data_3GGE
# 
_entry.id   3GGE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.289 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3GGE         
RCSB  RCSB051826   
WWPDB D_1000051826 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3GGE 
_pdbx_database_status.recvd_initial_deposition_date   2009-02-27 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chaikuad, A.'                         1  
'Hozjan, V.'                           2  
'Yue, W.'                              3  
'Cooper, C.'                           4  
'Elkins, J.'                           5  
'Pike, A.C.W.'                         6  
'Roos, A.K.'                           7  
'Filippakopoulos, P.'                  8  
'von Delft, F.'                        9  
'Arrowsmith, C.H.'                     10 
'Edwards, A.M.'                        11 
'Weigelt, J.'                          12 
'Bountra, C.'                          13 
'Oppermann, U.'                        14 
'Structural Genomics Consortium (SGC)' 15 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of the PDZ domain of PDZ domain-containing protein GIPC2' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chaikuad, A.'        1  
primary 'Hozjan, V.'          2  
primary 'Yue, W.'             3  
primary 'Cooper, C.'          4  
primary 'Elkins, J.'          5  
primary 'Pike, A.C.W.'        6  
primary 'Roos, A.K.'          7  
primary 'Filippakopoulos, P.' 8  
primary 'von Delft, F.'       9  
primary 'Arrowsmith, C.H.'    10 
primary 'Edwards, A.M.'       11 
primary 'Weigelt, J.'         12 
primary 'Bountra, C.'         13 
primary 'Oppermann, U.'       14 
# 
_cell.entry_id           3GGE 
_cell.length_a           83.510 
_cell.length_b           83.510 
_cell.length_c           160.310 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3GGE 
_symmetry.space_group_name_H-M             'P 41 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                91 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PDZ domain-containing protein GIPC2' 10632.248 3   ? ? 'PDZ domain' ? 
2 non-polymer syn 'SULFATE ION'                         96.063    2   ? ? ?            ? 
3 non-polymer syn GLYCEROL                              92.094    1   ? ? ?            ? 
4 water       nat water                                 18.015    107 ? ? ?            ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMKGIEKEVNVYKSEDSLGLTITDNGVGYAFIKRIKDGGVIDSVKTICVGDHIESINGENIVGWRHYDVAKKLKELKKEE
LFTMKLIEPKKSSEA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMKGIEKEVNVYKSEDSLGLTITDNGVGYAFIKRIKDGGVIDSVKTICVGDHIESINGENIVGWRHYDVAKKLKELKKEE
LFTMKLIEPKKSSEA
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  SER n 
1 2  MET n 
1 3  LYS n 
1 4  GLY n 
1 5  ILE n 
1 6  GLU n 
1 7  LYS n 
1 8  GLU n 
1 9  VAL n 
1 10 ASN n 
1 11 VAL n 
1 12 TYR n 
1 13 LYS n 
1 14 SER n 
1 15 GLU n 
1 16 ASP n 
1 17 SER n 
1 18 LEU n 
1 19 GLY n 
1 20 LEU n 
1 21 THR n 
1 22 ILE n 
1 23 THR n 
1 24 ASP n 
1 25 ASN n 
1 26 GLY n 
1 27 VAL n 
1 28 GLY n 
1 29 TYR n 
1 30 ALA n 
1 31 PHE n 
1 32 ILE n 
1 33 LYS n 
1 34 ARG n 
1 35 ILE n 
1 36 LYS n 
1 37 ASP n 
1 38 GLY n 
1 39 GLY n 
1 40 VAL n 
1 41 ILE n 
1 42 ASP n 
1 43 SER n 
1 44 VAL n 
1 45 LYS n 
1 46 THR n 
1 47 ILE n 
1 48 CYS n 
1 49 VAL n 
1 50 GLY n 
1 51 ASP n 
1 52 HIS n 
1 53 ILE n 
1 54 GLU n 
1 55 SER n 
1 56 ILE n 
1 57 ASN n 
1 58 GLY n 
1 59 GLU n 
1 60 ASN n 
1 61 ILE n 
1 62 VAL n 
1 63 GLY n 
1 64 TRP n 
1 65 ARG n 
1 66 HIS n 
1 67 TYR n 
1 68 ASP n 
1 69 VAL n 
1 70 ALA n 
1 71 LYS n 
1 72 LYS n 
1 73 LEU n 
1 74 LYS n 
1 75 GLU n 
1 76 LEU n 
1 77 LYS n 
1 78 LYS n 
1 79 GLU n 
1 80 GLU n 
1 81 LEU n 
1 82 PHE n 
1 83 THR n 
1 84 MET n 
1 85 LYS n 
1 86 LEU n 
1 87 ILE n 
1 88 GLU n 
1 89 PRO n 
1 90 LYS n 
1 91 LYS n 
1 92 SER n 
1 93 SER n 
1 94 GLU n 
1 95 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 GIPC2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-R3-pRARE2' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNIC28-Bsa4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GIPC2_HUMAN 
_struct_ref.pdbx_db_accession          Q8TF65 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;KGIEKEVNVYKSEDSLGLTITDNGVGYAFIKRIKDGGVIDSVKTICVGDHIESINGENIVGWRHYDVAKKLKELKKEELF
TMKLIEPKK
;
_struct_ref.pdbx_align_begin           112 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3GGE A 3 ? 91 ? Q8TF65 112 ? 200 ? 112 200 
2 1 3GGE B 3 ? 91 ? Q8TF65 112 ? 200 ? 112 200 
3 1 3GGE C 3 ? 91 ? Q8TF65 112 ? 200 ? 112 200 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3GGE SER A 1  ? UNP Q8TF65 ? ? 'EXPRESSION TAG' -1  1  
1 3GGE MET A 2  ? UNP Q8TF65 ? ? 'EXPRESSION TAG' 0   2  
1 3GGE SER A 92 ? UNP Q8TF65 ? ? 'EXPRESSION TAG' 201 3  
1 3GGE SER A 93 ? UNP Q8TF65 ? ? 'EXPRESSION TAG' 202 4  
1 3GGE GLU A 94 ? UNP Q8TF65 ? ? 'EXPRESSION TAG' 203 5  
1 3GGE ALA A 95 ? UNP Q8TF65 ? ? 'EXPRESSION TAG' 204 6  
2 3GGE SER B 1  ? UNP Q8TF65 ? ? 'EXPRESSION TAG' 110 7  
2 3GGE MET B 2  ? UNP Q8TF65 ? ? 'EXPRESSION TAG' 111 8  
2 3GGE SER B 92 ? UNP Q8TF65 ? ? 'EXPRESSION TAG' 201 9  
2 3GGE SER B 93 ? UNP Q8TF65 ? ? 'EXPRESSION TAG' 202 10 
2 3GGE GLU B 94 ? UNP Q8TF65 ? ? 'EXPRESSION TAG' 203 11 
2 3GGE ALA B 95 ? UNP Q8TF65 ? ? 'EXPRESSION TAG' 204 12 
3 3GGE SER C 1  ? UNP Q8TF65 ? ? 'EXPRESSION TAG' -1  13 
3 3GGE MET C 2  ? UNP Q8TF65 ? ? 'EXPRESSION TAG' 0   14 
3 3GGE SER C 92 ? UNP Q8TF65 ? ? 'EXPRESSION TAG' 201 15 
3 3GGE SER C 93 ? UNP Q8TF65 ? ? 'EXPRESSION TAG' 202 16 
3 3GGE GLU C 94 ? UNP Q8TF65 ? ? 'EXPRESSION TAG' 203 17 
3 3GGE ALA C 95 ? UNP Q8TF65 ? ? 'EXPRESSION TAG' 204 18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ?                               'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3GGE 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.38 
_exptl_crystal.density_percent_sol   71.93 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'2M ammonium sulfate; 2.5% v/v propanol; , pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277.15K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MAR225 CCD' 
_diffrn_detector.pdbx_collection_date   2009-01-30 
_diffrn_detector.details                'Dynamically bendable mirror' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    
;LN2 cooled fixed-exit 
Si(111) monochromator
;
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.8800 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.8800 
# 
_reflns.entry_id                     3GGE 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             55.37 
_reflns.d_resolution_high            2.60 
_reflns.number_obs                   18077 
_reflns.number_all                   18077 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.112 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.3 
_reflns.B_iso_Wilson_estimate        59.3 
_reflns.pdbx_redundancy              6.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.60 
_reflns_shell.d_res_low              2.74 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.767 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.5 
_reflns_shell.pdbx_redundancy        6.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2566 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3GGE 
_refine.ls_number_reflns_obs                     17111 
_refine.ls_number_reflns_all                     18031 
_refine.pdbx_ls_sigma_I                          20. 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             41.76 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    99.28 
_refine.ls_R_factor_obs                          0.22504 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.22302 
_refine.ls_R_factor_R_free                       0.26456 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  920 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.926 
_refine.correlation_coeff_Fo_to_Fc_free          0.892 
_refine.B_iso_mean                               15.202 
_refine.aniso_B[1][1]                            0.31 
_refine.aniso_B[2][2]                            0.31 
_refine.aniso_B[3][3]                            -0.61 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1KWA' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.322 
_refine.pdbx_overall_ESU_R_Free                  0.258 
_refine.overall_SU_ML                            0.194 
_refine.overall_SU_B                             17.837 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3GGE 
_refine_analyze.Luzzati_coordinate_error_obs    0.446 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2199 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         16 
_refine_hist.number_atoms_solvent             107 
_refine_hist.number_atoms_total               2322 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        41.76 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       0.015  0.022  ? 2239 'X-RAY DIFFRACTION' ? 
