATOM   2104 C  C   . HIS A 1  277 ? -25.575 -34.286 28.552  1.00 39.21  ? 275 HIS A C   1 
ATOM   2105 O  O   . HIS A 1  277 ? -26.240 -34.182 29.579  1.00 42.01  ? 275 HIS A O   1 
ATOM   2106 C  CB  . HIS A 1  277 ? -26.341 -35.425 26.435  1.00 37.24  ? 275 HIS A CB  1 
ATOM   2107 C  CG  . HIS A 1  277 ? -25.983 -36.469 25.421  1.00 48.41  ? 275 HIS A CG  1 
ATOM   2108 N  ND1 . HIS A 1  277 ? -24.991 -36.282 24.480  1.00 58.71  ? 275 HIS A ND1 1 
ATOM   2109 C  CD2 . HIS A 1  277 ? -26.467 -37.719 25.212  1.00 53.59  ? 275 HIS A CD2 1 
ATOM   2110 C  CE1 . HIS A 1  277 ? -24.883 -37.369 23.735  1.00 60.05  ? 275 HIS A CE1 1 
ATOM   2111 N  NE2 . HIS A 1  277 ? -25.768 -38.256 24.156  1.00 54.72  ? 275 HIS A NE2 1 
ATOM   2112 N  N   . ASP A 1  278 ? -24.823 -33.302 28.093  1.00 40.34  ? 276 ASP A N   1 
ATOM   2113 C  CA  . ASP A 1  278 ? -24.785 -32.026 28.778  1.00 42.24  ? 276 ASP A CA  1 
ATOM   2114 C  C   . ASP A 1  278 ? -25.897 -31.151 28.191  1.00 41.05  ? 276 ASP A C   1 
ATOM   2115 O  O   . ASP A 1  278 ? -25.682 -30.282 27.358  1.00 43.90  ? 276 ASP A O   1 
ATOM   2116 C  CB  . ASP A 1  278 ? -23.391 -31.394 28.687  1.00 43.60  ? 276 ASP A CB  1 
ATOM   2117 C  CG  . ASP A 1  278 ? -23.138 -30.390 29.807  1.00 52.55  ? 276 ASP A CG  1 
ATOM   2118 O  OD1 . ASP A 1  278 ? -23.701 -29.278 29.763  1.00 61.92  ? 276 ASP A OD1 1 
ATOM   2119 O  OD2 . ASP A 1  278 ? -22.386 -30.721 30.744  1.00 62.57  ? 276 ASP A OD2 1 
ATOM   2120 N  N   . CYS A 1  279 ? -27.114 -31.461 28.607  1.00 40.30  ? 277 CYS A N   1 
ATOM   2121 C  CA  . CYS A 1  279 ? -28.303 -30.692 28.277  1.00 38.91  ? 277 CYS A CA  1 
ATOM   2122 C  C   . CYS A 1  279 ? -28.954 -30.320 29.610  1.00 33.72  ? 277 CYS A C   1 
ATOM   2123 O  O   . CYS A 1  279 ? -28.635 -30.879 30.645  1.00 30.38  ? 277 CYS A O   1 
ATOM   2124 C  CB  . CYS A 1  279 ? -29.264 -31.493 27.382  1.00 39.92  ? 277 CYS A CB  1 
ATOM   2125 S  SG  . CYS A 1  279 ? -29.414 -33.272 27.794  1.00 46.75  ? 277 CYS A SG  1 
ATOM   2126 N  N   . ASN A 1  280 ? -29.801 -29.311 29.588  1.00 34.21  ? 278 ASN A N   1 
ATOM   2127 C  CA  . ASN A 1  280 ? -30.584 -28.979 30.746  1.00 34.66  ? 278 ASN A CA  1 
ATOM   2128 C  C   . ASN A 1  280 ? -32.087 -29.108 30.447  1.00 33.85  ? 278 ASN A C   1 
ATOM   2129 O  O   . ASN A 1  280 ? -32.572 -28.820 29.354  1.00 32.13  ? 278 ASN A O   1 
ATOM   2130 C  CB  . ASN A 1  280 ? -30.214 -27.597 31.293  1.00 37.88  ? 278 ASN A CB  1 
ATOM   2131 C  CG  . ASN A 1  280 ? -30.455 -27.498 32.811  1.00 51.57  ? 278 ASN A CG  1 
ATOM   2132 O  OD1 . ASN A 1  280 ? -29.733 -28.101 33.619  1.00 62.25  ? 278 ASN A OD1 1 
ATOM   2133 N  ND2 . ASN A 1  280 ? -31.494 -26.756 33.197  1.00 65.68  ? 278 ASN A ND2 1 
ATOM   2134 N  N   . THR A 1  281 ? -32.828 -29.588 31.430  1.00 34.07  ? 279 THR A N   1 
ATOM   2135 C  CA  . THR A 1  281 ? -34.271 -29.744 31.273  1.00 31.66  ? 279 THR A CA  1 
ATOM   2136 C  C   . THR A 1  281 ? -34.917 -29.399 32.587  1.00 29.37  ? 279 THR A C   1 
ATOM   2137 O  O   . THR A 1  281 ? -34.276 -29.472 33.618  1.00 32.56  ? 279 THR A O   1 
ATOM   2138 C  CB  . THR A 1  281 ? -34.597 -31.211 30.876  1.00 29.22  ? 279 THR A CB  1 
ATOM   2139 O  OG1 . THR A 1  281 ? -35.974 -31.320 30.569  1.00 32.55  ? 279 THR A OG1 1 
ATOM   2140 C  CG2 . THR A 1  281 ? -34.266 -32.156 32.024  1.00 29.11  ? 279 THR A CG2 1 
ATOM   2141 N  N   . LYS A 1  282 ? -36.185 -29.027 32.554  1.00 31.88  ? 280 LYS A N   1 
ATOM   2142 C  CA  . LYS A 1  282 ? -37.027 -29.015 33.779  1.00 30.86  ? 280 LYS A CA  1 
ATOM   2143 C  C   . LYS A 1  282 ? -37.813 -30.332 34.009  1.00 27.23  ? 280 LYS A C   1 
ATOM   2144 O  O   . LYS A 1  282 ? -38.299 -30.613 35.120  1.00 26.98  ? 280 LYS A O   1 
ATOM   2145 C  CB  . LYS A 1  282 ? -37.888 -27.740 33.775  1.00 33.65  ? 280 LYS A CB  1 
ATOM   2146 C  CG  . LYS A 1  282 ? -39.371 -27.879 33.818  1.00 43.11  ? 280 LYS A CG  1 
ATOM   2147 C  CD  . LYS A 1  282 ? -40.015 -26.478 33.733  1.00 53.07  ? 280 LYS A CD  1 
ATOM   2148 C  CE  . LYS A 1  282 ? -41.535 -26.528 33.564  1.00 55.47  ? 280 LYS A CE  1 
ATOM   2149 N  NZ  . LYS A 1  282 ? -42.126 -25.158 33.416  1.00 52.95  ? 280 LYS A NZ  1 
ATOM   2150 N  N   . CYS A 1  283 ? -37.835 -31.195 33.000  1.00 27.68  ? 281 CYS A N   1 
ATOM   2151 C  CA  . CYS A 1  283 ? -38.615 -32.441 33.051  1.00 27.36  ? 281 CYS A CA  1 
ATOM   2152 C  C   . CYS A 1  283 ? -37.885 -33.567 32.437  1.00 26.02  ? 281 CYS A C   1 
ATOM   2153 O  O   . CYS A 1  283 ? -37.505 -33.490 31.257  1.00 26.53  ? 281 CYS A O   1 
ATOM   2154 C  CB  . CYS A 1  283 ? -39.937 -32.262 32.308  1.00 30.98  ? 281 CYS A CB  1 
ATOM   2155 S  SG  . CYS A 1  283 ? -40.926 -33.759 32.219  1.00 28.39  ? 281 CYS A SG  1 
ATOM   2156 N  N   . GLN A 1  284 ? -37.650 -34.626 33.217  1.00 27.37  ? 282 GLN A N   1 
ATOM   2157 C  CA  . GLN A 1  284 ? -36.876 -35.768 32.728  1.00 27.94  ? 282 GLN A CA  1 
ATOM   2158 C  C   . GLN A 1  284 ? -37.713 -37.034 32.844  1.00 30.12  ? 282 GLN A C   1 
ATOM   2159 O  O   . GLN A 1  284 ? -38.294 -37.263 33.914  1.00 27.62  ? 282 GLN A O   1 
ATOM   2160 C  CB  . GLN A 1  284 ? -35.589 -35.916 33.549  1.00 26.73  ? 282 GLN A CB  1 
ATOM   2161 C  CG  . GLN A 1  284 ? -34.637 -37.041 33.056  1.00 23.78  ? 282 GLN A CG  1 
ATOM   2162 C  CD  . GLN A 1  284 ? -34.061 -36.738 31.698  1.00 26.93  ? 282 GLN A CD  1 
ATOM   2163 O  OE1 . GLN A 1  284 ? -33.452 -35.699 31.504  1.00 29.82  ? 282 GLN A OE1 1 
ATOM   2164 N  NE2 . GLN A 1  284 ? -34.303 -37.615 30.728  1.00 28.22  ? 282 GLN A NE2 1 
ATOM   2165 N  N   . THR A 1  285 ? -37.792 -37.831 31.761  1.00 29.00  ? 283 THR A N   1 
ATOM   2166 C  CA  . THR A 1  285 ? -38.367 -39.186 31.787  1.00 25.95  ? 283 THR A CA  1 
ATOM   2167 C  C   . THR A 1  285 ? -37.305 -40.213 31.450  1.00 29.20  ? 283 THR A C   1 
ATOM   2168 O  O   . THR A 1  285 ? -36.225 -39.844 30.964  1.00 25.26  ? 283 THR A O   1 
ATOM   2169 C  CB  . THR A 1  285 ? -39.513 -39.403 30.798  1.00 27.81  ? 283 THR A CB  1 
ATOM   2170 O  OG1 . THR A 1  285 ? -39.015 -39.800 29.512  1.00 24.54  ? 283 THR A OG1 1 
ATOM   2171 C  CG2 . THR A 1  285 ? -40.424 -38.148 30.730  1.00 18.49  ? 283 THR A CG2 1 
ATOM   2172 N  N   . PRO A 1  286 ? -37.594 -41.511 31.700  1.00 26.40  ? 284 PRO A N   1 
ATOM   2173 C  CA  . PRO A 1  286 ? -36.584 -42.493 31.365  1.00 28.14  ? 284 PRO A CA  1 
ATOM   2174 C  C   . PRO A 1  286 ? -36.334 -42.666 29.869  1.00 30.20  ? 284 PRO A C   1 
ATOM   2175 O  O   . PRO A 1  286 ? -35.299 -43.206 29.510  1.00 31.83  ? 284 PRO A O   1 
ATOM   2176 C  CB  . PRO A 1  286 ? -37.120 -43.789 31.959  1.00 27.76  ? 284 PRO A CB  1 
ATOM   2177 C  CG  . PRO A 1  286 ? -38.015 -43.380 33.036  1.00 26.21  ? 284 PRO A CG  1 
ATOM   2178 C  CD  . PRO A 1  286 ? -38.603 -42.055 32.610  1.00 25.34  ? 284 PRO A CD  1 
ATOM   2179 N  N   . HIS A 1  287 ? -37.257 -42.255 29.022  1.00 28.71  ? 285 HIS A N   1 
ATOM   2180 C  CA  . HIS A 1  287 ? -37.001 -42.257 27.570  1.00 31.68  ? 285 HIS A CA  1 
ATOM   2181 C  C   . HIS A 1  287 ? -36.208 -41.018 27.118  1.00 31.81  ? 285 HIS A C   1 
ATOM   2182 O  O   . HIS A 1  287 ? -35.633 -41.021 26.056  1.00 33.03  ? 285 HIS A O   1 
ATOM   2183 C  CB  . HIS A 1  287 ? -38.326 -42.223 26.773  1.00 30.16  ? 285 HIS A CB  1 
ATOM   2184 C  CG  . HIS A 1  287 ? -39.140 -43.481 26.848  1.00 24.07  ? 285 HIS A CG  1 
ATOM   2185 N  ND1 . HIS A 1  287 ? -38.618 -44.696 27.219  1.00 30.31  ? 285 HIS A ND1 1 
ATOM   2186 C  CD2 . HIS A 1  287 ? -40.434 -43.711 26.545  1.00 34.54  ? 285 HIS A CD2 1 
ATOM   2187 C  CE1 . HIS A 1  287 ? -39.564 -45.614 27.181  1.00 29.27  ? 285 HIS A CE1 1 
ATOM   2188 N  NE2 . HIS A 1  287 ? -40.674 -45.043 26.773  1.00 35.10  ? 285 HIS A NE2 1 
ATOM   2189 N  N   . GLY A 1  288 ? -36.266 -39.933 27.885  1.00 32.92  ? 286 GLY A N   1 
ATOM   2190 C  CA  . GLY A 1  288 ? -35.663 -38.688 27.470  1.00 31.38  ? 286 GLY A CA  1 
ATOM   2191 C  C   . GLY A 1  288 ? -36.328 -37.489 28.104  1.00 31.32  ? 286 GLY A C   1 
ATOM   2192 O  O   . GLY A 1  288 ? -37.345 -37.615 28.784  1.00 32.14  ? 286 GLY A O   1 
ATOM   2193 N  N   . ALA A 1  289 ? -35.764 -36.324 27.824  1.00 30.43  ? 287 ALA A N   1 
ATOM   2194 C  CA  . ALA A 1  289 ? -36.140 -35.064 28.467  1.00 27.92  ? 287 ALA A CA  1 
ATOM   2195 C  C   . ALA A 1  289 ? -37.213 -34.400 27.703  1.00 27.36  ? 287 ALA A C   1 
ATOM   2196 O  O   . ALA A 1  289 ? -37.238 -34.468 26.473  1.00 32.04  ? 287 ALA A O   1 
ATOM   2197 C  CB  . ALA A 1  289 ? -34.887 -34.113 28.631  1.00 27.83  ? 287 ALA A CB  1 
ATOM   2198 N  N   . ILE A 1  290 ? -38.138 -33.771 28.429  1.00 25.79  ? 288 ILE A N   1 
ATOM   2199 C  CA  . ILE A 1  290 ? -39.211 -32.982 27.830  1.00 24.70  ? 288 ILE A CA  1 
ATOM   2200 C  C   . ILE A 1  290 ? -38.984 -31.456 28.017  1.00 26.11  ? 288 ILE A C   1 
ATOM   2201 O  O   . ILE A 1  290 ? -38.638 -30.999 29.103  1.00 28.91  ? 288 ILE A O   1 
ATOM   2202 C  CB  . ILE A 1  290 ? -40.545 -33.351 28.453  1.00 28.03  ? 288 ILE A CB  1 
ATOM   2203 C  CG1 . ILE A 1  290 ? -40.926 -34.782 28.034  1.00 28.72  ? 288 ILE A CG1 1 
ATOM   2204 C  CG2 . ILE A 1  290 ? -41.660 -32.316 28.073  1.00 24.32  ? 288 ILE A CG2 1 
ATOM   2205 C  CD1 . ILE A 1  290 ? -42.159 -35.373 28.774  1.00 28.56  ? 288 ILE A CD1 1 
ATOM   2206 N  N   . ASN A 1  291 ? -39.169 -30.708 26.948  1.00 25.94  ? 289 ASN A N   1 
ATOM   2207 C  CA  . ASN A 1  291 ? -39.082 -29.278 26.916  1.00 31.82  ? 289 ASN A CA  1 
ATOM   2208 C  C   . ASN A 1  291 ? -40.435 -28.792 26.407  1.00 32.27  ? 289 ASN A C   1 
ATOM   2209 O  O   . ASN A 1  291 ? -40.680 -28.721 25.197  1.00 33.65  ? 289 ASN A O   1 
ATOM   2210 C  CB  . ASN A 1  291 ? -37.990 -28.851 25.917  1.00 33.15  ? 289 ASN A CB  1 
ATOM   2211 C  CG  . ASN A 1  291 ? -37.067 -27.812 26.474  1.00 47.77  ? 289 ASN A CG  1 
ATOM   2212 O  OD1 . ASN A 1  291 ? -36.515 -27.983 27.563  1.00 62.92  ? 289 ASN A OD1 1 
ATOM   2213 N  ND2 . ASN A 1  291 ? -36.856 -26.731 25.716  1.00 65.43  ? 289 ASN A ND2 1 
ATOM   2214 N  N   . SER A 1  292 ? -41.336 -28.468 27.314  1.00 31.84  ? 290 SER A N   1 
ATOM   2215 C  CA  . SER A 1  292 ? -42.736 -28.256 26.895  1.00 28.98  ? 290 SER A CA  1 
ATOM   2216 C  C   . SER A 1  292 ? -43.480 -27.507 27.969  1.00 25.20  ? 290 SER A C   1 
ATOM   2217 O  O   . SER A 1  292 ? -43.187 -27.667 29.139  1.00 27.85  ? 290 SER A O   1 
ATOM   2218 C  CB  . SER A 1  292 ? -43.405 -29.628 26.701  1.00 31.02  ? 290 SER A CB  1 
ATOM   2219 O  OG  . SER A 1  292 ? -44.756 -29.549 26.231  1.00 28.34  ? 290 SER A OG  1 
ATOM   2220 N  N   . SER A 1  293 ? -44.521 -26.813 27.568  1.00 24.62  ? 291 SER A N   1 
ATOM   2221 C  CA  . SER A 1  293 ? -45.405 -26.099 28.468  1.00 25.52  ? 291 SER A CA  1 
ATOM   2222 C  C   . SER A 1  293 ? -46.825 -26.638 28.323  1.00 25.94  ? 291 SER A C   1 
ATOM   2223 O  O   . SER A 1  293 ? -47.764 -26.056 28.834  1.00 25.75  ? 291 SER A O   1 
ATOM   2224 C  CB  . SER A 1  293 ? -45.351 -24.605 28.117  1.00 23.68  ? 291 SER A CB  1 
ATOM   2225 O  OG  . SER A 1  293 ? -44.101 -24.068 28.554  1.00 28.06  ? 291 SER A OG  1 
ATOM   2226 N  N   . LEU A 1  294 ? -46.976 -27.735 27.614  1.00 21.42  ? 292 LEU A N   1 
ATOM   2227 C  CA  . LEU A 1  294 ? -48.286 -28.351 27.444  1.00 24.89  ? 292 LEU A CA  1 
ATOM   2228 C  C   . LEU A 1  294 ? -48.717 -28.997 28.762  1.00 23.42  ? 292 LEU A C   1 
ATOM   2229 O  O   . LEU A 1  294 ? -47.911 -29.424 29.549  1.00 26.12  ? 292 LEU A O   1 
ATOM   2230 C  CB  . LEU A 1  294 ? -48.240 -29.430 26.313  1.00 24.79  ? 292 LEU A CB  1 
ATOM   2231 C  CG  . LEU A 1  294 ? -47.810 -28.930 24.938  1.00 34.23  ? 292 LEU A CG  1 
ATOM   2232 C  CD1 . LEU A 1  294 ? -48.200 -30.007 23.797  1.00 26.92  ? 292 LEU A CD1 1 
ATOM   2233 C  CD2 . LEU A 1  294 ? -48.398 -27.541 24.657  1.00 32.02  ? 292 LEU A CD2 1 
ATOM   2234 N  N   . PRO A 1  295 ? -50.003 -29.136 28.969  1.00 24.52  ? 293 PRO A N   1 
ATOM   2235 C  CA  . PRO A 1  295 ? -50.498 -29.671 30.243  1.00 27.73  ? 293 PRO A CA  1 
ATOM   2236 C  C   . PRO A 1  295 ? -50.491 -31.204 30.380  1.00 29.49  ? 293 PRO A C   1 
ATOM   2237 O  O   . PRO A 1  295 ? -50.520 -31.681 31.498  1.00 29.94  ? 293 PRO A O   1 
ATOM   2238 C  CB  . PRO A 1  295 ? -51.948 -29.226 30.251  1.00 26.53  ? 293 PRO A CB  1 
ATOM   2239 C  CG  . PRO A 1  295 ? -52.296 -29.106 28.786  1.00 28.91  ? 293 PRO A CG  1 
ATOM   2240 C  CD  . PRO A 1  295 ? -51.074 -28.591 28.126  1.00 20.89  ? 293 PRO A CD  1 
ATOM   2241 N  N   . PHE A 1  296 ? -50.440 -31.925 29.262  1.00 26.73  ? 294 PHE A N   1 
ATOM   2242 C  CA  . PHE A 1  296 ? -50.365 -33.380 29.212  1.00 28.29  ? 294 PHE A CA  1 
ATOM   2243 C  C   . PHE A 1  296 ? -49.195 -33.953 28.388  1.00 28.82  ? 294 PHE A C   1 
ATOM   2244 O  O   . PHE A 1  296 ? -48.703 -33.323 27.482  1.00 28.49  ? 294 PHE A O   1 
ATOM   2245 C  CB  . PHE A 1  296 ? -51.628 -33.887 28.561  1.00 24.56  ? 294 PHE A CB  1 
ATOM   2246 C  CG  . PHE A 1  296 ? -52.855 -33.510 29.300  1.00 24.90  ? 294 PHE A CG  1 
ATOM   2247 C  CD1 . PHE A 1  296 ? -53.758 -32.596 28.760  1.00 25.37  ? 294 PHE A CD1 1 
ATOM   2248 C  CD2 . PHE A 1  296 ? -53.094 -34.034 30.549  1.00 23.49  ? 294 PHE A CD2 1 
ATOM   2249 C  CE1 . PHE A 1  296 ? -54.886 -32.252 29.470  1.00 36.09  ? 294 PHE A CE1 1 
ATOM   2250 C  CE2 . PHE A 1  296 ? -54.242 -33.670 31.275  1.00 27.85  ? 294 PHE A CE2 1 
ATOM   2251 C  CZ  . PHE A 1  296 ? -55.100 -32.770 30.756  1.00 26.80  ? 294 PHE A CZ  1 
ATOM   2252 N  N   . GLN A 1  297 ? -48.792 -35.189 28.688  1.00 31.18  ? 295 GLN A N   1 
ATOM   2253 C  CA  . GLN A 1  297 ? -47.782 -35.899 27.885  1.00 28.92  ? 295 GLN A CA  1 
ATOM   2254 C  C   . GLN A 1  297 ? -48.102 -37.381 27.882  1.00 28.52  ? 295 GLN A C   1 
ATOM   2255 O  O   . GLN A 1  297 ? -48.756 -37.840 28.805  1.00 26.77  ? 295 GLN A O   1 
ATOM   2256 C  CB  . GLN A 1  297 ? -46.392 -35.635 28.423  1.00 28.95  ? 295 GLN A CB  1 
ATOM   2257 C  CG  . GLN A 1  297 ? -46.167 -35.889 29.927  1.00 24.44  ? 295 GLN A CG  1 
ATOM   2258 C  CD  . GLN A 1  297 ? -45.568 -37.264 30.275  1.00 30.08  ? 295 GLN A CD  1 
ATOM   2259 O  OE1 . GLN A 1  297 ? -45.220 -38.062 29.403  1.00 26.22  ? 295 GLN A OE1 1 
ATOM   2260 N  NE2 . GLN A 1  297 ? -45.498 -37.552 31.562  1.00 25.28  ? 295 GLN A NE2 1 
ATOM   2261 N  N   . ASN A 1  298 ? -47.704 -38.101 26.827  1.00 26.38  ? 296 ASN A N   1 
ATOM   2262 C  CA  . ASN A 1  298 ? -47.897 -39.532 26.764  1.00 25.23  ? 296 ASN A CA  1 
ATOM   2263 C  C   . ASN A 1  298 ? -46.584 -40.276 26.615  1.00 26.01  ? 296 ASN A C   1 
ATOM   2264 O  O   . ASN A 1  298 ? -46.552 -41.402 26.160  1.00 21.06  ? 296 ASN A O   1 
ATOM   2265 C  CB  . ASN A 1  298 ? -48.882 -39.936 25.671  1.00 25.16  ? 296 ASN A CB  1 
ATOM   2266 C  CG  . ASN A 1  298 ? -48.434 -39.518 24.288  1.00 26.69  ? 296 ASN A CG  1 
ATOM   2267 O  OD1 . ASN A 1  298 ? -47.320 -39.088 24.113  1.00 28.14  ? 296 ASN A OD1 1 
ATOM   2268 N  ND2 . ASN A 1  298 ? -49.307 -39.694 23.294  1.00 20.18  ? 296 ASN A ND2 1 
ATOM   2269 N  N   . ILE A 1  299 ? -45.501 -39.666 27.083  1.00 28.07  ? 297 ILE A N   1 
ATOM   2270 C  CA  . ILE A 1  299 ? -44.181 -40.239 26.913  1.00 25.55  ? 297 ILE A CA  1 
ATOM   2271 C  C   . ILE A 1  299 ? -43.880 -41.294 27.987  1.00 27.95  ? 297 ILE A C   1 
ATOM   2272 O  O   . ILE A 1  299 ? -43.388 -42.355 27.656  1.00 25.95  ? 297 ILE A O   1 
ATOM   2273 C  CB  . ILE A 1  299 ? -43.127 -39.111 26.916  1.00 25.40  ? 297 ILE A CB  1 
ATOM   2274 C  CG1 . ILE A 1  299 ? -43.392 -38.242 25.654  1.00 34.35  ? 297 ILE A CG1 1 
ATOM   2275 C  CG2 . ILE A 1  299 ? -41.695 -39.719 26.879  1.00 24.13  ? 297 ILE A CG2 1 
ATOM   2276 C  CD1 . ILE A 1  299 ? -43.067 -36.810 25.810  1.00 38.89  ? 297 ILE A CD1 1 
ATOM   2277 N  N   . HIS A 1  300 ? -44.166 -41.000 29.268  1.00 24.92  ? 298 HIS A N   1 
ATOM   2278 C  CA  . HIS A 1  300 ? -43.814 -41.905 30.360  1.00 28.74  ? 298 HIS A CA  1 
ATOM   2279 C  C   . HIS A 1  300 ? -44.433 -41.461 31.682  1.00 27.74  ? 298 HIS A C   1 
ATOM   2280 O  O   . HIS A 1  300 ? -44.514 -40.241 31.912  1.00 26.80  ? 298 HIS A O   1 
ATOM   2281 C  CB  . HIS A 1  300 ? -42.296 -41.958 30.530  1.00 29.05  ? 298 HIS A CB  1 
ATOM   2282 C  CG  . HIS A 1  300 ? -41.788 -43.260 31.076  1.00 32.12  ? 298 HIS A CG  1 
ATOM   2283 N  ND1 . HIS A 1  300 ? -41.981 -43.648 32.387  1.00 27.03  ? 298 HIS A ND1 1 
ATOM   2284 C  CD2 . HIS A 1  300 ? -41.031 -44.231 30.506  1.00 30.69  ? 298 HIS A CD2 1 
ATOM   2285 C  CE1 . HIS A 1  300 ? -41.430 -44.836 32.581  1.00 29.82  ? 298 HIS A CE1 1 
ATOM   2286 N  NE2 . HIS A 1  300 ? -40.841 -45.206 31.460  1.00 28.58  ? 298 HIS A NE2 1 
ATOM   2287 N  N   . PRO A 1  301 ? -44.884 -42.436 32.528  1.00 23.76  ? 299 PRO A N   1 
ATOM   2288 C  CA  . PRO A 1  301 ? -45.428 -42.062 33.829  1.00 22.90  ? 299 PRO A CA  1 
ATOM   2289 C  C   . PRO A 1  301 ? -44.389 -41.729 34.801  1.00 22.54  ? 299 PRO A C   1 
ATOM   2290 O  O   . PRO A 1  301 ? -44.683 -41.109 35.823  1.00 26.89  ? 299 PRO A O   1 
ATOM   2291 C  CB  . PRO A 1  301 ? -46.211 -43.307 34.292  1.00 22.96  ? 299 PRO A CB  1 
ATOM   2292 C  CG  . PRO A 1  301 ? -45.500 -44.527 33.553  1.00 22.69  ? 299 PRO A CG  1 
ATOM   2293 C  CD  . PRO A 1  301 ? -45.044 -43.880 32.232  1.00 24.44  ? 299 PRO A CD  1 
ATOM   2294 N  N   . VAL A 1  302 ? -43.156 -42.124 34.544  1.00 23.42  ? 300 VAL A N   1 
ATOM   2295 C  CA  . VAL A 1  302 ? -42.079 -41.818 35.482  1.00 22.86  ? 300 VAL A CA  1 
ATOM   2296 C  C   . VAL A 1  302 ? -41.464 -40.475 35.073  1.00 28.38  ? 300 VAL A C   1 
ATOM   2297 O  O   . VAL A 1  302 ? -41.024 -40.308 33.921  1.00 28.89  ? 300 VAL A O   1 
ATOM   2298 C  CB  . VAL A 1  302 ? -41.029 -42.933 35.530  1.00 26.04  ? 300 VAL A CB  1 
ATOM   2299 C  CG1 . VAL A 1  302 ? -39.766 -42.497 36.281  1.00 22.63  ? 300 VAL A CG1 1 
ATOM   2300 C  CG2 . VAL A 1  302 ? -41.654 -44.234 36.117  1.00 27.11  ? 300 VAL A CG2 1 
ATOM   2301 N  N   . THR A 1  303 ? -41.416 -39.533 36.030  1.00 31.06  ? 301 THR A N   1 
ATOM   2302 C  CA  . THR A 1  303 ? -40.948 -38.164 35.786  1.00 30.82  ? 301 THR A CA  1 
ATOM   2303 C  C   . THR A 1  303 ? -40.130 -37.609 36.952  1.00 33.18  ? 301 THR A C   1 
ATOM   2304 O  O   . THR A 1  303 ? -40.416 -37.894 38.132  1.00 32.57  ? 301 THR A O   1 
ATOM   2305 C  CB  . THR A 1  303 ? -42.128 -37.221 35.454  1.00 32.38  ? 301 THR A CB  1 
ATOM   2306 O  OG1 . THR A 1  303 ? -43.064 -37.162 36.538  1.00 30.20  ? 301 THR A OG1 1 
ATOM   2307 C  CG2 . THR A 1  303 ? -42.842 -37.710 34.228  1.00 23.83  ? 301 THR A CG2 1 
ATOM   2308 N  N   . ILE A 1  304 ? -39.074 -36.864 36.610  1.00 31.29  ? 302 ILE A N   1 
ATOM   2309 C  CA  . ILE A 1  304 ? -38.307 -36.116 37.584  1.00 30.05  ? 302 ILE A CA  1 
ATOM   2310 C  C   . ILE A 1  304 ? -38.458 -34.669 37.183  1.00 31.96  ? 302 ILE A C   1 
ATOM   2311 O  O   . ILE A 1  304 ? -38.237 -34.334 36.024  1.00 28.67  ? 302 ILE A O   1 
ATOM   2312 C  CB  . ILE A 1  304 ? -36.833 -36.423 37.534  1.00 30.41  ? 302 ILE A CB  1 
ATOM   2313 C  CG1 . ILE A 1  304 ? -36.553 -37.941 37.466  1.00 30.60  ? 302 ILE A CG1 1 
ATOM   2314 C  CG2 . ILE A 1  304 ? -36.144 -35.764 38.756  1.00 31.03  ? 302 ILE A CG2 1 
ATOM   2315 C  CD1 . ILE A 1  304 ? -36.448 -38.647 38.814  1.00 26.75  ? 302 ILE A CD1 1 
ATOM   2316 N  N   . GLY A 1  305 ? -38.853 -33.812 38.127  1.00 34.03  ? 303 GLY A N   1 
ATOM   2317 C  CA  . GLY A 1  305 ? -38.874 -32.368 37.892  1.00 30.77  ? 303 GLY A CA  1 
ATOM   2318 C  C   . GLY A 1  305 ? -40.294 -31.881 37.858  1.00 29.82  ? 303 GLY A C   1 
ATOM   2319 O  O   . GLY A 1  305 ? -41.060 -32.206 38.739  1.00 33.54  ? 303 GLY A O   1 
ATOM   2320 N  N   . GLU A 1  306 ? -40.640 -31.079 36.861  1.00 27.53  ? 304 GLU A N   1 
ATOM   2321 C  CA  . GLU A 1  306 ? -41.938 -30.527 36.758  1.00 27.06  ? 304 GLU A CA  1 
ATOM   2322 C  C   . GLU A 1  306 ? -42.369 -30.768 35.358  1.00 27.48  ? 304 GLU A C   1 
ATOM   2323 O  O   . GLU A 1  306 ? -41.873 -30.099 34.422  1.00 25.42  ? 304 GLU A O   1 
ATOM   2324 C  CB  . GLU A 1  306 ? -41.951 -28.996 36.988  1.00 28.23  ? 304 GLU A CB  1 
ATOM   2325 C  CG  . GLU A 1  306 ? -41.403 -28.524 38.313  1.00 43.35  ? 304 GLU A CG  1 
ATOM   2326 C  CD  . GLU A 1  306 ? -41.191 -27.005 38.333  1.00 55.48  ? 304 GLU A CD  1 
ATOM   2327 O  OE1 . GLU A 1  306 ? -42.054 -26.272 37.784  1.00 51.39  ? 304 GLU A OE1 1 
ATOM   2328 O  OE2 . GLU A 1  306 ? -40.149 -26.566 38.882  1.00 58.01  ? 304 GLU A OE2 1 
ATOM   2329 N  N   . CYS A 1  307 ? -43.393 -31.604 35.217  1.00 25.21  ? 305 CYS A N   1 
ATOM   2330 C  CA  . CYS A 1  307 ? -43.698 -32.218 33.947  1.00 22.78  ? 305 CYS A CA  1 
ATOM   2331 C  C   . CYS A 1  307 ? -45.141 -32.044 33.646  1.00 27.45  ? 305 CYS A C   1 
ATOM   2332 O  O   . CYS A 1  307 ? -45.926 -31.785 34.547  1.00 26.84  ? 305 CYS A O   1 
ATOM   2333 C  CB  . CYS A 1  307 ? -43.369 -33.696 34.043  1.00 24.60  ? 305 CYS A CB  1 
ATOM   2334 S  SG  . CYS A 1  307 ? -41.585 -34.026 34.197  1.00 30.35  ? 305 CYS A SG  1 
ATOM   2335 N  N   . PRO A 1  308 ? -45.506 -32.163 32.379  1.00 26.35  ? 306 PRO A N   1 
ATOM   2336 C  CA  . PRO A 1  308 ? -46.916 -32.339 32.102  1.00 26.30  ? 306 PRO A CA  1 
ATOM   2337 C  C   . PRO A 1  308 ? -47.456 -33.654 32.706  1.00 27.56  ? 306 PRO A C   1 
ATOM   2338 O  O   . PRO A 1  308 ? -46.718 -34.612 32.939  1.00 24.08  ? 306 PRO A O   1 
ATOM   2339 C  CB  . PRO A 1  308 ? -46.970 -32.408 30.568  1.00 25.56  ? 306 PRO A CB  1 
ATOM   2340 C  CG  . PRO A 1  308 ? -45.595 -31.905 30.063  1.00 30.70  ? 306 PRO A CG  1 
ATOM   2341 C  CD  . PRO A 1  308 ? -44.651 -32.172 31.182  1.00 30.45  ? 306 PRO A CD  1 
ATOM   2342 N  N   . LYS A 1  309 ? -48.752 -33.699 32.888  1.00 30.47  ? 307 LYS A N   1 
ATOM   2343 C  CA  . LYS A 1  309 ? -49.436 -34.862 33.451  1.00 29.36  ? 307 LYS A CA  1 
ATOM   2344 C  C   . LYS A 1  309 ? -49.499 -36.017 32.441  1.00 28.36  ? 307 LYS A C   1 
ATOM   2345 O  O   . LYS A 1  309 ? -49.930 -35.820 31.310  1.00 26.51  ? 307 LYS A O   1 
ATOM   2346 C  CB  . LYS A 1  309 ? -50.831 -34.404 33.838  1.00 25.27  ? 307 LYS A CB  1 
ATOM   2347 C  CG  . LYS A 1  309 ? -51.719 -35.482 34.517  1.00 30.48  ? 307 LYS A CG  1 
ATOM   2348 C  CD  . LYS A 1  309 ? -51.225 -35.750 35.922  1.00 51.50  ? 307 LYS A CD  1 
ATOM   2349 C  CE  . LYS A 1  309 ? -52.278 -36.410 36.810  1.00 49.30  ? 307 LYS A CE  1 
ATOM   2350 N  NZ  . LYS A 1  309 ? -51.685 -36.668 38.145  1.00 34.19  ? 307 LYS A NZ  1 
ATOM   2351 N  N   . TYR A 1  310 ? -49.049 -37.196 32.859  1.00 26.32  ? 308 TYR A N   1 
ATOM   2352 C  CA  . TYR A 1  310 ? -49.080 -38.404 32.032  1.00 25.36  ? 308 TYR A CA  1 
ATOM   2353 C  C   . TYR A 1  310 ? -50.503 -38.908 31.851  1.00 24.54  ? 308 TYR A C   1 
ATOM   2354 O  O   . TYR A 1  310 ? -51.243 -38.971 32.814  1.00 25.99  ? 308 TYR A O   1 
ATOM   2355 C  CB  . TYR A 1  310 ? -48.217 -39.548 32.648  1.00 25.89  ? 308 TYR A CB  1 
ATOM   2356 C  CG  . TYR A 1  310 ? -48.202 -40.761 31.728  1.00 20.59  ? 308 TYR A CG  1 
ATOM   2357 C  CD1 . TYR A 1  310 ? -47.548 -40.720 30.514  1.00 18.38  ? 308 TYR A CD1 1 
ATOM   2358 C  CD2 . TYR A 1  310 ? -48.886 -41.900 32.042  1.00 25.65  ? 308 TYR A CD2 1 
ATOM   2359 C  CE1 . TYR A 1  310 ? -47.530 -41.832 29.657  1.00 22.21  ? 308 TYR A CE1 1 
ATOM   2360 C  CE2 . TYR A 1  310 ? -48.872 -42.986 31.220  1.00 27.07  ? 308 TYR A CE2 1 
ATOM   2361 C  CZ  . TYR A 1  310 ? -48.186 -42.963 30.042  1.00 24.75  ? 308 TYR A CZ  1 
ATOM   2362 O  OH  . TYR A 1  310 ? -48.215 -44.094 29.247  1.00 28.01  ? 308 TYR A OH  1 
ATOM   2363 N  N   . VAL A 1  311 ? -50.893 -39.160 30.599  1.00 22.43  ? 309 VAL A N   1 
ATOM   2364 C  CA  . VAL A 1  311 ? -52.150 -39.760 30.224  1.00 20.21  ? 309 VAL A CA  1 
ATOM   2365 C  C   . VAL A 1  311 ? -51.905 -40.771 29.103  1.00 21.70  ? 309 VAL A C   1 
ATOM   2366 O  O   . VAL A 1  311 ? -50.886 -40.698 28.434  1.00 22.84  ? 309 VAL A O   1 
ATOM   2367 C  CB  . VAL A 1  311 ? -53.174 -38.767 29.707  1.00 22.74  ? 309 VAL A CB  1 
ATOM   2368 C  CG1 . VAL A 1  311 ? -53.687 -37.826 30.847  1.00 20.59  ? 309 VAL A CG1 1 
ATOM   2369 C  CG2 . VAL A 1  311 ? -52.581 -37.902 28.552  1.00 23.00  ? 309 VAL A CG2 1 
ATOM   2370 N  N   . ARG A 1  312 ? -52.847 -41.694 28.876  1.00 19.55  ? 310 ARG A N   1 
ATOM   2371 C  CA  . ARG A 1  312 ? -52.685 -42.699 27.815  1.00 24.82  ? 310 ARG A CA  1 
ATOM   2372 C  C   . ARG A 1  312 ? -53.075 -42.200 26.430  1.00 24.30  ? 310 ARG A C   1 
ATOM   2373 O  O   . ARG A 1  312 ? -52.916 -42.898 25.463  1.00 27.96  ? 310 ARG A O   1 
ATOM   2374 C  CB  . ARG A 1  312 ? -53.547 -43.937 28.101  1.00 20.41  ? 310 ARG A CB  1 
ATOM   2375 C  CG  . ARG A 1  312 ? -53.190 -44.623 29.384  1.00 23.88  ? 310 ARG A CG  1 
ATOM   2376 C  CD  . ARG A 1  312 ? -53.914 -45.991 29.414  1.00 28.99  ? 310 ARG A CD  1 
ATOM   2377 N  NE  . ARG A 1  312 ? -53.545 -46.694 30.640  1.00 37.43  ? 310 ARG A NE  1 
ATOM   2378 C  CZ  . ARG A 1  312 ? -54.326 -46.750 31.705  1.00 31.46  ? 310 ARG A CZ  1 
ATOM   2379 N  NH1 . ARG A 1  312 ? -55.511 -46.168 31.665  1.00 37.80  ? 310 ARG A NH1 1 
ATOM   2380 N  NH2 . ARG A 1  312 ? -53.931 -47.394 32.808  1.00 29.30  ? 310 ARG A NH2 1 
ATOM   2381 N  N   . SER A 1  313 ? -53.667 -41.038 26.367  1.00 23.55  ? 311 SER A N   1 
ATOM   2382 C  CA  . SER A 1  313 ? -54.204 -40.485 25.141  1.00 23.97  ? 311 SER A CA  1 
ATOM   2383 C  C   . SER A 1  313 ? -53.162 -40.402 24.013  1.00 22.22  ? 311 SER A C   1 
ATOM   2384 O  O   . SER A 1  313 ? -51.991 -40.133 24.269  1.00 25.78  ? 311 SER A O   1 
ATOM   2385 C  CB  . SER A 1  313 ? -54.679 -39.084 25.461  1.00 24.32  ? 311 SER A CB  1 
ATOM   2386 O  OG  . SER A 1  313 ? -55.543 -39.066 26.588  1.00 23.29  ? 311 SER A OG  1 
ATOM   2387 N  N   . THR A 1  314 ? -53.585 -40.614 22.786  1.00 23.65  ? 312 THR A N   1 
ATOM   2388 C  CA  . THR A 1  314 ? -52.705 -40.392 21.656  1.00 28.17  ? 312 THR A CA  1 
ATOM   2389 C  C   . THR A 1  314 ? -53.070 -39.077 20.949  1.00 29.08  ? 312 THR A C   1 
ATOM   2390 O  O   . THR A 1  314 ? -52.300 -38.624 20.122  1.00 29.22  ? 312 THR A O   1 
ATOM   2391 C  CB  . THR A 1  314 ? -52.852 -41.510 20.665  1.00 31.02  ? 312 THR A CB  1 
ATOM   2392 O  OG1 . THR A 1  314 ? -54.244 -41.619 20.379  1.00 28.52  ? 312 THR A OG1 1 
ATOM   2393 C  CG2 . THR A 1  314 ? -52.348 -42.838 21.244  1.00 26.45  ? 312 THR A CG2 1 
ATOM   2394 N  N   . LYS A 1  315 ? -54.234 -38.498 21.253  1.00 28.73  ? 313 LYS A N   1 
ATOM   2395 C  CA  . LYS A 1  315 ? -54.685 -37.221 20.656  1.00 30.39  ? 313 LYS A CA  1 
ATOM   2396 C  C   . LYS A 1  315 ? -55.537 -36.426 21.629  1.00 28.27  ? 313 LYS A C   1 
ATOM   2397 O  O   . LYS A 1  315 ? -56.450 -36.970 22.244  1.00 25.25  ? 313 LYS A O   1 
ATOM   2398 C  CB  . LYS A 1  315 ? -55.500 -37.442 19.362  1.00 33.44  ? 313 LYS A CB  1 
ATOM   2399 C  CG  . LYS A 1  315 ? -55.853 -36.078 18.646  1.00 39.04  ? 313 LYS A CG  1 
ATOM   2400 C  CD  . LYS A 1  315 ? -56.643 -36.197 17.312  1.00 38.04  ? 313 LYS A CD  1 
ATOM   2401 C  CE  . LYS A 1  315 ? -57.360 -34.804 16.977  1.00 40.07  ? 313 LYS A CE  1 
ATOM   2402 N  NZ  . LYS A 1  315 ? -57.601 -34.554 15.548  1.00 38.43  ? 313 LYS A NZ  1 
ATOM   2403 N  N   . LEU A 1  316 ? -55.194 -35.161 21.819  1.00 23.23  ? 314 LEU A N   1 
ATOM   2404 C  CA  . LEU A 1  316 ? -55.998 -34.245 22.605  1.00 27.86  ? 314 LEU A CA  1 
ATOM   2405 C  C   . LEU A 1  316 ? -55.894 -32.871 21.985  1.00 25.02  ? 314 LEU A C   1 
ATOM   2406 O  O   . LEU A 1  316 ? -55.065 -32.087 22.401  1.00 27.13  ? 314 LEU A O   1 
ATOM   2407 C  CB  . LEU A 1  316 ? -55.568 -34.166 24.081  1.00 31.29  ? 314 LEU A CB  1 
ATOM   2408 C  CG  . LEU A 1  316 ? -55.818 -35.347 25.008  1.00 40.10  ? 314 LEU A CG  1 
ATOM   2409 C  CD1 . LEU A 1  316 ? -54.987 -35.192 26.274  1.00 32.32  ? 314 LEU A CD1 1 
ATOM   2410 C  CD2 . LEU A 1  316 ? -57.312 -35.535 25.308  1.00 32.55  ? 314 LEU A CD2 1 
ATOM   2411 N  N   . ARG A 1  317 ? -56.736 -32.586 20.995  1.00 24.34  ? 315 ARG A N   1 
ATOM   2412 C  CA  . ARG A 1  317 ? -56.705 -31.290 20.304  1.00 22.82  ? 315 ARG A CA  1 
ATOM   2413 C  C   . ARG A 1  317 ? -57.993 -30.538 20.669  1.00 24.24  ? 315 ARG A C   1 
ATOM   2414 O  O   . ARG A 1  317 ? -59.097 -31.066 20.514  1.00 23.23  ? 315 ARG A O   1 
ATOM   2415 C  CB  . ARG A 1  317 ? -56.586 -31.506 18.810  1.00 22.51  ? 315 ARG A CB  1 
ATOM   2416 C  CG  . ARG A 1  317 ? -56.325 -30.210 18.123  1.00 29.96  ? 315 ARG A CG  1 
ATOM   2417 C  CD  . ARG A 1  317 ? -56.024 -30.390 16.620  1.00 28.29  ? 315 ARG A CD  1 
ATOM   2418 N  NE  . ARG A 1  317 ? -54.631 -30.651 16.555  1.00 34.91  ? 315 ARG A NE  1 
ATOM   2419 C  CZ  . ARG A 1  317 ? -53.693 -29.733 16.476  1.00 33.57  ? 315 ARG A CZ  1 
ATOM   2420 N  NH1 . ARG A 1  317 ? -54.002 -28.435 16.390  1.00 30.73  ? 315 ARG A NH1 1 
ATOM   2421 N  NH2 . ARG A 1  317 ? -52.445 -30.151 16.480  1.00 30.94  ? 315 ARG A NH2 1 
ATOM   2422 N  N   . MET A 1  318 ? -57.830 -29.335 21.162  1.00 22.56  ? 316 MET A N   1 
ATOM   2423 C  CA  . MET A 1  318 ? -58.899 -28.493 21.609  1.00 26.01  ? 316 MET A CA  1 
ATOM   2424 C  C   . MET A 1  318 ? -59.160 -27.385 20.581  1.00 28.84  ? 316 MET A C   1 
ATOM   2425 O  O   . MET A 1  318 ? -58.233 -26.704 20.118  1.00 25.18  ? 316 MET A O   1 
ATOM   2426 C  CB  . MET A 1  318 ? -58.454 -27.921 22.932  1.00 23.54  ? 316 MET A CB  1 
ATOM   2427 C  CG  . MET A 1  318 ? -59.412 -27.225 23.662  1.00 26.96  ? 316 MET A CG  1 
ATOM   2428 S  SD  . MET A 1  318 ? -58.843 -26.739 25.322  1.00 31.06  ? 316 MET A SD  1 
ATOM   2429 C  CE  . MET A 1  318 ? -60.255 -25.724 25.636  1.00 23.53  ? 316 MET A CE  1 
ATOM   2430 N  N   . ALA A 1  319 ? -60.404 -27.272 20.151  1.00 24.90  ? 317 ALA A N   1 
ATOM   2431 C  CA  . ALA A 1  319 ? -60.773 -26.215 19.218  1.00 23.28  ? 317 ALA A CA  1 
ATOM   2432 C  C   . ALA A 1  319 ? -60.671 -24.836 19.880  1.00 22.91  ? 317 ALA A C   1 
ATOM   2433 O  O   . ALA A 1  319 ? -60.979 -24.658 21.050  1.00 23.37  ? 317 ALA A O   1 
ATOM   2434 C  CB  . ALA A 1  319 ? -62.172 -26.426 18.705  1.00 18.10  ? 317 ALA A CB  1 
ATOM   2435 N  N   . THR A 1  320 ? -60.205 -23.875 19.118  1.00 23.69  ? 318 THR A N   1 
ATOM   2436 C  CA  . THR A 1  320 ? -60.268 -22.498 19.545  1.00 22.30  ? 318 THR A CA  1 
ATOM   2437 C  C   . THR A 1  320 ? -61.161 -21.746 18.571  1.00 21.80  ? 318 THR A C   1 
ATOM   2438 O  O   . THR A 1  320 ? -62.023 -20.951 18.965  1.00 23.69  ? 318 THR A O   1 
ATOM   2439 C  CB  . THR A 1  320 ? -58.860 -21.879 19.622  1.00 21.99  ? 318 THR A CB  1 
ATOM   2440 O  OG1 . THR A 1  320 ? -58.168 -22.105 18.381  1.00 25.09  ? 318 THR A OG1 1 
ATOM   2441 C  CG2 . THR A 1  320 ? -58.089 -22.497 20.759  1.00 18.19  ? 318 THR A CG2 1 
ATOM   2442 N  N   . GLY A 1  321 ? -60.951 -22.005 17.296  1.00 20.98  ? 319 GLY A N   1 
ATOM   2443 C  CA  . GLY A 1  321 ? -61.720 -21.412 16.211  1.00 19.87  ? 319 GLY A CA  1 
ATOM   2444 C  C   . GLY A 1  321 ? -62.973 -22.185 15.896  1.00 24.02  ? 319 GLY A C   1 
ATOM   2445 O  O   . GLY A 1  321 ? -63.452 -22.963 16.693  1.00 22.06  ? 319 GLY A O   1 
ATOM   2446 N  N   . LEU A 1  322 ? -63.498 -21.961 14.709  1.00 22.98  ? 320 LEU A N   1 
ATOM   2447 C  CA  . LEU A 1  322 ? -64.803 -22.440 14.373  1.00 22.94  ? 320 LEU A CA  1 
ATOM   2448 C  C   . LEU A 1  322 ? -64.705 -23.451 13.221  1.00 21.89  ? 320 LEU A C   1 
ATOM   2449 O  O   . LEU A 1  322 ? -63.637 -23.676 12.656  1.00 24.46  ? 320 LEU A O   1 
ATOM   2450 C  CB  . LEU A 1  322 ? -65.667 -21.303 13.955  1.00 22.55  ? 320 LEU A CB  1 
ATOM   2451 C  CG  . LEU A 1  322 ? -65.061 -20.487 12.809  1.00 31.77  ? 320 LEU A CG  1 
ATOM   2452 C  CD1 . LEU A 1  322 ? -66.026 -20.276 11.721  1.00 27.35  ? 320 LEU A CD1 1 
ATOM   2453 C  CD2 . LEU A 1  322 ? -64.584 -19.182 13.297  1.00 33.89  ? 320 LEU A CD2 1 
ATOM   2454 N  N   . ARG A 1  323 ? -65.826 -24.067 12.925  1.00 18.28  ? 321 ARG A N   1 
ATOM   2455 C  CA  . ARG A 1  323 ? -65.915 -25.013 11.870  1.00 22.43  ? 321 ARG A CA  1 
ATOM   2456 C  C   . ARG A 1  323 ? -65.448 -24.404 10.558  1.00 21.04  ? 321 ARG A C   1 
ATOM   2457 O  O   . ARG A 1  323 ? -65.934 -23.348 10.154  1.00 24.86  ? 321 ARG A O   1 
ATOM   2458 C  CB  . ARG A 1  323 ? -67.327 -25.529 11.797  1.00 20.99  ? 321 ARG A CB  1 
ATOM   2459 C  CG  . ARG A 1  323 ? -67.523 -26.624 10.848  1.00 33.39  ? 321 ARG A CG  1 
ATOM   2460 C  CD  . ARG A 1  323 ? -68.985 -27.084 10.805  1.00 33.01  ? 321 ARG A CD  1 
ATOM   2461 N  NE  . ARG A 1  323 ? -69.354 -27.803 12.047  1.00 35.94  ? 321 ARG A NE  1 
ATOM   2462 C  CZ  . ARG A 1  323 ? -69.483 -29.123 12.152  1.00 31.75  ? 321 ARG A CZ  1 
ATOM   2463 N  NH1 . ARG A 1  323 ? -69.189 -29.934 11.135  1.00 24.11  ? 321 ARG A NH1 1 
ATOM   2464 N  NH2 . ARG A 1  323 ? -69.841 -29.632 13.305  1.00 28.45  ? 321 ARG A NH2 1 
ATOM   2465 N  N   . ASN A 1  324 ? -64.483 -25.053 9.914   1.00 23.43  ? 322 ASN A N   1 
ATOM   2466 C  CA  . ASN A 1  324 ? -63.853 -24.501 8.681   1.00 18.74  ? 322 ASN A CA  1 
ATOM   2467 C  C   . ASN A 1  324 ? -64.498 -24.888 7.400   1.00 17.87  ? 322 ASN A C   1 
ATOM   2468 O  O   . ASN A 1  324 ? -64.486 -26.045 6.994   1.00 19.55  ? 322 ASN A O   1 
ATOM   2469 C  CB  . ASN A 1  324 ? -62.363 -24.823 8.671   1.00 21.16  ? 322 ASN A CB  1 
ATOM   2470 C  CG  . ASN A 1  324 ? -61.590 -24.026 7.627   1.00 25.28  ? 322 ASN A CG  1 
ATOM   2471 O  OD1 . ASN A 1  324 ? -62.034 -22.970 7.182   1.00 21.47  ? 322 ASN A OD1 1 
ATOM   2472 N  ND2 . ASN A 1  324 ? -60.473 -24.594 7.150   1.00 28.89  ? 322 ASN A ND2 1 
ATOM   2473 N  N   . ILE A 1  325 ? -65.106 -23.910 6.745   1.00 17.51  ? 323 ILE A N   1 
ATOM   2474 C  CA  . ILE A 1  325 ? -65.856 -24.168 5.553   1.00 17.64  ? 323 ILE A CA  1 
ATOM   2475 C  C   . ILE A 1  325 ? -65.402 -23.255 4.425   1.00 20.10  ? 323 ILE A C   1 
ATOM   2476 O  O   . ILE A 1  325 ? -66.164 -22.409 4.014   1.00 16.29  ? 323 ILE A O   1 
ATOM   2477 C  CB  . ILE A 1  325 ? -67.352 -24.057 5.776   1.00 19.93  ? 323 ILE A CB  1 
ATOM   2478 C  CG1 . ILE A 1  325 ? -67.734 -24.743 7.117   1.00 28.72  ? 323 ILE A CG1 1 
ATOM   2479 C  CG2 . ILE A 1  325 ? -68.140 -24.680 4.550   1.00 15.42  ? 323 ILE A CG2 1 
ATOM   2480 C  CD1 . ILE A 1  325 ? -69.136 -24.434 7.560   1.00 30.18  ? 323 ILE A CD1 1 
ATOM   2481 N  N   . PRO A 1  326 ? -64.157 -23.478 3.888   1.00 22.36  ? 324 PRO A N   1 
ATOM   2482 C  CA  . PRO A 1  326 ? -63.599 -22.609 2.854   1.00 24.33  ? 324 PRO A CA  1 
ATOM   2483 C  C   . PRO A 1  326 ? -64.307 -22.735 1.522   1.00 28.83  ? 324 PRO A C   1 
ATOM   2484 O  O   . PRO A 1  326 ? -64.254 -21.811 0.723   1.00 30.28  ? 324 PRO A O   1 
ATOM   2485 C  CB  . PRO A 1  326 ? -62.140 -23.102 2.715   1.00 27.17  ? 324 PRO A CB  1 
ATOM   2486 C  CG  . PRO A 1  326 ? -62.165 -24.566 3.069   1.00 19.73  ? 324 PRO A CG  1 
ATOM   2487 C  CD  . PRO A 1  326 ? -63.211 -24.562 4.237   1.00 21.41  ? 324 PRO A CD  1 
ATOM   2488 N  N   . SER A 1  327 ? -64.945 -23.861 1.237   1.00 34.06  ? 325 SER A N   1 
ATOM   2489 C  CA  . SER A 1  327 ? -65.730 -23.956 -0.010  1.00 44.23  ? 325 SER A CA  1 
ATOM   2490 C  C   . SER A 1  327 ? -67.047 -24.721 0.157   1.00 49.88  ? 325 SER A C   1 
ATOM   2491 O  O   . SER A 1  327 ? -67.126 -25.714 0.916   1.00 52.04  ? 325 SER A O   1 
ATOM   2492 C  CB  . SER A 1  327 ? -64.904 -24.622 -1.120  1.00 44.09  ? 325 SER A CB  1 
ATOM   2493 O  OG  . SER A 1  327 ? -64.375 -25.830 -0.606  1.00 47.34  ? 325 SER A OG  1 
ATOM   2494 N  N   . ILE A 1  328 ? -68.054 -24.278 -0.590  1.00 53.74  ? 326 ILE A N   1 
ATOM   2495 C  CA  . ILE A 1  328 ? -69.400 -24.836 -0.493  1.00 58.38  ? 326 ILE A CA  1 
ATOM   2496 C  C   . ILE A 1  328 ? -69.546 -26.086 -1.379  1.00 57.27  ? 326 ILE A C   1 
ATOM   2497 O  O   . ILE A 1  328 ? -69.540 -25.979 -2.604  1.00 57.16  ? 326 ILE A O   1 
ATOM   2498 C  CB  . ILE A 1  328 ? -70.456 -23.755 -0.872  1.00 60.29  ? 326 ILE A CB  1 
ATOM   2499 C  CG1 . ILE A 1  328 ? -70.382 -22.587 0.124   1.00 63.82  ? 326 ILE A CG1 1 
ATOM   2500 C  CG2 . ILE A 1  328 ? -71.887 -24.348 -0.926  1.00 59.03  ? 326 ILE A CG2 1 
ATOM   2501 C  CD1 . ILE A 1  328 ? -70.957 -21.275 -0.432  1.00 70.64  ? 326 ILE A CD1 1 
ATOM   2502 N  N   . GLY B 2  1   ? -75.476 -26.779 13.145  1.00 28.79  ? 1   GLY B N   1 
ATOM   2503 C  CA  . GLY B 2  1   ? -75.104 -26.534 14.619  1.00 28.23  ? 1   GLY B CA  1 
ATOM   2504 C  C   . GLY B 2  1   ? -76.287 -25.958 15.425  1.00 25.18  ? 1   GLY B C   1 
ATOM   2505 O  O   . GLY B 2  1   ? -77.296 -25.613 14.839  1.00 24.76  ? 1   GLY B O   1 
ATOM   2506 N  N   . LEU B 2  2   ? -76.127 -25.781 16.724  1.00 23.30  ? 2   LEU B N   1 
ATOM   2507 C  CA  . LEU B 2  2   ? -77.269 -25.437 17.571  1.00 26.28  ? 2   LEU B CA  1 
ATOM   2508 C  C   . LEU B 2  2   ? -77.952 -24.146 17.206  1.00 24.60  ? 2   LEU B C   1 
ATOM   2509 O  O   . LEU B 2  2   ? -79.126 -24.085 17.352  1.00 23.48  ? 2   LEU B O   1 
ATOM   2510 C  CB  . LEU B 2  2   ? -76.932 -25.366 19.048  1.00 25.81  ? 2   LEU B CB  1 
ATOM   2511 C  CG  . LEU B 2  2   ? -76.627 -26.576 19.897  1.00 28.91  ? 2   LEU B CG  1 
ATOM   2512 C  CD1 . LEU B 2  2   ? -76.345 -26.112 21.423  1.00 22.60  ? 2   LEU B CD1 1 
ATOM   2513 C  CD2 . LEU B 2  2   ? -77.700 -27.572 19.864  1.00 21.93  ? 2   LEU B CD2 1 
ATOM   2514 N  N   . PHE B 2  3   ? -77.224 -23.175 16.651  1.00 22.84  ? 3   PHE B N   1 
ATOM   2515 C  CA  . PHE B 2  3   ? -77.767 -21.858 16.409  1.00 22.35  ? 3   PHE B CA  1 
ATOM   2516 C  C   . PHE B 2  3   ? -78.093 -21.630 14.964  1.00 25.78  ? 3   PHE B C   1 
ATOM   2517 O  O   . PHE B 2  3   ? -78.566 -20.574 14.600  1.00 24.32  ? 3   PHE B O   1 
ATOM   2518 C  CB  . PHE B 2  3   ? -76.808 -20.791 17.014  1.00 23.32  ? 3   PHE B CB  1 
ATOM   2519 C  CG  . PHE B 2  3   ? -76.787 -20.864 18.516  1.00 21.91  ? 3   PHE B CG  1 
ATOM   2520 C  CD1 . PHE B 2  3   ? -75.913 -21.699 19.165  1.00 19.77  ? 3   PHE B CD1 1 
ATOM   2521 C  CD2 . PHE B 2  3   ? -77.758 -20.205 19.253  1.00 21.55  ? 3   PHE B CD2 1 
ATOM   2522 C  CE1 . PHE B 2  3   ? -75.964 -21.863 20.508  1.00 26.48  ? 3   PHE B CE1 1 
ATOM   2523 C  CE2 . PHE B 2  3   ? -77.812 -20.358 20.616  1.00 23.37  ? 3   PHE B CE2 1 
ATOM   2524 C  CZ  . PHE B 2  3   ? -76.922 -21.193 21.252  1.00 22.15  ? 3   PHE B CZ  1 
ATOM   2525 N  N   . GLY B 2  4   ? -77.921 -22.661 14.140  1.00 23.40  ? 4   GLY B N   1 
ATOM   2526 C  CA  . GLY B 2  4   ? -78.387 -22.599 12.740  1.00 22.83  ? 4   GLY B CA  1 
ATOM   2527 C  C   . GLY B 2  4   ? -77.679 -21.704 11.717  1.00 24.12  ? 4   GLY B C   1 
ATOM   2528 O  O   . GLY B 2  4   ? -78.101 -21.646 10.545  1.00 24.86  ? 4   GLY B O   1 
ATOM   2529 N  N   . ALA B 2  5   ? -76.635 -20.989 12.135  1.00 24.11  ? 5   ALA B N   1 
ATOM   2530 C  CA  . ALA B 2  5   ? -75.952 -20.040 11.282  1.00 23.20  ? 5   ALA B CA  1 
ATOM   2531 C  C   . ALA B 2  5   ? -74.795 -20.713 10.543  1.00 20.78  ? 5   ALA B C   1 
ATOM   2532 O  O   . ALA B 2  5   ? -74.860 -20.841 9.339   1.00 23.63  ? 5   ALA B O   1 
ATOM   2533 C  CB  . ALA B 2  5   ? -75.491 -18.747 12.068  1.00 21.24  ? 5   ALA B CB  1 
ATOM   2534 N  N   . ILE B 2  6   ? -73.780 -21.140 11.248  1.00 23.09  ? 6   ILE B N   1 
ATOM   2535 C  CA  . ILE B 2  6   ? -72.590 -21.772 10.631  1.00 23.54  ? 6   ILE B CA  1 
ATOM   2536 C  C   . ILE B 2  6   ? -72.962 -23.139 10.034  1.00 25.61  ? 6   ILE B C   1 
ATOM   2537 O  O   . ILE B 2  6   ? -73.643 -23.966 10.637  1.00 26.00  ? 6   ILE B O   1 
ATOM   2538 C  CB  . ILE B 2  6   ? -71.426 -21.919 11.601  1.00 24.68  ? 6   ILE B CB  1 
ATOM   2539 C  CG1 . ILE B 2  6   ? -70.950 -20.576 12.109  1.00 22.37  ? 6   ILE B CG1 1 
ATOM   2540 C  CG2 . ILE B 2  6   ? -70.242 -22.734 10.953  1.00 18.44  ? 6   ILE B CG2 1 
ATOM   2541 C  CD1 . ILE B 2  6   ? -69.850 -20.600 13.246  1.00 18.13  ? 6   ILE B CD1 1 
ATOM   2542 N  N   . ALA B 2  7   ? -72.552 -23.350 8.805   1.00 25.94  ? 7   ALA B N   1 
ATOM   2543 C  CA  . ALA B 2  7   ? -73.006 -24.480 7.975   1.00 25.74  ? 7   ALA B CA  1 
ATOM   2544 C  C   . ALA B 2  7   ? -74.550 -24.598 8.014   1.00 26.14  ? 7   ALA B C   1 
ATOM   2545 O  O   . ALA B 2  7   ? -75.116 -25.672 7.994   1.00 26.70  ? 7   ALA B O   1 
ATOM   2546 C  CB  . ALA B 2  7   ? -72.261 -25.831 8.375   1.00 22.92  ? 7   ALA B CB  1 
ATOM   2547 N  N   . GLY B 2  8   ? -75.223 -23.460 8.033   1.00 29.91  ? 8   GLY B N   1 
ATOM   2548 C  CA  . GLY B 2  8   ? -76.686 -23.385 8.168   1.00 23.06  ? 8   GLY B CA  1 
ATOM   2549 C  C   . GLY B 2  8   ? -77.206 -22.352 7.187   1.00 21.57  ? 8   GLY B C   1 
ATOM   2550 O  O   . GLY B 2  8   ? -77.081 -22.508 5.988   1.00 20.93  ? 8   GLY B O   1 
ATOM   2551 N  N   . PHE B 2  9   ? -77.854 -21.314 7.676   1.00 20.14  ? 9   PHE B N   1 
ATOM   2552 C  CA  . PHE B 2  9   ? -78.448 -20.332 6.763   1.00 20.19  ? 9   PHE B CA  1 
ATOM   2553 C  C   . PHE B 2  9   ? -77.382 -19.428 6.184   1.00 20.36  ? 9   PHE B C   1 
ATOM   2554 O  O   . PHE B 2  9   ? -77.676 -18.683 5.250   1.00 22.43  ? 9   PHE B O   1 
ATOM   2555 C  CB  . PHE B 2  9   ? -79.593 -19.480 7.393   1.00 23.31  ? 9   PHE B CB  1 
ATOM   2556 C  CG  . PHE B 2  9   ? -79.143 -18.509 8.541   1.00 16.90  ? 9   PHE B CG  1 
ATOM   2557 C  CD1 . PHE B 2  9   ? -78.735 -17.243 8.269   1.00 32.88  ? 9   PHE B CD1 1 
ATOM   2558 C  CD2 . PHE B 2  9   ? -79.295 -18.863 9.843   1.00 30.24  ? 9   PHE B CD2 1 
ATOM   2559 C  CE1 . PHE B 2  9   ? -78.373 -16.383 9.299   1.00 30.59  ? 9   PHE B CE1 1 
ATOM   2560 C  CE2 . PHE B 2  9   ? -78.931 -18.004 10.881  1.00 31.97  ? 9   PHE B CE2 1 
ATOM   2561 C  CZ  . PHE B 2  9   ? -78.489 -16.766 10.594  1.00 30.28  ? 9   PHE B CZ  1 
ATOM   2562 N  N   . ILE B 2  10  ? -76.187 -19.450 6.763   1.00 24.28  ? 10  ILE B N   1 
ATOM   2563 C  CA  . ILE B 2  10  ? -75.007 -18.880 6.127   1.00 24.71  ? 10  ILE B CA  1 
ATOM   2564 C  C   . ILE B 2  10  ? -74.125 -20.095 5.782   1.00 26.29  ? 10  ILE B C   1 
ATOM   2565 O  O   . ILE B 2  10  ? -73.478 -20.676 6.623   1.00 24.82  ? 10  ILE B O   1 
ATOM   2566 C  CB  . ILE B 2  10  ? -74.243 -17.911 7.009   1.00 26.11  ? 10  ILE B CB  1 
ATOM   2567 C  CG1 . ILE B 2  10  ? -75.197 -16.799 7.490   1.00 27.87  ? 10  ILE B CG1 1 
ATOM   2568 C  CG2 . ILE B 2  10  ? -73.027 -17.303 6.188   1.00 22.84  ? 10  ILE B CG2 1 
ATOM   2569 C  CD1 . ILE B 2  10  ? -74.653 -15.934 8.591   1.00 26.04  ? 10  ILE B CD1 1 
ATOM   2570 N  N   . GLU B 2  11  ? -74.168 -20.478 4.527   1.00 23.19  ? 11  GLU B N   1 
ATOM   2571 C  CA  . GLU B 2  11  ? -73.742 -21.790 4.105   1.00 25.16  ? 11  GLU B CA  1 
ATOM   2572 C  C   . GLU B 2  11  ? -72.221 -22.092 4.269   1.00 24.54  ? 11  GLU B C   1 
ATOM   2573 O  O   . GLU B 2  11  ? -71.838 -23.168 4.699   1.00 24.99  ? 11  GLU B O   1 
ATOM   2574 C  CB  . GLU B 2  11  ? -74.195 -21.931 2.648   1.00 26.17  ? 11  GLU B CB  1 
ATOM   2575 C  CG  . GLU B 2  11  ? -74.006 -23.248 2.092   1.00 44.27  ? 11  GLU B CG  1 
ATOM   2576 C  CD  . GLU B 2  11  ? -74.736 -23.430 0.739   1.00 49.74  ? 11  GLU B CD  1 
ATOM   2577 O  OE1 . GLU B 2  11  ? -75.039 -22.425 0.038   1.00 43.60  ? 11  GLU B OE1 1 
ATOM   2578 O  OE2 . GLU B 2  11  ? -74.990 -24.603 0.426   1.00 53.16  ? 11  GLU B OE2 1 
ATOM   2579 N  N   . GLY B 2  12  ? -71.375 -21.121 3.969   1.00 23.59  ? 12  GLY B N   1 
ATOM   2580 C  CA  . GLY B 2  12  ? -69.938 -21.338 4.006   1.00 24.33  ? 12  GLY B CA  1 
ATOM   2581 C  C   . GLY B 2  12  ? -69.182 -20.159 4.579   1.00 23.24  ? 12  GLY B C   1 
ATOM   2582 O  O   . GLY B 2  12  ? -69.740 -19.097 4.854   1.00 22.18  ? 12  GLY B O   1 
ATOM   2583 N  N   . GLY B 2  13  ? -67.903 -20.371 4.788   1.00 23.20  ? 13  GLY B N   1 
ATOM   2584 C  CA  . GLY B 2  13  ? -67.043 -19.343 5.364   1.00 23.14  ? 13  GLY B CA  1 
ATOM   2585 C  C   . GLY B 2  13  ? -66.378 -18.537 4.297   1.00 22.14  ? 13  GLY B C   1 
ATOM   2586 O  O   . GLY B 2  13  ? -66.506 -18.829 3.109   1.00 20.49  ? 13  GLY B O   1 
ATOM   2587 N  N   . TRP B 2  14  ? -65.629 -17.523 4.728   1.00 22.59  ? 14  TRP B N   1 
ATOM   2588 C  CA  . TRP B 2  14  ? -64.978 -16.628 3.795   1.00 22.11  ? 14  TRP B CA  1 
ATOM   2589 C  C   . TRP B 2  14  ? -63.491 -16.642 4.029   1.00 21.52  ? 14  TRP B C   1 
ATOM   2590 O  O   . TRP B 2  14  ? -63.052 -16.081 5.035   1.00 22.92  ? 14  TRP B O   1 
ATOM   2591 C  CB  . TRP B 2  14  ? -65.462 -15.200 4.109   1.00 22.49  ? 14  TRP B CB  1 
ATOM   2592 C  CG  . TRP B 2  14  ? -66.799 -14.875 3.764   1.00 23.05  ? 14  TRP B CG  1 
ATOM   2593 C  CD1 . TRP B 2  14  ? -67.567 -15.442 2.770   1.00 19.80  ? 14  TRP B CD1 1 
ATOM   2594 C  CD2 . TRP B 2  14  ? -67.598 -13.831 4.342   1.00 18.24  ? 14  TRP B CD2 1 
ATOM   2595 N  NE1 . TRP B 2  14  ? -68.753 -14.788 2.694   1.00 28.08  ? 14  TRP B NE1 1 
ATOM   2596 C  CE2 . TRP B 2  14  ? -68.812 -13.822 3.663   1.00 24.49  ? 14  TRP B CE2 1 
ATOM   2597 C  CE3 . TRP B 2  14  ? -67.408 -12.936 5.389   1.00 23.25  ? 14  TRP B CE3 1 
ATOM   2598 C  CZ2 . TRP B 2  14  ? -69.806 -12.936 3.957   1.00 23.34  ? 14  TRP B CZ2 1 
ATOM   2599 C  CZ3 . TRP B 2  14  ? -68.392 -12.063 5.681   1.00 22.97  ? 14  TRP B CZ3 1 
ATOM   2600 C  CH2 . TRP B 2  14  ? -69.581 -12.063 4.970   1.00 29.28  ? 14  TRP B CH2 1 
ATOM   2601 N  N   . THR B 2  15  ? -62.709 -17.239 3.135   1.00 22.61  ? 15  THR B N   1 
ATOM   2602 C  CA  . THR B 2  15  ? -61.231 -17.186 3.196   1.00 21.14  ? 15  THR B CA  1 
ATOM   2603 C  C   . THR B 2  15  ? -60.726 -15.749 2.975   1.00 19.96  ? 15  THR B C   1 
ATOM   2604 O  O   . THR B 2  15  ? -59.593 -15.431 3.342   1.00 18.84  ? 15  THR B O   1 
ATOM   2605 C  CB  . THR B 2  15  ? -60.549 -18.094 2.114   1.00 19.07  ? 15  THR B CB  1 
ATOM   2606 O  OG1 . THR B 2  15  ? -61.035 -17.677 0.819   1.00 17.12  ? 15  THR B OG1 1 
ATOM   2607 C  CG2 . THR B 2  15  ? -60.815 -19.602 2.381   1.00 17.03  ? 15  THR B CG2 1 
ATOM   2608 N  N   . GLY B 2  16  ? -61.556 -14.919 2.360   1.00 20.28  ? 16  GLY B N   1 
ATOM   2609 C  CA  . GLY B 2  16  ? -61.216 -13.503 2.092   1.00 23.50  ? 16  GLY B CA  1 
ATOM   2610 C  C   . GLY B 2  16  ? -61.331 -12.573 3.316   1.00 26.72  ? 16  GLY B C   1 
ATOM   2611 O  O   . GLY B 2  16  ? -60.875 -11.433 3.263   1.00 23.17  ? 16  GLY B O   1 
ATOM   2612 N  N   . MET B 2  17  ? -61.957 -13.026 4.410   1.00 24.62  ? 17  MET B N   1 
ATOM   2613 C  CA  . MET B 2  17  ? -62.051 -12.178 5.608   1.00 25.97  ? 17  MET B CA  1 
ATOM   2614 C  C   . MET B 2  17  ? -60.993 -12.615 6.601   1.00 25.80  ? 17  MET B C   1 
ATOM   2615 O  O   . MET B 2  17  ? -61.149 -13.608 7.252   1.00 28.49  ? 17  MET B O   1 
ATOM   2616 C  CB  . MET B 2  17  ? -63.416 -12.258 6.252   1.00 28.21  ? 17  MET B CB  1 
ATOM   2617 C  CG  . MET B 2  17  ? -63.561 -11.267 7.412   1.00 32.76  ? 17  MET B CG  1 
ATOM   2618 S  SD  . MET B 2  17  ? -65.101 -11.360 8.212   1.00 30.91  ? 17  MET B SD  1 
ATOM   2619 C  CE  . MET B 2  17  ? -65.009 -12.941 9.020   1.00 23.26  ? 17  MET B CE  1 
ATOM   2620 N  N   . ILE B 2  18  ? -59.937 -11.832 6.709   1.00 25.37  ? 18  ILE B N   1 
ATOM   2621 C  CA  . ILE B 2  18  ? -58.693 -12.194 7.366   1.00 31.16  ? 18  ILE B CA  1 
ATOM   2622 C  C   . ILE B 2  18  ? -58.557 -11.616 8.789   1.00 29.28  ? 18  ILE B C   1 
ATOM   2623 O  O   . ILE B 2  18  ? -57.818 -12.126 9.637   1.00 28.55  ? 18  ILE B O   1 
ATOM   2624 C  CB  . ILE B 2  18  ? -57.478 -11.687 6.526   1.00 37.34  ? 18  ILE B CB  1 
ATOM   2625 C  CG1 . ILE B 2  18  ? -57.695 -10.234 6.080   1.00 40.72  ? 18  ILE B CG1 1 
ATOM   2626 C  CG2 . ILE B 2  18  ? -57.323 -12.574 5.280   1.00 43.09  ? 18  ILE B CG2 1 
ATOM   2627 C  CD1 . ILE B 2  18  ? -56.406 -9.424  5.743   1.00 50.09  ? 18  ILE B CD1 1 
ATOM   2628 N  N   . ASP B 2  19  ? -59.291 -10.566 9.073   1.00 27.33  ? 19  ASP B N   1 
ATOM   2629 C  CA  . ASP B 2  19  ? -58.908 -9.807  10.252  1.00 39.68  ? 19  ASP B CA  1 
ATOM   2630 C  C   . ASP B 2  19  ? -59.634 -10.305 11.562  1.00 33.33  ? 19  ASP B C   1 
ATOM   2631 O  O   . ASP B 2  19  ? -59.473 -9.719  12.615  1.00 29.66  ? 19  ASP B O   1 
ATOM   2632 C  CB  . ASP B 2  19  ? -58.983 -8.261  9.938   1.00 42.89  ? 19  ASP B CB  1 
ATOM   2633 C  CG  . ASP B 2  19  ? -60.083 -7.910  8.894   1.00 48.46  ? 19  ASP B CG  1 
ATOM   2634 O  OD1 . ASP B 2  19  ? -60.672 -8.878  8.399   1.00 46.47  ? 19  ASP B OD1 1 
ATOM   2635 O  OD2 . ASP B 2  19  ? -60.380 -6.717  8.572   1.00 43.76  ? 19  ASP B OD2 1 
ATOM   2636 N  N   . GLY B 2  20  ? -60.356 -11.427 11.480  1.00 30.48  ? 20  GLY B N   1 
ATOM   2637 C  CA  . GLY B 2  20  ? -61.272 -11.832 12.536  1.00 29.22  ? 20  GLY B CA  1 
ATOM   2638 C  C   . GLY B 2  20  ? -62.149 -13.030 12.236  1.00 27.72  ? 20  GLY B C   1 
ATOM   2639 O  O   . GLY B 2  20  ? -62.050 -13.620 11.179  1.00 29.73  ? 20  GLY B O   1 
ATOM   2640 N  N   . TRP B 2  21  ? -62.971 -13.424 13.202  1.00 25.42  ? 21  TRP B N   1 
ATOM   2641 C  CA  . TRP B 2  21  ? -63.729 -14.667 13.120  1.00 24.81  ? 21  TRP B CA  1 
ATOM   2642 C  C   . TRP B 2  21  ? -65.074 -14.425 12.470  1.00 23.42  ? 21  TRP B C   1 
ATOM   2643 O  O   . TRP B 2  21  ? -65.607 -15.304 11.788  1.00 23.90  ? 21  TRP B O   1 
ATOM   2644 C  CB  . TRP B 2  21  ? -63.924 -15.313 14.489  1.00 26.81  ? 21  TRP B CB  1 
ATOM   2645 C  CG  . TRP B 2  21  ? -62.815 -16.274 14.935  1.00 19.97  ? 21  TRP B CG  1 
ATOM   2646 C  CD1 . TRP B 2  21  ? -62.007 -17.063 14.138  1.00 13.16  ? 21  TRP B CD1 1 
ATOM   2647 C  CD2 . TRP B 2  21  ? -62.421 -16.526 16.259  1.00 15.91  ? 21  TRP B CD2 1 
ATOM   2648 N  NE1 . TRP B 2  21  ? -61.124 -17.778 14.920  1.00 18.82  ? 21  TRP B NE1 1 
ATOM   2649 C  CE2 . TRP B 2  21  ? -61.378 -17.486 16.226  1.00 14.18  ? 21  TRP B CE2 1 
ATOM   2650 C  CE3 . TRP B 2  21  ? -62.855 -16.053 17.501  1.00 22.07  ? 21  TRP B CE3 1 
ATOM   2651 C  CZ2 . TRP B 2  21  ? -60.800 -17.979 17.365  1.00 15.81  ? 21  TRP B CZ2 1 
ATOM   2652 C  CZ3 . TRP B 2  21  ? -62.279 -16.554 18.626  1.00 18.71  ? 21  TRP B CZ3 1 
ATOM   2653 C  CH2 . TRP B 2  21  ? -61.248 -17.499 18.558  1.00 21.58  ? 21  TRP B CH2 1 
ATOM   2654 N  N   . TYR B 2  22  ? -65.606 -13.233 12.680  1.00 24.31  ? 22  TYR B N   1 
ATOM   2655 C  CA  . TYR B 2  22  ? -66.926 -12.835 12.187  1.00 21.13  ? 22  TYR B CA  1 
ATOM   2656 C  C   . TYR B 2  22  ? -66.854 -11.464 11.599  1.00 22.24  ? 22  TYR B C   1 
ATOM   2657 O  O   . TYR B 2  22  ? -66.084 -10.634 12.005  1.00 23.89  ? 22  TYR B O   1 
ATOM   2658 C  CB  . TYR B 2  22  ? -67.952 -12.815 13.327  1.00 25.30  ? 22  TYR B CB  1 
ATOM   2659 C  CG  . TYR B 2  22  ? -67.693 -13.767 14.448  1.00 22.99  ? 22  TYR B CG  1 
ATOM   2660 C  CD1 . TYR B 2  22  ? -67.773 -15.127 14.243  1.00 24.64  ? 22  TYR B CD1 1 
ATOM   2661 C  CD2 . TYR B 2  22  ? -67.347 -13.310 15.722  1.00 20.88  ? 22  TYR B CD2 1 
ATOM   2662 C  CE1 . TYR B 2  22  ? -67.465 -16.022 15.279  1.00 20.48  ? 22  TYR B CE1 1 
ATOM   2663 C  CE2 . TYR B 2  22  ? -67.101 -14.186 16.765  1.00 20.80  ? 22  TYR B CE2 1 
ATOM   2664 C  CZ  . TYR B 2  22  ? -67.169 -15.556 16.545  1.00 25.25  ? 22  TYR B CZ  1 
ATOM   2665 O  OH  . TYR B 2  22  ? -66.904 -16.431 17.602  1.00 22.07  ? 22  TYR B OH  1 
ATOM   2666 N  N   . GLY B 2  23  ? -67.669 -11.211 10.612  1.00 24.35  ? 23  GLY B N   1 
ATOM   2667 C  CA  . GLY B 2  23  ? -67.645 -9.926  10.019  1.00 23.48  ? 23  GLY B CA  1 
ATOM   2668 C  C   . GLY B 2  23  ? -68.577 -9.754  8.875   1.00 23.73  ? 23  GLY B C   1 
ATOM   2669 O  O   . GLY B 2  23  ? -69.622 -10.436 8.799   1.00 25.29  ? 23  GLY B O   1 
ATOM   2670 N  N   . TYR B 2  24  ? -68.167 -8.878  7.966   1.00 23.84  ? 24  TYR B N   1 
ATOM   2671 C  CA  . TYR B 2  24  ? -69.029 -8.338  6.879   1.00 21.06  ? 24  TYR B CA  1 
ATOM   2672 C  C   . TYR B 2  24  ? -68.399 -8.506  5.500   1.00 24.38  ? 24  TYR B C   1 
ATOM   2673 O  O   . TYR B 2  24  ? -67.160 -8.541  5.360   1.00 28.12  ? 24  TYR B O   1 
ATOM   2674 C  CB  . TYR B 2  24  ? -69.305 -6.844  7.104   1.00 23.00  ? 24  TYR B CB  1 
ATOM   2675 C  CG  . TYR B 2  24  ? -69.724 -6.503  8.542   1.00 22.93  ? 24  TYR B CG  1 
ATOM   2676 C  CD1 . TYR B 2  24  ? -68.781 -6.158  9.482   1.00 24.55  ? 24  TYR B CD1 1 
ATOM   2677 C  CD2 . TYR B 2  24  ? -71.042 -6.568  8.946   1.00 24.79  ? 24  TYR B CD2 1 
ATOM   2678 C  CE1 . TYR B 2  24  ? -69.119 -5.869  10.748  1.00 21.09  ? 24  TYR B CE1 1 
ATOM   2679 C  CE2 . TYR B 2  24  ? -71.408 -6.293  10.250  1.00 27.88  ? 24  TYR B CE2 1 
ATOM   2680 C  CZ  . TYR B 2  24  ? -70.424 -5.948  11.149  1.00 28.34  ? 24  TYR B CZ  1 
ATOM   2681 O  OH  . TYR B 2  24  ? -70.702 -5.651  12.431  1.00 23.73  ? 24  TYR B OH  1 
ATOM   2682 N  N   . HIS B 2  25  ? -69.256 -8.663  4.488   1.00 25.80  ? 25  HIS B N   1 
ATOM   2683 C  CA  . HIS B 2  25  ? -68.917 -8.376  3.094   1.00 23.95  ? 25  HIS B CA  1 
ATOM   2684 C  C   . HIS B 2  25  ? -69.936 -7.368  2.518   1.00 25.65  ? 25  HIS B C   1 
ATOM   2685 O  O   . HIS B 2  25  ? -71.128 -7.469  2.791   1.00 27.10  ? 25  HIS B O   1 
ATOM   2686 C  CB  . HIS B 2  25  ? -68.975 -9.661  2.252   1.00 25.59  ? 25  HIS B CB  1 
ATOM   2687 C  CG  . HIS B 2  25  ? -68.551 -9.458  0.836   1.00 24.24  ? 25  HIS B CG  1 
ATOM   2688 N  ND1 . HIS B 2  25  ? -69.451 -9.227  -0.180  1.00 29.00  ? 25  HIS B ND1 1 
ATOM   2689 C  CD2 . HIS B 2  25  ? -67.323 -9.450  0.263   1.00 28.44  ? 25  HIS B CD2 1 
ATOM   2690 C  CE1 . HIS B 2  25  ? -68.795 -9.060  -1.315  1.00 32.34  ? 25  HIS B CE1 1 
ATOM   2691 N  NE2 . HIS B 2  25  ? -67.507 -9.203  -1.076  1.00 29.41  ? 25  HIS B NE2 1 
ATOM   2692 N  N   . HIS B 2  26  ? -69.480 -6.425  1.696   1.00 24.78  ? 26  HIS B N   1 
ATOM   2693 C  CA  . HIS B 2  26  ? -70.372 -5.483  1.061   1.00 23.04  ? 26  HIS B CA  1 
ATOM   2694 C  C   . HIS B 2  26  ? -70.085 -5.325  -0.419  1.00 25.11  ? 26  HIS B C   1 
ATOM   2695 O  O   . HIS B 2  26  ? -68.971 -5.577  -0.899  1.00 22.86  ? 26  HIS B O   1 
ATOM   2696 C  CB  . HIS B 2  26  ? -70.280 -4.119  1.758   1.00 23.43  ? 26  HIS B CB  1 
ATOM   2697 C  CG  . HIS B 2  26  ? -69.066 -3.363  1.376   1.00 23.21  ? 26  HIS B CG  1 
ATOM   2698 N  ND1 . HIS B 2  26  ? -67.829 -3.636  1.915   1.00 25.47  ? 26  HIS B ND1 1 
ATOM   2699 C  CD2 . HIS B 2  26  ? -68.871 -2.431  0.422   1.00 24.44  ? 26  HIS B CD2 1 
ATOM   2700 C  CE1 . HIS B 2  26  ? -66.921 -2.872  1.323   1.00 24.82  ? 26  HIS B CE1 1 
ATOM   2701 N  NE2 . HIS B 2  26  ? -67.526 -2.132  0.414   1.00 30.62  ? 26  HIS B NE2 1 
ATOM   2702 N  N   . GLN B 2  27  ? -71.096 -4.817  -1.119  1.00 24.21  ? 27  GLN B N   1 
ATOM   2703 C  CA  . GLN B 2  27  ? -70.984 -4.383  -2.491  1.00 19.56  ? 27  GLN B CA  1 
ATOM   2704 C  C   . GLN B 2  27  ? -71.809 -3.095  -2.696  1.00 22.69  ? 27  GLN B C   1 
ATOM   2705 O  O   . GLN B 2  27  ? -73.036 -3.073  -2.454  1.00 23.98  ? 27  GLN B O   1 
ATOM   2706 C  CB  . GLN B 2  27  ? -71.471 -5.488  -3.484  1.00 18.19  ? 27  GLN B CB  1 
ATOM   2707 C  CG  . GLN B 2  27  ? -71.382 -5.037  -4.936  1.00 20.41  ? 27  GLN B CG  1 
ATOM   2708 C  CD  . GLN B 2  27  ? -71.728 -6.076  -5.961  1.00 16.01  ? 27  GLN B CD  1 
ATOM   2709 O  OE1 . GLN B 2  27  ? -71.987 -7.205  -5.652  1.00 26.72  ? 27  GLN B OE1 1 
ATOM   2710 N  NE2 . GLN B 2  27  ? -71.683 -5.677  -7.223  1.00 13.33  ? 27  GLN B NE2 1 
ATOM   2711 N  N   . ASN B 2  28  ? -71.158 -2.031  -3.163  1.00 20.26  ? 28  ASN B N   1 
ATOM   2712 C  CA  . ASN B 2  28  ? -71.863 -0.839  -3.604  1.00 23.46  ? 28  ASN B CA  1 
ATOM   2713 C  C   . ASN B 2  28  ? -71.107 -0.280  -4.814  1.00 22.07  ? 28  ASN B C   1 
ATOM   2714 O  O   . ASN B 2  28  ? -70.201 -0.924  -5.304  1.00 25.66  ? 28  ASN B O   1 
ATOM   2715 C  CB  . ASN B 2  28  ? -71.933 0.144   -2.461  1.00 20.30  ? 28  ASN B CB  1 
ATOM   2716 C  CG  . ASN B 2  28  ? -70.565 0.509   -1.951  1.00 28.57  ? 28  ASN B CG  1 
ATOM   2717 O  OD1 . ASN B 2  28  ? -69.568 0.354   -2.668  1.00 25.47  ? 28  ASN B OD1 1 
ATOM   2718 N  ND2 . ASN B 2  28  ? -70.501 1.004   -0.714  1.00 20.22  ? 28  ASN B ND2 1 
ATOM   2719 N  N   . GLU B 2  29  ? -71.555 0.838   -5.349  1.00 23.54  ? 29  GLU B N   1 
ATOM   2720 C  CA  . GLU B 2  29  ? -70.978 1.426   -6.546  1.00 24.93  ? 29  GLU B CA  1 
ATOM   2721 C  C   . GLU B 2  29  ? -69.453 1.632   -6.444  1.00 24.48  ? 29  GLU B C   1 
ATOM   2722 O  O   . GLU B 2  29  ? -68.774 1.573   -7.440  1.00 29.34  ? 29  GLU B O   1 
ATOM   2723 C  CB  . GLU B 2  29  ? -71.654 2.762   -6.890  1.00 21.63  ? 29  GLU B CB  1 
ATOM   2724 C  CG  . GLU B 2  29  ? -71.123 3.383   -8.229  1.00 30.21  ? 29  GLU B CG  1 
ATOM   2725 C  CD  . GLU B 2  29  ? -71.979 4.518   -8.779  1.00 40.82  ? 29  GLU B CD  1 
ATOM   2726 O  OE1 . GLU B 2  29  ? -72.756 5.145   -8.010  1.00 45.81  ? 29  GLU B OE1 1 
ATOM   2727 O  OE2 . GLU B 2  29  ? -71.845 4.801   -9.990  1.00 56.05  ? 29  GLU B OE2 1 
ATOM   2728 N  N   . GLN B 2  30  ? -68.955 1.908   -5.248  1.00 23.80  ? 30  GLN B N   1 
ATOM   2729 C  CA  . GLN B 2  30  ? -67.565 2.150   -5.034  1.00 22.86  ? 30  GLN B CA  1 
ATOM   2730 C  C   . GLN B 2  30  ? -66.767 0.839   -5.091  1.00 26.31  ? 30  GLN B C   1 
ATOM   2731 O  O   . GLN B 2  30  ? -65.585 0.893   -5.287  1.00 27.52  ? 30  GLN B O   1 
ATOM   2732 C  CB  . GLN B 2  30  ? -67.353 2.851   -3.677  1.00 19.83  ? 30  GLN B CB  1 
ATOM   2733 C  CG  . GLN B 2  30  ? -67.761 4.384   -3.647  1.00 23.93  ? 30  GLN B CG  1 
ATOM   2734 C  CD  . GLN B 2  30  ? -68.132 4.816   -2.240  1.00 35.25  ? 30  GLN B CD  1 
ATOM   2735 O  OE1 . GLN B 2  30  ? -69.072 4.272   -1.655  1.00 22.57  ? 30  GLN B OE1 1 
ATOM   2736 N  NE2 . GLN B 2  30  ? -67.380 5.752   -1.668  1.00 27.01  ? 30  GLN B NE2 1 
ATOM   2737 N  N   . GLY B 2  31  ? -67.402 -0.329  -4.902  1.00 24.18  ? 31  GLY B N   1 
ATOM   2738 C  CA  . GLY B 2  31  ? -66.680 -1.587  -4.929  1.00 23.65  ? 31  GLY B CA  1 
ATOM   2739 C  C   . GLY B 2  31  ? -67.141 -2.566  -3.899  1.00 24.37  ? 31  GLY B C   1 
ATOM   2740 O  O   . GLY B 2  31  ? -68.172 -2.337  -3.260  1.00 25.17  ? 31  GLY B O   1 
ATOM   2741 N  N   . SER B 2  32  ? -66.388 -3.659  -3.745  1.00 19.75  ? 32  SER B N   1 
ATOM   2742 C  CA  . SER B 2  32  ? -66.724 -4.732  -2.823  1.00 23.19  ? 32  SER B CA  1 
ATOM   2743 C  C   . SER B 2  32  ? -65.609 -4.928  -1.810  1.00 23.36  ? 32  SER B C   1 
ATOM   2744 O  O   . SER B 2  32  ? -64.538 -4.453  -1.997  1.00 26.04  ? 32  SER B O   1 
ATOM   2745 C  CB  . SER B 2  32  ? -66.912 -6.067  -3.550  1.00 22.51  ? 32  SER B CB  1 
ATOM   2746 O  OG  . SER B 2  32  ? -67.767 -5.897  -4.611  1.00 26.65  ? 32  SER B OG  1 
ATOM   2747 N  N   . GLY B 2  33  ? -65.866 -5.652  -0.740  1.00 25.21  ? 33  GLY B N   1 
ATOM   2748 C  CA  . GLY B 2  33  ? -64.772 -6.004  0.190   1.00 26.09  ? 33  GLY B CA  1 
ATOM   2749 C  C   . GLY B 2  33  ? -65.315 -6.663  1.434   1.00 27.24  ? 33  GLY B C   1 
ATOM   2750 O  O   . GLY B 2  33  ? -66.543 -6.746  1.621   1.00 25.41  ? 33  GLY B O   1 
ATOM   2751 N  N   . TYR B 2  34  ? -64.387 -7.126  2.269   1.00 27.06  ? 34  TYR B N   1 
ATOM   2752 C  CA  . TYR B 2  34  ? -64.654 -7.768  3.547   1.00 26.11  ? 34  TYR B CA  1 
ATOM   2753 C  C   . TYR B 2  34  ? -64.057 -6.951  4.675   1.00 24.58  ? 34  TYR B C   1 
ATOM   2754 O  O   . TYR B 2  34  ? -63.057 -6.292  4.476   1.00 25.91  ? 34  TYR B O   1 
ATOM   2755 C  CB  . TYR B 2  34  ? -63.931 -9.086  3.613   1.00 25.85  ? 34  TYR B CB  1 
ATOM   2756 C  CG  . TYR B 2  34  ? -64.347 -10.114 2.581   1.00 19.07  ? 34  TYR B CG  1 
ATOM   2757 C  CD1 . TYR B 2  34  ? -63.658 -10.235 1.351   1.00 32.75  ? 34  TYR B CD1 1 
ATOM   2758 C  CD2 . TYR B 2  34  ? -65.362 -11.001 2.859   1.00 22.83  ? 34  TYR B CD2 1 
ATOM   2759 C  CE1 . TYR B 2  34  ? -64.027 -11.188 0.432   1.00 26.05  ? 34  TYR B CE1 1 
ATOM   2760 C  CE2 . TYR B 2  34  ? -65.751 -11.948 1.935   1.00 25.24  ? 34  TYR B CE2 1 
ATOM   2761 C  CZ  . TYR B 2  34  ? -65.076 -12.055 0.765   1.00 27.34  ? 34  TYR B CZ  1 
ATOM   2762 O  OH  . TYR B 2  34  ? -65.524 -12.993 -0.074  1.00 28.25  ? 34  TYR B OH  1 
ATOM   2763 N  N   . ALA B 2  35  ? -64.648 -7.045  5.863   1.00 20.60  ? 35  ALA B N   1 
ATOM   2764 C  CA  . ALA B 2  35  ? -64.105 -6.424  7.067   1.00 18.74  ? 35  ALA B CA  1 
ATOM   2765 C  C   . ALA B 2  35  ? -64.555 -7.233  8.279   1.00 20.72  ? 35  ALA B C   1 
ATOM   2766 O  O   . ALA B 2  35  ? -65.737 -7.603  8.427   1.00 26.35  ? 35  ALA B O   1 
ATOM   2767 C  CB  . ALA B 2  35  ? -64.564 -4.936  7.204   1.00 17.27  ? 35  ALA B CB  1 
ATOM   2768 N  N   . ALA B 2  36  ? -63.621 -7.531  9.144   1.00 22.41  ? 36  ALA B N   1 
ATOM   2769 C  CA  . ALA B 2  36  ? -63.908 -8.282  10.344  1.00 23.45  ? 36  ALA B CA  1 