r_bond_other_d         0.002  0.020  ? 1553 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    1.458  1.981  ? 2996 'X-RAY DIFFRACTION' ? 
r_angle_other_deg      0.902  3.000  ? 3838 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 6.449  5.000  ? 279  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 36.346 26.000 ? 90   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 16.468 15.000 ? 456  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 13.499 15.000 ? 6    'X-RAY DIFFRACTION' ? 
r_chiral_restr         0.097  0.200  ? 339  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   0.005  0.020  ? 2406 'X-RAY DIFFRACTION' ? 
r_gen_planes_other     0.003  0.020  ? 393  'X-RAY DIFFRACTION' ? 
r_mcbond_it            0.505  1.500  ? 1383 'X-RAY DIFFRACTION' ? 
r_mcbond_other         0.113  1.500  ? 585  'X-RAY DIFFRACTION' ? 
r_mcangle_it           1.068  2.000  ? 2232 'X-RAY DIFFRACTION' ? 
r_scbond_it            1.835  3.000  ? 856  'X-RAY DIFFRACTION' ? 
r_scangle_it           3.245  4.500  ? 764  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 223 0.06 0.05  'tight positional'  1 1  'X-RAY DIFFRACTION' ? ? ? 
2 B 223 0.05 0.05  'tight positional'  1 2  'X-RAY DIFFRACTION' ? ? ? 
3 C 223 0.05 0.05  'tight positional'  1 3  'X-RAY DIFFRACTION' ? ? ? 
1 A 403 0.05 0.05  'tight positional'  3 4  'X-RAY DIFFRACTION' ? ? ? 
2 B 403 0.04 0.05  'tight positional'  3 5  'X-RAY DIFFRACTION' ? ? ? 
3 C 403 0.06 0.05  'tight positional'  3 6  'X-RAY DIFFRACTION' ? ? ? 
1 A 53  0.04 0.05  'tight positional'  4 7  'X-RAY DIFFRACTION' ? ? ? 
2 B 53  0.03 0.05  'tight positional'  4 8  'X-RAY DIFFRACTION' ? ? ? 
3 C 53  0.05 0.05  'tight positional'  4 9  'X-RAY DIFFRACTION' ? ? ? 
1 A 221 0.05 0.05  'tight positional'  5 10 'X-RAY DIFFRACTION' ? ? ? 
2 B 221 0.04 0.05  'tight positional'  5 11 'X-RAY DIFFRACTION' ? ? ? 
3 C 221 0.04 0.05  'tight positional'  5 12 'X-RAY DIFFRACTION' ? ? ? 
1 A 34  0.71 0.50  'medium positional' 2 13 'X-RAY DIFFRACTION' ? ? ? 
2 B 34  0.41 0.50  'medium positional' 2 14 'X-RAY DIFFRACTION' ? ? ? 
3 C 34  0.50 0.50  'medium positional' 2 15 'X-RAY DIFFRACTION' ? ? ? 
1 A 86  0.07 0.50  'medium positional' 4 16 'X-RAY DIFFRACTION' ? ? ? 
2 B 86  0.03 0.50  'medium positional' 4 17 'X-RAY DIFFRACTION' ? ? ? 
3 C 86  0.07 0.50  'medium positional' 4 18 'X-RAY DIFFRACTION' ? ? ? 
1 A 34  1.85 5.00  'loose positional'  2 19 'X-RAY DIFFRACTION' ? ? ? 
2 B 34  1.85 5.00  'loose positional'  2 20 'X-RAY DIFFRACTION' ? ? ? 
3 C 34  1.48 5.00  'loose positional'  2 21 'X-RAY DIFFRACTION' ? ? ? 
1 A 223 0.10 0.50  'tight thermal'     1 22 'X-RAY DIFFRACTION' ? ? ? 
2 B 223 0.10 0.50  'tight thermal'     1 23 'X-RAY DIFFRACTION' ? ? ? 
3 C 223 0.11 0.50  'tight thermal'     1 24 'X-RAY DIFFRACTION' ? ? ? 
1 A 403 0.10 0.50  'tight thermal'     3 25 'X-RAY DIFFRACTION' ? ? ? 
2 B 403 0.09 0.50  'tight thermal'     3 26 'X-RAY DIFFRACTION' ? ? ? 
3 C 403 0.10 0.50  'tight thermal'     3 27 'X-RAY DIFFRACTION' ? ? ? 
1 A 53  0.13 0.50  'tight thermal'     4 28 'X-RAY DIFFRACTION' ? ? ? 
2 B 53  0.12 0.50  'tight thermal'     4 29 'X-RAY DIFFRACTION' ? ? ? 
3 C 53  0.09 0.50  'tight thermal'     4 30 'X-RAY DIFFRACTION' ? ? ? 
1 A 221 0.11 0.50  'tight thermal'     5 31 'X-RAY DIFFRACTION' ? ? ? 
2 B 221 0.12 0.50  'tight thermal'     5 32 'X-RAY DIFFRACTION' ? ? ? 
3 C 221 0.09 0.50  'tight thermal'     5 33 'X-RAY DIFFRACTION' ? ? ? 
1 A 34  0.25 2.00  'medium thermal'    2 34 'X-RAY DIFFRACTION' ? ? ? 
2 B 34  0.65 2.00  'medium thermal'    2 35 'X-RAY DIFFRACTION' ? ? ? 
3 C 34  0.65 2.00  'medium thermal'    2 36 'X-RAY DIFFRACTION' ? ? ? 
1 A 86  0.13 2.00  'medium thermal'    4 37 'X-RAY DIFFRACTION' ? ? ? 
2 B 86  0.11 2.00  'medium thermal'    4 38 'X-RAY DIFFRACTION' ? ? ? 
3 C 86  0.08 2.00  'medium thermal'    4 39 'X-RAY DIFFRACTION' ? ? ? 
1 A 34  1.31 10.00 'loose thermal'     2 40 'X-RAY DIFFRACTION' ? ? ? 
2 B 34  0.54 10.00 'loose thermal'     2 41 'X-RAY DIFFRACTION' ? ? ? 
3 C 34  1.32 10.00 'loose thermal'     2 42 'X-RAY DIFFRACTION' ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.600 
_refine_ls_shell.d_res_low                        2.668 
_refine_ls_shell.number_reflns_R_work             1119 
_refine_ls_shell.R_factor_R_work                  0.377 
_refine_ls_shell.percent_reflns_obs               90.11 
_refine_ls_shell.R_factor_R_free                  0.403 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             56 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 B 1 
2 A 1 
3 C 1 
1 C 2 
2 B 2 
3 A 2 
1 C 3 
2 A 3 
3 B 3 
1 B 4 
2 A 4 
3 C 4 
1 B 5 
2 A 5 
3 C 5 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
1 1 1 B 116 B 131 1 . . . . B 116 B 131 ? 
1 2 1 A 116 A 131 1 . . . . A 116 A 131 ? 
1 3 1 C 116 C 131 1 . . . . C 116 C 131 ? 
2 1 1 C 133 C 138 5 . . . . C 133 C 138 ? 
2 2 1 B 133 B 138 5 . . . . B 133 B 138 ? 
2 3 1 A 133 A 138 5 . . . . A 133 A 138 ? 
3 1 1 C 139 C 170 1 . . . . C 139 C 170 ? 
3 2 1 A 139 A 170 1 . . . . A 139 A 170 ? 
3 3 1 B 139 B 170 1 . . . . B 139 B 170 ? 
4 1 1 B 172 B 180 2 . . . . B 172 B 180 ? 
4 2 1 A 172 A 180 2 . . . . A 172 A 180 ? 
4 3 1 C 172 C 180 2 . . . . C 172 C 180 ? 
5 1 1 B 181 B 195 1 . . . . B 181 B 195 ? 
5 2 1 A 181 A 195 1 . . . . A 181 A 195 ? 
5 3 1 C 181 C 195 1 . . . . C 181 C 195 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
4 ? 
5 ? 
# 
_struct.entry_id                  3GGE 
_struct.title                     'Crystal structure of the PDZ domain of PDZ domain-containing protein GIPC2' 
_struct.pdbx_descriptor           'PDZ domain-containing protein GIPC2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3GGE 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            'PDZ domain, Structural Genomics, Structural Genomics Consortium, SGC, PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 39 ? VAL A 44 ? GLY A 148 VAL A 153 1 ? 6  
HELX_P HELX_P2 2 ARG A 65 ? LEU A 76 ? ARG A 174 LEU A 185 1 ? 12 
HELX_P HELX_P3 3 ARG B 65 ? LEU B 76 ? ARG B 174 LEU B 185 1 ? 12 
HELX_P HELX_P4 4 GLY C 39 ? VAL C 44 ? GLY C 148 VAL C 153 1 ? 6  
HELX_P HELX_P5 5 ARG C 65 ? LEU C 76 ? ARG C 174 LEU C 185 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           1 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            -1 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   MET 
_struct_mon_prot_cis.pdbx_label_seq_id_2    2 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    MET 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     0 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       12.98 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 3 ? 
C ? 3 ? 
D ? 4 ? 
E ? 2 ? 
F ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 4  ? TYR A 12 ? GLY A 113 TYR A 121 
A 2 LEU A 81 ? PRO A 89 ? LEU A 190 PRO A 198 
A 3 HIS A 52 ? ILE A 56 ? HIS A 161 ILE A 165 
A 4 GLU A 59 ? ASN A 60 ? GLU A 168 ASN A 169 
B 1 PHE A 31 ? ILE A 35 ? PHE A 140 ILE A 144 
B 2 LEU A 20 ? THR A 23 ? LEU A 129 THR A 132 
B 3 SER B 93 ? ALA B 95 ? SER B 202 ALA B 204 
C 1 SER A 93 ? GLU A 94 ? SER A 202 GLU A 203 
C 2 LEU C 20 ? THR C 23 ? LEU C 129 THR C 132 
C 3 PHE C 31 ? ILE C 35 ? PHE C 140 ILE C 144 
D 1 GLU B 6  ? LYS B 13 ? GLU B 115 LYS B 122 
D 2 GLU B 80 ? ILE B 87 ? GLU B 189 ILE B 196 
D 3 HIS B 52 ? ILE B 56 ? HIS B 161 ILE B 165 
D 4 GLU B 59 ? ASN B 60 ? GLU B 168 ASN B 169 
E 1 LEU B 20 ? THR B 23 ? LEU B 129 THR B 132 
E 2 PHE B 31 ? ILE B 35 ? PHE B 140 ILE B 144 
F 1 GLY C 4  ? TYR C 12 ? GLY C 113 TYR C 121 
F 2 LEU C 81 ? PRO C 89 ? LEU C 190 PRO C 198 
F 3 HIS C 52 ? ILE C 56 ? HIS C 161 ILE C 165 
F 4 GLU C 59 ? ASN C 60 ? GLU C 168 ASN C 169 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 11 ? N VAL A 120 O PHE A 82 ? O PHE A 191 
A 2 3 O ILE A 87 ? O ILE A 196 N HIS A 52 ? N HIS A 161 
A 3 4 N ILE A 56 ? N ILE A 165 O GLU A 59 ? O GLU A 168 
B 1 2 O PHE A 31 ? O PHE A 140 N THR A 23 ? N THR A 132 
B 2 3 N LEU A 20 ? N LEU A 129 O ALA B 95 ? O ALA B 204 
C 1 2 N SER A 93 ? N SER A 202 O ILE C 22 ? O ILE C 131 
C 2 3 N THR C 23 ? N THR C 132 O PHE C 31 ? O PHE C 140 
D 1 2 N VAL B 9  ? N VAL B 118 O MET B 84 ? O MET B 193 
D 2 3 O ILE B 87 ? O ILE B 196 N HIS B 52 ? N HIS B 161 
D 3 4 N ILE B 56 ? N ILE B 165 O GLU B 59 ? O GLU B 168 
E 1 2 N THR B 21 ? N THR B 130 O LYS B 33 ? O LYS B 142 
F 1 2 N ILE C 5  ? N ILE C 114 O GLU C 88 ? O GLU C 197 
F 2 3 O ILE C 87 ? O ILE C 196 N HIS C 52 ? N HIS C 161 
F 3 4 N ILE C 56 ? N ILE C 165 O GLU C 59 ? O GLU C 168 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 B 1' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 B 2' 
AC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE GOL B 3' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 GLU B 59 ? GLU B 168 . ? 1_555 ? 