ATOM   2770 C  C   . ALA B 2  36  ? -64.729 -7.374  11.257  1.00 22.02  ? 36  ALA B C   1 
ATOM   2771 O  O   . ALA B 2  36  ? -64.605 -6.137  11.226  1.00 19.14  ? 36  ALA B O   1 
ATOM   2772 C  CB  . ALA B 2  36  ? -62.636 -8.616  11.018  1.00 25.50  ? 36  ALA B CB  1 
ATOM   2773 N  N   . ASP B 2  37  ? -65.558 -7.974  12.069  1.00 21.41  ? 37  ASP B N   1 
ATOM   2774 C  CA  . ASP B 2  37  ? -66.190 -7.227  13.164  1.00 20.49  ? 37  ASP B CA  1 
ATOM   2775 C  C   . ASP B 2  37  ? -65.312 -7.362  14.379  1.00 17.67  ? 37  ASP B C   1 
ATOM   2776 O  O   . ASP B 2  37  ? -65.244 -8.434  15.011  1.00 19.83  ? 37  ASP B O   1 
ATOM   2777 C  CB  . ASP B 2  37  ? -67.589 -7.819  13.505  1.00 22.15  ? 37  ASP B CB  1 
ATOM   2778 C  CG  . ASP B 2  37  ? -68.311 -6.993  14.553  1.00 23.92  ? 37  ASP B CG  1 
ATOM   2779 O  OD1 . ASP B 2  37  ? -68.383 -7.447  15.703  1.00 22.95  ? 37  ASP B OD1 1 
ATOM   2780 O  OD2 . ASP B 2  37  ? -68.651 -5.822  14.277  1.00 24.18  ? 37  ASP B OD2 1 
ATOM   2781 N  N   . GLN B 2  38  ? -64.754 -6.266  14.811  1.00 18.52  ? 38  GLN B N   1 
ATOM   2782 C  CA  . GLN B 2  38  ? -63.768 -6.271  15.905  1.00 21.62  ? 38  GLN B CA  1 
ATOM   2783 C  C   . GLN B 2  38  ? -64.345 -6.582  17.272  1.00 22.50  ? 38  GLN B C   1 
ATOM   2784 O  O   . GLN B 2  38  ? -63.788 -7.363  18.013  1.00 24.40  ? 38  GLN B O   1 
ATOM   2785 C  CB  . GLN B 2  38  ? -63.016 -4.925  15.919  1.00 20.51  ? 38  GLN B CB  1 
ATOM   2786 C  CG  . GLN B 2  38  ? -62.293 -4.760  14.511  1.00 37.92  ? 38  GLN B CG  1 
ATOM   2787 C  CD  . GLN B 2  38  ? -61.625 -3.363  14.222  1.00 46.58  ? 38  GLN B CD  1 
ATOM   2788 O  OE1 . GLN B 2  38  ? -61.555 -2.499  15.079  1.00 53.62  ? 38  GLN B OE1 1 
ATOM   2789 N  NE2 . GLN B 2  38  ? -61.146 -3.184  12.992  1.00 35.82  ? 38  GLN B NE2 1 
ATOM   2790 N  N   . LYS B 2  39  ? -65.498 -6.026  17.583  1.00 23.17  ? 39  LYS B N   1 
ATOM   2791 C  CA  . LYS B 2  39  ? -66.033 -6.185  18.902  1.00 23.93  ? 39  LYS B CA  1 
ATOM   2792 C  C   . LYS B 2  39  ? -66.425 -7.637  19.143  1.00 22.39  ? 39  LYS B C   1 
ATOM   2793 O  O   . LYS B 2  39  ? -66.010 -8.209  20.141  1.00 22.72  ? 39  LYS B O   1 
ATOM   2794 C  CB  . LYS B 2  39  ? -67.192 -5.209  19.097  1.00 27.93  ? 39  LYS B CB  1 
ATOM   2795 C  CG  . LYS B 2  39  ? -67.990 -5.432  20.404  1.00 42.57  ? 39  LYS B CG  1 
ATOM   2796 C  CD  . LYS B 2  39  ? -69.074 -4.362  20.603  1.00 51.11  ? 39  LYS B CD  1 
ATOM   2797 C  CE  . LYS B 2  39  ? -69.948 -4.667  21.847  1.00 61.53  ? 39  LYS B CE  1 
ATOM   2798 N  NZ  . LYS B 2  39  ? -70.863 -5.837  21.618  1.00 63.43  ? 39  LYS B NZ  1 
ATOM   2799 N  N   . SER B 2  40  ? -67.127 -8.259  18.189  1.00 20.58  ? 40  SER B N   1 
ATOM   2800 C  CA  . SER B 2  40  ? -67.562 -9.654  18.342  1.00 21.34  ? 40  SER B CA  1 
ATOM   2801 C  C   . SER B 2  40  ? -66.382 -10.593 18.323  1.00 24.17  ? 40  SER B C   1 
ATOM   2802 O  O   . SER B 2  40  ? -66.344 -11.552 19.099  1.00 22.32  ? 40  SER B O   1 
ATOM   2803 C  CB  . SER B 2  40  ? -68.624 -10.047 17.305  1.00 21.53  ? 40  SER B CB  1 
ATOM   2804 O  OG  . SER B 2  40  ? -68.185 -10.000 15.984  1.00 26.38  ? 40  SER B OG  1 
ATOM   2805 N  N   . THR B 2  41  ? -65.369 -10.290 17.499  1.00 25.37  ? 41  THR B N   1 
ATOM   2806 C  CA  . THR B 2  41  ? -64.125 -11.096 17.494  1.00 21.93  ? 41  THR B CA  1 
ATOM   2807 C  C   . THR B 2  41  ? -63.397 -10.980 18.820  1.00 21.89  ? 41  THR B C   1 
ATOM   2808 O  O   . THR B 2  41  ? -63.048 -11.982 19.452  1.00 25.12  ? 41  THR B O   1 
ATOM   2809 C  CB  . THR B 2  41  ? -63.204 -10.698 16.254  1.00 24.28  ? 41  THR B CB  1 
ATOM   2810 O  OG1 . THR B 2  41  ? -63.900 -10.978 15.001  1.00 18.06  ? 41  THR B OG1 1 
ATOM   2811 C  CG2 . THR B 2  41  ? -61.962 -11.495 16.283  1.00 20.14  ? 41  THR B CG2 1 
ATOM   2812 N  N   . GLN B 2  42  ? -63.226 -9.748  19.308  1.00 24.20  ? 42  GLN B N   1 
ATOM   2813 C  CA  . GLN B 2  42  ? -62.580 -9.532  20.601  1.00 22.19  ? 42  GLN B CA  1 
ATOM   2814 C  C   . GLN B 2  42  ? -63.289 -10.317 21.731  1.00 24.45  ? 42  GLN B C   1 
ATOM   2815 O  O   . GLN B 2  42  ? -62.660 -11.030 22.501  1.00 25.44  ? 42  GLN B O   1 
ATOM   2816 C  CB  . GLN B 2  42  ? -62.553 -8.036  20.937  1.00 20.92  ? 42  GLN B CB  1 
ATOM   2817 C  CG  . GLN B 2  42  ? -61.823 -7.764  22.249  1.00 23.85  ? 42  GLN B CG  1 
ATOM   2818 C  CD  . GLN B 2  42  ? -60.304 -8.010  22.111  1.00 30.00  ? 42  GLN B CD  1 
ATOM   2819 O  OE1 . GLN B 2  42  ? -59.642 -7.292  21.385  1.00 25.37  ? 42  GLN B OE1 1 
ATOM   2820 N  NE2 . GLN B 2  42  ? -59.775 -8.985  22.815  1.00 21.37  ? 42  GLN B NE2 1 
ATOM   2821 N  N   . ASN B 2  43  ? -64.612 -10.196 21.819  1.00 23.85  ? 43  ASN B N   1 
ATOM   2822 C  CA  A ASN B 2  43  ? -65.385 -10.878 22.866  0.30 23.48  ? 43  ASN B CA  1 
ATOM   2823 C  CA  B ASN B 2  43  ? -65.354 -10.894 22.903  0.70 26.09  ? 43  ASN B CA  1 
ATOM   2824 C  C   . ASN B 2  43  ? -65.161 -12.386 22.771  1.00 22.87  ? 43  ASN B C   1 
ATOM   2825 O  O   . ASN B 2  43  ? -64.972 -13.070 23.756  1.00 24.36  ? 43  ASN B O   1 
ATOM   2826 C  CB  A ASN B 2  43  ? -66.885 -10.518 22.742  0.30 22.83  ? 43  ASN B CB  1 
ATOM   2827 C  CB  B ASN B 2  43  ? -66.859 -10.559 22.877  0.70 27.82  ? 43  ASN B CB  1 
ATOM   2828 C  CG  A ASN B 2  43  ? -67.210 -9.146  23.333  0.30 18.35  ? 43  ASN B CG  1 
ATOM   2829 C  CG  B ASN B 2  43  ? -67.666 -11.335 23.938  0.70 34.64  ? 43  ASN B CG  1 
ATOM   2830 O  OD1 A ASN B 2  43  ? -66.471 -8.660  24.178  0.30 14.32  ? 43  ASN B OD1 1 
ATOM   2831 O  OD1 B ASN B 2  43  ? -67.851 -10.864 25.080  0.70 35.51  ? 43  ASN B OD1 1 
ATOM   2832 N  ND2 A ASN B 2  43  ? -68.332 -8.538  22.916  0.30 10.19  ? 43  ASN B ND2 1 
ATOM   2833 N  ND2 B ASN B 2  43  ? -68.181 -12.506 23.549  0.70 44.82  ? 43  ASN B ND2 1 
ATOM   2834 N  N   . ALA B 2  44  ? -65.152 -12.894 21.542  1.00 24.66  ? 44  ALA B N   1 
ATOM   2835 C  CA  . ALA B 2  44  ? -64.940 -14.343 21.350  1.00 24.25  ? 44  ALA B CA  1 
ATOM   2836 C  C   . ALA B 2  44  ? -63.546 -14.748 21.736  1.00 25.77  ? 44  ALA B C   1 
ATOM   2837 O  O   . ALA B 2  44  ? -63.328 -15.820 22.306  1.00 26.41  ? 44  ALA B O   1 
ATOM   2838 C  CB  . ALA B 2  44  ? -65.214 -14.745 19.910  1.00 23.27  ? 44  ALA B CB  1 
ATOM   2839 N  N   . ILE B 2  45  ? -62.570 -13.931 21.365  1.00 26.37  ? 45  ILE B N   1 
ATOM   2840 C  CA  . ILE B 2  45  ? -61.188 -14.238 21.748  1.00 24.16  ? 45  ILE B CA  1 
ATOM   2841 C  C   . ILE B 2  45  ? -61.020 -14.166 23.253  1.00 22.63  ? 45  ILE B C   1 
ATOM   2842 O  O   . ILE B 2  45  ? -60.303 -15.004 23.808  1.00 22.83  ? 45  ILE B O   1 
ATOM   2843 C  CB  . ILE B 2  45  ? -60.166 -13.286 21.026  1.00 27.60  ? 45  ILE B CB  1 
ATOM   2844 C  CG1 . ILE B 2  45  ? -60.204 -13.531 19.518  1.00 27.84  ? 45  ILE B CG1 1 
ATOM   2845 C  CG2 . ILE B 2  45  ? -58.723 -13.426 21.644  1.00 24.69  ? 45  ILE B CG2 1 
ATOM   2846 C  CD1 . ILE B 2  45  ? -59.256 -12.619 18.616  1.00 23.87  ? 45  ILE B CD1 1 
ATOM   2847 N  N   . ASP B 2  46  ? -61.643 -13.173 23.942  1.00 21.44  ? 46  ASP B N   1 
ATOM   2848 C  CA  . ASP B 2  46  ? -61.614 -13.163 25.410  1.00 21.67  ? 46  ASP B CA  1 
ATOM   2849 C  C   . ASP B 2  46  ? -62.161 -14.512 26.001  1.00 26.82  ? 46  ASP B C   1 
ATOM   2850 O  O   . ASP B 2  46  ? -61.513 -15.141 26.873  1.00 22.04  ? 46  ASP B O   1 
ATOM   2851 C  CB  . ASP B 2  46  ? -62.464 -12.000 26.016  1.00 23.46  ? 46  ASP B CB  1 
ATOM   2852 C  CG  . ASP B 2  46  ? -61.955 -10.608 25.605  1.00 27.38  ? 46  ASP B CG  1 
ATOM   2853 O  OD1 . ASP B 2  46  ? -60.810 -10.501 25.150  1.00 27.71  ? 46  ASP B OD1 1 
ATOM   2854 O  OD2 . ASP B 2  46  ? -62.671 -9.590  25.782  1.00 31.61  ? 46  ASP B OD2 1 
ATOM   2855 N  N   . GLY B 2  47  ? -63.312 -14.977 25.498  1.00 23.71  ? 47  GLY B N   1 
ATOM   2856 C  CA  . GLY B 2  47  ? -63.932 -16.213 26.069  1.00 24.62  ? 47  GLY B CA  1 
ATOM   2857 C  C   . GLY B 2  47  ? -63.087 -17.451 25.806  1.00 22.85  ? 47  GLY B C   1 
ATOM   2858 O  O   . GLY B 2  47  ? -62.862 -18.306 26.673  1.00 22.93  ? 47  GLY B O   1 
ATOM   2859 N  N   . ILE B 2  48  ? -62.633 -17.576 24.582  1.00 25.38  ? 48  ILE B N   1 
ATOM   2860 C  CA  . ILE B 2  48  ? -61.854 -18.759 24.198  1.00 24.53  ? 48  ILE B CA  1 
ATOM   2861 C  C   . ILE B 2  48  ? -60.491 -18.803 24.880  1.00 24.66  ? 48  ILE B C   1 
ATOM   2862 O  O   . ILE B 2  48  ? -60.017 -19.862 25.292  1.00 28.14  ? 48  ILE B O   1 
ATOM   2863 C  CB  . ILE B 2  48  ? -61.746 -18.825 22.622  1.00 26.02  ? 48  ILE B CB  1 
ATOM   2864 C  CG1 . ILE B 2  48  ? -63.127 -19.092 22.026  1.00 26.48  ? 48  ILE B CG1 1 
ATOM   2865 C  CG2 . ILE B 2  48  ? -60.771 -19.939 22.144  1.00 23.00  ? 48  ILE B CG2 1 
ATOM   2866 C  CD1 . ILE B 2  48  ? -63.779 -20.400 22.429  1.00 22.32  ? 48  ILE B CD1 1 
ATOM   2867 N  N   . THR B 2  49  ? -59.830 -17.659 25.000  1.00 26.88  ? 49  THR B N   1 
ATOM   2868 C  CA  . THR B 2  49  ? -58.570 -17.642 25.729  1.00 26.76  ? 49  THR B CA  1 
ATOM   2869 C  C   . THR B 2  49  ? -58.810 -17.978 27.172  1.00 24.93  ? 49  THR B C   1 
ATOM   2870 O  O   . THR B 2  49  ? -58.045 -18.746 27.780  1.00 25.46  ? 49  THR B O   1 
ATOM   2871 C  CB  . THR B 2  49  ? -57.769 -16.302 25.543  1.00 26.92  ? 49  THR B CB  1 
ATOM   2872 O  OG1 . THR B 2  49  ? -58.567 -15.222 25.876  1.00 36.11  ? 49  THR B OG1 1 
ATOM   2873 C  CG2 . THR B 2  49  ? -57.444 -16.073 24.084  1.00 27.32  ? 49  THR B CG2 1 
ATOM   2874 N  N   . ASN B 2  50  ? -59.864 -17.430 27.758  1.00 24.93  ? 50  ASN B N   1 
ATOM   2875 C  CA  . ASN B 2  50  ? -60.195 -17.824 29.129  1.00 25.55  ? 50  ASN B CA  1 
ATOM   2876 C  C   . ASN B 2  50  ? -60.480 -19.325 29.265  1.00 24.37  ? 50  ASN B C   1 
ATOM   2877 O  O   . ASN B 2  50  ? -60.038 -19.952 30.216  1.00 24.70  ? 50  ASN B O   1 
ATOM   2878 C  CB  . ASN B 2  50  ? -61.366 -16.999 29.675  1.00 27.12  ? 50  ASN B CB  1 
ATOM   2879 C  CG  . ASN B 2  50  ? -61.402 -17.017 31.170  1.00 40.21  ? 50  ASN B CG  1 
ATOM   2880 O  OD1 . ASN B 2  50  ? -62.173 -17.765 31.788  1.00 48.65  ? 50  ASN B OD1 1 
ATOM   2881 N  ND2 . ASN B 2  50  ? -60.522 -16.254 31.778  1.00 31.42  ? 50  ASN B ND2 1 
ATOM   2882 N  N   . LYS B 2  51  ? -61.167 -19.909 28.280  1.00 24.39  ? 51  LYS B N   1 
ATOM   2883 C  CA  . LYS B 2  51  ? -61.523 -21.342 28.315  1.00 25.95  ? 51  LYS B CA  1 
ATOM   2884 C  C   . LYS B 2  51  ? -60.273 -22.173 28.322  1.00 23.42  ? 51  LYS B C   1 
ATOM   2885 O  O   . LYS B 2  51  ? -60.077 -23.061 29.181  1.00 25.83  ? 51  LYS B O   1 
ATOM   2886 C  CB  . LYS B 2  51  ? -62.310 -21.714 27.060  1.00 25.17  ? 51  LYS B CB  1 
ATOM   2887 C  CG  . LYS B 2  51  ? -62.595 -23.211 26.978  1.00 26.13  ? 51  LYS B CG  1 
ATOM   2888 C  CD  . LYS B 2  51  ? -63.439 -23.581 25.740  1.00 29.09  ? 51  LYS B CD  1 
ATOM   2889 C  CE  . LYS B 2  51  ? -64.851 -23.073 25.769  1.00 25.58  ? 51  LYS B CE  1 
ATOM   2890 N  NZ  . LYS B 2  51  ? -65.816 -24.002 25.027  1.00 19.52  ? 51  LYS B NZ  1 
ATOM   2891 N  N   . VAL B 2  52  ? -59.348 -21.835 27.427  1.00 25.73  ? 52  VAL B N   1 
ATOM   2892 C  CA  . VAL B 2  52  ? -58.090 -22.588 27.364  1.00 20.80  ? 52  VAL B CA  1 
ATOM   2893 C  C   . VAL B 2  52  ? -57.241 -22.418 28.657  1.00 26.12  ? 52  VAL B C   1 
ATOM   2894 O  O   . VAL B 2  52  ? -56.690 -23.396 29.182  1.00 24.19  ? 52  VAL B O   1 
ATOM   2895 C  CB  . VAL B 2  52  ? -57.196 -22.230 26.142  1.00 26.97  ? 52  VAL B CB  1 
ATOM   2896 C  CG1 . VAL B 2  52  ? -55.833 -22.923 26.271  1.00 25.24  ? 52  VAL B CG1 1 
ATOM   2897 C  CG2 . VAL B 2  52  ? -57.838 -22.629 24.833  1.00 20.18  ? 52  VAL B CG2 1 
ATOM   2898 N  N   . ASN B 2  53  ? -57.184 -21.201 29.193  1.00 24.60  ? 53  ASN B N   1 
ATOM   2899 C  CA  . ASN B 2  53  ? -56.518 -20.952 30.444  1.00 25.04  ? 53  ASN B CA  1 
ATOM   2900 C  C   . ASN B 2  53  ? -57.178 -21.687 31.571  1.00 25.23  ? 53  ASN B C   1 
ATOM   2901 O  O   . ASN B 2  53  ? -56.486 -22.108 32.525  1.00 25.17  ? 53  ASN B O   1 
ATOM   2902 C  CB  . ASN B 2  53  ? -56.464 -19.418 30.748  1.00 23.22  ? 53  ASN B CB  1 
ATOM   2903 C  CG  . ASN B 2  53  ? -55.487 -18.698 29.846  1.00 31.20  ? 53  ASN B CG  1 
ATOM   2904 O  OD1 . ASN B 2  53  ? -54.578 -19.345 29.321  1.00 24.81  ? 53  ASN B OD1 1 
ATOM   2905 N  ND2 . ASN B 2  53  ? -55.655 -17.369 29.652  1.00 17.22  ? 53  ASN B ND2 1 
ATOM   2906 N  N   . SER B 2  54  ? -58.504 -21.834 31.535  1.00 25.48  ? 54  SER B N   1 
ATOM   2907 C  CA  . SER B 2  54  ? -59.168 -22.610 32.679  1.00 25.10  ? 54  SER B CA  1 
ATOM   2908 C  C   . SER B 2  54  ? -58.808 -24.104 32.588  1.00 23.54  ? 54  SER B C   1 
ATOM   2909 O  O   . SER B 2  54  ? -58.525 -24.781 33.586  1.00 22.36  ? 54  SER B O   1 
ATOM   2910 C  CB  . SER B 2  54  ? -60.685 -22.431 32.621  1.00 24.45  ? 54  SER B CB  1 
ATOM   2911 O  OG  . SER B 2  54  ? -61.036 -21.076 32.819  1.00 27.83  ? 54  SER B OG  1 
ATOM   2912 N  N   . VAL B 2  55  ? -58.716 -24.614 31.359  1.00 25.17  ? 55  VAL B N   1 
ATOM   2913 C  CA  . VAL B 2  55  ? -58.343 -26.010 31.248  1.00 26.87  ? 55  VAL B CA  1 
ATOM   2914 C  C   . VAL B 2  55  ? -56.957 -26.182 31.829  1.00 28.57  ? 55  VAL B C   1 
ATOM   2915 O  O   . VAL B 2  55  ? -56.730 -27.064 32.667  1.00 29.23  ? 55  VAL B O   1 
ATOM   2916 C  CB  . VAL B 2  55  ? -58.450 -26.538 29.839  1.00 26.31  ? 55  VAL B CB  1 
ATOM   2917 C  CG1 . VAL B 2  55  ? -57.797 -27.944 29.728  1.00 30.20  ? 55  VAL B CG1 1 
ATOM   2918 C  CG2 . VAL B 2  55  ? -59.915 -26.515 29.381  1.00 24.03  ? 55  VAL B CG2 1 
ATOM   2919 N  N   . ILE B 2  56  ? -56.032 -25.311 31.430  1.00 30.64  ? 56  ILE B N   1 
ATOM   2920 C  CA  . ILE B 2  56  ? -54.644 -25.384 31.962  1.00 25.11  ? 56  ILE B CA  1 
ATOM   2921 C  C   . ILE B 2  56  ? -54.582 -25.247 33.438  1.00 25.44  ? 56  ILE B C   1 
ATOM   2922 O  O   . ILE B 2  56  ? -53.793 -25.910 34.137  1.00 27.01  ? 56  ILE B O   1 
ATOM   2923 C  CB  . ILE B 2  56  ? -53.702 -24.345 31.305  1.00 25.00  ? 56  ILE B CB  1 
ATOM   2924 C  CG1 . ILE B 2  56  ? -53.547 -24.615 29.811  1.00 31.56  ? 56  ILE B CG1 1 
ATOM   2925 C  CG2 . ILE B 2  56  ? -52.265 -24.329 32.009  1.00 19.98  ? 56  ILE B CG2 1 
ATOM   2926 C  CD1 . ILE B 2  56  ? -52.951 -23.445 29.000  1.00 26.96  ? 56  ILE B CD1 1 
ATOM   2927 N  N   . GLU B 2  57  ? -55.374 -24.354 33.987  1.00 25.72  ? 57  GLU B N   1 
ATOM   2928 C  CA  . GLU B 2  57  ? -55.266 -24.144 35.429  1.00 21.66  ? 57  GLU B CA  1 
ATOM   2929 C  C   . GLU B 2  57  ? -55.731 -25.378 36.240  1.00 20.69  ? 57  GLU B C   1 
ATOM   2930 O  O   . GLU B 2  57  ? -55.186 -25.689 37.326  1.00 22.50  ? 57  GLU B O   1 
ATOM   2931 C  CB  . GLU B 2  57  ? -56.111 -22.881 35.738  1.00 26.20  ? 57  GLU B CB  1 
ATOM   2932 C  CG  . GLU B 2  57  ? -56.258 -22.504 37.185  1.00 40.88  ? 57  GLU B CG  1 
ATOM   2933 C  CD  . GLU B 2  57  ? -57.202 -21.288 37.340  1.00 56.92  ? 57  GLU B CD  1 
ATOM   2934 O  OE1 . GLU B 2  57  ? -58.049 -21.058 36.434  1.00 53.01  ? 57  GLU B OE1 1 
ATOM   2935 O  OE2 . GLU B 2  57  ? -57.083 -20.568 38.357  1.00 59.12  ? 57  GLU B OE2 1 
ATOM   2936 N  N   . LYS B 2  58  ? -56.763 -26.063 35.770  1.00 19.92  ? 58  LYS B N   1 
ATOM   2937 C  CA  . LYS B 2  58  ? -57.268 -27.221 36.485  1.00 21.47  ? 58  LYS B CA  1 
ATOM   2938 C  C   . LYS B 2  58  ? -56.358 -28.433 36.455  1.00 26.55  ? 58  LYS B C   1 
ATOM   2939 O  O   . LYS B 2  58  ? -56.410 -29.240 37.368  1.00 22.32  ? 58  LYS B O   1 
ATOM   2940 C  CB  . LYS B 2  58  ? -58.668 -27.619 36.010  1.00 23.78  ? 58  LYS B CB  1 
ATOM   2941 C  CG  . LYS B 2  58  ? -59.766 -26.594 36.293  1.00 30.62  ? 58  LYS B CG  1 
ATOM   2942 C  CD  . LYS B 2  58  ? -59.448 -25.748 37.564  1.00 34.63  ? 58  LYS B CD  1 
ATOM   2943 C  CE  . LYS B 2  58  ? -60.671 -25.051 38.093  1.00 27.52  ? 58  LYS B CE  1 
ATOM   2944 N  NZ  . LYS B 2  58  ? -60.319 -23.855 38.862  1.00 21.70  ? 58  LYS B NZ  1 
ATOM   2945 N  N   . MET B 2  59  ? -55.524 -28.533 35.425  1.00 28.95  ? 59  MET B N   1 
ATOM   2946 C  CA  . MET B 2  59  ? -54.666 -29.692 35.188  1.00 30.05  ? 59  MET B CA  1 
ATOM   2947 C  C   . MET B 2  59  ? -53.273 -29.387 35.685  1.00 33.83  ? 59  MET B C   1 
ATOM   2948 O  O   . MET B 2  59  ? -52.412 -28.900 34.936  1.00 43.47  ? 59  MET B O   1 
ATOM   2949 C  CB  . MET B 2  59  ? -54.590 -29.967 33.653  1.00 30.07  ? 59  MET B CB  1 
ATOM   2950 C  CG  . MET B 2  59  ? -55.977 -30.245 33.007  1.00 24.32  ? 59  MET B CG  1 
ATOM   2951 S  SD  . MET B 2  59  ? -56.636 -31.804 33.686  1.00 37.74  ? 59  MET B SD  1 
ATOM   2952 C  CE  . MET B 2  59  ? -58.140 -31.939 32.672  1.00 32.43  ? 59  MET B CE  1 
ATOM   2953 N  N   . ASN B 2  60  ? -52.999 -29.738 36.918  1.00 39.82  ? 60  ASN B N   1 
ATOM   2954 C  CA  A ASN B 2  60  ? -51.700 -29.386 37.506  0.50 38.79  ? 60  ASN B CA  1 
ATOM   2955 C  CA  B ASN B 2  60  ? -51.698 -29.445 37.559  0.50 39.89  ? 60  ASN B CA  1 
ATOM   2956 C  C   . ASN B 2  60  ? -50.540 -30.221 36.927  1.00 39.21  ? 60  ASN B C   1 
ATOM   2957 O  O   . ASN B 2  60  ? -50.715 -31.381 36.465  1.00 39.30  ? 60  ASN B O   1 
ATOM   2958 C  CB  A ASN B 2  60  ? -51.788 -29.450 39.034  0.50 38.71  ? 60  ASN B CB  1 
ATOM   2959 C  CB  B ASN B 2  60  ? -51.749 -29.693 39.089  0.50 40.51  ? 60  ASN B CB  1 
ATOM   2960 C  CG  A ASN B 2  60  ? -52.844 -28.475 39.587  0.50 34.67  ? 60  ASN B CG  1 
ATOM   2961 C  CG  B ASN B 2  60  ? -52.406 -31.022 39.475  0.50 42.99  ? 60  ASN B CG  1 
ATOM   2962 O  OD1 A ASN B 2  60  ? -53.951 -28.881 39.939  0.50 23.99  ? 60  ASN B OD1 1 
ATOM   2963 O  OD1 B ASN B 2  60  ? -51.797 -32.087 39.337  0.50 49.14  ? 60  ASN B OD1 1 
ATOM   2964 N  ND2 A ASN B 2  60  ? -52.525 -27.185 39.578  0.50 13.29  ? 60  ASN B ND2 1 
ATOM   2965 N  ND2 B ASN B 2  60  ? -53.641 -30.955 40.016  0.50 39.68  ? 60  ASN B ND2 1 
ATOM   2966 N  N   . THR B 2  61  ? -49.356 -29.609 36.894  1.00 38.61  ? 61  THR B N   1 
ATOM   2967 C  CA  . THR B 2  61  ? -48.177 -30.312 36.403  1.00 38.99  ? 61  THR B CA  1 
ATOM   2968 C  C   . THR B 2  61  ? -48.000 -31.492 37.359  1.00 36.32  ? 61  THR B C   1 
ATOM   2969 O  O   . THR B 2  61  ? -48.535 -31.480 38.492  1.00 33.66  ? 61  THR B O   1 
ATOM   2970 C  CB  . THR B 2  61  ? -46.970 -29.381 36.415  1.00 40.28  ? 61  THR B CB  1 
ATOM   2971 O  OG1 . THR B 2  61  ? -46.944 -28.718 37.666  1.00 46.12  ? 61  THR B OG1 1 
ATOM   2972 C  CG2 . THR B 2  61  ? -47.071 -28.269 35.280  1.00 43.81  ? 61  THR B CG2 1 
ATOM   2973 N  N   . GLN B 2  62  ? -47.314 -32.529 36.918  1.00 33.81  ? 62  GLN B N   1 
ATOM   2974 C  CA  . GLN B 2  62  ? -46.924 -33.579 37.852  1.00 32.91  ? 62  GLN B CA  1 
ATOM   2975 C  C   . GLN B 2  62  ? -45.457 -33.292 38.253  1.00 32.83  ? 62  GLN B C   1 
ATOM   2976 O  O   . GLN B 2  62  ? -44.652 -32.796 37.447  1.00 29.83  ? 62  GLN B O   1 
ATOM   2977 C  CB  . GLN B 2  62  ? -47.216 -34.975 37.281  1.00 33.09  ? 62  GLN B CB  1 
ATOM   2978 C  CG  . GLN B 2  62  ? -46.113 -35.734 36.607  1.00 32.07  ? 62  GLN B CG  1 
ATOM   2979 C  CD  . GLN B 2  62  ? -46.555 -37.164 36.107  1.00 39.86  ? 62  GLN B CD  1 
ATOM   2980 O  OE1 . GLN B 2  62  ? -47.710 -37.379 35.657  1.00 29.72  ? 62  GLN B OE1 1 
ATOM   2981 N  NE2 . GLN B 2  62  ? -45.626 -38.152 36.234  1.00 26.98  ? 62  GLN B NE2 1 
ATOM   2982 N  N   . PHE B 2  63  ? -45.160 -33.498 39.522  1.00 31.41  ? 63  PHE B N   1 
ATOM   2983 C  CA  . PHE B 2  63  ? -43.813 -33.353 40.037  1.00 34.14  ? 63  PHE B CA  1 
ATOM   2984 C  C   . PHE B 2  63  ? -43.258 -34.767 40.101  1.00 35.87  ? 63  PHE B C   1 
ATOM   2985 O  O   . PHE B 2  63  ? -43.874 -35.697 39.577  1.00 38.06  ? 63  PHE B O   1 
ATOM   2986 C  CB  . PHE B 2  63  ? -43.809 -32.651 41.413  1.00 34.80  ? 63  PHE B CB  1 
ATOM   2987 C  CG  . PHE B 2  63  ? -44.373 -31.245 41.378  1.00 34.62  ? 63  PHE B CG  1 
ATOM   2988 C  CD1 . PHE B 2  63  ? -45.685 -30.990 41.799  1.00 39.57  ? 63  PHE B CD1 1 
ATOM   2989 C  CD2 . PHE B 2  63  ? -43.592 -30.178 40.914  1.00 45.88  ? 63  PHE B CD2 1 
ATOM   2990 C  CE1 . PHE B 2  63  ? -46.241 -29.684 41.767  1.00 47.21  ? 63  PHE B CE1 1 
ATOM   2991 C  CE2 . PHE B 2  63  ? -44.133 -28.844 40.866  1.00 53.92  ? 63  PHE B CE2 1 
ATOM   2992 C  CZ  . PHE B 2  63  ? -45.461 -28.601 41.293  1.00 47.10  ? 63  PHE B CZ  1 
ATOM   2993 N  N   . THR B 2  64  ? -42.109 -34.931 40.740  1.00 32.97  ? 64  THR B N   1 
ATOM   2994 C  CA  . THR B 2  64  ? -41.378 -36.170 40.697  1.00 31.95  ? 64  THR B CA  1 
ATOM   2995 C  C   . THR B 2  64  ? -42.225 -37.383 41.095  1.00 33.75  ? 64  THR B C   1 
ATOM   2996 O  O   . THR B 2  64  ? -42.839 -37.410 42.161  1.00 37.27  ? 64  THR B O   1 
ATOM   2997 C  CB  . THR B 2  64  ? -40.110 -36.032 41.534  1.00 30.97  ? 64  THR B CB  1 
ATOM   2998 O  OG1 . THR B 2  64  ? -39.256 -35.064 40.881  1.00 27.91  ? 64  THR B OG1 1 
ATOM   2999 C  CG2 . THR B 2  64  ? -39.408 -37.384 41.672  1.00 25.57  ? 64  THR B CG2 1 
ATOM   3000 N  N   . ALA B 2  65  ? -42.280 -38.372 40.205  1.00 35.50  ? 65  ALA B N   1 
ATOM   3001 C  CA  . ALA B 2  65  ? -43.041 -39.630 40.448  1.00 36.73  ? 65  ALA B CA  1 
ATOM   3002 C  C   . ALA B 2  65  ? -42.244 -40.796 39.901  1.00 34.42  ? 65  ALA B C   1 
ATOM   3003 O  O   . ALA B 2  65  ? -42.058 -40.895 38.691  1.00 32.42  ? 65  ALA B O   1 
ATOM   3004 C  CB  . ALA B 2  65  ? -44.457 -39.589 39.791  1.00 31.68  ? 65  ALA B CB  1 
ATOM   3005 N  N   . VAL B 2  66  ? -41.763 -41.649 40.793  1.00 34.80  ? 66  VAL B N   1 
ATOM   3006 C  CA  . VAL B 2  66  ? -40.848 -42.754 40.436  1.00 34.74  ? 66  VAL B CA  1 
ATOM   3007 C  C   . VAL B 2  66  ? -41.422 -44.077 40.976  1.00 37.79  ? 66  VAL B C   1 
ATOM   3008 O  O   . VAL B 2  66  ? -42.352 -44.082 41.793  1.00 34.39  ? 66  VAL B O   1 
ATOM   3009 C  CB  . VAL B 2  66  ? -39.411 -42.491 40.942  1.00 35.73  ? 66  VAL B CB  1 
ATOM   3010 C  CG1 . VAL B 2  66  ? -38.854 -41.220 40.254  1.00 33.03  ? 66  VAL B CG1 1 
ATOM   3011 C  CG2 . VAL B 2  66  ? -39.344 -42.369 42.513  1.00 26.65  ? 66  VAL B CG2 1 
ATOM   3012 N  N   . GLY B 2  67  ? -40.913 -45.196 40.481  1.00 40.00  ? 67  GLY B N   1 
ATOM   3013 C  CA  . GLY B 2  67  ? -41.447 -46.502 40.892  1.00 40.27  ? 67  GLY B CA  1 
ATOM   3014 C  C   . GLY B 2  67  ? -40.986 -46.877 42.302  1.00 38.70  ? 67  GLY B C   1 
ATOM   3015 O  O   . GLY B 2  67  ? -40.186 -46.176 42.949  1.00 39.10  ? 67  GLY B O   1 
ATOM   3016 N  N   . LYS B 2  68  ? -41.490 -48.001 42.766  1.00 35.86  ? 68  LYS B N   1 
ATOM   3017 C  CA  . LYS B 2  68  ? -41.203 -48.511 44.098  1.00 31.51  ? 68  LYS B CA  1 
ATOM   3018 C  C   . LYS B 2  68  ? -40.881 -49.932 43.804  1.00 29.58  ? 68  LYS B C   1 
ATOM   3019 O  O   . LYS B 2  68  ? -41.305 -50.455 42.778  1.00 31.07  ? 68  LYS B O   1 
ATOM   3020 C  CB  . LYS B 2  68  ? -42.426 -48.452 44.986  1.00 30.60  ? 68  LYS B CB  1 
ATOM   3021 C  CG  . LYS B 2  68  ? -42.952 -47.062 45.314  1.00 34.75  ? 68  LYS B CG  1 
ATOM   3022 C  CD  . LYS B 2  68  ? -43.909 -47.090 46.554  1.00 30.00  ? 68  LYS B CD  1 
ATOM   3023 C  CE  . LYS B 2  68  ? -44.412 -45.706 46.931  1.00 29.91  ? 68  LYS B CE  1 
ATOM   3024 N  NZ  . LYS B 2  68  ? -43.329 -44.682 46.704  1.00 31.80  ? 68  LYS B NZ  1 
ATOM   3025 N  N   . GLU B 2  69  ? -40.091 -50.546 44.652  1.00 28.52  ? 69  GLU B N   1 
ATOM   3026 C  CA  . GLU B 2  69  ? -39.795 -51.949 44.521  1.00 31.03  ? 69  GLU B CA  1 
ATOM   3027 C  C   . GLU B 2  69  ? -40.327 -52.750 45.701  1.00 27.73  ? 69  GLU B C   1 
ATOM   3028 O  O   . GLU B 2  69  ? -40.455 -52.219 46.828  1.00 25.78  ? 69  GLU B O   1 
ATOM   3029 C  CB  . GLU B 2  69  ? -38.283 -52.188 44.285  1.00 33.00  ? 69  GLU B CB  1 
ATOM   3030 C  CG  . GLU B 2  69  ? -37.975 -52.041 42.765  1.00 42.78  ? 69  GLU B CG  1 
ATOM   3031 C  CD  . GLU B 2  69  ? -36.507 -52.051 42.383  1.00 50.20  ? 69  GLU B CD  1 
ATOM   3032 O  OE1 . GLU B 2  69  ? -35.684 -52.682 43.089  1.00 53.37  ? 69  GLU B OE1 1 
ATOM   3033 O  OE2 . GLU B 2  69  ? -36.198 -51.437 41.331  1.00 64.19  ? 69  GLU B OE2 1 
ATOM   3034 N  N   . PHE B 2  70  ? -40.596 -54.033 45.407  1.00 24.63  ? 70  PHE B N   1 
ATOM   3035 C  CA  . PHE B 2  70  ? -41.182 -54.987 46.322  1.00 23.68  ? 70  PHE B CA  1 
ATOM   3036 C  C   . PHE B 2  70  ? -40.460 -56.338 46.179  1.00 25.27  ? 70  PHE B C   1 
ATOM   3037 O  O   . PHE B 2  70  ? -40.037 -56.719 45.097  1.00 27.89  ? 70  PHE B O   1 
ATOM   3038 C  CB  . PHE B 2  70  ? -42.691 -55.133 46.035  1.00 22.39  ? 70  PHE B CB  1 
ATOM   3039 C  CG  . PHE B 2  70  ? -43.422 -53.822 46.013  1.00 20.02  ? 70  PHE B CG  1 
ATOM   3040 C  CD1 . PHE B 2  70  ? -43.899 -53.275 47.177  1.00 23.14  ? 70  PHE B CD1 1 
ATOM   3041 C  CD2 . PHE B 2  70  ? -43.549 -53.115 44.846  1.00 25.22  ? 70  PHE B CD2 1 
ATOM   3042 C  CE1 . PHE B 2  70  ? -44.516 -52.073 47.184  1.00 31.34  ? 70  PHE B CE1 1 
ATOM   3043 C  CE2 . PHE B 2  70  ? -44.141 -51.915 44.841  1.00 29.37  ? 70  PHE B CE2 1 
ATOM   3044 C  CZ  . PHE B 2  70  ? -44.648 -51.377 46.029  1.00 28.16  ? 70  PHE B CZ  1 
ATOM   3045 N  N   . ASN B 2  71  ? -40.331 -57.068 47.277  1.00 24.48  ? 71  ASN B N   1 
ATOM   3046 C  CA  . ASN B 2  71  ? -39.671 -58.375 47.254  1.00 25.94  ? 71  ASN B CA  1 
ATOM   3047 C  C   . ASN B 2  71  ? -40.680 -59.457 46.864  1.00 25.28  ? 71  ASN B C   1 
ATOM   3048 O  O   . ASN B 2  71  ? -41.861 -59.180 46.702  1.00 24.24  ? 71  ASN B O   1 
ATOM   3049 C  CB  . ASN B 2  71  ? -38.884 -58.676 48.585  1.00 24.50  ? 71  ASN B CB  1 
ATOM   3050 C  CG  . ASN B 2  71  ? -39.780 -58.867 49.827  1.00 24.84  ? 71  ASN B CG  1 
ATOM   3051 O  OD1 . ASN B 2  71  ? -40.802 -59.526 49.790  1.00 33.72  ? 71  ASN B OD1 1 
ATOM   3052 N  ND2 . ASN B 2  71  ? -39.338 -58.353 50.938  1.00 30.83  ? 71  ASN B ND2 1 
ATOM   3053 N  N   . ASN B 2  72  ? -40.212 -60.688 46.719  1.00 25.76  ? 72  ASN B N   1 
ATOM   3054 C  CA  . ASN B 2  72  ? -41.042 -61.800 46.260  1.00 28.19  ? 72  ASN B CA  1 
ATOM   3055 C  C   . ASN B 2  72  ? -42.135 -62.219 47.254  1.00 28.43  ? 72  ASN B C   1 
ATOM   3056 O  O   . ASN B 2  72  ? -42.945 -63.083 46.939  1.00 26.34  ? 72  ASN B O   1 
ATOM   3057 C  CB  . ASN B 2  72  ? -40.165 -63.013 45.935  1.00 31.31  ? 72  ASN B CB  1 
ATOM   3058 C  CG  . ASN B 2  72  ? -39.442 -63.590 47.186  1.00 37.60  ? 72  ASN B CG  1 
ATOM   3059 O  OD1 . ASN B 2  72  ? -39.419 -62.981 48.256  1.00 47.38  ? 72  ASN B OD1 1 
ATOM   3060 N  ND2 . ASN B 2  72  ? -38.865 -64.765 47.035  1.00 48.32  ? 72  ASN B ND2 1 
ATOM   3061 N  N   . LEU B 2  73  ? -42.154 -61.630 48.456  1.00 26.69  ? 73  LEU B N   1 
ATOM   3062 C  CA  . LEU B 2  73  ? -43.217 -61.913 49.434  1.00 24.72  ? 73  LEU B CA  1 
ATOM   3063 C  C   . LEU B 2  73  ? -44.085 -60.671 49.738  1.00 23.95  ? 73  LEU B C   1 
ATOM   3064 O  O   . LEU B 2  73  ? -44.803 -60.608 50.749  1.00 20.44  ? 73  LEU B O   1 
ATOM   3065 C  CB  . LEU B 2  73  ? -42.602 -62.519 50.694  1.00 24.61  ? 73  LEU B CB  1 
ATOM   3066 C  CG  . LEU B 2  73  ? -42.200 -64.021 50.597  1.00 32.86  ? 73  LEU B CG  1 
ATOM   3067 C  CD1 . LEU B 2  73  ? -41.421 -64.488 51.872  1.00 32.83  ? 73  LEU B CD1 1 
ATOM   3068 C  CD2 . LEU B 2  73  ? -43.428 -64.924 50.424  1.00 29.05  ? 73  LEU B CD2 1 
ATOM   3069 N  N   . GLU B 2  74  ? -44.021 -59.698 48.829  1.00 27.12  ? 74  GLU B N   1 
ATOM   3070 C  CA  . GLU B 2  74  ? -44.818 -58.490 48.933  1.00 28.88  ? 74  GLU B CA  1 
ATOM   3071 C  C   . GLU B 2  74  ? -45.690 -58.296 47.664  1.00 29.15  ? 74  GLU B C   1 
ATOM   3072 O  O   . GLU B 2  74  ? -45.900 -57.158 47.185  1.00 28.21  ? 74  GLU B O   1 
ATOM   3073 C  CB  . GLU B 2  74  ? -43.895 -57.297 49.172  1.00 30.68  ? 74  GLU B CB  1 
ATOM   3074 C  CG  . GLU B 2  74  ? -43.187 -57.304 50.491  1.00 32.49  ? 74  GLU B CG  1 
ATOM   3075 C  CD  . GLU B 2  74  ? -42.207 -56.154 50.641  1.00 33.09  ? 74  GLU B CD  1 
ATOM   3076 O  OE1 . GLU B 2  74  ? -41.492 -55.817 49.663  1.00 29.37  ? 74  GLU B OE1 1 
ATOM   3077 O  OE2 . GLU B 2  74  ? -42.134 -55.584 51.754  1.00 33.16  ? 74  GLU B OE2 1 
ATOM   3078 N  N   . ARG B 2  75  ? -46.212 -59.397 47.120  1.00 26.17  ? 75  ARG B N   1 
ATOM   3079 C  CA  . ARG B 2  75  ? -47.001 -59.324 45.923  1.00 25.61  ? 75  ARG B CA  1 
ATOM   3080 C  C   . ARG B 2  75  ? -48.327 -58.595 46.156  1.00 29.92  ? 75  ARG B C   1 
ATOM   3081 O  O   . ARG B 2  75  ? -48.797 -57.888 45.251  1.00 29.71  ? 75  ARG B O   1 
ATOM   3082 C  CB  . ARG B 2  75  ? -47.170 -60.685 45.276  1.00 26.62  ? 75  ARG B CB  1 
ATOM   3083 C  CG  . ARG B 2  75  ? -47.874 -60.647 43.888  1.00 36.60  ? 75  ARG B CG  1 
ATOM   3084 C  CD  . ARG B 2  75  ? -47.020 -59.878 42.824  1.00 49.57  ? 75  ARG B CD  1 
ATOM   3085 N  NE  . ARG B 2  75  ? -45.638 -60.361 42.848  1.00 58.14  ? 75  ARG B NE  1 
ATOM   3086 C  CZ  . ARG B 2  75  ? -45.190 -61.446 42.210  1.00 68.09  ? 75  ARG B CZ  1 
ATOM   3087 N  NH1 . ARG B 2  75  ? -46.007 -62.162 41.427  1.00 72.51  ? 75  ARG B NH1 1 
ATOM   3088 N  NH2 . ARG B 2  75  ? -43.906 -61.814 42.339  1.00 58.75  ? 75  ARG B NH2 1 
ATOM   3089 N  N   . ARG B 2  76  ? -48.912 -58.704 47.356  1.00 27.84  ? 76  ARG B N   1 
ATOM   3090 C  CA  . ARG B 2  76  ? -50.159 -58.051 47.634  1.00 27.82  ? 76  ARG B CA  1 
ATOM   3091 C  C   . ARG B 2  76  ? -49.985 -56.525 47.599  1.00 28.22  ? 76  ARG B C   1 
ATOM   3092 O  O   . ARG B 2  76  ? -50.800 -55.828 46.990  1.00 31.12  ? 76  ARG B O   1 
ATOM   3093 C  CB  . ARG B 2  76  ? -50.786 -58.491 48.973  1.00 28.80  ? 76  ARG B CB  1 
ATOM   3094 C  CG  . ARG B 2  76  ? -51.488 -59.872 48.932  1.00 27.11  ? 76  ARG B CG  1 
ATOM   3095 C  CD  . ARG B 2  76  ? -51.689 -60.507 50.323  1.00 25.02  ? 76  ARG B CD  1 
ATOM   3096 N  NE  . ARG B 2  76  ? -50.492 -60.374 51.156  1.00 30.91  ? 76  ARG B NE  1 
ATOM   3097 C  CZ  . ARG B 2  76  ? -50.490 -60.067 52.454  1.00 27.67  ? 76  ARG B CZ  1 
ATOM   3098 N  NH1 . ARG B 2  76  ? -51.640 -59.896 53.144  1.00 26.85  ? 76  ARG B NH1 1 
ATOM   3099 N  NH2 . ARG B 2  76  ? -49.326 -59.943 53.070  1.00 28.21  ? 76  ARG B NH2 1 
ATOM   3100 N  N   . ILE B 2  77  ? -48.955 -56.000 48.239  1.00 27.10  ? 77  ILE B N   1 
ATOM   3101 C  CA  . ILE B 2  77  ? -48.804 -54.606 48.259  1.00 29.95  ? 77  ILE B CA  1 
ATOM   3102 C  C   . ILE B 2  77  ? -48.277 -54.121 46.884  1.00 31.83  ? 77  ILE B C   1 
ATOM   3103 O  O   . ILE B 2  77  ? -48.642 -53.006 46.474  1.00 27.50  ? 77  ILE B O   1 
ATOM   3104 C  CB  . ILE B 2  77  ? -47.978 -54.050 49.446  1.00 29.35  ? 77  ILE B CB  1 
ATOM   3105 C  CG1 . ILE B 2  77  ? -46.604 -54.678 49.525  1.00 32.82  ? 77  ILE B CG1 1 
ATOM   3106 C  CG2 . ILE B 2  77  ? -48.683 -54.246 50.791  1.00 30.51  ? 77  ILE B CG2 1 
ATOM   3107 C  CD1 . ILE B 2  77  ? -45.747 -53.981 50.642  1.00 28.77  ? 77  ILE B CD1 1 
ATOM   3108 N  N   . GLU B 2  78  ? -47.480 -54.952 46.182  1.00 29.06  ? 78  GLU B N   1 
ATOM   3109 C  CA  . GLU B 2  78  ? -46.999 -54.613 44.863  1.00 26.60  ? 78  GLU B CA  1 
ATOM   3110 C  C   . GLU B 2  78  ? -48.232 -54.416 43.961  1.00 28.38  ? 78  GLU B C   1 
ATOM   3111 O  O   . GLU B 2  78  ? -48.348 -53.404 43.242  1.00 24.37  ? 78  GLU B O   1 
ATOM   3112 C  CB  . GLU B 2  78  ? -46.047 -55.655 44.244  1.00 25.52  ? 78  GLU B CB  1 
ATOM   3113 C  CG  . GLU B 2  78  ? -45.679 -55.227 42.810  1.00 28.71  ? 78  GLU B CG  1 
ATOM   3114 C  CD  . GLU B 2  78  ? -44.603 -56.030 42.140  1.00 19.54  ? 78  GLU B CD  1 
ATOM   3115 O  OE1 . GLU B 2  78  ? -44.129 -55.655 41.058  1.00 48.07  ? 78  GLU B OE1 1 
ATOM   3116 O  OE2 . GLU B 2  78  ? -44.276 -57.068 42.635  1.00 28.31  ? 78  GLU B OE2 1 
ATOM   3117 N  N   . ASN B 2  79  ? -49.147 -55.380 44.007  1.00 29.47  ? 79  ASN B N   1 
ATOM   3118 C  CA  . ASN B 2  79  ? -50.389 -55.311 43.216  1.00 27.28  ? 79  ASN B CA  1 
ATOM   3119 C  C   . ASN B 2  79  ? -51.265 -54.128 43.637  1.00 27.64  ? 79  ASN B C   1 
ATOM   3120 O  O   . ASN B 2  79  ? -51.913 -53.496 42.808  1.00 23.41  ? 79  ASN B O   1 
ATOM   3121 C  CB  . ASN B 2  79  ? -51.157 -56.618 43.301  1.00 25.31  ? 79  ASN B CB  1 
ATOM   3122 C  CG  . ASN B 2  79  ? -50.516 -57.721 42.522  1.00 32.98  ? 79  ASN B CG  1 
ATOM   3123 O  OD1 . ASN B 2  79  ? -49.700 -57.467 41.632  1.00 36.74  ? 79  ASN B OD1 1 
ATOM   3124 N  ND2 . ASN B 2  79  ? -50.895 -58.984 42.835  1.00 30.10  ? 79  ASN B ND2 1 
ATOM   3125 N  N   . LEU B 2  80  ? -51.263 -53.803 44.922  1.00 29.10  ? 80  LEU B N   1 
ATOM   3126 C  CA  . LEU B 2  80  ? -52.047 -52.664 45.401  1.00 28.90  ? 80  LEU B CA  1 
ATOM   3127 C  C   . LEU B 2  80  ? -51.477 -51.348 44.818  1.00 30.79  ? 80  LEU B C   1 
ATOM   3128 O  O   . LEU B 2  80  ? -52.215 -50.432 44.343  1.00 26.29  ? 80  LEU B O   1 
ATOM   3129 C  CB  . LEU B 2  80  ? -52.037 -52.612 46.944  1.00 28.26  ? 80  LEU B CB  1 
ATOM   3130 C  CG  . LEU B 2  80  ? -52.710 -51.420 47.618  1.00 30.31  ? 80  LEU B CG  1 
ATOM   3131 C  CD1 . LEU B 2  80  ? -54.184 -51.336 47.188  1.00 24.59  ? 80  LEU B CD1 1 
ATOM   3132 C  CD2 . LEU B 2  80  ? -52.536 -51.521 49.177  1.00 31.29  ? 80  LEU B CD2 1 
ATOM   3133 N  N   . ASN B 2  81  ? -50.157 -51.241 44.855  1.00 25.74  ? 81  ASN B N   1 
ATOM   3134 C  CA  . ASN B 2  81  ? -49.516 -50.079 44.253  1.00 27.37  ? 81  ASN B CA  1 
ATOM   3135 C  C   . ASN B 2  81  ? -49.895 -50.002 42.769  1.00 26.82  ? 81  ASN B C   1 
ATOM   3136 O  O   . ASN B 2  81  ? -50.260 -48.938 42.244  1.00 27.72  ? 81  ASN B O   1 
ATOM   3137 C  CB  . ASN B 2  81  ? -48.009 -50.157 44.467  1.00 25.39  ? 81  ASN B CB  1 
ATOM   3138 C  CG  . ASN B 2  81  ? -47.257 -48.886 44.086  1.00 25.55  ? 81  ASN B CG  1 
ATOM   3139 O  OD1 . ASN B 2  81  ? -47.444 -47.815 44.688  1.00 32.39  ? 81  ASN B OD1 1 
ATOM   3140 N  ND2 . ASN B 2  81  ? -46.316 -49.027 43.160  1.00 22.41  ? 81  ASN B ND2 1 
ATOM   3141 N  N   . LYS B 2  82  ? -49.869 -51.141 42.104  1.00 26.65  ? 82  LYS B N   1 
ATOM   3142 C  CA  . LYS B 2  82  ? -50.198 -51.179 40.697  1.00 25.49  ? 82  LYS B CA  1 
ATOM   3143 C  C   . LYS B 2  82  ? -51.637 -50.724 40.497  1.00 30.20  ? 82  LYS B C   1 
ATOM   3144 O  O   . LYS B 2  82  ? -51.915 -49.945 39.565  1.00 31.47  ? 82  LYS B O   1 
ATOM   3145 C  CB  . LYS B 2  82  ? -49.920 -52.530 40.096  1.00 24.61  ? 82  LYS B CB  1 
ATOM   3146 C  CG  . LYS B 2  82  ? -50.081 -52.564 38.561  1.00 41.27  ? 82  LYS B CG  1 
ATOM   3147 C  CD  . LYS B 2  82  ? -49.500 -53.815 37.906  1.00 49.30  ? 82  LYS B CD  1 
ATOM   3148 C  CE  . LYS B 2  82  ? -50.045 -54.040 36.451  1.00 55.15  ? 82  LYS B CE  1 
ATOM   3149 N  NZ  . LYS B 2  82  ? -50.295 -52.784 35.650  1.00 57.16  ? 82  LYS B NZ  1 
ATOM   3150 N  N   . LYS B 2  83  ? -52.538 -51.151 41.392  1.00 27.01  ? 83  LYS B N   1 
ATOM   3151 C  CA  . LYS B 2  83  ? -53.956 -50.864 41.194  1.00 26.81  ? 83  LYS B CA  1 
ATOM   3152 C  C   . LYS B 2  83  ? -54.165 -49.360 41.335  1.00 26.86  ? 83  LYS B C   1 
ATOM   3153 O  O   . LYS B 2  83  ? -54.984 -48.775 40.635  1.00 25.98  ? 83  LYS B O   1 
ATOM   3154 C  CB  . LYS B 2  83  ? -54.829 -51.702 42.154  1.00 24.82  ? 83  LYS B CB  1 
ATOM   3155 C  CG  . LYS B 2  83  ? -56.288 -51.329 42.285  1.00 27.22  ? 83  LYS B CG  1 
ATOM   3156 C  CD  . LYS B 2  83  ? -57.104 -52.434 43.076  1.00 24.50  ? 83  LYS B CD  1 
ATOM   3157 C  CE  . LYS B 2  83  ? -56.629 -52.604 44.571  1.00 24.85  ? 83  LYS B CE  1 
ATOM   3158 N  NZ  . LYS B 2  83  ? -57.659 -53.203 45.524  1.00 24.58  ? 83  LYS B NZ  1 
ATOM   3159 N  N   . VAL B 2  84  ? -53.422 -48.751 42.253  1.00 27.27  ? 84  VAL B N   1 
ATOM   3160 C  CA  . VAL B 2  84  ? -53.514 -47.342 42.495  1.00 26.99  ? 84  VAL B CA  1 
ATOM   3161 C  C   . VAL B 2  84  ? -52.998 -46.532 41.298  1.00 27.46  ? 84  VAL B C   1 
ATOM   3162 O  O   . VAL B 2  84  ? -53.659 -45.591 40.896  1.00 28.10  ? 84  VAL B O   1 
ATOM   3163 C  CB  . VAL B 2  84  ? -52.726 -46.927 43.751  1.00 28.33  ? 84  VAL B CB  1 
ATOM   3164 C  CG1 . VAL B 2  84  ? -52.586 -45.429 43.794  1.00 21.36  ? 84  VAL B CG1 1 
ATOM   3165 C  CG2 . VAL B 2  84  ? -53.426 -47.507 45.035  1.00 25.21  ? 84  VAL B CG2 1 
ATOM   3166 N  N   . ASP B 2  85  ? -51.803 -46.873 40.789  1.00 27.56  ? 85  ASP B N   1 
ATOM   3167 C  CA  . ASP B 2  85  ? -51.235 -46.195 39.642  1.00 27.12  ? 85  ASP B CA  1 
ATOM   3168 C  C   . ASP B 2  85  ? -52.112 -46.325 38.398  1.00 28.10  ? 85  ASP B C   1 
ATOM   3169 O  O   . ASP B 2  85  ? -52.352 -45.307 37.743  1.00 23.58  ? 85  ASP B O   1 
ATOM   3170 C  CB  . ASP B 2  85  ? -49.817 -46.631 39.336  1.00 25.39  ? 85  ASP B CB  1 
ATOM   3171 C  CG  . ASP B 2  85  ? -48.854 -46.252 40.431  1.00 30.65  ? 85  ASP B CG  1 
ATOM   3172 O  OD1 . ASP B 2  85  ? -49.100 -45.257 41.166  1.00 27.23  ? 85  ASP B OD1 1 
ATOM   3173 O  OD2 . ASP B 2  85  ? -47.818 -46.950 40.552  1.00 30.19  ? 85  ASP B OD2 1 
ATOM   3174 N  N   . ASP B 2  86  ? -52.583 -47.540 38.089  1.00 24.79  ? 86  ASP B N   1 
ATOM   3175 C  CA  . ASP B 2  86  ? -53.479 -47.755 36.955  1.00 25.41  ? 86  ASP B CA  1 
ATOM   3176 C  C   . ASP B 2  86  ? -54.794 -47.034 37.053  1.00 29.08  ? 86  ASP B C   1 
ATOM   3177 O  O   . ASP B 2  86  ? -55.285 -46.471 36.056  1.00 31.92  ? 86  ASP B O   1 
ATOM   3178 C  CB  . ASP B 2  86  ? -53.722 -49.246 36.719  1.00 27.15  ? 86  ASP B CB  1 
ATOM   3179 C  CG  . ASP B 2  86  ? -52.475 -49.956 36.199  1.00 32.18  ? 86  ASP B CG  1 
ATOM   3180 O  OD1 . ASP B 2  86  ? -51.546 -49.225 35.789  1.00 38.96  ? 86  ASP B OD1 1 
ATOM   3181 O  OD2 . ASP B 2  86  ? -52.411 -51.214 36.217  1.00 40.62  ? 86  ASP B OD2 1 
ATOM   3182 N  N   . GLY B 2  87  ? -55.381 -47.056 38.251  1.00 27.82  ? 87  GLY B N   1 
ATOM   3183 C  CA  . GLY B 2  87  ? -56.686 -46.457 38.483  1.00 23.05  ? 87  GLY B CA  1 
ATOM   3184 C  C   . GLY B 2  87  ? -56.673 -44.941 38.355  1.00 26.26  ? 87  GLY B C   1 
ATOM   3185 O  O   . GLY B 2  87  ? -57.623 -44.391 37.818  1.00 27.41  ? 87  GLY B O   1 
ATOM   3186 N  N   . PHE B 2  88  ? -55.649 -44.273 38.907  1.00 25.94  ? 88  PHE B N   1 
ATOM   3187 C  CA  . PHE B 2  88  ? -55.528 -42.851 38.790  1.00 27.94  ? 88  PHE B CA  1 
ATOM   3188 C  C   . PHE B 2  88  ? -55.263 -42.445 37.330  1.00 28.73  ? 88  PHE B C   1 
ATOM   3189 O  O   . PHE B 2  88  ? -55.771 -41.455 36.905  1.00 28.17  ? 88  PHE B O   1 
ATOM   3190 C  CB  . PHE B 2  88  ? -54.416 -42.260 39.683  1.00 24.63  ? 88  PHE B CB  1 
ATOM   3191 C  CG  . PHE B 2  88  ? -54.767 -42.140 41.160  1.00 30.62  ? 88  PHE B CG  1 
ATOM   3192 C  CD1 . PHE B 2  88  ? -53.820 -42.419 42.102  1.00 29.46  ? 88  PHE B CD1 1 
ATOM   3193 C  CD2 . PHE B 2  88  ? -56.009 -41.701 41.595  1.00 22.76  ? 88  PHE B CD2 1 
ATOM   3194 C  CE1 . PHE B 2  88  ? -54.076 -42.299 43.459  1.00 34.68  ? 88  PHE B CE1 1 
ATOM   3195 C  CE2 . PHE B 2  88  ? -56.264 -41.570 42.929  1.00 29.23  ? 88  PHE B CE2 1 
ATOM   3196 C  CZ  . PHE B 2  88  ? -55.292 -41.912 43.877  1.00 22.63  ? 88  PHE B CZ  1 
ATOM   3197 N  N   . LEU B 2  89  ? -54.430 -43.195 36.618  1.00 25.58  ? 89  LEU B N   1 
ATOM   3198 C  CA  . LEU B 2  89  ? -54.181 -43.019 35.176  1.00 25.48  ? 89  LEU B CA  1 
ATOM   3199 C  C   . LEU B 2  89  ? -55.445 -43.162 34.330  1.00 27.26  ? 89  LEU B C   1 
ATOM   3200 O  O   . LEU B 2  89  ? -55.720 -42.300 33.480  1.00 25.07  ? 89  LEU B O   1 
ATOM   3201 C  CB  . LEU B 2  89  ? -53.111 -44.016 34.694  1.00 27.75  ? 89  LEU B CB  1 
ATOM   3202 C  CG  . LEU B 2  89  ? -52.596 -43.973 33.245  1.00 21.65  ? 89  LEU B CG  1 
ATOM   3203 C  CD1 . LEU B 2  89  ? -52.280 -42.490 32.789  1.00 25.82  ? 89  LEU B CD1 1 
ATOM   3204 C  CD2 . LEU B 2  89  ? -51.356 -44.919 33.095  1.00 14.93  ? 89  LEU B CD2 1 
ATOM   3205 N  N   . ASP B 2  90  ? -56.255 -44.192 34.615  1.00 26.16  ? 90  ASP B N   1 
ATOM   3206 C  CA  . ASP B 2  90  ? -57.576 -44.372 33.980  1.00 25.91  ? 90  ASP B CA  1 
ATOM   3207 C  C   . ASP B 2  90  ? -58.420 -43.132 34.180  1.00 25.79  ? 90  ASP B C   1 
ATOM   3208 O  O   . ASP B 2  90  ? -59.047 -42.613 33.254  1.00 25.13  ? 90  ASP B O   1 
ATOM   3209 C  CB  . ASP B 2  90  ? -58.339 -45.547 34.604  1.00 25.07  ? 90  ASP B CB  1 
ATOM   3210 C  CG  . ASP B 2  90  ? -57.785 -46.859 34.233  1.00 30.47  ? 90  ASP B CG  1 
ATOM   3211 O  OD1 . ASP B 2  90  ? -56.918 -46.926 33.347  1.00 28.63  ? 90  ASP B OD1 1 
ATOM   3212 O  OD2 . ASP B 2  90  ? -58.254 -47.853 34.810  1.00 34.65  ? 90  ASP B OD2 1 
ATOM   3213 N  N   . ILE B 2  91  ? -58.464 -42.664 35.411  1.00 21.84  ? 91  ILE B N   1 
ATOM   3214 C  CA  . ILE B 2  91  ? -59.318 -41.540 35.723  1.00 25.74  ? 91  ILE B CA  1 
ATOM   3215 C  C   . ILE B 2  91  ? -58.821 -40.229 35.073  1.00 27.23  ? 91  ILE B C   1 
ATOM   3216 O  O   . ILE B 2  91  ? -59.616 -39.464 34.573  1.00 27.05  ? 91  ILE B O   1 
ATOM   3217 C  CB  . ILE B 2  91  ? -59.506 -41.357 37.246  1.00 20.70  ? 91  ILE B CB  1 
ATOM   3218 C  CG1 . ILE B 2  91  ? -60.489 -42.420 37.764  1.00 25.18  ? 91  ILE B CG1 1 
ATOM   3219 C  CG2 . ILE B 2  91  ? -60.029 -39.902 37.553  1.00 15.84  ? 91  ILE B CG2 1 
ATOM   3220 C  CD1 . ILE B 2  91  ? -60.265 -42.789 39.320  1.00 19.28  ? 91  ILE B CD1 1 
ATOM   3221 N  N   . TRP B 2  92  ? -57.526 -39.963 35.111  1.00 27.00  ? 92  TRP B N   1 
ATOM   3222 C  CA  . TRP B 2  92  ? -57.036 -38.740 34.503  1.00 27.69  ? 92  TRP B CA  1 
ATOM   3223 C  C   . TRP B 2  92  ? -57.105 -38.777 32.968  1.00 27.61  ? 92  TRP B C   1 
ATOM   3224 O  O   . TRP B 2  92  ? -57.406 -37.746 32.346  1.00 29.18  ? 92  TRP B O   1 
ATOM   3225 C  CB  . TRP B 2  92  ? -55.673 -38.360 35.018  1.00 27.32  ? 92  TRP B CB  1 
ATOM   3226 C  CG  . TRP B 2  92  ? -55.738 -37.737 36.385  1.00 23.42  ? 92  TRP B CG  1 
ATOM   3227 C  CD1 . TRP B 2  92  ? -55.264 -38.271 37.543  1.00 23.07  ? 92  TRP B CD1 1 
ATOM   3228 C  CD2 . TRP B 2  92  ? -56.268 -36.457 36.726  1.00 19.61  ? 92  TRP B CD2 1 
ATOM   3229 N  NE1 . TRP B 2  92  ? -55.469 -37.411 38.573  1.00 19.26  ? 92  TRP B NE1 1 
ATOM   3230 C  CE2 . TRP B 2  92  ? -56.109 -36.303 38.111  1.00 21.38  ? 92  TRP B CE2 1 
ATOM   3231 C  CE3 . TRP B 2  92  ? -56.879 -35.431 35.994  1.00 22.22  ? 92  TRP B CE3 1 
ATOM   3232 C  CZ2 . TRP B 2  92  ? -56.555 -35.178 38.799  1.00 28.81  ? 92  TRP B CZ2 1 
ATOM   3233 C  CZ3 . TRP B 2  92  ? -57.331 -34.329 36.670  1.00 24.53  ? 92  TRP B CZ3 1 
ATOM   3234 C  CH2 . TRP B 2  92  ? -57.142 -34.205 38.074  1.00 26.95  ? 92  TRP B CH2 1 
ATOM   3235 N  N   . THR B 2  93  ? -56.896 -39.945 32.356  1.00 27.16  ? 93  THR B N   1 
ATOM   3236 C  CA  . THR B 2  93  ? -57.076 -40.064 30.899  1.00 22.62  ? 93  THR B CA  1 
ATOM   3237 C  C   . THR B 2  93  ? -58.527 -39.782 30.497  1.00 28.70  ? 93  THR B C   1 
ATOM   3238 O  O   . THR B 2  93  ? -58.830 -39.057 29.486  1.00 25.56  ? 93  THR B O   1 
ATOM   3239 C  CB  . THR B 2  93  ? -56.650 -41.386 30.423  1.00 21.45  ? 93  THR B CB  1 
ATOM   3240 O  OG1 . THR B 2  93  ? -55.285 -41.635 30.810  1.00 22.06  ? 93  THR B OG1 1 
ATOM   3241 C  CG2 . THR B 2  93  ? -56.795 -41.514 28.865  1.00 17.24  ? 93  THR B CG2 1 
ATOM   3242 N  N   . TYR B 2  94  ? -59.444 -40.397 31.252  1.00 28.76  ? 94  TYR B N   1 
ATOM   3243 C  CA  . TYR B 2  94  ? -60.865 -40.197 31.036  1.00 24.70  ? 94  TYR B CA  1 
ATOM   3244 C  C   . TYR B 2  94  ? -61.220 -38.718 31.176  1.00 26.26  ? 94  TYR B C   1 
ATOM   3245 O  O   . TYR B 2  94  ? -61.998 -38.186 30.358  1.00 26.54  ? 94  TYR B O   1 
ATOM   3246 C  CB  . TYR B 2  94  ? -61.635 -41.008 32.052  1.00 29.19  ? 94  TYR B CB  1 
ATOM   3247 C  CG  . TYR B 2  94  ? -63.101 -40.756 32.128  1.00 16.93  ? 94  TYR B CG  1 
ATOM   3248 C  CD1 . TYR B 2  94  ? -63.979 -41.482 31.378  1.00 23.89  ? 94  TYR B CD1 1 
ATOM   3249 C  CD2 . TYR B 2  94  ? -63.605 -39.737 32.957  1.00 23.34  ? 94  TYR B CD2 1 
ATOM   3250 C  CE1 . TYR B 2  94  ? -65.403 -41.279 31.471  1.00 24.20  ? 94  TYR B CE1 1 
ATOM   3251 C  CE2 . TYR B 2  94  ? -65.006 -39.500 33.040  1.00 22.77  ? 94  TYR B CE2 1 
ATOM   3252 C  CZ  . TYR B 2  94  ? -65.888 -40.268 32.313  1.00 29.87  ? 94  TYR B CZ  1 
ATOM   3253 O  OH  . TYR B 2  94  ? -67.248 -39.973 32.399  1.00 27.13  ? 94  TYR B OH  1 
ATOM   3254 N  N   . ASN B 2  95  ? -60.713 -38.069 32.223  1.00 26.49  ? 95  ASN B N   1 
ATOM   3255 C  CA  . ASN B 2  95  ? -61.113 -36.670 32.535  1.00 27.02  ? 95  ASN B CA  1 
ATOM   3256 C  C   . ASN B 2  95  ? -60.618 -35.725 31.410  1.00 29.15  ? 95  ASN B C   1 
ATOM   3257 O  O   . ASN B 2  95  ? -61.312 -34.800 31.034  1.00 28.48  ? 95  ASN B O   1 
ATOM   3258 C  CB  . ASN B 2  95  ? -60.503 -36.131 33.827  1.00 28.44  ? 95  ASN B CB  1 
ATOM   3259 C  CG  . ASN B 2  95  ? -61.095 -36.721 35.105  1.00 29.62  ? 95  ASN B CG  1 
ATOM   3260 O  OD1 . ASN B 2  95  ? -62.214 -37.215 35.136  1.00 30.67  ? 95  ASN B OD1 1 
ATOM   3261 N  ND2 . ASN B 2  95  ? -60.337 -36.552 36.229  1.00 36.89  ? 95  ASN B ND2 1 
ATOM   3262 N  N   . ALA B 2  96  ? -59.396 -35.932 30.967  1.00 26.64  ? 96  ALA B N   1 
ATOM   3263 C  CA  . ALA B 2  96  ? -58.797 -35.084 29.949  1.00 28.99  ? 96  ALA B CA  1 
ATOM   3264 C  C   . ALA B 2  96  ? -59.522 -35.287 28.614  1.00 28.96  ? 96  ALA B C   1 
ATOM   3265 O  O   . ALA B 2  96  ? -59.881 -34.344 27.964  1.00 30.56  ? 96  ALA B O   1 
ATOM   3266 C  CB  . ALA B 2  96  ? -57.364 -35.409 29.807  1.00 20.88  ? 96  ALA B CB  1 
ATOM   3267 N  N   . GLU B 2  97  ? -59.791 -36.519 28.226  1.00 27.73  ? 97  GLU B N   1 
ATOM   3268 C  CA  . GLU B 2  97  ? -60.422 -36.734 26.949  1.00 23.02  ? 97  GLU B CA  1 
ATOM   3269 C  C   . GLU B 2  97  ? -61.822 -36.202 26.925  1.00 26.27  ? 97  GLU B C   1 
ATOM   3270 O  O   . GLU B 2  97  ? -62.273 -35.617 25.928  1.00 25.92  ? 97  GLU B O   1 
ATOM   3271 C  CB  . GLU B 2  97  ? -60.351 -38.198 26.490  1.00 20.71  ? 97  GLU B CB  1 
ATOM   3272 C  CG  . GLU B 2  97  ? -58.977 -38.644 26.300  1.00 23.19  ? 97  GLU B CG  1 
ATOM   3273 C  CD  . GLU B 2  97  ? -58.840 -40.111 25.912  1.00 30.39  ? 97  GLU B CD  1 
ATOM   3274 O  OE1 . GLU B 2  97  ? -59.853 -40.812 25.654  1.00 36.85  ? 97  GLU B OE1 1 
ATOM   3275 O  OE2 . GLU B 2  97  ? -57.686 -40.541 25.821  1.00 29.56  ? 97  GLU B OE2 1 
ATOM   3276 N  N   . LEU B 2  98  ? -62.532 -36.400 28.015  1.00 24.44  ? 98  LEU B N   1 
ATOM   3277 C  CA  . LEU B 2  98  ? -63.866 -35.991 28.071  1.00 21.60  ? 98  LEU B CA  1 
ATOM   3278 C  C   . LEU B 2  98  ? -64.000 -34.495 28.157  1.00 26.52  ? 98  LEU B C   1 
ATOM   3279 O  O   . LEU B 2  98  ? -64.861 -33.921 27.515  1.00 22.23  ? 98  LEU B O   1 
ATOM   3280 C  CB  . LEU B 2  98  ? -64.505 -36.621 29.287  1.00 24.48  ? 98  LEU B CB  1 
ATOM   3281 C  CG  . LEU B 2  98  ? -65.943 -36.290 29.470  1.00 27.07  ? 98  LEU B CG  1 
ATOM   3282 C  CD1 . LEU B 2  98  ? -66.752 -37.044 28.429  1.00 30.41  ? 98  LEU B CD1 1 
ATOM   3283 C  CD2 . LEU B 2  98  ? -66.292 -36.619 30.957  1.00 36.98  ? 98  LEU B CD2 1 
ATOM   3284 N  N   . LEU B 2  99  ? -63.221 -33.843 29.002  1.00 23.44  ? 99  LEU B N   1 
ATOM   3285 C  CA  . LEU B 2  99  ? -63.289 -32.383 29.024  1.00 24.54  ? 99  LEU B CA  1 
ATOM   3286 C  C   . LEU B 2  99  ? -63.029 -31.774 27.595  1.00 24.25  ? 99  LEU B C   1 
ATOM   3287 O  O   . LEU B 2  99  ? -63.692 -30.872 27.164  1.00 27.20  ? 99  LEU B O   1 
ATOM   3288 C  CB  . LEU B 2  99  ? -62.304 -31.866 30.071  1.00 26.00  ? 99  LEU B CB  1 
ATOM   3289 C  CG  . LEU B 2  99  ? -62.280 -30.355 30.253  1.00 30.59  ? 99  LEU B CG  1 
ATOM   3290 C  CD1 . LEU B 2  99  ? -63.668 -29.820 30.579  1.00 26.29  ? 99  LEU B CD1 1 
ATOM   3291 C  CD2 . LEU B 2  99  ? -61.324 -29.959 31.332  1.00 24.76  ? 99  LEU B CD2 1 
ATOM   3292 N  N   . VAL B 2  100 ? -62.063 -32.301 26.859  1.00 28.37  ? 100 VAL B N   1 
ATOM   3293 C  CA  . VAL B 2  100 ? -61.825 -31.845 25.492  1.00 26.00  ? 100 VAL B CA  1 
ATOM   3294 C  C   . VAL B 2  100 ? -63.018 -32.036 24.579  1.00 23.69  ? 100 VAL B C   1 
ATOM   3295 O  O   . VAL B 2  100 ? -63.388 -31.123 23.880  1.00 23.66  ? 100 VAL B O   1 
ATOM   3296 C  CB  . VAL B 2  100 ? -60.523 -32.477 24.955  1.00 26.85  ? 100 VAL B CB  1 
ATOM   3297 C  CG1 . VAL B 2  100 ? -60.324 -32.145 23.541  1.00 21.98  ? 100 VAL B CG1 1 
ATOM   3298 C  CG2 . VAL B 2  100 ? -59.313 -31.948 25.840  1.00 20.78  ? 100 VAL B CG2 1 
ATOM   3299 N  N   . LEU B 2  101 ? -63.660 -33.208 24.593  1.00 21.78  ? 101 LEU B N   1 
ATOM   3300 C  CA  . LEU B 2  101 ? -64.821 -33.417 23.763  1.00 23.86  ? 101 LEU B CA  1 
ATOM   3301 C  C   . LEU B 2  101 ? -65.938 -32.463 24.117  1.00 25.46  ? 101 LEU B C   1 
ATOM   3302 O  O   . LEU B 2  101 ? -66.546 -31.845 23.215  1.00 19.50  ? 101 LEU B O   1 
ATOM   3303 C  CB  . LEU B 2  101 ? -65.347 -34.858 23.845  1.00 23.84  ? 101 LEU B CB  1 
ATOM   3304 C  CG  . LEU B 2  101 ? -64.521 -36.008 23.288  1.00 29.71  ? 101 LEU B CG  1 
ATOM   3305 C  CD1 . LEU B 2  101 ? -65.307 -37.272 23.587  1.00 29.56  ? 101 LEU B CD1 1 
ATOM   3306 C  CD2 . LEU B 2  101 ? -64.251 -35.924 21.740  1.00 21.02  ? 101 LEU B CD2 1 
ATOM   3307 N  N   . LEU B 2  102 ? -66.207 -32.312 25.419  1.00 24.53  ? 102 LEU B N   1 
ATOM   3308 C  CA  . LEU B 2  102 ? -67.355 -31.510 25.838  1.00 26.73  ? 102 LEU B CA  1 
ATOM   3309 C  C   . LEU B 2  102 ? -67.113 -30.013 25.470  1.00 26.05  ? 102 LEU B C   1 
ATOM   3310 O  O   . LEU B 2  102 ? -67.960 -29.346 24.831  1.00 24.56  ? 102 LEU B O   1 
ATOM   3311 C  CB  . LEU B 2  102 ? -67.556 -31.650 27.343  1.00 26.91  ? 102 LEU B CB  1 
ATOM   3312 C  CG  . LEU B 2  102 ? -67.890 -33.000 27.996  1.00 38.30  ? 102 LEU B CG  1 
ATOM   3313 C  CD1 . LEU B 2  102 ? -67.946 -32.873 29.584  1.00 32.33  ? 102 LEU B CD1 1 
ATOM   3314 C  CD2 . LEU B 2  102 ? -69.204 -33.580 27.485  1.00 34.31  ? 102 LEU B CD2 1 
ATOM   3315 N  N   . GLU B 2  103 ? -65.915 -29.528 25.799  1.00 17.40  ? 103 GLU B N   1 
ATOM   3316 C  CA  . GLU B 2  103 ? -65.549 -28.152 25.460  1.00 19.25  ? 103 GLU B CA  1 
ATOM   3317 C  C   . GLU B 2  103 ? -65.469 -27.894 23.979  1.00 16.87  ? 103 GLU B C   1 
ATOM   3318 O  O   . GLU B 2  103 ? -65.897 -26.833 23.513  1.00 17.30  ? 103 GLU B O   1 
ATOM   3319 C  CB  . GLU B 2  103 ? -64.246 -27.709 26.143  1.00 19.49  ? 103 GLU B CB  1 
ATOM   3320 C  CG  . GLU B 2  103 ? -64.399 -27.582 27.657  1.00 25.07  ? 103 GLU B CG  1 
ATOM   3321 C  CD  . GLU B 2  103 ? -65.497 -26.562 28.056  1.00 20.01  ? 103 GLU B CD  1 
ATOM   3322 O  OE1 . GLU B 2  103 ? -65.823 -25.574 27.311  1.00 23.26  ? 103 GLU B OE1 1 
ATOM   3323 O  OE2 . GLU B 2  103 ? -66.043 -26.756 29.142  1.00 28.95  ? 103 GLU B OE2 1 
ATOM   3324 N  N   . ASN B 2  104 ? -64.951 -28.834 23.207  1.00 18.43  ? 104 ASN B N   1 
ATOM   3325 C  CA  . ASN B 2  104 ? -65.027 -28.657 21.729  1.00 16.69  ? 104 ASN B CA  1 
ATOM   3326 C  C   . ASN B 2  104 ? -66.458 -28.492 21.224  1.00 20.69  ? 104 ASN B C   1 
ATOM   3327 O  O   . ASN B 2  104 ? -66.736 -27.639 20.392  1.00 20.96  ? 104 ASN B O   1 
ATOM   3328 C  CB  . ASN B 2  104 ? -64.390 -29.858 21.015  1.00 15.60  ? 104 ASN B CB  1 
ATOM   3329 C  CG  . ASN B 2  104 ? -62.859 -29.868 21.135  1.00 22.71  ? 104 ASN B CG  1 
ATOM   3330 O  OD1 . ASN B 2  104 ? -62.265 -28.883 21.600  1.00 20.21  ? 104 ASN B OD1 1 
ATOM   3331 N  ND2 . ASN B 2  104 ? -62.207 -30.979 20.689  1.00 12.74  ? 104 ASN B ND2 1 
ATOM   3332 N  N   . GLU B 2  105 ? -67.409 -29.260 21.773  1.00 21.33  ? 105 GLU B N   1 
ATOM   3333 C  CA  . GLU B 2  105 ? -68.803 -29.054 21.374  1.00 18.27  ? 105 GLU B CA  1 
ATOM   3334 C  C   . GLU B 2  105 ? -69.218 -27.636 21.689  1.00 18.63  ? 105 GLU B C   1 
ATOM   3335 O  O   . GLU B 2  105 ? -69.752 -26.905 20.858  1.00 19.42  ? 105 GLU B O   1 
ATOM   3336 C  CB  . GLU B 2  105 ? -69.679 -30.104 22.055  1.00 18.15  ? 105 GLU B CB  1 
ATOM   3337 C  CG  . GLU B 2  105 ? -71.077 -30.215 21.519  1.00 22.24  ? 105 GLU B CG  1 
ATOM   3338 C  CD  . GLU B 2  105 ? -71.144 -31.088 20.258  1.00 33.07  ? 105 GLU B CD  1 
ATOM   3339 O  OE1 . GLU B 2  105 ? -70.810 -32.268 20.363  1.00 26.17  ? 105 GLU B OE1 1 
ATOM   3340 O  OE2 . GLU B 2  105 ? -71.561 -30.589 19.174  1.00 29.83  ? 105 GLU B OE2 1 
ATOM   3341 N  N   . ARG B 2  106 ? -68.941 -27.214 22.921  1.00 21.05  ? 106 ARG B N   1 
ATOM   3342 C  CA  . ARG B 2  106 ? -69.400 -25.906 23.372  1.00 21.52  ? 106 ARG B CA  1 
ATOM   3343 C  C   . ARG B 2  106 ? -68.721 -24.803 22.558  1.00 22.00  ? 106 ARG B C   1 
ATOM   3344 O  O   . ARG B 2  106 ? -69.354 -23.806 22.220  1.00 21.15  ? 106 ARG B O   1 
ATOM   3345 C  CB  . ARG B 2  106 ? -69.193 -25.722 24.904  1.00 22.23  ? 106 ARG B CB  1 
ATOM   3346 C  CG  . ARG B 2  106 ? -69.980 -26.652 25.825  1.00 18.34  ? 106 ARG B CG  1 
ATOM   3347 C  CD  . ARG B 2  106 ? -69.986 -26.162 27.344  1.00 20.18  ? 106 ARG B CD  1 
ATOM   3348 N  NE  . ARG B 2  106 ? -70.608 -24.865 27.320  1.00 22.53  ? 106 ARG B NE  1 
ATOM   3349 C  CZ  . ARG B 2  106 ? -71.893 -24.632 27.473  1.00 14.16  ? 106 ARG B CZ  1 
ATOM   3350 N  NH1 . ARG B 2  106 ? -72.693 -25.629 27.709  1.00 19.20  ? 106 ARG B NH1 1 
ATOM   3351 N  NH2 . ARG B 2  106 ? -72.359 -23.403 27.309  1.00 23.38  ? 106 ARG B NH2 1 
ATOM   3352 N  N   . THR B 2  107 ? -67.453 -25.023 22.184  1.00 21.81  ? 107 THR B N   1 
ATOM   3353 C  CA  . THR B 2  107 ? -66.696 -24.018 21.416  1.00 22.03  ? 107 THR B CA  1 
ATOM   3354 C  C   . THR B 2  107 ? -67.327 -23.794 20.048  1.00 23.02  ? 107 THR B C   1 
ATOM   3355 O  O   . THR B 2  107 ? -67.544 -22.645 19.637  1.00 20.70  ? 107 THR B O   1 
ATOM   3356 C  CB  . THR B 2  107 ? -65.214 -24.406 21.303  1.00 21.06  ? 107 THR B CB  1 
ATOM   3357 O  OG1 . THR B 2  107 ? -64.630 -24.354 22.626  1.00 22.88  ? 107 THR B OG1 1 
ATOM   3358 C  CG2 . THR B 2  107 ? -64.460 -23.499 20.341  1.00 14.59  ? 107 THR B CG2 1 
ATOM   3359 N  N   . LEU B 2  108 ? -67.647 -24.878 19.332  1.00 21.68  ? 108 LEU B N   1 
ATOM   3360 C  CA  . LEU B 2  108 ? -68.260 -24.688 18.002  1.00 21.47  ? 108 LEU B CA  1 
ATOM   3361 C  C   . LEU B 2  108 ? -69.646 -23.994 18.066  1.00 21.19  ? 108 LEU B C   1 
ATOM   3362 O  O   . LEU B 2  108 ? -69.946 -23.127 17.262  1.00 23.55  ? 108 LEU B O   1 
ATOM   3363 C  CB  . LEU B 2  108 ? -68.338 -26.023 17.279  1.00 17.41  ? 108 LEU B CB  1 
ATOM   3364 C  CG  . LEU B 2  108 ? -66.985 -26.703 17.083  1.00 27.41  ? 108 LEU B CG  1 
ATOM   3365 C  CD1 . LEU B 2  108 ? -67.153 -27.940 16.202  1.00 24.03  ? 108 LEU B CD1 1 
ATOM   3366 C  CD2 . LEU B 2  108 ? -65.899 -25.730 16.539  1.00 26.21  ? 108 LEU B CD2 1 
ATOM   3367 N  N   . ASP B 2  109 ? -70.455 -24.354 19.067  1.00 20.39  ? 109 ASP B N   1 
ATOM   3368 C  CA  . ASP B 2  109 ? -71.753 -23.684 19.330  1.00 20.35  ? 109 ASP B CA  1 
ATOM   3369 C  C   . ASP B 2  109 ? -71.634 -22.214 19.690  1.00 20.33  ? 109 ASP B C   1 
ATOM   3370 O  O   . ASP B 2  109 ? -72.491 -21.386 19.339  1.00 21.50  ? 109 ASP B O   1 
ATOM   3371 C  CB  . ASP B 2  109 ? -72.425 -24.426 20.494  1.00 20.77  ? 109 ASP B CB  1 
ATOM   3372 C  CG  . ASP B 2  109 ? -72.897 -25.862 20.122  1.00 25.67  ? 109 ASP B CG  1 
ATOM   3373 O  OD1 . ASP B 2  109 ? -73.173 -26.105 18.937  1.00 24.60  ? 109 ASP B OD1 1 
ATOM   3374 O  OD2 . ASP B 2  109 ? -73.072 -26.710 21.029  1.00 25.09  ? 109 ASP B OD2 1 
ATOM   3375 N  N   . PHE B 2  110 ? -70.559 -21.879 20.408  1.00 23.66  ? 110 PHE B N   1 
ATOM   3376 C  CA  . PHE B 2  110 ? -70.348 -20.479 20.873  1.00 24.28  ? 110 PHE B CA  1 
ATOM   3377 C  C   . PHE B 2  110 ? -70.105 -19.668 19.630  1.00 21.71  ? 110 PHE B C   1 
ATOM   3378 O  O   . PHE B 2  110 ? -70.725 -18.617 19.432  1.00 23.27  ? 110 PHE B O   1 
ATOM   3379 C  CB  . PHE B 2  110 ? -69.191 -20.459 21.895  1.00 19.68  ? 110 PHE B CB  1 
ATOM   3380 C  CG  . PHE B 2  110 ? -68.689 -19.090 22.275  1.00 23.02  ? 110 PHE B CG  1 
ATOM   3381 C  CD1 . PHE B 2  110 ? -69.493 -18.191 22.904  1.00 16.80  ? 110 PHE B CD1 1 
ATOM   3382 C  CD2 . PHE B 2  110 ? -67.364 -18.742 22.073  1.00 23.47  ? 110 PHE B CD2 1 
ATOM   3383 C  CE1 . PHE B 2  110 ? -68.996 -16.889 23.286  1.00 20.07  ? 110 PHE B CE1 1 
ATOM   3384 C  CE2 . PHE B 2  110 ? -66.854 -17.499 22.442  1.00 18.11  ? 110 PHE B CE2 1 
ATOM   3385 C  CZ  . PHE B 2  110 ? -67.678 -16.566 23.047  1.00 24.74  ? 110 PHE B CZ  1 
ATOM   3386 N  N   . HIS B 2  111 ? -69.251 -20.179 18.742  1.00 21.16  ? 111 HIS B N   1 
ATOM   3387 C  CA  . HIS B 2  111 ? -68.996 -19.478 17.479  1.00 22.27  ? 111 HIS B CA  1 
ATOM   3388 C  C   . HIS B 2  111 ? -70.286 -19.312 16.662  1.00 20.45  ? 111 HIS B C   1 
ATOM   3389 O  O   . HIS B 2  111 ? -70.531 -18.252 16.108  1.00 19.22  ? 111 HIS B O   1 
ATOM   3390 C  CB  . HIS B 2  111 ? -67.890 -20.145 16.661  1.00 21.91  ? 111 HIS B CB  1 
ATOM   3391 C  CG  . HIS B 2  111 ? -66.526 -19.999 17.247  1.00 24.23  ? 111 HIS B CG  1 
ATOM   3392 N  ND1 . HIS B 2  111 ? -65.878 -18.778 17.359  1.00 18.96  ? 111 HIS B ND1 1 
ATOM   3393 C  CD2 . HIS B 2  111 ? -65.664 -20.929 17.709  1.00 18.11  ? 111 HIS B CD2 1 
ATOM   3394 C  CE1 . HIS B 2  111 ? -64.682 -18.973 17.861  1.00 22.04  ? 111 HIS B CE1 1 
ATOM   3395 N  NE2 . HIS B 2  111 ? -64.528 -20.267 18.111  1.00 17.83  ? 111 HIS B NE2 1 
ATOM   3396 N  N   . ASP B 2  112 ? -71.102 -20.363 16.638  1.00 20.95  ? 112 ASP B N   1 
ATOM   3397 C  CA  . ASP B 2  112 ? -72.348 -20.405 15.863  1.00 19.93  ? 112 ASP B CA  1 
ATOM   3398 C  C   . ASP B 2  112 ? -73.257 -19.318 16.402  1.00 23.63  ? 112 ASP B C   1 
ATOM   3399 O  O   . ASP B 2  112 ? -73.830 -18.483 15.630  1.00 24.05  ? 112 ASP B O   1 
ATOM   3400 C  CB  . ASP B 2  112 ? -72.942 -21.859 15.964  1.00 19.18  ? 112 ASP B CB  1 
ATOM   3401 C  CG  . ASP B 2  112 ? -74.085 -22.132 15.011  1.00 19.02  ? 112 ASP B CG  1 
ATOM   3402 O  OD1 . ASP B 2  112 ? -74.730 -23.244 15.048  1.00 20.83  ? 112 ASP B OD1 1 
ATOM   3403 O  OD2 . ASP B 2  112 ? -74.307 -21.278 14.168  1.00 19.13  ? 112 ASP B OD2 1 
ATOM   3404 N  N   . SER B 2  113 ? -73.375 -19.275 17.733  1.00 23.23  ? 113 SER B N   1 
ATOM   3405 C  CA  . SER B 2  113 ? -74.191 -18.240 18.420  1.00 18.09  ? 113 SER B CA  1 
ATOM   3406 C  C   . SER B 2  113 ? -73.756 -16.829 18.090  1.00 20.95  ? 113 SER B C   1 
ATOM   3407 O  O   . SER B 2  113 ? -74.561 -15.938 17.841  1.00 21.90  ? 113 SER B O   1 
ATOM   3408 C  CB  . SER B 2  113 ? -74.033 -18.464 19.954  1.00 18.02  ? 113 SER B CB  1 
ATOM   3409 O  OG  . SER B 2  113 ? -74.591 -17.415 20.687  1.00 19.95  ? 113 SER B OG  1 
ATOM   3410 N  N   . ASN B 2  114 ? -72.454 -16.617 18.162  1.00 22.90  ? 114 ASN B N   1 
ATOM   3411 C  CA  . ASN B 2  114 ? -71.862 -15.335 17.862  1.00 21.76  ? 114 ASN B CA  1 
ATOM   3412 C  C   . ASN B 2  114 ? -72.223 -14.856 16.451  1.00 20.28  ? 114 ASN B C   1 
ATOM   3413 O  O   . ASN B 2  114 ? -72.534 -13.705 16.293  1.00 21.23  ? 114 ASN B O   1 
ATOM   3414 C  CB  . ASN B 2  114 ? -70.328 -15.374 18.060  1.00 21.15  ? 114 ASN B CB  1 
ATOM   3415 C  CG  . ASN B 2  114 ? -69.930 -15.497 19.511  1.00 17.86  ? 114 ASN B CG  1 
ATOM   3416 O  OD1 . ASN B 2  114 ? -70.703 -15.137 20.401  1.00 20.04  ? 114 ASN B OD1 1 
ATOM   3417 N  ND2 . ASN B 2  114 ? -68.709 -15.998 19.774  1.00 15.23  ? 114 ASN B ND2 1 
ATOM   3418 N  N   . VAL B 2  115 ? -72.194 -15.744 15.470  1.00 21.83  ? 115 VAL B N   1 
ATOM   3419 C  CA  . VAL B 2  115 ? -72.588 -15.404 14.109  1.00 22.81  ? 115 VAL B CA  1 
ATOM   3420 C  C   . VAL B 2  115 ? -74.058 -15.063 14.063  1.00 20.92  ? 115 VAL B C   1 
ATOM   3421 O  O   . VAL B 2  115 ? -74.466 -14.025 13.508  1.00 22.16  ? 115 VAL B O   1 
ATOM   3422 C  CB  . VAL B 2  115 ? -72.232 -16.552 13.132  1.00 25.58  ? 115 VAL B CB  1 
ATOM   3423 C  CG1 . VAL B 2  115 ? -72.871 -16.344 11.744  1.00 23.19  ? 115 VAL B CG1 1 
ATOM   3424 C  CG2 . VAL B 2  115 ? -70.670 -16.712 13.034  1.00 19.07  ? 115 VAL B CG2 1 
ATOM   3425 N  N   . ARG B 2  116 ? -74.869 -15.916 14.662  1.00 21.66  ? 116 ARG B N   1 
ATOM   3426 C  CA  . ARG B 2  116 ? -76.288 -15.638 14.725  1.00 23.09  ? 116 ARG B CA  1 
ATOM   3427 C  C   . ARG B 2  116 ? -76.569 -14.304 15.352  1.00 21.24  ? 116 ARG B C   1 
ATOM   3428 O  O   . ARG B 2  116 ? -77.343 -13.513 14.791  1.00 21.68  ? 116 ARG B O   1 
ATOM   3429 C  CB  . ARG B 2  116 ? -77.045 -16.746 15.476  1.00 22.26  ? 116 ARG B CB  1 
ATOM   3430 C  CG  . ARG B 2  116 ? -78.566 -16.619 15.323  1.00 21.62  ? 116 ARG B CG  1 
ATOM   3431 C  CD  . ARG B 2  116 ? -79.204 -17.734 16.017  1.00 31.68  ? 116 ARG B CD  1 
ATOM   3432 N  NE  . ARG B 2  116 ? -80.638 -17.657 16.026  1.00 47.72  ? 116 ARG B NE  1 
ATOM   3433 C  CZ  . ARG B 2  116 ? -81.437 -18.203 15.107  1.00 57.71  ? 116 ARG B CZ  1 
ATOM   3434 N  NH1 . ARG B 2  116 ? -80.917 -18.901 14.086  1.00 43.26  ? 116 ARG B NH1 1 
ATOM   3435 N  NH2 . ARG B 2  116 ? -82.765 -18.073 15.239  1.00 48.22  ? 116 ARG B NH2 1 