2  AC1 7 TRP B 64 ? TRP B 173 . ? 1_555 ? 
3  AC1 7 LYS B 71 ? LYS B 180 . ? 8_665 ? 
4  AC1 7 LYS B 72 ? LYS B 181 . ? 1_555 ? 
5  AC1 7 SER C 1  ? SER C -1  . ? 1_555 ? 
6  AC1 7 MET C 2  ? MET C 0   . ? 1_555 ? 
7  AC1 7 LYS C 3  ? LYS C 112 . ? 1_555 ? 
8  AC2 3 HIS B 52 ? HIS B 161 . ? 1_555 ? 
9  AC2 3 PRO B 89 ? PRO B 198 . ? 1_555 ? 
10 AC2 3 LYS B 90 ? LYS B 199 . ? 1_555 ? 
11 AC3 7 ASN B 60 ? ASN B 169 . ? 1_555 ? 
12 AC3 7 VAL B 62 ? VAL B 171 . ? 1_555 ? 
13 AC3 7 TRP B 64 ? TRP B 173 . ? 1_555 ? 
14 AC3 7 SER C 1  ? SER C -1  . ? 1_555 ? 
15 AC3 7 LYS C 3  ? LYS C 112 . ? 1_555 ? 
16 AC3 7 GLY C 4  ? GLY C 113 . ? 1_555 ? 
17 AC3 7 ILE C 87 ? ILE C 196 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3GGE 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3GGE 
_atom_sites.fract_transf_matrix[1][1]   0.011975 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011975 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006238 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 1  ? 25.417  40.110 0.520   1.00 34.65 ? -1  SER A N   1 
ATOM   2    C CA  . SER A 1 1  ? 24.001  40.290 0.059   1.00 34.98 ? -1  SER A CA  1 
ATOM   3    C C   . SER A 1 1  ? 23.036  39.285 0.744   1.00 35.00 ? -1  SER A C   1 
ATOM   4    O O   . SER A 1 1  ? 22.473  38.426 0.047   1.00 35.25 ? -1  SER A O   1 
ATOM   5    C CB  . SER A 1 1  ? 23.918  40.106 -1.477  1.00 35.05 ? -1  SER A CB  1 
ATOM   6    O OG  . SER A 1 1  ? 24.846  40.919 -2.184  1.00 34.72 ? -1  SER A OG  1 
ATOM   7    N N   . MET A 1 2  ? 22.785  39.387 2.062   1.00 34.69 ? 0   MET A N   1 
ATOM   8    C CA  . MET A 1 2  ? 23.132  40.550 2.927   1.00 34.32 ? 0   MET A CA  1 
ATOM   9    C C   . MET A 1 2  ? 24.537  40.505 3.537   1.00 33.69 ? 0   MET A C   1 
ATOM   10   O O   . MET A 1 2  ? 25.011  39.438 3.935   1.00 34.04 ? 0   MET A O   1 
ATOM   11   C CB  . MET A 1 2  ? 22.129  40.650 4.088   1.00 34.49 ? 0   MET A CB  1 
ATOM   12   C CG  . MET A 1 2  ? 22.107  42.009 4.823   1.00 34.17 ? 0   MET A CG  1 
ATOM   13   S SD  . MET A 1 2  ? 21.703  41.877 6.582   1.00 33.78 ? 0   MET A SD  1 
ATOM   14   C CE  . MET A 1 2  ? 20.200  40.895 6.583   1.00 32.23 ? 0   MET A CE  1 
ATOM   15   N N   . LYS A 1 3  ? 25.155  41.680 3.661   1.00 32.60 ? 112 LYS A N   1 
ATOM   16   C CA  . LYS A 1 3  ? 26.572  41.818 4.009   1.00 31.99 ? 112 LYS A CA  1 
ATOM   17   C C   . LYS A 1 3  ? 26.770  42.015 5.520   1.00 30.98 ? 112 LYS A C   1 
ATOM   18   O O   . LYS A 1 3  ? 25.945  42.661 6.181   1.00 31.12 ? 112 LYS A O   1 
ATOM   19   C CB  . LYS A 1 3  ? 27.142  43.008 3.221   1.00 32.37 ? 112 LYS A CB  1 
ATOM   20   C CG  . LYS A 1 3  ? 28.664  43.050 3.065   1.00 33.51 ? 112 LYS A CG  1 
ATOM   21   C CD  . LYS A 1 3  ? 29.074  43.780 1.776   1.00 34.55 ? 112 LYS A CD  1 
ATOM   22   C CE  . LYS A 1 3  ? 30.475  44.412 1.867   1.00 35.74 ? 112 LYS A CE  1 
ATOM   23   N NZ  . LYS A 1 3  ? 31.534  43.492 2.397   1.00 36.13 ? 112 LYS A NZ  1 
ATOM   24   N N   . GLY A 1 4  ? 27.864  41.463 6.057   1.00 29.46 ? 113 GLY A N   1 
ATOM   25   C CA  . GLY A 1 4  ? 28.168  41.525 7.497   1.00 27.79 ? 113 GLY A CA  1 
ATOM   26   C C   . GLY A 1 4  ? 28.751  40.231 8.046   1.00 26.45 ? 113 GLY A C   1 
ATOM   27   O O   . GLY A 1 4  ? 28.839  39.241 7.337   1.00 25.92 ? 113 GLY A O   1 
ATOM   28   N N   . ILE A 1 5  ? 29.135  40.247 9.322   1.00 25.07 ? 114 ILE A N   1 
ATOM   29   C CA  . ILE A 1 5  ? 29.706  39.073 10.020  1.00 24.15 ? 114 ILE A CA  1 
ATOM   30   C C   . ILE A 1 5  ? 28.713  37.891 10.137  1.00 23.04 ? 114 ILE A C   1 
ATOM   31   O O   . ILE A 1 5  ? 27.827  37.973 10.970  1.00 23.13 ? 114 ILE A O   1 
ATOM   32   C CB  . ILE A 1 5  ? 30.090  39.489 11.477  1.00 24.08 ? 114 ILE A CB  1 
ATOM   33   C CG1 . ILE A 1 5  ? 31.254  40.475 11.491  1.00 24.12 ? 114 ILE A CG1 1 
ATOM   34   C CG2 . ILE A 1 5  ? 30.456  38.293 12.313  1.00 24.25 ? 114 ILE A CG2 1 
ATOM   35   C CD1 . ILE A 1 5  ? 32.570  39.874 11.044  1.00 25.16 ? 114 ILE A CD1 1 
ATOM   36   N N   . GLU A 1 6  ? 28.846  36.824 9.329   1.00 21.71 ? 115 GLU A N   1 
ATOM   37   C CA  . GLU A 1 6  ? 27.970  35.621 9.418   1.00 21.74 ? 115 GLU A CA  1 
ATOM   38   C C   . GLU A 1 6  ? 28.397  34.732 10.606  1.00 21.04 ? 115 GLU A C   1 
ATOM   39   O O   . GLU A 1 6  ? 29.583  34.560 10.850  1.00 20.87 ? 115 GLU A O   1 
ATOM   40   C CB  . GLU A 1 6  ? 28.010  34.811 8.101   1.00 22.15 ? 115 GLU A CB  1 
ATOM   41   C CG  . GLU A 1 6  ? 27.030  33.599 8.013   1.00 25.29 ? 115 GLU A CG  1 
ATOM   42   C CD  . GLU A 1 6  ? 27.000  32.937 6.596   1.00 29.36 ? 115 GLU A CD  1 