ATOM   3436 N  N   . ASN B 2  117 ? -75.939 -14.019 16.497  1.00 20.24  ? 117 ASN B N   1 
ATOM   3437 C  CA  . ASN B 2  117 ? -76.272 -12.748 17.211  1.00 20.82  ? 117 ASN B CA  1 
ATOM   3438 C  C   . ASN B 2  117 ? -75.827 -11.492 16.373  1.00 21.13  ? 117 ASN B C   1 
ATOM   3439 O  O   . ASN B 2  117 ? -76.477 -10.419 16.355  1.00 18.89  ? 117 ASN B O   1 
ATOM   3440 C  CB  . ASN B 2  117 ? -75.641 -12.769 18.608  1.00 20.28  ? 117 ASN B CB  1 
ATOM   3441 C  CG  . ASN B 2  117 ? -76.229 -13.796 19.561  1.00 23.60  ? 117 ASN B CG  1 
ATOM   3442 O  OD1 . ASN B 2  117 ? -77.375 -14.217 19.441  1.00 21.88  ? 117 ASN B OD1 1 
ATOM   3443 N  ND2 . ASN B 2  117 ? -75.426 -14.178 20.581  1.00 19.43  ? 117 ASN B ND2 1 
ATOM   3444 N  N   . LEU B 2  118 ? -74.764 -11.650 15.582  1.00 24.56  ? 118 LEU B N   1 
ATOM   3445 C  CA  . LEU B 2  118 ? -74.285 -10.518 14.737  1.00 22.35  ? 118 LEU B CA  1 
ATOM   3446 C  C   . LEU B 2  118 ? -75.272 -10.291 13.587  1.00 20.46  ? 118 LEU B C   1 
ATOM   3447 O  O   . LEU B 2  118 ? -75.671 -9.163  13.300  1.00 23.51  ? 118 LEU B O   1 
ATOM   3448 C  CB  . LEU B 2  118 ? -72.895 -10.787 14.182  1.00 21.93  ? 118 LEU B CB  1 
ATOM   3449 C  CG  . LEU B 2  118 ? -72.276 -9.659  13.356  1.00 23.21  ? 118 LEU B CG  1 
ATOM   3450 C  CD1 . LEU B 2  118 ? -72.201 -8.353  14.255  1.00 17.58  ? 118 LEU B CD1 1 
ATOM   3451 C  CD2 . LEU B 2  118 ? -70.833 -10.044 12.849  1.00 23.53  ? 118 LEU B CD2 1 
ATOM   3452 N  N   . TYR B 2  119 ? -75.713 -11.362 12.976  1.00 23.78  ? 119 TYR B N   1 
ATOM   3453 C  CA  . TYR B 2  119 ? -76.762 -11.267 11.964  1.00 20.07  ? 119 TYR B CA  1 
ATOM   3454 C  C   . TYR B 2  119 ? -77.996 -10.575 12.479  1.00 20.02  ? 119 TYR B C   1 
ATOM   3455 O  O   . TYR B 2  119 ? -78.454 -9.601  11.905  1.00 22.92  ? 119 TYR B O   1 
ATOM   3456 C  CB  . TYR B 2  119 ? -77.071 -12.654 11.414  1.00 17.65  ? 119 TYR B CB  1 
ATOM   3457 C  CG  . TYR B 2  119 ? -78.141 -12.608 10.404  1.00 19.34  ? 119 TYR B CG  1 
ATOM   3458 C  CD1 . TYR B 2  119 ? -77.846 -12.295 9.106   1.00 24.71  ? 119 TYR B CD1 1 
ATOM   3459 C  CD2 . TYR B 2  119 ? -79.479 -12.856 10.749  1.00 22.91  ? 119 TYR B CD2 1 
ATOM   3460 C  CE1 . TYR B 2  119 ? -78.840 -12.200 8.138   1.00 23.50  ? 119 TYR B CE1 1 
ATOM   3461 C  CE2 . TYR B 2  119 ? -80.489 -12.748 9.797   1.00 25.39  ? 119 TYR B CE2 1 
ATOM   3462 C  CZ  . TYR B 2  119 ? -80.148 -12.414 8.474   1.00 29.73  ? 119 TYR B CZ  1 
ATOM   3463 O  OH  . TYR B 2  119 ? -81.091 -12.291 7.469   1.00 26.77  ? 119 TYR B OH  1 
ATOM   3464 N  N   . GLU B 2  120 ? -78.470 -11.005 13.642  1.00 20.28  ? 120 GLU B N   1 
ATOM   3465 C  CA  . GLU B 2  120 ? -79.650 -10.431 14.245  1.00 19.34  ? 120 GLU B CA  1 
ATOM   3466 C  C   . GLU B 2  120 ? -79.452 -8.995  14.692  1.00 22.02  ? 120 GLU B C   1 
ATOM   3467 O  O   . GLU B 2  120 ? -80.366 -8.162  14.646  1.00 20.37  ? 120 GLU B O   1 
ATOM   3468 C  CB  . GLU B 2  120 ? -80.093 -11.306 15.422  1.00 15.72  ? 120 GLU B CB  1 
ATOM   3469 C  CG  . GLU B 2  120 ? -80.660 -12.623 14.890  1.00 28.67  ? 120 GLU B CG  1 
ATOM   3470 C  CD  . GLU B 2  120 ? -81.304 -13.449 15.943  1.00 33.10  ? 120 GLU B CD  1 
ATOM   3471 O  OE1 . GLU B 2  120 ? -82.063 -14.350 15.542  1.00 52.53  ? 120 GLU B OE1 1 
ATOM   3472 O  OE2 . GLU B 2  120 ? -81.054 -13.215 17.159  1.00 43.10  ? 120 GLU B OE2 1 
ATOM   3473 N  N   . LYS B 2  121 ? -78.245 -8.671  15.084  1.00 21.86  ? 121 LYS B N   1 
ATOM   3474 C  CA  . LYS B 2  121 ? -77.994 -7.267  15.497  1.00 24.94  ? 121 LYS B CA  1 
ATOM   3475 C  C   . LYS B 2  121 ? -78.031 -6.329  14.300  1.00 20.28  ? 121 LYS B C   1 
ATOM   3476 O  O   . LYS B 2  121 ? -78.575 -5.198  14.340  1.00 21.29  ? 121 LYS B O   1 
ATOM   3477 C  CB  . LYS B 2  121 ? -76.668 -7.250  16.265  1.00 30.79  ? 121 LYS B CB  1 
ATOM   3478 C  CG  . LYS B 2  121 ? -75.846 -6.011  16.235  1.00 39.62  ? 121 LYS B CG  1 
ATOM   3479 C  CD  . LYS B 2  121 ? -74.641 -6.151  17.224  1.00 36.93  ? 121 LYS B CD  1 
ATOM   3480 N  N   . VAL B 2  122 ? -77.522 -6.807  13.170  1.00 23.68  ? 122 VAL B N   1 
ATOM   3481 C  CA  . VAL B 2  122 ? -77.606 -5.979  11.937  1.00 24.39  ? 122 VAL B CA  1 
ATOM   3482 C  C   . VAL B 2  122 ? -79.065 -5.883  11.395  1.00 20.77  ? 122 VAL B C   1 
ATOM   3483 O  O   . VAL B 2  122 ? -79.573 -4.812  11.030  1.00 21.57  ? 122 VAL B O   1 
ATOM   3484 C  CB  . VAL B 2  122 ? -76.623 -6.530  10.841  1.00 27.42  ? 122 VAL B CB  1 
ATOM   3485 C  CG1 . VAL B 2  122 ? -76.908 -5.903  9.466   1.00 20.72  ? 122 VAL B CG1 1 
ATOM   3486 C  CG2 . VAL B 2  122 ? -75.168 -6.297  11.265  1.00 20.67  ? 122 VAL B CG2 1 
ATOM   3487 N  N   . LYS B 2  123 ? -79.738 -7.015  11.316  1.00 18.12  ? 123 LYS B N   1 
ATOM   3488 C  CA  . LYS B 2  123 ? -81.135 -7.019  10.936  1.00 18.27  ? 123 LYS B CA  1 
ATOM   3489 C  C   . LYS B 2  123 ? -81.978 -6.046  11.716  1.00 18.74  ? 123 LYS B C   1 
ATOM   3490 O  O   . LYS B 2  123 ? -82.821 -5.308  11.187  1.00 19.48  ? 123 LYS B O   1 
ATOM   3491 C  CB  . LYS B 2  123 ? -81.700 -8.409  11.118  1.00 20.07  ? 123 LYS B CB  1 
ATOM   3492 C  CG  . LYS B 2  123 ? -83.213 -8.507  10.675  1.00 21.54  ? 123 LYS B CG  1 
ATOM   3493 C  CD  . LYS B 2  123 ? -83.543 -10.007 10.876  1.00 31.96  ? 123 LYS B CD  1 
ATOM   3494 C  CE  . LYS B 2  123 ? -85.046 -10.433 10.750  1.00 37.28  ? 123 LYS B CE  1 
ATOM   3495 N  NZ  . LYS B 2  123 ? -84.947 -12.018 10.754  1.00 45.42  ? 123 LYS B NZ  1 
ATOM   3496 N  N   . SER B 2  124 ? -81.726 -6.017  13.006  1.00 19.83  ? 124 SER B N   1 
ATOM   3497 C  CA  . SER B 2  124 ? -82.447 -5.107  13.884  1.00 17.79  ? 124 SER B CA  1 
ATOM   3498 C  C   . SER B 2  124 ? -82.059 -3.645  13.708  1.00 21.31  ? 124 SER B C   1 
ATOM   3499 O  O   . SER B 2  124 ? -82.870 -2.749  13.956  1.00 19.51  ? 124 SER B O   1 
ATOM   3500 C  CB  . SER B 2  124 ? -82.229 -5.589  15.328  1.00 21.21  ? 124 SER B CB  1 
ATOM   3501 O  OG  . SER B 2  124 ? -82.787 -4.653  16.153  1.00 28.81  ? 124 SER B OG  1 
ATOM   3502 N  N   . GLN B 2  125 ? -80.856 -3.359  13.212  1.00 20.78  ? 125 GLN B N   1 
ATOM   3503 C  CA  . GLN B 2  125 ? -80.529 -1.948  12.847  1.00 20.27  ? 125 GLN B CA  1 
ATOM   3504 C  C   . GLN B 2  125 ? -81.223 -1.487  11.565  1.00 19.18  ? 125 GLN B C   1 
ATOM   3505 O  O   . GLN B 2  125 ? -81.738 -0.365  11.459  1.00 21.56  ? 125 GLN B O   1 
ATOM   3506 C  CB  . GLN B 2  125 ? -79.031 -1.805  12.607  1.00 22.92  ? 125 GLN B CB  1 
ATOM   3507 C  CG  . GLN B 2  125 ? -78.154 -1.669  13.838  1.00 25.11  ? 125 GLN B CG  1 
ATOM   3508 C  CD  . GLN B 2  125 ? -76.775 -1.228  13.385  1.00 33.05  ? 125 GLN B CD  1 
ATOM   3509 O  OE1 . GLN B 2  125 ? -76.492 -0.039  13.391  1.00 22.83  ? 125 GLN B OE1 1 
ATOM   3510 N  NE2 . GLN B 2  125 ? -75.973 -2.178  12.847  1.00 22.58  ? 125 GLN B NE2 1 
ATOM   3511 N  N   . LEU B 2  126 ? -81.223 -2.361  10.562  1.00 21.34  ? 126 LEU B N   1 
ATOM   3512 C  CA  . LEU B 2  126 ? -81.753 -1.995  9.247   1.00 21.00  ? 126 LEU B CA  1 
ATOM   3513 C  C   . LEU B 2  126 ? -83.260 -1.985  9.188   1.00 22.17  ? 126 LEU B C   1 
ATOM   3514 O  O   . LEU B 2  126 ? -83.850 -1.211  8.455   1.00 25.70  ? 126 LEU B O   1 
ATOM   3515 C  CB  . LEU B 2  126 ? -81.216 -2.966  8.183   1.00 24.74  ? 126 LEU B CB  1 
ATOM   3516 C  CG  . LEU B 2  126 ? -79.693 -3.075  8.076   1.00 25.41  ? 126 LEU B CG  1 
ATOM   3517 C  CD1 . LEU B 2  126 ? -79.178 -4.011  6.899   1.00 19.21  ? 126 LEU B CD1 1 
ATOM   3518 C  CD2 . LEU B 2  126 ? -79.042 -1.672  8.052   1.00 17.28  ? 126 LEU B CD2 1 
ATOM   3519 N  N   . LYS B 2  127 ? -83.917 -2.838  9.943   1.00 23.25  ? 127 LYS B N   1 
ATOM   3520 C  CA  . LYS B 2  127 ? -85.389 -2.870  9.898   1.00 22.51  ? 127 LYS B CA  1 
ATOM   3521 C  C   . LYS B 2  127 ? -85.836 -3.019  8.419   1.00 21.13  ? 127 LYS B C   1 
ATOM   3522 O  O   . LYS B 2  127 ? -85.266 -3.859  7.690   1.00 25.62  ? 127 LYS B O   1 
ATOM   3523 C  CB  . LYS B 2  127 ? -85.946 -1.685  10.668  1.00 22.29  ? 127 LYS B CB  1 
ATOM   3524 C  CG  . LYS B 2  127 ? -85.557 -1.749  12.134  1.00 30.64  ? 127 LYS B CG  1 
ATOM   3525 C  CD  . LYS B 2  127 ? -86.202 -0.669  13.002  1.00 35.11  ? 127 LYS B CD  1 
ATOM   3526 C  CE  . LYS B 2  127 ? -85.609 0.679   12.709  1.00 42.44  ? 127 LYS B CE  1 
ATOM   3527 N  NZ  . LYS B 2  127 ? -85.806 1.638   13.826  1.00 45.75  ? 127 LYS B NZ  1 
ATOM   3528 N  N   . ASN B 2  128 ? -86.821 -2.262  7.984   1.00 21.46  ? 128 ASN B N   1 
ATOM   3529 C  CA  . ASN B 2  128 ? -87.379 -2.386  6.649   1.00 22.76  ? 128 ASN B CA  1 
ATOM   3530 C  C   . ASN B 2  128 ? -86.717 -1.487  5.597   1.00 23.58  ? 128 ASN B C   1 
ATOM   3531 O  O   . ASN B 2  128 ? -87.286 -1.288  4.525   1.00 24.66  ? 128 ASN B O   1 
ATOM   3532 C  CB  . ASN B 2  128 ? -88.930 -2.215  6.648   1.00 19.78  ? 128 ASN B CB  1 
ATOM   3533 C  CG  . ASN B 2  128 ? -89.396 -0.829  7.032   1.00 18.96  ? 128 ASN B CG  1 
ATOM   3534 O  OD1 . ASN B 2  128 ? -88.603 0.037   7.354   1.00 31.90  ? 128 ASN B OD1 1 
ATOM   3535 N  ND2 . ASN B 2  128 ? -90.728 -0.616  7.005   1.00 16.36  ? 128 ASN B ND2 1 
ATOM   3536 N  N   . ASN B 2  129 ? -85.499 -1.009  5.878   1.00 22.05  ? 129 ASN B N   1 
ATOM   3537 C  CA  . ASN B 2  129 ? -84.690 -0.238  4.917   1.00 22.77  ? 129 ASN B CA  1 
ATOM   3538 C  C   . ASN B 2  129 ? -83.821 -1.153  4.078   1.00 24.95  ? 129 ASN B C   1 
ATOM   3539 O  O   . ASN B 2  129 ? -83.026 -0.680  3.256   1.00 23.35  ? 129 ASN B O   1 
ATOM   3540 C  CB  . ASN B 2  129 ? -83.781 0.775   5.637   1.00 23.23  ? 129 ASN B CB  1 
ATOM   3541 C  CG  . ASN B 2  129 ? -84.492 2.052   6.007   1.00 25.18  ? 129 ASN B CG  1 
ATOM   3542 O  OD1 . ASN B 2  129 ? -85.698 2.199   5.775   1.00 26.50  ? 129 ASN B OD1 1 
ATOM   3543 N  ND2 . ASN B 2  129 ? -83.729 3.034   6.506   1.00 25.27  ? 129 ASN B ND2 1 
ATOM   3544 N  N   . ALA B 2  130 ? -83.950 -2.463  4.311   1.00 22.89  ? 130 ALA B N   1 
ATOM   3545 C  CA  . ALA B 2  130 ? -83.127 -3.470  3.662   1.00 22.13  ? 130 ALA B CA  1 
ATOM   3546 C  C   . ALA B 2  130 ? -84.001 -4.692  3.611   1.00 24.49  ? 130 ALA B C   1 
ATOM   3547 O  O   . ALA B 2  130 ? -84.912 -4.802  4.378   1.00 22.58  ? 130 ALA B O   1 
ATOM   3548 C  CB  . ALA B 2  130 ? -81.871 -3.785  4.456   1.00 19.87  ? 130 ALA B CB  1 
ATOM   3549 N  N   . LYS B 2  131 ? -83.760 -5.573  2.674   1.00 27.44  ? 131 LYS B N   1 
ATOM   3550 C  CA  . LYS B 2  131 ? -84.482 -6.805  2.638   1.00 28.78  ? 131 LYS B CA  1 
ATOM   3551 C  C   . LYS B 2  131 ? -83.526 -7.949  2.835   1.00 25.96  ? 131 LYS B C   1 
ATOM   3552 O  O   . LYS B 2  131 ? -82.363 -7.851  2.490   1.00 19.53  ? 131 LYS B O   1 
ATOM   3553 C  CB  . LYS B 2  131 ? -85.278 -6.915  1.353   1.00 32.44  ? 131 LYS B CB  1 
ATOM   3554 C  CG  . LYS B 2  131 ? -84.583 -7.191  0.091   1.00 34.68  ? 131 LYS B CG  1 
ATOM   3555 C  CD  . LYS B 2  131 ? -85.645 -7.631  -0.931  1.00 39.19  ? 131 LYS B CD  1 
ATOM   3556 C  CE  . LYS B 2  131 ? -85.071 -7.953  -2.313  1.00 48.80  ? 131 LYS B CE  1 
ATOM   3557 N  NZ  . LYS B 2  131 ? -85.793 -9.105  -2.972  1.00 44.70  ? 131 LYS B NZ  1 
ATOM   3558 N  N   . GLU B 2  132 ? -84.016 -9.011  3.458   1.00 22.47  ? 132 GLU B N   1 
ATOM   3559 C  CA  . GLU B 2  132 ? -83.218 -10.177 3.704   1.00 23.99  ? 132 GLU B CA  1 
ATOM   3560 C  C   . GLU B 2  132 ? -83.252 -11.047 2.452   1.00 23.93  ? 132 GLU B C   1 
ATOM   3561 O  O   . GLU B 2  132 ? -84.303 -11.426 2.044   1.00 24.22  ? 132 GLU B O   1 
ATOM   3562 C  CB  . GLU B 2  132 ? -83.819 -10.962 4.865   1.00 27.50  ? 132 GLU B CB  1 
ATOM   3563 C  CG  . GLU B 2  132 ? -83.636 -10.362 6.268   1.00 31.39  ? 132 GLU B CG  1 
ATOM   3564 C  CD  . GLU B 2  132 ? -84.231 -11.303 7.321   1.00 26.64  ? 132 GLU B CD  1 
ATOM   3565 O  OE1 . GLU B 2  132 ? -85.447 -11.200 7.508   1.00 34.40  ? 132 GLU B OE1 1 
ATOM   3566 O  OE2 . GLU B 2  132 ? -83.499 -12.168 7.904   1.00 26.76  ? 132 GLU B OE2 1 
ATOM   3567 N  N   . ILE B 2  133 ? -82.107 -11.393 1.876   1.00 24.45  ? 133 ILE B N   1 
ATOM   3568 C  CA  . ILE B 2  133 ? -82.083 -12.064 0.576   1.00 24.16  ? 133 ILE B CA  1 
ATOM   3569 C  C   . ILE B 2  133 ? -81.409 -13.405 0.692   1.00 25.70  ? 133 ILE B C   1 
ATOM   3570 O  O   . ILE B 2  133 ? -81.029 -14.017 -0.323  1.00 21.95  ? 133 ILE B O   1 
ATOM   3571 C  CB  . ILE B 2  133 ? -81.382 -11.220 -0.567  1.00 26.58  ? 133 ILE B CB  1 
ATOM   3572 C  CG1 . ILE B 2  133 ? -79.978 -10.728 -0.147  1.00 24.94  ? 133 ILE B CG1 1 
ATOM   3573 C  CG2 . ILE B 2  133 ? -82.246 -10.062 -0.993  1.00 15.12  ? 133 ILE B CG2 1 
ATOM   3574 C  CD1 . ILE B 2  133 ? -79.171 -10.067 -1.338  1.00 29.44  ? 133 ILE B CD1 1 
ATOM   3575 N  N   . GLY B 2  134 ? -81.292 -13.876 1.929   1.00 25.49  ? 134 GLY B N   1 
ATOM   3576 C  CA  . GLY B 2  134 ? -80.827 -15.210 2.175   1.00 23.12  ? 134 GLY B CA  1 
ATOM   3577 C  C   . GLY B 2  134 ? -79.310 -15.210 2.334   1.00 23.90  ? 134 GLY B C   1 
ATOM   3578 O  O   . GLY B 2  134 ? -78.602 -14.237 1.967   1.00 19.52  ? 134 GLY B O   1 
ATOM   3579 N  N   . ASN B 2  135 ? -78.834 -16.301 2.892   1.00 18.59  ? 135 ASN B N   1 
ATOM   3580 C  CA  . ASN B 2  135 ? -77.400 -16.584 3.058   1.00 24.16  ? 135 ASN B CA  1 
ATOM   3581 C  C   . ASN B 2  135 ? -76.657 -15.468 3.832   1.00 23.56  ? 135 ASN B C   1 
ATOM   3582 O  O   . ASN B 2  135 ? -75.459 -15.234 3.665   1.00 26.66  ? 135 ASN B O   1 
ATOM   3583 C  CB  . ASN B 2  135 ? -76.772 -16.923 1.682   1.00 26.02  ? 135 ASN B CB  1 
ATOM   3584 C  CG  . ASN B 2  135 ? -75.519 -17.867 1.776   1.00 28.26  ? 135 ASN B CG  1 
ATOM   3585 O  OD1 . ASN B 2  135 ? -75.370 -18.715 2.672   1.00 22.47  ? 135 ASN B OD1 1 
ATOM   3586 N  ND2 . ASN B 2  135 ? -74.682 -17.778 0.753   1.00 33.68  ? 135 ASN B ND2 1 
ATOM   3587 N  N   . GLY B 2  136 ? -77.364 -14.832 4.743   1.00 20.42  ? 136 GLY B N   1 
ATOM   3588 C  CA  . GLY B 2  136 ? -76.765 -13.864 5.622   1.00 20.84  ? 136 GLY B CA  1 
ATOM   3589 C  C   . GLY B 2  136 ? -76.640 -12.500 5.019   1.00 18.33  ? 136 GLY B C   1 
ATOM   3590 O  O   . GLY B 2  136 ? -76.034 -11.639 5.645   1.00 20.65  ? 136 GLY B O   1 
ATOM   3591 N  N   . CYS B 2  137 ? -77.285 -12.252 3.873   1.00 19.11  ? 137 CYS B N   1 
ATOM   3592 C  CA  . CYS B 2  137 ? -77.147 -10.956 3.165   1.00 15.39  ? 137 CYS B CA  1 
ATOM   3593 C  C   . CYS B 2  137 ? -78.401 -10.123 3.190   1.00 19.72  ? 137 CYS B C   1 
ATOM   3594 O  O   . CYS B 2  137 ? -79.517 -10.647 3.173   1.00 20.19  ? 137 CYS B O   1 
ATOM   3595 C  CB  . CYS B 2  137 ? -76.761 -11.218 1.693   1.00 13.54  ? 137 CYS B CB  1 
ATOM   3596 S  SG  . CYS B 2  137 ? -75.218 -12.075 1.488   1.00 24.41  ? 137 CYS B SG  1 
ATOM   3597 N  N   . PHE B 2  138 ? -78.195 -8.804  3.143   1.00 19.79  ? 138 PHE B N   1 
ATOM   3598 C  CA  . PHE B 2  138 ? -79.221 -7.809  3.073   1.00 19.05  ? 138 PHE B CA  1 
ATOM   3599 C  C   . PHE B 2  138 ? -78.949 -6.949  1.847   1.00 24.00  ? 138 PHE B C   1 
ATOM   3600 O  O   . PHE B 2  138 ? -77.786 -6.578  1.602   1.00 26.70  ? 138 PHE B O   1 
ATOM   3601 C  CB  . PHE B 2  138 ? -79.117 -6.882  4.282   1.00 19.56  ? 138 PHE B CB  1 
ATOM   3602 C  CG  . PHE B 2  138 ? -79.300 -7.554  5.583   1.00 22.64  ? 138 PHE B CG  1 
ATOM   3603 C  CD1 . PHE B 2  138 ? -78.219 -8.063  6.271   1.00 21.82  ? 138 PHE B CD1 1 
ATOM   3604 C  CD2 . PHE B 2  138 ? -80.594 -7.695  6.132   1.00 30.08  ? 138 PHE B CD2 1 
ATOM   3605 C  CE1 . PHE B 2  138 ? -78.426 -8.701  7.513   1.00 29.18  ? 138 PHE B CE1 1 
ATOM   3606 C  CE2 . PHE B 2  138 ? -80.800 -8.318  7.366   1.00 28.56  ? 138 PHE B CE2 1 
ATOM   3607 C  CZ  . PHE B 2  138 ? -79.719 -8.812  8.050   1.00 29.45  ? 138 PHE B CZ  1 
ATOM   3608 N  N   . GLU B 2  139 ? -80.008 -6.649  1.110   1.00 22.19  ? 139 GLU B N   1 
ATOM   3609 C  CA  . GLU B 2  139 ? -80.043 -5.659  0.047   1.00 22.12  ? 139 GLU B CA  1 
ATOM   3610 C  C   . GLU B 2  139 ? -80.741 -4.434  0.559   1.00 24.52  ? 139 GLU B C   1 
ATOM   3611 O  O   . GLU B 2  139 ? -81.908 -4.487  0.915   1.00 25.60  ? 139 GLU B O   1 
ATOM   3612 C  CB  . GLU B 2  139 ? -80.785 -6.172  -1.195  1.00 18.95  ? 139 GLU B CB  1 
ATOM   3613 C  CG  . GLU B 2  139 ? -80.694 -5.219  -2.386  1.00 23.29  ? 139 GLU B CG  1 
ATOM   3614 C  CD  . GLU B 2  139 ? -81.362 -5.741  -3.661  1.00 17.21  ? 139 GLU B CD  1 
ATOM   3615 O  OE1 . GLU B 2  139 ? -81.818 -4.912  -4.444  1.00 33.19  ? 139 GLU B OE1 1 
ATOM   3616 O  OE2 . GLU B 2  139 ? -81.422 -6.948  -3.880  1.00 33.59  ? 139 GLU B OE2 1 
ATOM   3617 N  N   . PHE B 2  140 ? -80.021 -3.318  0.571   1.00 24.31  ? 140 PHE B N   1 
ATOM   3618 C  CA  . PHE B 2  140 ? -80.563 -2.053  0.997   1.00 24.44  ? 140 PHE B CA  1 
ATOM   3619 C  C   . PHE B 2  140 ? -81.628 -1.548  0.016   1.00 26.19  ? 140 PHE B C   1 
ATOM   3620 O  O   . PHE B 2  140 ? -81.522 -1.737  -1.212  1.00 21.72  ? 140 PHE B O   1 
ATOM   3621 C  CB  . PHE B 2  140 ? -79.469 -1.019  1.079   1.00 22.65  ? 140 PHE B CB  1 
ATOM   3622 C  CG  . PHE B 2  140 ? -78.459 -1.301  2.104   1.00 17.53  ? 140 PHE B CG  1 
ATOM   3623 C  CD1 . PHE B 2  140 ? -77.322 -1.965  1.800   1.00 18.29  ? 140 PHE B CD1 1 
ATOM   3624 C  CD2 . PHE B 2  140 ? -78.632 -0.848  3.414   1.00 24.05  ? 140 PHE B CD2 1 
ATOM   3625 C  CE1 . PHE B 2  140 ? -76.372 -2.306  2.798   1.00 20.35  ? 140 PHE B CE1 1 
ATOM   3626 C  CE2 . PHE B 2  140 ? -77.660 -1.136  4.404   1.00 18.33  ? 140 PHE B CE2 1 
ATOM   3627 C  CZ  . PHE B 2  140 ? -76.559 -1.853  4.101   1.00 19.83  ? 140 PHE B CZ  1 
ATOM   3628 N  N   . TYR B 2  141 ? -82.647 -0.901  0.567   1.00 24.34  ? 141 TYR B N   1 
ATOM   3629 C  CA  . TYR B 2  141 ? -83.638 -0.218  -0.251  1.00 23.13  ? 141 TYR B CA  1 
ATOM   3630 C  C   . TYR B 2  141 ? -83.260 1.212   -0.605  1.00 26.30  ? 141 TYR B C   1 
ATOM   3631 O  O   . TYR B 2  141 ? -84.100 1.982   -1.073  1.00 27.09  ? 141 TYR B O   1 
ATOM   3632 C  CB  . TYR B 2  141 ? -85.014 -0.214  0.431   1.00 24.31  ? 141 TYR B CB  1 
ATOM   3633 C  CG  . TYR B 2  141 ? -85.736 -1.569  0.379   1.00 24.70  ? 141 TYR B CG  1 
ATOM   3634 C  CD1 . TYR B 2  141 ? -86.119 -2.213  1.537   1.00 29.79  ? 141 TYR B CD1 1 
ATOM   3635 C  CD2 . TYR B 2  141 ? -86.026 -2.184  -0.832  1.00 31.98  ? 141 TYR B CD2 1 
ATOM   3636 C  CE1 . TYR B 2  141 ? -86.778 -3.424  1.501   1.00 25.21  ? 141 TYR B CE1 1 
ATOM   3637 C  CE2 . TYR B 2  141 ? -86.669 -3.416  -0.881  1.00 29.86  ? 141 TYR B CE2 1 
ATOM   3638 C  CZ  . TYR B 2  141 ? -87.040 -4.013  0.300   1.00 28.45  ? 141 TYR B CZ  1 
ATOM   3639 O  OH  . TYR B 2  141 ? -87.684 -5.200  0.301   1.00 31.49  ? 141 TYR B OH  1 
ATOM   3640 N  N   . HIS B 2  142 ? -81.985 1.541   -0.448  1.00 26.45  ? 142 HIS B N   1 
ATOM   3641 C  CA  . HIS B 2  142 ? -81.464 2.877   -0.702  1.00 24.64  ? 142 HIS B CA  1 
ATOM   3642 C  C   . HIS B 2  142 ? -79.966 2.792   -1.052  1.00 26.43  ? 142 HIS B C   1 
ATOM   3643 O  O   . HIS B 2  142 ? -79.317 1.768   -0.868  1.00 22.97  ? 142 HIS B O   1 
ATOM   3644 C  CB  . HIS B 2  142 ? -81.622 3.767   0.537   1.00 23.84  ? 142 HIS B CB  1 
ATOM   3645 C  CG  . HIS B 2  142 ? -80.886 3.264   1.742   1.00 23.95  ? 142 HIS B CG  1 
ATOM   3646 N  ND1 . HIS B 2  142 ? -79.597 3.634   2.036   1.00 22.03  ? 142 HIS B ND1 1 
ATOM   3647 C  CD2 . HIS B 2  142 ? -81.264 2.410   2.728   1.00 26.93  ? 142 HIS B CD2 1 
ATOM   3648 C  CE1 . HIS B 2  142 ? -79.216 3.046   3.161   1.00 28.18  ? 142 HIS B CE1 1 
ATOM   3649 N  NE2 . HIS B 2  142 ? -80.216 2.310   3.611   1.00 24.09  ? 142 HIS B NE2 1 
ATOM   3650 N  N   . LYS B 2  143 ? -79.429 3.886   -1.568  1.00 28.16  ? 143 LYS B N   1 
ATOM   3651 C  CA  . LYS B 2  143 ? -78.021 3.932   -1.839  1.00 29.54  ? 143 LYS B CA  1 
ATOM   3652 C  C   . LYS B 2  143 ? -77.282 3.907   -0.517  1.00 28.59  ? 143 LYS B C   1 
ATOM   3653 O  O   . LYS B 2  143 ? -77.603 4.681   0.398   1.00 27.95  ? 143 LYS B O   1 
ATOM   3654 C  CB  . LYS B 2  143 ? -77.711 5.190   -2.677  1.00 29.10  ? 143 LYS B CB  1 
ATOM   3655 C  CG  . LYS B 2  143 ? -76.248 5.349   -3.052  1.00 36.35  ? 143 LYS B CG  1 
ATOM   3656 C  CD  . LYS B 2  143 ? -76.042 6.377   -4.171  1.00 38.78  ? 143 LYS B CD  1 
ATOM   3657 C  CE  . LYS B 2  143 ? -74.873 5.954   -5.145  1.00 52.24  ? 143 LYS B CE  1 
ATOM   3658 N  NZ  . LYS B 2  143 ? -74.963 4.525   -5.760  1.00 41.30  ? 143 LYS B NZ  1 
ATOM   3659 N  N   . CYS B 2  144 ? -76.307 2.997   -0.398  1.00 27.70  ? 144 CYS B N   1 
ATOM   3660 C  CA  . CYS B 2  144 ? -75.495 2.860   0.823   1.00 25.00  ? 144 CYS B CA  1 
ATOM   3661 C  C   . CYS B 2  144 ? -74.006 2.904   0.476   1.00 25.38  ? 144 CYS B C   1 
ATOM   3662 O  O   . CYS B 2  144 ? -73.437 1.896   0.103   1.00 27.88  ? 144 CYS B O   1 
ATOM   3663 C  CB  . CYS B 2  144 ? -75.825 1.541   1.541   1.00 26.30  ? 144 CYS B CB  1 
ATOM   3664 S  SG  . CYS B 2  144 ? -75.129 1.472   3.208   1.00 29.28  ? 144 CYS B SG  1 
ATOM   3665 N  N   . ASP B 2  145 ? -73.371 4.071   0.602   1.00 26.83  ? 145 ASP B N   1 
ATOM   3666 C  CA  . ASP B 2  145 ? -71.969 4.244   0.223   1.00 23.68  ? 145 ASP B CA  1 
ATOM   3667 C  C   . ASP B 2  145 ? -71.057 3.816   1.354   1.00 24.50  ? 145 ASP B C   1 
ATOM   3668 O  O   . ASP B 2  145 ? -71.539 3.310   2.382   1.00 27.08  ? 145 ASP B O   1 
ATOM   3669 C  CB  . ASP B 2  145 ? -71.715 5.704   -0.247  1.00 26.46  ? 145 ASP B CB  1 
ATOM   3670 C  CG  . ASP B 2  145 ? -71.862 6.746   0.885   1.00 27.22  ? 145 ASP B CG  1 
ATOM   3671 O  OD1 . ASP B 2  145 ? -71.787 7.963   0.585   1.00 35.40  ? 145 ASP B OD1 1 
ATOM   3672 O  OD2 . ASP B 2  145 ? -72.003 6.355   2.068   1.00 28.41  ? 145 ASP B OD2 1 
ATOM   3673 N  N   . ASP B 2  146 ? -69.749 3.974   1.208   1.00 23.49  ? 146 ASP B N   1 
ATOM   3674 C  CA  . ASP B 2  146 ? -68.851 3.391   2.226   1.00 26.96  ? 146 ASP B CA  1 
ATOM   3675 C  C   . ASP B 2  146 ? -69.071 3.947   3.630   1.00 27.59  ? 146 ASP B C   1 
ATOM   3676 O  O   . ASP B 2  146 ? -68.936 3.218   4.621   1.00 23.69  ? 146 ASP B O   1 
ATOM   3677 C  CB  . ASP B 2  146 ? -67.385 3.494   1.831   1.00 22.56  ? 146 ASP B CB  1 
ATOM   3678 C  CG  . ASP B 2  146 ? -67.015 2.545   0.663   1.00 30.91  ? 146 ASP B CG  1 
ATOM   3679 O  OD1 . ASP B 2  146 ? -67.741 1.546   0.416   1.00 30.26  ? 146 ASP B OD1 1 
ATOM   3680 O  OD2 . ASP B 2  146 ? -65.996 2.817   -0.006  1.00 28.97  ? 146 ASP B OD2 1 
ATOM   3681 N  N   . ALA B 2  147 ? -69.385 5.236   3.720   1.00 27.91  ? 147 ALA B N   1 
ATOM   3682 C  CA  . ALA B 2  147 ? -69.714 5.850   5.011   1.00 26.30  ? 147 ALA B CA  1 
ATOM   3683 C  C   . ALA B 2  147 ? -70.956 5.187   5.571   1.00 27.65  ? 147 ALA B C   1 
ATOM   3684 O  O   . ALA B 2  147 ? -71.040 4.900   6.775   1.00 29.02  ? 147 ALA B O   1 
ATOM   3685 C  CB  . ALA B 2  147 ? -69.879 7.439   4.893   1.00 23.90  ? 147 ALA B CB  1 
ATOM   3686 N  N   . CYS B 2  148 ? -71.910 4.870   4.708   1.00 29.22  ? 148 CYS B N   1 
ATOM   3687 C  CA  . CYS B 2  148 ? -73.118 4.200   5.184   1.00 31.86  ? 148 CYS B CA  1 
ATOM   3688 C  C   . CYS B 2  148 ? -72.817 2.785   5.625   1.00 29.98  ? 148 CYS B C   1 
ATOM   3689 O  O   . CYS B 2  148 ? -73.263 2.341   6.702   1.00 31.17  ? 148 CYS B O   1 
ATOM   3690 C  CB  . CYS B 2  148 ? -74.221 4.285   4.112   1.00 33.71  ? 148 CYS B CB  1 
ATOM   3691 S  SG  . CYS B 2  148 ? -75.681 3.256   4.323   1.00 37.70  ? 148 CYS B SG  1 
ATOM   3692 N  N   . MET B 2  149 ? -72.046 2.064   4.822   1.00 31.22  ? 149 MET B N   1 
ATOM   3693 C  CA  . MET B 2  149 ? -71.627 0.694   5.193   1.00 27.59  ? 149 MET B CA  1 
ATOM   3694 C  C   . MET B 2  149 ? -70.927 0.687   6.552   1.00 30.42  ? 149 MET B C   1 
ATOM   3695 O  O   . MET B 2  149 ? -71.171 -0.178  7.413   1.00 30.04  ? 149 MET B O   1 
ATOM   3696 C  CB  . MET B 2  149 ? -70.726 0.095   4.139   1.00 28.92  ? 149 MET B CB  1 
ATOM   3697 C  CG  . MET B 2  149 ? -71.377 -0.157  2.801   1.00 24.95  ? 149 MET B CG  1 
ATOM   3698 S  SD  . MET B 2  149 ? -72.609 -1.452  2.840   1.00 28.47  ? 149 MET B SD  1 
ATOM   3699 C  CE  . MET B 2  149 ? -73.058 -1.450  1.091   1.00 21.96  ? 149 MET B CE  1 
ATOM   3700 N  N   . GLU B 2  150 ? -70.054 1.653   6.764   1.00 28.61  ? 150 GLU B N   1 
ATOM   3701 C  CA  . GLU B 2  150 ? -69.324 1.687   8.010   1.00 29.97  ? 150 GLU B CA  1 
ATOM   3702 C  C   . GLU B 2  150 ? -70.256 1.942   9.195   1.00 28.81  ? 150 GLU B C   1 
ATOM   3703 O  O   . GLU B 2  150 ? -70.014 1.423   10.288  1.00 31.43  ? 150 GLU B O   1 
ATOM   3704 C  CB  . GLU B 2  150 ? -68.204 2.716   7.959   1.00 29.50  ? 150 GLU B CB  1 
ATOM   3705 C  CG  . GLU B 2  150 ? -67.398 2.868   9.275   1.00 30.87  ? 150 GLU B CG  1 
ATOM   3706 C  CD  . GLU B 2  150 ? -66.656 1.578   9.671   1.00 39.35  ? 150 GLU B CD  1 
ATOM   3707 O  OE1 . GLU B 2  150 ? -66.306 1.442   10.861  1.00 39.83  ? 150 GLU B OE1 1 
ATOM   3708 O  OE2 . GLU B 2  150 ? -66.433 0.694   8.806   1.00 33.81  ? 150 GLU B OE2 1 
ATOM   3709 N  N   . SER B 2  151 ? -71.314 2.726   8.985   1.00 27.59  ? 151 SER B N   1 
ATOM   3710 C  CA  . SER B 2  151 ? -72.269 2.983   10.053  1.00 27.43  ? 151 SER B CA  1 
ATOM   3711 C  C   . SER B 2  151 ? -73.000 1.671   10.471  1.00 29.42  ? 151 SER B C   1 
ATOM   3712 O  O   . SER B 2  151 ? -73.255 1.419   11.657  1.00 30.64  ? 151 SER B O   1 
ATOM   3713 C  CB  . SER B 2  151 ? -73.235 4.112   9.698   1.00 27.42  ? 151 SER B CB  1 
ATOM   3714 O  OG  . SER B 2  151 ? -74.277 3.665   8.847   1.00 26.45  ? 151 SER B OG  1 
ATOM   3715 N  N   . VAL B 2  152 ? -73.294 0.817   9.508   1.00 31.71  ? 152 VAL B N   1 
ATOM   3716 C  CA  . VAL B 2  152 ? -73.853 -0.464  9.839   1.00 30.90  ? 152 VAL B CA  1 
ATOM   3717 C  C   . VAL B 2  152 ? -72.848 -1.276  10.648  1.00 30.44  ? 152 VAL B C   1 
ATOM   3718 O  O   . VAL B 2  152 ? -73.167 -1.820  11.724  1.00 28.54  ? 152 VAL B O   1 
ATOM   3719 C  CB  . VAL B 2  152 ? -74.275 -1.231  8.579   1.00 30.19  ? 152 VAL B CB  1 
ATOM   3720 C  CG1 . VAL B 2  152 ? -74.822 -2.598  8.998   1.00 26.60  ? 152 VAL B CG1 1 
ATOM   3721 C  CG2 . VAL B 2  152 ? -75.338 -0.437  7.822   1.00 22.16  ? 152 VAL B CG2 1 
ATOM   3722 N  N   . ARG B 2  153 ? -71.615 -1.344  10.149  1.00 29.03  ? 153 ARG B N   1 
ATOM   3723 C  CA  . ARG B 2  153 ? -70.608 -2.131  10.835  1.00 28.08  ? 153 ARG B CA  1 
ATOM   3724 C  C   . ARG B 2  153 ? -70.307 -1.652  12.222  1.00 24.72  ? 153 ARG B C   1 
ATOM   3725 O  O   . ARG B 2  153 ? -69.867 -2.440  13.062  1.00 27.56  ? 153 ARG B O   1 
ATOM   3726 C  CB  . ARG B 2  153 ? -69.271 -2.150  10.087  1.00 27.33  ? 153 ARG B CB  1 
ATOM   3727 C  CG  . ARG B 2  153 ? -69.288 -2.788  8.714   1.00 27.37  ? 153 ARG B CG  1 
ATOM   3728 C  CD  . ARG B 2  153 ? -67.824 -2.746  8.188   1.00 30.20  ? 153 ARG B CD  1 
ATOM   3729 N  NE  . ARG B 2  153 ? -67.909 -2.665  6.805   1.00 45.69  ? 153 ARG B NE  1 
ATOM   3730 C  CZ  . ARG B 2  153 ? -67.655 -1.612  6.059   1.00 37.98  ? 153 ARG B CZ  1 
ATOM   3731 N  NH1 . ARG B 2  153 ? -67.171 -0.471  6.515   1.00 35.97  ? 153 ARG B NH1 1 
ATOM   3732 N  NH2 . ARG B 2  153 ? -67.876 -1.782  4.791   1.00 29.81  ? 153 ARG B NH2 1 
ATOM   3733 N  N   . ASN B 2  154 ? -70.475 -0.374  12.489  1.00 24.21  ? 154 ASN B N   1 
ATOM   3734 C  CA  . ASN B 2  154 ? -70.139 0.092   13.833  1.00 24.99  ? 154 ASN B CA  1 
ATOM   3735 C  C   . ASN B 2  154 ? -71.292 0.338   14.753  1.00 22.66  ? 154 ASN B C   1 
ATOM   3736 O  O   . ASN B 2  154 ? -71.084 0.800   15.858  1.00 22.51  ? 154 ASN B O   1 
ATOM   3737 C  CB  . ASN B 2  154 ? -69.163 1.295   13.816  1.00 30.89  ? 154 ASN B CB  1 
ATOM   3738 C  CG  . ASN B 2  154 ? -69.775 2.570   13.282  1.00 31.34  ? 154 ASN B CG  1 
ATOM   3739 O  OD1 . ASN B 2  154 ? -71.015 2.701   13.229  1.00 31.72  ? 154 ASN B OD1 1 
ATOM   3740 N  ND2 . ASN B 2  154 ? -68.890 3.551   12.883  1.00 38.51  ? 154 ASN B ND2 1 
ATOM   3741 N  N   . GLY B 2  155 ? -72.493 0.001   14.314  1.00 27.23  ? 155 GLY B N   1 
ATOM   3742 C  CA  . GLY B 2  155 ? -73.674 0.032   15.167  1.00 29.07  ? 155 GLY B CA  1 
ATOM   3743 C  C   . GLY B 2  155 ? -74.340 1.383   15.310  1.00 31.00  ? 155 GLY B C   1 
ATOM   3744 O  O   . GLY B 2  155 ? -75.096 1.604   16.246  1.00 30.40  ? 155 GLY B O   1 
ATOM   3745 N  N   . THR B 2  156 ? -74.119 2.265   14.345  1.00 31.41  ? 156 THR B N   1 
ATOM   3746 C  CA  . THR B 2  156 ? -74.681 3.604   14.410  1.00 28.77  ? 156 THR B CA  1 
ATOM   3747 C  C   . THR B 2  156 ? -75.444 3.889   13.131  1.00 31.00  ? 156 THR B C   1 
ATOM   3748 O  O   . THR B 2  156 ? -75.610 5.029   12.769  1.00 32.76  ? 156 THR B O   1 
ATOM   3749 C  CB  . THR B 2  156 ? -73.576 4.703   14.591  1.00 27.44  ? 156 THR B CB  1 
ATOM   3750 O  OG1 . THR B 2  156 ? -72.634 4.654   13.504  1.00 27.71  ? 156 THR B OG1 1 
ATOM   3751 C  CG2 . THR B 2  156 ? -72.829 4.542   15.920  1.00 23.66  ? 156 THR B CG2 1 
ATOM   3752 N  N   . TYR B 2  157 ? -75.927 2.863   12.431  1.00 31.70  ? 157 TYR B N   1 
ATOM   3753 C  CA  . TYR B 2  157 ? -76.772 3.123   11.260  1.00 29.68  ? 157 TYR B CA  1 
ATOM   3754 C  C   . TYR B 2  157 ? -77.968 4.018   11.610  1.00 33.77  ? 157 TYR B C   1 
ATOM   3755 O  O   . TYR B 2  157 ? -78.587 3.863   12.659  1.00 34.09  ? 157 TYR B O   1 
ATOM   3756 C  CB  . TYR B 2  157 ? -77.264 1.834   10.670  1.00 28.54  ? 157 TYR B CB  1 
ATOM   3757 C  CG  . TYR B 2  157 ? -78.256 1.931   9.548   1.00 26.58  ? 157 TYR B CG  1 
ATOM   3758 C  CD1 . TYR B 2  157 ? -77.838 2.219   8.265   1.00 33.85  ? 157 TYR B CD1 1 
ATOM   3759 C  CD2 . TYR B 2  157 ? -79.601 1.635   9.744   1.00 33.60  ? 157 TYR B CD2 1 
ATOM   3760 C  CE1 . TYR B 2  157 ? -78.719 2.284   7.236   1.00 27.16  ? 157 TYR B CE1 1 
ATOM   3761 C  CE2 . TYR B 2  157 ? -80.504 1.680   8.687   1.00 30.94  ? 157 TYR B CE2 1 
ATOM   3762 C  CZ  . TYR B 2  157 ? -80.055 2.032   7.443   1.00 30.45  ? 157 TYR B CZ  1 
ATOM   3763 O  OH  . TYR B 2  157 ? -80.906 2.072   6.353   1.00 28.15  ? 157 TYR B OH  1 
ATOM   3764 N  N   . ASP B 2  158 ? -78.285 4.920   10.685  1.00 32.18  ? 158 ASP B N   1 
ATOM   3765 C  CA  . ASP B 2  158 ? -79.313 5.917   10.842  1.00 32.74  ? 158 ASP B CA  1 
ATOM   3766 C  C   . ASP B 2  158 ? -80.567 5.558   10.044  1.00 33.05  ? 158 ASP B C   1 
ATOM   3767 O  O   . ASP B 2  158 ? -80.744 5.997   8.895   1.00 36.22  ? 158 ASP B O   1 
ATOM   3768 C  CB  . ASP B 2  158 ? -78.743 7.266   10.395  1.00 33.63  ? 158 ASP B CB  1 
ATOM   3769 C  CG  . ASP B 2  158 ? -79.580 8.441   10.871  1.00 38.65  ? 158 ASP B CG  1 
ATOM   3770 O  OD1 . ASP B 2  158 ? -79.007 9.503   11.249  1.00 29.35  ? 158 ASP B OD1 1 
ATOM   3771 O  OD2 . ASP B 2  158 ? -80.812 8.281   10.836  1.00 31.39  ? 158 ASP B OD2 1 
ATOM   3772 N  N   . TYR B 2  159 ? -81.440 4.753   10.641  1.00 30.69  ? 159 TYR B N   1 
ATOM   3773 C  CA  . TYR B 2  159 ? -82.655 4.353   9.948   1.00 29.30  ? 159 TYR B CA  1 
ATOM   3774 C  C   . TYR B 2  159 ? -83.471 5.553   9.381   1.00 27.49  ? 159 TYR B C   1 
ATOM   3775 O  O   . TYR B 2  159 ? -83.859 5.524   8.217   1.00 28.69  ? 159 TYR B O   1 
ATOM   3776 C  CB  . TYR B 2  159 ? -83.523 3.461   10.830  1.00 26.42  ? 159 TYR B CB  1 
ATOM   3777 C  CG  . TYR B 2  159 ? -84.873 3.132   10.222  1.00 25.86  ? 159 TYR B CG  1 
ATOM   3778 C  CD1 . TYR B 2  159 ? -86.006 3.948   10.447  1.00 28.88  ? 159 TYR B CD1 1 
ATOM   3779 C  CD2 . TYR B 2  159 ? -85.020 2.033   9.422   1.00 24.72  ? 159 TYR B CD2 1 
ATOM   3780 C  CE1 . TYR B 2  159 ? -87.251 3.617   9.878   1.00 32.73  ? 159 TYR B CE1 1 
ATOM   3781 C  CE2 . TYR B 2  159 ? -86.233 1.712   8.837   1.00 28.88  ? 159 TYR B CE2 1 
ATOM   3782 C  CZ  . TYR B 2  159 ? -87.342 2.493   9.064   1.00 31.88  ? 159 TYR B CZ  1 
ATOM   3783 O  OH  . TYR B 2  159 ? -88.523 2.117   8.453   1.00 26.59  ? 159 TYR B OH  1 
ATOM   3784 N  N   . PRO B 2  160 ? -83.749 6.583   10.201  1.00 27.38  ? 160 PRO B N   1 
ATOM   3785 C  CA  . PRO B 2  160 ? -84.576 7.687   9.720   1.00 30.00  ? 160 PRO B CA  1 
ATOM   3786 C  C   . PRO B 2  160 ? -83.984 8.428   8.516   1.00 31.37  ? 160 PRO B C   1 
ATOM   3787 O  O   . PRO B 2  160 ? -84.720 8.885   7.647   1.00 29.68  ? 160 PRO B O   1 
ATOM   3788 C  CB  . PRO B 2  160 ? -84.685 8.616   10.942  1.00 31.49  ? 160 PRO B CB  1 
ATOM   3789 C  CG  . PRO B 2  160 ? -84.529 7.697   12.128  1.00 34.48  ? 160 PRO B CG  1 
ATOM   3790 C  CD  . PRO B 2  160 ? -83.465 6.703   11.638  1.00 31.16  ? 160 PRO B CD  1 
ATOM   3791 N  N   . LYS B 2  161 ? -82.666 8.538   8.468   1.00 31.44  ? 161 LYS B N   1 
ATOM   3792 C  CA  . LYS B 2  161 ? -81.993 9.201   7.359   1.00 32.80  ? 161 LYS B CA  1 
ATOM   3793 C  C   . LYS B 2  161 ? -82.336 8.580   6.017   1.00 33.38  ? 161 LYS B C   1 
ATOM   3794 O  O   . LYS B 2  161 ? -82.367 9.272   5.035   1.00 30.23  ? 161 LYS B O   1 
ATOM   3795 C  CB  . LYS B 2  161 ? -80.483 9.156   7.560   1.00 33.25  ? 161 LYS B CB  1 
ATOM   3796 C  CG  . LYS B 2  161 ? -79.612 9.821   6.460   1.00 36.49  ? 161 LYS B CG  1 
ATOM   3797 C  CD  . LYS B 2  161 ? -78.199 10.075  7.003   1.00 37.47  ? 161 LYS B CD  1 
ATOM   3798 C  CE  . LYS B 2  161 ? -77.292 10.844  6.031   1.00 39.18  ? 161 LYS B CE  1 
ATOM   3799 N  NZ  . LYS B 2  161 ? -76.354 9.890   5.401   1.00 39.51  ? 161 LYS B NZ  1 
ATOM   3800 N  N   . TYR B 2  162 ? -82.605 7.279   5.971   1.00 34.07  ? 162 TYR B N   1 
ATOM   3801 C  CA  . TYR B 2  162 ? -82.711 6.597   4.686   1.00 30.25  ? 162 TYR B CA  1 
ATOM   3802 C  C   . TYR B 2  162 ? -84.109 6.064   4.499   1.00 27.20  ? 162 TYR B C   1 
ATOM   3803 O  O   . TYR B 2  162 ? -84.368 5.380   3.505   1.00 28.11  ? 162 TYR B O   1 
ATOM   3804 C  CB  . TYR B 2  162 ? -81.654 5.460   4.555   1.00 32.51  ? 162 TYR B CB  1 
ATOM   3805 C  CG  . TYR B 2  162 ? -80.194 5.906   4.664   1.00 36.80  ? 162 TYR B CG  1 
ATOM   3806 C  CD1 . TYR B 2  162 ? -79.528 6.481   3.589   1.00 31.39  ? 162 TYR B CD1 1 
ATOM   3807 C  CD2 . TYR B 2  162 ? -79.469 5.706   5.827   1.00 33.90  ? 162 TYR B CD2 1 
ATOM   3808 C  CE1 . TYR B 2  162 ? -78.173 6.895   3.713   1.00 37.57  ? 162 TYR B CE1 1 
ATOM   3809 C  CE2 . TYR B 2  162 ? -78.131 6.135   5.955   1.00 32.10  ? 162 TYR B CE2 1 
ATOM   3810 C  CZ  . TYR B 2  162 ? -77.487 6.714   4.898   1.00 31.74  ? 162 TYR B CZ  1 
ATOM   3811 O  OH  . TYR B 2  162 ? -76.144 7.118   5.053   1.00 32.00  ? 162 TYR B OH  1 
ATOM   3812 N  N   . SER B 2  163 ? -85.024 6.417   5.404   1.00 29.12  ? 163 SER B N   1 
ATOM   3813 C  CA  . SER B 2  163 ? -86.351 5.750   5.487   1.00 28.57  ? 163 SER B CA  1 
ATOM   3814 C  C   . SER B 2  163 ? -87.275 6.120   4.377   1.00 28.85  ? 163 SER B C   1 
ATOM   3815 O  O   . SER B 2  163 ? -87.998 5.246   3.845   1.00 30.25  ? 163 SER B O   1 
ATOM   3816 C  CB  . SER B 2  163 ? -87.036 5.991   6.837   1.00 30.36  ? 163 SER B CB  1 
ATOM   3817 O  OG  . SER B 2  163 ? -87.146 7.376   7.130   1.00 35.63  ? 163 SER B OG  1 
ATOM   3818 N  N   . GLU B 2  164 ? -87.256 7.405   3.993   1.00 29.79  ? 164 GLU B N   1 
ATOM   3819 C  CA  . GLU B 2  164 ? -88.071 7.847   2.888   1.00 28.08  ? 164 GLU B CA  1 
ATOM   3820 C  C   . GLU B 2  164 ? -87.596 7.255   1.575   1.00 25.43  ? 164 GLU B C   1 
ATOM   3821 O  O   . GLU B 2  164 ? -88.416 6.714   0.813   1.00 27.08  ? 164 GLU B O   1 
ATOM   3822 C  CB  . GLU B 2  164 ? -88.156 9.382   2.797   1.00 31.40  ? 164 GLU B CB  1 
ATOM   3823 C  CG  . GLU B 2  164 ? -89.381 9.974   3.532   1.00 46.48  ? 164 GLU B CG  1 
ATOM   3824 C  CD  . GLU B 2  164 ? -90.718 9.362   3.070   1.00 54.61  ? 164 GLU B CD  1 
ATOM   3825 O  OE1 . GLU B 2  164 ? -90.901 9.207   1.841   1.00 62.09  ? 164 GLU B OE1 1 
ATOM   3826 O  OE2 . GLU B 2  164 ? -91.572 9.031   3.931   1.00 58.19  ? 164 GLU B OE2 1 
ATOM   3827 N  N   . GLU B 2  165 ? -86.307 7.384   1.272   1.00 23.54  ? 165 GLU B N   1 
ATOM   3828 C  CA  . GLU B 2  165 ? -85.798 6.835   -0.013  1.00 25.52  ? 165 GLU B CA  1 
ATOM   3829 C  C   . GLU B 2  165 ? -86.051 5.329   -0.030  1.00 24.75  ? 165 GLU B C   1 
ATOM   3830 O  O   . GLU B 2  165 ? -86.491 4.794   -1.034  1.00 28.69  ? 165 GLU B O   1 
ATOM   3831 C  CB  . GLU B 2  165 ? -84.313 7.169   -0.218  1.00 27.15  ? 165 GLU B CB  1 
ATOM   3832 C  CG  . GLU B 2  165 ? -83.567 6.366   -1.315  1.00 33.01  ? 165 GLU B CG  1 
ATOM   3833 C  CD  . GLU B 2  165 ? -82.034 6.500   -1.228  1.00 29.32  ? 165 GLU B CD  1 
ATOM   3834 O  OE1 . GLU B 2  165 ? -81.524 7.240   -0.364  1.00 34.70  ? 165 GLU B OE1 1 
ATOM   3835 O  OE2 . GLU B 2  165 ? -81.325 5.852   -2.018  1.00 32.75  ? 165 GLU B OE2 1 
ATOM   3836 N  N   . SER B 2  166 ? -85.847 4.651   1.102   1.00 27.29  ? 166 SER B N   1 
ATOM   3837 C  CA  . SER B 2  166 ? -86.151 3.197   1.211   1.00 23.77  ? 166 SER B CA  1 
ATOM   3838 C  C   . SER B 2  166 ? -87.605 2.882   0.904   1.00 25.83  ? 166 SER B C   1 
ATOM   3839 O  O   . SER B 2  166 ? -87.940 1.956   0.135   1.00 24.76  ? 166 SER B O   1 
ATOM   3840 C  CB  . SER B 2  166 ? -85.806 2.685   2.609   1.00 23.81  ? 166 SER B CB  1 
ATOM   3841 O  OG  . SER B 2  166 ? -84.416 2.725   2.871   1.00 29.96  ? 166 SER B OG  1 
ATOM   3842 N  N   . LYS B 2  167 ? -88.488 3.660   1.532   1.00 29.95  ? 167 LYS B N   1 
ATOM   3843 C  CA  . LYS B 2  167 ? -89.933 3.456   1.415   1.00 30.09  ? 167 LYS B CA  1 
ATOM   3844 C  C   . LYS B 2  167 ? -90.394 3.614   -0.024  1.00 28.47  ? 167 LYS B C   1 
ATOM   3845 O  O   . LYS B 2  167 ? -91.185 2.806   -0.536  1.00 31.32  ? 167 LYS B O   1 
ATOM   3846 C  CB  . LYS B 2  167 ? -90.661 4.443   2.375   1.00 31.46  ? 167 LYS B CB  1 
ATOM   3847 C  CG  . LYS B 2  167 ? -92.184 4.394   2.416   1.00 27.95  ? 167 LYS B CG  1 
ATOM   3848 C  CD  . LYS B 2  167 ? -92.727 5.700   3.040   1.00 31.28  ? 167 LYS B CD  1 
ATOM   3849 C  CE  . LYS B 2  167 ? -94.077 5.515   3.726   1.00 42.02  ? 167 LYS B CE  1 
ATOM   3850 N  NZ  . LYS B 2  167 ? -95.192 5.266   2.756   1.00 38.24  ? 167 LYS B NZ  1 
ATOM   3851 N  N   . LEU B 2  168 ? -89.893 4.632   -0.703  1.00 27.78  ? 168 LEU B N   1 
ATOM   3852 C  CA  . LEU B 2  168 ? -90.279 4.832   -2.106  1.00 30.22  ? 168 LEU B CA  1 
ATOM   3853 C  C   . LEU B 2  168 ? -89.847 3.647   -2.948  1.00 29.35  ? 168 LEU B C   1 
ATOM   3854 O  O   . LEU B 2  168 ? -90.600 3.196   -3.810  1.00 27.15  ? 168 LEU B O   1 
ATOM   3855 C  CB  . LEU B 2  168 ? -89.704 6.141   -2.682  1.00 31.06  ? 168 LEU B CB  1 
ATOM   3856 C  CG  . LEU B 2  168 ? -90.311 7.455   -2.145  1.00 41.05  ? 168 LEU B CG  1 
ATOM   3857 C  CD1 . LEU B 2  168 ? -89.371 8.646   -2.402  1.00 45.04  ? 168 LEU B CD1 1 
ATOM   3858 C  CD2 . LEU B 2  168 ? -91.707 7.746   -2.729  1.00 29.51  ? 168 LEU B CD2 1 
ATOM   3859 N  N   . ASN B 2  169 ? -88.652 3.115   -2.674  1.00 30.49  ? 169 ASN B N   1 
ATOM   3860 C  CA  . ASN B 2  169 ? -88.176 1.943   -3.421  1.00 30.46  ? 169 ASN B CA  1 
ATOM   3861 C  C   . ASN B 2  169 ? -88.947 0.678   -3.067  1.00 30.60  ? 169 ASN B C   1 
ATOM   3862 O  O   . ASN B 2  169 ? -89.435 -0.030  -3.945  1.00 29.86  ? 169 ASN B O   1 
ATOM   3863 C  CB  . ASN B 2  169 ? -86.662 1.742   -3.242  1.00 31.23  ? 169 ASN B CB  1 
ATOM   3864 C  CG  . ASN B 2  169 ? -85.838 2.678   -4.125  1.00 20.95  ? 169 ASN B CG  1 
ATOM   3865 O  OD1 . ASN B 2  169 ? -86.185 2.924   -5.278  1.00 23.67  ? 169 ASN B OD1 1 
ATOM   3866 N  ND2 . ASN B 2  169 ? -84.769 3.219   -3.574  1.00 23.08  ? 169 ASN B ND2 1 
ATOM   3867 N  N   . ARG B 2  170 ? -89.069 0.412   -1.774  1.00 32.83  ? 170 ARG B N   1 
ATOM   3868 C  CA  . ARG B 2  170 ? -89.894 -0.691  -1.280  1.00 36.38  ? 170 ARG B CA  1 
ATOM   3869 C  C   . ARG B 2  170 ? -91.369 -0.602  -1.800  1.00 42.23  ? 170 ARG B C   1 
ATOM   3870 O  O   . ARG B 2  170 ? -91.970 -1.626  -2.127  1.00 44.35  ? 170 ARG B O   1 
ATOM   3871 C  CB  . ARG B 2  170 ? -89.805 -0.724  0.260   1.00 36.34  ? 170 ARG B CB  1 
ATOM   3872 C  CG  . ARG B 2  170 ? -90.227 -2.021  0.948   1.00 34.36  ? 170 ARG B CG  1 
ATOM   3873 C  CD  . ARG B 2  170 ? -90.207 -1.882  2.498   1.00 33.87  ? 170 ARG B CD  1 
ATOM   3874 N  NE  . ARG B 2  170 ? -91.010 -0.764  3.015   1.00 31.39  ? 170 ARG B NE  1 
ATOM   3875 C  CZ  . ARG B 2  170 ? -90.524 0.339   3.582   1.00 28.23  ? 170 ARG B CZ  1 
ATOM   3876 N  NH1 . ARG B 2  170 ? -89.234 0.490   3.761   1.00 27.53  ? 170 ARG B NH1 1 
ATOM   3877 N  NH2 . ARG B 2  170 ? -91.349 1.304   4.006   1.00 25.60  ? 170 ARG B NH2 1 
ATOM   3878 N  N   . GLU B 2  171 ? -91.929 0.596   -1.947  1.00 44.29  ? 171 GLU B N   1 
ATOM   3879 C  CA  . GLU B 2  171 ? -93.333 0.701   -2.375  1.00 50.55  ? 171 GLU B CA  1 
ATOM   3880 C  C   . GLU B 2  171 ? -93.510 0.672   -3.894  1.00 52.33  ? 171 GLU B C   1 
ATOM   3881 O  O   . GLU B 2  171 ? -94.627 0.575   -4.372  1.00 51.31  ? 171 GLU B O   1 
ATOM   3882 C  CB  . GLU B 2  171 ? -93.996 1.965   -1.807  1.00 52.16  ? 171 GLU B CB  1 
ATOM   3883 C  CG  . GLU B 2  171 ? -93.898 2.086   -0.273  1.00 57.05  ? 171 GLU B CG  1 
ATOM   3884 C  CD  . GLU B 2  171 ? -95.190 1.795   0.451   1.00 55.78  ? 171 GLU B CD  1 
ATOM   3885 O  OE1 . GLU B 2  171 ? -96.111 2.628   0.339   1.00 57.37  ? 171 GLU B OE1 1 
ATOM   3886 O  OE2 . GLU B 2  171 ? -95.266 0.759   1.152   1.00 55.93  ? 171 GLU B OE2 1 
ATOM   3887 N  N   . GLU B 2  172 ? -92.409 0.755   -4.637  1.00 55.02  ? 172 GLU B N   1 
ATOM   3888 C  CA  . GLU B 2  172 ? -92.426 0.659   -6.105  1.00 56.26  ? 172 GLU B CA  1 
ATOM   3889 C  C   . GLU B 2  172 ? -92.786 -0.758  -6.582  1.00 57.62  ? 172 GLU B C   1 
ATOM   3890 O  O   . GLU B 2  172 ? -93.526 -0.926  -7.561  1.00 58.53  ? 172 GLU B O   1 
ATOM   3891 C  CB  . GLU B 2  172 ? -91.046 1.059   -6.636  1.00 56.74  ? 172 GLU B CB  1 
ATOM   3892 C  CG  . GLU B 2  172 ? -90.909 1.241   -8.141  1.00 56.26  ? 172 GLU B CG  1 
ATOM   3893 C  CD  . GLU B 2  172 ? -89.494 1.660   -8.537  1.00 53.86  ? 172 GLU B CD  1 
ATOM   3894 O  OE1 . GLU B 2  172 ? -89.147 1.607   -9.738  1.00 54.38  ? 172 GLU B OE1 1 
ATOM   3895 O  OE2 . GLU B 2  172 ? -88.720 2.044   -7.639  1.00 50.17  ? 172 GLU B OE2 1 
ATOM   3896 N  N   . ILE B 2  173 ? -92.250 -1.762  -5.886  1.00 58.94  ? 173 ILE B N   1 
ATOM   3897 C  CA  . ILE B 2  173 ? -92.555 -3.171  -6.142  1.00 59.05  ? 173 ILE B CA  1 
ATOM   3898 C  C   . ILE B 2  173 ? -93.909 -3.522  -5.552  1.00 58.77  ? 173 ILE B C   1 
ATOM   3899 O  O   . ILE B 2  173 ? -94.180 -3.208  -4.394  1.00 57.87  ? 173 ILE B O   1 
ATOM   3900 C  CB  . ILE B 2  173 ? -91.489 -4.104  -5.500  1.00 59.44  ? 173 ILE B CB  1 
ATOM   3901 N  N   . GLU C 3  1   ? -52.221 -5.500  37.014  1.00 51.37  ? 1   GLU H N   1 
ATOM   3902 C  CA  . GLU C 3  1   ? -52.036 -5.455  35.536  1.00 52.27  ? 1   GLU H CA  1 
ATOM   3903 C  C   . GLU C 3  1   ? -50.911 -6.392  35.075  1.00 48.39  ? 1   GLU H C   1 
ATOM   3904 O  O   . GLU C 3  1   ? -50.044 -6.823  35.856  1.00 48.65  ? 1   GLU H O   1 
ATOM   3905 C  CB  . GLU C 3  1   ? -51.763 -4.008  35.032  1.00 54.54  ? 1   GLU H CB  1 
ATOM   3906 C  CG  . GLU C 3  1   ? -52.244 -3.750  33.549  1.00 57.71  ? 1   GLU H CG  1 
ATOM   3907 C  CD  . GLU C 3  1   ? -52.376 -2.259  33.170  1.00 64.89  ? 1   GLU H CD  1 
ATOM   3908 O  OE1 . GLU C 3  1   ? -51.579 -1.441  33.692  1.00 64.50  ? 1   GLU H OE1 1 
ATOM   3909 O  OE2 . GLU C 3  1   ? -53.266 -1.919  32.335  1.00 61.89  ? 1   GLU H OE2 1 
ATOM   3910 N  N   . VAL C 3  2   ? -50.934 -6.683  33.783  1.00 41.03  ? 2   VAL H N   1 
ATOM   3911 C  CA  . VAL C 3  2   ? -49.943 -7.522  33.170  1.00 35.59  ? 2   VAL H CA  1 
ATOM   3912 C  C   . VAL C 3  2   ? -48.524 -6.979  33.385  1.00 32.25  ? 2   VAL H C   1 
ATOM   3913 O  O   . VAL C 3  2   ? -48.301 -5.784  33.357  1.00 30.96  ? 2   VAL H O   1 
ATOM   3914 C  CB  . VAL C 3  2   ? -50.274 -7.727  31.663  1.00 35.52  ? 2   VAL H CB  1 
ATOM   3915 C  CG1 . VAL C 3  2   ? -49.248 -8.654  30.995  1.00 31.72  ? 2   VAL H CG1 1 
ATOM   3916 C  CG2 . VAL C 3  2   ? -51.655 -8.356  31.530  1.00 37.05  ? 2   VAL H CG2 1 
ATOM   3917 N  N   . GLN C 3  3   ? -47.575 -7.871  33.626  1.00 30.44  ? 3   GLN H N   1 
ATOM   3918 C  CA  . GLN C 3  3   ? -46.175 -7.510  33.594  1.00 33.50  ? 3   GLN H CA  1 
ATOM   3919 C  C   . GLN C 3  3   ? -45.488 -8.293  32.459  1.00 31.61  ? 3   GLN H C   1 
ATOM   3920 O  O   . GLN C 3  3   ? -45.843 -9.420  32.188  1.00 29.63  ? 3   GLN H O   1 
ATOM   3921 C  CB  . GLN C 3  3   ? -45.533 -7.709  34.968  1.00 34.30  ? 3   GLN H CB  1 
ATOM   3922 C  CG  . GLN C 3  3   ? -46.491 -7.236  36.098  1.00 45.00  ? 3   GLN H CG  1 
ATOM   3923 C  CD  . GLN C 3  3   ? -45.804 -6.772  37.353  1.00 56.13  ? 3   GLN H CD  1 
ATOM   3924 O  OE1 . GLN C 3  3   ? -44.584 -6.702  37.409  1.00 64.81  ? 3   GLN H OE1 1 
ATOM   3925 N  NE2 . GLN C 3  3   ? -46.595 -6.446  38.386  1.00 62.49  ? 3   GLN H NE2 1 
ATOM   3926 N  N   . LEU C 3  4   ? -44.568 -7.631  31.776  1.00 27.02  ? 4   LEU H N   1 
ATOM   3927 C  CA  . LEU C 3  4   ? -43.938 -8.145  30.590  1.00 31.57  ? 4   LEU H CA  1 
ATOM   3928 C  C   . LEU C 3  4   ? -42.464 -8.212  30.925  1.00 29.97  ? 4   LEU H C   1 
ATOM   3929 O  O   . LEU C 3  4   ? -41.865 -7.186  31.204  1.00 31.37  ? 4   LEU H O   1 
ATOM   3930 C  CB  . LEU C 3  4   ? -44.167 -7.188  29.411  1.00 30.38  ? 4   LEU H CB  1 
ATOM   3931 C  CG  . LEU C 3  4   ? -45.295 -7.310  28.373  1.00 40.16  ? 4   LEU H CG  1 
ATOM   3932 C  CD1 . LEU C 3  4   ? -46.434 -8.159  28.732  1.00 32.27  ? 4   LEU H CD1 1 
ATOM   3933 C  CD2 . LEU C 3  4   ? -45.781 -5.954  27.927  1.00 26.08  ? 4   LEU H CD2 1 
ATOM   3934 N  N   . VAL C 3  5   ? -41.874 -9.400  30.882  1.00 27.17  ? 5   VAL H N   1 
ATOM   3935 C  CA  . VAL C 3  5   ? -40.482 -9.544  31.325  1.00 28.53  ? 5   VAL H CA  1 
ATOM   3936 C  C   . VAL C 3  5   ? -39.680 -10.025 30.120  1.00 28.26  ? 5   VAL H C   1 
ATOM   3937 O  O   . VAL C 3  5   ? -40.023 -11.044 29.476  1.00 25.93  ? 5   VAL H O   1 
ATOM   3938 C  CB  . VAL C 3  5   ? -40.387 -10.492 32.537  1.00 31.61  ? 5   VAL H CB  1 
ATOM   3939 C  CG1 . VAL C 3  5   ? -38.913 -10.687 32.998  1.00 25.20  ? 5   VAL H CG1 1 
ATOM   3940 C  CG2 . VAL C 3  5   ? -41.367 -10.002 33.738  1.00 21.62  ? 5   VAL H CG2 1 
ATOM   3941 N  N   . GLU C 3  6   ? -38.633 -9.283  29.802  1.00 27.24  ? 6   GLU H N   1 
ATOM   3942 C  CA  . GLU C 3  6   ? -37.792 -9.598  28.648  1.00 31.07  ? 6   GLU H CA  1 
ATOM   3943 C  C   . GLU C 3  6   ? -36.512 -10.306 29.014  1.00 30.59  ? 6   GLU H C   1 
ATOM   3944 O  O   . GLU C 3  6   ? -36.042 -10.145 30.125  1.00 34.85  ? 6   GLU H O   1 
ATOM   3945 C  CB  . GLU C 3  6   ? -37.470 -8.346  27.902  1.00 30.98  ? 6   GLU H CB  1 
ATOM   3946 C  CG  . GLU C 3  6   ? -38.734 -7.561  27.631  1.00 36.23  ? 6   GLU H CG  1 
ATOM   3947 C  CD  . GLU C 3  6   ? -38.501 -6.357  26.784  1.00 44.19  ? 6   GLU H CD  1 
ATOM   3948 O  OE1 . GLU C 3  6   ? -39.076 -5.290  27.083  1.00 27.82  ? 6   GLU H OE1 1 
ATOM   3949 O  OE2 . GLU C 3  6   ? -37.780 -6.500  25.786  1.00 31.36  ? 6   GLU H OE2 1 
ATOM   3950 N  N   . SER C 3  7   ? -35.957 -11.073 28.069  1.00 27.23  ? 7   SER H N   1 
ATOM   3951 C  CA  . SER C 3  7   ? -34.680 -11.736 28.285  1.00 30.64  ? 7   SER H CA  1 
ATOM   3952 C  C   . SER C 3  7   ? -33.497 -10.747 28.357  1.00 27.49  ? 7   SER H C   1 
ATOM   3953 O  O   . SER C 3  7   ? -33.639 -9.530  28.176  1.00 27.09  ? 7   SER H O   1 
ATOM   3954 C  CB  . SER C 3  7   ? -34.458 -12.786 27.196  1.00 28.98  ? 7   SER H CB  1 
ATOM   3955 O  OG  . SER C 3  7   ? -34.683 -12.207 25.918  1.00 32.83  ? 7   SER H OG  1 
ATOM   3956 N  N   . GLY C 3  8   ? -32.337 -11.280 28.687  1.00 29.30  ? 8   GLY H N   1 
ATOM   3957 C  CA  . GLY C 3  8   ? -31.185 -10.454 29.104  1.00 27.02  ? 8   GLY H CA  1 
ATOM   3958 C  C   . GLY C 3  8   ? -30.452 -9.817  27.941  1.00 26.58  ? 8   GLY H C   1 
ATOM   3959 O  O   . GLY C 3  8   ? -30.658 -10.155 26.767  1.00 29.08  ? 8   GLY H O   1 
ATOM   3960 N  N   . ALA C 3  9   ? -29.539 -8.916  28.271  1.00 26.98  ? 9   ALA H N   1 
ATOM   3961 C  CA  . ALA C 3  9   ? -28.745 -8.172  27.281  1.00 27.27  ? 9   ALA H CA  1 
ATOM   3962 C  C   . ALA C 3  9   ? -28.010 -9.074  26.278  1.00 27.50  ? 9   ALA H C   1 
ATOM   3963 O  O   . ALA C 3  9   ? -27.551 -10.144 26.622  1.00 25.40  ? 9   ALA H O   1 
ATOM   3964 C  CB  . ALA C 3  9   ? -27.698 -7.262  28.061  1.00 26.42  ? 9   ALA H CB  1 
ATOM   3965 N  N   . GLU C 3  10  ? -27.828 -8.604  25.053  1.00 30.32  ? 10  GLU H N   1 
ATOM   3966 C  CA  . GLU C 3  10  ? -27.145 -9.382  24.037  1.00 28.29  ? 10  GLU H CA  1 
ATOM   3967 C  C   . GLU C 3  10  ? -26.050 -8.564  23.348  1.00 29.13  ? 10  GLU H C   1 
ATOM   3968 O  O   . GLU C 3  10  ? -26.198 -7.336  23.128  1.00 29.00  ? 10  GLU H O   1 
ATOM   3969 C  CB  . GLU C 3  10  ? -28.156 -9.794  22.966  1.00 29.78  ? 10  GLU H CB  1 
ATOM   3970 C  CG  . GLU C 3  10  ? -29.350 -10.614 23.465  1.00 35.52  ? 10  GLU H CG  1 
ATOM   3971 C  CD  . GLU C 3  10  ? -29.125 -12.074 23.485  1.00 35.27  ? 10  GLU H CD  1 
ATOM   3972 O  OE1 . GLU C 3  10  ? -28.033 -12.533 23.085  1.00 43.04  ? 10  GLU H OE1 1 
ATOM   3973 O  OE2 . GLU C 3  10  ? -30.065 -12.788 23.886  1.00 42.42  ? 10  GLU H OE2 1 
ATOM   3974 N  N   . VAL C 3  11  ? -24.944 -9.239  23.020  1.00 29.16  ? 11  VAL H N   1 
ATOM   3975 C  CA  . VAL C 3  11  ? -23.883 -8.619  22.239  1.00 25.92  ? 11  VAL H CA  1 
ATOM   3976 C  C   . VAL C 3  11  ? -23.635 -9.514  21.010  1.00 27.26  ? 11  VAL H C   1 
ATOM   3977 O  O   . VAL C 3  11  ? -23.417 -10.705 21.132  1.00 28.33  ? 11  VAL H O   1 
ATOM   3978 C  CB  . VAL C 3  11  ? -22.625 -8.362  23.099  1.00 29.42  ? 11  VAL H CB  1 
ATOM   3979 C  CG1 . VAL C 3  11  ? -21.544 -7.583  22.294  1.00 26.99  ? 11  VAL H CG1 1 
ATOM   3980 C  CG2 . VAL C 3  11  ? -23.011 -7.563  24.386  1.00 26.66  ? 11  VAL H CG2 1 
ATOM   3981 N  N   . LYS C 3  12  ? -23.696 -8.939  19.822  1.00 29.18  ? 12  LYS H N   1 
ATOM   3982 C  CA  . LYS C 3  12  ? -23.660 -9.726  18.588  1.00 30.54  ? 12  LYS H CA  1 
ATOM   3983 C  C   . LYS C 3  12  ? -22.767 -9.070  17.587  1.00 29.87  ? 12  LYS H C   1 
ATOM   3984 O  O   . LYS C 3  12  ? -22.503 -7.884  17.695  1.00 30.18  ? 12  LYS H O   1 
ATOM   3985 C  CB  . LYS C 3  12  ? -25.068 -9.834  17.974  1.00 29.89  ? 12  LYS H CB  1 
ATOM   3986 C  CG  . LYS C 3  12  ? -26.046 -10.557 18.831  1.00 31.11  ? 12  LYS H CG  1 
ATOM   3987 C  CD  . LYS C 3  12  ? -25.732 -12.002 18.868  1.00 33.73  ? 12  LYS H CD  1 
ATOM   3988 C  CE  . LYS C 3  12  ? -26.691 -12.687 19.776  1.00 36.45  ? 12  LYS H CE  1 
ATOM   3989 N  NZ  . LYS C 3  12  ? -26.330 -14.043 19.965  1.00 31.57  ? 12  LYS H NZ  1 
ATOM   3990 N  N   . LYS C 3  13  ? -22.304 -9.854  16.609  1.00 32.41  ? 13  LYS H N   1 
ATOM   3991 C  CA  . LYS C 3  13  ? -21.482 -9.332  15.486  1.00 31.74  ? 13  LYS H CA  1 
ATOM   3992 C  C   . LYS C 3  13  ? -22.327 -8.927  14.315  1.00 32.56  ? 13  LYS H C   1 
ATOM   3993 O  O   . LYS C 3  13  ? -23.388 -9.509  14.089  1.00 34.23  ? 13  LYS H O   1 
ATOM   3994 C  CB  . LYS C 3  13  ? -20.527 -10.398 14.961  1.00 30.51  ? 13  LYS H CB  1 
ATOM   3995 C  CG  . LYS C 3  13  ? -19.669 -11.048 16.034  1.00 32.72  ? 13  LYS H CG  1 
ATOM   3996 C  CD  . LYS C 3  13  ? -18.256 -10.452 16.053  1.00 39.91  ? 13  LYS H CD  1 
ATOM   3997 C  CE  . LYS C 3  13  ? -17.444 -11.128 17.151  1.00 43.97  ? 13  LYS H CE  1 
ATOM   3998 N  NZ  . LYS C 3  13  ? -16.123 -10.571 17.283  1.00 44.27  ? 13  LYS H NZ  1 
ATOM   3999 N  N   . PRO C 3  14  ? -21.837 -7.978  13.515  1.00 30.14  ? 14  PRO H N   1 
ATOM   4000 C  CA  . PRO C 3  14  ? -22.573 -7.687  12.287  1.00 32.09  ? 14  PRO H CA  1 
ATOM   4001 C  C   . PRO C 3  14  ? -22.796 -8.975  11.465  1.00 30.69  ? 14  PRO H C   1 
ATOM   4002 O  O   . PRO C 3  14  ? -21.933 -9.841  11.452  1.00 31.35  ? 14  PRO H O   1 
ATOM   4003 C  CB  . PRO C 3  14  ? -21.655 -6.690  11.565  1.00 33.71  ? 14  PRO H CB  1 
ATOM   4004 C  CG  . PRO C 3  14  ? -20.790 -6.125  12.679  1.00 32.43  ? 14  PRO H CG  1 
ATOM   4005 C  CD  . PRO C 3  14  ? -20.552 -7.262  13.565  1.00 28.97  ? 14  PRO H CD  1 
ATOM   4006 N  N   . GLY C 3  15  ? -23.964 -9.119  10.838  1.00 29.19  ? 15  GLY H N   1 
ATOM   4007 C  CA  . GLY C 3  15  ? -24.265 -10.315 10.006  1.00 28.67  ? 15  GLY H CA  1 
ATOM   4008 C  C   . GLY C 3  15  ? -24.912 -11.470 10.749  1.00 28.84  ? 15  GLY H C   1 
ATOM   4009 O  O   . GLY C 3  15  ? -25.472 -12.377 10.118  1.00 30.73  ? 15  GLY H O   1 
ATOM   4010 N  N   . SER C 3  16  ? -24.850 -11.447 12.080  1.00 24.46  ? 16  SER H N   1 
ATOM   4011 C  CA  . SER C 3  16  ? -25.465 -12.485 12.874  1.00 28.56  ? 16  SER H CA  1 
ATOM   4012 C  C   . SER C 3  16  ? -26.954 -12.124 13.160  1.00 29.06  ? 16  SER H C   1 
ATOM   4013 O  O   . SER C 3  16  ? -27.504 -11.195 12.570  1.00 26.08  ? 16  SER H O   1 
ATOM   4014 C  CB  . SER C 3  16  ? -24.680 -12.705 14.185  1.00 26.99  ? 16  SER H CB  1 
ATOM   4015 O  OG  . SER C 3  16  ? -24.571 -11.487 14.911  1.00 41.65  ? 16  SER H OG  1 
ATOM   4016 N  N   . SER C 3  17  ? -27.567 -12.923 14.026  1.00 30.26  ? 17  SER H N   1 
ATOM   4017 C  CA  . SER C 3  17  ? -28.958 -12.842 14.426  1.00 29.53  ? 17  SER H CA  1 
ATOM   4018 C  C   . SER C 3  17  ? -29.045 -12.774 15.928  1.00 29.16  ? 17  SER H C   1 
ATOM   4019 O  O   . SER C 3  17  ? -28.160 -13.270 16.648  1.00 29.54  ? 17  SER H O   1 
ATOM   4020 C  CB  . SER C 3  17  ? -29.697 -14.107 14.039  1.00 27.39  ? 17  SER H CB  1 
ATOM   4021 O  OG  . SER C 3  17  ? -29.718 -14.262 12.641  1.00 41.66  ? 17  SER H OG  1 
ATOM   4022 N  N   . VAL C 3  18  ? -30.139 -12.194 16.400  1.00 26.91  ? 18  VAL H N   1 
ATOM   4023 C  CA  . VAL C 3  18  ? -30.429 -12.159 17.808  1.00 24.97  ? 18  VAL H CA  1 
ATOM   4024 C  C   . VAL C 3  18  ? -31.896 -12.541 17.966  1.00 28.26  ? 18  VAL H C   1 
ATOM   4025 O  O   . VAL C 3  18  ? -32.714 -12.154 17.146  1.00 26.14  ? 18  VAL H O   1 
ATOM   4026 C  CB  . VAL C 3  18  ? -30.164 -10.765 18.372  1.00 21.90  ? 18  VAL H CB  1 
ATOM   4027 C  CG1 . VAL C 3  18  ? -31.150 -9.701  17.774  1.00 21.84  ? 18  VAL H CG1 1 
ATOM   4028 C  CG2 . VAL C 3  18  ? -30.177 -10.772 19.892  1.00 26.58  ? 18  VAL H CG2 1 
ATOM   4029 N  N   . LYS C 3  19  ? -32.203 -13.305 19.018  1.00 30.10  ? 19  LYS H N   1 
ATOM   4030 C  CA  . LYS C 3  19  ? -33.582 -13.645 19.395  1.00 28.17  ? 19  LYS H CA  1 
ATOM   4031 C  C   . LYS C 3  19  ? -33.899 -13.203 20.842  1.00 28.38  ? 19  LYS H C   1 
ATOM   4032 O  O   . LYS C 3  19  ? -33.317 -13.697 21.781  1.00 30.96  ? 19  LYS H O   1 
ATOM   4033 C  CB  . LYS C 3  19  ? -33.778 -15.142 19.274  1.00 28.41  ? 19  LYS H CB  1 
ATOM   4034 C  CG  . LYS C 3  19  ? -35.306 -15.551 19.363  1.00 25.66  ? 19  LYS H CG  1 
ATOM   4035 C  CD  . LYS C 3  19  ? -35.445 -17.091 18.980  1.00 25.95  ? 19  LYS H CD  1 
ATOM   4036 C  CE  . LYS C 3  19  ? -36.915 -17.463 18.876  1.00 37.99  ? 19  LYS H CE  1 
ATOM   4037 N  NZ  . LYS C 3  19  ? -37.177 -18.722 18.169  1.00 33.06  ? 19  LYS H NZ  1 
ATOM   4038 N  N   . VAL C 3  20  ? -34.845 -12.292 21.009  1.00 28.44  ? 20  VAL H N   1 
ATOM   4039 C  CA  . VAL C 3  20  ? -35.204 -11.773 22.313  1.00 30.12  ? 20  VAL H CA  1 
ATOM   4040 C  C   . VAL C 3  20  ? -36.583 -12.335 22.679  1.00 31.44  ? 20  VAL H C   1 
ATOM   4041 O  O   . VAL C 3  20  ? -37.439 -12.482 21.801  1.00 28.80  ? 20  VAL H O   1 
ATOM   4042 C  CB  . VAL C 3  20  ? -35.213 -10.231 22.243  1.00 32.16  ? 20  VAL H CB  1 
ATOM   4043 C  CG1 . VAL C 3  20  ? -35.591 -9.599  23.589  1.00 34.54  ? 20  VAL H CG1 1 
ATOM   4044 C  CG2 . VAL C 3  20  ? -33.790 -9.737  21.836  1.00 30.74  ? 20  VAL H CG2 1 
ATOM   4045 N  N   . SER C 3  21  ? -36.804 -12.609 23.964  1.00 28.36  ? 21  SER H N   1 
ATOM   4046 C  CA  . SER C 3  21  ? -38.085 -13.107 24.432  1.00 28.48  ? 21  SER H CA  1 
ATOM   4047 C  C   . SER C 3  21  ? -38.751 -12.142 25.379  1.00 28.26  ? 21  SER H C   1 
ATOM   4048 O  O   . SER C 3  21  ? -38.112 -11.330 25.999  1.00 25.87  ? 21  SER H O   1 
ATOM   4049 C  CB  . SER C 3  21  ? -37.884 -14.472 25.099  1.00 28.81  ? 21  SER H CB  1 
ATOM   4050 O  OG  . SER C 3  21  ? -37.215 -14.302 26.317  1.00 32.41  ? 21  SER H OG  1 
ATOM   4051 N  N   . CYS C 3  22  ? -40.075 -12.241 25.459  1.00 28.05  ? 22  CYS H N   1 
ATOM   4052 C  CA  . CYS C 3  22  ? -40.917 -11.451 26.312  1.00 27.24  ? 22  CYS H CA  1 
ATOM   4053 C  C   . CYS C 3  22  ? -41.931 -12.437 26.944  1.00 30.29  ? 22  CYS H C   1 
ATOM   4054 O  O   . CYS C 3  22  ? -42.738 -13.010 26.236  1.00 28.98  ? 22  CYS H O   1 
ATOM   4055 C  CB  . CYS C 3  22  ? -41.703 -10.464 25.474  1.00 27.91  ? 22  CYS H CB  1 
ATOM   4056 S  SG  . CYS C 3  22  ? -42.933 -9.374  26.278  1.00 37.35  ? 22  CYS H SG  1 
ATOM   4057 N  N   . LYS C 3  23  ? -41.929 -12.595 28.260  1.00 30.33  ? 23  LYS H N   1 
ATOM   4058 C  CA  . LYS C 3  23  ? -42.915 -13.450 28.925  1.00 30.73  ? 23  LYS H CA  1 
ATOM   4059 C  C   . LYS C 3  23  ? -43.974 -12.570 29.594  1.00 28.21  ? 23  LYS H C   1 
ATOM   4060 O  O   . LYS C 3  23  ? -43.638 -11.706 30.379  1.00 27.74  ? 23  LYS H O   1 
ATOM   4061 C  CB  . LYS C 3  23  ? -42.190 -14.342 29.963  1.00 33.20  ? 23  LYS H CB  1 
ATOM   4062 C  CG  . LYS C 3  23  ? -43.144 -15.440 30.533  1.00 39.75  ? 23  LYS H CG  1 
ATOM   4063 C  CD  . LYS C 3  23  ? -42.396 -16.510 31.265  1.00 50.58  ? 23  LYS H CD  1 
ATOM   4064 C  CE  . LYS C 3  23  ? -43.331 -17.668 31.668  1.00 60.36  ? 23  LYS H CE  1 
ATOM   4065 N  NZ  . LYS C 3  23  ? -44.707 -17.179 31.982  1.00 55.03  ? 23  LYS H NZ  1 
ATOM   4066 N  N   . ALA C 3  24  ? -45.233 -12.738 29.232  1.00 28.45  ? 24  ALA H N   1 
ATOM   4067 C  CA  . ALA C 3  24  ? -46.341 -11.994 29.854  1.00 30.82  ? 24  ALA H CA  1 
ATOM   4068 C  C   . ALA C 3  24  ? -46.847 -12.756 31.098  1.00 32.08  ? 24  ALA H C   1 
ATOM   4069 O  O   . ALA C 3  24  ? -47.047 -13.939 31.041  1.00 36.43  ? 24  ALA H O   1 
ATOM   4070 C  CB  . ALA C 3  24  ? -47.508 -11.829 28.832  1.00 23.33  ? 24  ALA H CB  1 
ATOM   4071 N  N   . SER C 3  25  ? -47.077 -12.076 32.212  1.00 32.16  ? 25  SER H N   1 
ATOM   4072 C  CA  . SER C 3  25  ? -47.656 -12.731 33.388  1.00 27.09  ? 25  SER H CA  1 
ATOM   4073 C  C   . SER C 3  25  ? -49.123 -13.093 33.195  1.00 25.69  ? 25  SER H C   1 
ATOM   4074 O  O   . SER C 3  25  ? -49.826 -12.507 32.374  1.00 24.53  ? 25  SER H O   1 
ATOM   4075 C  CB  . SER C 3  25  ? -47.514 -11.810 34.584  1.00 26.75  ? 25  SER H CB  1 
ATOM   4076 O  OG  . SER C 3  25  ? -48.305 -10.640 34.404  1.00 28.67  ? 25  SER H OG  1 
ATOM   4077 N  N   . GLY C 3  26  ? -49.613 -14.011 34.018  1.00 30.20  ? 26  GLY H N   1 
ATOM   4078 C  CA  . GLY C 3  26  ? -51.038 -14.390 33.993  1.00 29.93  ? 26  GLY H CA  1 
ATOM   4079 C  C   . GLY C 3  26  ? -51.243 -15.372 32.844  1.00 29.31  ? 26  GLY H C   1 
ATOM   4080 O  O   . GLY C 3  26  ? -50.312 -16.044 32.426  1.00 34.67  ? 26  GLY H O   1 
ATOM   4081 N  N   . GLY C 3  27  ? -52.431 -15.448 32.292  1.00 29.25  ? 27  GLY H N   1 
ATOM   4082 C  CA  . GLY C 3  27  ? -52.581 -16.242 31.094  1.00 30.36  ? 27  GLY H CA  1 
ATOM   4083 C  C   . GLY C 3  27  ? -52.468 -17.730 31.389  1.00 25.34  ? 27  GLY H C   1 
ATOM   4084 O  O   . GLY C 3  27  ? -53.012 -18.189 32.342  1.00 26.07  ? 27  GLY H O   1 
ATOM   4085 N  N   . PRO C 3  28  ? -51.704 -18.481 30.593  1.00 26.86  ? 28  PRO H N   1 
ATOM   4086 C  CA  . PRO C 3  28  ? -50.742 -17.986 29.629  1.00 22.94  ? 28  PRO H CA  1 
ATOM   4087 C  C   . PRO C 3  28  ? -51.312 -17.530 28.290  1.00 24.69  ? 28  PRO H C   1 
ATOM   4088 O  O   . PRO C 3  28  ? -50.671 -16.722 27.698  1.00 21.74  ? 28  PRO H O   1 
ATOM   4089 C  CB  . PRO C 3  28  ? -49.811 -19.182 29.433  1.00 28.25  ? 28  PRO H CB  1 
ATOM   4090 C  CG  . PRO C 3  28  ? -50.713 -20.388 29.628  1.00 27.54  ? 28  PRO H CG  1 
ATOM   4091 C  CD  . PRO C 3  28  ? -51.594 -19.952 30.784  1.00 28.49  ? 28  PRO H CD  1 
ATOM   4092 N  N   . PHE C 3  29  ? -52.478 -18.003 27.814  1.00 19.43  ? 29  PHE H N   1 
ATOM   4093 C  CA  . PHE C 3  29  ? -53.045 -17.425 26.603  1.00 22.04  ? 29  PHE H CA  1 
ATOM   4094 C  C   . PHE C 3  29  ? -53.572 -16.022 26.875  1.00 24.60  ? 29  PHE H C   1 
ATOM   4095 O  O   . PHE C 3  29  ? -54.011 -15.700 28.020  1.00 25.25  ? 29  PHE H O   1 
ATOM   4096 C  CB  . PHE C 3  29  ? -54.186 -18.260 26.021  1.00 22.24  ? 29  PHE H CB  1 
ATOM   4097 C  CG  . PHE C 3  29  ? -53.724 -19.496 25.332  1.00 21.78  ? 29  PHE H CG  1 
ATOM   4098 C  CD1 . PHE C 3  29  ? -52.931 -20.436 26.015  1.00 21.49  ? 29  PHE H CD1 1 
ATOM   4099 C  CD2 . PHE C 3  29  ? -54.088 -19.748 24.013  1.00 18.69  ? 29  PHE H CD2 1 
ATOM   4100 C  CE1 . PHE C 3  29  ? -52.489 -21.597 25.364  1.00 23.06  ? 29  PHE H CE1 1 
ATOM   4101 C  CE2 . PHE C 3  29  ? -53.624 -20.898 23.351  1.00 28.86  ? 29  PHE H CE2 1 
ATOM   4102 C  CZ  . PHE C 3  29  ? -52.847 -21.834 24.040  1.00 19.54  ? 29  PHE H CZ  1 
ATOM   4103 N  N   . ARG C 3  30  ? -53.519 -15.208 25.823  1.00 23.97  ? 30  ARG H N   1 
ATOM   4104 C  CA  . ARG C 3  30  ? -53.672 -13.742 25.885  1.00 26.85  ? 30  ARG H CA  1 
ATOM   4105 C  C   . ARG C 3  30  ? -54.751 -13.378 24.929  1.00 23.19  ? 30  ARG H C   1 
ATOM   4106 O  O   . ARG C 3  30  ? -54.746 -13.890 23.817  1.00 22.99  ? 30  ARG H O   1 
ATOM   4107 C  CB  . ARG C 3  30  ? -52.434 -13.070 25.308  1.00 31.52  ? 30  ARG H CB  1 
ATOM   4108 C  CG  . ARG C 3  30  ? -51.281 -12.886 26.232  1.00 43.83  ? 30  ARG H CG  1 
ATOM   4109 C  CD  . ARG C 3  30  ? -50.129 -12.258 25.438  1.00 50.62  ? 30  ARG H CD  1 
ATOM   4110 N  NE  . ARG C 3  30  ? -49.513 -13.179 24.465  1.00 46.23  ? 30  ARG H NE  1 
ATOM   4111 C  CZ  . ARG C 3  30  ? -49.566 -13.073 23.141  1.00 40.20  ? 30  ARG H CZ  1 
ATOM   4112 N  NH1 . ARG C 3  30  ? -50.225 -12.097 22.522  1.00 40.84  ? 30  ARG H NH1 1 
ATOM   4113 N  NH2 . ARG C 3  30  ? -48.959 -13.987 22.411  1.00 44.98  ? 30  ARG H NH2 1 
ATOM   4114 N  N   . SER C 3  31  ? -55.592 -12.420 25.281  1.00 20.42  ? 31  SER H N   1 
ATOM   4115 C  CA  . SER C 3  31  ? -56.621 -11.918 24.334  1.00 22.08  ? 31  SER H CA  1 
ATOM   4116 C  C   . SER C 3  31  ? -56.189 -10.659 23.592  1.00 22.77  ? 31  SER H C   1 
ATOM   4117 O  O   . SER C 3  31  ? -56.986 -10.060 22.901  1.00 25.81  ? 31  SER H O   1 
ATOM   4118 C  CB  . SER C 3  31  ? -57.909 -11.612 25.092  1.00 22.18  ? 31  SER H CB  1 
ATOM   4119 O  OG  . SER C 3  31  ? -57.579 -10.854 26.221  1.00 26.85  ? 31  SER H OG  1 
ATOM   4120 N  N   . TYR C 3  32  ? -54.935 -10.247 23.766  1.00 26.02  ? 32  TYR H N   1 
ATOM   4121 C  CA  . TYR C 3  32  ? -54.431 -8.998  23.212  1.00 25.13  ? 32  TYR H CA  1 
ATOM   4122 C  C   . TYR C 3  32  ? -53.150 -9.303  22.410  1.00 28.12  ? 32  TYR H C   1 
ATOM   4123 O  O   . TYR C 3  32  ? -52.453 -10.288 22.656  1.00 26.38  ? 32  TYR H O   1 
ATOM   4124 C  CB  . TYR C 3  32  ? -54.123 -7.963  24.353  1.00 28.67  ? 32  TYR H CB  1 
ATOM   4125 C  CG  . TYR C 3  32  ? -53.241 -8.521  25.430  1.00 23.44  ? 32  TYR H CG  1 
ATOM   4126 C  CD1 . TYR C 3  32  ? -51.876 -8.621  25.248  1.00 29.53  ? 32  TYR H CD1 1 
ATOM   4127 C  CD2 . TYR C 3  32  ? -53.772 -9.035  26.607  1.00 30.88  ? 32  TYR H CD2 1 
ATOM   4128 C  CE1 . TYR C 3  32  ? -51.048 -9.192  26.224  1.00 26.74  ? 32  TYR H CE1 1 
ATOM   4129 C  CE2 . TYR C 3  32  ? -52.929 -9.628  27.591  1.00 27.25  ? 32  TYR H CE2 1 
ATOM   4130 C  CZ  . TYR C 3  32  ? -51.568 -9.698  27.368  1.00 27.56  ? 32  TYR H CZ  1 
ATOM   4131 O  OH  . TYR C 3  32  ? -50.683 -10.238 28.309  1.00 25.64  ? 32  TYR H OH  1 
ATOM   4132 N  N   . ALA C 3  33  ? -52.875 -8.459  21.438  1.00 27.61  ? 33  ALA H N   1 
ATOM   4133 C  CA  . ALA C 3  33  ? -51.669 -8.536  20.649  1.00 28.11  ? 33  ALA H CA  1 
ATOM   4134 C  C   . ALA C 3  33  ? -50.475 -7.934  21.387  1.00 28.50  ? 33  ALA H C   1 
ATOM   4135 O  O   . ALA C 3  33  ? -50.624 -7.199  22.378  1.00 25.75  ? 33  ALA H O   1 
ATOM   4136 C  CB  . ALA C 3  33  ? -51.867 -7.836  19.319  1.00 23.46  ? 33  ALA H CB  1 
ATOM   4137 N  N   . ILE C 3  34  ? -49.288 -8.293  20.922  1.00 28.38  ? 34  ILE H N   1 
ATOM   4138 C  CA  . ILE C 3  34  ? -48.060 -7.790  21.484  1.00 29.11  ? 34  ILE H CA  1 
ATOM   4139 C  C   . ILE C 3  34  ? -47.139 -7.406  20.306  1.00 31.09  ? 34  ILE H C   1 
ATOM   4140 O  O   . ILE C 3  34  ? -47.057 -8.139  19.303  1.00 28.38  ? 34  ILE H O   1 
ATOM   4141 C  CB  . ILE C 3  34  ? -47.369 -8.810  22.317  1.00 32.81  ? 34  ILE H CB  1 
ATOM   4142 C  CG1 . ILE C 3  34  ? -48.085 -8.996  23.656  1.00 31.33  ? 34  ILE H CG1 1 
ATOM   4143 C  CG2 . ILE C 3  34  ? -45.911 -8.387  22.590  1.00 39.23  ? 34  ILE H CG2 1 
ATOM   4144 C  CD1 . ILE C 3  34  ? -47.406 -9.984  24.589  1.00 29.22  ? 34  ILE H CD1 1 
ATOM   4145 N  N   . SER C 3  35  ? -46.490 -6.238  20.435  1.00 33.10  ? 35  SER H N   1 
ATOM   4146 C  CA  . SER C 3  35  ? -45.554 -5.723  19.470  1.00 30.13  ? 35  SER H CA  1 
ATOM   4147 C  C   . SER C 3  35  ? -44.158 -5.621  20.104  1.00 31.34  ? 35  SER H C   1 
ATOM   4148 O  O   . SER C 3  35  ? -43.995 -5.668  21.336  1.00 27.93  ? 35  SER H O   1 
ATOM   4149 C  CB  . SER C 3  35  ? -45.967 -4.343  19.009  1.00 31.50  ? 35  SER H CB  1 
ATOM   4150 O  OG  . SER C 3  35  ? -47.004 -4.310  18.049  1.00 25.46  ? 35  SER H OG  1 
ATOM   4151 N  N   . TRP C 3  36  ? -43.174 -5.466  19.214  1.00 29.73  ? 36  TRP H N   1 
ATOM   4152 C  CA  . TRP C 3  36  ? -41.800 -5.084  19.508  1.00 28.32  ? 36  TRP H CA  1 
ATOM   4153 C  C   . TRP C 3  36  ? -41.507 -3.699  18.940  1.00 26.00  ? 36  TRP H C   1 
ATOM   4154 O  O   . TRP C 3  36  ? -41.891 -3.330  17.811  1.00 27.04  ? 36  TRP H O   1 
ATOM   4155 C  CB  . TRP C 3  36  ? -40.791 -6.119  18.966  1.00 27.78  ? 36  TRP H CB  1 
ATOM   4156 C  CG  . TRP C 3  36  ? -40.921 -7.414  19.681  1.00 25.92  ? 36  TRP H CG  1 
ATOM   4157 C  CD1 . TRP C 3  36  ? -41.821 -8.431  19.394  1.00 34.14  ? 36  TRP H CD1 1 
ATOM   4158 C  CD2 . TRP C 3  36  ? -40.198 -7.848  20.838  1.00 28.73  ? 36  TRP H CD2 1 
ATOM   4159 N  NE1 . TRP C 3  36  ? -41.666 -9.460  20.287  1.00 25.92  ? 36  TRP H NE1 1 
ATOM   4160 C  CE2 . TRP C 3  36  ? -40.678 -9.135  21.177  1.00 25.24  ? 36  TRP H CE2 1 
ATOM   4161 C  CE3 . TRP C 3  36  ? -39.162 -7.307  21.585  1.00 25.37  ? 36  TRP H CE3 1 
ATOM   4162 C  CZ2 . TRP C 3  36  ? -40.165 -9.858  22.229  1.00 26.84  ? 36  TRP H CZ2 1 
ATOM   4163 C  CZ3 . TRP C 3  36  ? -38.678 -8.014  22.632  1.00 24.59  ? 36  TRP H CZ3 1 
ATOM   4164 C  CH2 . TRP C 3  36  ? -39.175 -9.283  22.957  1.00 26.06  ? 36  TRP H CH2 1 
ATOM   4165 N  N   . VAL C 3  37  ? -40.893 -2.899  19.808  1.00 27.04  ? 37  VAL H N   1 
ATOM   4166 C  CA  . VAL C 3  37  ? -40.606 -1.539  19.528  1.00 23.68  ? 37  VAL H CA  1 
ATOM   4167 C  C   . VAL C 3  37  ? -39.168 -1.382  20.014  1.00 27.32  ? 37  VAL H C   1 
ATOM   4168 O  O   . VAL C 3  37  ? -38.803 -1.886  21.073  1.00 26.22  ? 37  VAL H O   1 
ATOM   4169 C  CB  . VAL C 3  37  ? -41.511 -0.597  20.280  1.00 27.55  ? 37  VAL H CB  1 
ATOM   4170 C  CG1 . VAL C 3  37  ? -41.041 0.841   20.040  1.00 24.26  ? 37  VAL H CG1 1 
ATOM   4171 C  CG2 . VAL C 3  37  ? -43.039 -0.800  19.869  1.00 25.94  ? 37  VAL H CG2 1 
ATOM   4172 N  N   . ARG C 3  38  ? -38.347 -0.718  19.222  1.00 25.11  ? 38  ARG H N   1 
ATOM   4173 C  CA  . ARG C 3  38  ? -36.971 -0.459  19.616  1.00 26.41  ? 38  ARG H CA  1 
ATOM   4174 C  C   . ARG C 3  38  ? -36.618 1.019   19.604  1.00 25.43  ? 38  ARG H C   1 
ATOM   4175 O  O   . ARG C 3  38  ? -37.316 1.846   19.029  1.00 27.90  ? 38  ARG H O   1 
ATOM   4176 C  CB  . ARG C 3  38  ? -36.031 -1.165  18.678  1.00 25.82  ? 38  ARG H CB  1 
ATOM   4177 C  CG  . ARG C 3  38  ? -35.766 -0.367  17.463  1.00 25.83  ? 38  ARG H CG  1 
ATOM   4178 C  CD  . ARG C 3  38  ? -34.725 -1.057  16.634  1.00 21.15  ? 38  ARG H CD  1 
ATOM   4179 N  NE  . ARG C 3  38  ? -34.269 -0.266  15.537  1.00 28.32  ? 38  ARG H NE  1 
ATOM   4180 C  CZ  . ARG C 3  38  ? -33.428 -0.713  14.609  1.00 29.00  ? 38  ARG H CZ  1 
ATOM   4181 N  NH1 . ARG C 3  38  ? -32.962 -1.945  14.654  1.00 27.02  ? 38  ARG H NH1 1 
ATOM   4182 N  NH2 . ARG C 3  38  ? -33.110 0.064   13.601  1.00 27.14  ? 38  ARG H NH2 1 
ATOM   4183 N  N   . GLN C 3  39  ? -35.532 1.348   20.278  1.00 25.36  ? 39  GLN H N   1 
ATOM   4184 C  CA  . GLN C 3  39  ? -35.113 2.714   20.434  1.00 23.52  ? 39  GLN H CA  1 
ATOM   4185 C  C   . GLN C 3  39  ? -33.602 2.783   20.489  1.00 23.28  ? 39  GLN H C   1 
ATOM   4186 O  O   . GLN C 3  39  ? -33.016 2.283   21.415  1.00 26.46  ? 39  GLN H O   1 
ATOM   4187 C  CB  . GLN C 3  39  ? -35.711 3.277   21.728  1.00 28.32  ? 39  GLN H CB  1 
ATOM   4188 C  CG  . GLN C 3  39  ? -35.388 4.785   21.932  1.00 27.83  ? 39  GLN H CG  1 
ATOM   4189 C  CD  . GLN C 3  39  ? -36.211 5.420   23.004  1.00 28.34  ? 39  GLN H CD  1 
ATOM   4190 O  OE1 . GLN C 3  39  ? -36.665 4.765   23.963  1.00 33.94  ? 39  GLN H OE1 1 
ATOM   4191 N  NE2 . GLN C 3  39  ? -36.424 6.701   22.856  1.00 21.39  ? 39  GLN H NE2 1 
ATOM   4192 N  N   . ALA C 3  40  ? -32.993 3.288   19.432  1.00 24.64  ? 40  ALA H N   1 
ATOM   4193 C  CA  . ALA C 3  40  ? -31.549 3.525   19.366  1.00 28.53  ? 40  ALA H CA  1 
ATOM   4194 C  C   . ALA C 3  40  ? -31.219 4.774   20.211  1.00 27.93  ? 40  ALA H C   1 
ATOM   4195 O  O   . ALA C 3  40  ? -32.083 5.642   20.415  1.00 25.37  ? 40  ALA H O   1 
ATOM   4196 C  CB  . ALA C 3  40  ? -31.109 3.731   17.874  1.00 24.82  ? 40  ALA H CB  1 
ATOM   4197 N  N   . PRO C 3  41  ? -30.012 4.848   20.763  1.00 29.69  ? 41  PRO H N   1 
ATOM   4198 C  CA  . PRO C 3  41  ? -29.721 6.065   21.549  1.00 35.54  ? 41  PRO H CA  1 
ATOM   4199 C  C   . PRO C 3  41  ? -29.490 7.237   20.587  1.00 35.96  ? 41  PRO H C   1 
ATOM   4200 O  O   . PRO C 3  41  ? -28.978 6.976   19.494  1.00 38.89  ? 41  PRO H O   1 
ATOM   4201 C  CB  . PRO C 3  41  ? -28.382 5.712   22.216  1.00 38.08  ? 41  PRO H CB  1 
ATOM   4202 C  CG  . PRO C 3  41  ? -27.712 4.752   21.217  1.00 34.92  ? 41  PRO H CG  1 
ATOM   4203 C  CD  . PRO C 3  41  ? -28.843 3.951   20.640  1.00 30.33  ? 41  PRO H CD  1 
ATOM   4204 N  N   . GLY C 3  42  ? -29.850 8.485   20.878  1.00 39.73  ? 42  GLY H N   1 
ATOM   4205 C  CA  . GLY C 3  42  ? -30.914 8.921   21.739  1.00 40.27  ? 42  GLY H CA  1 
ATOM   4206 C  C   . GLY C 3  42  ? -31.865 9.368   20.627  1.00 41.49  ? 42  GLY H C   1 
ATOM   4207 O  O   . GLY C 3  42  ? -31.822 10.515  20.189  1.00 38.84  ? 42  GLY H O   1 
ATOM   4208 N  N   . GLN C 3  43  ? -32.629 8.395   20.109  1.00 37.65  ? 43  GLN H N   1 
ATOM   4209 C  CA  . GLN C 3  43  ? -33.533 8.559   18.976  1.00 34.36  ? 43  GLN H CA  1 
ATOM   4210 C  C   . GLN C 3  43  ? -34.905 8.183   19.457  1.00 29.56  ? 43  GLN H C   1 
ATOM   4211 O  O   . GLN C 3  43  ? -35.053 7.675   20.555  1.00 28.87  ? 43  GLN H O   1 
ATOM   4212 C  CB  . GLN C 3  43  ? -33.158 7.600   17.853  1.00 36.91  ? 43  GLN H CB  1 
ATOM   4213 C  CG  . GLN C 3  43  ? -31.700 7.643   17.403  1.00 44.79  ? 43  GLN H CG  1 
ATOM   4214 C  CD  . GLN C 3  43  ? -31.548 8.146   15.979  1.00 55.32  ? 43  GLN H CD  1 
ATOM   4215 O  OE1 . GLN C 3  43  ? -31.716 7.389   15.015  1.00 61.05  ? 43  GLN H OE1 1 
ATOM   4216 N  NE2 . GLN C 3  43  ? -31.233 9.431   15.839  1.00 54.95  ? 43  GLN H NE2 1 
ATOM   4217 N  N   . GLY C 3  44  ? -35.920 8.400   18.638  1.00 30.66  ? 44  GLY H N   1 
ATOM   4218 C  CA  . GLY C 3  44  ? -37.275 8.011   19.011  1.00 29.17  ? 44  GLY H CA  1 
ATOM   4219 C  C   . GLY C 3  44  ? -37.542 6.520   18.866  1.00 29.60  ? 44  GLY H C   1 
ATOM   4220 O  O   . GLY C 3  44  ? -36.775 5.810   18.242  1.00 28.07  ? 44  GLY H O   1 
ATOM   4221 N  N   . PRO C 3  45  ? -38.655 6.032   19.438  1.00 28.24  ? 45  PRO H N   1 
ATOM   4222 C  CA  . PRO C 3  45  ? -38.965 4.648   19.244  1.00 29.31  ? 45  PRO H CA  1 
ATOM   4223 C  C   . PRO C 3  45  ? -39.377 4.333   17.798  1.00 28.52  ? 45  PRO H C   1 
ATOM   4224 O  O   . PRO C 3  45  ? -39.873 5.202   17.107  1.00 24.81  ? 45  PRO H O   1 
ATOM   4225 C  CB  . PRO C 3  45  ? -40.148 4.414   20.195  1.00 31.16  ? 45  PRO H CB  1 
ATOM   4226 C  CG  . PRO C 3  45  ? -40.396 5.753   20.904  1.00 34.17  ? 45  PRO H CG  1 
ATOM   4227 C  CD  . PRO C 3  45  ? -39.776 6.767   20.034  1.00 25.96  ? 45  PRO H CD  1 
ATOM   4228 N  N   . GLU C 3  46  ? -39.184 3.080   17.375  1.00 26.74  ? 46  GLU H N   1 
ATOM   4229 C  CA  . GLU C 3  46  ? -39.592 2.621   16.063  1.00 27.50  ? 46  GLU H CA  1 
ATOM   4230 C  C   . GLU C 3  46  ? -40.264 1.302   16.250  1.00 23.89  ? 46  GLU H C   1 
ATOM   4231 O  O   . GLU C 3  46  ? -39.674 0.340   16.824  1.00 24.67  ? 46  GLU H O   1 
ATOM   4232 C  CB  . GLU C 3  46  ? -38.408 2.299   15.143  1.00 27.12  ? 46  GLU H CB  1 
ATOM   4233 C  CG  . GLU C 3  46  ? -37.634 3.403   14.594  1.00 39.26  ? 46  GLU H CG  1 
ATOM   4234 C  CD  . GLU C 3  46  ? -36.455 2.856   13.797  1.00 42.22  ? 46  GLU H CD  1 
ATOM   4235 O  OE1 . GLU C 3  46  ? -35.420 2.466   14.415  1.00 42.13  ? 46  GLU H OE1 1 
ATOM   4236 O  OE2 . GLU C 3  46  ? -36.606 2.791   12.571  1.00 45.68  ? 46  GLU H OE2 1 
ATOM   4237 N  N   . TRP C 3  47  ? -41.464 1.224   15.731  1.00 24.62  ? 47  TRP H N   1 
ATOM   4238 C  CA  . TRP C 3  47  ? -42.247 0.010   15.813  1.00 24.85  ? 47  TRP H CA  1 
ATOM   4239 C  C   . TRP C 3  47  ? -41.656 -0.979  14.820  1.00 26.88  ? 47  TRP H C   1 
ATOM   4240 O  O   . TRP C 3  47  ? -41.489 -0.655  13.648  1.00 27.10  ? 47  TRP H O   1 
ATOM   4241 C  CB  . TRP C 3  47  ? -43.666 0.324   15.419  1.00 23.95  ? 47  TRP H CB  1 
ATOM   4242 C  CG  . TRP C 3  47  ? -44.595 -0.844  15.479  1.00 23.88  ? 47  TRP H CG  1 
ATOM   4243 C  CD1 . TRP C 3  47  ? -45.121 -1.441  16.602  1.00 26.63  ? 47  TRP H CD1 1 
ATOM   4244 C  CD2 . TRP C 3  47  ? -45.096 -1.558  14.373  1.00 23.77  ? 47  TRP H CD2 1 
ATOM   4245 N  NE1 . TRP C 3  47  ? -45.931 -2.498  16.235  1.00 29.30  ? 47  TRP H NE1 1 
ATOM   4246 C  CE2 . TRP C 3  47  ? -45.984 -2.538  14.870  1.00 23.58  ? 47  TRP H CE2 1 
ATOM   4247 C  CE3 . TRP C 3  47  ? -44.940 -1.423  12.980  1.00 29.38  ? 47  TRP H CE3 1 
ATOM   4248 C  CZ2 . TRP C 3  47  ? -46.660 -3.418  14.037  1.00 26.81  ? 47  TRP H CZ2 1 
ATOM   4249 C  CZ3 . TRP C 3  47  ? -45.668 -2.278  12.157  1.00 24.29  ? 47  TRP H CZ3 1 
ATOM   4250 C  CH2 . TRP C 3  47  ? -46.476 -3.279  12.695  1.00 26.21  ? 47  TRP H CH2 1 
ATOM   4251 N  N   . MET C 3  48  ? -41.339 -2.174  15.306  1.00 30.01  ? 48  MET H N   1 
ATOM   4252 C  CA  . MET C 3  48  ? -40.787 -3.217  14.460  1.00 29.78  ? 48  MET H CA  1 
ATOM   4253 C  C   . MET C 3  48  ? -41.855 -4.137  13.851  1.00 26.59  ? 48  MET H C   1 
ATOM   4254 O  O   . MET C 3  48  ? -41.756 -4.497  12.708  1.00 26.89  ? 48  MET H O   1 
ATOM   4255 C  CB  . MET C 3  48  ? -39.790 -4.017  15.258  1.00 25.33  ? 48  MET H CB  1 
ATOM   4256 C  CG  . MET C 3  48  ? -38.567 -3.177  15.580  1.00 33.06  ? 48  MET H CG  1 
ATOM   4257 S  SD  . MET C 3  48  ? -37.555 -4.197  16.550  1.00 34.02  ? 48  MET H SD  1 
ATOM   4258 C  CE  . MET C 3  48  ? -36.755 -5.149  15.213  1.00 17.19  ? 48  MET H CE  1 
ATOM   4259 N  N   . GLY C 3  49  ? -42.814 -4.567  14.665  1.00 30.20  ? 49  GLY H N   1 
ATOM   4260 C  CA  . GLY C 3  49  ? -43.916 -5.435  14.241  1.00 26.72  ? 49  GLY H CA  1 
ATOM   4261 C  C   . GLY C 3  49  ? -44.661 -6.011  15.435  1.00 26.81  ? 49  GLY H C   1 
ATOM   4262 O  O   . GLY C 3  49  ? -44.283 -5.788  16.600  1.00 27.93  ? 49  GLY H O   1 
ATOM   4263 N  N   . GLY C 3  50  ? -45.710 -6.782  15.168  1.00 27.22  ? 50  GLY H N   1 
ATOM   4264 C  CA  . GLY C 3  50  ? -46.472 -7.374  16.254  1.00 26.36  ? 50  GLY H CA  1 
ATOM   4265 C  C   . GLY C 3  50  ? -47.185 -8.612  15.749  1.00 30.63  ? 50  GLY H C   1 
ATOM   4266 O  O   . GLY C 3  50  ? -47.204 -8.870  14.551  1.00 24.95  ? 50  GLY H O   1 
ATOM   4267 N  N   . ILE C 3  51  ? -47.792 -9.335  16.690  1.00 28.48  ? 51  ILE H N   1 
ATOM   4268 C  CA  . ILE C 3  51  ? -48.436 -10.592 16.440  1.00 30.72  ? 51  ILE H CA  1 
ATOM   4269 C  C   . ILE C 3  51  ? -49.793 -10.667 17.192  1.00 29.58  ? 51  ILE H C   1 
ATOM   4270 O  O   . ILE C 3  51  ? -49.934 -10.209 18.328  1.00 29.82  ? 51  ILE H O   1 
ATOM   4271 C  CB  . ILE C 3  51  ? -47.521 -11.773 16.858  1.00 30.15  ? 51  ILE H CB  1 
ATOM   4272 C  CG1 . ILE C 3  51  ? -48.147 -13.104 16.433  1.00 30.76  ? 51  ILE H CG1 1 
ATOM   4273 C  CG2 . ILE C 3  51  ? -47.230 -11.789 18.387  1.00 26.60  ? 51  ILE H CG2 1 
ATOM   4274 C  CD1 . ILE C 3  51  ? -47.202 -14.262 16.603  1.00 21.54  ? 51  ILE H CD1 1 
ATOM   4275 N  N   . ILE C 3  52  ? -50.778 -11.233 16.524  1.00 29.02  ? 52  ILE H N   1 
ATOM   4276 C  CA  . ILE C 3  52  ? -52.190 -11.237 16.946  1.00 29.94  ? 52  ILE H CA  1 
ATOM   4277 C  C   . ILE C 3  52  ? -52.440 -12.568 17.651  1.00 24.34  ? 52  ILE H C   1 
ATOM   4278 O  O   . ILE C 3  52  ? -51.998 -13.574 17.180  1.00 25.89  ? 52  ILE H O   1 
ATOM   4279 C  CB  . ILE C 3  52  ? -53.093 -11.177 15.667  1.00 32.02  ? 52  ILE H CB  1 
ATOM   4280 C  CG1 . ILE C 3  52  ? -52.890 -9.863  14.948  1.00 45.44  ? 52  ILE H CG1 1 
ATOM   4281 C  CG2 . ILE C 3  52  ? -54.519 -11.311 15.966  1.00 35.64  ? 52  ILE H CG2 1 
ATOM   4282 C  CD1 . ILE C 3  52  ? -52.336 -8.894  15.795  1.00 38.30  ? 52  ILE H CD1 1 
ATOM   4283 N  N   . PRO C 3  53  A -53.199 -12.593 18.759  1.00 24.81  ? 52  PRO H N   1 
ATOM   4284 C  CA  . PRO C 3  53  A -53.410 -13.892 19.402  1.00 23.38  ? 52  PRO H CA  1 
ATOM   4285 C  C   . PRO C 3  53  A -54.416 -14.727 18.585  1.00 23.56  ? 52  PRO H C   1 
ATOM   4286 O  O   . PRO C 3  53  A -55.132 -14.199 17.755  1.00 26.85  ? 52  PRO H O   1 
ATOM   4287 C  CB  . PRO C 3  53  A -53.943 -13.500 20.745  1.00 23.65  ? 52  PRO H CB  1 
ATOM   4288 C  CG  . PRO C 3  53  A -54.765 -12.261 20.415  1.00 25.95  ? 52  PRO H CG  1 
ATOM   4289 C  CD  . PRO C 3  53  A -53.847 -11.514 19.519  1.00 26.98  ? 52  PRO H CD  1 
ATOM   4290 N  N   . ILE C 3  54  ? -54.329 -16.032 18.758  1.00 26.93  ? 53  ILE H N   1 
ATOM   4291 C  CA  . ILE C 3  54  ? -55.075 -17.060 18.076  1.00 24.81  ? 53  ILE H CA  1 
ATOM   4292 C  C   . ILE C 3  54  ? -54.774 -17.132 16.634  1.00 23.03  ? 53  ILE H C   1 
ATOM   4293 O  O   . ILE C 3  54  ? -54.485 -18.196 16.130  1.00 27.24  ? 53  ILE H O   1 
ATOM   4294 C  CB  . ILE C 3  54  ? -56.620 -16.929 18.235  1.00 28.03  ? 53  ILE H CB  1 
ATOM   4295 C  CG1 . ILE C 3  54  ? -56.995 -16.904 19.712  1.00 32.55  ? 53  ILE H CG1 1 
ATOM   4296 C  CG2 . ILE C 3  54  ? -57.320 -18.142 17.586  1.00 30.11  ? 53  ILE H CG2 1 
ATOM   4297 C  CD1 . ILE C 3  54  ? -56.924 -18.229 20.371  1.00 38.05  ? 53  ILE H CD1 1 
ATOM   4298 N  N   . PHE C 3  55  ? -55.000 -16.051 15.914  1.00 24.07  ? 54  PHE H N   1 
ATOM   4299 C  CA  . PHE C 3  55  ? -54.706 -16.064 14.490  1.00 24.19  ? 54  PHE H CA  1 
ATOM   4300 C  C   . PHE C 3  55  ? -53.221 -16.293 14.201  1.00 26.43  ? 54  PHE H C   1 
ATOM   4301 O  O   . PHE C 3  55  ? -52.893 -16.898 13.199  1.00 24.03  ? 54  PHE H O   1 
ATOM   4302 C  CB  . PHE C 3  55  ? -55.216 -14.788 13.799  1.00 25.91  ? 54  PHE H CB  1 
ATOM   4303 C  CG  . PHE C 3  55  ? -56.700 -14.731 13.737  1.00 20.13  ? 54  PHE H CG  1 
ATOM   4304 C  CD1 . PHE C 3  55  ? -57.402 -14.171 14.766  1.00 28.62  ? 54  PHE H CD1 1 
ATOM   4305 C  CD2 . PHE C 3  55  ? -57.392 -15.225 12.652  1.00 18.17  ? 54  PHE H CD2 1 
ATOM   4306 C  CE1 . PHE C 3  55  ? -58.763 -14.176 14.746  1.00 25.93  ? 54  PHE H CE1 1 
ATOM   4307 C  CE2 . PHE C 3  55  ? -58.751 -15.202 12.610  1.00 20.36  ? 54  PHE H CE2 1 
ATOM   4308 C  CZ  . PHE C 3  55  ? -59.437 -14.699 13.675  1.00 21.69  ? 54  PHE H CZ  1 
ATOM   4309 N  N   . GLY C 3  56  ? -52.337 -15.816 15.073  1.00 29.63  ? 55  GLY H N   1 
ATOM   4310 C  CA  . GLY C 3  56  ? -50.899 -15.858 14.806  1.00 29.34  ? 55  GLY H CA  1 
ATOM   4311 C  C   . GLY C 3  56  ? -50.363 -14.986 13.703  1.00 27.73  ? 55  GLY H C   1 
ATOM   4312 O  O   . GLY C 3  56  ? -49.190 -15.098 13.383  1.00 27.39  ? 55  GLY H O   1 
ATOM   4313 N  N   . THR C 3  57  ? -51.211 -14.148 13.089  1.00 29.10  ? 56  THR H N   1 
ATOM   4314 C  CA  . THR C 3  57  ? -50.797 -13.248 12.016  1.00 28.63  ? 56  THR H CA  1 
ATOM   4315 C  C   . THR C 3  57  ? -49.776 -12.220 12.507  1.00 27.32  ? 56  THR H C   1 
ATOM   4316 O  O   . THR C 3  57  ? -49.928 -11.689 13.584  1.00 28.25  ? 56  THR H O   1 
ATOM   4317 C  CB  . THR C 3  57  ? -51.979 -12.389 11.507  1.00 27.29  ? 56  THR H CB  1 
ATOM   4318 O  OG1 . THR C 3  57  ? -53.088 -13.203 11.206  1.00 41.92  ? 56  THR H OG1 1 
ATOM   4319 C  CG2 . THR C 3  57  ? -51.557 -11.665 10.195  1.00 36.64  ? 56  THR H CG2 1 
ATOM   4320 N  N   . THR C 3  58  ? -48.826 -11.883 11.662  1.00 25.06  ? 57  THR H N   1 
ATOM   4321 C  CA  . THR C 3  58  ? -47.835 -10.880 11.990  1.00 30.11  ? 57  THR H CA  1 
ATOM   4322 C  C   . THR C 3  58  ? -47.927 -9.714  11.038  1.00 30.13  ? 57  THR H C   1 
ATOM   4323 O  O   . THR C 3  58  ? -48.432 -9.843  9.945   1.00 26.89  ? 57  THR H O   1 
ATOM   4324 C  CB  . THR C 3  58  ? -46.418 -11.482 12.010  1.00 27.96  ? 57  THR H CB  1 
ATOM   4325 O  OG1 . THR C 3  58  ? -46.166 -12.157 10.787  1.00 30.91  ? 57  THR H OG1 1 
ATOM   4326 C  CG2 . THR C 3  58  ? -46.297 -12.458 13.159  1.00 24.80  ? 57  THR H CG2 1 
ATOM   4327 N  N   . LYS C 3  59  ? -47.499 -8.552  11.496  1.00 28.88  ? 58  LYS H N   1 
ATOM   4328 C  CA  . LYS C 3  59  ? -47.360 -7.390  10.643  1.00 26.28  ? 58  LYS H CA  1 
ATOM   4329 C  C   . LYS C 3  59  ? -46.016 -6.817  10.958  1.00 26.70  ? 58  LYS H C   1 
ATOM   4330 O  O   . LYS C 3  59  ? -45.674 -6.713  12.122  1.00 28.41  ? 58  LYS H O   1 
ATOM   4331 C  CB  . LYS C 3  59  ? -48.404 -6.358  11.009  1.00 31.35  ? 58  LYS H CB  1 
ATOM   4332 C  CG  . LYS C 3  59  ? -49.800 -6.737  10.560  1.00 41.30  ? 58  LYS H CG  1 
ATOM   4333 C  CD  . LYS C 3  59  ? -50.677 -5.495  10.444  1.00 54.38  ? 58  LYS H CD  1 
ATOM   4334 C  CE  . LYS C 3  59  ? -52.129 -5.782  10.859  1.00 57.36  ? 58  LYS H CE  1 
ATOM   4335 N  NZ  . LYS C 3  59  ? -52.841 -6.658  9.898   1.00 45.29  ? 58  LYS H NZ  1 
ATOM   4336 N  N   . TYR C 3  60  ? -45.249 -6.438  9.933   1.00 29.06  ? 59  TYR H N   1 
ATOM   4337 C  CA  . TYR C 3  60  ? -43.946 -5.880  10.143  1.00 27.23  ? 59  TYR H CA  1 
ATOM   4338 C  C   . TYR C 3  60  ? -43.817 -4.524  9.527   1.00 28.39  ? 59  TYR H C   1 
ATOM   4339 O  O   . TYR C 3  60  ? -44.426 -4.259  8.492   1.00 26.36  ? 59  TYR H O   1 
ATOM   4340 C  CB  . TYR C 3  60  ? -42.885 -6.798  9.573   1.00 24.60  ? 59  TYR H CB  1 
ATOM   4341 C  CG  . TYR C 3  60  ? -42.905 -8.173  10.148  1.00 26.11  ? 59  TYR H CG  1 
ATOM   4342 C  CD1 . TYR C 3  60  ? -42.641 -8.386  11.501  1.00 24.51  ? 59  TYR H CD1 1 
ATOM   4343 C  CD2 . TYR C 3  60  ? -43.120 -9.279  9.340   1.00 27.30  ? 59  TYR H CD2 1 
ATOM   4344 C  CE1 . TYR C 3  60  ? -42.655 -9.668  12.037  1.00 27.76  ? 59  TYR H CE1 1 
ATOM   4345 C  CE2 . TYR C 3  60  ? -43.127 -10.573 9.867   1.00 33.11  ? 59  TYR H CE2 1 
ATOM   4346 C  CZ  . TYR C 3  60  ? -42.878 -10.753 11.223  1.00 27.01  ? 59  TYR H CZ  1 
ATOM   4347 O  OH  . TYR C 3  60  ? -42.850 -12.028 11.752  1.00 27.62  ? 59  TYR H OH  1 
ATOM   4348 N  N   . ALA C 3  61  ? -42.985 -3.672  10.145  1.00 27.83  ? 60  ALA H N   1 
ATOM   4349 C  CA  . ALA C 3  61  ? -42.638 -2.375  9.569   1.00 27.84  ? 60  ALA H CA  1 
ATOM   4350 C  C   . ALA C 3  61  ? -41.814 -2.571  8.305   1.00 27.03  ? 60  ALA H C   1 
ATOM   4351 O  O   . ALA C 3  61  ? -40.989 -3.452  8.261   1.00 26.07  ? 60  ALA H O   1 
ATOM   4352 C  CB  . ALA C 3  61  ? -41.822 -1.538  10.612  1.00 30.20  ? 60  ALA H CB  1 
ATOM   4353 N  N   . PRO C 3  62  ? -42.003 -1.733  7.280   1.00 26.49  ? 61  PRO H N   1 
ATOM   4354 C  CA  . PRO C 3  62  ? -41.226 -1.869  6.047   1.00 29.73  ? 61  PRO H CA  1 
ATOM   4355 C  C   . PRO C 3  62  ? -39.715 -1.894  6.258   1.00 32.34  ? 61  PRO H C   1 
ATOM   4356 O  O   . PRO C 3  62  ? -38.991 -2.603  5.571   1.00 29.74  ? 61  PRO H O   1 
ATOM   4357 C  CB  . PRO C 3  62  ? -41.570 -0.587  5.269   1.00 32.16  ? 61  PRO H CB  1 
ATOM   4358 C  CG  . PRO C 3  62  ? -42.818 -0.113  5.809   1.00 35.11  ? 61  PRO H CG  1 
ATOM   4359 C  CD  . PRO C 3  62  ? -42.992 -0.659  7.194   1.00 26.48  ? 61  PRO H CD  1 
ATOM   4360 N  N   . LYS C 3  63  ? -39.249 -1.113  7.214   1.00 32.12  ? 62  LYS H N   1 
ATOM   4361 C  CA  . LYS C 3  63  ? -37.848 -1.049  7.510   1.00 33.86  ? 62  LYS H CA  1 
ATOM   4362 C  C   . LYS C 3  63  ? -37.276 -2.403  8.008   1.00 32.83  ? 62  LYS H C   1 
ATOM   4363 O  O   . LYS C 3  63  ? -36.087 -2.633  7.911   1.00 29.85  ? 62  LYS H O   1 
ATOM   4364 C  CB  . LYS C 3  63  ? -37.607 0.081   8.539   1.00 36.15  ? 62  LYS H CB  1 
ATOM   4365 C  CG  . LYS C 3  63  ? -36.162 0.257   8.972   1.00 41.09  ? 62  LYS H CG  1 
ATOM   4366 C  CD  . LYS C 3  63  ? -35.940 1.648   9.541   1.00 47.59  ? 62  LYS H CD  1 
ATOM   4367 C  CE  . LYS C 3  63  ? -34.619 1.726   10.312  1.00 45.13  ? 62  LYS H CE  1 
ATOM   4368 N  NZ  . LYS C 3  63  ? -34.576 2.985   11.112  1.00 42.88  ? 62  LYS H NZ  1 
ATOM   4369 N  N   . PHE C 3  64  ? -38.108 -3.294  8.535   1.00 32.13  ? 63  PHE H N   1 
ATOM   4370 C  CA  . PHE C 3  64  ? -37.606 -4.561  9.095   1.00 29.04  ? 63  PHE H CA  1 
ATOM   4371 C  C   . PHE C 3  64  ? -38.102 -5.802  8.369   1.00 29.61  ? 63  PHE H C   1 
ATOM   4372 O  O   . PHE C 3  64  ? -37.566 -6.911  8.563   1.00 31.07  ? 63  PHE H O   1 
ATOM   4373 C  CB  . PHE C 3  64  ? -37.969 -4.626  10.569  1.00 30.02  ? 63  PHE H CB  1 
ATOM   4374 C  CG  . PHE C 3  64  ? -37.416 -3.473  11.353  1.00 27.00  ? 63  PHE H CG  1 
ATOM   4375 C  CD1 . PHE C 3  64  ? -36.064 -3.365  11.574  1.00 31.77  ? 63  PHE H CD1 1 
ATOM   4376 C  CD2 . PHE C 3  64  ? -38.225 -2.471  11.765  1.00 21.89  ? 63  PHE H CD2 1 
ATOM   4377 C  CE1 . PHE C 3  64  ? -35.550 -2.282  12.237  1.00 31.97  ? 63  PHE H CE1 1 
ATOM   4378 C  CE2 . PHE C 3  64  ? -37.708 -1.382  12.436  1.00 33.79  ? 63  PHE H CE2 1 
ATOM   4379 C  CZ  . PHE C 3  64  ? -36.372 -1.309  12.676  1.00 26.38  ? 63  PHE H CZ  1 
ATOM   4380 N  N   . GLN C 3  65  ? -39.095 -5.613  7.516   1.00 29.79  ? 64  GLN H N   1 
ATOM   4381 C  CA  . GLN C 3  65  ? -39.696 -6.709  6.753   1.00 31.16  ? 64  GLN H CA  1 
ATOM   4382 C  C   . GLN C 3  65  ? -38.635 -7.426  5.980   1.00 28.02  ? 64  GLN H C   1 
ATOM   4383 O  O   . GLN C 3  65  ? -37.861 -6.816  5.286   1.00 28.62  ? 64  GLN H O   1 
ATOM   4384 C  CB  . GLN C 3  65  ? -40.734 -6.178  5.780   1.00 31.08  ? 64  GLN H CB  1 
ATOM   4385 C  CG  . GLN C 3  65  ? -41.330 -7.227  4.870   1.00 43.82  ? 64  GLN H CG  1 
ATOM   4386 C  CD  . GLN C 3  65  ? -42.419 -8.011  5.592   1.00 52.73  ? 64  GLN H CD  1 
ATOM   4387 O  OE1 . GLN C 3  65  ? -43.379 -7.413  6.092   1.00 49.99  ? 64  GLN H OE1 1 
ATOM   4388 N  NE2 . GLN C 3  65  ? -42.288 -9.350  5.633   1.00 53.43  ? 64  GLN H NE2 1 
ATOM   4389 N  N   . GLY C 3  66  ? -38.627 -8.742  6.066   1.00 29.84  ? 65  GLY H N   1 
ATOM   4390 C  CA  . GLY C 3  66  ? -37.606 -9.535  5.398   1.00 26.64  ? 65  GLY H CA  1 
ATOM   4391 C  C   . GLY C 3  66  ? -36.540 -9.932  6.413   1.00 31.67  ? 65  GLY H C   1 
ATOM   4392 O  O   . GLY C 3  66  ? -35.864 -10.923 6.228   1.00 31.51  ? 65  GLY H O   1 
ATOM   4393 N  N   . ARG C 3  67  ? -36.362 -9.202  7.512   1.00 32.37  ? 66  ARG H N   1 
ATOM   4394 C  CA  . ARG C 3  67  ? -35.358 -9.698  8.456   1.00 33.88  ? 66  ARG H CA  1 
ATOM   4395 C  C   . ARG C 3  67  ? -35.759 -9.791  9.894   1.00 32.28  ? 66  ARG H C   1 
ATOM   4396 O  O   . ARG C 3  67  ? -34.932 -10.176 10.692  1.00 30.69  ? 66  ARG H O   1 
ATOM   4397 C  CB  . ARG C 3  67  ? -33.999 -9.003  8.298   1.00 40.11  ? 66  ARG H CB  1 
ATOM   4398 C  CG  . ARG C 3  67  ? -33.956 -7.629  8.587   1.00 37.18  ? 66  ARG H CG  1 
ATOM   4399 C  CD  . ARG C 3  67  ? -32.524 -7.060  8.382   1.00 33.76  ? 66  ARG H CD  1 
ATOM   4400 N  NE  . ARG C 3  67  ? -32.558 -5.706  8.923   1.00 21.09  ? 66  ARG H NE  1 
ATOM   4401 C  CZ  . ARG C 3  67  ? -31.959 -5.296  10.025  1.00 28.18  ? 66  ARG H CZ  1 
ATOM   4402 N  NH1 . ARG C 3  67  ? -31.166 -6.101  10.703  1.00 28.05  ? 66  ARG H NH1 1 
ATOM   4403 N  NH2 . ARG C 3  67  ? -32.108 -4.035  10.404  1.00 27.58  ? 66  ARG H NH2 1 
ATOM   4404 N  N   . VAL C 3  68  ? -37.037 -9.547  10.208  1.00 31.09  ? 67  VAL H N   1 
ATOM   4405 C  CA  . VAL C 3  68  ? -37.536 -9.742  11.559  1.00 29.63  ? 67  VAL H CA  1 
ATOM   4406 C  C   . VAL C 3  68  ? -38.551 -10.881 11.484  1.00 28.80  ? 67  VAL H C   1 
ATOM   4407 O  O   . VAL C 3  68  ? -39.303 -10.991 10.525  1.00 27.88  ? 67  VAL H O   1 
ATOM   4408 C  CB  . VAL C 3  68  ? -38.113 -8.456  12.155  1.00 30.38  ? 67  VAL H CB  1 
ATOM   4409 C  CG1 . VAL C 3  68  ? -39.306 -7.950  11.363  1.00 33.64  ? 67  VAL H CG1 1 
ATOM   4410 C  CG2 . VAL C 3  68  ? -38.525 -8.685  13.594  1.00 27.94  ? 67  VAL H CG2 1 
ATOM   4411 N  N   . THR C 3  69  ? -38.514 -11.776 12.462  1.00 27.72  ? 68  THR H N   1 
ATOM   4412 C  CA  . THR C 3  69  ? -39.548 -12.762 12.640  1.00 28.31  ? 68  THR H CA  1 
ATOM   4413 C  C   . THR C 3  69  ? -40.068 -12.686 14.070  1.00 29.66  ? 68  THR H C   1 
ATOM   4414 O  O   . THR C 3  69  ? -39.297 -12.798 15.029  1.00 28.72  ? 68  THR H O   1 
ATOM   4415 C  CB  . THR C 3  69  ? -39.036 -14.175 12.373  1.00 28.35  ? 68  THR H CB  1 
ATOM   4416 O  OG1 . THR C 3  69  ? -38.435 -14.201 11.084  1.00 36.76  ? 68  THR H OG1 1 
ATOM   4417 C  CG2 . THR C 3  69  ? -40.205 -15.178 12.350  1.00 26.78  ? 68  THR H CG2 1 
ATOM   4418 N  N   . ILE C 3  70  ? -41.383 -12.518 14.210  1.00 26.87  ? 69  ILE H N   1 
ATOM   4419 C  CA  . ILE C 3  70  ? -42.018 -12.530 15.486  1.00 23.80  ? 69  ILE H CA  1 
ATOM   4420 C  C   . ILE C 3  70  ? -42.829 -13.831 15.589  1.00 28.75  ? 69  ILE H C   1 
ATOM   4421 O  O   . ILE C 3  70  ? -43.562 -14.176 14.653  1.00 27.45  ? 69  ILE H O   1 
ATOM   4422 C  CB  . ILE C 3  70  ? -42.890 -11.284 15.697  1.00 27.02  ? 69  ILE H CB  1 
ATOM   4423 C  CG1 . ILE C 3  70  ? -42.030 -10.044 15.769  1.00 21.52  ? 69  ILE H CG1 1 
ATOM   4424 C  CG2 . ILE C 3  70  ? -43.830 -11.440 17.020  1.00 20.24  ? 69  ILE H CG2 1 
ATOM   4425 C  CD1 . ILE C 3  70  ? -42.814 -8.668  15.658  1.00 22.97  ? 69  ILE H CD1 1 
ATOM   4426 N  N   . THR C 3  71  ? -42.648 -14.556 16.700  1.00 28.13  ? 70  THR H N   1 
ATOM   4427 C  CA  . THR C 3  71  ? -43.318 -15.818 16.957  1.00 29.27  ? 70  THR H CA  1 
ATOM   4428 C  C   . THR C 3  71  ? -43.927 -15.872 18.391  1.00 30.43  ? 70  THR H C   1 
ATOM   4429 O  O   . THR C 3  71  ? -43.627 -15.068 19.245  1.00 28.60  ? 70  THR H O   1 
ATOM   4430 C  CB  . THR C 3  71  ? -42.389 -17.031 16.794  1.00 30.59  ? 70  THR H CB  1 
ATOM   4431 O  OG1 . THR C 3  71  ? -41.208 -16.804 17.558  1.00 27.46  ? 70  THR H OG1 1 
ATOM   4432 C  CG2 . THR C 3  71  ? -42.041 -17.293 15.296  1.00 25.74  ? 70  THR H CG2 1 
ATOM   4433 N  N   . ALA C 3  72  ? -44.808 -16.825 18.649  1.00 27.92  ? 71  ALA H N   1 
ATOM   4434 C  CA  . ALA C 3  72  ? -45.432 -16.909 19.978  1.00 32.15  ? 71  ALA H CA  1 
ATOM   4435 C  C   . ALA C 3  72  ? -45.426 -18.368 20.407  1.00 32.34  ? 71  ALA H C   1 
ATOM   4436 O  O   . ALA C 3  72  ? -45.631 -19.240 19.583  1.00 35.40  ? 71  ALA H O   1 
ATOM   4437 C  CB  . ALA C 3  72  ? -46.859 -16.365 19.941  1.00 30.54  ? 71  ALA H CB  1 
ATOM   4438 N  N   . ASP C 3  73  ? -45.161 -18.626 21.680  1.00 31.17  ? 72  ASP H N   1 
ATOM   4439 C  CA  . ASP C 3  73  ? -45.396 -19.936 22.264  1.00 29.98  ? 72  ASP H CA  1 
ATOM   4440 C  C   . ASP C 3  73  ? -46.526 -19.722 23.268  1.00 27.33  ? 72  ASP H C   1 
ATOM   4441 O  O   . ASP C 3  73  ? -46.303 -19.235 24.362  1.00 26.28  ? 72  ASP H O   1 
ATOM   4442 C  CB  . ASP C 3  73  ? -44.132 -20.446 22.946  1.00 26.78  ? 72  ASP H CB  1 
ATOM   4443 C  CG  . ASP C 3  73  ? -44.340 -21.805 23.641  1.00 34.10  ? 72  ASP H CG  1 
ATOM   4444 O  OD1 . ASP C 3  73  ? -45.489 -22.182 23.988  1.00 33.58  ? 72  ASP H OD1 1 
ATOM   4445 O  OD2 . ASP C 3  73  ? -43.353 -22.508 23.863  1.00 31.04  ? 72  ASP H OD2 1 
ATOM   4446 N  N   . ASP C 3  74  ? -47.761 -20.033 22.913  1.00 28.50  ? 73  ASP H N   1 
ATOM   4447 C  CA  . ASP C 3  74  ? -48.854 -19.533 23.767  1.00 30.05  ? 73  ASP H CA  1 
ATOM   4448 C  C   . ASP C 3  74  ? -48.936 -20.271 25.112  1.00 27.14  ? 73  ASP H C   1 
ATOM   4449 O  O   . ASP C 3  74  ? -49.291 -19.657 26.093  1.00 28.29  ? 73  ASP H O   1 
ATOM   4450 C  CB  . ASP C 3  74  ? -50.205 -19.551 23.040  1.00 34.85  ? 73  ASP H CB  1 
ATOM   4451 C  CG  . ASP C 3  74  ? -50.256 -18.538 21.883  1.00 46.42  ? 73  ASP H CG  1 
ATOM   4452 O  OD1 . ASP C 3  74  ? -50.350 -18.997 20.710  1.00 60.38  ? 73  ASP H OD1 1 
ATOM   4453 O  OD2 . ASP C 3  74  ? -50.119 -17.313 22.159  1.00 49.16  ? 73  ASP H OD2 1 
ATOM   4454 N  N   . PHE C 3  75  ? -48.592 -21.555 25.163  1.00 26.00  ? 74  PHE H N   1 
ATOM   4455 C  CA  . PHE C 3  75  ? -48.617 -22.276 26.444  1.00 27.18  ? 74  PHE H CA  1 
ATOM   4456 C  C   . PHE C 3  75  ? -47.536 -21.780 27.417  1.00 26.82  ? 74  PHE H C   1 
ATOM   4457 O  O   . PHE C 3  75  ? -47.679 -21.907 28.612  1.00 26.69  ? 74  PHE H O   1 
ATOM   4458 C  CB  . PHE C 3  75  ? -48.535 -23.790 26.254  1.00 22.59  ? 74  PHE H CB  1 
ATOM   4459 C  CG  . PHE C 3  75  ? -49.801 -24.404 25.677  1.00 28.78  ? 74  PHE H CG  1 
ATOM   4460 C  CD1 . PHE C 3  75  ? -50.858 -24.799 26.506  1.00 18.58  ? 74  PHE H CD1 1 
ATOM   4461 C  CD2 . PHE C 3  75  ? -49.946 -24.556 24.300  1.00 23.15  ? 74  PHE H CD2 1 
ATOM   4462 C  CE1 . PHE C 3  75  ? -52.015 -25.344 25.975  1.00 21.46  ? 74  PHE H CE1 1 
ATOM   4463 C  CE2 . PHE C 3  75  ? -51.047 -25.103 23.781  1.00 27.06  ? 74  PHE H CE2 1 
ATOM   4464 C  CZ  . PHE C 3  75  ? -52.112 -25.533 24.630  1.00 22.27  ? 74  PHE H CZ  1 
ATOM   4465 N  N   . ALA C 3  76  ? -46.474 -21.173 26.899  1.00 28.76  ? 75  ALA H N   1 
ATOM   4466 C  CA  . ALA C 3  76  ? -45.443 -20.598 27.749  1.00 27.73  ? 75  ALA H CA  1 
ATOM   4467 C  C   . ALA C 3  76  ? -45.729 -19.132 28.083  1.00 29.75  ? 75  ALA H C   1 
ATOM   4468 O  O   . ALA C 3  76  ? -44.977 -18.548 28.834  1.00 30.21  ? 75  ALA H O   1 
ATOM   4469 C  CB  . ALA C 3  76  ? -44.043 -20.739 27.061  1.00 25.96  ? 75  ALA H CB  1 
ATOM   4470 N  N   . GLY C 3  77  ? -46.762 -18.523 27.467  1.00 29.55  ? 76  GLY H N   1 
ATOM   4471 C  CA  . GLY C 3  77  ? -47.058 -17.103 27.681  1.00 31.04  ? 76  GLY H CA  1 
ATOM   4472 C  C   . GLY C 3  77  ? -45.942 -16.171 27.188  1.00 30.99  ? 76  GLY H C   1 
ATOM   4473 O  O   . GLY C 3  77  ? -45.752 -15.096 27.748  1.00 31.63  ? 76  GLY H O   1 
ATOM   4474 N  N   . THR C 3  78  ? -45.245 -16.572 26.127  1.00 26.51  ? 77  THR H N   1 
ATOM   4475 C  CA  . THR C 3  78  ? -44.029 -15.924 25.648  1.00 27.34  ? 77  THR H CA  1 
ATOM   4476 C  C   . THR C 3  78  ? -44.151 -15.579 24.152  1.00 30.86  ? 77  THR H C   1 
ATOM   4477 O  O   . THR C 3  78  ? -44.762 -16.331 23.351  1.00 32.15  ? 77  THR H O   1 
ATOM   4478 C  CB  . THR C 3  78  ? -42.832 -16.884 25.954  1.00 29.99  ? 77  THR H CB  1 
ATOM   4479 O  OG1 . THR C 3  78  ? -42.794 -17.113 27.363  1.00 35.00  ? 77  THR H OG1 1 
ATOM   4480 C  CG2 . THR C 3  78  ? -41.454 -16.310 25.575  1.00 32.41  ? 77  THR H CG2 1 
ATOM   4481 N  N   . VAL C 3  79  ? -43.638 -14.418 23.778  1.00 30.88  ? 78  VAL H N   1 
ATOM   4482 C  CA  . VAL C 3  79  ? -43.468 -14.039 22.371  1.00 30.09  ? 78  VAL H CA  1 
ATOM   4483 C  C   . VAL C 3  79  ? -41.977 -13.742 22.118  1.00 30.64  ? 78  VAL H C   1 
ATOM   4484 O  O   . VAL C 3  79  ? -41.240 -13.361 23.042  1.00 30.48  ? 78  VAL H O   1 
ATOM   4485 C  CB  . VAL C 3  79  ? -44.331 -12.832 21.995  1.00 33.36  ? 78  VAL H CB  1 
ATOM   4486 C  CG1 . VAL C 3  79  ? -45.810 -13.151 22.228  1.00 33.84  ? 78  VAL H CG1 1 
ATOM   4487 C  CG2 . VAL C 3  79  ? -43.934 -11.636 22.811  1.00 38.56  ? 78  VAL H CG2 1 
ATOM   4488 N  N   . TYR C 3  80  ? -41.542 -13.920 20.876  1.00 28.35  ? 79  TYR H N   1 
ATOM   4489 C  CA  . TYR C 3  80  ? -40.145 -13.794 20.530  1.00 28.87  ? 79  TYR H CA  1 
ATOM   4490 C  C   . TYR C 3  80  ? -40.000 -12.876 19.378  1.00 29.70  ? 79  TYR H C   1 
ATOM   4491 O  O   . TYR C 3  80  ? -40.888 -12.834 18.527  1.00 28.51  ? 79  TYR H O   1 
ATOM   4492 C  CB  . TYR C 3  80  ? -39.548 -15.134 20.120  1.00 27.65  ? 79  TYR H CB  1 
ATOM   4493 C  CG  . TYR C 3  80  ? -39.673 -16.166 21.176  1.00 27.90  ? 79  TYR H CG  1 
ATOM   4494 C  CD1 . TYR C 3  80  ? -38.635 -16.395 22.072  1.00 28.76  ? 79  TYR H CD1 1 
ATOM   4495 C  CD2 . TYR C 3  80  ? -40.817 -16.926 21.296  1.00 33.65  ? 79  TYR H CD2 1 
ATOM   4496 C  CE1 . TYR C 3  80  ? -38.752 -17.375 23.080  1.00 34.35  ? 79  TYR H CE1 1 
ATOM   4497 C  CE2 . TYR C 3  80  ? -40.950 -17.897 22.310  1.00 29.36  ? 79  TYR H CE2 1 
ATOM   4498 C  CZ  . TYR C 3  80  ? -39.908 -18.110 23.182  1.00 35.60  ? 79  TYR H CZ  1 
ATOM   4499 O  OH  . TYR C 3  80  ? -40.039 -19.060 24.161  1.00 41.95  ? 79  TYR H OH  1 
ATOM   4500 N  N   . MET C 3  81  ? -38.860 -12.183 19.341  1.00 27.81  ? 80  MET H N   1 
ATOM   4501 C  CA  . MET C 3  81  ? -38.474 -11.385 18.200  1.00 28.72  ? 80  MET H CA  1 
ATOM   4502 C  C   . MET C 3  81  ? -37.081 -11.844 17.770  1.00 30.29  ? 80  MET H C   1 
ATOM   4503 O  O   . MET C 3  81  ? -36.117 -11.813 18.557  1.00 30.01  ? 80  MET H O   1 
ATOM   4504 C  CB  . MET C 3  81  ? -38.492 -9.925  18.581  1.00 28.61  ? 80  MET H CB  1 
ATOM   4505 C  CG  . MET C 3  81  ? -38.327 -8.921  17.447  1.00 34.73  ? 80  MET H CG  1 
ATOM   4506 S  SD  . MET C 3  81  ? -36.648 -8.818  16.898  1.00 44.73  ? 80  MET H SD  1 
ATOM   4507 C  CE  . MET C 3  81  ? -35.902 -8.062  18.352  1.00 34.66  ? 80  MET H CE  1 
ATOM   4508 N  N   . GLU C 3  82  ? -36.962 -12.269 16.515  1.00 28.14  ? 81  GLU H N   1 
ATOM   4509 C  CA  . GLU C 3  82  ? -35.666 -12.598 15.938  1.00 27.31  ? 81  GLU H CA  1 
ATOM   4510 C  C   . GLU C 3  82  ? -35.373 -11.618 14.807  1.00 28.57  ? 81  GLU H C   1 
ATOM   4511 O  O   . GLU C 3  82  ? -36.177 -11.442 13.890  1.00 28.08  ? 81  GLU H O   1 
ATOM   4512 C  CB  . GLU C 3  82  ? -35.648 -14.033 15.403  1.00 29.79  ? 81  GLU H CB  1 
ATOM   4513 C  CG  . GLU C 3  82  ? -34.238 -14.474 14.900  1.00 30.72  ? 81  GLU H CG  1 
ATOM   4514 C  CD  . GLU C 3  82  ? -34.099 -15.994 14.730  1.00 38.80  ? 81  GLU H CD  1 
ATOM   4515 O  OE1 . GLU C 3  82  ? -35.069 -16.630 14.301  1.00 38.28  ? 81  GLU H OE1 1 
ATOM   4516 O  OE2 . GLU C 3  82  ? -33.014 -16.551 15.020  1.00 52.76  ? 81  GLU H OE2 1 
ATOM   4517 N  N   . LEU C 3  83  ? -34.226 -10.968 14.898  1.00 28.12  ? 82  LEU H N   1 
ATOM   4518 C  CA  . LEU C 3  83  ? -33.778 -10.003 13.928  1.00 27.62  ? 82  LEU H CA  1 
ATOM   4519 C  C   . LEU C 3  83  ? -32.456 -10.553 13.369  1.00 27.90  ? 82  LEU H C   1 
ATOM   4520 O  O   . LEU C 3  83  ? -31.536 -10.788 14.118  1.00 28.05  ? 82  LEU H O   1 
ATOM   4521 C  CB  . LEU C 3  83  ? -33.523 -8.627  14.592  1.00 24.18  ? 82  LEU H CB  1 
ATOM   4522 C  CG  . LEU C 3  83  ? -33.126 -7.439  13.637  1.00 28.05  ? 82  LEU H CG  1 
ATOM   4523 C  CD1 . LEU C 3  83  ? -34.212 -7.122  12.613  1.00 25.51  ? 82  LEU H CD1 1 
ATOM   4524 C  CD2 . LEU C 3  83  ? -32.857 -6.167  14.386  1.00 20.10  ? 82  LEU H CD2 1 
ATOM   4525 N  N   . SER C 3  84  A -32.384 -10.738 12.064  1.00 27.16  ? 82  SER H N   1 
ATOM   4526 C  CA  . SER C 3  84  A -31.218 -11.317 11.404  1.00 27.45  ? 82  SER H CA  1 
ATOM   4527 C  C   . SER C 3  84  A -30.474 -10.268 10.589  1.00 29.19  ? 82  SER H C   1 
ATOM   4528 O  O   . SER C 3  84  A -30.872 -9.105  10.534  1.00 27.25  ? 82  SER H O   1 
ATOM   4529 C  CB  . SER C 3  84  A -31.664 -12.478 10.512  1.00 28.00  ? 82  SER H CB  1 
ATOM   4530 O  OG  . SER C 3  84  A -32.651 -12.039 9.635   1.00 41.38  ? 82  SER H OG  1 
ATOM   4531 N  N   . SER C 3  85  B -29.360 -10.676 9.992   1.00 30.53  ? 82  SER H N   1 
ATOM   4532 C  CA  . SER C 3  85  B -28.488 -9.779  9.238   1.00 31.67  ? 82  SER H CA  1 
ATOM   4533 C  C   . SER C 3  85  B -28.181 -8.470  9.978   1.00 25.99  ? 82  SER H C   1 
ATOM   4534 O  O   . SER C 3  85  B -28.324 -7.360  9.442   1.00 26.94  ? 82  SER H O   1 
ATOM   4535 C  CB  . SER C 3  85  B -29.043 -9.514  7.839   1.00 35.69  ? 82  SER H CB  1 
ATOM   4536 O  OG  . SER C 3  85  B -29.027 -10.683 7.063   1.00 43.87  ? 82  SER H OG  1 
ATOM   4537 N  N   . LEU C 3  86  C -27.739 -8.616  11.217  1.00 25.10  ? 82  LEU H N   1 
ATOM   4538 C  CA  . LEU C 3  86  C -27.584 -7.470  12.119  1.00 25.67  ? 82  LEU H CA  1 
ATOM   4539 C  C   . LEU C 3  86  C -26.566 -6.507  11.604  1.00 27.19  ? 82  LEU H C   1 
ATOM   4540 O  O   . LEU C 3  86  C -25.572 -6.888  11.006  1.00 26.48  ? 82  LEU H O   1 
ATOM   4541 C  CB  . LEU C 3  86  C -27.172 -7.917  13.544  1.00 25.19  ? 82  LEU H CB  1 
ATOM   4542 C  CG  . LEU C 3  86  C -28.282 -8.591  14.352  1.00 26.57  ? 82  LEU H CG  1 
ATOM   4543 C  CD1 . LEU C 3  86  C -27.779 -9.241  15.667  1.00 24.34  ? 82  LEU H CD1 1 
ATOM   4544 C  CD2 . LEU C 3  86  C -29.434 -7.597  14.631  1.00 24.82  ? 82  LEU H CD2 1 
ATOM   4545 N  N   . ARG C 3  87  ? -26.842 -5.233  11.817  1.00 31.18  ? 83  ARG H N   1 
ATOM   4546 C  CA  . ARG C 3  87  ? -25.876 -4.172  11.569  1.00 33.63  ? 83  ARG H CA  1 
ATOM   4547 C  C   . ARG C 3  87  ? -25.636 -3.366  12.880  1.00 31.39  ? 83  ARG H C   1 
ATOM   4548 O  O   . ARG C 3  87  ? -26.451 -3.419  13.853  1.00 25.49  ? 83  ARG H O   1 
ATOM   4549 C  CB  . ARG C 3  87  ? -26.445 -3.174  10.549  1.00 36.50  ? 83  ARG H CB  1 
ATOM   4550 C  CG  . ARG C 3  87  ? -26.532 -3.634  9.133   1.00 42.87  ? 83  ARG H CG  1 
ATOM   4551 C  CD  . ARG C 3  87  ? -27.659 -2.872  8.396   1.00 47.68  ? 83  ARG H CD  1 
ATOM   4552 N  NE  . ARG C 3  87  ? -27.317 -1.463  8.066   1.00 36.63  ? 83  ARG H NE  1 
ATOM   4553 C  CZ  . ARG C 3  87  ? -26.792 -1.077  6.916   1.00 41.78  ? 83  ARG H CZ  1 
ATOM   4554 N  NH1 . ARG C 3  87  ? -26.456 -1.991  5.992   1.00 37.24  ? 83  ARG H NH1 1 
ATOM   4555 N  NH2 . ARG C 3  87  ? -26.573 0.233   6.685   1.00 40.28  ? 83  ARG H NH2 1 
ATOM   4556 N  N   . SER C 3  88  ? -24.584 -2.549  12.865  1.00 26.96  ? 84  SER H N   1 
ATOM   4557 C  CA  . SER C 3  88  ? -24.251 -1.735  14.037  1.00 28.49  ? 84  SER H CA  1 
ATOM   4558 C  C   . SER C 3  88  ? -25.382 -0.754  14.377  1.00 25.33  ? 84  SER H C   1 
ATOM   4559 O  O   . SER C 3  88  ? -25.658 -0.534  15.545  1.00 27.92  ? 84  SER H O   1 
ATOM   4560 C  CB  . SER C 3  88  ? -22.844 -1.055  13.900  1.00 29.48  ? 84  SER H CB  1 
ATOM   4561 O  OG  . SER C 3  88  ? -22.897 -0.151  12.862  1.00 32.37  ? 84  SER H OG  1 
ATOM   4562 N  N   . GLU C 3  89  ? -26.131 -0.264  13.407  1.00 26.23  ? 85  GLU H N   1 
ATOM   4563 C  CA  . GLU C 3  89  ? -27.328 0.510   13.753  1.00 31.10  ? 85  GLU H CA  1 
ATOM   4564 C  C   . GLU C 3  89  ? -28.502 -0.303  14.283  1.00 31.40  ? 85  GLU H C   1 
ATOM   4565 O  O   . GLU C 3  89  ? -29.505 0.283   14.589  1.00 30.03  ? 85  GLU H O   1 
ATOM   4566 C  CB  . GLU C 3  89  ? -27.850 1.439   12.626  1.00 36.46  ? 85  GLU H CB  1 
ATOM   4567 C  CG  . GLU C 3  89  ? -27.986 0.865   11.248  1.00 40.98  ? 85  GLU H CG  1 
ATOM   4568 C  CD  . GLU C 3  89  ? -26.702 1.029   10.476  1.00 46.74  ? 85  GLU H CD  1 
ATOM   4569 O  OE1 . GLU C 3  89  ? -25.672 0.508   10.938  1.00 46.55  ? 85  GLU H OE1 1 
ATOM   4570 O  OE2 . GLU C 3  89  ? -26.709 1.704   9.425   1.00 64.82  ? 85  GLU H OE2 1 
ATOM   4571 N  N   . ASP C 3  90  ? -28.389 -1.620  14.436  1.00 28.96  ? 86  ASP H N   1 
ATOM   4572 C  CA  . ASP C 3  90  ? -29.388 -2.346  15.208  1.00 26.82  ? 86  ASP H CA  1 
ATOM   4573 C  C   . ASP C 3  90  ? -29.119 -2.247  16.697  1.00 28.06  ? 86  ASP H C   1 
ATOM   4574 O  O   . ASP C 3  90  ? -29.907 -2.775  17.500  1.00 27.88  ? 86  ASP H O   1 
ATOM   4575 C  CB  . ASP C 3  90  ? -29.471 -3.792  14.759  1.00 24.98  ? 86  ASP H CB  1 
ATOM   4576 C  CG  . ASP C 3  90  ? -29.935 -3.902  13.344  1.00 26.89  ? 86  ASP H CG  1 
ATOM   4577 O  OD1 . ASP C 3  90  ? -30.892 -3.165  12.983  1.00 27.85  ? 86  ASP H OD1 1 
ATOM   4578 O  OD2 . ASP C 3  90  ? -29.331 -4.662  12.569  1.00 23.72  ? 86  ASP H OD2 1 
ATOM   4579 N  N   . THR C 3  91  ? -28.044 -1.545  17.074  1.00 24.12  ? 87  THR H N   1 
ATOM   4580 C  CA  . THR C 3  91  ? -27.727 -1.282  18.490  1.00 23.82  ? 87  THR H CA  1 
ATOM   4581 C  C   . THR C 3  91  ? -28.841 -0.404  19.089  1.00 25.68  ? 87  THR H C   1 
ATOM   4582 O  O   . THR C 3  91  ? -29.078 0.731   18.673  1.00 26.73  ? 87  THR H O   1 
ATOM   4583 C  CB  . THR C 3  91  ? -26.280 -0.628  18.690  1.00 25.24  ? 87  THR H CB  1 
ATOM   4584 O  OG1 . THR C 3  91  ? -25.279 -1.512  18.173  1.00 24.68  ? 87  THR H OG1 1 
ATOM   4585 C  CG2 . THR C 3  91  ? -25.932 -0.301  20.238  1.00 17.15  ? 87  THR H CG2 1 
ATOM   4586 N  N   . ALA C 3  92  ? -29.548 -0.961  20.054  1.00 25.56  ? 88  ALA H N   1 
ATOM   4587 C  CA  . ALA C 3  92  ? -30.730 -0.317  20.568  1.00 25.79  ? 88  ALA H CA  1 
ATOM   4588 C  C   . ALA C 3  92  ? -31.238 -0.965  21.846  1.00 25.34  ? 88  ALA H C   1 
ATOM   4589 O  O   . ALA C 3  92  ? -30.848 -2.093  22.195  1.00 25.37  ? 88  ALA H O   1 
ATOM   4590 C  CB  . ALA C 3  92  ? -31.837 -0.346  19.471  1.00 25.56  ? 88  ALA H CB  1 
ATOM   4591 N  N   . MET C 3  93  ? -32.137 -0.269  22.521  1.00 26.45  ? 89  MET H N   1 
ATOM   4592 C  CA  . MET C 3  93  ? -33.023 -0.926  23.491  1.00 27.90  ? 89  MET H CA  1 
ATOM   4593 C  C   . MET C 3  93  ? -34.267 -1.547  22.799  1.00 28.21  ? 89  MET H C   1 
ATOM   4594 O  O   . MET C 3  93  ? -34.955 -0.887  22.012  1.00 28.67  ? 89  MET H O   1 
ATOM   4595 C  CB  . MET C 3  93  ? -33.459 0.079   24.541  1.00 30.67  ? 89  MET H CB  1 
ATOM   4596 C  CG  . MET C 3  93  ? -34.186 -0.552  25.698  1.00 30.46  ? 89  MET H CG  1 
ATOM   4597 S  SD  . MET C 3  93  ? -33.152 -1.252  26.954  1.00 39.72  ? 89  MET H SD  1 
ATOM   4598 C  CE  . MET C 3  93  ? -32.391 0.270   27.610  1.00 27.77  ? 89  MET H CE  1 
ATOM   4599 N  N   . TYR C 3  94  ? -34.558 -2.811  23.110  1.00 28.30  ? 90  TYR H N   1 
ATOM   4600 C  CA  . TYR C 3  94  ? -35.682 -3.546  22.506  1.00 25.93  ? 90  TYR H CA  1 
ATOM   4601 C  C   . TYR C 3  94  ? -36.796 -3.800  23.546  1.00 26.04  ? 90  TYR H C   1 
ATOM   4602 O  O   . TYR C 3  94  ? -36.595 -4.463  24.570  1.00 24.10  ? 90  TYR H O   1 
ATOM   4603 C  CB  . TYR C 3  94  ? -35.168 -4.845  21.861  1.00 26.73  ? 90  TYR H CB  1 
ATOM   4604 C  CG  . TYR C 3  94  ? -34.399 -4.577  20.568  1.00 28.13  ? 90  TYR H CG  1 
ATOM   4605 C  CD1 . TYR C 3  94  ? -35.024 -4.685  19.334  1.00 25.41  ? 90  TYR H CD1 1 
ATOM   4606 C  CD2 . TYR C 3  94  ? -33.052 -4.199  20.599  1.00 29.46  ? 90  TYR H CD2 1 
ATOM   4607 C  CE1 . TYR C 3  94  ? -34.333 -4.435  18.164  1.00 31.32  ? 90  TYR H CE1 1 
ATOM   4608 C  CE2 . TYR C 3  94  ? -32.341 -3.929  19.438  1.00 30.39  ? 90  TYR H CE2 1 
ATOM   4609 C  CZ  . TYR C 3  94  ? -32.980 -4.048  18.225  1.00 32.36  ? 90  TYR H CZ  1 
ATOM   4610 O  OH  . TYR C 3  94  ? -32.295 -3.756  17.082  1.00 27.17  ? 90  TYR H OH  1 
ATOM   4611 N  N   . TYR C 3  95  ? -37.972 -3.267  23.260  1.00 25.47  ? 91  TYR H N   1 
ATOM   4612 C  CA  . TYR C 3  95  ? -39.121 -3.356  24.141  1.00 27.01  ? 91  TYR H CA  1 
ATOM   4613 C  C   . TYR C 3  95  ? -40.190 -4.258  23.546  1.00 24.65  ? 91  TYR H C   1 
ATOM   4614 O  O   . TYR C 3  95  ? -40.503 -4.114  22.375  1.00 27.21  ? 91  TYR H O   1 
ATOM   4615 C  CB  . TYR C 3  95  ? -39.774 -1.988  24.311  1.00 26.07  ? 91  TYR H CB  1 
ATOM   4616 C  CG  . TYR C 3  95  ? -38.928 -0.900  24.940  1.00 26.79  ? 91  TYR H CG  1 
ATOM   4617 C  CD1 . TYR C 3  95  ? -38.758 -0.852  26.286  1.00 26.94  ? 91  TYR H CD1 1 
ATOM   4618 C  CD2 . TYR C 3  95  ? -38.344 0.108   24.173  1.00 24.79  ? 91  TYR H CD2 1 
ATOM   4619 C  CE1 . TYR C 3  95  ? -38.006 0.134   26.882  1.00 28.25  ? 91  TYR H CE1 1 
ATOM   4620 C  CE2 . TYR C 3  95  ? -37.558 1.105   24.776  1.00 28.04  ? 91  TYR H CE2 1 
ATOM   4621 C  CZ  . TYR C 3  95  ? -37.397 1.114   26.129  1.00 27.38  ? 91  TYR H CZ  1 
ATOM   4622 O  OH  . TYR C 3  95  ? -36.638 2.110   26.818  1.00 28.54  ? 91  TYR H OH  1 
ATOM   4623 N  N   . CYS C 3  96  ? -40.775 -5.151  24.344  1.00 27.00  ? 92  CYS H N   1 
ATOM   4624 C  CA  . CYS C 3  96  ? -42.131 -5.638  24.030  1.00 29.45  ? 92  CYS H CA  1 
ATOM   4625 C  C   . CYS C 3  96  ? -43.179 -4.757  24.633  1.00 26.03  ? 92  CYS H C   1 
ATOM   4626 O  O   . CYS C 3  96  ? -42.967 -4.157  25.653  1.00 31.27  ? 92  CYS H O   1 
ATOM   4627 C  CB  . CYS C 3  96  ? -42.402 -7.061  24.497  1.00 28.56  ? 92  CYS H CB  1 
ATOM   4628 S  SG  . CYS C 3  96  ? -42.071 -7.387  26.132  1.00 38.37  ? 92  CYS H SG  1 
ATOM   4629 N  N   . ALA C 3  97  ? -44.337 -4.711  24.012  1.00 23.64  ? 93  ALA H N   1 
ATOM   4630 C  CA  . ALA C 3  97  ? -45.432 -3.902  24.563  1.00 24.56  ? 93  ALA H CA  1 
ATOM   4631 C  C   . ALA C 3  97  ? -46.729 -4.490  24.114  1.00 24.80  ? 93  ALA H C   1 
ATOM   4632 O  O   . ALA C 3  97  ? -46.854 -4.909  22.980  1.00 26.55  ? 93  ALA H O   1 
ATOM   4633 C  CB  . ALA C 3  97  ? -45.330 -2.496  24.083  1.00 21.74  ? 93  ALA H CB  1 
ATOM   4634 N  N   . LYS C 3  98  ? -47.714 -4.515  24.994  1.00 24.11  ? 94  LYS H N   1 
ATOM   4635 C  CA  . LYS C 3  98  ? -48.973 -5.114  24.608  1.00 26.11  ? 94  LYS H CA  1 
ATOM   4636 C  C   . LYS C 3  98  ? -49.909 -4.035  24.147  1.00 23.88  ? 94  LYS H C   1 
ATOM   4637 O  O   . LYS C 3  98  ? -49.766 -2.896  24.536  1.00 26.65  ? 94  LYS H O   1 
ATOM   4638 C  CB  . LYS C 3  98  ? -49.629 -5.869  25.765  1.00 28.53  ? 94  LYS H CB  1 
ATOM   4639 C  CG  . LYS C 3  98  ? -49.903 -5.044  26.996  1.00 27.15  ? 94  LYS H CG  1 
ATOM   4640 C  CD  . LYS C 3  98  ? -50.761 -5.804  28.101  1.00 29.78  ? 94  LYS H CD  1 
ATOM   4641 C  CE  . LYS C 3  98  ? -52.224 -5.909  27.735  1.00 27.19  ? 94  LYS H CE  1 
ATOM   4642 N  NZ  . LYS C 3  98  ? -52.988 -4.638  27.899  1.00 28.07  ? 94  LYS H NZ  1 
ATOM   4643 N  N   . HIS C 3  99  ? -50.890 -4.440  23.343  1.00 24.72  ? 95  HIS H N   1 
ATOM   4644 C  CA  . HIS C 3  99  ? -51.977 -3.610  22.925  1.00 22.72  ? 95  HIS H CA  1 
ATOM   4645 C  C   . HIS C 3  99  ? -53.163 -3.843  23.823  1.00 23.36  ? 95  HIS H C   1 
ATOM   4646 O  O   . HIS C 3  99  ? -53.149 -4.706  24.694  1.00 27.75  ? 95  HIS H O   1 
ATOM   4647 C  CB  . HIS C 3  99  ? -52.271 -3.917  21.475  1.00 23.34  ? 95  HIS H CB  1 
ATOM   4648 C  CG  . HIS C 3  99  ? -51.089 -3.693  20.582  1.00 26.41  ? 95  HIS H CG  1 
ATOM   4649 N  ND1 . HIS C 3  99  ? -50.825 -2.475  20.006  1.00 31.10  ? 95  HIS H ND1 1 
ATOM   4650 C  CD2 . HIS C 3  99  ? -50.096 -4.523  20.169  1.00 24.98  ? 95  HIS H CD2 1 
ATOM   4651 C  CE1 . HIS C 3  99  ? -49.716 -2.556  19.281  1.00 32.52  ? 95  HIS H CE1 1 
ATOM   4652 N  NE2 . HIS C 3  99  ? -49.264 -3.793  19.348  1.00 28.22  ? 95  HIS H NE2 1 
ATOM   4653 N  N   . MET C 3  100 ? -54.158 -3.010  23.679  1.00 24.36  ? 96  MET H N   1 
ATOM   4654 C  CA  . MET C 3  100 ? -55.329 -3.064  24.506  1.00 27.32  ? 96  MET H CA  1 
ATOM   4655 C  C   . MET C 3  100 ? -56.286 -4.213  24.054  1.00 27.84  ? 96  MET H C   1 
ATOM   4656 O  O   . MET C 3  100 ? -57.090 -4.693  24.834  1.00 29.83  ? 96  MET H O   1 
ATOM   4657 C  CB  . MET C 3  100 ? -56.076 -1.731  24.417  1.00 23.10  ? 96  MET H CB  1 
ATOM   4658 C  CG  . MET C 3  100 ? -55.427 -0.636  25.231  1.00 34.20  ? 96  MET H CG  1 
ATOM   4659 S  SD  . MET C 3  100 ? -56.457 0.861   25.220  1.00 36.96  ? 96  MET H SD  1 
ATOM   4660 C  CE  . MET C 3  100 ? -55.547 1.798   26.429  1.00 32.03  ? 96  MET H CE  1 
ATOM   4661 N  N   . GLY C 3  101 ? -56.239 -4.560  22.787  1.00 23.91  ? 97  GLY H N   1 
ATOM   4662 C  CA  . GLY C 3  101 ? -57.058 -5.649  22.227  1.00 21.69  ? 97  GLY H CA  1 
ATOM   4663 C  C   . GLY C 3  101 ? -56.242 -6.525  21.324  1.00 22.35  ? 97  GLY H C   1 
ATOM   4664 O  O   . GLY C 3  101 ? -54.994 -6.412  21.282  1.00 23.11  ? 97  GLY H O   1 
ATOM   4665 N  N   . TYR C 3  102 ? -56.941 -7.322  20.522  1.00 21.91  ? 98  TYR H N   1 
ATOM   4666 C  CA  . TYR C 3  102 ? -56.313 -8.346  19.719  1.00 24.59  ? 98  TYR H CA  1 
ATOM   4667 C  C   . TYR C 3  102 ? -55.579 -7.806  18.497  1.00 25.90  ? 98  TYR H C   1 
ATOM   4668 O  O   . TYR C 3  102 ? -54.785 -8.504  17.886  1.00 23.28  ? 98  TYR H O   1 
ATOM   4669 C  CB  . TYR C 3  102 ? -57.374 -9.356  19.308  1.00 21.80  ? 98  TYR H CB  1 
ATOM   4670 C  CG  . TYR C 3  102 ? -58.234 -9.077  18.104  1.00 19.30  ? 98  TYR H CG  1 
ATOM   4671 C  CD1 . TYR C 3  102 ? -57.915 -9.588  16.893  1.00 22.88  ? 98  TYR H CD1 1 
ATOM   4672 C  CD2 . TYR C 3  102 ? -59.476 -8.430  18.234  1.00 22.63  ? 98  TYR H CD2 1 
ATOM   4673 C  CE1 . TYR C 3  102 ? -58.739 -9.394  15.793  1.00 21.59  ? 98  TYR H CE1 1 
ATOM   4674 C  CE2 . TYR C 3  102 ? -60.279 -8.241  17.163  1.00 17.43  ? 98  TYR H CE2 1 
ATOM   4675 C  CZ  . TYR C 3  102 ? -59.871 -8.697  15.924  1.00 19.69  ? 98  TYR H CZ  1 
ATOM   4676 O  OH  . TYR C 3  102 ? -60.694 -8.588  14.817  1.00 20.77  ? 98  TYR H OH  1 
ATOM   4677 N  N   . GLN C 3  103 ? -55.890 -6.578  18.098  1.00 24.03  ? 99  GLN H N   1 
ATOM   4678 C  CA  . GLN C 3  103 ? -55.276 -6.006  16.893  1.00 25.34  ? 99  GLN H CA  1 
ATOM   4679 C  C   . GLN C 3  103 ? -54.070 -5.135  17.206  1.00 28.89  ? 99  GLN H C   1 
ATOM   4680 O  O   . GLN C 3  103 ? -54.053 -4.426  18.205  1.00 25.54  ? 99  GLN H O   1 
ATOM   4681 C  CB  . GLN C 3  103 ? -56.315 -5.226  16.150  1.00 25.42  ? 99  GLN H CB  1 
ATOM   4682 C  CG  . GLN C 3  103 ? -57.253 -6.197  15.481  1.00 28.36  ? 99  GLN H CG  1 
ATOM   4683 C  CD  . GLN C 3  103 ? -58.280 -5.572  14.601  1.00 48.58  ? 99  GLN H CD  1 
ATOM   4684 O  OE1 . GLN C 3  103 ? -58.818 -4.498  14.903  1.00 51.85  ? 99  GLN H OE1 1 
ATOM   4685 N  NE2 . GLN C 3  103 ? -58.621 -6.281  13.511  1.00 51.66  ? 99  GLN H NE2 1 
ATOM   4686 N  N   . VAL C 3  104 ? -53.064 -5.200  16.350  1.00 27.83  ? 100 VAL H N   1 
ATOM   4687 C  CA  . VAL C 3  104 ? -51.933 -4.296  16.447  1.00 25.35  ? 100 VAL H CA  1 
ATOM   4688 C  C   . VAL C 3  104 ? -52.357 -2.852  16.152  1.00 26.72  ? 100 VAL H C   1 
ATOM   4689 O  O   . VAL C 3  104 ? -53.099 -2.608  15.280  1.00 25.23  ? 100 VAL H O   1 
ATOM   4690 C  CB  . VAL C 3  104 ? -50.827 -4.707  15.508  1.00 30.72  ? 100 VAL H CB  1 
ATOM   4691 C  CG1 . VAL C 3  104 ? -49.858 -3.536  15.283  1.00 37.01  ? 100 VAL H CG1 1 
ATOM   4692 C  CG2 . VAL C 3  104 ? -50.091 -5.894  16.099  1.00 26.33  ? 100 VAL H CG2 1 
ATOM   4693 N  N   . ARG C 3  105 A -51.921 -1.895  16.939  1.00 29.63  ? 100 ARG H N   1 
ATOM   4694 C  CA  . ARG C 3  105 A -52.210 -0.496  16.613  1.00 33.87  ? 100 ARG H CA  1 
ATOM   4695 C  C   . ARG C 3  105 A -51.301 0.452   17.354  1.00 27.53  ? 100 ARG H C   1 
ATOM   4696 O  O   . ARG C 3  105 A -50.332 0.026   17.932  1.00 29.41  ? 100 ARG H O   1 
ATOM   4697 C  CB  . ARG C 3  105 A -53.706 -0.183  16.807  1.00 38.04  ? 100 ARG H CB  1 
ATOM   4698 C  CG  . ARG C 3  105 A -54.392 0.067   15.470  1.00 48.09  ? 100 ARG H CG  1 
ATOM   4699 C  CD  . ARG C 3  105 A -55.843 0.272   15.644  1.00 60.94  ? 100 ARG H CD  1 
ATOM   4700 N  NE  . ARG C 3  105 A -56.090 1.386   16.551  1.00 63.27  ? 100 ARG H NE  1 
ATOM   4701 C  CZ  . ARG C 3  105 A -57.290 1.742   16.981  1.00 61.31  ? 100 ARG H CZ  1 
ATOM   4702 N  NH1 . ARG C 3  105 A -58.381 1.079   16.575  1.00 65.66  ? 100 ARG H NH1 1 
ATOM   4703 N  NH2 . ARG C 3  105 A -57.395 2.767   17.815  1.00 55.72  ? 100 ARG H NH2 1 
ATOM   4704 N  N   . GLU C 3  106 B -51.563 1.738   17.275  1.00 27.83  ? 100 GLU H N   1 
ATOM   4705 C  CA  . GLU C 3  106 B -50.659 2.756   17.827  1.00 30.11  ? 100 GLU H CA  1 
ATOM   4706 C  C   . GLU C 3  106 B -50.580 2.825   19.350  1.00 30.56  ? 100 GLU H C   1 
ATOM   4707 O  O   . GLU C 3  106 B -49.691 3.495   19.892  1.00 33.58  ? 100 GLU H O   1 
ATOM   4708 C  CB  . GLU C 3  106 B -51.038 4.125   17.290  1.00 30.13  ? 100 GLU H CB  1 
ATOM   4709 C  CG  . GLU C 3  106 B -52.374 4.673   17.811  1.00 31.18  ? 100 GLU H CG  1 
ATOM   4710 C  CD  . GLU C 3  106 B -53.568 3.980   17.218  1.00 38.59  ? 100 GLU H CD  1 
ATOM   4711 O  OE1 . GLU C 3  106 B -53.392 3.184   16.267  1.00 37.76  ? 100 GLU H OE1 1 
ATOM   4712 O  OE2 . GLU C 3  106 B -54.696 4.241   17.687  1.00 30.96  ? 100 GLU H OE2 1 
ATOM   4713 N  N   . THR C 3  107 C -51.506 2.138   20.013  1.00 31.93  ? 100 THR H N   1 
ATOM   4714 C  CA  . THR C 3  107 C -51.704 2.185   21.456  1.00 32.58  ? 100 THR H CA  1 
ATOM   4715 C  C   . THR C 3  107 C -51.162 0.945   22.146  1.00 31.07  ? 100 THR H C   1 
ATOM   4716 O  O   . THR C 3  107 C -51.686 -0.156  22.014  1.00 30.92  ? 100 THR H O   1 
ATOM   4717 C  CB  . THR C 3  107 C -53.182 2.424   21.825  1.00 31.01  ? 100 THR H CB  1 
ATOM   4718 O  OG1 . THR C 3  107 C -53.580 3.712   21.323  1.00 33.64  ? 100 THR H OG1 1 
ATOM   4719 C  CG2 . THR C 3  107 C -53.395 2.466   23.361  1.00 31.38  ? 100 THR H CG2 1 
ATOM   4720 N  N   . MET C 3  108 D -50.129 1.166   22.941  1.00 26.80  ? 100 MET H N   1 
ATOM   4721 C  CA  . MET C 3  108 D -49.511 0.095   23.642  1.00 26.98  ? 100 MET H CA  1 
ATOM   4722 C  C   . MET C 3  108 D -49.468 0.575   25.095  1.00 28.35  ? 100 MET H C   1 
ATOM   4723 O  O   . MET C 3  108 D -48.787 1.579   25.429  1.00 30.06  ? 100 MET H O   1 
ATOM   4724 C  CB  . MET C 3  108 D -48.123 -0.191  23.070  1.00 23.95  ? 100 MET H CB  1 
ATOM   4725 C  CG  . MET C 3  108 D -48.138 -0.832  21.718  1.00 31.46  ? 100 MET H CG  1 
ATOM   4726 S  SD  . MET C 3  108 D -46.614 -0.635  20.748  1.00 32.09  ? 100 MET H SD  1 
ATOM   4727 C  CE  . MET C 3  108 D -46.869 0.990   20.070  1.00 24.07  ? 100 MET H CE  1 
ATOM   4728 N  N   . ASP C 3  109 ? -50.228 -0.132  25.927  1.00 26.04  ? 101 ASP H N   1 
ATOM   4729 C  CA  . ASP C 3  109 ? -50.565 0.326   27.267  1.00 26.73  ? 101 ASP H CA  1 
ATOM   4730 C  C   . ASP C 3  109 ? -49.643 -0.180  28.356  1.00 29.70  ? 101 ASP H C   1 
ATOM   4731 O  O   . ASP C 3  109 ? -49.516 0.481   29.393  1.00 30.32  ? 101 ASP H O   1 
ATOM   4732 C  CB  . ASP C 3  109 ? -52.062 0.078   27.589  1.00 28.94  ? 101 ASP H CB  1 
ATOM   4733 C  CG  . ASP C 3  109 ? -52.466 -1.399  27.637  1.00 26.54  ? 101 ASP H CG  1 
ATOM   4734 O  OD1 . ASP C 3  109 ? -51.883 -2.269  26.945  1.00 35.82  ? 101 ASP H OD1 1 
ATOM   4735 O  OD2 . ASP C 3  109 ? -53.438 -1.682  28.357  1.00 35.86  ? 101 ASP H OD2 1 
ATOM   4736 N  N   . VAL C 3  110 ? -48.966 -1.316  28.122  1.00 28.37  ? 102 VAL H N   1 
ATOM   4737 C  CA  . VAL C 3  110 ? -48.023 -1.838  29.091  1.00 27.43  ? 102 VAL H CA  1 
ATOM   4738 C  C   . VAL C 3  110 ? -46.787 -2.268  28.327  1.00 27.37  ? 102 VAL H C   1 
ATOM   4739 O  O   . VAL C 3  110 ? -46.887 -2.939  27.308  1.00 30.17  ? 102 VAL H O   1 
ATOM   4740 C  CB  . VAL C 3  110 ? -48.613 -3.009  29.931  1.00 30.21  ? 102 VAL H CB  1 
ATOM   4741 C  CG1 . VAL C 3  110 ? -47.595 -3.471  30.974  1.00 32.14  ? 102 VAL H CG1 1 
ATOM   4742 C  CG2 . VAL C 3  110 ? -49.953 -2.582  30.696  1.00 22.13  ? 102 VAL H CG2 1 
ATOM   4743 N  N   . TRP C 3  111 ? -45.625 -1.857  28.829  1.00 26.79  ? 103 TRP H N   1 
ATOM   4744 C  CA  . TRP C 3  111 ? -44.330 -2.082  28.197  1.00 26.46  ? 103 TRP H CA  1 
ATOM   4745 C  C   . TRP C 3  111 ? -43.393 -2.873  29.075  1.00 25.54  ? 103 TRP H C   1 
ATOM   4746 O  O   . TRP C 3  111 ? -43.396 -2.713  30.277  1.00 26.41  ? 103 TRP H O   1 
ATOM   4747 C  CB  . TRP C 3  111 ? -43.651 -0.727  27.968  1.00 27.20  ? 103 TRP H CB  1 
ATOM   4748 C  CG  . TRP C 3  111 ? -44.359 0.086   26.950  1.00 24.05  ? 103 TRP H CG  1 
ATOM   4749 C  CD1 . TRP C 3  111 ? -45.598 0.588   27.051  1.00 29.41  ? 103 TRP H CD1 1 
ATOM   4750 C  CD2 . TRP C 3  111 ? -43.851 0.520   25.688  1.00 27.06  ? 103 TRP H CD2 1 
ATOM   4751 N  NE1 . TRP C 3  111 ? -45.928 1.296   25.919  1.00 30.76  ? 103 TRP H NE1 1 
ATOM   4752 C  CE2 . TRP C 3  111 ? -44.863 1.277   25.068  1.00 23.90  ? 103 TRP H CE2 1 
ATOM   4753 C  CE3 . TRP C 3  111 ? -42.636 0.377   25.040  1.00 31.05  ? 103 TRP H CE3 1 
ATOM   4754 C  CZ2 . TRP C 3  111 ? -44.692 1.882   23.846  1.00 26.37  ? 103 TRP H CZ2 1 
ATOM   4755 C  CZ3 . TRP C 3  111 ? -42.476 0.967   23.816  1.00 28.56  ? 103 TRP H CZ3 1 
ATOM   4756 C  CH2 . TRP C 3  111 ? -43.493 1.699   23.224  1.00 30.28  ? 103 TRP H CH2 1 
ATOM   4757 N  N   . GLY C 3  112 ? -42.593 -3.742  28.483  1.00 26.26  ? 104 GLY H N   1 
ATOM   4758 C  CA  . GLY C 3  112 ? -41.474 -4.295  29.212  1.00 25.51  ? 104 GLY H CA  1 
ATOM   4759 C  C   . GLY C 3  112 ? -40.482 -3.174  29.574  1.00 28.68  ? 104 GLY H C   1 
ATOM   4760 O  O   . GLY C 3  112 ? -40.563 -2.043  29.085  1.00 28.87  ? 104 GLY H O   1 
ATOM   4761 N  N   . LYS C 3  113 ? -39.526 -3.499  30.416  1.00 26.68  ? 105 LYS H N   1 
ATOM   4762 C  CA  . LYS C 3  113 ? -38.507 -2.554  30.788  1.00 30.71  ? 105 LYS H CA  1 
ATOM   4763 C  C   . LYS C 3  113 ? -37.427 -2.393  29.716  1.00 30.13  ? 105 LYS H C   1 
ATOM   4764 O  O   . LYS C 3  113 ? -36.626 -1.489  29.778  1.00 30.60  ? 105 LYS H O   1 
ATOM   4765 C  CB  . LYS C 3  113 ? -37.872 -2.994  32.107  1.00 32.86  ? 105 LYS H CB  1 
ATOM   4766 C  CG  . LYS C 3  113 ? -38.836 -2.831  33.282  1.00 37.89  ? 105 LYS H CG  1 