ATOM   43   O OE1 . GLU A 1 6  ? 27.494  31.791 6.456   1.00 31.82 ? 115 GLU A OE1 1 
ATOM   44   O OE2 . GLU A 1 6  ? 26.488  33.566 5.628   1.00 31.29 ? 115 GLU A OE2 1 
ATOM   45   N N   . LYS A 1 7  ? 27.435  34.182 11.355  1.00 20.36 ? 116 LYS A N   1 
ATOM   46   C CA  . LYS A 1 7  ? 27.727  33.293 12.492  1.00 19.59 ? 116 LYS A CA  1 
ATOM   47   C C   . LYS A 1 7  ? 26.899  32.058 12.387  1.00 19.19 ? 116 LYS A C   1 
ATOM   48   O O   . LYS A 1 7  ? 25.725  32.147 12.034  1.00 19.30 ? 116 LYS A O   1 
ATOM   49   C CB  . LYS A 1 7  ? 27.283  33.925 13.799  1.00 19.50 ? 116 LYS A CB  1 
ATOM   50   C CG  . LYS A 1 7  ? 27.862  35.276 14.073  1.00 20.36 ? 116 LYS A CG  1 
ATOM   51   C CD  . LYS A 1 7  ? 27.506  35.778 15.487  1.00 20.26 ? 116 LYS A CD  1 
ATOM   52   C CE  . LYS A 1 7  ? 26.102  36.399 15.558  1.00 20.58 ? 116 LYS A CE  1 
ATOM   53   N NZ  . LYS A 1 7  ? 25.997  37.471 16.646  1.00 19.58 ? 116 LYS A NZ  1 
ATOM   54   N N   . GLU A 1 8  ? 27.464  30.916 12.767  1.00 18.78 ? 117 GLU A N   1 
ATOM   55   C CA  . GLU A 1 8  ? 26.654  29.710 12.954  1.00 18.68 ? 117 GLU A CA  1 
ATOM   56   C C   . GLU A 1 8  ? 26.532  29.290 14.433  1.00 17.69 ? 117 GLU A C   1 
ATOM   57   O O   . GLU A 1 8  ? 27.515  29.334 15.196  1.00 17.53 ? 117 GLU A O   1 
ATOM   58   C CB  . GLU A 1 8  ? 27.200  28.548 12.151  1.00 19.26 ? 117 GLU A CB  1 
ATOM   59   C CG  . GLU A 1 8  ? 26.176  27.434 12.089  1.00 23.19 ? 117 GLU A CG  1 
ATOM   60   C CD  . GLU A 1 8  ? 26.725  26.163 11.470  1.00 28.90 ? 117 GLU A CD  1 
ATOM   61   O OE1 . GLU A 1 8  ? 26.978  25.196 12.255  1.00 32.91 ? 117 GLU A OE1 1 
ATOM   62   O OE2 . GLU A 1 8  ? 26.896  26.155 10.214  1.00 31.33 ? 117 GLU A OE2 1 
ATOM   63   N N   . VAL A 1 9  ? 25.329  28.878 14.831  1.00 16.41 ? 118 VAL A N   1 
ATOM   64   C CA  . VAL A 1 9  ? 25.074  28.542 16.212  1.00 15.72 ? 118 VAL A CA  1 
ATOM   65   C C   . VAL A 1 9  ? 24.281  27.252 16.323  1.00 15.67 ? 118 VAL A C   1 
ATOM   66   O O   . VAL A 1 9  ? 23.377  27.002 15.519  1.00 15.47 ? 118 VAL A O   1 
ATOM   67   C CB  . VAL A 1 9  ? 24.313  29.671 16.896  1.00 15.60 ? 118 VAL A CB  1 
ATOM   68   C CG1 . VAL A 1 9  ? 25.080  30.953 16.755  1.00 15.06 ? 118 VAL A CG1 1 
ATOM   69   C CG2 . VAL A 1 9  ? 22.943  29.838 16.262  1.00 15.66 ? 118 VAL A CG2 1 
ATOM   70   N N   . ASN A 1 10 ? 24.625  26.436 17.326  1.00 15.44 ? 119 ASN A N   1 
ATOM   71   C CA  . ASN A 1 10 ? 23.794  25.289 17.706  1.00 15.33 ? 119 ASN A CA  1 
ATOM   72   C C   . ASN A 1 10 ? 23.022  25.611 18.972  1.00 14.62 ? 119 ASN A C   1 
ATOM   73   O O   . ASN A 1 10 ? 23.560  26.189 19.910  1.00 15.31 ? 119 ASN A O   1 
ATOM   74   C CB  . ASN A 1 10 ? 24.637  24.043 17.946  1.00 15.76 ? 119 ASN A CB  1 
ATOM   75   C CG  . ASN A 1 10 ? 25.430  23.622 16.736  1.00 17.56 ? 119 ASN A CG  1 
ATOM   76   O OD1 . ASN A 1 10 ? 24.873  23.390 15.659  1.00 22.52 ? 119 ASN A OD1 1 
ATOM   77   N ND2 . ASN A 1 10 ? 26.747  23.517 16.908  1.00 17.55 ? 119 ASN A ND2 1 
ATOM   78   N N   . VAL A 1 11 ? 21.760  25.234 19.011  1.00 13.71 ? 120 VAL A N   1 
ATOM   79   C CA  . VAL A 1 11 ? 20.959  25.522 20.172  1.00 13.76 ? 120 VAL A CA  1 
ATOM   80   C C   . VAL A 1 11 ? 20.172  24.290 20.539  1.00 13.94 ? 120 VAL A C   1 
ATOM   81   O O   . VAL A 1 11 ? 19.597  23.646 19.656  1.00 14.34 ? 120 VAL A O   1 
ATOM   82   C CB  . VAL A 1 11 ? 19.978  26.687 19.886  1.00 13.85 ? 120 VAL A CB  1 
ATOM   83   C CG1 . VAL A 1 11 ? 19.070  26.955 21.083  1.00 12.70 ? 120 VAL A CG1 1 
ATOM   84   C CG2 . VAL A 1 11 ? 20.759  27.935 19.491  1.00 12.31 ? 120 VAL A CG2 1 
ATOM   85   N N   . TYR A 1 12 ? 20.131  23.967 21.826  1.00 13.71 ? 121 TYR A N   1 
ATOM   86   C CA  . TYR A 1 12 ? 19.340  22.851 22.286  1.00 14.14 ? 121 TYR A CA  1 
ATOM   87   C C   . TYR A 1 12 ? 18.024  23.374 22.795  1.00 14.69 ? 121 TYR A C   1 
ATOM   88   O O   . TYR A 1 12 ? 17.996  24.176 23.723  1.00 15.30 ? 121 TYR A O   1 
ATOM   89   C CB  . TYR A 1 12 ? 20.081  22.138 23.408  1.00 14.11 ? 121 TYR A CB  1 
ATOM   90   C CG  . TYR A 1 12 ? 19.436  20.875 23.895  1.00 13.83 ? 121 TYR A CG  1 
ATOM   91   C CD1 . TYR A 1 12 ? 19.489  19.716 23.131  1.00 13.88 ? 121 TYR A CD1 1 
ATOM   92   C CD2 . TYR A 1 12 ? 18.833  20.810 25.160  1.00 14.47 ? 121 TYR A CD2 1 
ATOM   93   C CE1 . TYR A 1 12 ? 18.928  18.523 23.580  1.00 14.22 ? 121 TYR A CE1 1 
ATOM   94   C CE2 . TYR A 1 12 ? 18.263  19.602 25.636  1.00 14.25 ? 121 TYR A CE2 1 
ATOM   95   C CZ  . TYR A 1 12 ? 18.319  18.469 24.839  1.00 14.94 ? 121 TYR A CZ  1 
ATOM   96   O OH  . TYR A 1 12 ? 17.777  17.276 25.281  1.00 16.58 ? 121 TYR A OH  1 