ATOM   4767 C  CD  . LYS C 3  113 ? -38.242 -3.365  34.592  1.00 47.98  ? 105 LYS H CD  1 
ATOM   4768 C  CE  . LYS C 3  113 ? -39.134 -3.030  35.802  1.00 50.14  ? 105 LYS H CE  1 
ATOM   4769 N  NZ  . LYS C 3  113 ? -38.308 -2.882  37.071  1.00 49.29  ? 105 LYS H NZ  1 
ATOM   4770 N  N   . GLY C 3  114 ? -37.428 -3.239  28.711  1.00 30.34  ? 106 GLY H N   1 
ATOM   4771 C  CA  . GLY C 3  114 ? -36.455 -3.127  27.638  1.00 32.05  ? 106 GLY H CA  1 
ATOM   4772 C  C   . GLY C 3  114 ? -35.264 -4.013  27.837  1.00 27.98  ? 106 GLY H C   1 
ATOM   4773 O  O   . GLY C 3  114 ? -34.863 -4.299  28.946  1.00 25.64  ? 106 GLY H O   1 
ATOM   4774 N  N   . THR C 3  115 ? -34.709 -4.488  26.739  1.00 32.42  ? 107 THR H N   1 
ATOM   4775 C  CA  . THR C 3  115 ? -33.426 -5.177  26.807  1.00 33.30  ? 107 THR H CA  1 
ATOM   4776 C  C   . THR C 3  115 ? -32.495 -4.617  25.710  1.00 31.79  ? 107 THR H C   1 
ATOM   4777 O  O   . THR C 3  115 ? -32.897 -4.308  24.589  1.00 33.52  ? 107 THR H O   1 
ATOM   4778 C  CB  . THR C 3  115 ? -33.544 -6.730  26.699  1.00 37.29  ? 107 THR H CB  1 
ATOM   4779 O  OG1 . THR C 3  115 ? -32.394 -7.319  27.334  1.00 50.84  ? 107 THR H OG1 1 
ATOM   4780 C  CG2 . THR C 3  115 ? -33.568 -7.191  25.313  1.00 34.60  ? 107 THR H CG2 1 
ATOM   4781 N  N   . THR C 3  116 ? -31.244 -4.500  26.059  1.00 27.66  ? 108 THR H N   1 
ATOM   4782 C  CA  . THR C 3  116 ? -30.242 -3.903  25.171  1.00 30.39  ? 108 THR H CA  1 
ATOM   4783 C  C   . THR C 3  116 ? -29.684 -4.943  24.225  1.00 26.14  ? 108 THR H C   1 
ATOM   4784 O  O   . THR C 3  116 ? -29.365 -6.073  24.632  1.00 23.35  ? 108 THR H O   1 
ATOM   4785 C  CB  . THR C 3  116 ? -29.130 -3.289  26.062  1.00 32.56  ? 108 THR H CB  1 
ATOM   4786 O  OG1 . THR C 3  116 ? -29.653 -2.067  26.620  1.00 38.46  ? 108 THR H OG1 1 
ATOM   4787 C  CG2 . THR C 3  116 ? -27.912 -2.954  25.295  1.00 44.38  ? 108 THR H CG2 1 
ATOM   4788 N  N   . VAL C 3  117 ? -29.570 -4.583  22.954  1.00 25.52  ? 109 VAL H N   1 
ATOM   4789 C  CA  . VAL C 3  117 ? -28.785 -5.385  22.037  1.00 26.00  ? 109 VAL H CA  1 
ATOM   4790 C  C   . VAL C 3  117 ? -27.676 -4.469  21.480  1.00 27.86  ? 109 VAL H C   1 
ATOM   4791 O  O   . VAL C 3  117 ? -27.962 -3.387  20.986  1.00 25.13  ? 109 VAL H O   1 
ATOM   4792 C  CB  . VAL C 3  117 ? -29.619 -5.941  20.885  1.00 28.52  ? 109 VAL H CB  1 
ATOM   4793 C  CG1 . VAL C 3  117 ? -28.731 -6.724  19.918  1.00 26.71  ? 109 VAL H CG1 1 
ATOM   4794 C  CG2 . VAL C 3  117 ? -30.775 -6.816  21.430  1.00 29.22  ? 109 VAL H CG2 1 
ATOM   4795 N  N   . THR C 3  118 ? -26.430 -4.926  21.561  1.00 27.11  ? 110 THR H N   1 
ATOM   4796 C  CA  . THR C 3  118 ? -25.271 -4.165  21.048  1.00 27.28  ? 110 THR H CA  1 
ATOM   4797 C  C   . THR C 3  118 ? -24.670 -4.966  19.906  1.00 27.72  ? 110 THR H C   1 
ATOM   4798 O  O   . THR C 3  118 ? -24.373 -6.135  20.076  1.00 24.92  ? 110 THR H O   1 
ATOM   4799 C  CB  . THR C 3  118 ? -24.204 -4.010  22.124  1.00 28.43  ? 110 THR H CB  1 
ATOM   4800 O  OG1 . THR C 3  118 ? -24.797 -3.357  23.245  1.00 28.52  ? 110 THR H OG1 1 
ATOM   4801 C  CG2 . THR C 3  118 ? -22.944 -3.203  21.602  1.00 23.71  ? 110 THR H CG2 1 
ATOM   4802 N  N   . VAL C 3  119 ? -24.601 -4.366  18.722  1.00 27.26  ? 111 VAL H N   1 
ATOM   4803 C  CA  . VAL C 3  119 ? -24.043 -5.048  17.606  1.00 27.15  ? 111 VAL H CA  1 
ATOM   4804 C  C   . VAL C 3  119 ? -22.698 -4.373  17.343  1.00 29.03  ? 111 VAL H C   1 
ATOM   4805 O  O   . VAL C 3  119 ? -22.631 -3.162  17.114  1.00 28.30  ? 111 VAL H O   1 
ATOM   4806 C  CB  . VAL C 3  119 ? -24.928 -4.965  16.378  1.00 28.06  ? 111 VAL H CB  1 
ATOM   4807 C  CG1 . VAL C 3  119 ? -24.302 -5.751  15.261  1.00 25.28  ? 111 VAL H CG1 1 
ATOM   4808 C  CG2 . VAL C 3  119 ? -26.347 -5.488  16.693  1.00 23.34  ? 111 VAL H CG2 1 
ATOM   4809 N  N   . SER C 3  120 ? -21.631 -5.149  17.392  1.00 25.86  ? 112 SER H N   1 
ATOM   4810 C  CA  . SER C 3  120 ? -20.307 -4.615  17.067  1.00 28.40  ? 112 SER H CA  1 
ATOM   4811 C  C   . SER C 3  120 ? -19.386 -5.655  16.480  1.00 28.17  ? 112 SER H C   1 
ATOM   4812 O  O   . SER C 3  120 ? -19.504 -6.842  16.803  1.00 27.32  ? 112 SER H O   1 
ATOM   4813 C  CB  . SER C 3  120 ? -19.615 -4.029  18.311  1.00 28.44  ? 112 SER H CB  1 
ATOM   4814 O  OG  . SER C 3  120 ? -18.209 -3.853  18.063  1.00 31.56  ? 112 SER H OG  1 
ATOM   4815 N  N   . SER C 3  121 ? -18.421 -5.197  15.677  1.00 28.48  ? 113 SER H N   1 
ATOM   4816 C  CA  . SER C 3  121 ? -17.419 -6.117  15.137  1.00 32.33  ? 113 SER H CA  1 
ATOM   4817 C  C   . SER C 3  121 ? -16.367 -6.531  16.167  1.00 32.77  ? 113 SER H C   1 
ATOM   4818 O  O   . SER C 3  121 ? -15.633 -7.498  15.954  1.00 32.46  ? 113 SER H O   1 
ATOM   4819 C  CB  . SER C 3  121 ? -16.737 -5.530  13.894  1.00 32.46  ? 113 SER H CB  1 
ATOM   4820 O  OG  . SER C 3  121 ? -16.205 -4.260  14.182  1.00 38.00  ? 113 SER H OG  1 
ATOM   4821 N  N   . ALA C 3  122 ? -16.293 -5.819  17.278  1.00 33.08  ? 114 ALA H N   1 
ATOM   4822 C  CA  . ALA C 3  122 ? -15.326 -6.155  18.326  1.00 34.55  ? 114 ALA H CA  1 
ATOM   4823 C  C   . ALA C 3  122 ? -15.657 -7.519  18.928  1.00 35.41  ? 114 ALA H C   1 
ATOM   4824 O  O   . ALA C 3  122 ? -16.812 -7.955  18.914  1.00 33.99  ? 114 ALA H O   1 
ATOM   4825 C  CB  . ALA C 3  122 ? -15.334 -5.063  19.457  1.00 32.00  ? 114 ALA H CB  1 
ATOM   4826 N  N   . SER C 3  123 ? -14.625 -8.140  19.485  1.00 37.27  ? 115 SER H N   1 
ATOM   4827 C  CA  . SER C 3  123 ? -14.704 -9.329  20.326  1.00 41.43  ? 115 SER H CA  1 
ATOM   4828 C  C   . SER C 3  123 ? -14.381 -8.910  21.754  1.00 44.32  ? 115 SER H C   1 
ATOM   4829 O  O   . SER C 3  123 ? -13.835 -7.820  21.998  1.00 44.98  ? 115 SER H O   1 
ATOM   4830 C  CB  . SER C 3  123 ? -13.689 -10.393 19.884  1.00 40.94  ? 115 SER H CB  1 
ATOM   4831 O  OG  . SER C 3  123 ? -14.033 -10.956 18.634  1.00 38.61  ? 115 SER H OG  1 
ATOM   4832 N  N   . THR C 3  124 ? -14.703 -9.789  22.695  1.00 47.30  ? 116 THR H N   1 
ATOM   4833 C  CA  . THR C 3  124 ? -14.513 -9.486  24.105  1.00 50.51  ? 116 THR H CA  1 
ATOM   4834 C  C   . THR C 3  124 ? -13.023 -9.471  24.475  1.00 50.42  ? 116 THR H C   1 
ATOM   4835 O  O   . THR C 3  124 ? -12.308 -10.432 24.209  1.00 51.11  ? 116 THR H O   1 
ATOM   4836 C  CB  . THR C 3  124 ? -15.283 -10.482 24.999  1.00 53.40  ? 116 THR H CB  1 
ATOM   4837 O  OG1 . THR C 3  124 ? -15.135 -10.100 26.373  1.00 54.15  ? 116 THR H OG1 1 
ATOM   4838 C  CG2 . THR C 3  124 ? -14.775 -11.922 24.793  1.00 53.54  ? 116 THR H CG2 1 
ATOM   4839 N  N   . LYS C 3  125 ? -12.573 -8.374  25.081  1.00 49.51  ? 117 LYS H N   1 
ATOM   4840 C  CA  . LYS C 3  125 ? -11.173 -8.182  25.430  1.00 49.71  ? 117 LYS H CA  1 
ATOM   4841 C  C   . LYS C 3  125 ? -11.032 -7.431  26.748  1.00 50.69  ? 117 LYS H C   1 
ATOM   4842 O  O   . LYS C 3  125 ? -11.898 -6.643  27.112  1.00 49.83  ? 117 LYS H O   1 
ATOM   4843 C  CB  . LYS C 3  125 ? -10.455 -7.390  24.331  1.00 49.62  ? 117 LYS H CB  1 
ATOM   4844 C  CG  . LYS C 3  125 ? -8.947  -7.263  24.532  1.00 49.23  ? 117 LYS H CG  1 
ATOM   4845 C  CD  . LYS C 3  125 ? -8.292  -6.418  23.462  1.00 48.63  ? 117 LYS H CD  1 
ATOM   4846 C  CE  . LYS C 3  125 ? -6.921  -5.947  23.920  1.00 51.22  ? 117 LYS H CE  1 
ATOM   4847 N  NZ  . LYS C 3  125 ? -6.351  -4.992  22.937  1.00 56.00  ? 117 LYS H NZ  1 
ATOM   4848 N  N   . GLY C 3  126 ? -9.923  -7.682  27.442  1.00 52.08  ? 118 GLY H N   1 
ATOM   4849 C  CA  . GLY C 3  126 ? -9.586  -6.991  28.677  1.00 52.49  ? 118 GLY H CA  1 
ATOM   4850 C  C   . GLY C 3  126 ? -8.641  -5.818  28.446  1.00 54.49  ? 118 GLY H C   1 
ATOM   4851 O  O   . GLY C 3  126 ? -7.857  -5.810  27.480  1.00 52.15  ? 118 GLY H O   1 
ATOM   4852 N  N   . PRO C 3  127 ? -8.691  -4.822  29.350  1.00 57.61  ? 119 PRO H N   1 
ATOM   4853 C  CA  . PRO C 3  127 ? -7.871  -3.594  29.283  1.00 57.82  ? 119 PRO H CA  1 
ATOM   4854 C  C   . PRO C 3  127 ? -6.412  -3.683  29.772  1.00 57.87  ? 119 PRO H C   1 
ATOM   4855 O  O   . PRO C 3  127 ? -6.130  -4.326  30.786  1.00 58.10  ? 119 PRO H O   1 
ATOM   4856 C  CB  . PRO C 3  127 ? -8.623  -2.629  30.195  1.00 59.90  ? 119 PRO H CB  1 
ATOM   4857 C  CG  . PRO C 3  127 ? -9.381  -3.517  31.153  1.00 60.93  ? 119 PRO H CG  1 
ATOM   4858 C  CD  . PRO C 3  127 ? -9.725  -4.755  30.407  1.00 57.27  ? 119 PRO H CD  1 
ATOM   4859 N  N   . SER C 3  128 ? -5.517  -3.012  29.037  1.00 55.89  ? 120 SER H N   1 
ATOM   4860 C  CA  . SER C 3  128 ? -4.134  -2.733  29.454  1.00 56.14  ? 120 SER H CA  1 
ATOM   4861 C  C   . SER C 3  128 ? -3.997  -1.293  30.035  1.00 53.85  ? 120 SER H C   1 
ATOM   4862 O  O   . SER C 3  128 ? -4.688  -0.368  29.584  1.00 54.23  ? 120 SER H O   1 
ATOM   4863 C  CB  . SER C 3  128 ? -3.166  -2.954  28.268  1.00 56.40  ? 120 SER H CB  1 
ATOM   4864 O  OG  . SER C 3  128 ? -3.863  -3.021  27.024  1.00 59.55  ? 120 SER H OG  1 
ATOM   4865 N  N   . VAL C 3  129 ? -3.100  -1.118  31.015  1.00 49.64  ? 121 VAL H N   1 
ATOM   4866 C  CA  . VAL C 3  129 ? -3.049  0.092   31.861  1.00 46.75  ? 121 VAL H CA  1 
ATOM   4867 C  C   . VAL C 3  129 ? -1.743  0.867   31.653  1.00 44.11  ? 121 VAL H C   1 
ATOM   4868 O  O   . VAL C 3  129 ? -0.679  0.273   31.764  1.00 45.00  ? 121 VAL H O   1 
ATOM   4869 C  CB  . VAL C 3  129 ? -3.194  -0.299  33.384  1.00 46.48  ? 121 VAL H CB  1 
ATOM   4870 C  CG1 . VAL C 3  129 ? -2.899  0.876   34.307  1.00 42.40  ? 121 VAL H CG1 1 
ATOM   4871 C  CG2 . VAL C 3  129 ? -4.592  -0.856  33.667  1.00 48.62  ? 121 VAL H CG2 1 
ATOM   4872 N  N   . PHE C 3  130 ? -1.822  2.174   31.364  1.00 41.66  ? 122 PHE H N   1 
ATOM   4873 C  CA  . PHE C 3  130 ? -0.620  3.051   31.232  1.00 40.37  ? 122 PHE H CA  1 
ATOM   4874 C  C   . PHE C 3  130 ? -0.635  4.274   32.163  1.00 39.08  ? 122 PHE H C   1 
ATOM   4875 O  O   . PHE C 3  130 ? -1.666  4.961   32.259  1.00 35.25  ? 122 PHE H O   1 
ATOM   4876 C  CB  . PHE C 3  130 ? -0.435  3.567   29.799  1.00 39.53  ? 122 PHE H CB  1 
ATOM   4877 C  CG  . PHE C 3  130 ? -0.292  2.484   28.792  1.00 41.82  ? 122 PHE H CG  1 
ATOM   4878 C  CD1 . PHE C 3  130 ? 0.857   1.709   28.760  1.00 46.40  ? 122 PHE H CD1 1 
ATOM   4879 C  CD2 . PHE C 3  130 ? -1.309  2.223   27.884  1.00 41.10  ? 122 PHE H CD2 1 
ATOM   4880 C  CE1 . PHE C 3  130 ? 0.992   0.687   27.827  1.00 50.61  ? 122 PHE H CE1 1 
ATOM   4881 C  CE2 . PHE C 3  130 ? -1.184  1.206   26.949  1.00 47.24  ? 122 PHE H CE2 1 
ATOM   4882 C  CZ  . PHE C 3  130 ? -0.028  0.436   26.917  1.00 46.56  ? 122 PHE H CZ  1 
ATOM   4883 N  N   . PRO C 3  131 ? 0.519   4.556   32.833  1.00 37.92  ? 123 PRO H N   1 
ATOM   4884 C  CA  . PRO C 3  131 ? 0.841   5.759   33.614  1.00 36.16  ? 123 PRO H CA  1 
ATOM   4885 C  C   . PRO C 3  131 ? 0.834   7.089   32.854  1.00 34.96  ? 123 PRO H C   1 
ATOM   4886 O  O   . PRO C 3  131 ? 1.359   7.163   31.747  1.00 33.82  ? 123 PRO H O   1 
ATOM   4887 C  CB  . PRO C 3  131 ? 2.278   5.485   34.073  1.00 36.34  ? 123 PRO H CB  1 
ATOM   4888 C  CG  . PRO C 3  131 ? 2.367   4.041   34.190  1.00 37.85  ? 123 PRO H CG  1 
ATOM   4889 C  CD  . PRO C 3  131 ? 1.525   3.497   33.071  1.00 38.77  ? 123 PRO H CD  1 
ATOM   4890 N  N   . LEU C 3  132 ? 0.298   8.137   33.481  1.00 34.65  ? 124 LEU H N   1 
ATOM   4891 C  CA  . LEU C 3  132 ? 0.282   9.487   32.894  1.00 35.62  ? 124 LEU H CA  1 
ATOM   4892 C  C   . LEU C 3  132 ? 1.077   10.471  33.754  1.00 35.53  ? 124 LEU H C   1 
ATOM   4893 O  O   . LEU C 3  132 ? 0.910   10.527  34.973  1.00 34.64  ? 124 LEU H O   1 
ATOM   4894 C  CB  . LEU C 3  132 ? -1.172  9.989   32.702  1.00 36.48  ? 124 LEU H CB  1 
ATOM   4895 C  CG  . LEU C 3  132 ? -1.886  9.614   31.369  1.00 37.71  ? 124 LEU H CG  1 
ATOM   4896 C  CD1 . LEU C 3  132 ? -1.713  8.127   30.995  1.00 23.74  ? 124 LEU H CD1 1 
ATOM   4897 C  CD2 . LEU C 3  132 ? -3.381  9.992   31.378  1.00 34.69  ? 124 LEU H CD2 1 
ATOM   4898 N  N   . GLY C 3  147 ? -3.549  10.488  37.732  1.00 45.08  ? 141 GLY H N   1 
ATOM   4899 C  CA  . GLY C 3  147 ? -3.470  10.146  36.314  1.00 45.21  ? 141 GLY H CA  1 
ATOM   4900 C  C   . GLY C 3  147 ? -3.421  8.647   36.075  1.00 46.02  ? 141 GLY H C   1 
ATOM   4901 O  O   . GLY C 3  147 ? -2.778  7.915   36.824  1.00 46.35  ? 141 GLY H O   1 
ATOM   4902 N  N   . CYS C 3  148 ? -4.109  8.196   35.024  1.00 46.93  ? 142 CYS H N   1 
ATOM   4903 C  CA  . CYS C 3  148 ? -4.172  6.771   34.640  1.00 47.51  ? 142 CYS H CA  1 
ATOM   4904 C  C   . CYS C 3  148 ? -4.844  6.574   33.240  1.00 46.11  ? 142 CYS H C   1 
ATOM   4905 O  O   . CYS C 3  148 ? -5.638  7.418   32.805  1.00 45.97  ? 142 CYS H O   1 
ATOM   4906 C  CB  . CYS C 3  148 ? -4.928  5.976   35.712  1.00 47.21  ? 142 CYS H CB  1 
ATOM   4907 S  SG  . CYS C 3  148 ? -4.269  4.328   35.974  1.00 55.65  ? 142 CYS H SG  1 
ATOM   4908 N  N   . LEU C 3  149 ? -4.529  5.474   32.544  1.00 43.36  ? 143 LEU H N   1 
ATOM   4909 C  CA  . LEU C 3  149 ? -5.085  5.207   31.192  1.00 41.16  ? 143 LEU H CA  1 
ATOM   4910 C  C   . LEU C 3  149 ? -5.469  3.737   31.054  1.00 39.26  ? 143 LEU H C   1 
ATOM   4911 O  O   . LEU C 3  149 ? -4.593  2.864   31.078  1.00 38.18  ? 143 LEU H O   1 
ATOM   4912 C  CB  . LEU C 3  149 ? -4.082  5.603   30.080  1.00 40.87  ? 143 LEU H CB  1 
ATOM   4913 C  CG  . LEU C 3  149 ? -4.405  5.404   28.573  1.00 38.98  ? 143 LEU H CG  1 
ATOM   4914 C  CD1 . LEU C 3  149 ? -5.462  6.387   28.062  1.00 30.79  ? 143 LEU H CD1 1 
ATOM   4915 C  CD2 . LEU C 3  149 ? -3.143  5.507   27.691  1.00 29.44  ? 143 LEU H CD2 1 
ATOM   4916 N  N   . VAL C 3  150 ? -6.772  3.475   30.915  1.00 37.69  ? 144 VAL H N   1 
ATOM   4917 C  CA  . VAL C 3  150 ? -7.292  2.114   30.689  1.00 38.02  ? 144 VAL H CA  1 
ATOM   4918 C  C   . VAL C 3  150 ? -7.762  1.908   29.224  1.00 38.93  ? 144 VAL H C   1 
ATOM   4919 O  O   . VAL C 3  150 ? -8.821  2.413   28.796  1.00 38.89  ? 144 VAL H O   1 
ATOM   4920 C  CB  . VAL C 3  150 ? -8.442  1.750   31.692  1.00 39.37  ? 144 VAL H CB  1 
ATOM   4921 C  CG1 . VAL C 3  150 ? -9.008  0.354   31.392  1.00 31.95  ? 144 VAL H CG1 1 
ATOM   4922 C  CG2 . VAL C 3  150 ? -7.947  1.848   33.149  1.00 29.71  ? 144 VAL H CG2 1 
ATOM   4923 N  N   . LYS C 3  151 ? -6.964  1.168   28.460  1.00 38.47  ? 145 LYS H N   1 
ATOM   4924 C  CA  . LYS C 3  151 ? -7.347  0.793   27.104  1.00 39.94  ? 145 LYS H CA  1 
ATOM   4925 C  C   . LYS C 3  151 ? -6.769  -0.580  26.806  1.00 39.66  ? 145 LYS H C   1 
ATOM   4926 O  O   . LYS C 3  151 ? -5.737  -0.905  27.383  1.00 43.75  ? 145 LYS H O   1 
ATOM   4927 C  CB  . LYS C 3  151 ? -6.822  1.838   26.118  1.00 41.48  ? 145 LYS H CB  1 
ATOM   4928 C  CG  . LYS C 3  151 ? -5.296  1.885   25.873  1.00 42.30  ? 145 LYS H CG  1 
ATOM   4929 C  CD  . LYS C 3  151 ? -4.997  2.589   24.548  1.00 45.21  ? 145 LYS H CD  1 
ATOM   4930 C  CE  . LYS C 3  151 ? -5.407  4.076   24.573  1.00 47.75  ? 145 LYS H CE  1 
ATOM   4931 N  NZ  . LYS C 3  151 ? -6.284  4.461   23.419  1.00 45.53  ? 145 LYS H NZ  1 
ATOM   4932 N  N   . ASP C 3  152 ? -7.362  -1.418  25.950  1.00 37.01  ? 146 ASP H N   1 
ATOM   4933 C  CA  . ASP C 3  152 ? -8.599  -1.218  25.205  1.00 33.66  ? 146 ASP H CA  1 
ATOM   4934 C  C   . ASP C 3  152 ? -9.510  -2.375  25.627  1.00 29.81  ? 146 ASP H C   1 
ATOM   4935 O  O   . ASP C 3  152 ? -9.073  -3.533  25.611  1.00 28.36  ? 146 ASP H O   1 
ATOM   4936 C  CB  . ASP C 3  152 ? -8.309  -1.370  23.711  1.00 35.21  ? 146 ASP H CB  1 
ATOM   4937 C  CG  . ASP C 3  152 ? -7.871  -0.079  23.037  1.00 38.54  ? 146 ASP H CG  1 
ATOM   4938 O  OD1 . ASP C 3  152 ? -8.373  0.987   23.428  1.00 44.18  ? 146 ASP H OD1 1 
ATOM   4939 O  OD2 . ASP C 3  152 ? -7.050  -0.140  22.085  1.00 33.33  ? 146 ASP H OD2 1 
ATOM   4940 N  N   . TYR C 3  153 ? -10.754 -2.098  26.002  1.00 24.66  ? 147 TYR H N   1 
ATOM   4941 C  CA  . TYR C 3  153 ? -11.652 -3.177  26.461  1.00 23.35  ? 147 TYR H CA  1 
ATOM   4942 C  C   . TYR C 3  153 ? -13.007 -3.208  25.729  1.00 20.63  ? 147 TYR H C   1 
ATOM   4943 O  O   . TYR C 3  153 ? -13.374 -2.233  25.067  1.00 16.05  ? 147 TYR H O   1 
ATOM   4944 C  CB  . TYR C 3  153 ? -11.872 -3.071  27.967  1.00 23.90  ? 147 TYR H CB  1 
ATOM   4945 C  CG  . TYR C 3  153 ? -12.634 -1.829  28.383  1.00 27.55  ? 147 TYR H CG  1 
ATOM   4946 C  CD1 . TYR C 3  153 ? -13.986 -1.905  28.727  1.00 26.28  ? 147 TYR H CD1 1 
ATOM   4947 C  CD2 . TYR C 3  153 ? -12.005 -0.577  28.423  1.00 30.34  ? 147 TYR H CD2 1 
ATOM   4948 C  CE1 . TYR C 3  153 ? -14.693 -0.778  29.104  1.00 28.35  ? 147 TYR H CE1 1 
ATOM   4949 C  CE2 . TYR C 3  153 ? -12.708 0.568   28.805  1.00 29.89  ? 147 TYR H CE2 1 
ATOM   4950 C  CZ  . TYR C 3  153 ? -14.050 0.451   29.143  1.00 27.38  ? 147 TYR H CZ  1 
ATOM   4951 O  OH  . TYR C 3  153 ? -14.766 1.559   29.490  1.00 31.72  ? 147 TYR H OH  1 
ATOM   4952 N  N   . PHE C 3  154 ? -13.729 -4.327  25.865  1.00 20.44  ? 148 PHE H N   1 
ATOM   4953 C  CA  . PHE C 3  154 ? -15.063 -4.514  25.244  1.00 23.64  ? 148 PHE H CA  1 
ATOM   4954 C  C   . PHE C 3  154 ? -15.694 -5.820  25.686  1.00 27.10  ? 148 PHE H C   1 
ATOM   4955 O  O   . PHE C 3  154 ? -15.002 -6.841  25.685  1.00 29.36  ? 148 PHE H O   1 
ATOM   4956 C  CB  . PHE C 3  154 ? -14.953 -4.598  23.720  1.00 22.98  ? 148 PHE H CB  1 
ATOM   4957 C  CG  . PHE C 3  154 ? -16.271 -4.896  23.021  1.00 17.73  ? 148 PHE H CG  1 
ATOM   4958 C  CD1 . PHE C 3  154 ? -17.166 -3.871  22.721  1.00 15.73  ? 148 PHE H CD1 1 
ATOM   4959 C  CD2 . PHE C 3  154 ? -16.609 -6.191  22.666  1.00 15.30  ? 148 PHE H CD2 1 
ATOM   4960 C  CE1 . PHE C 3  154 ? -18.381 -4.135  22.062  1.00 8.94   ? 148 PHE H CE1 1 
ATOM   4961 C  CE2 . PHE C 3  154 ? -17.833 -6.464  21.998  1.00 18.20  ? 148 PHE H CE2 1 
ATOM   4962 C  CZ  . PHE C 3  154 ? -18.707 -5.431  21.711  1.00 11.35  ? 148 PHE H CZ  1 
ATOM   4963 N  N   . PRO C 3  155 ? -16.999 -5.822  26.052  1.00 29.78  ? 149 PRO H N   1 
ATOM   4964 C  CA  . PRO C 3  155 ? -17.969 -4.738  26.250  1.00 31.07  ? 149 PRO H CA  1 
ATOM   4965 C  C   . PRO C 3  155 ? -17.834 -4.138  27.657  1.00 32.82  ? 149 PRO H C   1 
ATOM   4966 O  O   . PRO C 3  155 ? -16.708 -4.085  28.153  1.00 29.96  ? 149 PRO H O   1 
ATOM   4967 C  CB  . PRO C 3  155 ? -19.308 -5.433  26.018  1.00 30.65  ? 149 PRO H CB  1 
ATOM   4968 C  CG  . PRO C 3  155 ? -19.086 -6.854  26.439  1.00 29.75  ? 149 PRO H CG  1 
ATOM   4969 C  CD  . PRO C 3  155 ? -17.615 -7.145  26.299  1.00 29.69  ? 149 PRO H CD  1 
ATOM   4970 N  N   . GLU C 3  156 ? -18.929 -3.709  28.305  1.00 36.80  ? 150 GLU H N   1 
ATOM   4971 C  CA  . GLU C 3  156 ? -18.819 -2.754  29.439  1.00 39.22  ? 150 GLU H CA  1 
ATOM   4972 C  C   . GLU C 3  156 ? -19.232 -3.183  30.871  1.00 41.55  ? 150 GLU H C   1 
ATOM   4973 O  O   . GLU C 3  156 ? -20.201 -3.916  31.037  1.00 41.60  ? 150 GLU H O   1 
ATOM   4974 C  CB  . GLU C 3  156 ? -19.449 -1.423  29.033  1.00 39.28  ? 150 GLU H CB  1 
ATOM   4975 C  CG  . GLU C 3  156 ? -18.384 -0.353  28.771  1.00 39.05  ? 150 GLU H CG  1 
ATOM   4976 C  CD  . GLU C 3  156 ? -18.971 0.968   28.401  1.00 36.60  ? 150 GLU H CD  1 
ATOM   4977 O  OE1 . GLU C 3  156 ? -18.673 1.972   29.089  1.00 19.08  ? 150 GLU H OE1 1 
ATOM   4978 O  OE2 . GLU C 3  156 ? -19.732 0.987   27.408  1.00 38.18  ? 150 GLU H OE2 1 
ATOM   4979 N  N   . PRO C 3  157 ? -18.536 -2.609  31.894  1.00 44.30  ? 151 PRO H N   1 
ATOM   4980 C  CA  . PRO C 3  157 ? -17.817 -3.209  33.026  1.00 45.99  ? 151 PRO H CA  1 
ATOM   4981 C  C   . PRO C 3  157 ? -18.483 -3.095  34.419  1.00 47.54  ? 151 PRO H C   1 
ATOM   4982 O  O   . PRO C 3  157 ? -19.706 -3.154  34.504  1.00 50.50  ? 151 PRO H O   1 
ATOM   4983 C  CB  . PRO C 3  157 ? -16.551 -2.341  33.029  1.00 45.86  ? 151 PRO H CB  1 
ATOM   4984 C  CG  . PRO C 3  157 ? -17.149 -0.905  32.726  1.00 46.99  ? 151 PRO H CG  1 
ATOM   4985 C  CD  . PRO C 3  157 ? -18.546 -1.150  32.106  1.00 44.67  ? 151 PRO H CD  1 
ATOM   4986 N  N   . VAL C 3  158 ? -17.670 -2.993  35.488  1.00 47.29  ? 152 VAL H N   1 
ATOM   4987 C  CA  . VAL C 3  158 ? -18.104 -2.575  36.853  1.00 47.02  ? 152 VAL H CA  1 
ATOM   4988 C  C   . VAL C 3  158 ? -16.906 -2.493  37.844  1.00 46.06  ? 152 VAL H C   1 
ATOM   4989 O  O   . VAL C 3  158 ? -16.709 -3.380  38.683  1.00 46.39  ? 152 VAL H O   1 
ATOM   4990 C  CB  . VAL C 3  158 ? -19.241 -3.490  37.452  1.00 47.78  ? 152 VAL H CB  1 
ATOM   4991 C  CG1 . VAL C 3  158 ? -18.818 -4.973  37.487  1.00 46.36  ? 152 VAL H CG1 1 
ATOM   4992 C  CG2 . VAL C 3  158 ? -19.672 -2.995  38.843  1.00 45.54  ? 152 VAL H CG2 1 
ATOM   4993 N  N   . THR C 3  159 ? -16.146 -1.399  37.764  1.00 44.28  ? 153 THR H N   1 
ATOM   4994 C  CA  . THR C 3  159 ? -14.844 -1.279  38.437  1.00 42.14  ? 153 THR H CA  1 
ATOM   4995 C  C   . THR C 3  159 ? -14.954 -0.523  39.767  1.00 42.93  ? 153 THR H C   1 
ATOM   4996 O  O   . THR C 3  159 ? -14.788 -1.098  40.850  1.00 42.73  ? 153 THR H O   1 
ATOM   4997 C  CB  . THR C 3  159 ? -13.790 -0.568  37.518  1.00 41.99  ? 153 THR H CB  1 
ATOM   4998 O  OG1 . THR C 3  159 ? -13.707 0.829   37.835  1.00 36.84  ? 153 THR H OG1 1 
ATOM   4999 C  CG2 . THR C 3  159 ? -14.133 -0.743  36.030  1.00 35.56  ? 153 THR H CG2 1 
ATOM   5000 N  N   . THR C 3  173 ? -13.472 8.849   37.793  1.00 39.40  ? 173 THR H N   1 
ATOM   5001 C  CA  . THR C 3  173 ? -12.809 8.691   36.507  1.00 38.56  ? 173 THR H CA  1 
ATOM   5002 C  C   . THR C 3  173 ? -13.744 9.105   35.344  1.00 38.42  ? 173 THR H C   1 
ATOM   5003 O  O   . THR C 3  173 ? -14.972 9.092   35.475  1.00 37.44  ? 173 THR H O   1 
ATOM   5004 C  CB  . THR C 3  173 ? -12.228 7.233   36.339  1.00 40.07  ? 173 THR H CB  1 
ATOM   5005 O  OG1 . THR C 3  173 ? -13.226 6.330   35.835  1.00 35.16  ? 173 THR H OG1 1 
ATOM   5006 C  CG2 . THR C 3  173 ? -11.663 6.702   37.683  1.00 37.74  ? 173 THR H CG2 1 
ATOM   5007 N  N   . PHE C 3  174 ? -13.144 9.477   34.216  1.00 37.71  ? 174 PHE H N   1 
ATOM   5008 C  CA  . PHE C 3  174 ? -13.877 10.066  33.088  1.00 37.09  ? 174 PHE H CA  1 
ATOM   5009 C  C   . PHE C 3  174 ? -14.643 8.993   32.307  1.00 36.87  ? 174 PHE H C   1 
ATOM   5010 O  O   . PHE C 3  174 ? -14.109 7.906   32.067  1.00 37.58  ? 174 PHE H O   1 
ATOM   5011 C  CB  . PHE C 3  174 ? -12.913 10.807  32.141  1.00 36.07  ? 174 PHE H CB  1 
ATOM   5012 C  CG  . PHE C 3  174 ? -12.375 12.118  32.699  1.00 36.94  ? 174 PHE H CG  1 
ATOM   5013 C  CD1 . PHE C 3  174 ? -12.805 13.336  32.183  1.00 32.96  ? 174 PHE H CD1 1 
ATOM   5014 C  CD2 . PHE C 3  174 ? -11.431 12.130  33.735  1.00 36.86  ? 174 PHE H CD2 1 
ATOM   5015 C  CE1 . PHE C 3  174 ? -12.299 14.548  32.686  1.00 35.03  ? 174 PHE H CE1 1 
ATOM   5016 C  CE2 . PHE C 3  174 ? -10.930 13.331  34.246  1.00 32.37  ? 174 PHE H CE2 1 
ATOM   5017 C  CZ  . PHE C 3  174 ? -11.362 14.541  33.719  1.00 32.84  ? 174 PHE H CZ  1 
ATOM   5018 N  N   . PRO C 3  175 ? -15.893 9.294   31.893  1.00 35.79  ? 175 PRO H N   1 
ATOM   5019 C  CA  . PRO C 3  175 ? -16.653 8.306   31.119  1.00 35.83  ? 175 PRO H CA  1 
ATOM   5020 C  C   . PRO C 3  175 ? -15.840 7.706   29.973  1.00 34.08  ? 175 PRO H C   1 
ATOM   5021 O  O   . PRO C 3  175 ? -15.002 8.393   29.379  1.00 31.44  ? 175 PRO H O   1 
ATOM   5022 C  CB  . PRO C 3  175 ? -17.838 9.111   30.552  1.00 35.69  ? 175 PRO H CB  1 
ATOM   5023 C  CG  . PRO C 3  175 ? -17.933 10.333  31.372  1.00 34.30  ? 175 PRO H CG  1 
ATOM   5024 C  CD  . PRO C 3  175 ? -16.674 10.514  32.163  1.00 35.16  ? 175 PRO H CD  1 
ATOM   5025 N  N   . ALA C 3  176 ? -16.119 6.443   29.664  1.00 34.87  ? 176 ALA H N   1 
ATOM   5026 C  CA  . ALA C 3  176 ? -15.428 5.727   28.590  1.00 34.50  ? 176 ALA H CA  1 
ATOM   5027 C  C   . ALA C 3  176 ? -15.587 6.406   27.232  1.00 31.47  ? 176 ALA H C   1 
ATOM   5028 O  O   . ALA C 3  176 ? -16.655 6.914   26.922  1.00 29.36  ? 176 ALA H O   1 
ATOM   5029 C  CB  . ALA C 3  176 ? -15.952 4.297   28.531  1.00 34.44  ? 176 ALA H CB  1 
ATOM   5030 N  N   . VAL C 3  177 ? -14.517 6.452   26.446  1.00 31.46  ? 177 VAL H N   1 
ATOM   5031 C  CA  . VAL C 3  177 ? -14.633 6.767   25.009  1.00 31.25  ? 177 VAL H CA  1 
ATOM   5032 C  C   . VAL C 3  177 ? -14.715 5.448   24.253  1.00 30.38  ? 177 VAL H C   1 
ATOM   5033 O  O   . VAL C 3  177 ? -14.332 4.404   24.786  1.00 28.83  ? 177 VAL H O   1 
ATOM   5034 C  CB  . VAL C 3  177 ? -13.458 7.644   24.468  1.00 30.57  ? 177 VAL H CB  1 
ATOM   5035 C  CG1 . VAL C 3  177 ? -12.145 6.903   24.515  1.00 32.79  ? 177 VAL H CG1 1 
ATOM   5036 C  CG2 . VAL C 3  177 ? -13.750 8.122   23.023  1.00 29.89  ? 177 VAL H CG2 1 
ATOM   5037 N  N   . LEU C 3  178 ? -15.284 5.491   23.050  1.00 33.14  ? 178 LEU H N   1 
ATOM   5038 C  CA  . LEU C 3  178 ? -15.414 4.309   22.188  1.00 34.52  ? 178 LEU H CA  1 
ATOM   5039 C  C   . LEU C 3  178 ? -14.664 4.605   20.914  1.00 35.59  ? 178 LEU H C   1 
ATOM   5040 O  O   . LEU C 3  178 ? -15.046 5.499   20.169  1.00 34.80  ? 178 LEU H O   1 
ATOM   5041 C  CB  . LEU C 3  178 ? -16.893 3.988   21.868  1.00 34.57  ? 178 LEU H CB  1 
ATOM   5042 C  CG  . LEU C 3  178 ? -17.157 2.906   20.798  1.00 30.83  ? 178 LEU H CG  1 
ATOM   5043 C  CD1 . LEU C 3  178 ? -16.337 1.625   21.082  1.00 16.09  ? 178 LEU H CD1 1 
ATOM   5044 C  CD2 . LEU C 3  178 ? -18.653 2.584   20.657  1.00 26.74  ? 178 LEU H CD2 1 
ATOM   5045 N  N   . GLN C 3  179 ? -13.606 3.839   20.664  1.00 38.09  ? 179 GLN H N   1 
ATOM   5046 C  CA  . GLN C 3  179 ? -12.689 4.117   19.566  1.00 39.20  ? 179 GLN H CA  1 
ATOM   5047 C  C   . GLN C 3  179 ? -13.211 3.638   18.222  1.00 39.87  ? 179 GLN H C   1 
ATOM   5048 O  O   . GLN C 3  179 ? -14.262 2.999   18.143  1.00 39.80  ? 179 GLN H O   1 
ATOM   5049 C  CB  . GLN C 3  179 ? -11.342 3.474   19.859  1.00 40.98  ? 179 GLN H CB  1 
ATOM   5050 C  CG  . GLN C 3  179 ? -10.669 4.037   21.096  1.00 43.25  ? 179 GLN H CG  1 
ATOM   5051 C  CD  . GLN C 3  179 ? -9.865  3.002   21.833  1.00 46.97  ? 179 GLN H CD  1 
ATOM   5052 O  OE1 . GLN C 3  179 ? -10.341 2.433   22.819  1.00 39.77  ? 179 GLN H OE1 1 
ATOM   5053 N  NE2 . GLN C 3  179 ? -8.638  2.737   21.359  1.00 51.37  ? 179 GLN H NE2 1 
ATOM   5054 N  N   . SER C 3  180 ? -12.436 3.940   17.179  1.00 40.76  ? 180 SER H N   1 
ATOM   5055 C  CA  . SER C 3  180 ? -12.819 3.781   15.769  1.00 40.92  ? 180 SER H CA  1 
ATOM   5056 C  C   . SER C 3  180 ? -12.845 2.326   15.285  1.00 40.58  ? 180 SER H C   1 
ATOM   5057 O  O   . SER C 3  180 ? -13.827 1.601   15.448  1.00 41.60  ? 180 SER H O   1 
ATOM   5058 C  CB  . SER C 3  180 ? -11.822 4.580   14.906  1.00 40.83  ? 180 SER H CB  1 
ATOM   5059 O  OG  . SER C 3  180 ? -10.928 5.322   15.740  1.00 39.33  ? 180 SER H OG  1 
ATOM   5060 N  N   . SER C 3  181 ? -11.547 1.364   16.939  1.00 31.20  ? 182 SER H N   1 
ATOM   5061 C  CA  . SER C 3  181 ? -11.470 -0.085  16.863  1.00 30.97  ? 182 SER H CA  1 
ATOM   5062 C  C   . SER C 3  181 ? -12.693 -0.797  17.461  1.00 29.44  ? 182 SER H C   1 
ATOM   5063 O  O   . SER C 3  181 ? -12.676 -2.021  17.609  1.00 31.86  ? 182 SER H O   1 
ATOM   5064 C  CB  . SER C 3  181 ? -10.204 -0.544  17.583  1.00 30.86  ? 182 SER H CB  1 
ATOM   5065 O  OG  . SER C 3  181 ? -10.148 0.028   18.878  1.00 35.44  ? 182 SER H OG  1 
ATOM   5066 N  N   . GLY C 3  182 ? -13.747 -0.053  17.809  1.00 25.29  ? 183 GLY H N   1 
ATOM   5067 C  CA  . GLY C 3  182 ? -14.852 -0.618  18.604  1.00 21.18  ? 183 GLY H CA  1 
ATOM   5068 C  C   . GLY C 3  182 ? -14.488 -0.963  20.050  1.00 19.32  ? 183 GLY H C   1 
ATOM   5069 O  O   . GLY C 3  182 ? -15.270 -1.540  20.774  1.00 17.33  ? 183 GLY H O   1 
ATOM   5070 N  N   . LEU C 3  183 ? -13.293 -0.598  20.495  1.00 19.83  ? 184 LEU H N   1 
ATOM   5071 C  CA  . LEU C 3  183 ? -12.906 -0.875  21.860  1.00 19.46  ? 184 LEU H CA  1 
ATOM   5072 C  C   . LEU C 3  183 ? -13.064 0.387   22.725  1.00 17.13  ? 184 LEU H C   1 
ATOM   5073 O  O   . LEU C 3  183 ? -13.005 1.499   22.220  1.00 15.23  ? 184 LEU H O   1 
ATOM   5074 C  CB  . LEU C 3  183 ? -11.476 -1.407  21.901  1.00 20.04  ? 184 LEU H CB  1 
ATOM   5075 C  CG  . LEU C 3  183 ? -11.192 -2.682  21.089  1.00 21.47  ? 184 LEU H CG  1 
ATOM   5076 C  CD1 . LEU C 3  183 ? -9.694  -3.022  21.207  1.00 18.04  ? 184 LEU H CD1 1 
ATOM   5077 C  CD2 . LEU C 3  183 ? -12.061 -3.857  21.540  1.00 8.53   ? 184 LEU H CD2 1 
ATOM   5078 N  N   . TYR C 3  184 ? -13.292 0.195   24.017  1.00 17.66  ? 185 TYR H N   1 
ATOM   5079 C  CA  . TYR C 3  184 ? -13.599 1.311   24.914  1.00 22.37  ? 185 TYR H CA  1 
ATOM   5080 C  C   . TYR C 3  184 ? -12.362 1.754   25.688  1.00 27.38  ? 185 TYR H C   1 
ATOM   5081 O  O   . TYR C 3  184 ? -11.848 0.990   26.521  1.00 25.40  ? 185 TYR H O   1 
ATOM   5082 C  CB  . TYR C 3  184 ? -14.674 0.918   25.916  1.00 22.36  ? 185 TYR H CB  1 
ATOM   5083 C  CG  . TYR C 3  184 ? -16.047 0.772   25.339  1.00 16.61  ? 185 TYR H CG  1 
ATOM   5084 C  CD1 . TYR C 3  184 ? -16.575 -0.492  25.061  1.00 21.15  ? 185 TYR H CD1 1 
ATOM   5085 C  CD2 . TYR C 3  184 ? -16.855 1.880   25.109  1.00 16.99  ? 185 TYR H CD2 1 
ATOM   5086 C  CE1 . TYR C 3  184 ? -17.889 -0.655  24.542  1.00 14.43  ? 185 TYR H CE1 1 
ATOM   5087 C  CE2 . TYR C 3  184 ? -18.181 1.724   24.554  1.00 22.80  ? 185 TYR H CE2 1 
ATOM   5088 C  CZ  . TYR C 3  184 ? -18.683 0.452   24.277  1.00 16.72  ? 185 TYR H CZ  1 
ATOM   5089 O  OH  . TYR C 3  184 ? -19.984 0.267   23.740  1.00 18.23  ? 185 TYR H OH  1 
ATOM   5090 N  N   . SER C 3  185 ? -11.890 2.973   25.385  1.00 30.57  ? 186 SER H N   1 
ATOM   5091 C  CA  . SER C 3  185 ? -10.842 3.656   26.178  1.00 33.53  ? 186 SER H CA  1 
ATOM   5092 C  C   . SER C 3  185 ? -11.443 4.705   27.122  1.00 34.50  ? 186 SER H C   1 
ATOM   5093 O  O   . SER C 3  185 ? -12.303 5.501   26.724  1.00 33.20  ? 186 SER H O   1 
ATOM   5094 C  CB  . SER C 3  185 ? -9.805  4.339   25.281  1.00 33.94  ? 186 SER H CB  1 
ATOM   5095 O  OG  . SER C 3  185 ? -8.780  3.443   24.916  1.00 33.55  ? 186 SER H OG  1 
ATOM   5096 N  N   . LEU C 3  186 ? -10.966 4.696   28.365  1.00 34.60  ? 187 LEU H N   1 
ATOM   5097 C  CA  . LEU C 3  186 ? -11.403 5.645   29.380  1.00 34.91  ? 187 LEU H CA  1 
ATOM   5098 C  C   . LEU C 3  186 ? -10.175 6.088   30.124  1.00 34.19  ? 187 LEU H C   1 
ATOM   5099 O  O   . LEU C 3  186 ? -9.254  5.299   30.259  1.00 37.09  ? 187 LEU H O   1 
ATOM   5100 C  CB  . LEU C 3  186 ? -12.401 4.988   30.351  1.00 34.07  ? 187 LEU H CB  1 
ATOM   5101 C  CG  . LEU C 3  186 ? -11.993 4.080   31.520  1.00 22.51  ? 187 LEU H CG  1 
ATOM   5102 C  CD1 . LEU C 3  186 ? -11.159 4.757   32.653  1.00 14.09  ? 187 LEU H CD1 1 
ATOM   5103 C  CD2 . LEU C 3  186 ? -13.281 3.540   32.110  1.00 20.97  ? 187 LEU H CD2 1 
ATOM   5104 N  N   . SER C 3  187 ? -10.144 7.326   30.606  1.00 34.32  ? 188 SER H N   1 
ATOM   5105 C  CA  . SER C 3  187 ? -9.031  7.765   31.486  1.00 37.42  ? 188 SER H CA  1 
ATOM   5106 C  C   . SER C 3  187 ? -9.502  8.133   32.909  1.00 37.11  ? 188 SER H C   1 
ATOM   5107 O  O   . SER C 3  187 ? -8.914  7.699   33.908  1.00 35.88  ? 188 SER H O   1 
ATOM   5108 C  CB  . SER C 3  187 ? -8.245  8.924   30.851  1.00 35.76  ? 188 SER H CB  1 
ATOM   5109 O  OG  . SER C 3  187 ? -7.168  9.317   31.696  1.00 42.31  ? 188 SER H OG  1 
ATOM   5110 N  N   . VAL D 4  3   ? -42.896 9.654   8.435   1.00 47.64  ? 3   VAL L N   1 
ATOM   5111 C  CA  . VAL D 4  3   ? -42.694 10.109  9.857   1.00 46.74  ? 3   VAL L CA  1 
ATOM   5112 C  C   . VAL D 4  3   ? -43.546 11.351  10.188  1.00 43.73  ? 3   VAL L C   1 
ATOM   5113 O  O   . VAL D 4  3   ? -44.046 12.049  9.306   1.00 42.67  ? 3   VAL L O   1 
ATOM   5114 C  CB  . VAL D 4  3   ? -41.180 10.344  10.192  1.00 46.64  ? 3   VAL L CB  1 
ATOM   5115 C  CG1 . VAL D 4  3   ? -40.966 10.713  11.667  1.00 50.07  ? 3   VAL L CG1 1 
ATOM   5116 C  CG2 . VAL D 4  3   ? -40.369 9.088   9.870   1.00 54.27  ? 3   VAL L CG2 1 
ATOM   5117 N  N   . LEU D 4  4   ? -43.744 11.562  11.482  1.00 40.54  ? 4   LEU L N   1 
ATOM   5118 C  CA  . LEU D 4  4   ? -44.540 12.639  12.003  1.00 37.84  ? 4   LEU L CA  1 
ATOM   5119 C  C   . LEU D 4  4   ? -43.561 13.647  12.589  1.00 39.02  ? 4   LEU L C   1 
ATOM   5120 O  O   . LEU D 4  4   ? -42.494 13.283  13.133  1.00 37.38  ? 4   LEU L O   1 
ATOM   5121 C  CB  . LEU D 4  4   ? -45.462 12.127  13.107  1.00 36.22  ? 4   LEU L CB  1 
ATOM   5122 C  CG  . LEU D 4  4   ? -46.424 10.986  12.763  1.00 32.25  ? 4   LEU L CG  1 
ATOM   5123 C  CD1 . LEU D 4  4   ? -46.965 10.355  14.023  1.00 29.63  ? 4   LEU L CD1 1 
ATOM   5124 C  CD2 . LEU D 4  4   ? -47.561 11.490  11.894  1.00 29.73  ? 4   LEU L CD2 1 
ATOM   5125 N  N   . THR D 4  5   ? -43.927 14.917  12.487  1.00 37.24  ? 5   THR L N   1 
ATOM   5126 C  CA  . THR D 4  5   ? -43.003 15.988  12.815  1.00 35.91  ? 5   THR L CA  1 
ATOM   5127 C  C   . THR D 4  5   ? -43.432 16.613  14.132  1.00 32.44  ? 5   THR L C   1 
ATOM   5128 O  O   . THR D 4  5   ? -44.592 16.921  14.326  1.00 29.46  ? 5   THR L O   1 
ATOM   5129 C  CB  . THR D 4  5   ? -42.919 16.960  11.631  1.00 37.04  ? 5   THR L CB  1 
ATOM   5130 O  OG1 . THR D 4  5   ? -42.421 16.231  10.499  1.00 34.44  ? 5   THR L OG1 1 
ATOM   5131 C  CG2 . THR D 4  5   ? -41.992 18.171  11.932  1.00 40.39  ? 5   THR L CG2 1 
ATOM   5132 N  N   . GLN D 4  6   ? -42.495 16.672  15.068  1.00 34.32  ? 6   GLN L N   1 
ATOM   5133 C  CA  . GLN D 4  6   ? -42.696 17.308  16.361  1.00 35.52  ? 6   GLN L CA  1 
ATOM   5134 C  C   . GLN D 4  6   ? -41.618 18.387  16.486  1.00 37.62  ? 6   GLN L C   1 
ATOM   5135 O  O   . GLN D 4  6   ? -40.567 18.278  15.831  1.00 36.31  ? 6   GLN L O   1 
ATOM   5136 C  CB  . GLN D 4  6   ? -42.510 16.304  17.507  1.00 35.66  ? 6   GLN L CB  1 
ATOM   5137 C  CG  . GLN D 4  6   ? -43.618 15.254  17.674  1.00 34.03  ? 6   GLN L CG  1 
ATOM   5138 C  CD  . GLN D 4  6   ? -43.344 14.283  18.799  1.00 32.75  ? 6   GLN L CD  1 
ATOM   5139 O  OE1 . GLN D 4  6   ? -42.987 13.132  18.556  1.00 34.52  ? 6   GLN L OE1 1 
ATOM   5140 N  NE2 . GLN D 4  6   ? -43.494 14.741  20.046  1.00 31.50  ? 6   GLN L NE2 1 
ATOM   5141 N  N   . PRO D 4  7   ? -41.853 19.405  17.335  1.00 39.74  ? 7   PRO L N   1 
ATOM   5142 C  CA  . PRO D 4  7   ? -40.765 20.301  17.776  1.00 43.33  ? 7   PRO L CA  1 
ATOM   5143 C  C   . PRO D 4  7   ? -39.703 19.522  18.566  1.00 44.62  ? 7   PRO L C   1 
ATOM   5144 O  O   . PRO D 4  7   ? -40.075 18.639  19.330  1.00 46.70  ? 7   PRO L O   1 
ATOM   5145 C  CB  . PRO D 4  7   ? -41.481 21.272  18.727  1.00 43.46  ? 7   PRO L CB  1 
ATOM   5146 C  CG  . PRO D 4  7   ? -42.663 20.472  19.233  1.00 43.27  ? 7   PRO L CG  1 
ATOM   5147 C  CD  . PRO D 4  7   ? -43.110 19.684  18.047  1.00 38.91  ? 7   PRO L CD  1 
ATOM   5148 N  N   . PRO D 4  8   ? -38.403 19.842  18.408  1.00 45.30  ? 8   PRO L N   1 
ATOM   5149 C  CA  . PRO D 4  8   ? -37.406 19.094  19.190  1.00 46.76  ? 8   PRO L CA  1 
ATOM   5150 C  C   . PRO D 4  8   ? -37.333 19.454  20.673  1.00 47.55  ? 8   PRO L C   1 
ATOM   5151 O  O   . PRO D 4  8   ? -36.918 18.619  21.482  1.00 47.50  ? 8   PRO L O   1 
ATOM   5152 C  CB  . PRO D 4  8   ? -36.088 19.425  18.484  1.00 47.99  ? 8   PRO L CB  1 
ATOM   5153 C  CG  . PRO D 4  8   ? -36.499 19.767  17.091  1.00 48.34  ? 8   PRO L CG  1 
ATOM   5154 C  CD  . PRO D 4  8   ? -37.774 20.535  17.276  1.00 46.20  ? 8   PRO L CD  1 
ATOM   5155 N  N   . SER D 4  9   ? -37.748 20.676  21.019  1.00 49.01  ? 9   SER L N   1 
ATOM   5156 C  CA  . SER D 4  9   ? -37.687 21.183  22.399  1.00 47.73  ? 9   SER L CA  1 
ATOM   5157 C  C   . SER D 4  9   ? -38.390 22.521  22.509  1.00 46.44  ? 9   SER L C   1 
ATOM   5158 O  O   . SER D 4  9   ? -39.484 22.697  21.982  1.00 46.71  ? 9   SER L O   1 
ATOM   5159 C  CB  . SER D 4  9   ? -36.238 21.370  22.840  1.00 47.91  ? 9   SER L CB  1 
ATOM   5160 O  OG  . SER D 4  9   ? -35.504 22.011  21.817  1.00 48.96  ? 9   SER L OG  1 
ATOM   5161 N  N   . VAL D 4  10  ? -39.630 22.096  24.169  1.00 45.49  ? 11  VAL L N   1 
ATOM   5162 C  CA  . VAL D 4  10  ? -40.520 23.128  24.653  1.00 47.49  ? 11  VAL L CA  1 
ATOM   5163 C  C   . VAL D 4  10  ? -40.366 23.256  26.174  1.00 49.20  ? 11  VAL L C   1 
ATOM   5164 O  O   . VAL D 4  10  ? -40.157 22.260  26.865  1.00 49.46  ? 11  VAL L O   1 
ATOM   5165 C  CB  . VAL D 4  10  ? -41.959 22.795  24.306  1.00 46.53  ? 11  VAL L CB  1 
ATOM   5166 C  CG1 . VAL D 4  10  ? -42.150 22.740  22.783  1.00 50.62  ? 11  VAL L CG1 1 
ATOM   5167 C  CG2 . VAL D 4  10  ? -42.347 21.487  24.957  1.00 45.99  ? 11  VAL L CG2 1 
ATOM   5168 N  N   . SER D 4  11  ? -40.461 24.481  26.692  1.00 49.96  ? 12  SER L N   1 
ATOM   5169 C  CA  . SER D 4  11  ? -40.164 24.747  28.111  1.00 48.13  ? 12  SER L CA  1 
ATOM   5170 C  C   . SER D 4  11  ? -41.179 25.650  28.780  1.00 45.76  ? 12  SER L C   1 
ATOM   5171 O  O   . SER D 4  11  ? -41.849 26.439  28.141  1.00 44.87  ? 12  SER L O   1 
ATOM   5172 C  CB  . SER D 4  11  ? -38.797 25.382  28.213  1.00 46.96  ? 12  SER L CB  1 
ATOM   5173 O  OG  . SER D 4  11  ? -38.555 26.085  27.017  1.00 49.11  ? 12  SER L OG  1 
ATOM   5174 N  N   . ALA D 4  12  ? -41.307 25.506  30.085  1.00 46.21  ? 13  ALA L N   1 
ATOM   5175 C  CA  . ALA D 4  12  ? -42.130 26.428  30.855  1.00 46.37  ? 13  ALA L CA  1 
ATOM   5176 C  C   . ALA D 4  12  ? -41.732 26.371  32.335  1.00 44.30  ? 13  ALA L C   1 
ATOM   5177 O  O   . ALA D 4  12  ? -40.731 25.739  32.681  1.00 45.24  ? 13  ALA L O   1 
ATOM   5178 C  CB  . ALA D 4  12  ? -43.624 26.119  30.644  1.00 43.48  ? 13  ALA L CB  1 
ATOM   5179 N  N   . ALA D 4  13  ? -42.523 27.030  33.177  1.00 41.50  ? 14  ALA L N   1 
ATOM   5180 C  CA  . ALA D 4  13  ? -42.286 27.127  34.615  1.00 41.70  ? 14  ALA L CA  1 
ATOM   5181 C  C   . ALA D 4  13  ? -43.362 26.346  35.401  1.00 41.68  ? 14  ALA L C   1 
ATOM   5182 O  O   . ALA D 4  13  ? -44.469 26.116  34.898  1.00 41.28  ? 14  ALA L O   1 
ATOM   5183 C  CB  . ALA D 4  13  ? -42.283 28.615  35.037  1.00 38.22  ? 14  ALA L CB  1 
ATOM   5184 N  N   . PRO D 4  14  ? -43.051 25.931  36.637  1.00 41.55  ? 15  PRO L N   1 
ATOM   5185 C  CA  . PRO D 4  14  ? -44.101 25.256  37.407  1.00 43.73  ? 15  PRO L CA  1 
ATOM   5186 C  C   . PRO D 4  14  ? -45.478 25.974  37.403  1.00 45.29  ? 15  PRO L C   1 
ATOM   5187 O  O   . PRO D 4  14  ? -45.545 27.192  37.584  1.00 45.30  ? 15  PRO L O   1 
ATOM   5188 C  CB  . PRO D 4  14  ? -43.503 25.176  38.818  1.00 43.23  ? 15  PRO L CB  1 
ATOM   5189 C  CG  . PRO D 4  14  ? -42.016 25.080  38.588  1.00 41.73  ? 15  PRO L CG  1 
ATOM   5190 C  CD  . PRO D 4  14  ? -41.718 25.722  37.230  1.00 41.91  ? 15  PRO L CD  1 
ATOM   5191 N  N   . GLY D 4  15  ? -46.555 25.212  37.186  1.00 45.20  ? 16  GLY L N   1 
ATOM   5192 C  CA  . GLY D 4  15  ? -47.908 25.778  37.056  1.00 44.49  ? 16  GLY L CA  1 
ATOM   5193 C  C   . GLY D 4  15  ? -48.264 26.232  35.641  1.00 43.39  ? 16  GLY L C   1 
ATOM   5194 O  O   . GLY D 4  15  ? -49.430 26.191  35.262  1.00 46.03  ? 16  GLY L O   1 
ATOM   5195 N  N   . GLN D 4  16  ? -47.259 26.679  34.881  1.00 41.07  ? 17  GLN L N   1 
ATOM   5196 C  CA  . GLN D 4  16  ? -47.371 27.091  33.468  1.00 43.28  ? 17  GLN L CA  1 
ATOM   5197 C  C   . GLN D 4  16  ? -47.874 25.953  32.508  1.00 46.83  ? 17  GLN L C   1 
ATOM   5198 O  O   . GLN D 4  16  ? -47.979 24.764  32.903  1.00 46.90  ? 17  GLN L O   1 
ATOM   5199 C  CB  . GLN D 4  16  ? -45.973 27.592  33.047  1.00 42.78  ? 17  GLN L CB  1 
ATOM   5200 C  CG  . GLN D 4  16  ? -45.797 28.354  31.738  1.00 42.77  ? 17  GLN L CG  1 
ATOM   5201 C  CD  . GLN D 4  16  ? -44.584 29.320  31.773  1.00 45.94  ? 17  GLN L CD  1 
ATOM   5202 O  OE1 . GLN D 4  16  ? -44.219 29.815  32.836  1.00 56.80  ? 17  GLN L OE1 1 
ATOM   5203 N  NE2 . GLN D 4  16  ? -43.973 29.589  30.613  1.00 44.36  ? 17  GLN L NE2 1 
ATOM   5204 N  N   . LYS D 4  17  ? -48.185 26.327  31.257  1.00 47.11  ? 18  LYS L N   1 
ATOM   5205 C  CA  . LYS D 4  17  ? -48.743 25.400  30.259  1.00 44.53  ? 18  LYS L CA  1 
ATOM   5206 C  C   . LYS D 4  17  ? -47.936 25.391  28.965  1.00 44.60  ? 18  LYS L C   1 
ATOM   5207 O  O   . LYS D 4  17  ? -47.577 26.436  28.418  1.00 43.35  ? 18  LYS L O   1 
ATOM   5208 C  CB  . LYS D 4  17  ? -50.191 25.737  29.927  1.00 45.38  ? 18  LYS L CB  1 
ATOM   5209 N  N   . VAL D 4  18  ? -47.637 24.188  28.482  1.00 44.06  ? 19  VAL L N   1 
ATOM   5210 C  CA  . VAL D 4  18  ? -46.979 24.045  27.197  1.00 42.81  ? 19  VAL L CA  1 
ATOM   5211 C  C   . VAL D 4  18  ? -47.769 23.070  26.308  1.00 40.34  ? 19  VAL L C   1 
ATOM   5212 O  O   . VAL D 4  18  ? -48.559 22.243  26.792  1.00 32.13  ? 19  VAL L O   1 
ATOM   5213 C  CB  . VAL D 4  18  ? -45.500 23.627  27.386  1.00 43.40  ? 19  VAL L CB  1 
ATOM   5214 C  CG1 . VAL D 4  18  ? -45.365 22.118  27.378  1.00 44.92  ? 19  VAL L CG1 1 
ATOM   5215 C  CG2 . VAL D 4  18  ? -44.620 24.290  26.316  1.00 42.79  ? 19  VAL L CG2 1 
ATOM   5216 N  N   . THR D 4  19  ? -47.599 23.230  25.000  1.00 41.27  ? 20  THR L N   1 
ATOM   5217 C  CA  . THR D 4  19  ? -48.257 22.361  24.045  1.00 38.59  ? 20  THR L CA  1 
ATOM   5218 C  C   . THR D 4  19  ? -47.199 21.844  23.120  1.00 38.75  ? 20  THR L C   1 
ATOM   5219 O  O   . THR D 4  19  ? -46.305 22.590  22.686  1.00 38.02  ? 20  THR L O   1 
ATOM   5220 C  CB  . THR D 4  19  ? -49.356 23.065  23.208  1.00 38.75  ? 20  THR L CB  1 
ATOM   5221 O  OG1 . THR D 4  19  ? -48.752 23.923  22.248  1.00 40.96  ? 20  THR L OG1 1 
ATOM   5222 C  CG2 . THR D 4  19  ? -50.290 23.855  24.059  1.00 34.05  ? 20  THR L CG2 1 
ATOM   5223 N  N   . ILE D 4  20  ? -47.294 20.546  22.843  1.00 38.50  ? 21  ILE L N   1 
ATOM   5224 C  CA  . ILE D 4  20  ? -46.400 19.861  21.933  1.00 36.22  ? 21  ILE L CA  1 
ATOM   5225 C  C   . ILE D 4  20  ? -47.253 19.456  20.723  1.00 36.54  ? 21  ILE L C   1 
ATOM   5226 O  O   . ILE D 4  20  ? -48.290 18.821  20.870  1.00 36.51  ? 21  ILE L O   1 
ATOM   5227 C  CB  . ILE D 4  20  ? -45.751 18.622  22.614  1.00 38.37  ? 21  ILE L CB  1 
ATOM   5228 C  CG1 . ILE D 4  20  ? -44.868 19.050  23.810  1.00 39.01  ? 21  ILE L CG1 1 
ATOM   5229 C  CG2 . ILE D 4  20  ? -44.904 17.843  21.600  1.00 33.74  ? 21  ILE L CG2 1 
ATOM   5230 C  CD1 . ILE D 4  20  ? -44.673 17.992  24.920  1.00 25.01  ? 21  ILE L CD1 1 
ATOM   5231 N  N   . SER D 4  21  ? -46.830 19.851  19.532  1.00 36.84  ? 22  SER L N   1 
ATOM   5232 C  CA  . SER D 4  21  ? -47.617 19.614  18.334  1.00 38.73  ? 22  SER L CA  1 
ATOM   5233 C  C   . SER D 4  21  ? -47.096 18.386  17.573  1.00 36.76  ? 22  SER L C   1 
ATOM   5234 O  O   . SER D 4  21  ? -45.919 18.022  17.686  1.00 35.92  ? 22  SER L O   1 
ATOM   5235 C  CB  . SER D 4  21  ? -47.589 20.865  17.444  1.00 38.49  ? 22  SER L CB  1 
ATOM   5236 O  OG  . SER D 4  21  ? -46.260 21.162  17.039  1.00 43.71  ? 22  SER L OG  1 
ATOM   5237 N  N   . CYS D 4  22  ? -47.968 17.741  16.799  1.00 37.66  ? 23  CYS L N   1 
ATOM   5238 C  CA  . CYS D 4  22  ? -47.558 16.566  16.007  1.00 37.39  ? 23  CYS L CA  1 
ATOM   5239 C  C   . CYS D 4  22  ? -48.141 16.656  14.611  1.00 35.83  ? 23  CYS L C   1 
ATOM   5240 O  O   . CYS D 4  22  ? -49.324 16.488  14.433  1.00 36.00  ? 23  CYS L O   1 
ATOM   5241 C  CB  . CYS D 4  22  ? -48.019 15.284  16.711  1.00 39.36  ? 23  CYS L CB  1 
ATOM   5242 S  SG  . CYS D 4  22  ? -47.626 13.741  15.833  1.00 42.74  ? 23  CYS L SG  1 
ATOM   5243 N  N   . SER D 4  23  ? -47.311 16.934  13.619  1.00 38.14  ? 24  SER L N   1 
ATOM   5244 C  CA  . SER D 4  23  ? -47.803 17.166  12.249  1.00 40.57  ? 24  SER L CA  1 
ATOM   5245 C  C   . SER D 4  23  ? -47.531 15.955  11.344  1.00 38.77  ? 24  SER L C   1 
ATOM   5246 O  O   . SER D 4  23  ? -46.403 15.474  11.273  1.00 38.07  ? 24  SER L O   1 
ATOM   5247 C  CB  . SER D 4  23  ? -47.144 18.427  11.644  1.00 40.36  ? 24  SER L CB  1 
ATOM   5248 O  OG  . SER D 4  23  ? -47.357 18.486  10.239  1.00 46.27  ? 24  SER L OG  1 
ATOM   5249 N  N   . GLY D 4  24  ? -48.548 15.484  10.637  1.00 37.32  ? 25  GLY L N   1 
ATOM   5250 C  CA  . GLY D 4  24  ? -48.357 14.349  9.749   1.00 39.42  ? 25  GLY L CA  1 
ATOM   5251 C  C   . GLY D 4  24  ? -48.895 14.562  8.352   1.00 40.12  ? 25  GLY L C   1 
ATOM   5252 O  O   . GLY D 4  24  ? -48.569 15.540  7.691   1.00 38.58  ? 25  GLY L O   1 
ATOM   5253 N  N   . SER D 4  25  ? -49.708 13.617  7.894   1.00 41.68  ? 26  SER L N   1 
ATOM   5254 C  CA  . SER D 4  25  ? -50.288 13.688  6.558   1.00 42.36  ? 26  SER L CA  1 
ATOM   5255 C  C   . SER D 4  25  ? -51.594 12.923  6.578   1.00 41.48  ? 26  SER L C   1 
ATOM   5256 O  O   . SER D 4  25  ? -52.003 12.419  7.631   1.00 39.82  ? 26  SER L O   1 
ATOM   5257 C  CB  . SER D 4  25  ? -49.333 13.093  5.522   1.00 42.05  ? 26  SER L CB  1 
ATOM   5258 O  OG  . SER D 4  25  ? -49.454 11.673  5.478   1.00 46.69  ? 26  SER L OG  1 
ATOM   5259 N  N   . SER D 4  26  ? -52.234 12.818  5.412   1.00 41.50  ? 27  SER L N   1 
ATOM   5260 C  CA  . SER D 4  26  ? -53.591 12.272  5.321   1.00 40.07  ? 27  SER L CA  1 
ATOM   5261 C  C   . SER D 4  26  ? -53.615 10.750  5.460   1.00 39.15  ? 27  SER L C   1 
ATOM   5262 O  O   . SER D 4  26  ? -54.619 10.174  5.880   1.00 38.18  ? 27  SER L O   1 
ATOM   5263 C  CB  . SER D 4  26  ? -54.259 12.698  4.003   1.00 40.88  ? 27  SER L CB  1 
ATOM   5264 O  OG  . SER D 4  26  ? -54.006 11.742  2.991   1.00 39.81  ? 27  SER L OG  1 
ATOM   5265 N  N   . SER D 4  27  A -52.517 10.093  5.100   1.00 40.58  ? 27  SER L N   1 
ATOM   5266 C  CA  . SER D 4  27  A -52.438 8.638   5.272   1.00 40.75  ? 27  SER L CA  1 
ATOM   5267 C  C   . SER D 4  27  A -52.252 8.248   6.753   1.00 38.90  ? 27  SER L C   1 
ATOM   5268 O  O   . SER D 4  27  A -52.631 7.145   7.162   1.00 37.24  ? 27  SER L O   1 
ATOM   5269 C  CB  . SER D 4  27  A -51.347 8.022   4.384   1.00 41.79  ? 27  SER L CB  1 
ATOM   5270 O  OG  . SER D 4  27  A -50.106 8.697   4.527   1.00 46.95  ? 27  SER L OG  1 
ATOM   5271 N  N   . ASN D 4  28  B -51.712 9.151   7.567   1.00 37.25  ? 27  ASN L N   1 
ATOM   5272 C  CA  . ASN D 4  28  B -51.506 8.823   8.990   1.00 36.67  ? 27  ASN L CA  1 
ATOM   5273 C  C   . ASN D 4  28  B -52.414 9.587   9.983   1.00 32.39  ? 27  ASN L C   1 
ATOM   5274 O  O   . ASN D 4  28  B -53.468 9.102   10.350  1.00 28.43  ? 27  ASN L O   1 
ATOM   5275 C  CB  . ASN D 4  28  B -50.000 8.869   9.360   1.00 37.41  ? 27  ASN L CB  1 
ATOM   5276 C  CG  . ASN D 4  28  B -49.347 10.185  9.009   1.00 35.79  ? 27  ASN L CG  1 
ATOM   5277 O  OD1 . ASN D 4  28  B -49.753 11.229  9.511   1.00 30.04  ? 27  ASN L OD1 1 
ATOM   5278 N  ND2 . ASN D 4  28  B -48.335 10.146  8.150   1.00 33.35  ? 27  ASN L ND2 1 
ATOM   5279 N  N   . ILE D 4  29  ? -52.032 10.774  10.419  1.00 34.58  ? 28  ILE L N   1 
ATOM   5280 C  CA  . ILE D 4  29  ? -52.867 11.495  11.402  1.00 36.28  ? 28  ILE L CA  1 
ATOM   5281 C  C   . ILE D 4  29  ? -54.263 11.820  10.819  1.00 36.91  ? 28  ILE L C   1 
ATOM   5282 O  O   . ILE D 4  29  ? -55.271 11.769  11.525  1.00 33.83  ? 28  ILE L O   1 
ATOM   5283 C  CB  . ILE D 4  29  ? -52.163 12.749  11.909  1.00 35.17  ? 28  ILE L CB  1 
ATOM   5284 C  CG1 . ILE D 4  29  ? -50.881 12.333  12.668  1.00 39.84  ? 28  ILE L CG1 1 
ATOM   5285 C  CG2 . ILE D 4  29  ? -53.094 13.546  12.821  1.00 36.41  ? 28  ILE L CG2 1 
ATOM   5286 C  CD1 . ILE D 4  29  ? -50.095 13.482  13.250  1.00 42.85  ? 28  ILE L CD1 1 
ATOM   5287 N  N   . GLY D 4  30  ? -54.301 12.096  9.517   1.00 38.61  ? 29  GLY L N   1 
ATOM   5288 C  CA  . GLY D 4  30  ? -55.533 12.431  8.831   1.00 41.04  ? 29  GLY L CA  1 
ATOM   5289 C  C   . GLY D 4  30  ? -56.697 11.494  9.095   1.00 42.64  ? 29  GLY L C   1 
ATOM   5290 O  O   . GLY D 4  30  ? -57.810 11.958  9.336   1.00 43.22  ? 29  GLY L O   1 
ATOM   5291 N  N   . ASN D 4  31  ? -56.460 10.180  9.062   1.00 42.76  ? 30  ASN L N   1 
ATOM   5292 C  CA  . ASN D 4  31  ? -57.566 9.228   9.217   1.00 42.15  ? 30  ASN L CA  1 
ATOM   5293 C  C   . ASN D 4  31  ? -57.353 8.136   10.269  1.00 38.65  ? 30  ASN L C   1 
ATOM   5294 O  O   . ASN D 4  31  ? -57.921 7.038   10.161  1.00 36.09  ? 30  ASN L O   1 
ATOM   5295 C  CB  . ASN D 4  31  ? -57.936 8.615   7.849   1.00 43.39  ? 30  ASN L CB  1 
ATOM   5296 C  CG  . ASN D 4  31  ? -58.656 9.600   6.940   1.00 48.28  ? 30  ASN L CG  1 
ATOM   5297 O  OD1 . ASN D 4  31  ? -59.782 10.011  7.222   1.00 56.16  ? 30  ASN L OD1 1 
ATOM   5298 N  ND2 . ASN D 4  31  ? -58.012 9.975   5.838   1.00 48.03  ? 30  ASN L ND2 1 
ATOM   5299 N  N   . ASP D 4  32  ? -56.574 8.451   11.303  1.00 38.26  ? 31  ASP L N   1 
ATOM   5300 C  CA  . ASP D 4  32  ? -56.295 7.502   12.374  1.00 37.41  ? 31  ASP L CA  1 
ATOM   5301 C  C   . ASP D 4  32  ? -56.223 8.198   13.753  1.00 39.61  ? 31  ASP L C   1 
ATOM   5302 O  O   . ASP D 4  32  ? -56.073 9.427   13.848  1.00 38.70  ? 31  ASP L O   1 
ATOM   5303 C  CB  . ASP D 4  32  ? -54.970 6.808   12.071  1.00 38.26  ? 31  ASP L CB  1 
ATOM   5304 C  CG  . ASP D 4  32  ? -54.965 6.129   10.717  1.00 40.55  ? 31  ASP L CG  1 
ATOM   5305 O  OD1 . ASP D 4  32  ? -54.517 6.744   9.713   1.00 44.73  ? 31  ASP L OD1 1 
ATOM   5306 O  OD2 . ASP D 4  32  ? -55.433 4.982   10.655  1.00 31.57  ? 31  ASP L OD2 1 
ATOM   5307 N  N   . TYR D 4  33  ? -56.291 7.397   14.814  1.00 39.15  ? 32  TYR L N   1 
ATOM   5308 C  CA  . TYR D 4  33  ? -56.245 7.906   16.184  1.00 36.90  ? 32  TYR L CA  1 
ATOM   5309 C  C   . TYR D 4  33  ? -54.790 8.145   16.568  1.00 38.91  ? 32  TYR L C   1 
ATOM   5310 O  O   . TYR D 4  33  ? -53.870 7.496   16.007  1.00 36.05  ? 32  TYR L O   1 
ATOM   5311 C  CB  . TYR D 4  33  ? -56.915 6.925   17.141  1.00 36.70  ? 32  TYR L CB  1 
ATOM   5312 C  CG  . TYR D 4  33  ? -58.400 6.814   16.913  1.00 42.16  ? 32  TYR L CG  1 
ATOM   5313 C  CD1 . TYR D 4  33  ? -59.274 7.756   17.444  1.00 40.32  ? 32  TYR L CD1 1 
ATOM   5314 C  CD2 . TYR D 4  33  ? -58.924 5.800   16.119  1.00 43.90  ? 32  TYR L CD2 1 
ATOM   5315 C  CE1 . TYR D 4  33  ? -60.627 7.673   17.228  1.00 44.49  ? 32  TYR L CE1 1 
ATOM   5316 C  CE2 . TYR D 4  33  ? -60.281 5.707   15.897  1.00 51.60  ? 32  TYR L CE2 1 
ATOM   5317 C  CZ  . TYR D 4  33  ? -61.133 6.657   16.452  1.00 49.76  ? 32  TYR L CZ  1 
ATOM   5318 O  OH  . TYR D 4  33  ? -62.485 6.587   16.225  1.00 50.09  ? 32  TYR L OH  1 
ATOM   5319 N  N   . VAL D 4  34  ? -54.574 9.108   17.477  1.00 35.78  ? 33  VAL L N   1 
ATOM   5320 C  CA  . VAL D 4  34  ? -53.213 9.504   17.862  1.00 33.91  ? 33  VAL L CA  1 
ATOM   5321 C  C   . VAL D 4  34  ? -53.023 9.164   19.314  1.00 31.78  ? 33  VAL L C   1 
ATOM   5322 O  O   . VAL D 4  34  ? -53.901 9.354   20.127  1.00 29.18  ? 33  VAL L O   1 
ATOM   5323 C  CB  . VAL D 4  34  ? -52.943 11.007  17.556  1.00 35.80  ? 33  VAL L CB  1 
ATOM   5324 C  CG1 . VAL D 4  34  ? -51.562 11.508  18.130  1.00 31.69  ? 33  VAL L CG1 1 
ATOM   5325 C  CG2 . VAL D 4  34  ? -52.969 11.219  16.027  1.00 29.70  ? 33  VAL L CG2 1 
ATOM   5326 N  N   . SER D 4  35  ? -51.878 8.607   19.636  1.00 31.68  ? 34  SER L N   1 
ATOM   5327 C  CA  . SER D 4  35  ? -51.565 8.308   21.021  1.00 31.59  ? 34  SER L CA  1 
ATOM   5328 C  C   . SER D 4  35  ? -50.314 9.089   21.407  1.00 30.34  ? 34  SER L C   1 
ATOM   5329 O  O   . SER D 4  35  ? -49.567 9.516   20.547  1.00 31.87  ? 34  SER L O   1 
ATOM   5330 C  CB  . SER D 4  35  ? -51.364 6.828   21.191  1.00 29.90  ? 34  SER L CB  1 
ATOM   5331 O  OG  . SER D 4  35  ? -52.598 6.147   21.332  1.00 36.25  ? 34  SER L OG  1 
ATOM   5332 N  N   . TRP D 4  36  ? -50.123 9.330   22.693  1.00 33.96  ? 35  TRP L N   1 
ATOM   5333 C  CA  . TRP D 4  36  ? -48.960 10.083  23.187  1.00 34.57  ? 35  TRP L CA  1 
ATOM   5334 C  C   . TRP D 4  36  ? -48.238 9.313   24.262  1.00 34.58  ? 35  TRP L C   1 
ATOM   5335 O  O   . TRP D 4  36  ? -48.868 8.684   25.136  1.00 32.42  ? 35  TRP L O   1 
ATOM   5336 C  CB  . TRP D 4  36  ? -49.420 11.408  23.813  1.00 38.17  ? 35  TRP L CB  1 
ATOM   5337 C  CG  . TRP D 4  36  ? -49.838 12.402  22.804  1.00 31.76  ? 35  TRP L CG  1 
ATOM   5338 C  CD1 . TRP D 4  36  ? -51.106 12.614  22.346  1.00 31.22  ? 35  TRP L CD1 1 
ATOM   5339 C  CD2 . TRP D 4  36  ? -48.991 13.269  22.064  1.00 36.87  ? 35  TRP L CD2 1 
ATOM   5340 N  NE1 . TRP D 4  36  ? -51.103 13.616  21.414  1.00 32.31  ? 35  TRP L NE1 1 
ATOM   5341 C  CE2 . TRP D 4  36  ? -49.823 14.037  21.213  1.00 40.04  ? 35  TRP L CE2 1 
ATOM   5342 C  CE3 . TRP D 4  36  ? -47.618 13.541  22.090  1.00 35.10  ? 35  TRP L CE3 1 
ATOM   5343 C  CZ2 . TRP D 4  36  ? -49.324 15.041  20.370  1.00 39.65  ? 35  TRP L CZ2 1 
ATOM   5344 C  CZ3 . TRP D 4  36  ? -47.122 14.508  21.225  1.00 37.29  ? 35  TRP L CZ3 1 
ATOM   5345 C  CH2 . TRP D 4  36  ? -47.974 15.256  20.390  1.00 35.78  ? 35  TRP L CH2 1 
ATOM   5346 N  N   . TYR D 4  37  ? -46.919 9.400   24.243  1.00 32.48  ? 36  TYR L N   1 
ATOM   5347 C  CA  . TYR D 4  37  ? -46.144 8.629   25.206  1.00 31.38  ? 36  TYR L CA  1 
ATOM   5348 C  C   . TYR D 4  37  ? -45.151 9.558   25.925  1.00 34.73  ? 36  TYR L C   1 
ATOM   5349 O  O   . TYR D 4  37  ? -44.520 10.438  25.283  1.00 33.03  ? 36  TYR L O   1 
ATOM   5350 C  CB  . TYR D 4  37  ? -45.401 7.516   24.458  1.00 33.16  ? 36  TYR L CB  1 
ATOM   5351 C  CG  . TYR D 4  37  ? -46.322 6.465   23.871  1.00 31.56  ? 36  TYR L CG  1 
ATOM   5352 C  CD1 . TYR D 4  37  ? -46.719 5.376   24.629  1.00 38.63  ? 36  TYR L CD1 1 
ATOM   5353 C  CD2 . TYR D 4  37  ? -46.826 6.587   22.589  1.00 33.35  ? 36  TYR L CD2 1 
ATOM   5354 C  CE1 . TYR D 4  37  ? -47.555 4.422   24.128  1.00 37.80  ? 36  TYR L CE1 1 
ATOM   5355 C  CE2 . TYR D 4  37  ? -47.694 5.625   22.051  1.00 28.36  ? 36  TYR L CE2 1 
ATOM   5356 C  CZ  . TYR D 4  37  ? -48.053 4.540   22.822  1.00 31.12  ? 36  TYR L CZ  1 
ATOM   5357 O  OH  . TYR D 4  37  ? -48.912 3.566   22.353  1.00 30.48  ? 36  TYR L OH  1 
ATOM   5358 N  N   . GLN D 4  38  ? -45.048 9.375   27.246  1.00 30.98  ? 37  GLN L N   1 
ATOM   5359 C  CA  . GLN D 4  38  ? -44.027 10.017  28.033  1.00 33.33  ? 37  GLN L CA  1 
ATOM   5360 C  C   . GLN D 4  38  ? -42.868 9.096   28.332  1.00 33.60  ? 37  GLN L C   1 
ATOM   5361 O  O   . GLN D 4  38  ? -43.068 7.951   28.743  1.00 37.95  ? 37  GLN L O   1 
ATOM   5362 C  CB  . GLN D 4  38  ? -44.597 10.414  29.390  1.00 34.37  ? 37  GLN L CB  1 
ATOM   5363 C  CG  . GLN D 4  38  ? -43.572 11.089  30.304  1.00 30.92  ? 37  GLN L CG  1 
ATOM   5364 C  CD  . GLN D 4  38  ? -44.139 11.516  31.616  1.00 33.66  ? 37  GLN L CD  1 
ATOM   5365 O  OE1 . GLN D 4  38  ? -44.572 10.683  32.412  1.00 33.84  ? 37  GLN L OE1 1 
ATOM   5366 N  NE2 . GLN D 4  38  ? -44.125 12.828  31.871  1.00 38.10  ? 37  GLN L NE2 1 
ATOM   5367 N  N   . GLN D 4  39  ? -41.659 9.613   28.244  1.00 33.82  ? 38  GLN L N   1 
ATOM   5368 C  CA  . GLN D 4  39  ? -40.483 8.817   28.624  1.00 34.89  ? 38  GLN L CA  1 
ATOM   5369 C  C   . GLN D 4  39  ? -39.491 9.569   29.486  1.00 33.83  ? 38  GLN L C   1 
ATOM   5370 O  O   . GLN D 4  39  ? -38.825 10.479  29.019  1.00 35.23  ? 38  GLN L O   1 
ATOM   5371 C  CB  . GLN D 4  39  ? -39.752 8.303   27.378  1.00 34.60  ? 38  GLN L CB  1 
ATOM   5372 C  CG  . GLN D 4  39  ? -38.676 7.307   27.709  1.00 35.94  ? 38  GLN L CG  1 
ATOM   5373 C  CD  . GLN D 4  39  ? -38.065 6.713   26.473  1.00 39.89  ? 38  GLN L CD  1 
ATOM   5374 O  OE1 . GLN D 4  39  ? -37.977 7.378   25.466  1.00 33.38  ? 38  GLN L OE1 1 
ATOM   5375 N  NE2 . GLN D 4  39  ? -37.613 5.462   26.552  1.00 29.48  ? 38  GLN L NE2 1 
ATOM   5376 N  N   . LEU D 4  40  ? -39.352 9.127   30.727  1.00 36.93  ? 39  LEU L N   1 
ATOM   5377 C  CA  . LEU D 4  40  ? -38.296 9.597   31.628  1.00 38.39  ? 39  LEU L CA  1 
ATOM   5378 C  C   . LEU D 4  40  ? -36.978 8.916   31.295  1.00 38.05  ? 39  LEU L C   1 
ATOM   5379 O  O   . LEU D 4  40  ? -36.964 7.905   30.608  1.00 40.50  ? 39  LEU L O   1 
ATOM   5380 C  CB  . LEU D 4  40  ? -38.648 9.254   33.080  1.00 39.53  ? 39  LEU L CB  1 
ATOM   5381 C  CG  . LEU D 4  40  ? -40.077 9.442   33.616  1.00 40.97  ? 39  LEU L CG  1 
ATOM   5382 C  CD1 . LEU D 4  40  ? -40.018 9.750   35.124  1.00 43.80  ? 39  LEU L CD1 1 
ATOM   5383 C  CD2 . LEU D 4  40  ? -40.802 10.541  32.901  1.00 45.55  ? 39  LEU L CD2 1 
ATOM   5384 N  N   . PRO D 4  41  ? -35.855 9.447   31.800  1.00 37.63  ? 40  PRO L N   1 
ATOM   5385 C  CA  . PRO D 4  41  ? -34.580 8.754   31.598  1.00 36.48  ? 40  PRO L CA  1 
ATOM   5386 C  C   . PRO D 4  41  ? -34.572 7.362   32.195  1.00 35.71  ? 40  PRO L C   1 
ATOM   5387 O  O   . PRO D 4  41  ? -35.122 7.159   33.282  1.00 36.48  ? 40  PRO L O   1 
ATOM   5388 C  CB  . PRO D 4  41  ? -33.572 9.643   32.352  1.00 36.78  ? 40  PRO L CB  1 
ATOM   5389 C  CG  . PRO D 4  41  ? -34.181 10.980  32.318  1.00 37.51  ? 40  PRO L CG  1 
ATOM   5390 C  CD  . PRO D 4  41  ? -35.663 10.774  32.414  1.00 35.90  ? 40  PRO L CD  1 
ATOM   5391 N  N   . GLY D 4  42  ? -33.944 6.424   31.487  1.00 35.16  ? 41  GLY L N   1 
ATOM   5392 C  CA  . GLY D 4  42  ? -33.850 5.042   31.920  1.00 33.09  ? 41  GLY L CA  1 
ATOM   5393 C  C   . GLY D 4  42  ? -35.165 4.282   32.076  1.00 34.64  ? 41  GLY L C   1 
ATOM   5394 O  O   . GLY D 4  42  ? -35.210 3.256   32.751  1.00 36.63  ? 41  GLY L O   1 
ATOM   5395 N  N   . THR D 4  43  ? -36.245 4.739   31.461  1.00 35.35  ? 42  THR L N   1 
ATOM   5396 C  CA  . THR D 4  43  ? -37.484 3.959   31.546  1.00 38.59  ? 42  THR L CA  1 
ATOM   5397 C  C   . THR D 4  43  ? -38.184 3.859   30.202  1.00 33.45  ? 42  THR L C   1 
ATOM   5398 O  O   . THR D 4  43  ? -37.867 4.580   29.240  1.00 33.24  ? 42  THR L O   1 
ATOM   5399 C  CB  . THR D 4  43  ? -38.470 4.522   32.638  1.00 38.23  ? 42  THR L CB  1 
ATOM   5400 O  OG1 . THR D 4  43  ? -38.694 5.905   32.393  1.00 46.96  ? 42  THR L OG1 1 
ATOM   5401 C  CG2 . THR D 4  43  ? -37.879 4.379   34.033  1.00 47.86  ? 42  THR L CG2 1 
ATOM   5402 N  N   . ALA D 4  44  ? -39.153 2.951   30.160  1.00 31.08  ? 43  ALA L N   1 
ATOM   5403 C  CA  . ALA D 4  44  ? -39.898 2.638   28.926  1.00 28.77  ? 43  ALA L CA  1 
ATOM   5404 C  C   . ALA D 4  44  ? -40.906 3.734   28.672  1.00 31.14  ? 43  ALA L C   1 
ATOM   5405 O  O   . ALA D 4  44  ? -41.450 4.286   29.637  1.00 30.61  ? 43  ALA L O   1 
ATOM   5406 C  CB  . ALA D 4  44  ? -40.641 1.251   29.095  1.00 26.31  ? 43  ALA L CB  1 
ATOM   5407 N  N   . PRO D 4  45  ? -41.195 4.032   27.385  1.00 30.12  ? 44  PRO L N   1 
ATOM   5408 C  CA  . PRO D 4  45  ? -42.294 4.900   27.105  1.00 29.02  ? 44  PRO L CA  1 
ATOM   5409 C  C   . PRO D 4  45  ? -43.528 4.470   27.885  1.00 30.60  ? 44  PRO L C   1 
ATOM   5410 O  O   . PRO D 4  45  ? -43.736 3.296   28.085  1.00 32.10  ? 44  PRO L O   1 
ATOM   5411 C  CB  . PRO D 4  45  ? -42.504 4.744   25.577  1.00 32.63  ? 44  PRO L CB  1 
ATOM   5412 C  CG  . PRO D 4  45  ? -41.218 4.324   25.057  1.00 33.33  ? 44  PRO L CG  1 
ATOM   5413 C  CD  . PRO D 4  45  ? -40.648 3.438   26.148  1.00 28.82  ? 44  PRO L CD  1 
ATOM   5414 N  N   . LYS D 4  46  ? -44.298 5.447   28.361  1.00 32.74  ? 45  LYS L N   1 
ATOM   5415 C  CA  . LYS D 4  46  ? -45.496 5.239   29.155  1.00 33.85  ? 45  LYS L CA  1 
ATOM   5416 C  C   . LYS D 4  46  ? -46.620 5.980   28.457  1.00 34.82  ? 45  LYS L C   1 
ATOM   5417 O  O   . LYS D 4  46  ? -46.470 7.149   28.081  1.00 37.20  ? 45  LYS L O   1 
ATOM   5418 C  CB  . LYS D 4  46  ? -45.288 5.813   30.543  1.00 35.91  ? 45  LYS L CB  1 
ATOM   5419 C  CG  . LYS D 4  46  ? -46.434 5.665   31.493  1.00 36.68  ? 45  LYS L CG  1 
ATOM   5420 C  CD  . LYS D 4  46  ? -46.298 6.589   32.746  1.00 44.32  ? 45  LYS L CD  1 
ATOM   5421 C  CE  . LYS D 4  46  ? -47.288 6.148   33.827  1.00 51.22  ? 45  LYS L CE  1 
ATOM   5422 N  NZ  . LYS D 4  46  ? -47.129 6.856   35.152  1.00 48.44  ? 45  LYS L NZ  1 
ATOM   5423 N  N   . LEU D 4  47  ? -47.750 5.305   28.299  1.00 34.61  ? 46  LEU L N   1 
ATOM   5424 C  CA  . LEU D 4  47  ? -48.896 5.851   27.581  1.00 33.28  ? 46  LEU L CA  1 
ATOM   5425 C  C   . LEU D 4  47  ? -49.592 6.954   28.397  1.00 32.73  ? 46  LEU L C   1 
ATOM   5426 O  O   . LEU D 4  47  ? -50.014 6.738   29.530  1.00 28.10  ? 46  LEU L O   1 
ATOM   5427 C  CB  . LEU D 4  47  ? -49.896 4.724   27.273  1.00 33.80  ? 46  LEU L CB  1 
ATOM   5428 C  CG  . LEU D 4  47  ? -51.225 5.091   26.599  1.00 33.38  ? 46  LEU L CG  1 
ATOM   5429 C  CD1 . LEU D 4  47  ? -50.929 5.432   25.197  1.00 18.65  ? 46  LEU L CD1 1 
ATOM   5430 C  CD2 . LEU D 4  47  ? -52.233 3.931   26.697  1.00 23.03  ? 46  LEU L CD2 1 
ATOM   5431 N  N   . LEU D 4  48  ? -49.754 8.108   27.775  1.00 31.84  ? 47  LEU L N   1 
ATOM   5432 C  CA  . LEU D 4  48  ? -50.403 9.247   28.401  1.00 33.75  ? 47  LEU L CA  1 
ATOM   5433 C  C   . LEU D 4  48  ? -51.821 9.475   27.842  1.00 33.11  ? 47  LEU L C   1 
ATOM   5434 O  O   . LEU D 4  48  ? -52.770 9.625   28.565  1.00 33.58  ? 47  LEU L O   1 
ATOM   5435 C  CB  . LEU D 4  48  ? -49.608 10.484  28.068  1.00 35.24  ? 47  LEU L CB  1 
ATOM   5436 C  CG  . LEU D 4  48  ? -48.256 10.702  28.694  1.00 34.72  ? 47  LEU L CG  1 
ATOM   5437 C  CD1 . LEU D 4  48  ? -47.740 11.929  28.040  1.00 32.25  ? 47  LEU L CD1 1 
ATOM   5438 C  CD2 . LEU D 4  48  ? -48.373 10.872  30.237  1.00 26.66  ? 47  LEU L CD2 1 
ATOM   5439 N  N   . ILE D 4  49  ? -51.934 9.474   26.532  1.00 33.89  ? 48  ILE L N   1 
ATOM   5440 C  CA  . ILE D 4  49  ? -53.211 9.695   25.819  1.00 33.23  ? 48  ILE L CA  1 
ATOM   5441 C  C   . ILE D 4  49  ? -53.371 8.655   24.713  1.00 31.23  ? 48  ILE L C   1 
ATOM   5442 O  O   . ILE D 4  49  ? -52.388 8.363   24.020  1.00 29.61  ? 48  ILE L O   1 
ATOM   5443 C  CB  . ILE D 4  49  ? -53.200 11.062  25.116  1.00 30.67  ? 48  ILE L CB  1 
ATOM   5444 C  CG1 . ILE D 4  49  ? -53.421 12.176  26.138  1.00 41.71  ? 48  ILE L CG1 1 
ATOM   5445 C  CG2 . ILE D 4  49  ? -54.250 11.145  24.018  1.00 30.44  ? 48  ILE L CG2 1 
ATOM   5446 C  CD1 . ILE D 4  49  ? -52.173 12.756  26.530  1.00 42.17  ? 48  ILE L CD1 1 
ATOM   5447 N  N   . TYR D 4  50  ? -54.580 8.108   24.560  1.00 31.43  ? 49  TYR L N   1 
ATOM   5448 C  CA  . TYR D 4  50  ? -54.936 7.304   23.383  1.00 33.26  ? 49  TYR L CA  1 
ATOM   5449 C  C   . TYR D 4  50  ? -56.285 7.712   22.828  1.00 36.49  ? 49  TYR L C   1 
ATOM   5450 O  O   . TYR D 4  50  ? -57.101 8.380   23.495  1.00 33.33  ? 49  TYR L O   1 
ATOM   5451 C  CB  . TYR D 4  50  ? -54.957 5.793   23.712  1.00 34.57  ? 49  TYR L CB  1 
ATOM   5452 C  CG  . TYR D 4  50  ? -56.018 5.385   24.726  1.00 30.64  ? 49  TYR L CG  1 
ATOM   5453 C  CD1 . TYR D 4  50  ? -55.887 5.708   26.061  1.00 36.32  ? 49  TYR L CD1 1 
ATOM   5454 C  CD2 . TYR D 4  50  ? -57.161 4.669   24.338  1.00 36.59  ? 49  TYR L CD2 1 
ATOM   5455 C  CE1 . TYR D 4  50  ? -56.888 5.358   26.999  1.00 32.75  ? 49  TYR L CE1 1 
ATOM   5456 C  CE2 . TYR D 4  50  ? -58.144 4.321   25.257  1.00 32.58  ? 49  TYR L CE2 1 
ATOM   5457 C  CZ  . TYR D 4  50  ? -57.989 4.665   26.587  1.00 36.92  ? 49  TYR L CZ  1 
ATOM   5458 O  OH  . TYR D 4  50  ? -58.938 4.322   27.514  1.00 38.46  ? 49  TYR L OH  1 
ATOM   5459 N  N   . ASP D 4  51  ? -56.528 7.291   21.593  1.00 35.82  ? 50  ASP L N   1 
ATOM   5460 C  CA  . ASP D 4  51  ? -57.729 7.666   20.887  1.00 32.35  ? 50  ASP L CA  1 
ATOM   5461 C  C   . ASP D 4  51  ? -57.852 9.192   20.873  1.00 33.94  ? 50  ASP L C   1 
ATOM   5462 O  O   . ASP D 4  51  ? -58.922 9.748   21.119  1.00 35.27  ? 50  ASP L O   1 
ATOM   5463 C  CB  . ASP D 4  51  ? -58.927 6.946   21.505  1.00 31.98  ? 50  ASP L CB  1 
ATOM   5464 C  CG  . ASP D 4  51  ? -58.960 5.445   21.171  1.00 34.76  ? 50  ASP L CG  1 
ATOM   5465 O  OD1 . ASP D 4  51  ? -58.064 4.942   20.421  1.00 35.12  ? 50  ASP L OD1 1 
ATOM   5466 O  OD2 . ASP D 4  51  ? -59.895 4.749   21.638  1.00 39.04  ? 50  ASP L OD2 1 
ATOM   5467 N  N   . ASN D 4  52  ? -56.738 9.864   20.568  1.00 34.10  ? 51  ASN L N   1 
ATOM   5468 C  CA  . ASN D 4  52  ? -56.670 11.335  20.429  1.00 32.27  ? 51  ASN L CA  1 
ATOM   5469 C  C   . ASN D 4  52  ? -56.681 12.121  21.757  1.00 32.81  ? 51  ASN L C   1 
ATOM   5470 O  O   . ASN D 4  52  ? -55.953 13.127  21.904  1.00 29.98  ? 51  ASN L O   1 
ATOM   5471 C  CB  . ASN D 4  52  ? -57.813 11.870  19.540  1.00 33.18  ? 51  ASN L CB  1 
ATOM   5472 C  CG  . ASN D 4  52  ? -57.775 11.331  18.105  1.00 34.22  ? 51  ASN L CG  1 
ATOM   5473 O  OD1 . ASN D 4  52  ? -56.724 11.007  17.559  1.00 30.76  ? 51  ASN L OD1 1 
ATOM   5474 N  ND2 . ASN D 4  52  ? -58.920 11.312  17.473  1.00 26.45  ? 51  ASN L ND2 1 
ATOM   5475 N  N   . ASN D 4  53  ? -57.530 11.691  22.696  1.00 31.97  ? 52  ASN L N   1 
ATOM   5476 C  CA  . ASN D 4  53  ? -57.777 12.452  23.903  1.00 35.53  ? 52  ASN L CA  1 
ATOM   5477 C  C   . ASN D 4  53  ? -58.211 11.688  25.162  1.00 36.50  ? 52  ASN L C   1 
ATOM   5478 O  O   . ASN D 4  53  ? -58.564 12.332  26.144  1.00 39.01  ? 52  ASN L O   1 
ATOM   5479 C  CB  . ASN D 4  53  ? -58.844 13.547  23.598  1.00 38.36  ? 52  ASN L CB  1 
ATOM   5480 C  CG  . ASN D 4  53  ? -60.164 12.958  23.065  1.00 36.08  ? 52  ASN L CG  1 
ATOM   5481 O  OD1 . ASN D 4  53  ? -60.436 11.771  23.217  1.00 41.82  ? 52  ASN L OD1 1 
ATOM   5482 N  ND2 . ASN D 4  53  ? -60.984 13.804  22.444  1.00 37.21  ? 52  ASN L ND2 1 
ATOM   5483 N  N   . LYS D 4  54  ? -58.224 10.353  25.149  1.00 37.11  ? 53  LYS L N   1 
ATOM   5484 C  CA  . LYS D 4  54  ? -58.574 9.571   26.356  1.00 35.32  ? 53  LYS L CA  1 
ATOM   5485 C  C   . LYS D 4  54  ? -57.338 9.329   27.206  1.00 37.47  ? 53  LYS L C   1 
ATOM   5486 O  O   . LYS D 4  54  ? -56.219 9.205   26.661  1.00 34.67  ? 53  LYS L O   1 
ATOM   5487 C  CB  . LYS D 4  54  ? -59.184 8.216   26.001  1.00 35.89  ? 53  LYS L CB  1 
ATOM   5488 C  CG  . LYS D 4  54  ? -60.488 8.241   25.184  1.00 40.59  ? 53  LYS L CG  1 
ATOM   5489 C  CD  . LYS D 4  54  ? -60.944 6.807   24.851  1.00 47.41  ? 53  LYS L CD  1 
ATOM   5490 C  CE  . LYS D 4  54  ? -62.280 6.739   24.101  1.00 49.50  ? 53  LYS L CE  1 
ATOM   5491 N  NZ  . LYS D 4  54  ? -62.506 5.389   23.489  1.00 40.52  ? 53  LYS L NZ  1 
ATOM   5492 N  N   . ARG D 4  55  ? -57.548 9.250   28.528  1.00 36.62  ? 54  ARG L N   1 
ATOM   5493 C  CA  . ARG D 4  55  ? -56.476 9.113   29.512  1.00 37.60  ? 54  ARG L CA  1 
ATOM   5494 C  C   . ARG D 4  55  ? -56.551 7.738   30.131  1.00 37.86  ? 54  ARG L C   1 
ATOM   5495 O  O   . ARG D 4  55  ? -57.603 7.342   30.620  1.00 37.15  ? 54  ARG L O   1 
ATOM   5496 C  CB  . ARG D 4  55  ? -56.603 10.162  30.651  1.00 41.00  ? 54  ARG L CB  1 
ATOM   5497 C  CG  . ARG D 4  55  ? -55.888 11.497  30.395  1.00 41.15  ? 54  ARG L CG  1 
ATOM   5498 C  CD  . ARG D 4  55  ? -55.956 12.468  31.602  1.00 47.09  ? 54  ARG L CD  1 
ATOM   5499 N  NE  . ARG D 4  55  ? -57.293 13.057  31.803  1.00 44.40  ? 54  ARG L NE  1 
ATOM   5500 C  CZ  . ARG D 4  55  ? -58.214 12.599  32.653  1.00 47.93  ? 54  ARG L CZ  1 
ATOM   5501 N  NH1 . ARG D 4  55  ? -57.994 11.532  33.428  1.00 47.85  ? 54  ARG L NH1 1 
ATOM   5502 N  NH2 . ARG D 4  55  ? -59.378 13.218  32.737  1.00 54.22  ? 54  ARG L NH2 1 
ATOM   5503 N  N   . PRO D 4  56  ? -55.441 6.978   30.109  1.00 36.80  ? 55  PRO L N   1 
ATOM   5504 C  CA  . PRO D 4  56  ? -55.498 5.779   30.913  1.00 37.74  ? 55  PRO L CA  1 
ATOM   5505 C  C   . PRO D 4  56  ? -55.599 6.162   32.393  1.00 40.71  ? 55  PRO L C   1 
ATOM   5506 O  O   . PRO D 4  56  ? -55.255 7.292   32.778  1.00 38.99  ? 55  PRO L O   1 
ATOM   5507 C  CB  . PRO D 4  56  ? -54.152 5.086   30.642  1.00 37.24  ? 55  PRO L CB  1 
ATOM   5508 C  CG  . PRO D 4  56  ? -53.546 5.772   29.526  1.00 32.96  ? 55  PRO L CG  1 
ATOM   5509 C  CD  . PRO D 4  56  ? -54.157 7.126   29.418  1.00 36.23  ? 55  PRO L CD  1 
ATOM   5510 N  N   . SER D 4  57  ? -56.045 5.219   33.209  1.00 43.94  ? 56  SER L N   1 
ATOM   5511 C  CA  . SER D 4  57  ? -55.991 5.387   34.654  1.00 46.64  ? 56  SER L CA  1 
ATOM   5512 C  C   . SER D 4  57  ? -54.535 5.530   35.084  1.00 47.45  ? 56  SER L C   1 
ATOM   5513 O  O   . SER D 4  57  ? -53.651 4.818   34.595  1.00 49.94  ? 56  SER L O   1 
ATOM   5514 C  CB  . SER D 4  57  ? -56.663 4.210   35.362  1.00 46.20  ? 56  SER L CB  1 
ATOM   5515 O  OG  . SER D 4  57  ? -56.814 3.108   34.471  1.00 55.15  ? 56  SER L OG  1 
ATOM   5516 N  N   . GLY D 4  58  ? -54.292 6.476   35.988  1.00 47.28  ? 57  GLY L N   1 
ATOM   5517 C  CA  . GLY D 4  58  ? -52.964 6.755   36.504  1.00 46.04  ? 57  GLY L CA  1 
ATOM   5518 C  C   . GLY D 4  58  ? -52.516 8.083   35.960  1.00 46.43  ? 57  GLY L C   1 
ATOM   5519 O  O   . GLY D 4  58  ? -51.613 8.724   36.519  1.00 49.01  ? 57  GLY L O   1 
ATOM   5520 N  N   . ILE D 4  59  ? -53.144 8.499   34.861  1.00 43.60  ? 58  ILE L N   1 
ATOM   5521 C  CA  . ILE D 4  59  ? -52.780 9.732   34.210  1.00 42.98  ? 58  ILE L CA  1 
ATOM   5522 C  C   . ILE D 4  59  ? -53.778 10.828  34.630  1.00 45.86  ? 58  ILE L C   1 
ATOM   5523 O  O   . ILE D 4  59  ? -55.005 10.612  34.602  1.00 44.63  ? 58  ILE L O   1 
ATOM   5524 C  CB  . ILE D 4  59  ? -52.786 9.597   32.709  1.00 41.64  ? 58  ILE L CB  1 
ATOM   5525 C  CG1 . ILE D 4  59  ? -51.964 8.377   32.267  1.00 45.05  ? 58  ILE L CG1 1 
ATOM   5526 C  CG2 . ILE D 4  59  ? -52.230 10.857  32.102  1.00 33.64  ? 58  ILE L CG2 1 
ATOM   5527 C  CD1 . ILE D 4  59  ? -50.520 8.405   32.718  1.00 37.07  ? 58  ILE L CD1 1 
ATOM   5528 N  N   . PRO D 4  60  ? -53.259 11.996  35.045  1.00 47.15  ? 59  PRO L N   1 
ATOM   5529 C  CA  . PRO D 4  60  ? -54.182 12.994  35.582  1.00 47.66  ? 59  PRO L CA  1 
ATOM   5530 C  C   . PRO D 4  60  ? -54.616 14.008  34.534  1.00 47.15  ? 59  PRO L C   1 
ATOM   5531 O  O   . PRO D 4  60  ? -53.911 14.178  33.511  1.00 48.27  ? 59  PRO L O   1 
ATOM   5532 C  CB  . PRO D 4  60  ? -53.357 13.665  36.705  1.00 48.53  ? 59  PRO L CB  1 
ATOM   5533 C  CG  . PRO D 4  60  ? -52.043 12.870  36.806  1.00 48.97  ? 59  PRO L CG  1 
ATOM   5534 C  CD  . PRO D 4  60  ? -51.866 12.314  35.412  1.00 47.71  ? 59  PRO L CD  1 
ATOM   5535 N  N   . ASP D 4  61  ? -55.741 14.694  34.808  1.00 45.84  ? 60  ASP L N   1 
ATOM   5536 C  CA  . ASP D 4  61  ? -56.340 15.674  33.871  1.00 44.25  ? 60  ASP L CA  1 
ATOM   5537 C  C   . ASP D 4  61  ? -55.477 16.889  33.539  1.00 44.50  ? 60  ASP L C   1 
ATOM   5538 O  O   . ASP D 4  61  ? -55.879 17.767  32.759  1.00 45.20  ? 60  ASP L O   1 
ATOM   5539 C  CB  . ASP D 4  61  ? -57.772 16.094  34.274  1.00 45.61  ? 60  ASP L CB  1 
ATOM   5540 C  CG  . ASP D 4  61  ? -57.863 16.791  35.655  1.00 48.81  ? 60  ASP L CG  1 
ATOM   5541 O  OD1 . ASP D 4  61  ? -56.864 17.382  36.158  1.00 38.86  ? 60  ASP L OD1 1 
ATOM   5542 O  OD2 . ASP D 4  61  ? -58.987 16.748  36.218  1.00 40.45  ? 60  ASP L OD2 1 
ATOM   5543 N  N   . ARG D 4  62  ? -54.273 16.924  34.093  1.00 41.88  ? 61  ARG L N   1 
ATOM   5544 C  CA  . ARG D 4  62  ? -53.292 17.896  33.703  1.00 40.96  ? 61  ARG L CA  1 
ATOM   5545 C  C   . ARG D 4  62  ? -52.813 17.678  32.283  1.00 41.78  ? 61  ARG L C   1 
ATOM   5546 O  O   . ARG D 4  62  ? -52.412 18.638  31.604  1.00 43.51  ? 61  ARG L O   1 
ATOM   5547 C  CB  . ARG D 4  62  ? -52.108 17.773  34.630  1.00 43.60  ? 61  ARG L CB  1 
ATOM   5548 C  CG  . ARG D 4  62  ? -51.374 19.059  34.868  1.00 44.96  ? 61  ARG L CG  1 
ATOM   5549 C  CD  . ARG D 4  62  ? -50.785 19.029  36.269  1.00 46.19  ? 61  ARG L CD  1 
ATOM   5550 N  NE  . ARG D 4  62  ? -50.073 17.778  36.567  1.00 40.81  ? 61  ARG L NE  1 
ATOM   5551 C  CZ  . ARG D 4  62  ? -48.864 17.475  36.105  1.00 38.21  ? 61  ARG L CZ  1 
ATOM   5552 N  NH1 . ARG D 4  62  ? -48.214 18.315  35.305  1.00 43.71  ? 61  ARG L NH1 1 
ATOM   5553 N  NH2 . ARG D 4  62  ? -48.287 16.333  36.451  1.00 42.10  ? 61  ARG L NH2 1 
ATOM   5554 N  N   . PHE D 4  63  ? -52.791 16.409  31.857  1.00 41.04  ? 62  PHE L N   1 
ATOM   5555 C  CA  . PHE D 4  63  ? -52.410 16.062  30.487  1.00 36.47  ? 62  PHE L CA  1 
ATOM   5556 C  C   . PHE D 4  63  ? -53.673 15.876  29.698  1.00 35.78  ? 62  PHE L C   1 
ATOM   5557 O  O   . PHE D 4  63  ? -54.635 15.226  30.154  1.00 33.78  ? 62  PHE L O   1 
ATOM   5558 C  CB  . PHE D 4  63  ? -51.668 14.721  30.410  1.00 37.69  ? 62  PHE L CB  1 
ATOM   5559 C  CG  . PHE D 4  63  ? -50.371 14.703  31.091  1.00 27.54  ? 62  PHE L CG  1 
ATOM   5560 C  CD1 . PHE D 4  63  ? -49.217 15.083  30.415  1.00 34.30  ? 62  PHE L CD1 1 
ATOM   5561 C  CD2 . PHE D 4  63  ? -50.282 14.274  32.416  1.00 37.97  ? 62  PHE L CD2 1 
ATOM   5562 C  CE1 . PHE D 4  63  ? -47.971 15.059  31.065  1.00 35.37  ? 62  PHE L CE1 1 
ATOM   5563 C  CE2 . PHE D 4  63  ? -49.045 14.244  33.084  1.00 39.74  ? 62  PHE L CE2 1 
ATOM   5564 C  CZ  . PHE D 4  63  ? -47.891 14.633  32.412  1.00 32.79  ? 62  PHE L CZ  1 
ATOM   5565 N  N   . SER D 4  64  ? -53.669 16.415  28.491  1.00 34.88  ? 63  SER L N   1 
ATOM   5566 C  CA  . SER D 4  64  ? -54.738 16.105  27.582  1.00 36.57  ? 63  SER L CA  1 
ATOM   5567 C  C   . SER D 4  64  ? -54.230 16.186  26.168  1.00 36.11  ? 63  SER L C   1 
ATOM   5568 O  O   . SER D 4  64  ? -53.117 16.641  25.903  1.00 38.40  ? 63  SER L O   1 
ATOM   5569 C  CB  . SER D 4  64  ? -55.921 17.076  27.815  1.00 40.60  ? 63  SER L CB  1 
ATOM   5570 O  OG  . SER D 4  64  ? -55.588 18.386  27.399  1.00 31.34  ? 63  SER L OG  1 
ATOM   5571 N  N   . GLY D 4  65  ? -55.051 15.747  25.234  1.00 37.13  ? 64  GLY L N   1 
ATOM   5572 C  CA  . GLY D 4  65  ? -54.618 15.790  23.844  1.00 33.40  ? 64  GLY L CA  1 
ATOM   5573 C  C   . GLY D 4  65  ? -55.725 16.209  22.940  1.00 31.80  ? 64  GLY L C   1 
ATOM   5574 O  O   . GLY D 4  65  ? -56.896 16.027  23.246  1.00 25.51  ? 64  GLY L O   1 
ATOM   5575 N  N   . SER D 4  66  ? -55.324 16.687  21.775  1.00 33.95  ? 65  SER L N   1 
ATOM   5576 C  CA  . SER D 4  66  ? -56.253 17.071  20.758  1.00 38.16  ? 65  SER L CA  1 
ATOM   5577 C  C   . SER D 4  66  ? -55.722 16.673  19.375  1.00 38.77  ? 65  SER L C   1 
ATOM   5578 O  O   . SER D 4  66  ? -54.496 16.551  19.181  1.00 36.67  ? 65  SER L O   1 
ATOM   5579 C  CB  . SER D 4  66  ? -56.470 18.598  20.839  1.00 34.91  ? 65  SER L CB  1 
ATOM   5580 O  OG  . SER D 4  66  ? -57.623 18.920  20.131  1.00 43.08  ? 65  SER L OG  1 
ATOM   5581 N  N   . LYS D 4  67  ? -56.652 16.508  18.430  1.00 40.55  ? 66  LYS L N   1 
ATOM   5582 C  CA  . LYS D 4  67  ? -56.340 16.201  17.020  1.00 41.88  ? 66  LYS L CA  1 
ATOM   5583 C  C   . LYS D 4  67  ? -57.261 16.983  16.081  1.00 41.92  ? 66  LYS L C   1 
ATOM   5584 O  O   . LYS D 4  67  ? -58.479 17.014  16.276  1.00 40.53  ? 66  LYS L O   1 
ATOM   5585 C  CB  . LYS D 4  67  ? -56.476 14.698  16.732  1.00 41.95  ? 66  LYS L CB  1 
ATOM   5586 C  CG  . LYS D 4  67  ? -56.322 14.328  15.233  1.00 42.67  ? 66  LYS L CG  1 
ATOM   5587 C  CD  . LYS D 4  67  ? -56.802 12.907  14.920  1.00 42.71  ? 66  LYS L CD  1 
ATOM   5588 C  CE  . LYS D 4  67  ? -57.403 12.828  13.543  1.00 44.33  ? 66  LYS L CE  1 
ATOM   5589 N  NZ  . LYS D 4  67  ? -57.637 11.447  13.114  1.00 42.44  ? 66  LYS L NZ  1 
ATOM   5590 N  N   . SER D 4  68  ? -56.668 17.608  15.063  1.00 42.71  ? 67  SER L N   1 
ATOM   5591 C  CA  . SER D 4  68  ? -57.416 18.419  14.085  1.00 41.55  ? 67  SER L CA  1 
ATOM   5592 C  C   . SER D 4  68  ? -56.846 18.267  12.671  1.00 38.94  ? 67  SER L C   1 
ATOM   5593 O  O   . SER D 4  68  ? -55.743 18.736  12.371  1.00 35.24  ? 67  SER L O   1 
ATOM   5594 C  CB  . SER D 4  68  ? -57.391 19.899  14.498  1.00 42.86  ? 67  SER L CB  1 
ATOM   5595 O  OG  . SER D 4  68  ? -58.089 20.709  13.555  1.00 46.33  ? 67  SER L OG  1 
ATOM   5596 N  N   . GLY D 4  69  ? -57.616 17.621  11.800  1.00 39.15  ? 68  GLY L N   1 
ATOM   5597 C  CA  . GLY D 4  69  ? -57.177 17.363  10.441  1.00 37.73  ? 68  GLY L CA  1 
ATOM   5598 C  C   . GLY D 4  69  ? -55.936 16.499  10.481  1.00 38.80  ? 68  GLY L C   1 
ATOM   5599 O  O   . GLY D 4  69  ? -55.971 15.378  11.018  1.00 39.00  ? 68  GLY L O   1 
ATOM   5600 N  N   . THR D 4  70  ? -54.840 17.060  9.975   1.00 37.53  ? 69  THR L N   1 
ATOM   5601 C  CA  . THR D 4  70  ? -53.556 16.371  9.831   1.00 40.72  ? 69  THR L CA  1 
ATOM   5602 C  C   . THR D 4  70  ? -52.547 16.595  11.005  1.00 39.02  ? 69  THR L C   1 
ATOM   5603 O  O   . THR D 4  70  ? -51.361 16.261  10.894  1.00 40.73  ? 69  THR L O   1 
ATOM   5604 C  CB  . THR D 4  70  ? -52.971 16.735  8.411   1.00 41.91  ? 69  THR L CB  1 
ATOM   5605 O  OG1 . THR D 4  70  ? -53.168 15.617  7.531   1.00 49.63  ? 69  THR L OG1 1 
ATOM   5606 C  CG2 . THR D 4  70  ? -51.491 17.121  8.423   1.00 45.66  ? 69  THR L CG2 1 
ATOM   5607 N  N   . SER D 4  71  ? -53.027 17.120  12.132  1.00 38.07  ? 70  SER L N   1 
ATOM   5608 C  CA  . SER D 4  71  ? -52.151 17.538  13.254  1.00 36.67  ? 70  SER L CA  1 
ATOM   5609 C  C   . SER D 4  71  ? -52.752 17.120  14.576  1.00 32.70  ? 70  SER L C   1 
ATOM   5610 O  O   . SER D 4  71  ? -53.958 17.012  14.693  1.00 31.64  ? 70  SER L O   1 
ATOM   5611 C  CB  . SER D 4  71  ? -51.921 19.061  13.269  1.00 37.25  ? 70  SER L CB  1 
ATOM   5612 O  OG  . SER D 4  71  ? -50.798 19.424  12.481  1.00 43.54  ? 70  SER L OG  1 
ATOM   5613 N  N   . ALA D 4  72  ? -51.899 16.866  15.564  1.00 31.76  ? 71  ALA L N   1 
ATOM   5614 C  CA  . ALA D 4  72  ? -52.360 16.509  16.912  1.00 31.04  ? 71  ALA L CA  1 
ATOM   5615 C  C   . ALA D 4  72  ? -51.555 17.327  17.909  1.00 30.47  ? 71  ALA L C   1 
ATOM   5616 O  O   . ALA D 4  72  ? -50.432 17.761  17.592  1.00 29.74  ? 71  ALA L O   1 
ATOM   5617 C  CB  . ALA D 4  72  ? -52.158 15.008  17.185  1.00 28.43  ? 71  ALA L CB  1 
ATOM   5618 N  N   . THR D 4  73  ? -52.101 17.477  19.109  1.00 28.59  ? 72  THR L N   1 
ATOM   5619 C  CA  . THR D 4  73  ? -51.484 18.300  20.126  1.00 32.60  ? 72  THR L CA  1 
ATOM   5620 C  C   . THR D 4  73  ? -51.635 17.691  21.496  1.00 32.75  ? 72  THR L C   1 
ATOM   5621 O  O   . THR D 4  73  ? -52.704 17.219  21.849  1.00 29.25  ? 72  THR L O   1 
ATOM   5622 C  CB  . THR D 4  73  ? -52.101 19.701  20.229  1.00 34.17  ? 72  THR L CB  1 
ATOM   5623 O  OG1 . THR D 4  73  ? -52.027 20.368  18.965  1.00 38.10  ? 72  THR L OG1 1 
ATOM   5624 C  CG2 . THR D 4  73  ? -51.322 20.510  21.253  1.00 38.40  ? 72  THR L CG2 1 
ATOM   5625 N  N   . LEU D 4  74  ? -50.534 17.716  22.250  1.00 34.69  ? 73  LEU L N   1 
ATOM   5626 C  CA  . LEU D 4  74  ? -50.517 17.317  23.639  1.00 36.36  ? 73  LEU L CA  1 
ATOM   5627 C  C   . LEU D 4  74  ? -50.396 18.626  24.422  1.00 36.98  ? 73  LEU L C   1 
ATOM   5628 O  O   . LEU D 4  74  ? -49.560 19.481  24.088  1.00 37.35  ? 73  LEU L O   1 
ATOM   5629 C  CB  . LEU D 4  74  ? -49.316 16.394  23.934  1.00 34.53  ? 73  LEU L CB  1 
ATOM   5630 C  CG  . LEU D 4  74  ? -49.086 16.019  25.407  1.00 36.08  ? 73  LEU L CG  1 
ATOM   5631 C  CD1 . LEU D 4  74  ? -50.182 15.122  25.882  1.00 29.17  ? 73  LEU L CD1 1 
ATOM   5632 C  CD2 . LEU D 4  74  ? -47.736 15.343  25.653  1.00 38.79  ? 73  LEU L CD2 1 
ATOM   5633 N  N   . GLY D 4  75  ? -51.231 18.765  25.443  1.00 36.76  ? 74  GLY L N   1 
ATOM   5634 C  CA  . GLY D 4  75  ? -51.200 19.916  26.325  1.00 38.11  ? 74  GLY L CA  1 
ATOM   5635 C  C   . GLY D 4  75  ? -50.874 19.444  27.730  1.00 39.60  ? 74  GLY L C   1 
ATOM   5636 O  O   . GLY D 4  75  ? -51.398 18.405  28.175  1.00 37.87  ? 74  GLY L O   1 
ATOM   5637 N  N   . ILE D 4  76  ? -50.002 20.199  28.409  1.00 39.46  ? 75  ILE L N   1 
ATOM   5638 C  CA  . ILE D 4  76  ? -49.602 19.912  29.802  1.00 41.34  ? 75  ILE L CA  1 
ATOM   5639 C  C   . ILE D 4  76  ? -49.737 21.197  30.617  1.00 38.63  ? 75  ILE L C   1 
ATOM   5640 O  O   . ILE D 4  76  ? -48.960 22.150  30.423  1.00 37.13  ? 75  ILE L O   1 
ATOM   5641 C  CB  . ILE D 4  76  ? -48.127 19.466  29.917  1.00 41.17  ? 75  ILE L CB  1 
ATOM   5642 C  CG1 . ILE D 4  76  ? -47.810 18.347  28.905  1.00 46.05  ? 75  ILE L CG1 1 
ATOM   5643 C  CG2 . ILE D 4  76  ? -47.808 19.026  31.374  1.00 43.69  ? 75  ILE L CG2 1 
ATOM   5644 C  CD1 . ILE D 4  76  ? -46.361 17.830  28.997  1.00 38.56  ? 75  ILE L CD1 1 
ATOM   5645 N  N   . THR D 4  77  ? -50.718 21.233  31.508  1.00 38.10  ? 76  THR L N   1 
ATOM   5646 C  CA  . THR D 4  77  ? -50.920 22.434  32.339  1.00 40.37  ? 76  THR L CA  1 
ATOM   5647 C  C   . THR D 4  77  ? -50.226 22.183  33.670  1.00 40.29  ? 76  THR L C   1 
ATOM   5648 O  O   . THR D 4  77  ? -49.496 21.189  33.811  1.00 39.03  ? 76  THR L O   1 
ATOM   5649 C  CB  . THR D 4  77  ? -52.427 22.798  32.493  1.00 40.73  ? 76  THR L CB  1 
ATOM   5650 O  OG1 . THR D 4  77  ? -53.115 21.768  33.213  1.00 38.56  ? 76  THR L OG1 1 
ATOM   5651 C  CG2 . THR D 4  77  ? -53.082 23.000  31.091  1.00 39.04  ? 76  THR L CG2 1 
ATOM   5652 N  N   . GLY D 4  78  ? -50.384 23.098  34.617  1.00 39.08  ? 77  GLY L N   1 
ATOM   5653 C  CA  . GLY D 4  78  ? -49.835 22.915  35.957  1.00 38.95  ? 77  GLY L CA  1 
ATOM   5654 C  C   . GLY D 4  78  ? -48.433 22.328  36.001  1.00 37.51  ? 77  GLY L C   1 
ATOM   5655 O  O   . GLY D 4  78  ? -48.142 21.480  36.854  1.00 37.95  ? 77  GLY L O   1 
ATOM   5656 N  N   . LEU D 4  79  ? -47.562 22.785  35.100  1.00 37.61  ? 78  LEU L N   1 
ATOM   5657 C  CA  . LEU D 4  79  ? -46.315 22.052  34.794  1.00 37.63  ? 78  LEU L CA  1 
ATOM   5658 C  C   . LEU D 4  79  ? -45.493 21.752  36.043  1.00 39.27  ? 78  LEU L C   1 
ATOM   5659 O  O   . LEU D 4  79  ? -45.353 22.612  36.911  1.00 42.48  ? 78  LEU L O   1 
ATOM   5660 C  CB  . LEU D 4  79  ? -45.472 22.825  33.772  1.00 36.97  ? 78  LEU L CB  1 
ATOM   5661 C  CG  . LEU D 4  79  ? -44.299 22.087  33.110  1.00 42.58  ? 78  LEU L CG  1 
ATOM   5662 C  CD1 . LEU D 4  79  ? -44.743 20.806  32.382  1.00 47.05  ? 78  LEU L CD1 1 
ATOM   5663 C  CD2 . LEU D 4  79  ? -43.608 22.996  32.127  1.00 44.66  ? 78  LEU L CD2 1 
ATOM   5664 N  N   . GLN D 4  80  ? -44.972 20.535  36.155  1.00 40.01  ? 79  GLN L N   1 
ATOM   5665 C  CA  . GLN D 4  80  ? -44.105 20.173  37.278  1.00 40.10  ? 79  GLN L CA  1 
ATOM   5666 C  C   . GLN D 4  80  ? -42.717 19.761  36.845  1.00 39.40  ? 79  GLN L C   1 
ATOM   5667 O  O   . GLN D 4  80  ? -42.447 19.543  35.662  1.00 40.88  ? 79  GLN L O   1 
ATOM   5668 C  CB  . GLN D 4  80  ? -44.691 19.038  38.084  1.00 39.36  ? 79  GLN L CB  1 
ATOM   5669 C  CG  . GLN D 4  80  ? -45.951 19.372  38.752  1.00 41.92  ? 79  GLN L CG  1 
ATOM   5670 C  CD  . GLN D 4  80  ? -46.561 18.157  39.377  1.00 47.79  ? 79  GLN L CD  1 
ATOM   5671 O  OE1 . GLN D 4  80  ? -45.898 17.116  39.525  1.00 41.01  ? 79  GLN L OE1 1 
ATOM   5672 N  NE2 . GLN D 4  80  ? -47.836 18.263  39.743  1.00 45.88  ? 79  GLN L NE2 1 
ATOM   5673 N  N   . THR D 4  81  ? -41.855 19.652  37.845  1.00 37.17  ? 80  THR L N   1 
ATOM   5674 C  CA  . THR D 4  81  ? -40.463 19.302  37.681  1.00 38.21  ? 80  THR L CA  1 
ATOM   5675 C  C   . THR D 4  81  ? -40.321 17.903  37.110  1.00 38.81  ? 80  THR L C   1 
ATOM   5676 O  O   . THR D 4  81  ? -39.510 17.692  36.200  1.00 39.66  ? 80  THR L O   1 
ATOM   5677 C  CB  . THR D 4  81  ? -39.756 19.357  39.053  1.00 37.85  ? 80  THR L CB  1 
ATOM   5678 O  OG1 . THR D 4  81  ? -39.865 20.684  39.583  1.00 35.88  ? 80  THR L OG1 1 
ATOM   5679 C  CG2 . THR D 4  81  ? -38.287 18.969  38.917  1.00 44.17  ? 80  THR L CG2 1 
ATOM   5680 N  N   . GLY D 4  82  ? -41.117 16.971  37.658  1.00 39.00  ? 81  GLY L N   1 
ATOM   5681 C  CA  . GLY D 4  82  ? -41.175 15.556  37.230  1.00 40.04  ? 81  GLY L CA  1 
ATOM   5682 C  C   . GLY D 4  82  ? -41.670 15.325  35.803  1.00 40.06  ? 81  GLY L C   1 
ATOM   5683 O  O   . GLY D 4  82  ? -41.424 14.278  35.225  1.00 42.73  ? 81  GLY L O   1 
ATOM   5684 N  N   . ASP D 4  83  ? -42.349 16.312  35.223  1.00 40.08  ? 82  ASP L N   1 
ATOM   5685 C  CA  . ASP D 4  83  ? -42.763 16.262  33.810  1.00 37.53  ? 82  ASP L CA  1 
ATOM   5686 C  C   . ASP D 4  83  ? -41.636 16.518  32.828  1.00 36.75  ? 82  ASP L C   1 
ATOM   5687 O  O   . ASP D 4  83  ? -41.844 16.436  31.618  1.00 38.75  ? 82  ASP L O   1 
ATOM   5688 C  CB  . ASP D 4  83  ? -43.830 17.310  33.525  1.00 37.35  ? 82  ASP L CB  1 
ATOM   5689 C  CG  . ASP D 4  83  ? -44.963 17.206  34.439  1.00 35.79  ? 82  ASP L CG  1 
ATOM   5690 O  OD1 . ASP D 4  83  ? -45.141 16.106  34.969  1.00 34.15  ? 82  ASP L OD1 1 
ATOM   5691 O  OD2 . ASP D 4  83  ? -45.654 18.221  34.656  1.00 40.24  ? 82  ASP L OD2 1 
ATOM   5692 N  N   . GLU D 4  84  ? -40.453 16.864  33.315  1.00 34.39  ? 83  GLU L N   1 
ATOM   5693 C  CA  . GLU D 4  84  ? -39.315 17.000  32.417  1.00 33.99  ? 83  GLU L CA  1 
ATOM   5694 C  C   . GLU D 4  84  ? -39.006 15.644  31.747  1.00 33.07  ? 83  GLU L C   1 
ATOM   5695 O  O   . GLU D 4  84  ? -38.705 14.666  32.426  1.00 31.63  ? 83  GLU L O   1 
ATOM   5696 C  CB  . GLU D 4  84  ? -38.103 17.507  33.197  1.00 33.19  ? 83  GLU L CB  1 
ATOM   5697 C  CG  . GLU D 4  84  ? -36.824 17.550  32.369  1.00 37.03  ? 83  GLU L CG  1 
ATOM   5698 C  CD  . GLU D 4  84  ? -35.909 18.720  32.708  1.00 45.83  ? 83  GLU L CD  1 
ATOM   5699 O  OE1 . GLU D 4  84  ? -34.800 18.722  32.123  1.00 38.76  ? 83  GLU L OE1 1 
ATOM   5700 O  OE2 . GLU D 4  84  ? -36.291 19.611  33.526  1.00 37.96  ? 83  GLU L OE2 1 
ATOM   5701 N  N   . ALA D 4  85  ? -39.071 15.581  30.424  1.00 34.23  ? 84  ALA L N   1 
ATOM   5702 C  CA  . ALA D 4  85  ? -39.132 14.271  29.754  1.00 34.73  ? 84  ALA L CA  1 
ATOM   5703 C  C   . ALA D 4  85  ? -39.246 14.383  28.263  1.00 36.56  ? 84  ALA L C   1 
ATOM   5704 O  O   . ALA D 4  85  ? -39.396 15.489  27.708  1.00 36.68  ? 84  ALA L O   1 
ATOM   5705 C  CB  . ALA D 4  85  ? -40.307 13.483  30.284  1.00 32.79  ? 84  ALA L CB  1 
ATOM   5706 N  N   . ASN D 4  86  ? -39.136 13.233  27.604  1.00 36.81  ? 85  ASN L N   1 
ATOM   5707 C  CA  . ASN D 4  86  ? -39.386 13.157  26.173  1.00 37.18  ? 85  ASN L CA  1 
ATOM   5708 C  C   . ASN D 4  86  ? -40.818 12.729  25.934  1.00 35.24  ? 85  ASN L C   1 
ATOM   5709 O  O   . ASN D 4  86  ? -41.368 11.933  26.681  1.00 35.22  ? 85  ASN L O   1 
ATOM   5710 C  CB  . ASN D 4  86  ? -38.382 12.238  25.507  1.00 37.72  ? 85  ASN L CB  1 
ATOM   5711 C  CG  . ASN D 4  86  ? -36.978 12.795  25.609  1.00 43.70  ? 85  ASN L CG  1 
ATOM   5712 O  OD1 . ASN D 4  86  ? -36.627 13.745  24.907  1.00 50.88  ? 85  ASN L OD1 1 
ATOM   5713 N  ND2 . ASN D 4  86  ? -36.188 12.246  26.512  1.00 38.23  ? 85  ASN L ND2 1 
ATOM   5714 N  N   . TYR D 4  87  ? -41.434 13.326  24.927  1.00 32.58  ? 86  TYR L N   1 
ATOM   5715 C  CA  . TYR D 4  87  ? -42.808 13.056  24.602  1.00 30.73  ? 86  TYR L CA  1 
ATOM   5716 C  C   . TYR D 4  87  ? -42.868 12.695  23.118  1.00 29.71  ? 86  TYR L C   1 
ATOM   5717 O  O   . TYR D 4  87  ? -42.328 13.398  22.293  1.00 33.20  ? 86  TYR L O   1 
ATOM   5718 C  CB  . TYR D 4  87  ? -43.663 14.272  24.942  1.00 34.17  ? 86  TYR L CB  1 
ATOM   5719 C  CG  . TYR D 4  87  ? -43.746 14.525  26.423  1.00 28.67  ? 86  TYR L CG  1 
ATOM   5720 C  CD1 . TYR D 4  87  ? -42.821 15.331  27.065  1.00 34.55  ? 86  TYR L CD1 1 
ATOM   5721 C  CD2 . TYR D 4  87  ? -44.728 13.947  27.179  1.00 28.10  ? 86  TYR L CD2 1 
ATOM   5722 C  CE1 . TYR D 4  87  ? -42.887 15.549  28.424  1.00 28.57  ? 86  TYR L CE1 1 
ATOM   5723 C  CE2 . TYR D 4  87  ? -44.806 14.151  28.511  1.00 30.86  ? 86  TYR L CE2 1 
ATOM   5724 C  CZ  . TYR D 4  87  ? -43.869 14.958  29.148  1.00 35.24  ? 86  TYR L CZ  1 
ATOM   5725 O  OH  . TYR D 4  87  ? -43.950 15.181  30.516  1.00 34.90  ? 86  TYR L OH  1 
ATOM   5726 N  N   . TYR D 4  88  ? -43.486 11.561  22.809  1.00 32.09  ? 87  TYR L N   1 
ATOM   5727 C  CA  . TYR D 4  88  ? -43.611 11.041  21.445  1.00 32.83  ? 87  TYR L CA  1 
ATOM   5728 C  C   . TYR D 4  88  ? -45.098 10.835  21.124  1.00 34.16  ? 87  TYR L C   1 
ATOM   5729 O  O   . TYR D 4  88  ? -45.830 10.287  21.965  1.00 33.42  ? 87  TYR L O   1 
ATOM   5730 C  CB  . TYR D 4  88  ? -42.923 9.670   21.334  1.00 30.42  ? 87  TYR L CB  1 
ATOM   5731 C  CG  . TYR D 4  88  ? -41.451 9.713   21.663  1.00 26.04  ? 87  TYR L CG  1 
ATOM   5732 C  CD1 . TYR D 4  88  ? -40.533 10.146  20.744  1.00 26.82  ? 87  TYR L CD1 1 
ATOM   5733 C  CD2 . TYR D 4  88  ? -40.994 9.315   22.895  1.00 26.69  ? 87  TYR L CD2 1 
ATOM   5734 C  CE1 . TYR D 4  88  ? -39.189 10.209  21.066  1.00 31.66  ? 87  TYR L CE1 1 
ATOM   5735 C  CE2 . TYR D 4  88  ? -39.677 9.351   23.207  1.00 29.93  ? 87  TYR L CE2 1 
ATOM   5736 C  CZ  . TYR D 4  88  ? -38.782 9.827   22.298  1.00 31.94  ? 87  TYR L CZ  1 
ATOM   5737 O  OH  . TYR D 4  88  ? -37.451 9.873   22.628  1.00 39.90  ? 87  TYR L OH  1 
ATOM   5738 N  N   . CYS D 4  89  ? -45.522 11.302  19.939  1.00 35.01  ? 88  CYS L N   1 
ATOM   5739 C  CA  . CYS D 4  89  ? -46.847 10.982  19.372  1.00 36.59  ? 88  CYS L CA  1 
ATOM   5740 C  C   . CYS D 4  89  ? -46.696 9.701   18.553  1.00 33.33  ? 88  CYS L C   1 
ATOM   5741 O  O   . CYS D 4  89  ? -45.594 9.362   18.127  1.00 32.40  ? 88  CYS L O   1 
ATOM   5742 C  CB  . CYS D 4  89  ? -47.423 12.122  18.487  1.00 35.59  ? 88  CYS L CB  1 
ATOM   5743 S  SG  . CYS D 4  89  ? -46.411 12.601  17.095  1.00 44.04  ? 88  CYS L SG  1 
ATOM   5744 N  N   . ALA D 4  90  ? -47.805 9.009   18.348  1.00 30.71  ? 89  ALA L N   1 
ATOM   5745 C  CA  . ALA D 4  90  ? -47.845 7.784   17.547  1.00 30.89  ? 89  ALA L CA  1 
ATOM   5746 C  C   . ALA D 4  90  ? -49.201 7.652   16.893  1.00 30.60  ? 89  ALA L C   1 
ATOM   5747 O  O   . ALA D 4  90  ? -50.203 8.019   17.458  1.00 30.42  ? 89  ALA L O   1 
ATOM   5748 C  CB  . ALA D 4  90  ? -47.574 6.559   18.398  1.00 27.03  ? 89  ALA L CB  1 
ATOM   5749 N  N   . THR D 4  91  ? -49.219 7.088   15.697  1.00 29.83  ? 90  THR L N   1 
ATOM   5750 C  CA  . THR D 4  91  ? -50.463 6.768   15.020  1.00 28.02  ? 90  THR L CA  1 
ATOM   5751 C  C   . THR D 4  91  ? -50.210 5.622   14.025  1.00 29.07  ? 90  THR L C   1 
ATOM   5752 O  O   . THR D 4  91  ? -49.118 5.047   13.940  1.00 26.92  ? 90  THR L O   1 
ATOM   5753 C  CB  . THR D 4  91  ? -51.030 8.041   14.314  1.00 29.97  ? 90  THR L CB  1 
ATOM   5754 O  OG1 . THR D 4  91  ? -52.331 7.793   13.803  1.00 29.96  ? 90  THR L OG1 1 
ATOM   5755 C  CG2 . THR D 4  91  ? -50.118 8.525   13.185  1.00 27.06  ? 90  THR L CG2 1 
ATOM   5756 N  N   . TRP D 4  92  ? -51.246 5.284   13.288  1.00 33.30  ? 91  TRP L N   1 
ATOM   5757 C  CA  . TRP D 4  92  ? -51.209 4.200   12.319  1.00 34.06  ? 91  TRP L CA  1 
ATOM   5758 C  C   . TRP D 4  92  ? -51.051 4.893   10.970  1.00 36.50  ? 91  TRP L C   1 
ATOM   5759 O  O   . TRP D 4  92  ? -51.815 5.829   10.670  1.00 35.80  ? 91  TRP L O   1 
ATOM   5760 C  CB  . TRP D 4  92  ? -52.526 3.445   12.422  1.00 34.10  ? 91  TRP L CB  1 
ATOM   5761 C  CG  . TRP D 4  92  ? -52.637 2.275   11.550  1.00 41.96  ? 91  TRP L CG  1 
ATOM   5762 C  CD1 . TRP D 4  92  ? -53.393 2.173   10.434  1.00 43.41  ? 91  TRP L CD1 1 
ATOM   5763 C  CD2 . TRP D 4  92  ? -51.976 1.014   11.707  1.00 40.34  ? 91  TRP L CD2 1 
ATOM   5764 N  NE1 . TRP D 4  92  ? -53.239 0.945   9.869   1.00 40.93  ? 91  TRP L NE1 1 
ATOM   5765 C  CE2 . TRP D 4  92  ? -52.378 0.204   10.633  1.00 47.27  ? 91  TRP L CE2 1 
ATOM   5766 C  CE3 . TRP D 4  92  ? -51.073 0.502   12.634  1.00 37.36  ? 91  TRP L CE3 1 
ATOM   5767 C  CZ2 . TRP D 4  92  ? -51.913 -1.111  10.464  1.00 47.25  ? 91  TRP L CZ2 1 
ATOM   5768 C  CZ3 . TRP D 4  92  ? -50.609 -0.800  12.476  1.00 36.10  ? 91  TRP L CZ3 1 
ATOM   5769 C  CH2 . TRP D 4  92  ? -51.030 -1.591  11.402  1.00 47.45  ? 91  TRP L CH2 1 
ATOM   5770 N  N   . ASP D 4  93  ? -50.033 4.512   10.196  1.00 36.23  ? 92  ASP L N   1 
ATOM   5771 C  CA  . ASP D 4  93  ? -49.903 4.994   8.816   1.00 37.44  ? 92  ASP L CA  1 
ATOM   5772 C  C   . ASP D 4  93  ? -50.325 3.900   7.831   1.00 41.05  ? 92  ASP L C   1 
ATOM   5773 O  O   . ASP D 4  93  ? -49.605 2.938   7.613   1.00 41.95  ? 92  ASP L O   1 
ATOM   5774 C  CB  . ASP D 4  93  ? -48.491 5.488   8.487   1.00 35.39  ? 92  ASP L CB  1 
ATOM   5775 C  CG  . ASP D 4  93  ? -48.471 6.468   7.297   1.00 38.61  ? 92  ASP L CG  1 
ATOM   5776 O  OD1 . ASP D 4  93  ? -47.487 7.212   7.132   1.00 36.49  ? 92  ASP L OD1 1 
ATOM   5777 O  OD2 . ASP D 4  93  ? -49.454 6.517   6.521   1.00 48.58  ? 92  ASP L OD2 1 
ATOM   5778 N  N   . ARG D 4  94  ? -51.489 4.094   7.224   1.00 45.41  ? 93  ARG L N   1 
ATOM   5779 C  CA  . ARG D 4  94  ? -52.082 3.145   6.265   1.00 49.80  ? 93  ARG L CA  1 
ATOM   5780 C  C   . ARG D 4  94  ? -51.340 3.027   4.928   1.00 50.43  ? 93  ARG L C   1 
ATOM   5781 O  O   . ARG D 4  94  ? -51.635 2.127   4.157   1.00 52.17  ? 93  ARG L O   1 
ATOM   5782 C  CB  . ARG D 4  94  ? -53.535 3.559   5.934   1.00 50.63  ? 93  ARG L CB  1 
ATOM   5783 C  CG  . ARG D 4  94  ? -54.472 3.806   7.138   1.00 54.88  ? 93  ARG L CG  1 
ATOM   5784 C  CD  . ARG D 4  94  ? -55.745 4.541   6.689   1.00 60.43  ? 93  ARG L CD  1 
ATOM   5785 N  NE  . ARG D 4  94  ? -56.793 4.602   7.719   1.00 65.86  ? 93  ARG L NE  1 
ATOM   5786 C  CZ  . ARG D 4  94  ? -57.591 3.590   8.072   1.00 69.04  ? 93  ARG L CZ  1 
ATOM   5787 N  NH1 . ARG D 4  94  ? -57.470 2.390   7.502   1.00 69.64  ? 93  ARG L NH1 1 
ATOM   5788 N  NH2 . ARG D 4  94  ? -58.513 3.774   9.017   1.00 67.85  ? 93  ARG L NH2 1 
ATOM   5789 N  N   . ARG D 4  95  ? -50.391 3.923   4.659   1.00 52.94  ? 94  ARG L N   1 
ATOM   5790 C  CA  . ARG D 4  95  ? -49.939 4.184   3.296   1.00 54.55  ? 94  ARG L CA  1 
ATOM   5791 C  C   . ARG D 4  95  ? -48.975 3.129   2.767   1.00 56.69  ? 94  ARG L C   1 
ATOM   5792 O  O   . ARG D 4  95  ? -49.439 2.101   2.241   1.00 58.30  ? 94  ARG L O   1 
ATOM   5793 C  CB  . ARG D 4  95  ? -49.348 5.594   3.157   1.00 54.90  ? 94  ARG L CB  1 
ATOM   5794 N  N   . PRO D 4  96  ? -47.643 3.360   2.904   1.00 56.49  ? 95  PRO L N   1 
ATOM   5795 C  CA  . PRO D 4  96  ? -46.697 2.505   2.143   1.00 54.49  ? 95  PRO L CA  1 
ATOM   5796 C  C   . PRO D 4  96  ? -47.101 1.029   2.252   1.00 51.45  ? 95  PRO L C   1 
ATOM   5797 O  O   . PRO D 4  96  ? -47.579 0.441   1.294   1.00 50.91  ? 95  PRO L O   1 
ATOM   5798 C  CB  . PRO D 4  96  ? -45.326 2.805   2.796   1.00 55.41  ? 95  PRO L CB  1 
ATOM   5799 C  CG  . PRO D 4  96  ? -45.632 3.510   4.089   1.00 53.40  ? 95  PRO L CG  1 
ATOM   5800 C  CD  . PRO D 4  96  ? -46.951 4.198   3.909   1.00 54.72  ? 95  PRO L CD  1 
ATOM   5801 N  N   . THR D 4  97  A -46.901 0.459   3.428   1.00 49.08  ? 95  THR L N   1 
ATOM   5802 C  CA  . THR D 4  97  A -47.644 -0.701  3.897   1.00 45.92  ? 95  THR L CA  1 
ATOM   5803 C  C   . THR D 4  97  A -48.065 -0.223  5.299   1.00 42.44  ? 95  THR L C   1 
ATOM   5804 O  O   . THR D 4  97  A -47.461 0.703   5.845   1.00 40.13  ? 95  THR L O   1 
ATOM   5805 C  CB  . THR D 4  97  A -46.767 -1.963  3.972   1.00 45.19  ? 95  THR L CB  1 
ATOM   5806 O  OG1 . THR D 4  97  A -45.524 -1.636  4.608   1.00 50.63  ? 95  THR L OG1 1 
ATOM   5807 C  CG2 . THR D 4  97  A -46.474 -2.512  2.608   1.00 42.60  ? 95  THR L CG2 1 
ATOM   5808 N  N   . ALA D 4  98  B -49.098 -0.816  5.875   1.00 38.82  ? 95  ALA L N   1 
ATOM   5809 C  CA  . ALA D 4  98  B -49.593 -0.317  7.155   1.00 38.10  ? 95  ALA L CA  1 
ATOM   5810 C  C   . ALA D 4  98  B -48.589 -0.554  8.316   1.00 33.97  ? 95  ALA L C   1 
ATOM   5811 O  O   . ALA D 4  98  B -48.022 -1.650  8.498   1.00 29.09  ? 95  ALA L O   1 
ATOM   5812 C  CB  . ALA D 4  98  B -50.945 -0.930  7.471   1.00 38.63  ? 95  ALA L CB  1 
ATOM   5813 N  N   . TYR D 4  99  C -48.359 0.487   9.086   1.00 31.37  ? 95  TYR L N   1 
ATOM   5814 C  CA  . TYR D 4  99  C -47.529 0.329   10.261  1.00 31.51  ? 95  TYR L CA  1 
ATOM   5815 C  C   . TYR D 4  99  C -47.735 1.463   11.260  1.00 30.36  ? 95  TYR L C   1 
ATOM   5816 O  O   . TYR D 4  99  C -48.308 2.504   10.928  1.00 27.90  ? 95  TYR L O   1 
ATOM   5817 C  CB  . TYR D 4  99  C -46.048 0.165   9.855   1.00 32.06  ? 95  TYR L CB  1 
ATOM   5818 C  CG  . TYR D 4  99  C -45.331 1.386   9.398   1.00 29.86  ? 95  TYR L CG  1 
ATOM   5819 C  CD1 . TYR D 4  99  C -44.264 1.879   10.138  1.00 30.42  ? 95  TYR L CD1 1 
ATOM   5820 C  CD2 . TYR D 4  99  C -45.665 2.034   8.204   1.00 37.04  ? 95  TYR L CD2 1 
ATOM   5821 C  CE1 . TYR D 4  99  C -43.579 2.976   9.741   1.00 32.35  ? 95  TYR L CE1 1 
ATOM   5822 C  CE2 . TYR D 4  99  C -44.952 3.183   7.785   1.00 27.76  ? 95  TYR L CE2 1 
ATOM   5823 C  CZ  . TYR D 4  99  C -43.917 3.633   8.569   1.00 31.09  ? 95  TYR L CZ  1 
ATOM   5824 O  OH  . TYR D 4  99  C -43.188 4.752   8.252   1.00 39.06  ? 95  TYR L OH  1 
ATOM   5825 N  N   . VAL D 4  100 ? -47.287 1.223   12.487  1.00 27.18  ? 96  VAL L N   1 
ATOM   5826 C  CA  . VAL D 4  100 ? -47.408 2.186   13.550  1.00 27.11  ? 96  VAL L CA  1 
ATOM   5827 C  C   . VAL D 4  100 ? -46.263 3.162   13.340  1.00 23.14  ? 96  VAL L C   1 
ATOM   5828 O  O   . VAL D 4  100 ? -45.177 2.745   13.223  1.00 26.70  ? 96  VAL L O   1 
ATOM   5829 C  CB  . VAL D 4  100 ? -47.254 1.496   14.932  1.00 24.33  ? 96  VAL L CB  1 
ATOM   5830 C  CG1 . VAL D 4  100 ? -47.094 2.529   16.012  1.00 21.14  ? 96  VAL L CG1 1 
ATOM   5831 C  CG2 . VAL D 4  100 ? -48.486 0.576   15.206  1.00 25.51  ? 96  VAL L CG2 1 
ATOM   5832 N  N   . VAL D 4  101 ? -46.505 4.452   13.291  1.00 26.59  ? 97  VAL L N   1 
ATOM   5833 C  CA  . VAL D 4  101 ? -45.400 5.401   13.156  1.00 28.50  ? 97  VAL L CA  1 
ATOM   5834 C  C   . VAL D 4  101 ? -45.367 6.263   14.415  1.00 28.67  ? 97  VAL L C   1 
ATOM   5835 O  O   . VAL D 4  101 ? -46.399 6.555   14.988  1.00 29.87  ? 97  VAL L O   1 
ATOM   5836 C  CB  . VAL D 4  101 ? -45.557 6.295   11.914  1.00 30.05  ? 97  VAL L CB  1 
ATOM   5837 C  CG1 . VAL D 4  101 ? -46.880 7.067   11.975  1.00 26.45  ? 97  VAL L CG1 1 
ATOM   5838 C  CG2 . VAL D 4  101 ? -44.370 7.316   11.826  1.00 34.75  ? 97  VAL L CG2 1 
ATOM   5839 N  N   . PHE D 4  102 ? -44.173 6.609   14.863  1.00 29.43  ? 98  PHE L N   1 
ATOM   5840 C  CA  . PHE D 4  102 ? -44.000 7.519   15.978  1.00 32.33  ? 98  PHE L CA  1 
ATOM   5841 C  C   . PHE D 4  102 ? -43.445 8.862   15.508  1.00 34.18  ? 98  PHE L C   1 
ATOM   5842 O  O   . PHE D 4  102 ? -42.621 8.932   14.593  1.00 34.35  ? 98  PHE L O   1 
ATOM   5843 C  CB  . PHE D 4  102 ? -42.955 6.965   16.970  1.00 31.15  ? 98  PHE L CB  1 
ATOM   5844 C  CG  . PHE D 4  102 ? -43.435 5.800   17.793  1.00 35.98  ? 98  PHE L CG  1 
ATOM   5845 C  CD1 . PHE D 4  102 ? -43.267 4.506   17.349  1.00 31.32  ? 98  PHE L CD1 1 
ATOM   5846 C  CD2 . PHE D 4  102 ? -44.001 6.001   19.025  1.00 31.08  ? 98  PHE L CD2 1 
ATOM   5847 C  CE1 . PHE D 4  102 ? -43.672 3.452   18.118  1.00 32.99  ? 98  PHE L CE1 1 
ATOM   5848 C  CE2 . PHE D 4  102 ? -44.395 4.932   19.803  1.00 33.30  ? 98  PHE L CE2 1 
ATOM   5849 C  CZ  . PHE D 4  102 ? -44.248 3.670   19.345  1.00 27.35  ? 98  PHE L CZ  1 
ATOM   5850 N  N   . GLY D 4  103 ? -43.781 9.910   16.232  1.00 33.97  ? 99  GLY L N   1 
ATOM   5851 C  CA  . GLY D 4  103 ? -43.084 11.172  16.064  1.00 33.41  ? 99  GLY L CA  1 
ATOM   5852 C  C   . GLY D 4  103 ? -41.627 11.090  16.499  1.00 35.21  ? 99  GLY L C   1 
ATOM   5853 O  O   . GLY D 4  103 ? -41.255 10.209  17.256  1.00 32.12  ? 99  GLY L O   1 
ATOM   5854 N  N   . GLY D 4  104 ? -40.823 12.053  16.035  1.00 34.94  ? 100 GLY L N   1 
ATOM   5855 C  CA  . GLY D 4  104 ? -39.395 12.122  16.315  1.00 34.82  ? 100 GLY L CA  1 
ATOM   5856 C  C   . GLY D 4  104 ? -39.022 12.540  17.724  1.00 34.65  ? 100 GLY L C   1 
ATOM   5857 O  O   . GLY D 4  104 ? -37.873 12.396  18.106  1.00 35.31  ? 100 GLY L O   1 
ATOM   5858 N  N   . GLY D 4  105 ? -39.979 13.051  18.498  1.00 33.29  ? 101 GLY L N   1 
ATOM   5859 C  CA  . GLY D 4  105 ? -39.772 13.268  19.933  1.00 33.82  ? 101 GLY L CA  1 
ATOM   5860 C  C   . GLY D 4  105 ? -39.590 14.746  20.278  1.00 36.08  ? 101 GLY L C   1 
ATOM   5861 O  O   . GLY D 4  105 ? -38.965 15.483  19.514  1.00 33.41  ? 101 GLY L O   1 
ATOM   5862 N  N   . THR D 4  106 ? -40.170 15.176  21.402  1.00 36.02  ? 102 THR L N   1 
ATOM   5863 C  CA  . THR D 4  106 ? -39.981 16.540  21.898  1.00 36.81  ? 102 THR L CA  1 
ATOM   5864 C  C   . THR D 4  106 ? -39.468 16.447  23.321  1.00 35.66  ? 102 THR L C   1 
ATOM   5865 O  O   . THR D 4  106 ? -40.072 15.757  24.135  1.00 35.57  ? 102 THR L O   1 
ATOM   5866 C  CB  . THR D 4  106 ? -41.269 17.375  21.954  1.00 35.19  ? 102 THR L CB  1 
ATOM   5867 O  OG1 . THR D 4  106 ? -41.923 17.411  20.682  1.00 31.76  ? 102 THR L OG1 1 
ATOM   5868 C  CG2 . THR D 4  106 ? -40.914 18.827  22.365  1.00 38.50  ? 102 THR L CG2 1 
ATOM   5869 N  N   . LYS D 4  107 ? -38.363 17.136  23.596  1.00 34.80  ? 103 LYS L N   1 
ATOM   5870 C  CA  . LYS D 4  107 ? -37.784 17.209  24.946  1.00 35.73  ? 103 LYS L CA  1 
ATOM   5871 C  C   . LYS D 4  107 ? -38.326 18.434  25.665  1.00 33.92  ? 103 LYS L C   1 
ATOM   5872 O  O   . LYS D 4  107 ? -38.163 19.547  25.194  1.00 34.10  ? 103 LYS L O   1 
ATOM   5873 C  CB  . LYS D 4  107 ? -36.263 17.272  24.876  1.00 35.64  ? 103 LYS L CB  1 
ATOM   5874 C  CG  . LYS D 4  107 ? -35.533 17.475  26.225  1.00 42.38  ? 103 LYS L CG  1 
ATOM   5875 C  CD  . LYS D 4  107 ? -36.107 16.646  27.387  1.00 45.59  ? 103 LYS L CD  1 
ATOM   5876 C  CE  . LYS D 4  107 ? -35.038 16.224  28.421  1.00 49.02  ? 103 LYS L CE  1 
ATOM   5877 N  NZ  . LYS D 4  107 ? -33.702 16.876  28.229  1.00 38.11  ? 103 LYS L NZ  1 
ATOM   5878 N  N   . LEU D 4  108 ? -39.020 18.188  26.771  1.00 32.66  ? 104 LEU L N   1 
ATOM   5879 C  CA  . LEU D 4  108 ? -39.602 19.199  27.592  1.00 33.21  ? 104 LEU L CA  1 
ATOM   5880 C  C   . LEU D 4  108 ? -38.610 19.432  28.714  1.00 36.53  ? 104 LEU L C   1 
ATOM   5881 O  O   . LEU D 4  108 ? -38.290 18.497  29.447  1.00 35.93  ? 104 LEU L O   1 
ATOM   5882 C  CB  . LEU D 4  108 ? -40.931 18.712  28.170  1.00 33.51  ? 104 LEU L CB  1 
ATOM   5883 C  CG  . LEU D 4  108 ? -41.689 19.660  29.113  1.00 32.86  ? 104 LEU L CG  1 
ATOM   5884 C  CD1 . LEU D 4  108 ? -43.028 19.078  29.475  1.00 34.56  ? 104 LEU L CD1 1 
ATOM   5885 C  CD2 . LEU D 4  108 ? -40.913 19.949  30.360  1.00 36.30  ? 104 LEU L CD2 1 
ATOM   5886 N  N   . THR D 4  109 ? -38.108 20.663  28.832  1.00 38.28  ? 105 THR L N   1 
ATOM   5887 C  CA  . THR D 4  109 ? -37.225 21.044  29.944  1.00 39.77  ? 105 THR L CA  1 
ATOM   5888 C  C   . THR D 4  109 ? -37.995 22.010  30.865  1.00 38.57  ? 105 THR L C   1 
ATOM   5889 O  O   . THR D 4  109 ? -38.610 22.954  30.395  1.00 36.28  ? 105 THR L O   1 
ATOM   5890 C  CB  . THR D 4  109 ? -35.917 21.675  29.420  1.00 39.15  ? 105 THR L CB  1 
ATOM   5891 O  OG1 . THR D 4  109 ? -36.227 22.798  28.596  1.00 51.36  ? 105 THR L OG1 1 
ATOM   5892 C  CG2 . THR D 4  109 ? -35.118 20.681  28.576  1.00 40.88  ? 105 THR L CG2 1 
ATOM   5893 N  N   . VAL D 4  110 ? -38.025 21.726  32.162  1.00 39.73  ? 106 VAL L N   1 
ATOM   5894 C  CA  . VAL D 4  110 ? -38.697 22.609  33.115  1.00 40.91  ? 106 VAL L CA  1 
ATOM   5895 C  C   . VAL D 4  110 ? -37.659 23.502  33.800  1.00 42.05  ? 106 VAL L C   1 
ATOM   5896 O  O   . VAL D 4  110 ? -36.668 23.002  34.337  1.00 42.04  ? 106 VAL L O   1 
ATOM   5897 C  CB  . VAL D 4  110 ? -39.490 21.823  34.173  1.00 40.92  ? 106 VAL L CB  1 
ATOM   5898 C  CG1 . VAL D 4  110 ? -40.286 22.781  35.063  1.00 39.01  ? 106 VAL L CG1 1 
ATOM   5899 C  CG2 . VAL D 4  110 ? -40.414 20.818  33.502  1.00 41.43  ? 106 VAL L CG2 1 
ATOM   5900 N  N   . LEU D 4  111 A -37.884 24.818  33.769  1.00 43.19  ? 106 LEU L N   1 
ATOM   5901 C  CA  . LEU D 4  111 A -36.931 25.791  34.329  1.00 43.97  ? 106 LEU L CA  1 
ATOM   5902 C  C   . LEU D 4  111 A -37.223 26.009  35.808  1.00 43.38  ? 106 LEU L C   1 
ATOM   5903 O  O   . LEU D 4  111 A -38.385 26.119  36.207  1.00 43.15  ? 106 LEU L O   1 
ATOM   5904 C  CB  . LEU D 4  111 A -36.999 27.122  33.558  1.00 44.55  ? 106 LEU L CB  1 
ATOM   5905 C  CG  . LEU D 4  111 A -36.787 27.023  32.035  1.00 45.45  ? 106 LEU L CG  1 
ATOM   5906 C  CD1 . LEU D 4  111 A -37.274 28.265  31.305  1.00 43.50  ? 106 LEU L CD1 1 
ATOM   5907 C  CD2 . LEU D 4  111 A -35.324 26.748  31.704  1.00 48.70  ? 106 LEU L CD2 1 
ATOM   5908 N  N   . GLU D 4  132 ? 6.005   3.954   28.479  1.00 90.78  ? 123 GLU L N   1 
ATOM   5909 C  CA  . GLU D 4  132 ? 5.582   2.548   28.566  1.00 92.56  ? 123 GLU L CA  1 
ATOM   5910 C  C   . GLU D 4  132 ? 4.744   2.081   27.347  1.00 92.37  ? 123 GLU L C   1 
ATOM   5911 O  O   . GLU D 4  132 ? 5.049   1.040   26.750  1.00 93.00  ? 123 GLU L O   1 
ATOM   5912 C  CB  . GLU D 4  132 ? 4.822   2.283   29.878  1.00 92.13  ? 123 GLU L CB  1 
ATOM   5913 C  CG  . GLU D 4  132 ? 4.263   0.850   30.006  1.00 96.81  ? 123 GLU L CG  1 
ATOM   5914 C  CD  . GLU D 4  132 ? 3.575   0.575   31.351  1.00 104.87 ? 123 GLU L CD  1 
ATOM   5915 O  OE1 . GLU D 4  132 ? 3.817   1.338   32.321  1.00 107.46 ? 123 GLU L OE1 1 
ATOM   5916 O  OE2 . GLU D 4  132 ? 2.797   -0.412  31.435  1.00 101.84 ? 123 GLU L OE2 1 
ATOM   5917 N  N   . GLU D 4  133 ? 3.683   2.815   27.002  1.00 90.66  ? 124 GLU L N   1 
ATOM   5918 C  CA  . GLU D 4  133 ? 2.957   2.552   25.746  1.00 89.40  ? 124 GLU L CA  1 
ATOM   5919 C  C   . GLU D 4  133 ? 3.840   2.863   24.532  1.00 90.09  ? 124 GLU L C   1 
ATOM   5920 O  O   . GLU D 4  133 ? 3.666   2.244   23.475  1.00 91.17  ? 124 GLU L O   1 
ATOM   5921 C  CB  . GLU D 4  133 ? 1.650   3.346   25.652  1.00 88.09  ? 124 GLU L CB  1 
ATOM   5922 C  CG  . GLU D 4  133 ? 1.813   4.840   25.751  1.00 88.49  ? 124 GLU L CG  1 
ATOM   5923 C  CD  . GLU D 4  133 ? 0.486   5.567   25.739  1.00 91.53  ? 124 GLU L CD  1 
ATOM   5924 O  OE1 . GLU D 4  133 ? 0.173   6.216   26.784  1.00 75.03  ? 124 GLU L OE1 1 
ATOM   5925 O  OE2 . GLU D 4  133 ? -0.220  5.472   24.690  1.00 79.15  ? 124 GLU L OE2 1 
ATOM   5926 N  N   . LEU D 4  134 ? 4.762   3.831   24.684  1.00 90.01  ? 125 LEU L N   1 
ATOM   5927 C  CA  . LEU D 4  134 ? 5.841   4.087   23.694  1.00 89.45  ? 125 LEU L CA  1 
ATOM   5928 C  C   . LEU D 4  134 ? 6.722   2.848   23.486  1.00 88.22  ? 125 LEU L C   1 
ATOM   5929 O  O   . LEU D 4  134 ? 7.110   2.552   22.353  1.00 89.19  ? 125 LEU L O   1 
ATOM   5930 C  CB  . LEU D 4  134 ? 6.716   5.305   24.082  1.00 89.85  ? 125 LEU L CB  1 
ATOM   5931 C  CG  . LEU D 4  134 ? 6.140   6.698   23.771  1.00 89.37  ? 125 LEU L CG  1 
ATOM   5932 C  CD1 . LEU D 4  134 ? 7.023   7.823   24.332  1.00 85.96  ? 125 LEU L CD1 1 
ATOM   5933 C  CD2 . LEU D 4  134 ? 5.914   6.881   22.267  1.00 90.61  ? 125 LEU L CD2 1 
ATOM   5934 N  N   . GLN D 4  135 ? 7.015   2.124   24.566  1.00 85.79  ? 126 GLN L N   1 
ATOM   5935 C  CA  . GLN D 4  135 ? 7.749   0.850   24.470  1.00 85.55  ? 126 GLN L CA  1 
ATOM   5936 C  C   . GLN D 4  135 ? 6.980   -0.202  23.653  1.00 85.58  ? 126 GLN L C   1 
ATOM   5937 O  O   . GLN D 4  135 ? 7.583   -1.017  22.946  1.00 85.92  ? 126 GLN L O   1 
ATOM   5938 C  CB  . GLN D 4  135 ? 8.090   0.305   25.869  1.00 85.82  ? 126 GLN L CB  1 
ATOM   5939 N  N   . ALA D 4  136 ? 5.646   -0.175  23.733  1.00 85.27  ? 127 ALA L N   1 
ATOM   5940 C  CA  . ALA D 4  136 ? 4.810   -1.018  22.877  1.00 82.08  ? 127 ALA L CA  1 
ATOM   5941 C  C   . ALA D 4  136 ? 4.570   -0.406  21.464  1.00 78.22  ? 127 ALA L C   1 
ATOM   5942 O  O   . ALA D 4  136 ? 3.654   -0.834  20.747  1.00 79.97  ? 127 ALA L O   1 
ATOM   5943 C  CB  . ALA D 4  136 ? 3.490   -1.328  23.594  1.00 83.01  ? 127 ALA L CB  1 
ATOM   5944 N  N   . ASN D 4  137 ? 5.408   0.559   21.068  1.00 72.56  ? 128 ASN L N   1 
ATOM   5945 C  CA  . ASN D 4  137 ? 5.341   1.229   19.755  1.00 68.12  ? 128 ASN L CA  1 
ATOM   5946 C  C   . ASN D 4  137 ? 4.038   2.004   19.487  1.00 64.16  ? 128 ASN L C   1 
ATOM   5947 O  O   . ASN D 4  137 ? 3.609   2.128   18.334  1.00 63.07  ? 128 ASN L O   1 
ATOM   5948 C  CB  . ASN D 4  137 ? 5.621   0.234   18.619  1.00 67.90  ? 128 ASN L CB  1 
ATOM   5949 N  N   . LYS D 4  138 ? 3.431   2.531   20.555  1.00 59.68  ? 129 LYS L N   1 
ATOM   5950 C  CA  . LYS D 4  138 ? 2.185   3.311   20.472  1.00 55.82  ? 129 LYS L CA  1 
ATOM   5951 C  C   . LYS D 4  138 ? 2.322   4.652   21.219  1.00 52.85  ? 129 LYS L C   1 
ATOM   5952 O  O   . LYS D 4  138 ? 3.225   4.831   22.028  1.00 52.92  ? 129 LYS L O   1 
ATOM   5953 C  CB  . LYS D 4  138 ? 1.010   2.504   21.052  1.00 55.42  ? 129 LYS L CB  1 
ATOM   5954 C  CG  . LYS D 4  138 ? 0.769   1.145   20.388  1.00 53.04  ? 129 LYS L CG  1 
ATOM   5955 N  N   . ALA D 4  139 ? 1.431   5.595   20.938  1.00 48.99  ? 130 ALA L N   1 
ATOM   5956 C  CA  . ALA D 4  139 ? 1.386   6.853   21.682  1.00 45.69  ? 130 ALA L CA  1 
ATOM   5957 C  C   . ALA D 4  139 ? -0.002  7.460   21.576  1.00 42.93  ? 130 ALA L C   1 
ATOM   5958 O  O   . ALA D 4  139 ? -0.556  7.586   20.485  1.00 40.93  ? 130 ALA L O   1 
ATOM   5959 C  CB  . ALA D 4  139 ? 2.417   7.818   21.152  1.00 46.20  ? 130 ALA L CB  1 
ATOM   5960 N  N   . THR D 4  140 ? -0.568  7.836   22.710  1.00 41.35  ? 131 THR L N   1 
ATOM   5961 C  CA  . THR D 4  140 ? -1.902  8.424   22.720  1.00 40.52  ? 131 THR L CA  1 
ATOM   5962 C  C   . THR D 4  140 ? -1.883  9.681   23.572  1.00 39.88  ? 131 THR L C   1 
ATOM   5963 O  O   . THR D 4  140 ? -1.587  9.622   24.773  1.00 37.42  ? 131 THR L O   1 
ATOM   5964 C  CB  . THR D 4  140 ? -2.930  7.448   23.286  1.00 39.25  ? 131 THR L CB  1 
ATOM   5965 O  OG1 . THR D 4  140 ? -2.680  7.270   24.682  1.00 46.31  ? 131 THR L OG1 1 
ATOM   5966 C  CG2 . THR D 4  140 ? -2.846  6.084   22.586  1.00 36.68  ? 131 THR L CG2 1 
ATOM   5967 N  N   . LEU D 4  141 ? -2.159  10.821  22.940  1.00 40.45  ? 132 LEU L N   1 
ATOM   5968 C  CA  . LEU D 4  141 ? -2.278  12.086  23.665  1.00 41.09  ? 132 LEU L CA  1 
ATOM   5969 C  C   . LEU D 4  141 ? -3.596  12.052  24.443  1.00 41.74  ? 132 LEU L C   1 
ATOM   5970 O  O   . LEU D 4  141 ? -4.645  11.735  23.873  1.00 39.48  ? 132 LEU L O   1 
ATOM   5971 C  CB  . LEU D 4  141 ? -2.232  13.280  22.704  1.00 40.40  ? 132 LEU L CB  1 
ATOM   5972 N  N   . VAL D 4  142 ? -3.516  12.346  25.744  1.00 43.21  ? 133 VAL L N   1 
ATOM   5973 C  CA  . VAL D 4  142 ? -4.660  12.296  26.663  1.00 44.03  ? 133 VAL L CA  1 
ATOM   5974 C  C   . VAL D 4  142 ? -5.064  13.728  27.069  1.00 44.85  ? 133 VAL L C   1 
ATOM   5975 O  O   . VAL D 4  142 ? -4.390  14.357  27.885  1.00 43.55  ? 133 VAL L O   1 
ATOM   5976 C  CB  . VAL D 4  142 ? -4.317  11.459  27.952  1.00 44.37  ? 133 VAL L CB  1 
ATOM   5977 C  CG1 . VAL D 4  142 ? -5.534  11.336  28.879  1.00 46.80  ? 133 VAL L CG1 1 
ATOM   5978 C  CG2 . VAL D 4  142 ? -3.794  10.063  27.596  1.00 43.17  ? 133 VAL L CG2 1 
ATOM   5979 N  N   . CYS D 4  143 ? -6.149  14.242  26.492  1.00 46.07  ? 134 CYS L N   1 
ATOM   5980 C  CA  . CYS D 4  143 ? -6.707  15.551  26.887  1.00 48.04  ? 134 CYS L CA  1 
ATOM   5981 C  C   . CYS D 4  143 ? -7.955  15.393  27.786  1.00 48.76  ? 134 CYS L C   1 
ATOM   5982 O  O   . CYS D 4  143 ? -9.063  15.164  27.284  1.00 49.98  ? 134 CYS L O   1 
ATOM   5983 C  CB  . CYS D 4  143 ? -7.046  16.382  25.635  1.00 48.77  ? 134 CYS L CB  1 
ATOM   5984 S  SG  . CYS D 4  143 ? -7.206  18.155  25.950  1.00 50.36  ? 134 CYS L SG  1 
ATOM   5985 N  N   . LEU D 4  144 ? -7.774  15.501  29.108  1.00 48.62  ? 135 LEU L N   1 
ATOM   5986 C  CA  . LEU D 4  144 ? -8.901  15.459  30.057  1.00 48.30  ? 135 LEU L CA  1 
ATOM   5987 C  C   . LEU D 4  144 ? -9.555  16.867  30.151  1.00 49.87  ? 135 LEU L C   1 
ATOM   5988 O  O   . LEU D 4  144 ? -8.842  17.876  30.084  1.00 49.70  ? 135 LEU L O   1 
ATOM   5989 C  CB  . LEU D 4  144 ? -8.433  14.961  31.439  1.00 46.97  ? 135 LEU L CB  1 
ATOM   5990 C  CG  . LEU D 4  144 ? -8.065  13.472  31.612  1.00 43.96  ? 135 LEU L CG  1 
ATOM   5991 C  CD1 . LEU D 4  144 ? -6.669  13.149  31.105  1.00 43.84  ? 135 LEU L CD1 1 
ATOM   5992 C  CD2 . LEU D 4  144 ? -8.154  13.059  33.073  1.00 36.50  ? 135 LEU L CD2 1 
ATOM   5993 N  N   . ILE D 4  145 ? -10.890 16.941  30.280  1.00 49.89  ? 136 ILE L N   1 
ATOM   5994 C  CA  . ILE D 4  145 ? -11.627 18.244  30.308  1.00 51.24  ? 136 ILE L CA  1 
ATOM   5995 C  C   . ILE D 4  145 ? -12.752 18.265  31.367  1.00 52.38  ? 136 ILE L C   1 
ATOM   5996 O  O   . ILE D 4  145 ? -13.505 17.301  31.493  1.00 53.00  ? 136 ILE L O   1 
ATOM   5997 C  CB  . ILE D 4  145 ? -12.244 18.605  28.914  1.00 50.93  ? 136 ILE L CB  1 
ATOM   5998 C  CG1 . ILE D 4  145 ? -11.239 18.365  27.776  1.00 52.03  ? 136 ILE L CG1 1 
ATOM   5999 C  CG2 . ILE D 4  145 ? -12.740 20.061  28.896  1.00 51.05  ? 136 ILE L CG2 1 
ATOM   6000 C  CD1 . ILE D 4  145 ? -11.713 18.836  26.387  1.00 53.80  ? 136 ILE L CD1 1 
ATOM   6001 N  N   . SER D 4  146 ? -12.891 19.363  32.113  1.00 54.04  ? 137 SER L N   1 
ATOM   6002 C  CA  . SER D 4  146 ? -13.781 19.357  33.293  1.00 55.32  ? 137 SER L CA  1 
ATOM   6003 C  C   . SER D 4  146 ? -14.339 20.719  33.775  1.00 56.87  ? 137 SER L C   1 
ATOM   6004 O  O   . SER D 4  146 ? -13.750 21.784  33.523  1.00 56.78  ? 137 SER L O   1 
ATOM   6005 C  CB  . SER D 4  146 ? -13.053 18.673  34.460  1.00 55.10  ? 137 SER L CB  1 
ATOM   6006 O  OG  . SER D 4  146 ? -12.810 17.303  34.186  1.00 54.63  ? 137 SER L OG  1 
ATOM   6007 N  N   . ASP D 4  147 ? -15.476 20.647  34.484  1.00 57.84  ? 138 ASP L N   1 
ATOM   6008 C  CA  . ASP D 4  147 ? -16.102 21.792  35.179  1.00 58.34  ? 138 ASP L CA  1 
ATOM   6009 C  C   . ASP D 4  147 ? -16.387 23.003  34.284  1.00 58.53  ? 138 ASP L C   1 
ATOM   6010 O  O   . ASP D 4  147 ? -15.933 24.123  34.556  1.00 57.56  ? 138 ASP L O   1 
ATOM   6011 C  CB  . ASP D 4  147 ? -15.263 22.211  36.397  1.00 58.72  ? 138 ASP L CB  1 
ATOM   6012 C  CG  . ASP D 4  147 ? -15.248 21.153  37.487  1.00 58.47  ? 138 ASP L CG  1 
ATOM   6013 O  OD1 . ASP D 4  147 ? -16.330 20.625  37.829  1.00 60.77  ? 138 ASP L OD1 1 
ATOM   6014 O  OD2 . ASP D 4  147 ? -14.154 20.856  38.008  1.00 53.22  ? 138 ASP L OD2 1 
ATOM   6015 N  N   . PHE D 4  148 ? -17.146 22.753  33.219  1.00 58.80  ? 139 PHE L N   1 
ATOM   6016 C  CA  . PHE D 4  148 ? -17.650 23.806  32.327  1.00 59.22  ? 139 PHE L CA  1 
ATOM   6017 C  C   . PHE D 4  148 ? -19.185 23.763  32.303  1.00 58.53  ? 139 PHE L C   1 
ATOM   6018 O  O   . PHE D 4  148 ? -19.785 22.841  32.870  1.00 58.67  ? 139 PHE L O   1 
ATOM   6019 C  CB  . PHE D 4  148 ? -17.042 23.691  30.908  1.00 59.44  ? 139 PHE L CB  1 
ATOM   6020 C  CG  . PHE D 4  148 ? -17.154 22.310  30.275  1.00 59.29  ? 139 PHE L CG  1 
ATOM   6021 C  CD1 . PHE D 4  148 ? -16.221 21.311  30.570  1.00 59.43  ? 139 PHE L CD1 1 
ATOM   6022 C  CD2 . PHE D 4  148 ? -18.162 22.030  29.349  1.00 59.83  ? 139 PHE L CD2 1 
ATOM   6023 C  CE1 . PHE D 4  148 ? -16.307 20.046  29.976  1.00 59.60  ? 139 PHE L CE1 1 
ATOM   6024 C  CE2 . PHE D 4  148 ? -18.256 20.768  28.749  1.00 60.85  ? 139 PHE L CE2 1 
ATOM   6025 C  CZ  . PHE D 4  148 ? -17.323 19.774  29.064  1.00 59.58  ? 139 PHE L CZ  1 
ATOM   6026 N  N   . TYR D 4  149 ? -19.817 24.754  31.668  1.00 57.40  ? 140 TYR L N   1 
ATOM   6027 C  CA  . TYR D 4  149 ? -21.280 24.882  31.711  1.00 56.23  ? 140 TYR L CA  1 
ATOM   6028 C  C   . TYR D 4  149 ? -21.800 25.909  30.712  1.00 53.45  ? 140 TYR L C   1 
ATOM   6029 O  O   . TYR D 4  149 ? -21.131 26.897  30.435  1.00 49.99  ? 140 TYR L O   1 
ATOM   6030 C  CB  . TYR D 4  149 ? -21.698 25.276  33.126  1.00 56.36  ? 140 TYR L CB  1 
ATOM   6031 C  CG  . TYR D 4  149 ? -23.167 25.125  33.444  1.00 60.51  ? 140 TYR L CG  1 
ATOM   6032 C  CD1 . TYR D 4  149 ? -24.018 26.234  33.421  1.00 64.63  ? 140 TYR L CD1 1 
ATOM   6033 C  CD2 . TYR D 4  149 ? -23.702 23.890  33.814  1.00 63.18  ? 140 TYR L CD2 1 
ATOM   6034 C  CE1 . TYR D 4  149 ? -25.375 26.119  33.740  1.00 65.08  ? 140 TYR L CE1 1 
ATOM   6035 C  CE2 . TYR D 4  149 ? -25.064 23.761  34.131  1.00 66.40  ? 140 TYR L CE2 1 
ATOM   6036 C  CZ  . TYR D 4  149 ? -25.891 24.886  34.092  1.00 66.33  ? 140 TYR L CZ  1 
ATOM   6037 O  OH  . TYR D 4  149 ? -27.228 24.791  34.402  1.00 64.93  ? 140 TYR L OH  1 
ATOM   6038 N  N   . GLY D 4  167 ? -5.641  11.315  13.943  1.00 48.50  ? 158 GLY L N   1 
ATOM   6039 C  CA  . GLY D 4  167 ? -6.719  10.407  14.347  1.00 49.20  ? 158 GLY L CA  1 
ATOM   6040 C  C   . GLY D 4  167 ? -7.334  10.822  15.679  1.00 49.57  ? 158 GLY L C   1 
ATOM   6041 O  O   . GLY D 4  167 ? -6.800  10.500  16.739  1.00 49.86  ? 158 GLY L O   1 
ATOM   6042 N  N   . VAL D 4  168 ? -8.457  11.536  15.626  1.00 49.38  ? 159 VAL L N   1 
ATOM   6043 C  CA  . VAL D 4  168 ? -9.069  12.107  16.830  1.00 50.02  ? 159 VAL L CA  1 
ATOM   6044 C  C   . VAL D 4  168 ? -10.308 11.318  17.270  1.00 49.59  ? 159 VAL L C   1 
ATOM   6045 O  O   . VAL D 4  168 ? -11.114 10.901  16.438  1.00 50.12  ? 159 VAL L O   1 
ATOM   6046 C  CB  . VAL D 4  168 ? -9.430  13.614  16.623  1.00 50.72  ? 159 VAL L CB  1 
ATOM   6047 C  CG1 . VAL D 4  168 ? -10.235 14.159  17.807  1.00 47.08  ? 159 VAL L CG1 1 
ATOM   6048 C  CG2 . VAL D 4  168 ? -8.157  14.445  16.394  1.00 47.51  ? 159 VAL L CG2 1 
ATOM   6049 N  N   . GLU D 4  169 ? -10.432 11.108  18.583  1.00 48.37  ? 160 GLU L N   1 
ATOM   6050 C  CA  . GLU D 4  169 ? -11.609 10.472  19.192  1.00 47.04  ? 160 GLU L CA  1 
ATOM   6051 C  C   . GLU D 4  169 ? -12.003 11.246  20.467  1.00 44.75  ? 160 GLU L C   1 
ATOM   6052 O  O   . GLU D 4  169 ? -11.287 11.221  21.486  1.00 42.82  ? 160 GLU L O   1 
ATOM   6053 C  CB  . GLU D 4  169 ? -11.336 8.985   19.492  1.00 47.59  ? 160 GLU L CB  1 
ATOM   6054 N  N   . THR D 4  170 ? -13.149 11.924  20.396  1.00 43.55  ? 161 THR L N   1 
ATOM   6055 C  CA  . THR D 4  170 ? -13.575 12.865  21.439  1.00 42.76  ? 161 THR L CA  1 
ATOM   6056 C  C   . THR D 4  170 ? -14.822 12.397  22.218  1.00 41.37  ? 161 THR L C   1 
ATOM   6057 O  O   . THR D 4  170 ? -15.912 12.351  21.652  1.00 42.07  ? 161 THR L O   1 
ATOM   6058 C  CB  . THR D 4  170 ? -13.852 14.261  20.819  1.00 42.74  ? 161 THR L CB  1 
ATOM   6059 N  N   . THR D 4  171 ? -14.643 12.054  23.503  1.00 39.71  ? 162 THR L N   1 
ATOM   6060 C  CA  . THR D 4  171 ? -15.748 11.713  24.440  1.00 39.05  ? 162 THR L CA  1 
ATOM   6061 C  C   . THR D 4  171 ? -16.803 12.818  24.568  1.00 39.32  ? 162 THR L C   1 
ATOM   6062 O  O   . THR D 4  171 ? -16.458 13.973  24.777  1.00 38.41  ? 162 THR L O   1 
ATOM   6063 C  CB  . THR D 4  171 ? -15.226 11.405  25.894  1.00 39.04  ? 162 THR L CB  1 
ATOM   6064 O  OG1 . THR D 4  171 ? -15.247 9.994   26.142  1.00 37.95  ? 162 THR L OG1 1 
ATOM   6065 C  CG2 . THR D 4  171 ? -16.091 12.067  26.958  1.00 32.99  ? 162 THR L CG2 1 
ATOM   6066 N  N   . THR D 4  172 ? -18.085 12.451  24.468  1.00 38.92  ? 163 THR L N   1 
ATOM   6067 C  CA  . THR D 4  172 ? -19.174 13.407  24.715  1.00 38.07  ? 163 THR L CA  1 
ATOM   6068 C  C   . THR D 4  172 ? -19.174 13.982  26.146  1.00 37.40  ? 163 THR L C   1 
ATOM   6069 O  O   . THR D 4  172 ? -18.638 13.365  27.092  1.00 34.98  ? 163 THR L O   1 
ATOM   6070 C  CB  . THR D 4  172 ? -20.605 12.793  24.493  1.00 38.51  ? 163 THR L CB  1 
ATOM   6071 O  OG1 . THR D 4  172 ? -20.792 11.657  25.349  1.00 32.74  ? 163 THR L OG1 1 
ATOM   6072 C  CG2 . THR D 4  172 ? -20.858 12.422  23.018  1.00 33.40  ? 163 THR L CG2 1 
ATOM   6073 N  N   . PRO D 4  173 ? -19.800 15.168  26.303  1.00 37.59  ? 164 PRO L N   1 
ATOM   6074 C  CA  . PRO D 4  173 ? -20.142 15.739  27.606  1.00 36.24  ? 164 PRO L CA  1 
ATOM   6075 C  C   . PRO D 4  173 ? -21.052 14.823  28.437  1.00 34.35  ? 164 PRO L C   1 
ATOM   6076 O  O   . PRO D 4  173 ? -22.150 14.510  28.018  1.00 33.49  ? 164 PRO L O   1 
ATOM   6077 C  CB  . PRO D 4  173 ? -20.892 17.030  27.240  1.00 37.19  ? 164 PRO L CB  1 
ATOM   6078 C  CG  . PRO D 4  173 ? -20.444 17.386  25.877  1.00 36.87  ? 164 PRO L CG  1 
ATOM   6079 C  CD  . PRO D 4  173 ? -20.113 16.096  25.194  1.00 38.63  ? 164 PRO L CD  1 
ATOM   6080 N  N   . SER D 4  174 ? -20.571 14.356  29.577  1.00 33.76  ? 165 SER L N   1 
ATOM   6081 C  CA  . SER D 4  174 ? -21.440 13.757  30.566  1.00 36.24  ? 165 SER L CA  1 
ATOM   6082 C  C   . SER D 4  174 ? -21.583 14.831  31.641  1.00 37.87  ? 165 SER L C   1 
ATOM   6083 O  O   . SER D 4  174 ? -20.803 15.795  31.650  1.00 37.16  ? 165 SER L O   1 
ATOM   6084 C  CB  . SER D 4  174 ? -20.855 12.452  31.124  1.00 35.65  ? 165 SER L CB  1 
ATOM   6085 O  OG  . SER D 4  174 ? -19.742 12.687  31.970  1.00 38.68  ? 165 SER L OG  1 
ATOM   6086 N  N   . LYS D 4  175 ? -22.579 14.680  32.516  1.00 39.38  ? 166 LYS L N   1 
ATOM   6087 C  CA  . LYS D 4  175 ? -22.801 15.617  33.613  1.00 41.73  ? 166 LYS L CA  1 
ATOM   6088 C  C   . LYS D 4  175 ? -22.365 14.988  34.937  1.00 44.90  ? 166 LYS L C   1 
ATOM   6089 O  O   . LYS D 4  175 ? -22.888 13.939  35.334  1.00 44.48  ? 166 LYS L O   1 
ATOM   6090 C  CB  . LYS D 4  175 ? -24.267 16.037  33.681  1.00 42.25  ? 166 LYS L CB  1 
ATOM   6091 N  N   . GLN D 4  176 ? -21.413 15.641  35.612  1.00 48.08  ? 167 GLN L N   1 
ATOM   6092 C  CA  . GLN D 4  176 ? -20.871 15.173  36.897  1.00 50.95  ? 167 GLN L CA  1 
ATOM   6093 C  C   . GLN D 4  176 ? -21.925 15.291  38.003  1.00 53.79  ? 167 GLN L C   1 
ATOM   6094 O  O   . GLN D 4  176 ? -22.848 16.111  37.915  1.00 54.50  ? 167 GLN L O   1 
ATOM   6095 C  CB  . GLN D 4  176 ? -19.631 15.988  37.296  1.00 51.68  ? 167 GLN L CB  1 
ATOM   6096 C  CG  . GLN D 4  176 ? -18.459 15.961  36.294  1.00 52.07  ? 167 GLN L CG  1 
ATOM   6097 C  CD  . GLN D 4  176 ? -17.552 17.195  36.391  1.00 54.73  ? 167 GLN L CD  1 
ATOM   6098 O  OE1 . GLN D 4  176 ? -17.866 18.168  37.084  1.00 55.36  ? 167 GLN L OE1 1 