ATOM   97   N N   . LYS A 1 13 ? 16.938  22.929 22.187  1.00 15.49 ? 122 LYS A N   1 
ATOM   98   C CA  . LYS A 1 13 ? 15.605  23.344 22.599  1.00 16.19 ? 122 LYS A CA  1 
ATOM   99   C C   . LYS A 1 13 ? 15.129  22.536 23.816  1.00 17.21 ? 122 LYS A C   1 
ATOM   100  O O   . LYS A 1 13 ? 14.404  21.541 23.697  1.00 17.08 ? 122 LYS A O   1 
ATOM   101  C CB  . LYS A 1 13 ? 14.627  23.193 21.434  1.00 15.78 ? 122 LYS A CB  1 
ATOM   102  C CG  . LYS A 1 13 ? 13.229  23.763 21.732  1.00 16.19 ? 122 LYS A CG  1 
ATOM   103  C CD  . LYS A 1 13 ? 12.276  23.647 20.545  1.00 16.52 ? 122 LYS A CD  1 
ATOM   104  C CE  . LYS A 1 13 ? 10.968  24.403 20.774  1.00 17.22 ? 122 LYS A CE  1 
ATOM   105  N NZ  . LYS A 1 13 ? 9.945   24.114 19.690  1.00 16.49 ? 122 LYS A NZ  1 
ATOM   106  N N   . SER A 1 14 ? 15.533  22.964 24.998  1.00 18.48 ? 123 SER A N   1 
ATOM   107  C CA  . SER A 1 14 ? 15.183  22.215 26.205  1.00 19.85 ? 123 SER A CA  1 
ATOM   108  C C   . SER A 1 14 ? 13.751  22.460 26.668  1.00 20.56 ? 123 SER A C   1 
ATOM   109  O O   . SER A 1 14 ? 13.141  21.567 27.236  1.00 21.50 ? 123 SER A O   1 
ATOM   110  C CB  . SER A 1 14 ? 16.146  22.539 27.341  1.00 19.90 ? 123 SER A CB  1 
ATOM   111  O OG  . SER A 1 14 ? 16.346  23.941 27.403  1.00 20.93 ? 123 SER A OG  1 
ATOM   112  N N   . GLU A 1 15 ? 13.225  23.650 26.416  1.00 21.19 ? 124 GLU A N   1 
ATOM   113  C CA  . GLU A 1 15 ? 11.902  24.039 26.880  1.00 21.91 ? 124 GLU A CA  1 
ATOM   114  C C   . GLU A 1 15 ? 10.948  24.262 25.731  1.00 21.89 ? 124 GLU A C   1 
ATOM   115  O O   . GLU A 1 15 ? 11.374  24.397 24.571  1.00 22.12 ? 124 GLU A O   1 
ATOM   116  C CB  . GLU A 1 15 ? 11.991  25.370 27.610  1.00 22.34 ? 124 GLU A CB  1 
ATOM   117  C CG  . GLU A 1 15 ? 13.018  25.424 28.732  1.00 24.76 ? 124 GLU A CG  1 
ATOM   118  C CD  . GLU A 1 15 ? 12.644  24.551 29.946  1.00 27.26 ? 124 GLU A CD  1 
ATOM   119  O OE1 . GLU A 1 15 ? 11.441  24.504 30.312  1.00 29.45 ? 124 GLU A OE1 1 
ATOM   120  O OE2 . GLU A 1 15 ? 13.550  23.916 30.531  1.00 28.74 ? 124 GLU A OE2 1 
ATOM   121  N N   . ASP A 1 16 ? 9.667   24.378 26.072  1.00 21.59 ? 125 ASP A N   1 
ATOM   122  C CA  . ASP A 1 16 ? 8.645   24.723 25.099  1.00 21.75 ? 125 ASP A CA  1 
ATOM   123  C C   . ASP A 1 16 ? 8.948   26.038 24.425  1.00 20.96 ? 125 ASP A C   1 
ATOM   124  O O   . ASP A 1 16 ? 8.710   26.183 23.239  1.00 21.27 ? 125 ASP A O   1 
ATOM   125  C CB  . ASP A 1 16 ? 7.277   24.843 25.750  1.00 22.02 ? 125 ASP A CB  1 
ATOM   126  C CG  . ASP A 1 16 ? 6.709   23.515 26.137  1.00 23.87 ? 125 ASP A CG  1 
ATOM   127  O OD1 . ASP A 1 16 ? 6.673   22.588 25.289  1.00 26.56 ? 125 ASP A OD1 1 
ATOM   128  O OD2 . ASP A 1 16 ? 6.284   23.399 27.296  1.00 24.91 ? 125 ASP A OD2 1 
ATOM   129  N N   . SER A 1 17 ? 9.472   26.985 25.192  1.00 19.93 ? 126 SER A N   1 
ATOM   130  C CA  . SER A 1 17 ? 9.707   28.331 24.718  1.00 19.16 ? 126 SER A CA  1 
ATOM   131  C C   . SER A 1 17 ? 11.215  28.614 24.667  1.00 18.24 ? 126 SER A C   1 
ATOM   132  O O   . SER A 1 17 ? 11.959  28.225 25.567  1.00 18.28 ? 126 SER A O   1 
ATOM   133  C CB  . SER A 1 17 ? 8.986   29.300 25.660  1.00 19.25 ? 126 SER A CB  1 
ATOM   134  O OG  . SER A 1 17 ? 9.290   30.652 25.378  1.00 20.40 ? 126 SER A OG  1 
ATOM   135  N N   . LEU A 1 18 ? 11.667  29.271 23.598  1.00 17.14 ? 127 LEU A N   1 
ATOM   136  C CA  . LEU A 1 18 ? 13.093  29.581 23.419  1.00 16.17 ? 127 LEU A CA  1 
ATOM   137  C C   . LEU A 1 18 ? 13.461  30.936 24.008  1.00 15.89 ? 127 LEU A C   1 
ATOM   138  O O   . LEU A 1 18 ? 14.614  31.234 24.205  1.00 16.10 ? 127 LEU A O   1 
ATOM   139  C CB  . LEU A 1 18 ? 13.466  29.558 21.947  1.00 15.85 ? 127 LEU A CB  1 
ATOM   140  C CG  . LEU A 1 18 ? 13.531  28.212 21.235  1.00 14.99 ? 127 LEU A CG  1 
ATOM   141  C CD1 . LEU A 1 18 ? 13.516  28.393 19.712  1.00 12.69 ? 127 LEU A CD1 1 
ATOM   142  C CD2 . LEU A 1 18 ? 14.784  27.468 21.649  1.00 14.06 ? 127 LEU A CD2 1 
ATOM   143  N N   . GLY A 1 19 ? 12.479  31.767 24.298  1.00 15.90 ? 128 GLY A N   1 
ATOM   144  C CA  . GLY A 1 19 ? 12.760  33.050 24.930  1.00 15.90 ? 128 GLY A CA  1 
ATOM   145  C C   . GLY A 1 19 ? 13.293  34.100 23.954  1.00 16.22 ? 128 GLY A C   1 
ATOM   146  O O   . GLY A 1 19 ? 14.282  34.792 24.244  1.00 16.77 ? 128 GLY A O   1 
ATOM   147  N N   . LEU A 1 20 ? 12.645  34.246 22.797  1.00 15.91 ? 129 LEU A N   1 
ATOM   148  C CA  . LEU A 1 20 ? 12.982  35.357 21.911  1.00 15.87 ? 129 LEU A CA  1 
ATOM   149  C C   . LEU A 1 20 ? 11.793  35.898 21.167  1.00 15.68 ? 129 LEU A C   1 