ATOM   6099 N  NE2 . GLN D 4  176 ? -16.420 17.155  35.688  1.00 53.76  ? 167 GLN L NE2 1 
ATOM   6100 N  N   . SER D 4  177 ? -21.763 14.485  39.051  1.00 55.79  ? 168 SER L N   1 
ATOM   6101 C  CA  . SER D 4  177 ? -22.780 14.325  40.104  1.00 56.72  ? 168 SER L CA  1 
ATOM   6102 C  C   . SER D 4  177 ? -23.236 15.640  40.740  1.00 56.37  ? 168 SER L C   1 
ATOM   6103 O  O   . SER D 4  177 ? -24.243 15.685  41.447  1.00 56.21  ? 168 SER L O   1 
ATOM   6104 C  CB  . SER D 4  177 ? -22.235 13.401  41.192  1.00 57.27  ? 168 SER L CB  1 
ATOM   6105 O  OG  . SER D 4  177 ? -20.971 13.867  41.635  1.00 57.58  ? 168 SER L OG  1 
ATOM   6106 N  N   . ASN D 4  178 ? -21.066 17.303  40.861  1.00 67.28  ? 170 ASN L N   1 
ATOM   6107 C  CA  . ASN D 4  178 ? -20.856 18.736  40.664  1.00 67.26  ? 170 ASN L CA  1 
ATOM   6108 C  C   . ASN D 4  178 ? -21.992 19.394  39.879  1.00 66.17  ? 170 ASN L C   1 
ATOM   6109 O  O   . ASN D 4  178 ? -22.081 20.622  39.845  1.00 66.00  ? 170 ASN L O   1 
ATOM   6110 C  CB  . ASN D 4  178 ? -19.532 19.018  39.922  1.00 67.79  ? 170 ASN L CB  1 
ATOM   6111 C  CG  . ASN D 4  178 ? -18.390 18.086  40.338  1.00 68.58  ? 170 ASN L CG  1 
ATOM   6112 O  OD1 . ASN D 4  178 ? -18.552 16.863  40.413  1.00 66.48  ? 170 ASN L OD1 1 
ATOM   6113 N  ND2 . ASN D 4  178 ? -17.220 18.666  40.577  1.00 68.30  ? 170 ASN L ND2 1 
ATOM   6114 N  N   . ASN D 4  179 ? -22.831 18.583  39.228  1.00 64.58  ? 171 ASN L N   1 
ATOM   6115 C  CA  . ASN D 4  179 ? -23.900 19.074  38.341  1.00 63.43  ? 171 ASN L CA  1 
ATOM   6116 C  C   . ASN D 4  179 ? -23.380 20.008  37.233  1.00 61.99  ? 171 ASN L C   1 
ATOM   6117 O  O   . ASN D 4  179 ? -24.097 20.881  36.747  1.00 61.36  ? 171 ASN L O   1 
ATOM   6118 C  CB  . ASN D 4  179 ? -25.038 19.726  39.150  1.00 63.32  ? 171 ASN L CB  1 
ATOM   6119 C  CG  . ASN D 4  179 ? -25.884 18.706  39.914  1.00 64.34  ? 171 ASN L CG  1 
ATOM   6120 O  OD1 . ASN D 4  179 ? -25.513 17.538  40.041  1.00 63.86  ? 171 ASN L OD1 1 
ATOM   6121 N  ND2 . ASN D 4  179 ? -27.030 19.151  40.423  1.00 61.84  ? 171 ASN L ND2 1 
ATOM   6122 N  N   . LYS D 4  180 ? -22.123 19.794  36.846  1.00 61.62  ? 172 LYS L N   1 
ATOM   6123 C  CA  . LYS D 4  180 ? -21.476 20.501  35.741  1.00 61.16  ? 172 LYS L CA  1 
ATOM   6124 C  C   . LYS D 4  180 ? -21.145 19.474  34.645  1.00 59.99  ? 172 LYS L C   1 
ATOM   6125 O  O   . LYS D 4  180 ? -21.503 18.304  34.776  1.00 59.96  ? 172 LYS L O   1 
ATOM   6126 C  CB  . LYS D 4  180 ? -20.199 21.187  36.240  1.00 61.40  ? 172 LYS L CB  1 
ATOM   6127 N  N   . TYR D 4  181 ? -20.463 19.902  33.581  1.00 58.72  ? 173 TYR L N   1 
ATOM   6128 C  CA  . TYR D 4  181 ? -20.109 19.004  32.464  1.00 57.35  ? 173 TYR L CA  1 
ATOM   6129 C  C   . TYR D 4  181 ? -18.640 18.507  32.483  1.00 56.11  ? 173 TYR L C   1 
ATOM   6130 O  O   . TYR D 4  181 ? -17.721 19.220  32.912  1.00 54.69  ? 173 TYR L O   1 
ATOM   6131 C  CB  . TYR D 4  181 ? -20.423 19.679  31.122  1.00 56.84  ? 173 TYR L CB  1 
ATOM   6132 N  N   . ALA D 4  182 ? -18.448 17.274  32.006  1.00 54.52  ? 174 ALA L N   1 
ATOM   6133 C  CA  . ALA D 4  182 ? -17.132 16.628  31.896  1.00 53.11  ? 174 ALA L CA  1 
ATOM   6134 C  C   . ALA D 4  182 ? -16.965 16.033  30.491  1.00 52.22  ? 174 ALA L C   1 
ATOM   6135 O  O   . ALA D 4  182 ? -17.948 15.844  29.787  1.00 52.87  ? 174 ALA L O   1 
ATOM   6136 C  CB  . ALA D 4  182 ? -16.996 15.530  32.951  1.00 52.74  ? 174 ALA L CB  1 
ATOM   6137 N  N   . ALA D 4  183 ? -15.729 15.732  30.089  1.00 50.06  ? 175 ALA L N   1 
ATOM   6138 C  CA  . ALA D 4  183 ? -15.454 15.183  28.755  1.00 48.43  ? 175 ALA L CA  1 
ATOM   6139 C  C   . ALA D 4  183 ? -14.007 14.693  28.628  1.00 48.80  ? 175 ALA L C   1 
ATOM   6140 O  O   . ALA D 4  183 ? -13.235 14.777  29.590  1.00 50.11  ? 175 ALA L O   1 
ATOM   6141 C  CB  . ALA D 4  183 ? -15.739 16.232  27.690  1.00 47.47  ? 175 ALA L CB  1 
ATOM   6142 N  N   . SER D 4  184 ? -13.656 14.171  27.448  1.00 46.22  ? 176 SER L N   1 
ATOM   6143 C  CA  . SER D 4  184 ? -12.253 13.948  27.071  1.00 44.28  ? 176 SER L CA  1 
ATOM   6144 C  C   . SER D 4  184 ? -12.049 13.815  25.542  1.00 45.64  ? 176 SER L C   1 
ATOM   6145 O  O   . SER D 4  184 ? -12.996 13.597  24.776  1.00 44.15  ? 176 SER L O   1 
ATOM   6146 C  CB  . SER D 4  184 ? -11.632 12.765  27.829  1.00 43.09  ? 176 SER L CB  1 
ATOM   6147 O  OG  . SER D 4  184 ? -12.517 11.679  27.912  1.00 33.55  ? 176 SER L OG  1 
ATOM   6148 N  N   . SER D 4  185 ? -10.803 14.022  25.112  1.00 45.76  ? 177 SER L N   1 
ATOM   6149 C  CA  . SER D 4  185 ? -10.389 13.795  23.720  1.00 44.27  ? 177 SER L CA  1 
ATOM   6150 C  C   . SER D 4  185 ? -9.045  13.108  23.765  1.00 42.18  ? 177 SER L C   1 
ATOM   6151 O  O   . SER D 4  185 ? -8.269  13.330  24.687  1.00 41.21  ? 177 SER L O   1 
ATOM   6152 C  CB  . SER D 4  185 ? -10.287 15.106  22.918  1.00 44.08  ? 177 SER L CB  1 
ATOM   6153 O  OG  . SER D 4  185 ? -11.313 15.211  21.938  1.00 48.61  ? 177 SER L OG  1 
ATOM   6154 N  N   . TYR D 4  186 ? -8.795  12.252  22.782  1.00 40.47  ? 178 TYR L N   1 
ATOM   6155 C  CA  . TYR D 4  186 ? -7.539  11.545  22.675  1.00 40.09  ? 178 TYR L CA  1 
ATOM   6156 C  C   . TYR D 4  186 ? -7.087  11.587  21.223  1.00 39.76  ? 178 TYR L C   1 
ATOM   6157 O  O   . TYR D 4  186 ? -7.889  11.361  20.319  1.00 40.79  ? 178 TYR L O   1 
ATOM   6158 C  CB  . TYR D 4  186 ? -7.676  10.067  23.060  1.00 40.21  ? 178 TYR L CB  1 
ATOM   6159 C  CG  . TYR D 4  186 ? -8.229  9.713   24.437  1.00 40.76  ? 178 TYR L CG  1 
ATOM   6160 C  CD1 . TYR D 4  186 ? -7.411  9.094   25.399  1.00 32.08  ? 178 TYR L CD1 1 
ATOM   6161 C  CD2 . TYR D 4  186 ? -9.586  9.905   24.748  1.00 33.90  ? 178 TYR L CD2 1 
ATOM   6162 C  CE1 . TYR D 4  186 ? -7.907  8.710   26.632  1.00 27.40  ? 178 TYR L CE1 1 
ATOM   6163 C  CE2 . TYR D 4  186 ? -10.093 9.533   26.009  1.00 36.36  ? 178 TYR L CE2 1 
ATOM   6164 C  CZ  . TYR D 4  186 ? -9.244  8.933   26.941  1.00 30.43  ? 178 TYR L CZ  1 
ATOM   6165 O  OH  . TYR D 4  186 ? -9.730  8.552   28.165  1.00 22.84  ? 178 TYR L OH  1 
ATOM   6166 N  N   . LEU D 4  187 ? -5.801  11.847  21.012  1.00 38.60  ? 179 LEU L N   1 
ATOM   6167 C  CA  . LEU D 4  187 ? -5.194  11.787  19.688  1.00 38.54  ? 179 LEU L CA  1 
ATOM   6168 C  C   . LEU D 4  187 ? -4.332  10.529  19.637  1.00 38.37  ? 179 LEU L C   1 
ATOM   6169 O  O   . LEU D 4  187 ? -3.422  10.357  20.463  1.00 36.15  ? 179 LEU L O   1 
ATOM   6170 C  CB  . LEU D 4  187 ? -4.355  13.057  19.422  1.00 39.11  ? 179 LEU L CB  1 
ATOM   6171 C  CG  . LEU D 4  187 ? -3.479  13.212  18.161  1.00 37.62  ? 179 LEU L CG  1 
ATOM   6172 C  CD1 . LEU D 4  187 ? -4.298  13.191  16.857  1.00 36.86  ? 179 LEU L CD1 1 
ATOM   6173 C  CD2 . LEU D 4  187 ? -2.654  14.507  18.256  1.00 35.07  ? 179 LEU L CD2 1 
ATOM   6174 N  N   . SER D 4  188 ? -4.640  9.655   18.675  1.00 38.52  ? 180 SER L N   1 
ATOM   6175 C  CA  . SER D 4  188 ? -3.941  8.379   18.491  1.00 39.49  ? 180 SER L CA  1 
ATOM   6176 C  C   . SER D 4  188 ? -3.020  8.433   17.258  1.00 40.13  ? 180 SER L C   1 
ATOM   6177 O  O   . SER D 4  188 ? -1.817  8.705   17.358  1.00 38.83  ? 180 SER L O   1 
ATOM   6178 C  CB  . SER D 4  188 ? -4.962  7.239   18.324  1.00 40.35  ? 180 SER L CB  1 
ATOM   6179 O  OG  . SER D 4  188 ? -6.080  7.384   19.202  1.00 39.19  ? 180 SER L OG  1 
ATOM   6180 N  N   . CYS D 4  202 ? -4.141  20.662  22.064  1.00 49.15  ? 194 CYS L N   1 
ATOM   6181 C  CA  . CYS D 4  202 ? -5.523  20.453  22.469  1.00 49.09  ? 194 CYS L CA  1 
ATOM   6182 C  C   . CYS D 4  202 ? -6.188  21.777  22.843  1.00 48.74  ? 194 CYS L C   1 
ATOM   6183 O  O   . CYS D 4  202 ? -5.907  22.335  23.909  1.00 47.35  ? 194 CYS L O   1 
ATOM   6184 C  CB  . CYS D 4  202 ? -5.605  19.473  23.649  1.00 48.91  ? 194 CYS L CB  1 
ATOM   6185 S  SG  . CYS D 4  202 ? -7.327  19.080  24.121  1.00 52.62  ? 194 CYS L SG  1 
ATOM   6186 N  N   . GLN D 4  203 ? -7.047  22.273  21.943  1.00 49.77  ? 195 GLN L N   1 
ATOM   6187 C  CA  . GLN D 4  203 ? -7.935  23.440  22.178  1.00 50.29  ? 195 GLN L CA  1 
ATOM   6188 C  C   . GLN D 4  203 ? -7.617  24.225  23.463  1.00 50.43  ? 195 GLN L C   1 
ATOM   6189 O  O   . GLN D 4  203 ? -8.265  24.054  24.503  1.00 49.16  ? 195 GLN L O   1 
ATOM   6190 C  CB  . GLN D 4  203 ? -9.408  22.997  22.201  1.00 50.03  ? 195 GLN L CB  1 
ATOM   6191 C  CG  . GLN D 4  203 ? -9.896  22.253  20.929  1.00 53.40  ? 195 GLN L CG  1 
ATOM   6192 C  CD  . GLN D 4  203 ? -11.083 21.295  21.181  1.00 56.93  ? 195 GLN L CD  1 
ATOM   6193 O  OE1 . GLN D 4  203 ? -11.576 20.643  20.252  1.00 53.39  ? 195 GLN L OE1 1 
ATOM   6194 N  NE2 . GLN D 4  203 ? -11.531 21.206  22.439  1.00 53.46  ? 195 GLN L NE2 1 
HETATM 6195 C  C1  . NAG E 5  .   ? -52.622 -21.965 2.581   0.50 48.77  ? 1   NAG C C1  1 
HETATM 6196 C  C2  . NAG E 5  .   ? -52.706 -21.824 1.058   0.50 49.84  ? 1   NAG C C2  1 
HETATM 6197 C  C3  . NAG E 5  .   ? -51.360 -21.321 0.531   0.50 53.47  ? 1   NAG C C3  1 
HETATM 6198 C  C4  . NAG E 5  .   ? -51.328 -19.900 1.161   0.50 33.76  ? 1   NAG C C4  1 
HETATM 6199 C  C5  . NAG E 5  .   ? -51.357 -19.953 2.683   0.50 49.18  ? 1   NAG C C5  1 
HETATM 6200 C  C6  . NAG E 5  .   ? -51.426 -18.553 3.295   0.50 49.80  ? 1   NAG C C6  1 
HETATM 6201 C  C7  . NAG E 5  .   ? -54.563 -22.867 0.011   0.50 58.18  ? 1   NAG C C7  1 
HETATM 6202 C  C8  . NAG E 5  .   ? -55.305 -24.063 -0.516  0.50 62.24  ? 1   NAG C C8  1 
HETATM 6203 N  N2  . NAG E 5  .   ? -53.339 -23.022 0.517   0.50 55.87  ? 1   NAG C N2  1 
HETATM 6204 O  O3  . NAG E 5  .   ? -51.301 -21.391 -0.904  0.50 44.48  ? 1   NAG C O3  1 
HETATM 6205 O  O4  . NAG E 5  .   ? -50.243 -19.081 0.841   0.50 41.43  ? 1   NAG C O4  1 
HETATM 6206 O  O5  . NAG E 5  .   ? -52.492 -20.661 3.120   0.50 28.55  ? 1   NAG C O5  1 
HETATM 6207 O  O6  . NAG E 5  .   ? -50.992 -18.601 4.651   0.50 66.25  ? 1   NAG C O6  1 
HETATM 6208 O  O7  . NAG E 5  .   ? -55.055 -21.747 -0.044  0.50 42.70  ? 1   NAG C O7  1 
HETATM 6209 C  C1  . NAG E 5  .   ? -49.641 -18.041 0.266   0.50 49.40  ? 2   NAG C C1  1 
HETATM 6210 C  C2  . NAG E 5  .   ? -49.053 -16.641 0.244   0.50 54.57  ? 2   NAG C C2  1 
HETATM 6211 C  C3  . NAG E 5  .   ? -48.988 -16.182 -1.211  0.50 47.23  ? 2   NAG C C3  1 
HETATM 6212 C  C4  . NAG E 5  .   ? -48.204 -17.166 -2.051  0.50 41.63  ? 2   NAG C C4  1 
HETATM 6213 C  C5  . NAG E 5  .   ? -48.749 -18.560 -1.892  0.50 32.56  ? 2   NAG C C5  1 
HETATM 6214 C  C6  . NAG E 5  .   ? -47.812 -19.418 -2.712  0.50 24.74  ? 2   NAG C C6  1 
HETATM 6215 C  C7  . NAG E 5  .   ? -49.498 -15.298 2.253   0.50 61.34  ? 2   NAG C C7  1 
HETATM 6216 C  C8  . NAG E 5  .   ? -50.314 -14.228 2.916   0.50 61.03  ? 2   NAG C C8  1 
HETATM 6217 N  N2  . NAG E 5  .   ? -49.806 -15.635 0.987   0.50 54.72  ? 2   NAG C N2  1 
HETATM 6218 O  O3  . NAG E 5  .   ? -48.458 -14.883 -1.327  0.50 40.44  ? 2   NAG C O3  1 
HETATM 6219 O  O4  . NAG E 5  .   ? -48.313 -16.846 -3.433  0.50 44.66  ? 2   NAG C O4  1 
HETATM 6220 O  O5  . NAG E 5  .   ? -48.785 -18.887 -0.524  0.50 51.06  ? 2   NAG C O5  1 
HETATM 6221 O  O6  . NAG E 5  .   ? -47.245 -20.526 -2.070  0.50 30.33  ? 2   NAG C O6  1 
HETATM 6222 O  O7  . NAG E 5  .   ? -48.602 -15.824 2.907   0.50 62.21  ? 2   NAG C O7  1 
HETATM 6223 C  C1  . BMA E 5  .   ? -47.118 -16.532 -3.968  0.50 41.54  ? 3   BMA C C1  1 
HETATM 6224 C  C2  . BMA E 5  .   ? -47.297 -16.749 -5.454  0.50 46.25  ? 3   BMA C C2  1 
HETATM 6225 C  C3  . BMA E 5  .   ? -46.256 -15.920 -6.175  0.50 49.92  ? 3   BMA C C3  1 
HETATM 6226 C  C4  . BMA E 5  .   ? -46.673 -14.489 -5.868  0.50 47.67  ? 3   BMA C C4  1 
HETATM 6227 C  C5  . BMA E 5  .   ? -46.611 -14.214 -4.360  0.50 52.99  ? 3   BMA C C5  1 
HETATM 6228 C  C6  . BMA E 5  .   ? -47.114 -12.806 -4.033  0.50 56.53  ? 3   BMA C C6  1 
HETATM 6229 O  O2  . BMA E 5  .   ? -48.604 -16.293 -5.835  0.50 42.65  ? 3   BMA C O2  1 
HETATM 6230 O  O3  . BMA E 5  .   ? -46.213 -16.198 -7.592  0.50 40.60  ? 3   BMA C O3  1 
HETATM 6231 O  O4  . BMA E 5  .   ? -45.783 -13.587 -6.496  0.50 46.59  ? 3   BMA C O4  1 
HETATM 6232 O  O5  . BMA E 5  .   ? -47.397 -15.164 -3.666  0.50 44.76  ? 3   BMA C O5  1 
HETATM 6233 O  O6  . BMA E 5  .   ? -47.304 -12.607 -2.623  0.50 57.77  ? 3   BMA C O6  1 
HETATM 6234 C  C1  . MAN E 5  .   ? -45.483 -17.217 -8.022  0.50 34.27  ? 4   MAN C C1  1 
HETATM 6235 C  C2  . MAN E 5  .   ? -45.262 -17.042 -9.549  0.50 29.71  ? 4   MAN C C2  1 
HETATM 6236 C  C3  . MAN E 5  .   ? -46.488 -17.489 -10.270 0.50 27.53  ? 4   MAN C C3  1 
HETATM 6237 C  C4  . MAN E 5  .   ? -46.849 -18.886 -9.869  0.50 27.56  ? 4   MAN C C4  1 
HETATM 6238 C  C5  . MAN E 5  .   ? -47.052 -18.980 -8.381  0.50 29.02  ? 4   MAN C C5  1 
HETATM 6239 C  C6  . MAN E 5  .   ? -47.272 -20.417 -7.912  0.50 35.46  ? 4   MAN C C6  1 
HETATM 6240 O  O2  . MAN E 5  .   ? -44.253 -17.931 -9.952  0.50 24.90  ? 4   MAN C O2  1 
HETATM 6241 O  O3  . MAN E 5  .   ? -46.268 -17.529 -11.643 0.50 23.19  ? 4   MAN C O3  1 
HETATM 6242 O  O4  . MAN E 5  .   ? -47.959 -19.219 -10.628 0.50 36.13  ? 4   MAN C O4  1 
HETATM 6243 O  O5  . MAN E 5  .   ? -45.850 -18.563 -7.750  0.50 26.49  ? 4   MAN C O5  1 
HETATM 6244 O  O6  . MAN E 5  .   ? -47.799 -20.310 -6.610  0.50 48.95  ? 4   MAN C O6  1 
HETATM 6245 C  C1  . NAG F 6  .   ? -19.957 -57.661 37.736  1.00 73.77  ? 330 NAG A C1  1 
HETATM 6246 C  C2  . NAG F 6  .   ? -19.176 -58.835 38.381  1.00 81.54  ? 330 NAG A C2  1 
HETATM 6247 C  C3  . NAG F 6  .   ? -18.547 -59.787 37.352  1.00 86.81  ? 330 NAG A C3  1 
HETATM 6248 C  C4  . NAG F 6  .   ? -19.620 -60.265 36.366  1.00 83.98  ? 330 NAG A C4  1 
HETATM 6249 C  C5  . NAG F 6  .   ? -20.223 -59.003 35.715  1.00 82.22  ? 330 NAG A C5  1 
HETATM 6250 C  C6  . NAG F 6  .   ? -21.325 -59.264 34.698  1.00 78.40  ? 330 NAG A C6  1 
HETATM 6251 C  C7  . NAG F 6  .   ? -18.459 -58.017 40.573  1.00 79.34  ? 330 NAG A C7  1 
HETATM 6252 C  C8  . NAG F 6  .   ? -17.336 -57.498 41.417  1.00 81.87  ? 330 NAG A C8  1 
HETATM 6253 N  N2  . NAG F 6  .   ? -18.165 -58.334 39.312  1.00 83.75  ? 330 NAG A N2  1 
HETATM 6254 O  O3  . NAG F 6  .   ? -17.928 -60.876 38.014  1.00 82.40  ? 330 NAG A O3  1 
HETATM 6255 O  O4  . NAG F 6  .   ? -19.050 -61.153 35.428  1.00 82.11  ? 330 NAG A O4  1 
HETATM 6256 O  O5  . NAG F 6  .   ? -20.806 -58.185 36.712  1.00 77.88  ? 330 NAG A O5  1 
HETATM 6257 O  O6  . NAG F 6  .   ? -22.555 -59.373 35.384  1.00 79.05  ? 330 NAG A O6  1 
HETATM 6258 O  O7  . NAG F 6  .   ? -19.588 -58.138 41.046  1.00 89.85  ? 330 NAG A O7  1 
HETATM 6259 C  C1  . EDO G 7  .   ? -59.466 -34.384 19.575  1.00 65.26  ? 331 EDO A C1  1 
HETATM 6260 O  O1  . EDO G 7  .   ? -60.425 -33.299 19.686  1.00 32.68  ? 331 EDO A O1  1 
HETATM 6261 C  C2  . EDO G 7  .   ? -59.401 -35.404 20.713  1.00 63.35  ? 331 EDO A C2  1 
HETATM 6262 O  O2  . EDO G 7  .   ? -59.320 -36.757 20.120  1.00 59.07  ? 331 EDO A O2  1 
HETATM 6263 C  C1  . GOL H 8  .   ? -72.520 -27.921 12.115  1.00 58.77  ? 332 GOL A C1  1 
HETATM 6264 O  O1  . GOL H 8  .   ? -73.837 -28.401 12.266  1.00 57.09  ? 332 GOL A O1  1 
HETATM 6265 C  C2  . GOL H 8  .   ? -72.233 -26.691 13.002  1.00 61.65  ? 332 GOL A C2  1 
HETATM 6266 O  O2  . GOL H 8  .   ? -72.547 -25.598 12.244  1.00 36.65  ? 332 GOL A O2  1 
HETATM 6267 C  C3  . GOL H 8  .   ? -70.802 -26.384 13.489  1.00 59.99  ? 332 GOL A C3  1 
HETATM 6268 O  O3  . GOL H 8  .   ? -70.688 -25.210 14.225  1.00 41.13  ? 332 GOL A O3  1 
HETATM 6269 C  C2  . ETX I 9  .   ? -72.562 -32.975 22.823  1.00 51.23  ? 333 ETX A C2  1 
HETATM 6270 O  O2  . ETX I 9  .   ? -73.854 -33.020 23.358  1.00 40.11  ? 333 ETX A O2  1 
HETATM 6271 C  C3  . ETX I 9  .   ? -74.636 -32.740 22.270  1.00 24.90  ? 333 ETX A C3  1 
HETATM 6272 C  C4  . ETX I 9  .   ? -76.071 -32.769 22.407  1.00 21.10  ? 333 ETX A C4  1 
HETATM 6273 O  O1  . ETX I 9  .   ? -71.771 -33.093 25.085  1.00 40.66  ? 333 ETX A O1  1 
HETATM 6274 C  C1  . ETX I 9  .   ? -71.598 -32.401 23.862  1.00 62.76  ? 333 ETX A C1  1 
HETATM 6275 C  C1  . NAG J 6  .   ? -68.845 4.848   12.667  1.00 57.78  ? 180 NAG B C1  1 
HETATM 6276 C  C2  . NAG J 6  .   ? -68.147 5.937   13.528  1.00 74.27  ? 180 NAG B C2  1 
HETATM 6277 C  C3  . NAG J 6  .   ? -68.169 7.416   13.081  1.00 76.25  ? 180 NAG B C3  1 
HETATM 6278 C  C4  . NAG J 6  .   ? -68.459 7.590   11.585  1.00 74.24  ? 180 NAG B C4  1 
HETATM 6279 C  C5  . NAG J 6  .   ? -69.628 6.658   11.226  1.00 70.35  ? 180 NAG B C5  1 
HETATM 6280 C  C6  . NAG J 6  .   ? -70.136 6.836   9.795   1.00 67.52  ? 180 NAG B C6  1 
HETATM 6281 C  C7  . NAG J 6  .   ? -68.205 5.053   15.791  1.00 81.76  ? 180 NAG B C7  1 
HETATM 6282 C  C8  . NAG J 6  .   ? -68.856 4.977   17.152  1.00 68.62  ? 180 NAG B C8  1 
HETATM 6283 N  N2  . NAG J 6  .   ? -68.743 5.846   14.867  1.00 79.85  ? 180 NAG B N2  1 
HETATM 6284 O  O3  . NAG J 6  .   ? -66.960 8.063   13.492  1.00 80.49  ? 180 NAG B O3  1 
HETATM 6285 O  O4  . NAG J 6  .   ? -68.716 8.955   11.268  1.00 75.18  ? 180 NAG B O4  1 
HETATM 6286 O  O5  . NAG J 6  .   ? -69.210 5.314   11.371  1.00 61.19  ? 180 NAG B O5  1 
HETATM 6287 O  O6  . NAG J 6  .   ? -69.200 6.399   8.831   1.00 53.97  ? 180 NAG B O6  1 
HETATM 6288 O  O7  . NAG J 6  .   ? -67.185 4.413   15.533  1.00 78.98  ? 180 NAG B O7  1 
HETATM 6289 C  C1  . GOL K 8  .   ? -66.642 -1.783  12.898  1.00 56.36  ? 181 GOL B C1  1 
HETATM 6290 O  O1  . GOL K 8  .   ? -65.701 -0.892  12.334  1.00 63.42  ? 181 GOL B O1  1 
HETATM 6291 C  C2  . GOL K 8  .   ? -66.046 -2.631  14.015  1.00 57.44  ? 181 GOL B C2  1 
HETATM 6292 O  O2  . GOL K 8  .   ? -65.319 -3.698  13.411  1.00 33.97  ? 181 GOL B O2  1 
HETATM 6293 C  C3  . GOL K 8  .   ? -67.193 -2.999  15.000  1.00 55.77  ? 181 GOL B C3  1 
HETATM 6294 O  O3  . GOL K 8  .   ? -66.999 -4.046  15.939  1.00 39.45  ? 181 GOL B O3  1 
HETATM 6295 CL CL  . CL  L 10 .   ? -67.597 -4.978  4.480   1.00 38.81  ? 182 CL  B CL  1 
HETATM 6296 C  C1  . EDO M 7  .   ? -70.539 -3.833  16.250  1.00 51.90  ? 183 EDO B C1  1 
HETATM 6297 O  O1  . EDO M 7  .   ? -71.599 -2.940  15.883  1.00 56.58  ? 183 EDO B O1  1 
HETATM 6298 C  C2  . EDO M 7  .   ? -71.054 -5.274  16.091  1.00 48.66  ? 183 EDO B C2  1 
HETATM 6299 O  O2  . EDO M 7  .   ? -70.408 -6.260  16.920  1.00 36.54  ? 183 EDO B O2  1 
HETATM 6300 C  C1  . EDO N 7  .   ? -79.430 -28.986 12.231  1.00 67.91  ? 184 EDO B C1  1 
HETATM 6301 O  O1  . EDO N 7  .   ? -80.241 -28.309 13.201  1.00 41.48  ? 184 EDO B O1  1 
HETATM 6302 C  C2  . EDO N 7  .   ? -77.989 -28.478 12.260  1.00 62.15  ? 184 EDO B C2  1 
HETATM 6303 O  O2  . EDO N 7  .   ? -77.364 -28.725 13.546  1.00 54.96  ? 184 EDO B O2  1 
HETATM 6304 C  C1  . EDO O 7  .   ? -72.936 3.200   -4.087  1.00 54.98  ? 185 EDO B C1  1 
HETATM 6305 O  O1  . EDO O 7  .   ? -74.172 2.657   -3.702  1.00 46.60  ? 185 EDO B O1  1 
HETATM 6306 C  C2  . EDO O 7  .   ? -72.240 4.035   -3.054  1.00 57.86  ? 185 EDO B C2  1 
HETATM 6307 O  O2  . EDO O 7  .   ? -70.890 3.542   -3.094  1.00 53.96  ? 185 EDO B O2  1 
HETATM 6308 O  O14 . UNL P 11 .   ? -85.874 -5.808  16.103  1.00 67.13  ? 186 UNL B O14 1 
HETATM 6309 O  O13 . UNL P 11 .   ? -85.773 -5.963  17.474  1.00 84.74  ? 186 UNL B O13 1 
HETATM 6310 O  O2  . UNL P 11 .   ? -84.973 -6.685  18.011  1.00 87.36  ? 186 UNL B O2  1 
HETATM 6311 O  O1  . UNL P 11 .   ? -83.905 -6.183  18.552  1.00 72.99  ? 186 UNL B O1  1 
HETATM 6312 O  O3  . UNL P 11 .   ? -85.205 -7.865  18.110  1.00 91.60  ? 186 UNL B O3  1 
HETATM 6313 O  O4  . UNL P 11 .   ? -84.461 -8.787  17.792  1.00 97.58  ? 186 UNL B O4  1 
HETATM 6314 O  O8  . UNL P 11 .   ? -84.819 -9.879  17.732  1.00 84.70  ? 186 UNL B O8  1 
HETATM 6315 O  O9  . UNL P 11 .   ? -85.953 -10.266 17.526  1.00 90.22  ? 186 UNL B O9  1 
HETATM 6316 O  O10 . UNL P 11 .   ? -86.322 -11.447 17.935  1.00 85.57  ? 186 UNL B O10 1 
HETATM 6317 O  O11 . UNL P 11 .   ? -85.405 -12.123 18.510  1.00 91.72  ? 186 UNL B O11 1 
HETATM 6318 O  O12 . UNL P 11 .   ? -84.190 -11.700 18.351  1.00 88.21  ? 186 UNL B O12 1 
HETATM 6319 O  O7  . UNL P 11 .   ? -83.982 -10.598 17.910  1.00 84.76  ? 186 UNL B O7  1 
HETATM 6320 O  O6  . UNL P 11 .   ? -82.944 -9.995  18.074  1.00 74.51  ? 186 UNL B O6  1 
HETATM 6321 O  O5  . UNL P 11 .   ? -83.241 -8.748  17.960  1.00 66.33  ? 186 UNL B O5  1 
HETATM 6322 C  C1  . EDO Q 7  .   ? -55.638 -12.855 28.756  1.00 55.56  ? 228 EDO H C1  1 
HETATM 6323 O  O1  . EDO Q 7  .   ? -55.982 -11.784 27.889  1.00 39.19  ? 228 EDO H O1  1 
HETATM 6324 C  C2  . EDO Q 7  .   ? -54.457 -12.452 29.609  1.00 52.30  ? 228 EDO H C2  1 
HETATM 6325 O  O2  . EDO Q 7  .   ? -53.622 -13.568 29.815  1.00 48.18  ? 228 EDO H O2  1 
HETATM 6326 O  O   . HOH R 12 .   ? -65.168 -30.984 8.952   1.00 27.98  ? 6   HOH A O   1 
HETATM 6327 O  O   . HOH R 12 .   ? -37.847 -46.021 36.118  1.00 29.34  ? 334 HOH A O   1 
HETATM 6328 O  O   . HOH R 12 .   ? -37.388 -53.448 52.128  1.00 23.24  ? 335 HOH A O   1 
HETATM 6329 O  O   . HOH R 12 .   ? -37.281 -46.987 55.646  1.00 21.88  ? 336 HOH A O   1 
HETATM 6330 O  O   . HOH R 12 .   ? -49.545 -38.933 20.374  1.00 35.46  ? 337 HOH A O   1 
HETATM 6331 O  O   . HOH R 12 .   ? -66.673 -34.418 10.443  1.00 32.88  ? 338 HOH A O   1 
HETATM 6332 O  O   . HOH R 12 .   ? -21.052 -35.103 41.999  1.00 39.73  ? 339 HOH A O   1 
HETATM 6333 O  O   . HOH R 12 .   ? -28.617 -44.743 30.887  1.00 28.38  ? 340 HOH A O   1 
HETATM 6334 O  O   . HOH R 12 .   ? -65.519 -21.448 8.111   1.00 25.74  ? 341 HOH A O   1 
HETATM 6335 O  O   . HOH R 12 .   ? -53.145 -34.055 20.080  1.00 26.75  ? 342 HOH A O   1 
HETATM 6336 O  O   . HOH R 12 .   ? -44.073 -22.683 30.689  1.00 43.57  ? 343 HOH A O   1 
HETATM 6337 O  O   . HOH R 12 .   ? -51.024 -26.368 19.323  1.00 25.09  ? 344 HOH A O   1 
HETATM 6338 O  O   . HOH R 12 .   ? -36.693 -48.793 44.158  1.00 42.74  ? 345 HOH A O   1 
HETATM 6339 O  O   . HOH R 12 .   ? -38.407 -45.224 38.812  1.00 33.97  ? 346 HOH A O   1 
HETATM 6340 O  O   . HOH R 12 .   ? -77.013 -0.366  -9.506  1.00 28.73  ? 347 HOH A O   1 
HETATM 6341 O  O   . HOH R 12 .   ? -33.284 -48.794 60.606  1.00 19.56  ? 348 HOH A O   1 
HETATM 6342 O  O   . HOH R 12 .   ? -66.741 -38.398 19.496  1.00 31.73  ? 349 HOH A O   1 
HETATM 6343 O  O   . HOH R 12 .   ? -72.246 -8.064  -0.354  1.00 27.88  ? 350 HOH A O   1 
HETATM 6344 O  O   . HOH R 12 .   ? -55.450 -21.276 18.465  1.00 29.17  ? 351 HOH A O   1 
HETATM 6345 O  O   . HOH R 12 .   ? -33.231 -46.371 59.968  1.00 21.71  ? 352 HOH A O   1 
HETATM 6346 O  O   . HOH R 12 .   ? -50.798 -39.644 35.222  1.00 34.35  ? 353 HOH A O   1 
HETATM 6347 O  O   . HOH R 12 .   ? -47.707 -29.145 19.906  1.00 29.00  ? 354 HOH A O   1 
HETATM 6348 O  O   . HOH R 12 .   ? -42.325 -29.479 31.867  1.00 46.05  ? 355 HOH A O   1 
HETATM 6349 O  O   . HOH R 12 .   ? -59.119 -31.588 7.515   1.00 31.09  ? 356 HOH A O   1 
HETATM 6350 O  O   . HOH R 12 .   ? -49.640 -27.176 21.200  1.00 21.59  ? 357 HOH A O   1 
HETATM 6351 O  O   . HOH R 12 .   ? -35.460 -57.985 53.674  1.00 30.43  ? 358 HOH A O   1 
HETATM 6352 O  O   . HOH R 12 .   ? -62.420 -27.686 5.652   1.00 39.48  ? 359 HOH A O   1 
HETATM 6353 O  O   . HOH R 12 .   ? -33.516 -50.818 37.724  1.00 41.93  ? 360 HOH A O   1 
HETATM 6354 O  O   . HOH R 12 .   ? -68.463 -23.695 14.502  1.00 19.62  ? 361 HOH A O   1 
HETATM 6355 O  O   . HOH R 12 .   ? -82.250 -3.549  -7.907  1.00 44.94  ? 362 HOH A O   1 
HETATM 6356 O  O   . HOH R 12 .   ? -59.962 -35.769 15.350  1.00 39.71  ? 363 HOH A O   1 
HETATM 6357 O  O   . HOH R 12 .   ? -39.692 -37.949 20.502  1.00 36.59  ? 364 HOH A O   1 
HETATM 6358 O  O   . HOH R 12 .   ? -53.739 -27.190 9.202   1.00 37.03  ? 365 HOH A O   1 
HETATM 6359 O  O   . HOH R 12 .   ? -55.128 -22.642 12.166  1.00 29.25  ? 366 HOH A O   1 
HETATM 6360 O  O   . HOH R 12 .   ? -26.428 -33.777 23.658  1.00 46.55  ? 367 HOH A O   1 
HETATM 6361 O  O   . HOH R 12 .   ? -32.742 -50.206 58.495  1.00 16.17  ? 368 HOH A O   1 
HETATM 6362 O  O   . HOH R 12 .   ? -24.690 -42.352 29.502  1.00 36.58  ? 369 HOH A O   1 
HETATM 6363 O  O   . HOH R 12 .   ? -40.377 -32.210 24.583  1.00 30.14  ? 370 HOH A O   1 
HETATM 6364 O  O   . HOH R 12 .   ? -15.741 -68.009 52.799  1.00 33.51  ? 371 HOH A O   1 
HETATM 6365 O  O   . HOH R 12 .   ? -56.862 -25.657 13.781  1.00 44.34  ? 372 HOH A O   1 
HETATM 6366 O  O   . HOH R 12 .   ? -8.453  -55.808 55.062  1.00 19.37  ? 373 HOH A O   1 
HETATM 6367 O  O   . HOH R 12 .   ? -56.520 -40.631 22.567  1.00 40.83  ? 374 HOH A O   1 
HETATM 6368 O  O   . HOH R 12 .   ? -48.352 -46.502 30.701  1.00 47.36  ? 375 HOH A O   1 
HETATM 6369 O  O   . HOH R 12 .   ? -68.586 -38.383 13.032  1.00 39.00  ? 376 HOH A O   1 
HETATM 6370 O  O   . HOH R 12 .   ? -48.622 -29.868 17.459  1.00 36.22  ? 377 HOH A O   1 
HETATM 6371 O  O   . HOH R 12 .   ? -22.372 -40.365 37.243  1.00 34.32  ? 378 HOH A O   1 
HETATM 6372 O  O   . HOH R 12 .   ? -22.456 -58.351 41.914  1.00 44.62  ? 379 HOH A O   1 
HETATM 6373 O  O   . HOH R 12 .   ? -44.091 -31.573 20.475  1.00 45.47  ? 380 HOH A O   1 
HETATM 6374 O  O   . HOH R 12 .   ? -30.922 -53.491 56.995  1.00 26.64  ? 381 HOH A O   1 
HETATM 6375 O  O   . HOH R 12 .   ? -61.410 -39.094 15.693  1.00 48.35  ? 382 HOH A O   1 
HETATM 6376 O  O   . HOH R 12 .   ? -34.453 -46.713 28.448  1.00 37.82  ? 383 HOH A O   1 
HETATM 6377 O  O   . HOH R 12 .   ? -50.116 -43.379 24.586  1.00 39.99  ? 384 HOH A O   1 
HETATM 6378 O  O   . HOH R 12 .   ? -57.379 -45.106 29.977  1.00 32.04  ? 385 HOH A O   1 
HETATM 6379 O  O   . HOH R 12 .   ? -32.059 -39.435 44.720  1.00 35.71  ? 386 HOH A O   1 
HETATM 6380 O  O   . HOH R 12 .   ? -45.620 -40.750 22.877  1.00 40.19  ? 387 HOH A O   1 
HETATM 6381 O  O   . HOH R 12 .   ? -68.250 -41.057 13.783  1.00 42.26  ? 388 HOH A O   1 
HETATM 6382 O  O   . HOH R 12 .   ? -49.588 -34.927 20.324  1.00 29.48  ? 389 HOH A O   1 
HETATM 6383 O  O   . HOH R 12 .   ? -55.613 -32.453 13.411  1.00 41.70  ? 390 HOH A O   1 
HETATM 6384 O  O   . HOH R 12 .   ? -51.506 -23.990 18.101  1.00 55.35  ? 391 HOH A O   1 
HETATM 6385 O  O   . HOH R 12 .   ? -9.817  -53.324 68.757  1.00 35.49  ? 392 HOH A O   1 
HETATM 6386 O  O   . HOH R 12 .   ? -54.499 -23.257 14.715  1.00 29.71  ? 393 HOH A O   1 
HETATM 6387 O  O   . HOH R 12 .   ? -38.843 -55.120 57.762  1.00 38.24  ? 394 HOH A O   1 
HETATM 6388 O  O   . HOH R 12 .   ? -18.626 -37.403 50.186  1.00 40.19  ? 395 HOH A O   1 
HETATM 6389 O  O   . HOH R 12 .   ? -22.588 -59.691 39.915  1.00 36.41  ? 396 HOH A O   1 
HETATM 6390 O  O   . HOH R 12 .   ? -39.026 -54.125 54.296  1.00 30.45  ? 397 HOH A O   1 
HETATM 6391 O  O   . HOH R 12 .   ? -71.349 -27.238 16.270  1.00 33.86  ? 398 HOH A O   1 
HETATM 6392 O  O   . HOH R 12 .   ? -11.382 -55.861 71.775  1.00 27.18  ? 399 HOH A O   1 
HETATM 6393 O  O   . HOH R 12 .   ? -55.692 -35.993 13.847  1.00 55.70  ? 400 HOH A O   1 
HETATM 6394 O  O   . HOH R 12 .   ? -65.456 -26.502 2.650   1.00 30.42  ? 401 HOH A O   1 
HETATM 6395 O  O   . HOH R 12 .   ? -44.009 -45.259 28.056  1.00 54.12  ? 402 HOH A O   1 
HETATM 6396 O  O   . HOH R 12 .   ? -56.480 -33.922 11.611  1.00 65.16  ? 403 HOH A O   1 
HETATM 6397 O  O   . HOH R 12 .   ? -35.698 -48.237 41.816  1.00 47.28  ? 404 HOH A O   1 
HETATM 6398 O  O   . HOH R 12 .   ? -37.391 -40.706 50.671  1.00 42.93  ? 405 HOH A O   1 
HETATM 6399 O  O   . HOH R 12 .   ? -18.930 -32.556 61.203  1.00 33.32  ? 406 HOH A O   1 
HETATM 6400 O  O   . HOH R 12 .   ? -52.765 -25.631 15.346  1.00 51.58  ? 407 HOH A O   1 
HETATM 6401 O  O   . HOH R 12 .   ? -40.332 -28.717 30.062  1.00 37.51  ? 408 HOH A O   1 
HETATM 6402 O  O   . HOH R 12 .   ? -10.251 -44.148 56.797  1.00 25.53  ? 409 HOH A O   1 
HETATM 6403 O  O   . HOH R 12 .   ? -44.360 -46.779 30.239  1.00 53.08  ? 410 HOH A O   1 
HETATM 6404 O  O   . HOH R 12 .   ? -37.316 -28.521 30.067  1.00 33.31  ? 411 HOH A O   1 
HETATM 6405 O  O   . HOH R 12 .   ? -40.084 -26.069 29.868  1.00 44.93  ? 412 HOH A O   1 
HETATM 6406 O  O   . HOH R 12 .   ? -58.599 -40.549 21.209  1.00 57.68  ? 413 HOH A O   1 
HETATM 6407 O  O   . HOH R 12 .   ? -50.017 -28.739 16.564  1.00 39.52  ? 414 HOH A O   1 
HETATM 6408 O  O   . HOH S 12 .   ? -78.949 7.118   0.036   1.00 23.04  ? 187 HOH B O   1 
HETATM 6409 O  O   . HOH S 12 .   ? -44.108 -55.506 53.508  1.00 28.66  ? 188 HOH B O   1 
HETATM 6410 O  O   . HOH S 12 .   ? -80.643 -12.823 4.653   1.00 22.09  ? 189 HOH B O   1 
HETATM 6411 O  O   . HOH S 12 .   ? -78.472 -16.853 19.713  1.00 38.07  ? 190 HOH B O   1 
HETATM 6412 O  O   . HOH S 12 .   ? -52.972 -33.186 36.275  1.00 60.07  ? 191 HOH B O   1 
HETATM 6413 O  O   . HOH S 12 .   ? -69.274 -16.576 5.773   1.00 23.29  ? 192 HOH B O   1 
HETATM 6414 O  O   . HOH S 12 .   ? -72.957 -25.239 16.486  1.00 48.52  ? 193 HOH B O   1 
HETATM 6415 O  O   . HOH S 12 .   ? -72.499 -16.294 22.188  1.00 26.86  ? 194 HOH B O   1 
HETATM 6416 O  O   . HOH S 12 .   ? -47.328 -34.423 41.246  1.00 43.12  ? 195 HOH B O   1 
HETATM 6417 O  O   . HOH S 12 .   ? -62.702 -26.131 22.730  1.00 21.75  ? 196 HOH B O   1 
HETATM 6418 O  O   . HOH S 12 .   ? -58.481 -16.935 5.144   1.00 25.91  ? 197 HOH B O   1 
HETATM 6419 O  O   . HOH S 12 .   ? -77.158 7.022   14.178  1.00 46.17  ? 198 HOH B O   1 
HETATM 6420 O  O   . HOH S 12 .   ? -72.090 -18.501 2.563   1.00 30.71  ? 199 HOH B O   1 
HETATM 6421 O  O   . HOH S 12 .   ? -83.792 -5.804  8.627   1.00 26.76  ? 200 HOH B O   1 
HETATM 6422 O  O   . HOH S 12 .   ? -40.460 -54.622 42.468  1.00 31.28  ? 201 HOH B O   1 
HETATM 6423 O  O   . HOH S 12 .   ? -85.672 9.433   5.409   1.00 25.69  ? 202 HOH B O   1 
HETATM 6424 O  O   . HOH S 12 .   ? -60.049 -46.064 37.902  1.00 38.57  ? 203 HOH B O   1 
HETATM 6425 O  O   . HOH S 12 .   ? -46.770 -36.484 41.913  1.00 63.30  ? 204 HOH B O   1 
HETATM 6426 O  O   . HOH S 12 .   ? -59.422 -55.698 46.598  1.00 33.50  ? 205 HOH B O   1 
HETATM 6427 O  O   . HOH S 12 .   ? -86.770 -8.806  4.315   1.00 24.87  ? 206 HOH B O   1 
HETATM 6428 O  O   . HOH S 12 .   ? -72.789 -4.249  13.364  1.00 23.77  ? 207 HOH B O   1 
HETATM 6429 O  O   . HOH S 12 .   ? -81.866 1.295   13.704  1.00 24.07  ? 208 HOH B O   1 
HETATM 6430 O  O   . HOH S 12 .   ? -70.675 -12.185 0.202   1.00 41.58  ? 209 HOH B O   1 
HETATM 6431 O  O   . HOH S 12 .   ? -75.551 -24.193 12.595  1.00 22.53  ? 210 HOH B O   1 
HETATM 6432 O  O   . HOH S 12 .   ? -51.118 -42.893 38.012  1.00 25.44  ? 211 HOH B O   1 
HETATM 6433 O  O   . HOH S 12 .   ? -37.355 -60.865 46.419  1.00 38.58  ? 212 HOH B O   1 
HETATM 6434 O  O   . HOH S 12 .   ? -46.399 -59.732 52.628  1.00 18.80  ? 213 HOH B O   1 
HETATM 6435 O  O   . HOH S 12 .   ? -90.889 3.417   9.835   1.00 38.32  ? 214 HOH B O   1 
HETATM 6436 O  O   . HOH S 12 .   ? -71.845 -11.679 18.022  1.00 25.43  ? 215 HOH B O   1 
HETATM 6437 O  O   . HOH S 12 .   ? -53.952 -52.863 38.068  1.00 42.01  ? 216 HOH B O   1 
HETATM 6438 O  O   . HOH S 12 .   ? -42.555 -41.151 43.673  1.00 39.43  ? 217 HOH B O   1 
HETATM 6439 O  O   . HOH S 12 .   ? -76.590 9.961   10.462  1.00 34.76  ? 218 HOH B O   1 
HETATM 6440 O  O   . HOH S 12 .   ? -73.205 -14.032 4.197   1.00 21.29  ? 219 HOH B O   1 
HETATM 6441 O  O   . HOH S 12 .   ? -69.447 -3.105  -7.142  1.00 33.59  ? 220 HOH B O   1 
HETATM 6442 O  O   . HOH S 12 .   ? -57.699 -44.857 27.204  1.00 41.62  ? 221 HOH B O   1 
HETATM 6443 O  O   . HOH S 12 .   ? -46.478 -51.852 41.851  1.00 25.71  ? 222 HOH B O   1 
HETATM 6444 O  O   . HOH S 12 .   ? -47.814 -57.717 50.527  1.00 37.11  ? 223 HOH B O   1 
HETATM 6445 O  O   . HOH S 12 .   ? -66.837 -4.652  -6.810  1.00 25.89  ? 224 HOH B O   1 
HETATM 6446 O  O   . HOH S 12 .   ? -72.063 -14.456 1.498   1.00 46.92  ? 225 HOH B O   1 
HETATM 6447 O  O   . HOH S 12 .   ? -75.415 -30.010 21.417  1.00 33.79  ? 226 HOH B O   1 
HETATM 6448 O  O   . HOH S 12 .   ? -74.062 -28.984 19.353  1.00 28.09  ? 227 HOH B O   1 
HETATM 6449 O  O   . HOH S 12 .   ? -75.347 -29.108 16.869  1.00 38.00  ? 228 HOH B O   1 
HETATM 6450 O  O   . HOH S 12 .   ? -70.657 -28.395 18.287  1.00 23.66  ? 229 HOH B O   1 
HETATM 6451 O  O   . HOH S 12 .   ? -59.592 -44.165 31.033  1.00 18.97  ? 230 HOH B O   1 
HETATM 6452 O  O   . HOH S 12 .   ? -61.369 -43.329 29.274  1.00 31.12  ? 231 HOH B O   1 
HETATM 6453 O  O   . HOH S 12 .   ? -64.313 -0.866  -2.012  1.00 53.51  ? 232 HOH B O   1 
HETATM 6454 O  O   . HOH S 12 .   ? -63.025 -33.803 32.823  1.00 29.45  ? 233 HOH B O   1 
HETATM 6455 O  O   . HOH S 12 .   ? -76.447 -24.789 4.704   1.00 33.29  ? 234 HOH B O   1 
HETATM 6456 O  O   . HOH S 12 .   ? -74.446 7.716   6.941   1.00 42.55  ? 235 HOH B O   1 
HETATM 6457 O  O   . HOH S 12 .   ? -79.275 -0.398  -2.477  1.00 22.50  ? 236 HOH B O   1 
HETATM 6458 O  O   . HOH S 12 .   ? -75.814 -25.105 25.287  0.33 24.21  ? 237 HOH B O   1 
HETATM 6459 O  O   . HOH S 12 .   ? -60.106 -43.382 26.763  1.00 37.92  ? 238 HOH B O   1 
HETATM 6460 O  O   . HOH S 12 .   ? -77.551 -9.648  20.993  1.00 20.45  ? 239 HOH B O   1 
HETATM 6461 O  O   . HOH S 12 .   ? -75.048 -10.029 21.179  1.00 46.11  ? 240 HOH B O   1 
HETATM 6462 O  O   . HOH S 12 .   ? -72.917 -9.495  17.916  1.00 28.13  ? 241 HOH B O   1 
HETATM 6463 O  O   . HOH S 12 .   ? -59.694 -19.343 -1.093  1.00 52.42  ? 242 HOH B O   1 
HETATM 6464 O  O   . HOH S 12 .   ? -63.783 -2.132  0.003   1.00 48.60  ? 243 HOH B O   1 
HETATM 6465 O  O   . HOH S 12 .   ? -68.499 7.207   1.414   1.00 27.63  ? 244 HOH B O   1 
HETATM 6466 O  O   . HOH S 12 .   ? -78.956 -3.816  16.621  1.00 28.46  ? 245 HOH B O   1 
HETATM 6467 O  O   . HOH S 12 .   ? -52.476 -40.690 37.349  1.00 27.86  ? 246 HOH B O   1 
HETATM 6468 O  O   . HOH S 12 .   ? -88.316 2.735   5.236   1.00 25.17  ? 247 HOH B O   1 
HETATM 6469 O  O   . HOH S 12 .   ? -47.299 -48.986 39.261  1.00 39.73  ? 248 HOH B O   1 
HETATM 6470 O  O   . HOH S 12 .   ? -43.857 -48.914 40.863  1.00 40.36  ? 249 HOH B O   1 
HETATM 6471 O  O   . HOH S 12 .   ? -60.951 -8.521  5.963   1.00 35.69  ? 250 HOH B O   1 
HETATM 6472 O  O   . HOH S 12 .   ? -57.053 -49.978 39.082  1.00 39.42  ? 251 HOH B O   1 
HETATM 6473 O  O   . HOH S 12 .   ? -41.091 -59.323 53.177  1.00 46.03  ? 252 HOH B O   1 
HETATM 6474 O  O   . HOH S 12 .   ? -78.341 1.648   14.200  1.00 28.30  ? 253 HOH B O   1 
HETATM 6475 O  O   . HOH S 12 .   ? -60.987 -35.940 23.484  1.00 28.59  ? 254 HOH B O   1 
HETATM 6476 O  O   . HOH S 12 .   ? -74.979 7.551   9.956   1.00 42.76  ? 255 HOH B O   1 
HETATM 6477 O  O   . HOH S 12 .   ? -61.729 -6.583  1.431   1.00 29.15  ? 256 HOH B O   1 
HETATM 6478 O  O   . HOH S 12 .   ? -76.081 5.598   9.009   1.00 33.57  ? 257 HOH B O   1 
HETATM 6479 O  O   . HOH S 12 .   ? -73.075 -25.723 4.552   1.00 40.40  ? 258 HOH B O   1 
HETATM 6480 O  O   . HOH S 12 .   ? -80.746 -2.039  16.651  1.00 34.15  ? 259 HOH B O   1 
HETATM 6481 O  O   . HOH S 12 .   ? -80.490 0.539   15.881  1.00 29.80  ? 260 HOH B O   1 
HETATM 6482 O  O   . HOH S 12 .   ? -70.001 -9.184  20.715  1.00 39.53  ? 261 HOH B O   1 
HETATM 6483 O  O   . HOH S 12 .   ? -44.020 -52.978 54.561  1.00 35.81  ? 262 HOH B O   1 
HETATM 6484 O  O   . HOH S 12 .   ? -66.927 -0.132  -1.514  1.00 22.70  ? 263 HOH B O   1 
HETATM 6485 O  O   . HOH S 12 .   ? -93.848 -1.054  3.056   1.00 39.66  ? 264 HOH B O   1 
HETATM 6486 O  O   . HOH S 12 .   ? -70.470 -31.339 17.088  1.00 24.19  ? 265 HOH B O   1 
HETATM 6487 O  O   . HOH S 12 .   ? -77.620 -14.055 -0.836  1.00 40.24  ? 266 HOH B O   1 
HETATM 6488 O  O   . HOH S 12 .   ? -71.544 -23.335 23.714  1.00 20.61  ? 267 HOH B O   1 
HETATM 6489 O  O   . HOH S 12 .   ? -73.188 -25.405 23.967  1.00 26.60  ? 268 HOH B O   1 
HETATM 6490 O  O   . HOH S 12 .   ? -67.370 -0.141  2.677   1.00 28.03  ? 269 HOH B O   1 
HETATM 6491 O  O   . HOH S 12 .   ? -70.437 -30.399 25.922  1.00 29.01  ? 270 HOH B O   1 
HETATM 6492 O  O   . HOH S 12 .   ? -82.952 -9.183  14.680  1.00 26.23  ? 271 HOH B O   1 
HETATM 6493 O  O   . HOH S 12 .   ? -42.203 -43.640 44.291  1.00 38.52  ? 272 HOH B O   1 
HETATM 6494 O  O   . HOH S 12 .   ? -65.013 -3.610  3.576   1.00 37.92  ? 273 HOH B O   1 
HETATM 6495 O  O   . HOH S 12 .   ? -66.985 6.288   8.251   1.00 39.41  ? 274 HOH B O   1 
HETATM 6496 O  O   . HOH S 12 .   ? -67.662 -20.773 1.465   1.00 42.55  ? 275 HOH B O   1 
HETATM 6497 O  O   . HOH S 12 .   ? -74.986 8.215   3.041   1.00 44.33  ? 276 HOH B O   1 
HETATM 6498 O  O   . HOH S 12 .   ? -60.333 -5.167  20.367  1.00 27.40  ? 277 HOH B O   1 
HETATM 6499 O  O   . HOH S 12 .   ? -80.408 -8.157  17.970  1.00 23.40  ? 278 HOH B O   1 
HETATM 6500 O  O   . HOH S 12 .   ? -71.410 -16.043 3.530   1.00 36.14  ? 279 HOH B O   1 
HETATM 6501 O  O   . HOH S 12 .   ? -57.182 -43.148 25.503  1.00 33.88  ? 280 HOH B O   1 
HETATM 6502 O  O   . HOH S 12 .   ? -51.988 -25.888 35.914  1.00 44.88  ? 281 HOH B O   1 
HETATM 6503 O  O   . HOH S 12 .   ? -57.805 -15.853 30.726  1.00 39.22  ? 282 HOH B O   1 
HETATM 6504 O  O   . HOH S 12 .   ? -89.011 -6.287  2.846   1.00 42.01  ? 283 HOH B O   1 
HETATM 6505 O  O   . HOH S 12 .   ? -58.311 -14.047 28.242  1.00 43.98  ? 284 HOH B O   1 
HETATM 6506 O  O   . HOH S 12 .   ? -81.464 3.730   13.547  1.00 26.49  ? 285 HOH B O   1 
HETATM 6507 O  O   . HOH S 12 .   ? -61.055 -7.307  25.663  1.00 47.33  ? 286 HOH B O   1 
HETATM 6508 O  O   . HOH S 12 .   ? -49.999 -42.838 40.459  1.00 28.48  ? 287 HOH B O   1 
HETATM 6509 O  O   . HOH S 12 .   ? -68.466 -13.479 -0.515  1.00 37.78  ? 288 HOH B O   1 
HETATM 6510 O  O   . HOH S 12 .   ? -71.386 -7.362  19.088  1.00 41.84  ? 289 HOH B O   1 
HETATM 6511 O  O   . HOH S 12 .   ? -63.988 -15.268 0.750   1.00 23.26  ? 290 HOH B O   1 
HETATM 6512 O  O   . HOH S 12 .   ? -80.146 -15.201 5.582   1.00 36.36  ? 291 HOH B O   1 
HETATM 6513 O  O   . HOH S 12 .   ? -64.777 -17.379 -0.634  1.00 32.22  ? 292 HOH B O   1 
HETATM 6514 O  O   . HOH S 12 .   ? -64.320 -18.971 1.350   1.00 21.57  ? 293 HOH B O   1 
HETATM 6515 O  O   . HOH S 12 .   ? -37.394 -48.884 40.048  1.00 51.73  ? 294 HOH B O   1 
HETATM 6516 O  O   . HOH S 12 .   ? -82.194 4.848   -4.009  1.00 31.65  ? 295 HOH B O   1 
HETATM 6517 O  O   . HOH S 12 .   ? -57.298 -14.370 1.951   1.00 42.55  ? 296 HOH B O   1 
HETATM 6518 O  O   . HOH S 12 .   ? -75.329 6.273   1.222   1.00 32.69  ? 297 HOH B O   1 
HETATM 6519 O  O   . HOH S 12 .   ? -69.092 -8.367  -4.693  1.00 29.54  ? 298 HOH B O   1 
HETATM 6520 O  O   . HOH S 12 .   ? -71.716 -29.007 27.735  0.33 2.00   ? 299 HOH B O   1 
HETATM 6521 O  O   . HOH S 12 .   ? -65.781 -3.985  10.723  1.00 32.92  ? 300 HOH B O   1 
HETATM 6522 O  O   . HOH S 12 .   ? -68.699 -12.598 20.031  1.00 35.14  ? 301 HOH B O   1 
HETATM 6523 O  O   . HOH S 12 .   ? -61.930 -20.112 -1.056  1.00 43.39  ? 302 HOH B O   1 
HETATM 6524 O  O   . HOH S 12 .   ? -79.803 -18.985 3.919   1.00 34.19  ? 303 HOH B O   1 
HETATM 6525 O  O   . HOH S 12 .   ? -63.328 -38.149 37.348  0.33 13.36  ? 304 HOH B O   1 
HETATM 6526 O  O   . HOH S 12 .   ? -65.547 -6.788  22.606  1.00 52.52  ? 305 HOH B O   1 
HETATM 6527 O  O   . HOH S 12 .   ? -59.908 -15.699 -0.417  1.00 36.72  ? 306 HOH B O   1 
HETATM 6528 O  O   . HOH S 12 .   ? -56.269 -16.911 1.097   1.00 47.91  ? 313 HOH B O   1 
HETATM 6529 O  O   . HOH S 12 .   ? -80.574 -17.932 19.134  1.00 42.68  ? 317 HOH B O   1 
HETATM 6530 O  O   . HOH S 12 .   ? -72.195 -11.252 -1.736  1.00 55.77  ? 321 HOH B O   1 
HETATM 6531 O  O   . HOH S 12 .   ? -74.398 -11.450 -2.466  1.00 56.24  ? 322 HOH B O   1 
HETATM 6532 O  O   . HOH T 12 .   ? -19.538 -10.470 20.026  1.00 4.73   ? 155 HOH H O   1 
HETATM 6533 O  O   . HOH T 12 .   ? -52.925 -16.525 22.963  1.00 39.26  ? 181 HOH H O   1 
HETATM 6534 O  O   . HOH T 12 .   ? -30.976 -16.035 16.608  1.00 37.65  ? 229 HOH H O   1 
HETATM 6535 O  O   . HOH T 12 .   ? -48.786 -13.582 9.292   1.00 32.69  ? 230 HOH H O   1 
HETATM 6536 O  O   . HOH T 12 .   ? -41.056 1.415   12.150  1.00 34.26  ? 231 HOH H O   1 
HETATM 6537 O  O   . HOH T 12 .   ? -34.685 4.258   17.266  1.00 25.87  ? 232 HOH H O   1 
HETATM 6538 O  O   . HOH T 12 .   ? -34.827 -13.310 8.880   1.00 48.32  ? 233 HOH H O   1 
HETATM 6539 O  O   . HOH T 12 .   ? -55.249 -11.660 10.792  1.00 26.62  ? 234 HOH H O   1 
HETATM 6540 O  O   . HOH T 12 .   ? -22.395 -12.705 16.915  1.00 31.77  ? 235 HOH H O   1 
HETATM 6541 O  O   . HOH T 12 .   ? -46.335 -10.728 8.042   1.00 40.63  ? 236 HOH H O   1 
HETATM 6542 O  O   . HOH T 12 .   ? -35.936 1.572   29.562  1.00 32.05  ? 237 HOH H O   1 
HETATM 6543 O  O   . HOH T 12 .   ? -28.249 -12.083 28.539  1.00 48.62  ? 238 HOH H O   1 
HETATM 6544 O  O   . HOH T 12 .   ? -35.506 -5.935  30.921  1.00 34.73  ? 239 HOH H O   1 
HETATM 6545 O  O   . HOH T 12 .   ? -40.074 -19.088 18.137  1.00 32.87  ? 240 HOH H O   1 
HETATM 6546 O  O   . HOH T 12 .   ? -44.673 -15.723 12.877  1.00 34.71  ? 241 HOH H O   1 
HETATM 6547 O  O   . HOH T 12 .   ? -46.546 -20.925 31.095  1.00 45.30  ? 242 HOH H O   1 
HETATM 6548 O  O   . HOH T 12 .   ? -36.746 -4.205  5.663   1.00 31.17  ? 243 HOH H O   1 
HETATM 6549 O  O   . HOH T 12 .   ? -25.311 -12.306 23.509  1.00 42.51  ? 244 HOH H O   1 
HETATM 6550 O  O   . HOH T 12 .   ? -59.388 2.730   19.553  1.00 47.44  ? 245 HOH H O   1 
HETATM 6551 O  O   . HOH T 12 .   ? -53.446 -20.240 19.905  1.00 32.84  ? 246 HOH H O   1 
HETATM 6552 O  O   . HOH T 12 .   ? -53.983 -20.781 33.163  1.00 28.09  ? 247 HOH H O   1 
HETATM 6553 O  O   . HOH T 12 .   ? -49.612 -14.608 28.727  1.00 39.10  ? 248 HOH H O   1 
HETATM 6554 O  O   . HOH T 12 .   ? -24.312 -15.346 17.220  1.00 50.04  ? 249 HOH H O   1 
HETATM 6555 O  O   . HOH T 12 .   ? -32.199 -11.577 25.127  1.00 34.33  ? 250 HOH H O   1 
HETATM 6556 O  O   . HOH T 12 .   ? -27.781 2.285   16.812  1.00 32.39  ? 251 HOH H O   1 
HETATM 6557 O  O   . HOH T 12 .   ? -43.058 -14.177 10.017  1.00 38.27  ? 252 HOH H O   1 
HETATM 6558 O  O   . HOH T 12 .   ? -28.118 -13.295 10.127  1.00 31.79  ? 253 HOH H O   1 
HETATM 6559 O  O   . HOH T 12 .   ? -45.824 -17.929 16.311  1.00 26.96  ? 254 HOH H O   1 
HETATM 6560 O  O   . HOH T 12 .   ? -50.154 -14.736 18.733  1.00 40.25  ? 255 HOH H O   1 
HETATM 6561 O  O   . HOH T 12 .   ? -53.270 -4.524  30.738  1.00 38.33  ? 256 HOH H O   1 
HETATM 6562 O  O   . HOH T 12 .   ? -30.711 -5.259  28.974  1.00 45.70  ? 257 HOH H O   1 
HETATM 6563 O  O   . HOH T 12 .   ? -30.013 -14.364 20.527  1.00 41.02  ? 258 HOH H O   1 
HETATM 6564 O  O   . HOH T 12 .   ? -47.957 -15.236 36.024  1.00 48.89  ? 259 HOH H O   1 
HETATM 6565 O  O   . HOH T 12 .   ? -40.524 1.132   8.540   1.00 34.97  ? 260 HOH H O   1 
HETATM 6566 O  O   . HOH T 12 .   ? -26.047 -5.216  24.825  1.00 31.30  ? 261 HOH H O   1 
HETATM 6567 O  O   . HOH T 12 .   ? -47.365 -16.976 13.803  1.00 40.99  ? 262 HOH H O   1 
HETATM 6568 O  O   . HOH T 12 .   ? -39.989 -10.284 8.064   1.00 39.67  ? 263 HOH H O   1 
HETATM 6569 O  O   . HOH T 12 .   ? -31.932 -13.980 29.381  1.00 47.81  ? 264 HOH H O   1 
HETATM 6570 O  O   . HOH T 12 .   ? -56.712 1.072   22.120  1.00 45.99  ? 265 HOH H O   1 
HETATM 6571 O  O   . HOH T 12 .   ? -47.783 -21.714 20.234  1.00 50.63  ? 266 HOH H O   1 
HETATM 6572 O  O   . HOH T 12 .   ? -50.207 -17.840 18.405  1.00 55.61  ? 267 HOH H O   1 
HETATM 6573 O  O   . HOH T 12 .   ? -55.464 -17.244 34.130  1.00 46.79  ? 268 HOH H O   1 
HETATM 6574 O  O   . HOH T 12 .   ? -48.197 -19.111 12.490  1.00 51.20  ? 269 HOH H O   1 
HETATM 6575 O  O   . HOH T 12 .   ? -58.095 -4.409  18.944  1.00 31.16  ? 270 HOH H O   1 
HETATM 6576 O  O   . HOH T 12 .   ? -39.179 -15.329 16.509  1.00 26.37  ? 271 HOH H O   1 
HETATM 6577 O  O   . HOH T 12 .   ? -57.141 -1.981  13.975  1.00 55.10  ? 272 HOH H O   1 
HETATM 6578 O  O   . HOH T 12 .   ? -42.390 3.024   13.858  1.00 29.54  ? 273 HOH H O   1 
HETATM 6579 O  O   . HOH T 12 .   ? -33.450 -2.152  8.891   1.00 37.16  ? 274 HOH H O   1 
HETATM 6580 O  O   . HOH T 12 .   ? -47.767 2.697   29.503  1.00 30.71  ? 275 HOH H O   1 
HETATM 6581 O  O   . HOH T 12 .   ? -19.488 -8.141  19.240  1.00 29.47  ? 276 HOH H O   1 
HETATM 6582 O  O   . HOH T 12 .   ? -29.145 -8.323  30.948  1.00 35.44  ? 277 HOH H O   1 
HETATM 6583 O  O   . HOH T 12 .   ? -38.484 -13.403 29.206  1.00 38.31  ? 278 HOH H O   1 
HETATM 6584 O  O   . HOH T 12 .   ? -42.699 -24.098 25.475  1.00 31.95  ? 279 HOH H O   1 
HETATM 6585 O  O   . HOH T 12 .   ? -55.698 -3.485  20.197  1.00 31.96  ? 280 HOH H O   1 
HETATM 6586 O  O   . HOH T 12 .   ? -45.738 0.371   30.980  1.00 34.48  ? 281 HOH H O   1 
HETATM 6587 O  O   . HOH T 12 .   ? -54.365 -3.719  12.807  1.00 46.06  ? 282 HOH H O   1 
HETATM 6588 O  O   . HOH T 12 .   ? -22.425 -0.352  17.892  1.00 36.67  ? 283 HOH H O   1 
HETATM 6589 O  O   . HOH T 12 .   ? -36.480 9.314   16.096  1.00 50.01  ? 284 HOH H O   1 
HETATM 6590 O  O   . HOH T 12 .   ? -43.628 -12.726 33.187  1.00 42.89  ? 285 HOH H O   1 
HETATM 6591 O  O   . HOH T 12 .   ? -33.879 -8.066  30.962  1.00 60.57  ? 286 HOH H O   1 
HETATM 6592 O  O   . HOH T 12 .   ? -44.313 -4.666  32.288  1.00 28.01  ? 287 HOH H O   1 
HETATM 6593 O  O   . HOH T 12 .   ? -47.629 -16.026 23.453  1.00 33.91  ? 288 HOH H O   1 
HETATM 6594 O  O   . HOH T 12 .   ? -23.954 1.768   16.626  1.00 51.95  ? 289 HOH H O   1 
HETATM 6595 O  O   . HOH T 12 .   ? -46.188 -24.483 23.653  1.00 41.73  ? 290 HOH H O   1 
HETATM 6596 O  O   . HOH T 12 .   ? -40.089 -5.620  32.110  1.00 47.22  ? 291 HOH H O   1 
HETATM 6597 O  O   . HOH T 12 .   ? -52.960 -17.724 20.907  1.00 47.40  ? 292 HOH H O   1 
HETATM 6598 O  O   . HOH T 12 .   ? -35.197 -16.144 25.513  1.00 52.65  ? 293 HOH H O   1 
HETATM 6599 O  O   . HOH T 12 .   ? -56.414 -9.607  29.184  1.00 52.82  ? 294 HOH H O   1 
HETATM 6600 O  O   . HOH T 12 .   ? -45.864 -7.439  7.258   1.00 40.64  ? 295 HOH H O   1 
HETATM 6601 O  O   . HOH T 12 .   ? -53.685 -6.249  13.669  1.00 34.99  ? 296 HOH H O   1 
HETATM 6602 O  O   . HOH T 12 .   ? -51.535 2.601   30.763  1.00 45.48  ? 297 HOH H O   1 
HETATM 6603 O  O   . HOH T 12 .   ? -37.665 -17.077 15.418  1.00 30.28  ? 298 HOH H O   1 
HETATM 6604 O  O   . HOH T 12 .   ? -47.182 -3.927  34.502  1.00 42.76  ? 299 HOH H O   1 
HETATM 6605 O  O   . HOH T 12 .   ? -51.054 -21.418 20.240  1.00 46.04  ? 300 HOH H O   1 
HETATM 6606 O  O   . HOH T 12 .   ? -35.578 -13.019 11.402  1.00 39.28  ? 301 HOH H O   1 
HETATM 6607 O  O   . HOH T 12 .   ? -51.092 -12.634 29.924  1.00 42.21  ? 302 HOH H O   1 
HETATM 6608 O  O   . HOH T 12 .   ? -32.977 -10.585 5.085   1.00 37.43  ? 306 HOH H O   1 
HETATM 6609 O  O   . HOH T 12 .   ? -26.701 -15.253 17.018  1.00 59.87  ? 309 HOH H O   1 
HETATM 6610 O  O   . HOH T 12 .   ? -43.287 -17.852 11.895  1.00 45.94  ? 318 HOH H O   1 
HETATM 6611 O  O   . HOH U 12 .   ? -54.768 19.459  17.243  1.00 43.79  ? 214 HOH L O   1 
HETATM 6612 O  O   . HOH U 12 .   ? -41.016 6.934   31.181  1.00 36.50  ? 215 HOH L O   1 
HETATM 6613 O  O   . HOH U 12 .   ? -61.663 9.968   21.064  1.00 35.24  ? 216 HOH L O   1 
HETATM 6614 O  O   . HOH U 12 .   ? -36.585 9.140   25.103  1.00 40.77  ? 217 HOH L O   1 
HETATM 6615 O  O   . HOH U 12 .   ? -35.948 11.658  20.189  1.00 41.50  ? 236 HOH L O   1 
HETATM 6616 O  O   . HOH U 12 .   ? -42.416 3.889   31.755  1.00 41.92  ? 277 HOH L O   1 
HETATM 6617 O  O   . HOH U 12 .   ? -41.727 5.637   13.308  1.00 48.33  ? 279 HOH L O   1 
HETATM 6618 O  O   . HOH U 12 .   ? -50.250 4.909   31.365  1.00 32.43  ? 280 HOH L O   1 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'NAG B 180 HAS WRONG CHIRALITY AT ATOM C1' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   7   7   ALA ALA A . n 
A 1 2   ASP 2   8   8   ASP ASP A . n 
A 1 3   PRO 3   9   9   PRO PRO A . n 
A 1 4   GLY 4   10  10  GLY GLY A . n 
A 1 5   ASP 5   11  11  ASP ASP A . n 
A 1 6   THR 6   12  12  THR THR A . n 
A 1 7   ILE 7   13  13  ILE ILE A . n 
A 1 8   CYS 8   14  14  CYS CYS A . n 
A 1 9   ILE 9   15  15  ILE ILE A . n 
A 1 10  GLY 10  16  16  GLY GLY A . n 
A 1 11  TYR 11  17  17  TYR TYR A . n 
A 1 12  HIS 12  18  18  HIS HIS A . n 
A 1 13  ALA 13  19  19  ALA ALA A . n 
A 1 14  ASN 14  20  20  ASN ASN A . n 
A 1 15  ASN 15  21  21  ASN ASN A . n 
A 1 16  SER 16  22  22  SER SER A . n 
A 1 17  THR 17  23  23  THR THR A . n 
A 1 18  ASP 18  24  24  ASP ASP A . n 
A 1 19  THR 19  25  25  THR THR A . n 
A 1 20  VAL 20  26  26  VAL VAL A . n 
A 1 21  ASP 21  27  27  ASP ASP A . n 
A 1 22  THR 22  28  28  THR THR A . n 
A 1 23  VAL 23  29  29  VAL VAL A . n 
A 1 24  LEU 24  30  30  LEU LEU A . n 
A 1 25  GLU 25  31  31  GLU GLU A . n 
A 1 26  LYS 26  32  32  LYS LYS A . n 
A 1 27  ASN 27  33  33  ASN ASN A . n 
A 1 28  VAL 28  34  34  VAL VAL A . n 
A 1 29  THR 29  35  35  THR THR A . n 
A 1 30  VAL 30  36  36  VAL VAL A . n 
A 1 31  THR 31  37  37  THR THR A . n 
A 1 32  HIS 32  38  38  HIS HIS A . n 
A 1 33  SER 33  39  39  SER SER A . n 
A 1 34  VAL 34  40  40  VAL VAL A . n 
A 1 35  ASN 35  41  41  ASN ASN A . n 
A 1 36  LEU 36  42  42  LEU LEU A . n 
A 1 37  LEU 37  43  43  LEU LEU A . n 
A 1 38  GLU 38  44  44  GLU GLU A . n 
A 1 39  ASP 39  45  45  ASP ASP A . n 
A 1 40  SER 40  46  46  SER SER A . n 
A 1 41  HIS 41  47  47  HIS HIS A . n 
A 1 42  ASN 42  48  48  ASN ASN A . n 
A 1 43  GLY 43  49  49  GLY GLY A . n 
A 1 44  LYS 44  50  50  LYS LYS A . n 
A 1 45  LEU 45  51  51  LEU LEU A . n 
A 1 46  CYS 46  52  52  CYS CYS A . n 
A 1 47  LYS 47  53  53  LYS LYS A . n 
A 1 48  LEU 48  54  54  LEU LEU A . n 
A 1 49  LYS 49  54  54  LYS LYS A A n 
A 1 50  GLY 50  55  55  GLY GLY A . n 
A 1 51  ILE 51  56  56  ILE ILE A . n 
A 1 52  ALA 52  57  57  ALA ALA A . n 
A 1 53  PRO 53  58  58  PRO PRO A . n 
A 1 54  LEU 54  59  59  LEU LEU A . n 
A 1 55  GLN 55  60  60  GLN GLN A . n 
A 1 56  LEU 56  61  61  LEU LEU A . n 
A 1 57  GLY 57  62  62  GLY GLY A . n 
A 1 58  LYS 58  63  63  LYS LYS A . n 
A 1 59  CYS 59  64  64  CYS CYS A . n 
A 1 60  ASN 60  65  65  ASN ASN A . n 
A 1 61  ILE 61  66  66  ILE ILE A . n 
A 1 62  ALA 62  67  67  ALA ALA A . n 
A 1 63  GLY 63  68  68  GLY GLY A . n 
A 1 64  TRP 64  69  69  TRP TRP A . n 
A 1 65  LEU 65  70  70  LEU LEU A . n 
A 1 66  LEU 66  71  71  LEU LEU A . n 
A 1 67  GLY 67  72  72  GLY GLY A . n 
A 1 68  ASN 68  73  73  ASN ASN A . n 
A 1 69  PRO 69  74  74  PRO PRO A . n 
A 1 70  GLU 70  75  75  GLU GLU A . n 
A 1 71  CYS 71  76  76  CYS CYS A . n 
A 1 72  ASP 72  77  77  ASP ASP A . n 
A 1 73  LEU 73  78  78  LEU LEU A . n 
A 1 74  LEU 74  79  79  LEU LEU A . n 
A 1 75  LEU 75  80  80  LEU LEU A . n 
A 1 76  THR 76  81  81  THR THR A . n 
A 1 77  ALA 77  82  82  ALA ALA A . n 
A 1 78  SER 78  83  83  SER SER A . n 
A 1 79  SER 79  83  83  SER SER A A n 
A 1 80  TRP 80  84  84  TRP TRP A . n 
A 1 81  SER 81  85  85  SER SER A . n 
A 1 82  TYR 82  86  86  TYR TYR A . n 
A 1 83  ILE 83  87  87  ILE ILE A . n 
A 1 84  VAL 84  88  88  VAL VAL A . n 
A 1 85  GLU 85  89  89  GLU GLU A . n 
A 1 86  THR 86  90  90  THR THR A . n 
A 1 87  SER 87  91  91  SER SER A . n 
A 1 88  ASN 88  92  92  ASN ASN A . n 
A 1 89  SER 89  93  93  SER SER A . n 
A 1 90  GLU 90  94  94  GLU GLU A . n 
A 1 91  ASN 91  95  95  ASN ASN A . n 
A 1 92  GLY 92  95  95  GLY GLY A A n 
A 1 93  THR 93  96  96  THR THR A . n 
A 1 94  CYS 94  97  97  CYS CYS A . n 
A 1 95  TYR 95  98  98  TYR TYR A . n 
A 1 96  PRO 96  99  99  PRO PRO A . n 
A 1 97  GLY 97  100 100 GLY GLY A . n 
A 1 98  ASP 98  101 101 ASP ASP A . n 
A 1 99  PHE 99  102 102 PHE PHE A . n 
A 1 100 ILE 100 103 103 ILE ILE A . n 
A 1 101 ASP 101 104 104 ASP ASP A . n 
A 1 102 TYR 102 105 105 TYR TYR A . n 
A 1 103 GLU 103 106 106 GLU GLU A . n 
A 1 104 GLU 104 107 107 GLU GLU A . n 
A 1 105 LEU 105 108 108 LEU LEU A . n 
A 1 106 ARG 106 109 109 ARG ARG A . n 
A 1 107 GLU 107 110 110 GLU GLU A . n 
A 1 108 GLN 108 111 111 GLN GLN A . n 
A 1 109 LEU 109 112 112 LEU LEU A . n 
A 1 110 SER 110 113 113 SER SER A . n 
A 1 111 SER 111 114 114 SER SER A . n 
A 1 112 VAL 112 115 115 VAL VAL A . n 
A 1 113 SER 113 116 116 SER SER A . n 
A 1 114 SER 114 117 117 SER SER A . n 
A 1 115 PHE 115 118 118 PHE PHE A . n 
A 1 116 GLU 116 119 119 GLU GLU A . n 
A 1 117 LYS 117 120 120 LYS LYS A . n 
A 1 118 PHE 118 121 121 PHE PHE A . n 
A 1 119 GLU 119 122 122 GLU GLU A . n 
A 1 120 ILE 120 123 123 ILE ILE A . n 
A 1 121 PHE 121 124 124 PHE PHE A . n 
A 1 122 PRO 122 125 125 PRO PRO A . n 
A 1 123 LYS 123 125 125 LYS LYS A A n 
A 1 124 THR 124 125 125 THR THR A B n 
A 1 125 SER 125 125 125 SER SER A C n 
A 1 126 SER 126 126 126 SER SER A . n 
A 1 127 TRP 127 127 127 TRP TRP A . n 
A 1 128 PRO 128 128 128 PRO PRO A . n 
A 1 129 ASN 129 129 129 ASN ASN A . n 
A 1 130 HIS 130 130 130 HIS HIS A . n 
A 1 131 GLU 131 131 131 GLU GLU A . n 
A 1 132 THR 132 132 132 THR THR A . n 
A 1 133 THR 133 133 133 THR THR A . n 
A 1 134 LYS 134 133 133 LYS LYS A A n 
A 1 135 GLY 135 134 134 GLY GLY A . n 
A 1 136 VAL 136 135 135 VAL VAL A . n 
A 1 137 THR 137 136 136 THR THR A . n 
A 1 138 ALA 138 137 137 ALA ALA A . n 
A 1 139 ALA 139 138 138 ALA ALA A . n 
A 1 140 CYS 140 139 139 CYS CYS A . n 
A 1 141 SER 141 140 140 SER SER A . n 
A 1 142 TYR 142 141 141 TYR TYR A . n 
A 1 143 ALA 143 142 142 ALA ALA A . n 
A 1 144 GLY 144 143 143 GLY GLY A . n 
A 1 145 ALA 145 144 144 ALA ALA A . n 
A 1 146 SER 146 145 145 SER SER A . n 
A 1 147 SER 147 146 146 SER SER A . n 
A 1 148 PHE 148 147 147 PHE PHE A . n 
A 1 149 TYR 149 148 148 TYR TYR A . n 
A 1 150 ARG 150 149 149 ARG ARG A . n 
A 1 151 ASN 151 150 150 ASN ASN A . n 
A 1 152 LEU 152 151 151 LEU LEU A . n 
A 1 153 LEU 153 152 152 LEU LEU A . n 
A 1 154 TRP 154 153 153 TRP TRP A . n 
A 1 155 LEU 155 154 154 LEU LEU A . n 
A 1 156 THR 156 155 155 THR THR A . n 
A 1 157 LYS 157 156 156 LYS LYS A . n 
A 1 158 LYS 158 157 157 LYS LYS A . n 
A 1 159 GLY 159 158 158 GLY GLY A . n 
A 1 160 SER 160 159 159 SER SER A . n 
A 1 161 SER 161 160 160 SER SER A . n 
A 1 162 TYR 162 161 161 TYR TYR A . n 
A 1 163 PRO 163 162 162 PRO PRO A . n 
A 1 164 LYS 164 163 163 LYS LYS A . n 
A 1 165 LEU 165 164 164 LEU LEU A . n 
A 1 166 SER 166 165 165 SER SER A . n 
A 1 167 LYS 167 166 166 LYS LYS A . n 
A 1 168 SER 168 167 167 SER SER A . n 
A 1 169 TYR 169 168 168 TYR TYR A . n 
A 1 170 VAL 170 169 169 VAL VAL A . n 
A 1 171 ASN 171 170 170 ASN ASN A . n 
A 1 172 ASN 172 171 171 ASN ASN A . n 
A 1 173 LYS 173 172 172 LYS LYS A . n 
A 1 174 GLY 174 173 173 GLY GLY A . n 
A 1 175 LYS 175 174 174 LYS LYS A . n 
A 1 176 GLU 176 175 175 GLU GLU A . n 
A 1 177 VAL 177 176 176 VAL VAL A . n 
A 1 178 LEU 178 177 177 LEU LEU A . n 
A 1 179 VAL 179 178 178 VAL VAL A . n 
A 1 180 LEU 180 179 179 LEU LEU A . n 
A 1 181 TRP 181 180 180 TRP TRP A . n 
A 1 182 GLY 182 181 181 GLY GLY A . n 
A 1 183 VAL 183 182 182 VAL VAL A . n 
A 1 184 HIS 184 183 183 HIS HIS A . n 
A 1 185 HIS 185 184 184 HIS HIS A . n 
A 1 186 PRO 186 185 185 PRO PRO A . n 
A 1 187 PRO 187 186 186 PRO PRO A . n 
A 1 188 THR 188 187 187 THR THR A . n 
A 1 189 GLY 189 188 188 GLY GLY A . n 
A 1 190 THR 190 189 189 THR THR A . n 
A 1 191 ASP 191 190 190 ASP ASP A . n 
A 1 192 GLN 192 191 191 GLN GLN A . n 
A 1 193 GLN 193 192 192 GLN GLN A . n 
A 1 194 SER 194 193 193 SER SER A . n 
A 1 195 LEU 195 194 194 LEU LEU A . n 
A 1 196 TYR 196 195 195 TYR TYR A . n 
A 1 197 GLN 197 196 196 GLN GLN A . n 
A 1 198 ASN 198 197 197 ASN ASN A . n 
A 1 199 ALA 199 198 198 ALA ALA A . n 
A 1 200 ASP 200 199 199 ASP ASP A . n 
A 1 201 ALA 201 200 200 ALA ALA A . n 
A 1 202 TYR 202 201 201 TYR TYR A . n 
A 1 203 VAL 203 202 202 VAL VAL A . n 
A 1 204 SER 204 203 203 SER SER A . n 
A 1 205 VAL 205 204 204 VAL VAL A . n 
A 1 206 GLY 206 205 205 GLY GLY A . n 
A 1 207 SER 207 206 206 SER SER A . n 
A 1 208 SER 208 207 207 SER SER A . n 
A 1 209 LYS 209 208 208 LYS LYS A . n 
A 1 210 TYR 210 209 209 TYR TYR A . n 
A 1 211 ASN 211 210 210 ASN ASN A . n 
A 1 212 ARG 212 211 211 ARG ARG A . n 
A 1 213 ARG 213 212 212 ARG ARG A . n 
A 1 214 PHE 214 213 213 PHE PHE A . n 
A 1 215 THR 215 214 214 THR THR A . n 
A 1 216 PRO 216 215 215 PRO PRO A . n 
A 1 217 GLU 217 216 216 GLU GLU A . n 
A 1 218 ILE 218 217 217 ILE ILE A . n 
A 1 219 ALA 219 218 218 ALA ALA A . n 
A 1 220 ALA 220 219 219 ALA ALA A . n 
A 1 221 ARG 221 220 220 ARG ARG A . n 
A 1 222 PRO 222 221 221 PRO PRO A . n 
A 1 223 LYS 223 222 222 LYS LYS A . n 
A 1 224 VAL 224 223 223 VAL VAL A . n 
A 1 225 ARG 225 224 224 ARG ARG A . n 
A 1 226 ASP 226 225 225 ASP ASP A . n 
A 1 227 GLN 227 226 226 GLN GLN A . n 
A 1 228 ALA 228 227 227 ALA ALA A . n 
A 1 229 GLY 229 228 228 GLY GLY A . n 
A 1 230 ARG 230 229 229 ARG ARG A . n 
A 1 231 MET 231 230 230 MET MET A . n 
A 1 232 ASN 232 231 231 ASN ASN A . n 
A 1 233 TYR 233 232 232 TYR TYR A . n 
A 1 234 TYR 234 233 233 TYR TYR A . n 
A 1 235 TRP 235 234 234 TRP TRP A . n 
A 1 236 THR 236 235 235 THR THR A . n 
A 1 237 LEU 237 236 236 LEU LEU A . n 
A 1 238 LEU 238 237 237 LEU LEU A . n 
A 1 239 GLU 239 238 238 GLU GLU A . n 
A 1 240 PRO 240 239 239 PRO PRO A . n 
A 1 241 GLY 241 240 240 GLY GLY A . n 
A 1 242 ASP 242 241 241 ASP ASP A . n 
A 1 243 THR 243 242 242 THR THR A . n 
A 1 244 ILE 244 243 243 ILE ILE A . n 
A 1 245 THR 245 244 244 THR THR A . n 
A 1 246 PHE 246 245 245 PHE PHE A . n 
A 1 247 GLU 247 246 246 GLU GLU A . n 
A 1 248 ALA 248 247 247 ALA ALA A . n 
A 1 249 THR 249 248 248 THR THR A . n 
A 1 250 GLY 250 249 249 GLY GLY A . n 
A 1 251 ASN 251 250 250 ASN ASN A . n 
A 1 252 LEU 252 251 251 LEU LEU A . n 
A 1 253 ILE 253 252 252 ILE ILE A . n 
A 1 254 ALA 254 253 253 ALA ALA A . n 
A 1 255 PRO 255 254 254 PRO PRO A . n 
A 1 256 TRP 256 255 255 TRP TRP A . n 
A 1 257 TYR 257 256 256 TYR TYR A . n 
A 1 258 ALA 258 257 257 ALA ALA A . n 
A 1 259 PHE 259 258 258 PHE PHE A . n 
A 1 260 ALA 260 259 259 ALA ALA A . n 
A 1 261 LEU 261 260 260 LEU LEU A . n 
A 1 262 ASN 262 261 261 ASN ASN A . n 
A 1 263 ARG 263 262 262 ARG ARG A . n 
A 1 264 GLY 264 263 263 GLY GLY A . n 
A 1 265 SER 265 264 264 SER SER A . n 
A 1 266 GLY 266 264 264 GLY GLY A A n 
A 1 267 SER 267 265 265 SER SER A . n 
A 1 268 GLY 268 266 266 GLY GLY A . n 
A 1 269 ILE 269 267 267 ILE ILE A . n 
A 1 270 ILE 270 268 268 ILE ILE A . n 
A 1 271 THR 271 269 269 THR THR A . n 
A 1 272 SER 272 270 270 SER SER A . n 
A 1 273 ASP 273 271 271 ASP ASP A . n 
A 1 274 ALA 274 272 272 ALA ALA A . n 
A 1 275 PRO 275 273 273 PRO PRO A . n 
A 1 276 VAL 276 274 274 VAL VAL A . n 
A 1 277 HIS 277 275 275 HIS HIS A . n 
A 1 278 ASP 278 276 276 ASP ASP A . n 
A 1 279 CYS 279 277 277 CYS CYS A . n 
A 1 280 ASN 280 278 278 ASN ASN A . n 
A 1 281 THR 281 279 279 THR THR A . n 
A 1 282 LYS 282 280 280 LYS LYS A . n 
A 1 283 CYS 283 281 281 CYS CYS A . n 
A 1 284 GLN 284 282 282 GLN GLN A . n 
A 1 285 THR 285 283 283 THR THR A . n 
A 1 286 PRO 286 284 284 PRO PRO A . n 
A 1 287 HIS 287 285 285 HIS HIS A . n 
A 1 288 GLY 288 286 286 GLY GLY A . n 
A 1 289 ALA 289 287 287 ALA ALA A . n 
A 1 290 ILE 290 288 288 ILE ILE A . n 
A 1 291 ASN 291 289 289 ASN ASN A . n 
A 1 292 SER 292 290 290 SER SER A . n 
A 1 293 SER 293 291 291 SER SER A . n 
A 1 294 LEU 294 292 292 LEU LEU A . n 
A 1 295 PRO 295 293 293 PRO PRO A . n 
A 1 296 PHE 296 294 294 PHE PHE A . n 
A 1 297 GLN 297 295 295 GLN GLN A . n 
A 1 298 ASN 298 296 296 ASN ASN A . n 
A 1 299 ILE 299 297 297 ILE ILE A . n 
A 1 300 HIS 300 298 298 HIS HIS A . n 
A 1 301 PRO 301 299 299 PRO PRO A . n 
A 1 302 VAL 302 300 300 VAL VAL A . n 
A 1 303 THR 303 301 301 THR THR A . n 
A 1 304 ILE 304 302 302 ILE ILE A . n 
A 1 305 GLY 305 303 303 GLY GLY A . n 
A 1 306 GLU 306 304 304 GLU GLU A . n 
A 1 307 CYS 307 305 305 CYS CYS A . n 
A 1 308 PRO 308 306 306 PRO PRO A . n 
A 1 309 LYS 309 307 307 LYS LYS A . n 
A 1 310 TYR 310 308 308 TYR TYR A . n 
A 1 311 VAL 311 309 309 VAL VAL A . n 
A 1 312 ARG 312 310 310 ARG ARG A . n 
A 1 313 SER 313 311 311 SER SER A . n 
A 1 314 THR 314 312 312 THR THR A . n 
A 1 315 LYS 315 313 313 LYS LYS A . n 
A 1 316 LEU 316 314 314 LEU LEU A . n 
A 1 317 ARG 317 315 315 ARG ARG A . n 
A 1 318 MET 318 316 316 MET MET A . n 
A 1 319 ALA 319 317 317 ALA ALA A . n 
A 1 320 THR 320 318 318 THR THR A . n 
A 1 321 GLY 321 319 319 GLY GLY A . n 
A 1 322 LEU 322 320 320 LEU LEU A . n 
A 1 323 ARG 323 321 321 ARG ARG A . n 
A 1 324 ASN 324 322 322 ASN ASN A . n 
A 1 325 ILE 325 323 323 ILE ILE A . n 
A 1 326 PRO 326 324 324 PRO PRO A . n 
A 1 327 SER 327 325 325 SER SER A . n 
A 1 328 ILE 328 326 326 ILE ILE A . n 
A 1 329 GLN 329 327 ?   ?   ?   A . n 
A 1 330 SER 330 328 ?   ?   ?   A . n 
A 1 331 ARG 331 329 ?   ?   ?   A . n 
B 2 1   GLY 1   1   1   GLY GLY B . n 
B 2 2   LEU 2   2   2   LEU LEU B . n 
B 2 3   PHE 3   3   3   PHE PHE B . n 
B 2 4   GLY 4   4   4   GLY GLY B . n 
B 2 5   ALA 5   5   5   ALA ALA B . n 