ATOM   150  O O   . LEU A 1 20 ? 10.779  35.224 21.051  1.00 15.99 ? 129 LEU A O   1 
ATOM   151  C CB  . LEU A 1 20 ? 14.092  35.005 20.929  1.00 15.87 ? 129 LEU A CB  1 
ATOM   152  C CG  . LEU A 1 20 ? 13.730  34.162 19.723  1.00 15.87 ? 129 LEU A CG  1 
ATOM   153  C CD1 . LEU A 1 20 ? 14.997  33.945 18.915  1.00 14.72 ? 129 LEU A CD1 1 
ATOM   154  C CD2 . LEU A 1 20 ? 13.141  32.852 20.162  1.00 15.69 ? 129 LEU A CD2 1 
ATOM   155  N N   . THR A 1 21 ? 11.922  37.146 20.711  1.00 15.65 ? 130 THR A N   1 
ATOM   156  C CA  . THR A 1 21 ? 10.875  37.833 19.937  1.00 15.22 ? 130 THR A CA  1 
ATOM   157  C C   . THR A 1 21 ? 11.463  38.187 18.594  1.00 14.87 ? 130 THR A C   1 
ATOM   158  O O   . THR A 1 21 ? 12.603  38.627 18.514  1.00 14.76 ? 130 THR A O   1 
ATOM   159  C CB  . THR A 1 21 ? 10.417  39.092 20.658  1.00 15.26 ? 130 THR A CB  1 
ATOM   160  O OG1 . THR A 1 21 ? 10.010  38.736 21.988  1.00 15.68 ? 130 THR A OG1 1 
ATOM   161  C CG2 . THR A 1 21 ? 9.261   39.757 19.926  1.00 15.04 ? 130 THR A CG2 1 
ATOM   162  N N   . ILE A 1 22 ? 10.697  37.949 17.546  1.00 14.72 ? 131 ILE A N   1 
ATOM   163  C CA  . ILE A 1 22 ? 11.180  38.099 16.183  1.00 15.01 ? 131 ILE A CA  1 
ATOM   164  C C   . ILE A 1 22 ? 10.325  39.094 15.444  1.00 15.08 ? 131 ILE A C   1 
ATOM   165  O O   . ILE A 1 22 ? 9.108   39.130 15.642  1.00 15.18 ? 131 ILE A O   1 
ATOM   166  C CB  . ILE A 1 22 ? 11.063  36.764 15.451  1.00 15.23 ? 131 ILE A CB  1 
ATOM   167  C CG1 . ILE A 1 22 ? 12.030  35.771 16.067  1.00 16.67 ? 131 ILE A CG1 1 
ATOM   168  C CG2 . ILE A 1 22 ? 11.392  36.893 13.982  1.00 14.78 ? 131 ILE A CG2 1 
ATOM   169  C CD1 . ILE A 1 22 ? 11.956  34.443 15.416  1.00 19.97 ? 131 ILE A CD1 1 
ATOM   170  N N   . THR A 1 23 ? 10.945  39.874 14.560  1.00 15.79 ? 132 THR A N   1 
ATOM   171  C CA  . THR A 1 23 ? 10.218  40.858 13.752  1.00 15.82 ? 132 THR A CA  1 
ATOM   172  C C   . THR A 1 23 ? 10.895  40.915 12.398  1.00 16.10 ? 132 THR A C   1 
ATOM   173  O O   . THR A 1 23 ? 11.860  40.174 12.188  1.00 16.27 ? 132 THR A O   1 
ATOM   174  C CB  . THR A 1 23 ? 10.247  42.197 14.438  1.00 15.57 ? 132 THR A CB  1 
ATOM   175  O OG1 . THR A 1 23 ? 9.267   43.042 13.846  1.00 16.60 ? 132 THR A OG1 1 
ATOM   176  C CG2 . THR A 1 23 ? 11.623  42.808 14.329  1.00 15.82 ? 132 THR A CG2 1 
ATOM   177  N N   . ASP A 1 24 ? 10.412  41.756 11.476  1.00 16.33 ? 133 ASP A N   1 
ATOM   178  C CA  . ASP A 1 24 ? 10.994  41.797 10.113  1.00 16.52 ? 133 ASP A CA  1 
ATOM   179  C C   . ASP A 1 24 ? 10.773  43.108 9.380   1.00 16.54 ? 133 ASP A C   1 
ATOM   180  O O   . ASP A 1 24 ? 10.232  44.058 9.956   1.00 16.49 ? 133 ASP A O   1 
ATOM   181  C CB  . ASP A 1 24 ? 10.517  40.607 9.261   1.00 16.71 ? 133 ASP A CB  1 
ATOM   182  C CG  . ASP A 1 24 ? 9.054   40.717 8.851   1.00 18.50 ? 133 ASP A CG  1 
ATOM   183  O OD1 . ASP A 1 24 ? 8.505   41.851 8.890   1.00 19.10 ? 133 ASP A OD1 1 
ATOM   184  O OD2 . ASP A 1 24 ? 8.455   39.661 8.481   1.00 19.50 ? 133 ASP A OD2 1 
ATOM   185  N N   . ASN A 1 25 ? 11.211  43.151 8.114   1.00 16.79 ? 134 ASN A N   1 
ATOM   186  C CA  . ASN A 1 25 ? 11.203  44.390 7.289   1.00 16.65 ? 134 ASN A CA  1 
ATOM   187  C C   . ASN A 1 25 ? 9.999   44.578 6.352   1.00 16.48 ? 134 ASN A C   1 
ATOM   188  O O   . ASN A 1 25 ? 9.968   45.528 5.580   1.00 16.22 ? 134 ASN A O   1 
ATOM   189  C CB  . ASN A 1 25 ? 12.518  44.504 6.476   1.00 16.53 ? 134 ASN A CB  1 
ATOM   190  C CG  . ASN A 1 25 ? 12.483  43.731 5.152   1.00 16.11 ? 134 ASN A CG  1 
ATOM   191  O OD1 . ASN A 1 25 ? 11.446  43.635 4.513   1.00 16.93 ? 134 ASN A OD1 1 
ATOM   192  N ND2 . ASN A 1 25 ? 13.626  43.217 4.725   1.00 14.79 ? 134 ASN A ND2 1 
ATOM   193  N N   . GLY A 1 26 ? 9.035   43.662 6.395   1.00 16.78 ? 135 GLY A N   1 
ATOM   194  C CA  . GLY A 1 26 ? 7.867   43.704 5.484   1.00 17.05 ? 135 GLY A CA  1 
ATOM   195  C C   . GLY A 1 26 ? 7.825   42.626 4.393   1.00 17.19 ? 135 GLY A C   1 
ATOM   196  O O   . GLY A 1 26 ? 6.774   42.419 3.768   1.00 16.63 ? 135 GLY A O   1 
ATOM   197  N N   . VAL A 1 27 ? 8.969   41.961 4.171   1.00 17.50 ? 136 VAL A N   1 
ATOM   198  C CA  . VAL A 1 27 ? 9.107   40.822 3.245   1.00 17.62 ? 136 VAL A CA  1 
ATOM   199  C C   . VAL A 1 27 ? 9.940   39.699 3.915   1.00 18.22 ? 136 VAL A C   1 
ATOM   200  O O   . VAL A 1 27 ? 9.502   38.544 3.969   1.00 18.68 ? 136 VAL A O   1 
ATOM   201  C CB  . VAL A 1 27 ? 9.770   41.255 1.874   1.00 17.95 ? 136 VAL A CB  1 
ATOM   202  C CG1 . VAL A 1 27 ? 9.939   40.045 0.922   1.00 17.67 ? 136 VAL A CG1 1 
ATOM   203  C CG2 . VAL A 1 27 ? 8.955   42.376 1.172   1.00 16.64 ? 136 VAL A CG2 1 