B 2 6   ILE 6   6   6   ILE ILE B . n 
B 2 7   ALA 7   7   7   ALA ALA B . n 
B 2 8   GLY 8   8   8   GLY GLY B . n 
B 2 9   PHE 9   9   9   PHE PHE B . n 
B 2 10  ILE 10  10  10  ILE ILE B . n 
B 2 11  GLU 11  11  11  GLU GLU B . n 
B 2 12  GLY 12  12  12  GLY GLY B . n 
B 2 13  GLY 13  13  13  GLY GLY B . n 
B 2 14  TRP 14  14  14  TRP TRP B . n 
B 2 15  THR 15  15  15  THR THR B . n 
B 2 16  GLY 16  16  16  GLY GLY B . n 
B 2 17  MET 17  17  17  MET MET B . n 
B 2 18  ILE 18  18  18  ILE ILE B . n 
B 2 19  ASP 19  19  19  ASP ASP B . n 
B 2 20  GLY 20  20  20  GLY GLY B . n 
B 2 21  TRP 21  21  21  TRP TRP B . n 
B 2 22  TYR 22  22  22  TYR TYR B . n 
B 2 23  GLY 23  23  23  GLY GLY B . n 
B 2 24  TYR 24  24  24  TYR TYR B . n 
B 2 25  HIS 25  25  25  HIS HIS B . n 
B 2 26  HIS 26  26  26  HIS HIS B . n 
B 2 27  GLN 27  27  27  GLN GLN B . n 
B 2 28  ASN 28  28  28  ASN ASN B . n 
B 2 29  GLU 29  29  29  GLU GLU B . n 
B 2 30  GLN 30  30  30  GLN GLN B . n 
B 2 31  GLY 31  31  31  GLY GLY B . n 
B 2 32  SER 32  32  32  SER SER B . n 
B 2 33  GLY 33  33  33  GLY GLY B . n 
B 2 34  TYR 34  34  34  TYR TYR B . n 
B 2 35  ALA 35  35  35  ALA ALA B . n 
B 2 36  ALA 36  36  36  ALA ALA B . n 
B 2 37  ASP 37  37  37  ASP ASP B . n 
B 2 38  GLN 38  38  38  GLN GLN B . n 
B 2 39  LYS 39  39  39  LYS LYS B . n 
B 2 40  SER 40  40  40  SER SER B . n 
B 2 41  THR 41  41  41  THR THR B . n 
B 2 42  GLN 42  42  42  GLN GLN B . n 
B 2 43  ASN 43  43  43  ASN ASN B . n 
B 2 44  ALA 44  44  44  ALA ALA B . n 
B 2 45  ILE 45  45  45  ILE ILE B . n 
B 2 46  ASP 46  46  46  ASP ASP B . n 
B 2 47  GLY 47  47  47  GLY GLY B . n 
B 2 48  ILE 48  48  48  ILE ILE B . n 
B 2 49  THR 49  49  49  THR THR B . n 
B 2 50  ASN 50  50  50  ASN ASN B . n 
B 2 51  LYS 51  51  51  LYS LYS B . n 
B 2 52  VAL 52  52  52  VAL VAL B . n 
B 2 53  ASN 53  53  53  ASN ASN B . n 
B 2 54  SER 54  54  54  SER SER B . n 
B 2 55  VAL 55  55  55  VAL VAL B . n 
B 2 56  ILE 56  56  56  ILE ILE B . n 
B 2 57  GLU 57  57  57  GLU GLU B . n 
B 2 58  LYS 58  58  58  LYS LYS B . n 
B 2 59  MET 59  59  59  MET MET B . n 
B 2 60  ASN 60  60  60  ASN ASN B . n 
B 2 61  THR 61  61  61  THR THR B . n 
B 2 62  GLN 62  62  62  GLN GLN B . n 
B 2 63  PHE 63  63  63  PHE PHE B . n 
B 2 64  THR 64  64  64  THR THR B . n 
B 2 65  ALA 65  65  65  ALA ALA B . n 
B 2 66  VAL 66  66  66  VAL VAL B . n 
B 2 67  GLY 67  67  67  GLY GLY B . n 
B 2 68  LYS 68  68  68  LYS LYS B . n 
B 2 69  GLU 69  69  69  GLU GLU B . n 
B 2 70  PHE 70  70  70  PHE PHE B . n 
B 2 71  ASN 71  71  71  ASN ASN B . n 
B 2 72  ASN 72  72  72  ASN ASN B . n 
B 2 73  LEU 73  73  73  LEU LEU B . n 
B 2 74  GLU 74  74  74  GLU GLU B . n 
B 2 75  ARG 75  75  75  ARG ARG B . n 
B 2 76  ARG 76  76  76  ARG ARG B . n 
B 2 77  ILE 77  77  77  ILE ILE B . n 
B 2 78  GLU 78  78  78  GLU GLU B . n 
B 2 79  ASN 79  79  79  ASN ASN B . n 
B 2 80  LEU 80  80  80  LEU LEU B . n 
B 2 81  ASN 81  81  81  ASN ASN B . n 
B 2 82  LYS 82  82  82  LYS LYS B . n 
B 2 83  LYS 83  83  83  LYS LYS B . n 
B 2 84  VAL 84  84  84  VAL VAL B . n 
B 2 85  ASP 85  85  85  ASP ASP B . n 
B 2 86  ASP 86  86  86  ASP ASP B . n 
B 2 87  GLY 87  87  87  GLY GLY B . n 
B 2 88  PHE 88  88  88  PHE PHE B . n 
B 2 89  LEU 89  89  89  LEU LEU B . n 
B 2 90  ASP 90  90  90  ASP ASP B . n 
B 2 91  ILE 91  91  91  ILE ILE B . n 
B 2 92  TRP 92  92  92  TRP TRP B . n 
B 2 93  THR 93  93  93  THR THR B . n 
B 2 94  TYR 94  94  94  TYR TYR B . n 
B 2 95  ASN 95  95  95  ASN ASN B . n 
B 2 96  ALA 96  96  96  ALA ALA B . n 
B 2 97  GLU 97  97  97  GLU GLU B . n 
B 2 98  LEU 98  98  98  LEU LEU B . n 
B 2 99  LEU 99  99  99  LEU LEU B . n 
B 2 100 VAL 100 100 100 VAL VAL B . n 
B 2 101 LEU 101 101 101 LEU LEU B . n 
B 2 102 LEU 102 102 102 LEU LEU B . n 
B 2 103 GLU 103 103 103 GLU GLU B . n 
B 2 104 ASN 104 104 104 ASN ASN B . n 
B 2 105 GLU 105 105 105 GLU GLU B . n 
B 2 106 ARG 106 106 106 ARG ARG B . n 
B 2 107 THR 107 107 107 THR THR B . n 
B 2 108 LEU 108 108 108 LEU LEU B . n 
B 2 109 ASP 109 109 109 ASP ASP B . n 
B 2 110 PHE 110 110 110 PHE PHE B . n 
B 2 111 HIS 111 111 111 HIS HIS B . n 
B 2 112 ASP 112 112 112 ASP ASP B . n 
B 2 113 SER 113 113 113 SER SER B . n 
B 2 114 ASN 114 114 114 ASN ASN B . n 
B 2 115 VAL 115 115 115 VAL VAL B . n 
B 2 116 ARG 116 116 116 ARG ARG B . n 
B 2 117 ASN 117 117 117 ASN ASN B . n 
B 2 118 LEU 118 118 118 LEU LEU B . n 
B 2 119 TYR 119 119 119 TYR TYR B . n 
B 2 120 GLU 120 120 120 GLU GLU B . n 
B 2 121 LYS 121 121 121 LYS LYS B . n 
B 2 122 VAL 122 122 122 VAL VAL B . n 
B 2 123 LYS 123 123 123 LYS LYS B . n 
B 2 124 SER 124 124 124 SER SER B . n 
B 2 125 GLN 125 125 125 GLN GLN B . n 
B 2 126 LEU 126 126 126 LEU LEU B . n 
B 2 127 LYS 127 127 127 LYS LYS B . n 
B 2 128 ASN 128 128 128 ASN ASN B . n 
B 2 129 ASN 129 129 129 ASN ASN B . n 
B 2 130 ALA 130 130 130 ALA ALA B . n 
B 2 131 LYS 131 131 131 LYS LYS B . n 
B 2 132 GLU 132 132 132 GLU GLU B . n 
B 2 133 ILE 133 133 133 ILE ILE B . n 
B 2 134 GLY 134 134 134 GLY GLY B . n 
B 2 135 ASN 135 135 135 ASN ASN B . n 
B 2 136 GLY 136 136 136 GLY GLY B . n 
B 2 137 CYS 137 137 137 CYS CYS B . n 
B 2 138 PHE 138 138 138 PHE PHE B . n 
B 2 139 GLU 139 139 139 GLU GLU B . n 
B 2 140 PHE 140 140 140 PHE PHE B . n 
B 2 141 TYR 141 141 141 TYR TYR B . n 
B 2 142 HIS 142 142 142 HIS HIS B . n 
B 2 143 LYS 143 143 143 LYS LYS B . n 
B 2 144 CYS 144 144 144 CYS CYS B . n 
B 2 145 ASP 145 145 145 ASP ASP B . n 
B 2 146 ASP 146 146 146 ASP ASP B . n 
B 2 147 ALA 147 147 147 ALA ALA B . n 
B 2 148 CYS 148 148 148 CYS CYS B . n 
B 2 149 MET 149 149 149 MET MET B . n 
B 2 150 GLU 150 150 150 GLU GLU B . n 
B 2 151 SER 151 151 151 SER SER B . n 
B 2 152 VAL 152 152 152 VAL VAL B . n 
B 2 153 ARG 153 153 153 ARG ARG B . n 
B 2 154 ASN 154 154 154 ASN ASN B . n 
B 2 155 GLY 155 155 155 GLY GLY B . n 
B 2 156 THR 156 156 156 THR THR B . n 
B 2 157 TYR 157 157 157 TYR TYR B . n 
B 2 158 ASP 158 158 158 ASP ASP B . n 
B 2 159 TYR 159 159 159 TYR TYR B . n 
B 2 160 PRO 160 160 160 PRO PRO B . n 
B 2 161 LYS 161 161 161 LYS LYS B . n 
B 2 162 TYR 162 162 162 TYR TYR B . n 
B 2 163 SER 163 163 163 SER SER B . n 
B 2 164 GLU 164 164 164 GLU GLU B . n 
B 2 165 GLU 165 165 165 GLU GLU B . n 
B 2 166 SER 166 166 166 SER SER B . n 
B 2 167 LYS 167 167 167 LYS LYS B . n 
B 2 168 LEU 168 168 168 LEU LEU B . n 
B 2 169 ASN 169 169 169 ASN ASN B . n 
B 2 170 ARG 170 170 170 ARG ARG B . n 
B 2 171 GLU 171 171 171 GLU GLU B . n 
B 2 172 GLU 172 172 172 GLU GLU B . n 
B 2 173 ILE 173 173 173 ILE ILE B . n 
B 2 174 ASP 174 174 ?   ?   ?   B . n 
B 2 175 GLY 175 175 ?   ?   ?   B . n 
B 2 176 VAL 176 176 ?   ?   ?   B . n 
B 2 177 SER 177 177 ?   ?   ?   B . n 
B 2 178 GLY 178 178 ?   ?   ?   B . n 
B 2 179 ARG 179 179 ?   ?   ?   B . n 
C 3 1   GLU 1   1   1   GLU GLU H . n 
C 3 2   VAL 2   2   2   VAL VAL H . n 
C 3 3   GLN 3   3   3   GLN GLN H . n 
C 3 4   LEU 4   4   4   LEU LEU H . n 
C 3 5   VAL 5   5   5   VAL VAL H . n 
C 3 6   GLU 6   6   6   GLU GLU H . n 
C 3 7   SER 7   7   7   SER SER H . n 
C 3 8   GLY 8   8   8   GLY GLY H . n 
C 3 9   ALA 9   9   9   ALA ALA H . n 
C 3 10  GLU 10  10  10  GLU GLU H . n 
C 3 11  VAL 11  11  11  VAL VAL H . n 
C 3 12  LYS 12  12  12  LYS LYS H . n 
C 3 13  LYS 13  13  13  LYS LYS H . n 
C 3 14  PRO 14  14  14  PRO PRO H . n 
C 3 15  GLY 15  15  15  GLY GLY H . n 
C 3 16  SER 16  16  16  SER SER H . n 
C 3 17  SER 17  17  17  SER SER H . n 
C 3 18  VAL 18  18  18  VAL VAL H . n 
C 3 19  LYS 19  19  19  LYS LYS H . n 
C 3 20  VAL 20  20  20  VAL VAL H . n 
C 3 21  SER 21  21  21  SER SER H . n 
C 3 22  CYS 22  22  22  CYS CYS H . n 
C 3 23  LYS 23  23  23  LYS LYS H . n 
C 3 24  ALA 24  24  24  ALA ALA H . n 
C 3 25  SER 25  25  25  SER SER H . n 
C 3 26  GLY 26  26  26  GLY GLY H . n 
C 3 27  GLY 27  27  27  GLY GLY H . n 
C 3 28  PRO 28  28  28  PRO PRO H . n 
C 3 29  PHE 29  29  29  PHE PHE H . n 
C 3 30  ARG 30  30  30  ARG ARG H . n 
C 3 31  SER 31  31  31  SER SER H . n 
C 3 32  TYR 32  32  32  TYR TYR H . n 
C 3 33  ALA 33  33  33  ALA ALA H . n 
C 3 34  ILE 34  34  34  ILE ILE H . n 
C 3 35  SER 35  35  35  SER SER H . n 
C 3 36  TRP 36  36  36  TRP TRP H . n 
C 3 37  VAL 37  37  37  VAL VAL H . n 
C 3 38  ARG 38  38  38  ARG ARG H . n 
C 3 39  GLN 39  39  39  GLN GLN H . n 
C 3 40  ALA 40  40  40  ALA ALA H . n 
C 3 41  PRO 41  41  41  PRO PRO H . n 
C 3 42  GLY 42  42  42  GLY GLY H . n 
C 3 43  GLN 43  43  43  GLN GLN H . n 
C 3 44  GLY 44  44  44  GLY GLY H . n 
C 3 45  PRO 45  45  45  PRO PRO H . n 
C 3 46  GLU 46  46  46  GLU GLU H . n 
C 3 47  TRP 47  47  47  TRP TRP H . n 
C 3 48  MET 48  48  48  MET MET H . n 
C 3 49  GLY 49  49  49  GLY GLY H . n 
C 3 50  GLY 50  50  50  GLY GLY H . n 
C 3 51  ILE 51  51  51  ILE ILE H . n 
C 3 52  ILE 52  52  52  ILE ILE H . n 
C 3 53  PRO 53  52  52  PRO PRO H A n 
C 3 54  ILE 54  53  53  ILE ILE H . n 
C 3 55  PHE 55  54  54  PHE PHE H . n 
C 3 56  GLY 56  55  55  GLY GLY H . n 
C 3 57  THR 57  56  56  THR THR H . n 
C 3 58  THR 58  57  57  THR THR H . n 
C 3 59  LYS 59  58  58  LYS LYS H . n 
C 3 60  TYR 60  59  59  TYR TYR H . n 
C 3 61  ALA 61  60  60  ALA ALA H . n 
C 3 62  PRO 62  61  61  PRO PRO H . n 
C 3 63  LYS 63  62  62  LYS LYS H . n 
C 3 64  PHE 64  63  63  PHE PHE H . n 
C 3 65  GLN 65  64  64  GLN GLN H . n 
C 3 66  GLY 66  65  65  GLY GLY H . n 
C 3 67  ARG 67  66  66  ARG ARG H . n 
C 3 68  VAL 68  67  67  VAL VAL H . n 
C 3 69  THR 69  68  68  THR THR H . n 
C 3 70  ILE 70  69  69  ILE ILE H . n 
C 3 71  THR 71  70  70  THR THR H . n 
C 3 72  ALA 72  71  71  ALA ALA H . n 
C 3 73  ASP 73  72  72  ASP ASP H . n 
C 3 74  ASP 74  73  73  ASP ASP H . n 
C 3 75  PHE 75  74  74  PHE PHE H . n 
C 3 76  ALA 76  75  75  ALA ALA H . n 
C 3 77  GLY 77  76  76  GLY GLY H . n 
C 3 78  THR 78  77  77  THR THR H . n 
C 3 79  VAL 79  78  78  VAL VAL H . n 
C 3 80  TYR 80  79  79  TYR TYR H . n 
C 3 81  MET 81  80  80  MET MET H . n 
C 3 82  GLU 82  81  81  GLU GLU H . n 
C 3 83  LEU 83  82  82  LEU LEU H . n 
C 3 84  SER 84  82  82  SER SER H A n 
C 3 85  SER 85  82  82  SER SER H B n 
C 3 86  LEU 86  82  82  LEU LEU H C n 
C 3 87  ARG 87  83  83  ARG ARG H . n 
C 3 88  SER 88  84  84  SER SER H . n 
C 3 89  GLU 89  85  85  GLU GLU H . n 
C 3 90  ASP 90  86  86  ASP ASP H . n 
C 3 91  THR 91  87  87  THR THR H . n 
C 3 92  ALA 92  88  88  ALA ALA H . n 
C 3 93  MET 93  89  89  MET MET H . n 
C 3 94  TYR 94  90  90  TYR TYR H . n 
C 3 95  TYR 95  91  91  TYR TYR H . n 
C 3 96  CYS 96  92  92  CYS CYS H . n 
C 3 97  ALA 97  93  93  ALA ALA H . n 
C 3 98  LYS 98  94  94  LYS LYS H . n 
C 3 99  HIS 99  95  95  HIS HIS H . n 
C 3 100 MET 100 96  96  MET MET H . n 
C 3 101 GLY 101 97  97  GLY GLY H . n 
C 3 102 TYR 102 98  98  TYR TYR H . n 
C 3 103 GLN 103 99  99  GLN GLN H . n 
C 3 104 VAL 104 100 100 VAL VAL H . n 
C 3 105 ARG 105 100 100 ARG ARG H A n 
C 3 106 GLU 106 100 100 GLU GLU H B n 
C 3 107 THR 107 100 100 THR THR H C n 
C 3 108 MET 108 100 100 MET MET H D n 
C 3 109 ASP 109 101 101 ASP ASP H . n 
C 3 110 VAL 110 102 102 VAL VAL H . n 
C 3 111 TRP 111 103 103 TRP TRP H . n 
C 3 112 GLY 112 104 104 GLY GLY H . n 
C 3 113 LYS 113 105 105 LYS LYS H . n 
C 3 114 GLY 114 106 106 GLY GLY H . n 
C 3 115 THR 115 107 107 THR THR H . n 
C 3 116 THR 116 108 108 THR THR H . n 
C 3 117 VAL 117 109 109 VAL VAL H . n 
C 3 118 THR 118 110 110 THR THR H . n 
C 3 119 VAL 119 111 111 VAL VAL H . n 
C 3 120 SER 120 112 112 SER SER H . n 
C 3 121 SER 121 113 113 SER SER H . n 
C 3 122 ALA 122 114 114 ALA ALA H . n 
C 3 123 SER 123 115 115 SER SER H . n 
C 3 124 THR 124 116 116 THR THR H . n 
C 3 125 LYS 125 117 117 LYS LYS H . n 
C 3 126 GLY 126 118 118 GLY GLY H . n 
C 3 127 PRO 127 119 119 PRO PRO H . n 
C 3 128 SER 128 120 120 SER SER H . n 
C 3 129 VAL 129 121 121 VAL VAL H . n 
C 3 130 PHE 130 122 122 PHE PHE H . n 
C 3 131 PRO 131 123 123 PRO PRO H . n 
C 3 132 LEU 132 124 124 LEU LEU H . n 
C 3 133 ALA 133 127 ?   ?   ?   H . n 
C 3 134 PRO 134 128 ?   ?   ?   H . n 
C 3 135 SER 135 129 ?   ?   ?   H . n 
C 3 136 SER 136 130 ?   ?   ?   H . n 
C 3 137 LYS 137 131 ?   ?   ?   H . n 
C 3 138 SER 138 132 ?   ?   ?   H . n 
C 3 139 THR 139 133 ?   ?   ?   H . n 
C 3 140 SER 140 134 ?   ?   ?   H . n 
C 3 141 GLY 141 135 ?   ?   ?   H . n 
C 3 142 GLY 142 136 ?   ?   ?   H . n 
C 3 143 THR 143 137 ?   ?   ?   H . n 
C 3 144 ALA 144 138 ?   ?   ?   H . n 
C 3 145 ALA 145 139 ?   ?   ?   H . n 
C 3 146 LEU 146 140 ?   ?   ?   H . n 
C 3 147 GLY 147 141 141 GLY GLY H . n 
C 3 148 CYS 148 142 142 CYS CYS H . n 
C 3 149 LEU 149 143 143 LEU LEU H . n 
C 3 150 VAL 150 144 144 VAL VAL H . n 
C 3 151 LYS 151 145 145 LYS LYS H . n 
C 3 152 ASP 152 146 146 ASP ASP H . n 
C 3 153 TYR 153 147 147 TYR TYR H . n 
C 3 154 PHE 154 148 148 PHE PHE H . n 
C 3 155 PRO 155 149 149 PRO PRO H . n 
C 3 156 GLU 156 150 150 GLU GLU H . n 
C 3 157 PRO 157 151 151 PRO PRO H . n 
C 3 158 VAL 158 152 152 VAL VAL H . n 
C 3 159 THR 159 153 153 THR THR H . n 
C 3 160 VAL 160 160 ?   ?   ?   H . n 
C 3 161 SER 161 161 ?   ?   ?   H . n 
C 3 162 TRP 162 162 ?   ?   ?   H . n 
C 3 163 ASN 163 163 ?   ?   ?   H . n 
C 3 164 SER 164 164 ?   ?   ?   H . n 
C 3 165 GLY 165 165 ?   ?   ?   H . n 
C 3 166 ALA 166 166 ?   ?   ?   H . n 
C 3 167 LEU 167 167 ?   ?   ?   H . n 
C 3 168 THR 168 168 ?   ?   ?   H . n 
C 3 169 SER 169 169 ?   ?   ?   H . n 
C 3 170 GLY 170 170 ?   ?   ?   H . n 
C 3 171 VAL 171 171 ?   ?   ?   H . n 
C 3 172 HIS 172 172 ?   ?   ?   H . n 
C 3 173 THR 173 173 173 THR THR H . n 
C 3 174 PHE 174 174 174 PHE PHE H . n 
C 3 175 PRO 175 175 175 PRO PRO H . n 
C 3 176 ALA 176 176 176 ALA ALA H . n 
C 3 177 VAL 177 177 177 VAL VAL H . n 
C 3 178 LEU 178 178 178 LEU LEU H . n 
C 3 179 GLN 179 179 179 GLN GLN H . n 
C 3 180 SER 180 180 180 SER SER H . n 
C 3 181 SER 181 182 182 SER SER H . n 
C 3 182 GLY 182 183 183 GLY GLY H . n 
C 3 183 LEU 183 184 184 LEU LEU H . n 
C 3 184 TYR 184 185 185 TYR TYR H . n 
C 3 185 SER 185 186 186 SER SER H . n 
C 3 186 LEU 186 187 187 LEU LEU H . n 
C 3 187 SER 187 188 188 SER SER H . n 
C 3 188 SER 188 189 ?   ?   ?   H . n 
C 3 189 VAL 189 190 ?   ?   ?   H . n 
C 3 190 VAL 190 191 ?   ?   ?   H . n 
C 3 191 THR 191 192 ?   ?   ?   H . n 
C 3 192 VAL 192 193 ?   ?   ?   H . n 
C 3 193 PRO 193 194 ?   ?   ?   H . n 
C 3 194 SER 194 195 ?   ?   ?   H . n 
C 3 195 SER 195 196 ?   ?   ?   H . n 
C 3 196 SER 196 197 ?   ?   ?   H . n 
C 3 197 LEU 197 198 ?   ?   ?   H . n 
C 3 198 GLY 198 199 ?   ?   ?   H . n 
C 3 199 THR 199 200 ?   ?   ?   H . n 
C 3 200 GLN 200 201 ?   ?   ?   H . n 
C 3 201 THR 201 202 ?   ?   ?   H . n 
C 3 202 TYR 202 203 ?   ?   ?   H . n 
C 3 203 ILE 203 204 ?   ?   ?   H . n 
C 3 204 CYS 204 205 ?   ?   ?   H . n 
C 3 205 ASN 205 206 ?   ?   ?   H . n 
C 3 206 VAL 206 207 ?   ?   ?   H . n 
C 3 207 ASN 207 208 ?   ?   ?   H . n 
C 3 208 HIS 208 209 ?   ?   ?   H . n 
C 3 209 LYS 209 210 ?   ?   ?   H . n 
C 3 210 PRO 210 211 ?   ?   ?   H . n 
C 3 211 SER 211 212 ?   ?   ?   H . n 
C 3 212 ASN 212 213 ?   ?   ?   H . n 
C 3 213 THR 213 214 ?   ?   ?   H . n 
C 3 214 LYS 214 215 ?   ?   ?   H . n 
C 3 215 VAL 215 216 ?   ?   ?   H . n 
C 3 216 ASP 216 217 ?   ?   ?   H . n 
C 3 217 LYS 217 218 ?   ?   ?   H . n 
C 3 218 ARG 218 219 ?   ?   ?   H . n 
C 3 219 VAL 219 220 ?   ?   ?   H . n 
C 3 220 GLU 220 221 ?   ?   ?   H . n 
C 3 221 PRO 221 222 ?   ?   ?   H . n 
C 3 222 LYS 222 223 ?   ?   ?   H . n 
C 3 223 SER 223 224 ?   ?   ?   H . n 
C 3 224 CYS 224 225 ?   ?   ?   H . n 
C 3 225 ASP 225 226 ?   ?   ?   H . n 
C 3 226 LYS 226 227 ?   ?   ?   H . n 
D 4 1   GLN 1   1   ?   ?   ?   L . n 
D 4 2   SER 2   2   ?   ?   ?   L . n 
D 4 3   VAL 3   3   3   VAL VAL L . n 
D 4 4   LEU 4   4   4   LEU LEU L . n 
D 4 5   THR 5   5   5   THR THR L . n 
D 4 6   GLN 6   6   6   GLN GLN L . n 
D 4 7   PRO 7   7   7   PRO PRO L . n 
D 4 8   PRO 8   8   8   PRO PRO L . n 
D 4 9   SER 9   9   9   SER SER L . n 
D 4 10  VAL 10  11  11  VAL VAL L . n 
D 4 11  SER 11  12  12  SER SER L . n 
D 4 12  ALA 12  13  13  ALA ALA L . n 
D 4 13  ALA 13  14  14  ALA ALA L . n 
D 4 14  PRO 14  15  15  PRO PRO L . n 
D 4 15  GLY 15  16  16  GLY GLY L . n 
D 4 16  GLN 16  17  17  GLN GLN L . n 
D 4 17  LYS 17  18  18  LYS LYS L . n 
D 4 18  VAL 18  19  19  VAL VAL L . n 
D 4 19  THR 19  20  20  THR THR L . n 
D 4 20  ILE 20  21  21  ILE ILE L . n 
D 4 21  SER 21  22  22  SER SER L . n 
D 4 22  CYS 22  23  23  CYS CYS L . n 
D 4 23  SER 23  24  24  SER SER L . n 
D 4 24  GLY 24  25  25  GLY GLY L . n 
D 4 25  SER 25  26  26  SER SER L . n 
D 4 26  SER 26  27  27  SER SER L . n 
D 4 27  SER 27  27  27  SER SER L A n 
D 4 28  ASN 28  27  27  ASN ASN L B n 
D 4 29  ILE 29  28  28  ILE ILE L . n 
D 4 30  GLY 30  29  29  GLY GLY L . n 
D 4 31  ASN 31  30  30  ASN ASN L . n 
D 4 32  ASP 32  31  31  ASP ASP L . n 
D 4 33  TYR 33  32  32  TYR TYR L . n 
D 4 34  VAL 34  33  33  VAL VAL L . n 
D 4 35  SER 35  34  34  SER SER L . n 
D 4 36  TRP 36  35  35  TRP TRP L . n 
D 4 37  TYR 37  36  36  TYR TYR L . n 
D 4 38  GLN 38  37  37  GLN GLN L . n 
D 4 39  GLN 39  38  38  GLN GLN L . n 
D 4 40  LEU 40  39  39  LEU LEU L . n 
D 4 41  PRO 41  40  40  PRO PRO L . n 
D 4 42  GLY 42  41  41  GLY GLY L . n 
D 4 43  THR 43  42  42  THR THR L . n 
D 4 44  ALA 44  43  43  ALA ALA L . n 
D 4 45  PRO 45  44  44  PRO PRO L . n 
D 4 46  LYS 46  45  45  LYS LYS L . n 
D 4 47  LEU 47  46  46  LEU LEU L . n 
D 4 48  LEU 48  47  47  LEU LEU L . n 
D 4 49  ILE 49  48  48  ILE ILE L . n 
D 4 50  TYR 50  49  49  TYR TYR L . n 
D 4 51  ASP 51  50  50  ASP ASP L . n 
D 4 52  ASN 52  51  51  ASN ASN L . n 
D 4 53  ASN 53  52  52  ASN ASN L . n 
D 4 54  LYS 54  53  53  LYS LYS L . n 
D 4 55  ARG 55  54  54  ARG ARG L . n 
D 4 56  PRO 56  55  55  PRO PRO L . n 
D 4 57  SER 57  56  56  SER SER L . n 
D 4 58  GLY 58  57  57  GLY GLY L . n 
D 4 59  ILE 59  58  58  ILE ILE L . n 
D 4 60  PRO 60  59  59  PRO PRO L . n 
D 4 61  ASP 61  60  60  ASP ASP L . n 
D 4 62  ARG 62  61  61  ARG ARG L . n 
D 4 63  PHE 63  62  62  PHE PHE L . n 
D 4 64  SER 64  63  63  SER SER L . n 
D 4 65  GLY 65  64  64  GLY GLY L . n 
D 4 66  SER 66  65  65  SER SER L . n 
D 4 67  LYS 67  66  66  LYS LYS L . n 
D 4 68  SER 68  67  67  SER SER L . n 
D 4 69  GLY 69  68  68  GLY GLY L . n 
D 4 70  THR 70  69  69  THR THR L . n 
D 4 71  SER 71  70  70  SER SER L . n 
D 4 72  ALA 72  71  71  ALA ALA L . n 
D 4 73  THR 73  72  72  THR THR L . n 
D 4 74  LEU 74  73  73  LEU LEU L . n 
D 4 75  GLY 75  74  74  GLY GLY L . n 
D 4 76  ILE 76  75  75  ILE ILE L . n 
D 4 77  THR 77  76  76  THR THR L . n 
D 4 78  GLY 78  77  77  GLY GLY L . n 
D 4 79  LEU 79  78  78  LEU LEU L . n 
D 4 80  GLN 80  79  79  GLN GLN L . n 
D 4 81  THR 81  80  80  THR THR L . n 
D 4 82  GLY 82  81  81  GLY GLY L . n 
D 4 83  ASP 83  82  82  ASP ASP L . n 
D 4 84  GLU 84  83  83  GLU GLU L . n 
D 4 85  ALA 85  84  84  ALA ALA L . n 
D 4 86  ASN 86  85  85  ASN ASN L . n 
D 4 87  TYR 87  86  86  TYR TYR L . n 
D 4 88  TYR 88  87  87  TYR TYR L . n 
D 4 89  CYS 89  88  88  CYS CYS L . n 
D 4 90  ALA 90  89  89  ALA ALA L . n 
D 4 91  THR 91  90  90  THR THR L . n 
D 4 92  TRP 92  91  91  TRP TRP L . n 
D 4 93  ASP 93  92  92  ASP ASP L . n 
D 4 94  ARG 94  93  93  ARG ARG L . n 
D 4 95  ARG 95  94  94  ARG ARG L . n 
D 4 96  PRO 96  95  95  PRO PRO L . n 
D 4 97  THR 97  95  95  THR THR L A n 
D 4 98  ALA 98  95  95  ALA ALA L B n 
D 4 99  TYR 99  95  95  TYR TYR L C n 
D 4 100 VAL 100 96  96  VAL VAL L . n 
D 4 101 VAL 101 97  97  VAL VAL L . n 
D 4 102 PHE 102 98  98  PHE PHE L . n 
D 4 103 GLY 103 99  99  GLY GLY L . n 
D 4 104 GLY 104 100 100 GLY GLY L . n 
D 4 105 GLY 105 101 101 GLY GLY L . n 
D 4 106 THR 106 102 102 THR THR L . n 
D 4 107 LYS 107 103 103 LYS LYS L . n 
D 4 108 LEU 108 104 104 LEU LEU L . n 
D 4 109 THR 109 105 105 THR THR L . n 
D 4 110 VAL 110 106 106 VAL VAL L . n 
D 4 111 LEU 111 106 106 LEU LEU L A n 
D 4 112 GLY 112 106 ?   ?   ?   L B n 
D 4 113 ALA 113 106 ?   ?   ?   L C n 
D 4 114 ALA 114 106 ?   ?   ?   L D n 
D 4 115 ALA 115 106 ?   ?   ?   L E n 
D 4 116 GLY 116 106 ?   ?   ?   L F n 
D 4 117 GLN 117 106 ?   ?   ?   L G n 
D 4 118 PRO 118 106 ?   ?   ?   L H n 
D 4 119 LYS 119 106 ?   ?   ?   L I n 
D 4 120 ALA 120 106 ?   ?   ?   L J n 
D 4 121 ALA 121 106 ?   ?   ?   L K n 
D 4 122 PRO 122 106 ?   ?   ?   L L n 
D 4 123 SER 123 106 ?   ?   ?   L M n 
D 4 124 VAL 124 106 ?   ?   ?   L N n 
D 4 125 THR 125 106 ?   ?   ?   L O n 
D 4 126 LEU 126 106 ?   ?   ?   L P n 
D 4 127 PHE 127 106 ?   ?   ?   L Q n 
D 4 128 PRO 128 106 ?   ?   ?   L R n 
D 4 129 PRO 129 106 ?   ?   ?   L S n 
D 4 130 SER 130 106 ?   ?   ?   L T n 
D 4 131 SER 131 106 ?   ?   ?   L U n 
D 4 132 GLU 132 123 123 GLU GLU L . n 
D 4 133 GLU 133 124 124 GLU GLU L . n 
D 4 134 LEU 134 125 125 LEU LEU L . n 
D 4 135 GLN 135 126 126 GLN GLN L . n 
D 4 136 ALA 136 127 127 ALA ALA L . n 
D 4 137 ASN 137 128 128 ASN ASN L . n 
D 4 138 LYS 138 129 129 LYS LYS L . n 
D 4 139 ALA 139 130 130 ALA ALA L . n 
D 4 140 THR 140 131 131 THR THR L . n 
D 4 141 LEU 141 132 132 LEU LEU L . n 
D 4 142 VAL 142 133 133 VAL VAL L . n 
D 4 143 CYS 143 134 134 CYS CYS L . n 
D 4 144 LEU 144 135 135 LEU LEU L . n 
D 4 145 ILE 145 136 136 ILE ILE L . n 
D 4 146 SER 146 137 137 SER SER L . n 
D 4 147 ASP 147 138 138 ASP ASP L . n 
D 4 148 PHE 148 139 139 PHE PHE L . n 
D 4 149 TYR 149 140 140 TYR TYR L . n 
D 4 150 PRO 150 141 ?   ?   ?   L . n 
D 4 151 GLY 151 142 ?   ?   ?   L . n 
D 4 152 ALA 152 143 ?   ?   ?   L . n 
D 4 153 VAL 153 144 ?   ?   ?   L . n 
D 4 154 THR 154 145 ?   ?   ?   L . n 
D 4 155 VAL 155 146 ?   ?   ?   L . n 
D 4 156 ALA 156 147 ?   ?   ?   L . n 
D 4 157 TRP 157 148 ?   ?   ?   L . n 
D 4 158 LYS 158 149 ?   ?   ?   L . n 
D 4 159 ALA 159 150 ?   ?   ?   L . n 
D 4 160 ASP 160 151 ?   ?   ?   L . n 
D 4 161 SER 161 152 ?   ?   ?   L . n 
D 4 162 SER 162 153 ?   ?   ?   L . n 
D 4 163 PRO 163 154 ?   ?   ?   L . n 
D 4 164 VAL 164 155 ?   ?   ?   L . n 
D 4 165 LYS 165 156 ?   ?   ?   L . n 
D 4 166 ALA 166 157 ?   ?   ?   L . n 
D 4 167 GLY 167 158 158 GLY GLY L . n 
D 4 168 VAL 168 159 159 VAL VAL L . n 
D 4 169 GLU 169 160 160 GLU GLU L . n 
D 4 170 THR 170 161 161 THR THR L . n 
D 4 171 THR 171 162 162 THR THR L . n 
D 4 172 THR 172 163 163 THR THR L . n 
D 4 173 PRO 173 164 164 PRO PRO L . n 
D 4 174 SER 174 165 165 SER SER L . n 
D 4 175 LYS 175 166 166 LYS LYS L . n 
D 4 176 GLN 176 167 167 GLN GLN L . n 
D 4 177 SER 177 168 168 SER SER L . n 
D 4 178 ASN 178 170 170 ASN ASN L . n 
D 4 179 ASN 179 171 171 ASN ASN L . n 
D 4 180 LYS 180 172 172 LYS LYS L . n 
D 4 181 TYR 181 173 173 TYR TYR L . n 
D 4 182 ALA 182 174 174 ALA ALA L . n 
D 4 183 ALA 183 175 175 ALA ALA L . n 
D 4 184 SER 184 176 176 SER SER L . n 
D 4 185 SER 185 177 177 SER SER L . n 
D 4 186 TYR 186 178 178 TYR TYR L . n 
D 4 187 LEU 187 179 179 LEU LEU L . n 
D 4 188 SER 188 180 180 SER SER L . n 
D 4 189 LEU 189 181 ?   ?   ?   L . n 
D 4 190 THR 190 182 ?   ?   ?   L . n 
D 4 191 PRO 191 183 ?   ?   ?   L . n 
D 4 192 GLU 192 184 ?   ?   ?   L . n 
D 4 193 GLN 193 185 ?   ?   ?   L . n 
D 4 194 TRP 194 186 ?   ?   ?   L . n 
D 4 195 LYS 195 187 ?   ?   ?   L . n 
D 4 196 SER 196 188 ?   ?   ?   L . n 
D 4 197 HIS 197 189 ?   ?   ?   L . n 
D 4 198 ARG 198 190 ?   ?   ?   L . n 
D 4 199 SER 199 191 ?   ?   ?   L . n 
D 4 200 TYR 200 192 ?   ?   ?   L . n 
D 4 201 SER 201 193 ?   ?   ?   L . n 
D 4 202 CYS 202 194 194 CYS CYS L . n 
D 4 203 GLN 203 195 195 GLN GLN L . n 
D 4 204 VAL 204 196 ?   ?   ?   L . n 
D 4 205 THR 205 197 ?   ?   ?   L . n 
D 4 206 HIS 206 198 ?   ?   ?   L . n 
D 4 207 GLU 207 199 ?   ?   ?   L . n 
D 4 208 GLY 208 200 ?   ?   ?   L . n 
D 4 209 SER 209 201 ?   ?   ?   L . n 
D 4 210 THR 210 202 ?   ?   ?   L . n 
D 4 211 VAL 211 203 ?   ?   ?   L . n 
D 4 212 GLU 212 204 ?   ?   ?   L . n 
D 4 213 LYS 213 205 ?   ?   ?   L . n 
D 4 214 THR 214 206 ?   ?   ?   L . n 
D 4 215 VAL 215 207 ?   ?   ?   L . n 
D 4 216 ALA 216 208 ?   ?   ?   L . n 
D 4 217 PRO 217 209 ?   ?   ?   L . n 
D 4 218 THR 218 210 ?   ?   ?   L . n 
D 4 219 GLU 219 211 ?   ?   ?   L . n 
D 4 220 CYS 220 212 ?   ?   ?   L . n 
D 4 221 SER 221 213 ?   ?   ?   L . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
F 6  NAG 1   330 330 NAG NAG A . 
G 7  EDO 1   331 331 EDO EDO A . 
H 8  GOL 1   332 332 GOL GOL A . 
I 9  ETX 1   333 333 ETX ETX A . 
J 6  NAG 1   180 180 NAG NAG B . 
K 8  GOL 1   181 181 GOL GOL B . 
L 10 CL  1   182 182 CL  CL  B . 
M 7  EDO 1   183 183 EDO EDO B . 
N 7  EDO 1   184 184 EDO EDO B . 
O 7  EDO 1   185 185 EDO EDO B . 
P 11 UNL 1   186 186 UNL UNL B . 
Q 7  EDO 1   228 228 EDO EDO H . 
R 12 HOH 1   6   6   HOH HOH A . 
R 12 HOH 2   334 334 HOH HOH A . 
R 12 HOH 3   335 335 HOH HOH A . 
R 12 HOH 4   336 336 HOH HOH A . 
R 12 HOH 5   337 337 HOH HOH A . 
R 12 HOH 6   338 338 HOH HOH A . 
R 12 HOH 7   339 339 HOH HOH A . 
R 12 HOH 8   340 340 HOH HOH A . 
R 12 HOH 9   341 341 HOH HOH A . 
R 12 HOH 10  342 342 HOH HOH A . 
R 12 HOH 11  343 343 HOH HOH A . 
R 12 HOH 12  344 344 HOH HOH A . 
R 12 HOH 13  345 345 HOH HOH A . 
R 12 HOH 14  346 346 HOH HOH A . 
R 12 HOH 15  347 347 HOH HOH A . 
R 12 HOH 16  348 348 HOH HOH A . 
R 12 HOH 17  349 349 HOH HOH A . 
R 12 HOH 18  350 350 HOH HOH A . 
R 12 HOH 19  351 351 HOH HOH A . 
R 12 HOH 20  352 352 HOH HOH A . 
R 12 HOH 21  353 353 HOH HOH A . 
R 12 HOH 22  354 354 HOH HOH A . 
R 12 HOH 23  355 355 HOH HOH A . 
R 12 HOH 24  356 356 HOH HOH A . 
R 12 HOH 25  357 357 HOH HOH A . 
R 12 HOH 26  358 358 HOH HOH A . 
R 12 HOH 27  359 359 HOH HOH A . 
R 12 HOH 28  360 360 HOH HOH A . 
R 12 HOH 29  361 361 HOH HOH A . 
R 12 HOH 30  362 362 HOH HOH A . 
R 12 HOH 31  363 363 HOH HOH A . 
R 12 HOH 32  364 364 HOH HOH A . 
R 12 HOH 33  365 365 HOH HOH A . 
R 12 HOH 34  366 366 HOH HOH A . 
R 12 HOH 35  367 367 HOH HOH A . 
R 12 HOH 36  368 368 HOH HOH A . 
R 12 HOH 37  369 369 HOH HOH A . 
R 12 HOH 38  370 370 HOH HOH A . 
R 12 HOH 39  371 371 HOH HOH A . 
R 12 HOH 40  372 372 HOH HOH A . 
R 12 HOH 41  373 373 HOH HOH A . 
R 12 HOH 42  374 374 HOH HOH A . 
R 12 HOH 43  375 375 HOH HOH A . 
R 12 HOH 44  376 376 HOH HOH A . 
R 12 HOH 45  377 377 HOH HOH A . 
R 12 HOH 46  378 378 HOH HOH A . 
R 12 HOH 47  379 379 HOH HOH A . 
R 12 HOH 48  380 380 HOH HOH A . 
R 12 HOH 49  381 381 HOH HOH A . 
R 12 HOH 50  382 382 HOH HOH A . 
R 12 HOH 51  383 383 HOH HOH A . 
R 12 HOH 52  384 384 HOH HOH A . 
R 12 HOH 53  385 385 HOH HOH A . 
R 12 HOH 54  386 386 HOH HOH A . 
R 12 HOH 55  387 387 HOH HOH A . 
R 12 HOH 56  388 388 HOH HOH A . 
R 12 HOH 57  389 389 HOH HOH A . 
R 12 HOH 58  390 390 HOH HOH A . 
R 12 HOH 59  391 391 HOH HOH A . 
R 12 HOH 60  392 392 HOH HOH A . 
R 12 HOH 61  393 393 HOH HOH A . 
R 12 HOH 62  394 394 HOH HOH A . 
R 12 HOH 63  395 395 HOH HOH A . 
R 12 HOH 64  396 396 HOH HOH A . 
R 12 HOH 65  397 397 HOH HOH A . 
R 12 HOH 66  398 398 HOH HOH A . 
R 12 HOH 67  399 399 HOH HOH A . 
R 12 HOH 68  400 400 HOH HOH A . 
R 12 HOH 69  401 401 HOH HOH A . 
R 12 HOH 70  402 402 HOH HOH A . 
R 12 HOH 71  403 403 HOH HOH A . 
R 12 HOH 72  404 404 HOH HOH A . 
R 12 HOH 73  405 405 HOH HOH A . 
R 12 HOH 74  406 406 HOH HOH A . 
R 12 HOH 75  407 407 HOH HOH A . 
R 12 HOH 76  408 408 HOH HOH A . 
R 12 HOH 77  409 409 HOH HOH A . 
R 12 HOH 78  410 410 HOH HOH A . 
R 12 HOH 79  411 411 HOH HOH A . 
R 12 HOH 80  412 412 HOH HOH A . 
R 12 HOH 81  413 413 HOH HOH A . 
R 12 HOH 82  414 414 HOH HOH A . 
S 12 HOH 1   187 187 HOH HOH B . 
S 12 HOH 2   188 188 HOH HOH B . 
S 12 HOH 3   189 189 HOH HOH B . 
S 12 HOH 4   190 190 HOH HOH B . 
S 12 HOH 5   191 191 HOH HOH B . 
S 12 HOH 6   192 192 HOH HOH B . 
S 12 HOH 7   193 193 HOH HOH B . 
S 12 HOH 8   194 194 HOH HOH B . 
S 12 HOH 9   195 195 HOH HOH B . 
S 12 HOH 10  196 196 HOH HOH B . 
S 12 HOH 11  197 197 HOH HOH B . 
S 12 HOH 12  198 198 HOH HOH B . 
S 12 HOH 13  199 199 HOH HOH B . 
S 12 HOH 14  200 200 HOH HOH B . 
S 12 HOH 15  201 201 HOH HOH B . 
S 12 HOH 16  202 202 HOH HOH B . 
S 12 HOH 17  203 203 HOH HOH B . 
S 12 HOH 18  204 204 HOH HOH B . 
S 12 HOH 19  205 205 HOH HOH B . 
S 12 HOH 20  206 206 HOH HOH B . 
S 12 HOH 21  207 207 HOH HOH B . 
S 12 HOH 22  208 208 HOH HOH B . 
S 12 HOH 23  209 209 HOH HOH B . 
S 12 HOH 24  210 210 HOH HOH B . 
S 12 HOH 25  211 211 HOH HOH B . 
S 12 HOH 26  212 212 HOH HOH B . 
S 12 HOH 27  213 213 HOH HOH B . 
S 12 HOH 28  214 214 HOH HOH B . 
S 12 HOH 29  215 215 HOH HOH B . 
S 12 HOH 30  216 216 HOH HOH B . 
S 12 HOH 31  217 217 HOH HOH B . 
S 12 HOH 32  218 218 HOH HOH B . 
S 12 HOH 33  219 219 HOH HOH B . 
S 12 HOH 34  220 220 HOH HOH B . 
S 12 HOH 35  221 221 HOH HOH B . 
S 12 HOH 36  222 222 HOH HOH B . 
S 12 HOH 37  223 223 HOH HOH B . 
S 12 HOH 38  224 224 HOH HOH B . 
S 12 HOH 39  225 225 HOH HOH B . 
S 12 HOH 40  226 226 HOH HOH B . 
S 12 HOH 41  227 227 HOH HOH B . 
S 12 HOH 42  228 228 HOH HOH B . 
S 12 HOH 43  229 229 HOH HOH B . 
S 12 HOH 44  230 230 HOH HOH B . 
S 12 HOH 45  231 231 HOH HOH B . 
S 12 HOH 46  232 232 HOH HOH B . 
S 12 HOH 47  233 233 HOH HOH B . 
S 12 HOH 48  234 234 HOH HOH B . 
S 12 HOH 49  235 235 HOH HOH B . 
S 12 HOH 50  236 236 HOH HOH B . 
S 12 HOH 51  237 237 HOH HOH B . 
S 12 HOH 52  238 238 HOH HOH B . 
S 12 HOH 53  239 239 HOH HOH B . 
S 12 HOH 54  240 240 HOH HOH B . 
S 12 HOH 55  241 241 HOH HOH B . 
S 12 HOH 56  242 242 HOH HOH B . 
S 12 HOH 57  243 243 HOH HOH B . 
S 12 HOH 58  244 244 HOH HOH B . 
S 12 HOH 59  245 245 HOH HOH B . 
S 12 HOH 60  246 246 HOH HOH B . 
S 12 HOH 61  247 247 HOH HOH B . 
S 12 HOH 62  248 248 HOH HOH B . 
S 12 HOH 63  249 249 HOH HOH B . 
S 12 HOH 64  250 250 HOH HOH B . 
S 12 HOH 65  251 251 HOH HOH B . 
S 12 HOH 66  252 252 HOH HOH B . 
S 12 HOH 67  253 253 HOH HOH B . 
S 12 HOH 68  254 254 HOH HOH B . 
S 12 HOH 69  255 255 HOH HOH B . 
S 12 HOH 70  256 256 HOH HOH B . 
S 12 HOH 71  257 257 HOH HOH B . 
S 12 HOH 72  258 258 HOH HOH B . 
S 12 HOH 73  259 259 HOH HOH B . 
S 12 HOH 74  260 260 HOH HOH B . 
S 12 HOH 75  261 261 HOH HOH B . 
S 12 HOH 76  262 262 HOH HOH B . 
S 12 HOH 77  263 263 HOH HOH B . 
S 12 HOH 78  264 264 HOH HOH B . 
S 12 HOH 79  265 265 HOH HOH B . 
S 12 HOH 80  266 266 HOH HOH B . 
S 12 HOH 81  267 267 HOH HOH B . 
S 12 HOH 82  268 268 HOH HOH B . 
S 12 HOH 83  269 269 HOH HOH B . 
S 12 HOH 84  270 270 HOH HOH B . 
S 12 HOH 85  271 271 HOH HOH B . 
S 12 HOH 86  272 272 HOH HOH B . 
S 12 HOH 87  273 273 HOH HOH B . 
S 12 HOH 88  274 274 HOH HOH B . 
S 12 HOH 89  275 275 HOH HOH B . 
S 12 HOH 90  276 276 HOH HOH B . 
S 12 HOH 91  277 277 HOH HOH B . 
S 12 HOH 92  278 278 HOH HOH B . 
S 12 HOH 93  279 279 HOH HOH B . 
S 12 HOH 94  280 280 HOH HOH B . 
S 12 HOH 95  281 281 HOH HOH B . 
S 12 HOH 96  282 282 HOH HOH B . 
S 12 HOH 97  283 283 HOH HOH B . 
S 12 HOH 98  284 284 HOH HOH B . 
S 12 HOH 99  285 285 HOH HOH B . 
S 12 HOH 100 286 286 HOH HOH B . 
S 12 HOH 101 287 287 HOH HOH B . 
S 12 HOH 102 288 288 HOH HOH B . 
S 12 HOH 103 289 289 HOH HOH B . 
S 12 HOH 104 290 290 HOH HOH B . 
S 12 HOH 105 291 291 HOH HOH B . 
S 12 HOH 106 292 292 HOH HOH B . 
S 12 HOH 107 293 293 HOH HOH B . 
S 12 HOH 108 294 294 HOH HOH B . 
S 12 HOH 109 295 295 HOH HOH B . 
S 12 HOH 110 296 296 HOH HOH B . 
S 12 HOH 111 297 297 HOH HOH B . 
S 12 HOH 112 298 298 HOH HOH B . 
S 12 HOH 113 299 299 HOH HOH B . 
S 12 HOH 114 300 300 HOH HOH B . 
S 12 HOH 115 301 301 HOH HOH B . 
S 12 HOH 116 302 302 HOH HOH B . 
S 12 HOH 117 303 303 HOH HOH B . 
S 12 HOH 118 304 304 HOH HOH B . 
S 12 HOH 119 305 305 HOH HOH B . 
S 12 HOH 120 306 306 HOH HOH B . 
S 12 HOH 121 313 313 HOH HOH B . 
S 12 HOH 122 317 317 HOH HOH B . 
S 12 HOH 123 321 321 HOH HOH B . 
S 12 HOH 124 322 322 HOH HOH B . 
T 12 HOH 1   155 155 HOH HOH H . 
T 12 HOH 2   181 181 HOH HOH H . 
T 12 HOH 3   229 229 HOH HOH H . 
T 12 HOH 4   230 230 HOH HOH H . 
T 12 HOH 5   231 231 HOH HOH H . 
T 12 HOH 6   232 232 HOH HOH H . 
T 12 HOH 7   233 233 HOH HOH H . 
T 12 HOH 8   234 234 HOH HOH H . 
T 12 HOH 9   235 235 HOH HOH H . 
T 12 HOH 10  236 236 HOH HOH H . 
T 12 HOH 11  237 237 HOH HOH H . 
T 12 HOH 12  238 238 HOH HOH H . 
T 12 HOH 13  239 239 HOH HOH H . 
T 12 HOH 14  240 240 HOH HOH H . 
T 12 HOH 15  241 241 HOH HOH H . 
T 12 HOH 16  242 242 HOH HOH H . 
T 12 HOH 17  243 243 HOH HOH H . 
T 12 HOH 18  244 244 HOH HOH H . 
T 12 HOH 19  245 245 HOH HOH H . 
T 12 HOH 20  246 246 HOH HOH H . 
T 12 HOH 21  247 247 HOH HOH H . 
T 12 HOH 22  248 248 HOH HOH H . 
T 12 HOH 23  249 249 HOH HOH H . 
T 12 HOH 24  250 250 HOH HOH H . 
T 12 HOH 25  251 251 HOH HOH H . 
T 12 HOH 26  252 252 HOH HOH H . 
T 12 HOH 27  253 253 HOH HOH H . 
T 12 HOH 28  254 254 HOH HOH H . 
T 12 HOH 29  255 255 HOH HOH H . 
T 12 HOH 30  256 256 HOH HOH H . 
T 12 HOH 31  257 257 HOH HOH H . 
T 12 HOH 32  258 258 HOH HOH H . 
T 12 HOH 33  259 259 HOH HOH H . 
T 12 HOH 34  260 260 HOH HOH H . 
T 12 HOH 35  261 261 HOH HOH H . 
T 12 HOH 36  262 262 HOH HOH H . 
T 12 HOH 37  263 263 HOH HOH H . 
T 12 HOH 38  264 264 HOH HOH H . 
T 12 HOH 39  265 265 HOH HOH H . 
T 12 HOH 40  266 266 HOH HOH H . 
T 12 HOH 41  267 267 HOH HOH H . 
T 12 HOH 42  268 268 HOH HOH H . 
T 12 HOH 43  269 269 HOH HOH H . 
T 12 HOH 44  270 270 HOH HOH H . 
T 12 HOH 45  271 271 HOH HOH H . 
T 12 HOH 46  272 272 HOH HOH H . 
T 12 HOH 47  273 273 HOH HOH H . 
T 12 HOH 48  274 274 HOH HOH H . 
T 12 HOH 49  275 275 HOH HOH H . 
T 12 HOH 50  276 276 HOH HOH H . 
T 12 HOH 51  277 277 HOH HOH H . 
T 12 HOH 52  278 278 HOH HOH H . 
T 12 HOH 53  279 279 HOH HOH H . 
T 12 HOH 54  280 280 HOH HOH H . 
T 12 HOH 55  281 281 HOH HOH H . 
T 12 HOH 56  282 282 HOH HOH H . 
T 12 HOH 57  283 283 HOH HOH H . 
T 12 HOH 58  284 284 HOH HOH H . 
T 12 HOH 59  285 285 HOH HOH H . 
T 12 HOH 60  286 286 HOH HOH H . 
T 12 HOH 61  287 287 HOH HOH H . 
T 12 HOH 62  288 288 HOH HOH H . 
T 12 HOH 63  289 289 HOH HOH H . 
T 12 HOH 64  290 290 HOH HOH H . 
T 12 HOH 65  291 291 HOH HOH H . 
T 12 HOH 66  292 292 HOH HOH H . 
T 12 HOH 67  293 293 HOH HOH H . 
T 12 HOH 68  294 294 HOH HOH H . 
T 12 HOH 69  295 295 HOH HOH H . 
T 12 HOH 70  296 296 HOH HOH H . 
T 12 HOH 71  297 297 HOH HOH H . 
T 12 HOH 72  298 298 HOH HOH H . 
T 12 HOH 73  299 299 HOH HOH H . 
T 12 HOH 74  300 300 HOH HOH H . 
T 12 HOH 75  301 301 HOH HOH H . 
T 12 HOH 76  302 302 HOH HOH H . 
T 12 HOH 77  306 306 HOH HOH H . 
T 12 HOH 78  309 309 HOH HOH H . 
T 12 HOH 79  318 318 HOH HOH H . 
U 12 HOH 1   214 214 HOH HOH L . 
U 12 HOH 2   215 215 HOH HOH L . 
U 12 HOH 3   216 216 HOH HOH L . 
U 12 HOH 4   217 217 HOH HOH L . 
U 12 HOH 5   236 236 HOH HOH L . 
U 12 HOH 6   277 277 HOH HOH L . 
U 12 HOH 7   279 279 HOH HOH L . 
U 12 HOH 8   280 280 HOH HOH L . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 15  A ASN 21  ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 91  A ASN 95  ? ASN 'GLYCOSYLATION SITE' 
3 B ASN 154 B ASN 154 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dodecameric 
_pdbx_struct_assembly.oligomeric_count     12 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 52610  ? 
1 MORE         -197   ? 
1 'SSA (A^2)'  104050 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z           1.0000000000 0.0000000000  0.0000000000 0.0000000000    0.0000000000  
1.0000000000 0.0000000000  0.0000000000    0.0000000000 0.0000000000  1.0000000000 0.0000000000   
2 'crystal symmetry operation' 6_445  z-1/2,-x-1/2,-y 0.0000000000 0.0000000000  0.9961076825 -100.9590000000 -1.0016392793 
0.0000000000 0.0000000000  -101.1245000000 0.0000000000 -1.0022645353 0.0000000000 0.0000000000   
3 'crystal symmetry operation' 12_455 -y-1/2,-z,x+1/2 0.0000000000 -0.9983634035 0.0000000000 -100.9590000000 0.0000000000  
0.0000000000 -0.9977405812 0.0000000000    1.0039075268 0.0000000000  0.0000000000 101.3535000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    B 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     237 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   S 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-03-10 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 3 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Refinement description'    
3 2 'Structure model' 'Version format compliance' 
4 3 'Structure model' Advisory                    
5 3 'Structure model' 'Atomic model'              
6 3 'Structure model' 'Data collection'           
7 3 'Structure model' 'Database references'       
8 3 'Structure model' 'Derived calculations'      
9 3 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' atom_site                     
2  3 'Structure model' chem_comp                     
3  3 'Structure model' database_PDB_caveat           
4  3 'Structure model' entity                        
5  3 'Structure model' pdbx_branch_scheme            
6  3 'Structure model' pdbx_chem_comp_identifier     
7  3 'Structure model' pdbx_entity_branch            
8  3 'Structure model' pdbx_entity_branch_descriptor 
9  3 'Structure model' pdbx_entity_branch_link       
10 3 'Structure model' pdbx_entity_branch_list       
11 3 'Structure model' pdbx_entity_nonpoly           
12 3 'Structure model' pdbx_nonpoly_scheme           
13 3 'Structure model' pdbx_struct_assembly_gen      
14 3 'Structure model' pdbx_struct_special_symmetry  
15 3 'Structure model' pdbx_validate_close_contact   
16 3 'Structure model' struct_asym                   
17 3 'Structure model' struct_conn                   
18 3 'Structure model' struct_ref_seq_dif            
19 3 'Structure model' struct_site                   
20 3 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_atom_site.auth_asym_id'                     
2  3 'Structure model' '_atom_site.label_asym_id'                    
3  3 'Structure model' '_atom_site.label_entity_id'                  
4  3 'Structure model' '_chem_comp.name'                             
5  3 'Structure model' '_chem_comp.type'                             
6  3 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'      
7  3 'Structure model' '_pdbx_struct_special_symmetry.label_asym_id' 
8  3 'Structure model' '_pdbx_validate_close_contact.auth_asym_id_2' 
9  3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
10 3 'Structure model' '_struct_conn.pdbx_role'                      
11 3 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
12 3 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
13 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
14 3 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
15 3 'Structure model' '_struct_ref_seq_dif.details'                 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1  ? refined -64.6657 -22.7674 10.6577 0.0111 0.0744 0.0112 0.0014  -0.0013 -0.0276 1.6150 5.4073  3.6680 
-1.4817 1.1321  -3.4373 0.0746  -0.0249 -0.0497 0.2769  -0.1199 0.0204  -0.2442 0.1447  0.2026  
'X-RAY DIFFRACTION' 2  ? refined -22.9579 -47.5210 45.4460 0.1748 0.3710 0.3697 0.0602  -0.0201 -0.0011 1.0981 0.5711  1.8093 
-0.0432 0.4376  -0.5528 0.0511  -0.1714 0.1203  -0.0343 -0.0083 -0.4046 0.0244  0.2318  0.5975  
'X-RAY DIFFRACTION' 3  ? refined -17.9674 -54.4593 61.3031 0.2985 0.5290 0.3880 0.0171  -0.0858 0.0306  2.0019 3.9329  1.8823 
-1.4402 0.4452  -1.0051 -0.0699 -0.1238 0.1937  -0.1785 -0.1037 -0.3447 0.5000  0.2607  0.5684  
'X-RAY DIFFRACTION' 4  ? refined -24.5660 -60.0523 59.6970 0.5161 0.5494 0.4674 0.1129  -0.0639 0.0254  0.6150 3.8407  2.2994 
0.2097  0.1762  -1.8730 -0.0095 -0.1186 0.1281  -0.2009 -0.2344 -0.1542 0.4199  0.4890  0.2208  
'X-RAY DIFFRACTION' 5  ? refined -26.9465 -43.0013 48.1883 0.0928 0.3036 0.2738 -0.0105 -0.0211 -0.0321 1.0596 1.3228  3.7833 
-0.4008 1.0813  -0.7565 -0.0080 -0.1230 0.1310  -0.1013 0.1029  -0.3420 0.2688  -0.1052 0.4944  
'X-RAY DIFFRACTION' 6  ? refined -51.2696 -33.4913 24.4556 0.0189 0.0899 0.0493 0.0188  0.0085  -0.0339 3.8801 3.8196  3.2889 
-3.1449 2.7917  -3.3621 0.0614  -0.0655 0.0040  0.0713  -0.1453 -0.0722 -0.1224 0.1474  0.2292  
'X-RAY DIFFRACTION' 7  ? refined -68.8480 -12.5052 6.3346  0.0570 0.0434 0.0341 0.0065  0.0237  0.0295  0.9610 4.5111  5.4090 
0.3701  -0.4113 -3.2573 0.0857  -0.0753 -0.0104 0.1472  0.1753  -0.0274 -0.3339 -0.0143 0.2568  
'X-RAY DIFFRACTION' 8  ? refined -61.5166 -15.6332 25.0451 0.0245 0.0315 0.0104 -0.0052 -0.0025 -0.0099 2.3832 8.8038  6.6724 
-3.4387 2.6001  -5.2963 -0.1575 0.0601  0.0974  -0.1703 0.0864  0.0262  0.3860  -0.3901 0.0707  
'X-RAY DIFFRACTION' 9  ? refined -45.2967 -42.7989 41.9566 0.1778 0.1469 0.1512 0.0520  0.0037  0.0090  1.4150 0.1364  0.5298 
0.4291  -0.4072 -0.1577 0.0112  -0.0137 0.0024  0.0540  0.0805  0.0052  -0.0115 0.0107  0.1715  
'X-RAY DIFFRACTION' 10 ? refined -55.0539 -45.9261 37.9720 0.0331 0.0498 0.0951 0.0309  -0.0148 -0.0498 3.4888 9.4427  8.9592 
-5.6041 5.5480  -9.1515 0.2350  -0.0926 -0.1425 0.1315  -0.1604 0.0646  -0.3466 0.3648  0.1558  
'X-RAY DIFFRACTION' 11 ? refined -77.1768 -12.1738 11.7042 0.0276 0.0366 0.1381 0.0254  0.0199  0.0009  3.9769 9.1517  7.0383 
-4.9317 3.0205  -6.9912 0.1913  0.1403  -0.3316 0.0934  -0.2250 0.7024  0.0008  -0.1190 -0.3305 
'X-RAY DIFFRACTION' 12 ? refined -80.3422 3.5267   4.5365  0.1733 0.0807 0.1541 0.0804  0.0564  0.0610  7.0628 4.1919  5.7229 
-2.4442 -0.0652 -0.1365 -0.0136 0.0421  -0.0285 0.2574  0.6734  0.0878  -0.2020 -0.5783 -0.5799 
'X-RAY DIFFRACTION' 13 ? refined -37.2462 -11.5750 24.9402 0.0546 0.0892 0.1245 0.0078  -0.0197 -0.0201 5.6680 1.3458  2.1437 
2.1842  -1.3669 -1.4619 0.0004  -0.1317 0.1313  -0.3931 -0.2178 -0.1556 -0.0100 0.0664  0.1146  
'X-RAY DIFFRACTION' 14 ? refined -44.5955 -5.3369  18.4909 0.0076 0.0202 0.0296 -0.0116 0.0071  -0.0169 7.7027 3.2529  2.6937 
2.1923  0.9415  0.1420  -0.1531 0.1802  -0.0271 0.2043  0.1152  -0.1520 -0.1121 -0.0885 0.0904  
'X-RAY DIFFRACTION' 15 ? refined -38.9183 -10.0701 14.3283 0.0267 0.0499 0.1048 -0.0225 0.0307  -0.0514 3.2392 2.1989  3.2851 
1.5867  -2.6755 -1.7247 -0.0463 0.0107  0.0356  0.1541  -0.3088 -0.1966 -0.1043 -0.0078 -0.0371 
'X-RAY DIFFRACTION' 16 ? refined -35.3571 -2.9724  22.9478 0.0625 0.0545 0.0969 -0.0095 -0.0293 -0.0418 7.9158 1.4909  2.0985 
1.6007  0.1775  0.4344  -0.0438 0.0143  0.0296  -0.4445 0.3232  -0.2196 0.1436  -0.0504 0.1784  
'X-RAY DIFFRACTION' 17 ? refined -11.1949 2.3445   30.5188 0.7106 0.6318 0.6051 0.0782  0.0084  -0.0595 5.0311 5.0017  3.6822 
4.6921  4.2908  3.9260  0.0525  0.0908  -0.1433 -0.0630 -0.1126 0.0237  0.7066  -0.0335 0.0155  
'X-RAY DIFFRACTION' 18 ? refined -13.2845 2.9808   23.5199 0.1999 0.8943 0.5866 -0.0878 -0.0812 0.0700  4.9330 10.2255 2.3534 
7.0679  3.3306  4.7174  -0.3315 0.3934  -0.0619 0.3930  -0.1103 -0.3714 -0.4009 -0.2437 0.5655  
'X-RAY DIFFRACTION' 19 ? refined -45.7103 18.5412  19.2691 0.4449 0.1839 0.3347 0.0070  -0.0559 0.0087  3.0389 1.0135  5.6292 
1.0692  2.1149  1.2803  -0.1388 0.0917  0.0471  0.1461  0.1849  -0.0481 -0.0791 -0.4322 0.1882  
'X-RAY DIFFRACTION' 20 ? refined -48.1147 7.8497   24.6744 0.0731 0.0506 0.1210 0.0112  0.0126  -0.0658 4.6644 6.3515  4.4556 
-0.6417 -0.4242 -0.7071 -0.1422 -0.0240 0.1662  -0.3461 0.4418  0.0319  0.1523  -0.1356 -0.2458 
'X-RAY DIFFRACTION' 21 ? refined -52.0670 15.2563  28.0563 0.2622 0.2026 0.2838 0.1088  -0.0068 -0.0893 3.5117 3.1460  4.8234 
0.2330  1.4389  0.9958  -0.1907 0.0763  0.1144  -0.3692 0.3789  0.2309  0.3049  -0.6510 -0.4955 
'X-RAY DIFFRACTION' 22 ? refined -47.2530 6.2627   13.9467 0.1872 0.1170 0.2219 -0.0173 -0.0138 -0.0120 4.4551 6.3874  5.7245 
0.2896  -0.0675 1.2224  -0.3372 0.0291  0.3082  0.6124  0.1410  0.2916  -0.8526 -0.5629 -0.2853 
'X-RAY DIFFRACTION' 23 ? refined -40.5906 14.4746  23.0681 0.3625 0.1457 0.3629 -0.0127 -0.1160 -0.0689 3.2274 4.6172  6.6451 
3.3497  2.2753  2.5336  -0.3245 0.0856  0.2390  -0.1305 0.4168  -0.1012 -0.0915 -1.2770 0.4167  
'X-RAY DIFFRACTION' 24 ? refined -12.7796 15.2714  27.8105 0.5109 0.5881 0.5819 -0.0346 0.0222  -0.0727 2.1250 3.3519  1.1372 
-0.1856 1.3456  -1.0798 -0.0361 -0.0251 0.0612  -0.0112 0.1493  0.2443  0.0166  -0.1084 0.0365  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1  1  A 7   A 43  ? . . . . ? 
'X-RAY DIFFRACTION' 2  2  A 44  A 149 ? . . . . ? 
'X-RAY DIFFRACTION' 3  3  A 150 A 190 ? . . . . ? 
'X-RAY DIFFRACTION' 4  4  A 191 A 239 ? . . . . ? 
'X-RAY DIFFRACTION' 5  5  A 240 A 283 ? . . . . ? 
'X-RAY DIFFRACTION' 6  6  A 284 A 326 ? . . . . ? 
'X-RAY DIFFRACTION' 7  7  B 1   B 37  ? . . . . ? 
'X-RAY DIFFRACTION' 8  8  B 38  B 57  ? . . . . ? 
'X-RAY DIFFRACTION' 9  9  B 58  B 73  ? . . . . ? 
'X-RAY DIFFRACTION' 10 10 B 74  B 102 ? . . . . ? 
'X-RAY DIFFRACTION' 11 11 B 103 B 142 ? . . . . ? 
'X-RAY DIFFRACTION' 12 12 B 143 B 173 ? . . . . ? 
'X-RAY DIFFRACTION' 13 13 H 1   H 29  ? . . . . ? 
'X-RAY DIFFRACTION' 14 14 H 30  H 57  ? . . . . ? 
'X-RAY DIFFRACTION' 15 15 H 58  H 84  ? . . . . ? 
'X-RAY DIFFRACTION' 16 16 H 85  H 122 ? . . . . ? 
'X-RAY DIFFRACTION' 17 17 H 123 H 175 ? . . . . ? 
'X-RAY DIFFRACTION' 18 18 H 176 H 188 ? . . . . ? 
'X-RAY DIFFRACTION' 19 19 L 3   L 29  ? . . . . ? 
'X-RAY DIFFRACTION' 20 20 L 30  L 50  ? . . . . ? 
'X-RAY DIFFRACTION' 21 21 L 51  L 83  ? . . . . ? 
'X-RAY DIFFRACTION' 22 22 L 84  L 95  ? . . . . ? 
'X-RAY DIFFRACTION' 23 23 L 96  L 106 ? . . . . ? 
'X-RAY DIFFRACTION' 24 24 L 128 L 195 ? . . . . ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
Blu-Ice   'data collection' .        ? 1 
PHASER    phasing           .        ? 2 
REFMAC    refinement        5.5.0070 ? 3 
HKL-2000  'data reduction'  .        ? 4 
SCALEPACK 'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 377 ? ? O  A HOH 414 ? ? 2.01 
2 1 ND2 A ASN 21  ? ? O5 C NAG 1   ? ? 2.17 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            H 
_pdbx_validate_rmsd_bond.auth_comp_id_1            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_1             92 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            SG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            H 
_pdbx_validate_rmsd_bond.auth_comp_id_2            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_2             92 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.700 
_pdbx_validate_rmsd_bond.bond_target_value         1.812 
_pdbx_validate_rmsd_bond.bond_deviation            -0.112 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.016 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 315 ? ? CZ A ARG 315 ? ? NH2 A ARG 315 ? ? 117.04 120.30 -3.27  0.50 N 
2 1 NE B ARG 153 ? ? CZ B ARG 153 ? ? NH1 B ARG 153 ? ? 124.52 120.30 4.22   0.50 N 
3 1 NE B ARG 153 ? ? CZ B ARG 153 ? ? NH2 B ARG 153 ? ? 114.60 120.30 -5.70  0.50 N 
4 1 N  H GLY 42  ? ? CA H GLY 42  ? ? C   H GLY 42  ? ? 96.51  113.10 -16.59 2.50 N 
5 1 C  H GLU 150 ? ? N  H PRO 151 ? ? CA  H PRO 151 ? ? 130.98 119.30 11.68  1.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 125 C ? -165.58 -50.03  
2  1 TRP A 127 ? ? -119.43 63.92   
3  1 LYS A 133 A ? 53.37   85.60   
4  1 VAL A 135 ? ? 43.73   146.13  
5  1 CYS A 139 ? ? -116.64 72.72   
6  1 SER A 159 ? ? 77.76   -26.77  
7  1 TYR A 161 ? ? -160.57 98.55   
8  1 LYS A 163 ? ? -53.89  99.85   
9  1 ASN A 171 ? ? -106.64 40.53   
10 1 THR A 187 ? ? -16.18  93.54   
11 1 THR A 189 ? ? 68.64   -95.86  
12 1 GLN A 196 ? ? 64.47   -1.04   
13 1 ASP A 199 ? ? -106.71 70.67   
14 1 ASP A 225 ? ? 85.21   -2.11   
15 1 ASN A 250 ? ? 54.86   18.41   
16 1 HIS A 298 ? ? -170.97 142.50  
17 1 ALA B 5   ? ? -91.12  -66.29  
18 1 LYS B 127 ? ? 52.68   -135.41 
19 1 ILE H 53  ? ? 65.28   -59.29  
20 1 PHE H 148 ? ? -174.33 135.13  
21 1 PRO H 149 ? ? -83.74  -144.87 
22 1 PRO H 151 ? ? -106.35 -147.51 
23 1 VAL H 152 ? ? -177.19 79.17   
24 1 ASN L 27  B ? -110.71 -86.47  
25 1 ASN L 51  ? ? 75.77   -41.78  
26 1 ASN L 52  ? ? -152.89 6.37    
27 1 ASP L 60  ? ? -62.46  1.70    
28 1 ALA L 84  ? ? 178.15  171.97  
29 1 ARG L 94  ? ? -78.55  -93.86  
30 1 PRO L 95  ? ? -45.23  -71.69  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   GLU 
_pdbx_validate_peptide_omega.auth_asym_id_1   H 
_pdbx_validate_peptide_omega.auth_seq_id_1    150 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   PRO 
_pdbx_validate_peptide_omega.auth_asym_id_2   H 
_pdbx_validate_peptide_omega.auth_seq_id_2    151 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -126.73 
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    C1 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    B 
_pdbx_validate_chiral.auth_comp_id    NAG 
_pdbx_validate_chiral.auth_seq_id     180 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_validate_polymer_linkage.id 
_pdbx_validate_polymer_linkage.PDB_model_num 
_pdbx_validate_polymer_linkage.auth_atom_id_1 
_pdbx_validate_polymer_linkage.auth_asym_id_1 
_pdbx_validate_polymer_linkage.auth_comp_id_1 
_pdbx_validate_polymer_linkage.auth_seq_id_1 
_pdbx_validate_polymer_linkage.PDB_ins_code_1 
_pdbx_validate_polymer_linkage.label_alt_id_1 
_pdbx_validate_polymer_linkage.auth_atom_id_2 
_pdbx_validate_polymer_linkage.auth_asym_id_2 
_pdbx_validate_polymer_linkage.auth_comp_id_2 
_pdbx_validate_polymer_linkage.auth_seq_id_2 
_pdbx_validate_polymer_linkage.PDB_ins_code_2 
_pdbx_validate_polymer_linkage.label_alt_id_2 
_pdbx_validate_polymer_linkage.dist 
1 1 C H SER 180 ? ? N H SER 182 ? ? 2.31 
2 1 C L SER 9   ? ? N L VAL 11  ? ? 2.12 
3 1 C L SER 168 ? ? N L ASN 170 ? ? 2.74 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A GLU 122 ? CG  ? A GLU 119 CG  
2   1 Y 1 A GLU 122 ? CD  ? A GLU 119 CD  
3   1 Y 1 A GLU 122 ? OE1 ? A GLU 119 OE1 
4   1 Y 1 A GLU 122 ? OE2 ? A GLU 119 OE2 
5   1 Y 1 A LYS 133 A CG  ? A LYS 134 CG  
6   1 Y 1 A LYS 133 A CD  ? A LYS 134 CD  
7   1 Y 1 A LYS 133 A CE  ? A LYS 134 CE  
8   1 Y 1 A LYS 133 A NZ  ? A LYS 134 NZ  
9   1 Y 1 A SER 159 ? OG  ? A SER 160 OG  
10  1 Y 1 A SER 160 ? OG  ? A SER 161 OG  
11  1 Y 1 A LYS 163 ? CG  ? A LYS 164 CG  
12  1 Y 1 A LYS 163 ? CD  ? A LYS 164 CD  
13  1 Y 1 A LYS 163 ? CE  ? A LYS 164 CE  
14  1 Y 1 A LYS 163 ? NZ  ? A LYS 164 NZ  
15  1 Y 1 A LYS 166 ? CG  ? A LYS 167 CG  
16  1 Y 1 A LYS 166 ? CD  ? A LYS 167 CD  
17  1 Y 1 A LYS 166 ? CE  ? A LYS 167 CE  
18  1 Y 1 A LYS 166 ? NZ  ? A LYS 167 NZ  
19  1 Y 1 A THR 187 ? OG1 ? A THR 188 OG1 
20  1 Y 1 A THR 187 ? CG2 ? A THR 188 CG2 
21  1 Y 1 A GLN 192 ? CG  ? A GLN 193 CG  
22  1 Y 1 A GLN 192 ? CD  ? A GLN 193 CD  
23  1 Y 1 A GLN 192 ? OE1 ? A GLN 193 OE1 
24  1 Y 1 A GLN 192 ? NE2 ? A GLN 193 NE2 
25  1 Y 1 A TYR 195 ? CG  ? A TYR 196 CG  
26  1 Y 1 A TYR 195 ? CD1 ? A TYR 196 CD1 
27  1 Y 1 A TYR 195 ? CD2 ? A TYR 196 CD2 
28  1 Y 1 A TYR 195 ? CE1 ? A TYR 196 CE1 
29  1 Y 1 A TYR 195 ? CE2 ? A TYR 196 CE2 
30  1 Y 1 A TYR 195 ? CZ  ? A TYR 196 CZ  
31  1 Y 1 A TYR 195 ? OH  ? A TYR 196 OH  
32  1 Y 1 A GLN 196 ? CG  ? A GLN 197 CG  
33  1 Y 1 A GLN 196 ? CD  ? A GLN 197 CD  
34  1 Y 1 A GLN 196 ? OE1 ? A GLN 197 OE1 
35  1 Y 1 A GLN 196 ? NE2 ? A GLN 197 NE2 
36  1 Y 1 A ARG 212 ? CG  ? A ARG 213 CG  
37  1 Y 1 A ARG 212 ? CD  ? A ARG 213 CD  
38  1 Y 1 A ARG 212 ? NE  ? A ARG 213 NE  
39  1 Y 1 A ARG 212 ? CZ  ? A ARG 213 CZ  
40  1 Y 1 A ARG 212 ? NH1 ? A ARG 213 NH1 
41  1 Y 1 A ARG 212 ? NH2 ? A ARG 213 NH2 
42  1 Y 1 A ARG 220 ? CG  ? A ARG 221 CG  
43  1 Y 1 A ARG 220 ? CD  ? A ARG 221 CD  
44  1 Y 1 A ARG 220 ? NE  ? A ARG 221 NE  
45  1 Y 1 A ARG 220 ? CZ  ? A ARG 221 CZ  
46  1 Y 1 A ARG 220 ? NH1 ? A ARG 221 NH1 
47  1 Y 1 A ARG 220 ? NH2 ? A ARG 221 NH2 
48  1 Y 1 A LYS 222 ? CG  ? A LYS 223 CG  
49  1 Y 1 A LYS 222 ? CD  ? A LYS 223 CD  
50  1 Y 1 A LYS 222 ? CE  ? A LYS 223 CE  
51  1 Y 1 A LYS 222 ? NZ  ? A LYS 223 NZ  
52  1 Y 1 A ASP 225 ? CG  ? A ASP 226 CG  
53  1 Y 1 A ASP 225 ? OD1 ? A ASP 226 OD1 
54  1 Y 1 A ASP 225 ? OD2 ? A ASP 226 OD2 
55  1 Y 1 B LYS 121 ? CE  ? B LYS 121 CE  
56  1 Y 1 B LYS 121 ? NZ  ? B LYS 121 NZ  
57  1 Y 1 B ILE 173 ? CG1 ? B ILE 173 CG1 
58  1 Y 1 B ILE 173 ? CG2 ? B ILE 173 CG2 
59  1 Y 1 B ILE 173 ? CD1 ? B ILE 173 CD1 
60  1 Y 1 L LYS 18  ? CG  ? D LYS 17  CG  
61  1 Y 1 L LYS 18  ? CD  ? D LYS 17  CD  
62  1 Y 1 L LYS 18  ? CE  ? D LYS 17  CE  
63  1 Y 1 L LYS 18  ? NZ  ? D LYS 17  NZ  
64  1 Y 1 L ARG 94  ? CG  ? D ARG 95  CG  
65  1 Y 1 L ARG 94  ? CD  ? D ARG 95  CD  
66  1 Y 1 L ARG 94  ? NE  ? D ARG 95  NE  
67  1 Y 1 L ARG 94  ? CZ  ? D ARG 95  CZ  
68  1 Y 1 L ARG 94  ? NH1 ? D ARG 95  NH1 
69  1 Y 1 L ARG 94  ? NH2 ? D ARG 95  NH2 
70  1 Y 1 L GLN 126 ? CG  ? D GLN 135 CG  
71  1 Y 1 L GLN 126 ? CD  ? D GLN 135 CD  
72  1 Y 1 L GLN 126 ? OE1 ? D GLN 135 OE1 
73  1 Y 1 L GLN 126 ? NE2 ? D GLN 135 NE2 
74  1 Y 1 L ASN 128 ? CG  ? D ASN 137 CG  
75  1 Y 1 L ASN 128 ? OD1 ? D ASN 137 OD1 
76  1 Y 1 L ASN 128 ? ND2 ? D ASN 137 ND2 
77  1 Y 1 L LYS 129 ? CD  ? D LYS 138 CD  
78  1 Y 1 L LYS 129 ? CE  ? D LYS 138 CE  
79  1 Y 1 L LYS 129 ? NZ  ? D LYS 138 NZ  
80  1 Y 1 L LEU 132 ? CG  ? D LEU 141 CG  
81  1 Y 1 L LEU 132 ? CD1 ? D LEU 141 CD1 
82  1 Y 1 L LEU 132 ? CD2 ? D LEU 141 CD2 
83  1 Y 1 L GLU 160 ? CG  ? D GLU 169 CG  
84  1 Y 1 L GLU 160 ? CD  ? D GLU 169 CD  
85  1 Y 1 L GLU 160 ? OE1 ? D GLU 169 OE1 
86  1 Y 1 L GLU 160 ? OE2 ? D GLU 169 OE2 
87  1 Y 1 L THR 161 ? OG1 ? D THR 170 OG1 
88  1 Y 1 L THR 161 ? CG2 ? D THR 170 CG2 
89  1 Y 1 L LYS 166 ? CG  ? D LYS 175 CG  
90  1 Y 1 L LYS 166 ? CD  ? D LYS 175 CD  
91  1 Y 1 L LYS 166 ? CE  ? D LYS 175 CE  
92  1 Y 1 L LYS 166 ? NZ  ? D LYS 175 NZ  
93  1 Y 1 L LYS 172 ? CG  ? D LYS 180 CG  
94  1 Y 1 L LYS 172 ? CD  ? D LYS 180 CD  
95  1 Y 1 L LYS 172 ? CE  ? D LYS 180 CE  
96  1 Y 1 L LYS 172 ? NZ  ? D LYS 180 NZ  
97  1 Y 1 L TYR 173 ? CG  ? D TYR 181 CG  
98  1 Y 1 L TYR 173 ? CD1 ? D TYR 181 CD1 
99  1 Y 1 L TYR 173 ? CD2 ? D TYR 181 CD2 
100 1 Y 1 L TYR 173 ? CE1 ? D TYR 181 CE1 
101 1 Y 1 L TYR 173 ? CE2 ? D TYR 181 CE2 
102 1 Y 1 L TYR 173 ? CZ  ? D TYR 181 CZ  
103 1 Y 1 L TYR 173 ? OH  ? D TYR 181 OH  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A GLN 327 ? A GLN 329 
2   1 Y 1 A SER 328 ? A SER 330 
3   1 Y 1 A ARG 329 ? A ARG 331 
4   1 Y 1 B ASP 174 ? B ASP 174 
5   1 Y 1 B GLY 175 ? B GLY 175 
6   1 Y 1 B VAL 176 ? B VAL 176 
7   1 Y 1 B SER 177 ? B SER 177 
8   1 Y 1 B GLY 178 ? B GLY 178 
9   1 Y 1 B ARG 179 ? B ARG 179 
10  1 Y 1 H ALA 127 ? C ALA 133 
11  1 Y 1 H PRO 128 ? C PRO 134 
12  1 Y 1 H SER 129 ? C SER 135 
13  1 Y 1 H SER 130 ? C SER 136 
14  1 Y 1 H LYS 131 ? C LYS 137 
15  1 Y 1 H SER 132 ? C SER 138 
16  1 Y 1 H THR 133 ? C THR 139 
17  1 Y 1 H SER 134 ? C SER 140 
18  1 Y 1 H GLY 135 ? C GLY 141 
19  1 Y 1 H GLY 136 ? C GLY 142 
20  1 Y 1 H THR 137 ? C THR 143 
21  1 Y 1 H ALA 138 ? C ALA 144 
22  1 Y 1 H ALA 139 ? C ALA 145 
23  1 Y 1 H LEU 140 ? C LEU 146 
24  1 Y 1 H VAL 160 ? C VAL 160 
25  1 Y 1 H SER 161 ? C SER 161 
26  1 Y 1 H TRP 162 ? C TRP 162 
27  1 Y 1 H ASN 163 ? C ASN 163 
28  1 Y 1 H SER 164 ? C SER 164 
29  1 Y 1 H GLY 165 ? C GLY 165 
30  1 Y 1 H ALA 166 ? C ALA 166 
31  1 Y 1 H LEU 167 ? C LEU 167 
32  1 Y 1 H THR 168 ? C THR 168 
33  1 Y 1 H SER 169 ? C SER 169 
34  1 Y 1 H GLY 170 ? C GLY 170 
35  1 Y 1 H VAL 171 ? C VAL 171 
36  1 Y 1 H HIS 172 ? C HIS 172 
37  1 Y 1 H SER 189 ? C SER 188 
38  1 Y 1 H VAL 190 ? C VAL 189 
39  1 Y 1 H VAL 191 ? C VAL 190 
40  1 Y 1 H THR 192 ? C THR 191 
41  1 Y 1 H VAL 193 ? C VAL 192 
42  1 Y 1 H PRO 194 ? C PRO 193 
43  1 Y 1 H SER 195 ? C SER 194 
44  1 Y 1 H SER 196 ? C SER 195 
45  1 Y 1 H SER 197 ? C SER 196 
46  1 Y 1 H LEU 198 ? C LEU 197 
47  1 Y 1 H GLY 199 ? C GLY 198 
48  1 Y 1 H THR 200 ? C THR 199 
49  1 Y 1 H GLN 201 ? C GLN 200 
50  1 Y 1 H THR 202 ? C THR 201 
51  1 Y 1 H TYR 203 ? C TYR 202 
52  1 Y 1 H ILE 204 ? C ILE 203 
53  1 Y 1 H CYS 205 ? C CYS 204 
54  1 Y 1 H ASN 206 ? C ASN 205 
55  1 Y 1 H VAL 207 ? C VAL 206 
56  1 Y 1 H ASN 208 ? C ASN 207 
57  1 Y 1 H HIS 209 ? C HIS 208 
58  1 Y 1 H LYS 210 ? C LYS 209 
59  1 Y 1 H PRO 211 ? C PRO 210 
60  1 Y 1 H SER 212 ? C SER 211 
61  1 Y 1 H ASN 213 ? C ASN 212 
62  1 Y 1 H THR 214 ? C THR 213 
63  1 Y 1 H LYS 215 ? C LYS 214 
64  1 Y 1 H VAL 216 ? C VAL 215 
65  1 Y 1 H ASP 217 ? C ASP 216 
66  1 Y 1 H LYS 218 ? C LYS 217 
67  1 Y 1 H ARG 219 ? C ARG 218 
68  1 Y 1 H VAL 220 ? C VAL 219 
69  1 Y 1 H GLU 221 ? C GLU 220 
70  1 Y 1 H PRO 222 ? C PRO 221 
71  1 Y 1 H LYS 223 ? C LYS 222 
72  1 Y 1 H SER 224 ? C SER 223 
73  1 Y 1 H CYS 225 ? C CYS 224 
74  1 Y 1 H ASP 226 ? C ASP 225 
75  1 Y 1 H LYS 227 ? C LYS 226 
76  1 Y 1 L GLN 1   ? D GLN 1   
77  1 Y 1 L SER 2   ? D SER 2   
78  1 Y 1 L GLY 106 B D GLY 112 
79  1 Y 1 L ALA 106 C D ALA 113 
80  1 Y 1 L ALA 106 D D ALA 114 
81  1 Y 1 L ALA 106 E D ALA 115 
82  1 Y 1 L GLY 106 F D GLY 116 
83  1 Y 1 L GLN 106 G D GLN 117 
84  1 Y 1 L PRO 106 H D PRO 118 
85  1 Y 1 L LYS 106 I D LYS 119 
86  1 Y 1 L ALA 106 J D ALA 120 
87  1 Y 1 L ALA 106 K D ALA 121 
88  1 Y 1 L PRO 106 L D PRO 122 
89  1 Y 1 L SER 106 M D SER 123 
90  1 Y 1 L VAL 106 N D VAL 124 
91  1 Y 1 L THR 106 O D THR 125 
92  1 Y 1 L LEU 106 P D LEU 126 
93  1 Y 1 L PHE 106 Q D PHE 127 
94  1 Y 1 L PRO 106 R D PRO 128 
95  1 Y 1 L PRO 106 S D PRO 129 
96  1 Y 1 L SER 106 T D SER 130 
97  1 Y 1 L SER 106 U D SER 131 
98  1 Y 1 L PRO 141 ? D PRO 150 
99  1 Y 1 L GLY 142 ? D GLY 151 
100 1 Y 1 L ALA 143 ? D ALA 152 
101 1 Y 1 L VAL 144 ? D VAL 153 
102 1 Y 1 L THR 145 ? D THR 154 
103 1 Y 1 L VAL 146 ? D VAL 155 
104 1 Y 1 L ALA 147 ? D ALA 156 
105 1 Y 1 L TRP 148 ? D TRP 157 
106 1 Y 1 L LYS 149 ? D LYS 158 
107 1 Y 1 L ALA 150 ? D ALA 159 
108 1 Y 1 L ASP 151 ? D ASP 160 
109 1 Y 1 L SER 152 ? D SER 161 
110 1 Y 1 L SER 153 ? D SER 162 
111 1 Y 1 L PRO 154 ? D PRO 163 
112 1 Y 1 L VAL 155 ? D VAL 164 
113 1 Y 1 L LYS 156 ? D LYS 165 
114 1 Y 1 L ALA 157 ? D ALA 166 
115 1 Y 1 L LEU 181 ? D LEU 189 
116 1 Y 1 L THR 182 ? D THR 190 
117 1 Y 1 L PRO 183 ? D PRO 191 
118 1 Y 1 L GLU 184 ? D GLU 192 
119 1 Y 1 L GLN 185 ? D GLN 193 
120 1 Y 1 L TRP 186 ? D TRP 194 
121 1 Y 1 L LYS 187 ? D LYS 195 
122 1 Y 1 L SER 188 ? D SER 196 
123 1 Y 1 L HIS 189 ? D HIS 197 
124 1 Y 1 L ARG 190 ? D ARG 198 
125 1 Y 1 L SER 191 ? D SER 199 
126 1 Y 1 L TYR 192 ? D TYR 200 
127 1 Y 1 L SER 193 ? D SER 201 
128 1 Y 1 L VAL 196 ? D VAL 204 
129 1 Y 1 L THR 197 ? D THR 205 
130 1 Y 1 L HIS 198 ? D HIS 206 
131 1 Y 1 L GLU 199 ? D GLU 207 
132 1 Y 1 L GLY 200 ? D GLY 208 
133 1 Y 1 L SER 201 ? D SER 209 
134 1 Y 1 L THR 202 ? D THR 210 
135 1 Y 1 L VAL 203 ? D VAL 211 
136 1 Y 1 L GLU 204 ? D GLU 212 
137 1 Y 1 L LYS 205 ? D LYS 213 
138 1 Y 1 L THR 206 ? D THR 214 
139 1 Y 1 L VAL 207 ? D VAL 215 
140 1 Y 1 L ALA 208 ? D ALA 216 
141 1 Y 1 L PRO 209 ? D PRO 217 
142 1 Y 1 L THR 210 ? D THR 218 
143 1 Y 1 L GLU 211 ? D GLU 219 
144 1 Y 1 L CYS 212 ? D CYS 220 
145 1 Y 1 L SER 213 ? D SER 221 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
E 5 NAG 1 C NAG 1 X NAG 1 n 
E 5 NAG 2 C NAG 2 X NAG 2 n 
E 5 BMA 3 C BMA 3 X BMA 3 n 
E 5 MAN 4 C MAN 4 X MAN 4 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
BMA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DManpb                         
BMA 'COMMON NAME'                         GMML     1.0 b-D-mannopyranose              
BMA 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Manp                       
BMA 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Man                            
MAN 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DManpa                         
MAN 'COMMON NAME'                         GMML     1.0 a-D-mannopyranose              
MAN 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-Manp                       
MAN 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Man                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   5 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 5 DManpa1-3DManpb1-4DGlcpNAcb1-4DGlcpNAcb1-                                                           
'Glycam Condensed Sequence' GMML       1.0   
2 5 'WURCS=2.0/3,4,3/[a2122h-1b_1-5_2*NCC/3=O][a1122h-1b_1-5][a1122h-1a_1-5]/1-1-2-3/a4-b1_b4-c1_c3-d1' WURCS PDB2Glycan 1.1.0 
3 5 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-Manp]{[(3+1)][a-D-Manp]{}}}}}'            LINUCS PDB-CARE   ?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 5 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
2 5 3 BMA C1 O1 2 NAG O4 HO4 sing ? 
3 5 4 MAN C1 O1 3 BMA O3 HO3 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
5 NAG 1 n 
5 NAG 2 n 
5 BMA 3 n 
5 MAN 4 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
6  2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
7  1,2-ETHANEDIOL                           EDO 
8  GLYCEROL                                 GOL 
9  2-ETHOXYETHANOL                          ETX 
10 'CHLORIDE ION'                           CL  
11 'UNKNOWN LIGAND'                         UNL 
12 water                                    HOH 
#