ATOM   204  N N   . GLY A 1 28 ? 11.130  40.030 4.442   1.00 18.55 ? 137 GLY A N   1 
ATOM   205  C CA  . GLY A 1 28 ? 12.035  39.021 5.036   1.00 18.00 ? 137 GLY A CA  1 
ATOM   206  C C   . GLY A 1 28 ? 13.469  39.414 5.408   1.00 17.88 ? 137 GLY A C   1 
ATOM   207  O O   . GLY A 1 28 ? 13.916  40.549 5.241   1.00 18.04 ? 137 GLY A O   1 
ATOM   208  N N   . TYR A 1 29 ? 14.210  38.399 5.836   1.00 18.01 ? 138 TYR A N   1 
ATOM   209  C CA  . TYR A 1 29 ? 15.316  38.508 6.815   1.00 17.62 ? 138 TYR A CA  1 
ATOM   210  C C   . TYR A 1 29 ? 14.723  39.115 8.075   1.00 16.64 ? 138 TYR A C   1 
ATOM   211  O O   . TYR A 1 29 ? 14.939  40.289 8.401   1.00 16.35 ? 138 TYR A O   1 
ATOM   212  C CB  . TYR A 1 29 ? 16.508  39.357 6.356   1.00 18.03 ? 138 TYR A CB  1 
ATOM   213  C CG  . TYR A 1 29 ? 17.325  38.871 5.171   1.00 18.75 ? 138 TYR A CG  1 
ATOM   214  C CD1 . TYR A 1 29 ? 18.418  37.965 5.332   1.00 18.79 ? 138 TYR A CD1 1 
ATOM   215  C CD2 . TYR A 1 29 ? 17.059  39.388 3.887   1.00 19.62 ? 138 TYR A CD2 1 
ATOM   216  C CE1 . TYR A 1 29 ? 19.211  37.565 4.205   1.00 19.02 ? 138 TYR A CE1 1 
ATOM   217  C CE2 . TYR A 1 29 ? 17.825  39.012 2.757   1.00 20.28 ? 138 TYR A CE2 1 
ATOM   218  C CZ  . TYR A 1 29 ? 18.901  38.102 2.905   1.00 21.14 ? 138 TYR A CZ  1 
ATOM   219  O OH  . TYR A 1 29 ? 19.608  37.785 1.727   1.00 21.44 ? 138 TYR A OH  1 
ATOM   220  N N   . ALA A 1 30 ? 13.940  38.302 8.756   1.00 15.61 ? 139 ALA A N   1 
ATOM   221  C CA  . ALA A 1 30 ? 13.480  38.636 10.081  1.00 15.15 ? 139 ALA A CA  1 
ATOM   222  C C   . ALA A 1 30 ? 14.693  38.758 10.987  1.00 15.16 ? 139 ALA A C   1 
ATOM   223  O O   . ALA A 1 30 ? 15.765  38.230 10.683  1.00 14.84 ? 139 ALA A O   1 
ATOM   224  C CB  . ALA A 1 30 ? 12.592  37.567 10.579  1.00 15.13 ? 139 ALA A CB  1 
ATOM   225  N N   . PHE A 1 31 ? 14.533  39.479 12.088  1.00 15.01 ? 140 PHE A N   1 
ATOM   226  C CA  . PHE A 1 31 ? 15.600  39.641 13.029  1.00 14.73 ? 140 PHE A CA  1 
ATOM   227  C C   . PHE A 1 31 ? 15.083  39.605 14.441  1.00 15.03 ? 140 PHE A C   1 
ATOM   228  O O   . PHE A 1 31 ? 13.882  39.597 14.671  1.00 16.22 ? 140 PHE A O   1 
ATOM   229  C CB  . PHE A 1 31 ? 16.375  40.926 12.748  1.00 14.88 ? 140 PHE A CB  1 
ATOM   230  C CG  . PHE A 1 31 ? 15.568  42.199 12.867  1.00 14.78 ? 140 PHE A CG  1 
ATOM   231  C CD1 . PHE A 1 31 ? 15.478  42.891 14.090  1.00 15.18 ? 140 PHE A CD1 1 
ATOM   232  C CD2 . PHE A 1 31 ? 14.967  42.758 11.738  1.00 14.34 ? 140 PHE A CD2 1 
ATOM   233  C CE1 . PHE A 1 31 ? 14.766  44.103 14.181  1.00 14.39 ? 140 PHE A CE1 1 
ATOM   234  C CE2 . PHE A 1 31 ? 14.254  43.967 11.817  1.00 14.68 ? 140 PHE A CE2 1 
ATOM   235  C CZ  . PHE A 1 31 ? 14.155  44.637 13.034  1.00 14.04 ? 140 PHE A CZ  1 
ATOM   236  N N   . ILE A 1 32 ? 16.001  39.564 15.394  1.00 14.85 ? 141 ILE A N   1 
ATOM   237  C CA  . ILE A 1 32 ? 15.664  39.363 16.792  1.00 14.40 ? 141 ILE A CA  1 
ATOM   238  C C   . ILE A 1 32 ? 15.431  40.696 17.438  1.00 14.70 ? 141 ILE A C   1 
ATOM   239  O O   . ILE A 1 32 ? 16.332  41.508 17.484  1.00 14.92 ? 141 ILE A O   1 
ATOM   240  C CB  . ILE A 1 32 ? 16.825  38.655 17.531  1.00 13.99 ? 141 ILE A CB  1 
ATOM   241  C CG1 . ILE A 1 32 ? 17.119  37.313 16.860  1.00 13.61 ? 141 ILE A CG1 1 
ATOM   242  C CG2 . ILE A 1 32 ? 16.479  38.436 18.986  1.00 12.96 ? 141 ILE A CG2 1 
ATOM   243  C CD1 . ILE A 1 32 ? 18.259  36.527 17.480  1.00 11.74 ? 141 ILE A CD1 1 
ATOM   244  N N   . LYS A 1 33 ? 14.244  40.902 17.972  1.00 15.11 ? 142 LYS A N   1 
ATOM   245  C CA  . LYS A 1 33 ? 13.887  42.168 18.586  1.00 15.81 ? 142 LYS A CA  1 
ATOM   246  C C   . LYS A 1 33 ? 14.148  42.152 20.077  1.00 16.13 ? 142 LYS A C   1 
ATOM   247  O O   . LYS A 1 33 ? 14.544  43.167 20.654  1.00 16.33 ? 142 LYS A O   1 
ATOM   248  C CB  . LYS A 1 33 ? 12.404  42.467 18.324  1.00 16.07 ? 142 LYS A CB  1 
ATOM   249  C CG  . LYS A 1 33 ? 12.002  43.914 18.593  1.00 16.65 ? 142 LYS A CG  1 
ATOM   250  C CD  . LYS A 1 33 ? 10.502  44.080 18.686  1.00 17.53 ? 142 LYS A CD  1 
ATOM   251  C CE  . LYS A 1 33 ? 10.114  45.540 18.855  1.00 18.36 ? 142 LYS A CE  1 
ATOM   252  N NZ  . LYS A 1 33 ? 8.651   45.664 19.072  1.00 19.96 ? 142 LYS A NZ  1 
ATOM   253  N N   . ARG A 1 34 ? 13.901  41.009 20.706  1.00 16.75 ? 143 ARG A N   1 
ATOM   254  C CA  . ARG A 1 34 ? 14.089  40.855 22.156  1.00 17.31 ? 143 ARG A CA  1 
ATOM   255  C C   . ARG A 1 34 ? 14.665  39.496 22.468  1.00 16.82 ? 143 ARG A C   1 
ATOM   256  O O   . ARG A 1 34 ? 14.383  38.528 21.772  1.00 16.41 ? 143 ARG A O   1 
ATOM   257  C CB  . ARG A 1 34 ? 12.753  40.975 22.899  1.00 17.77 ? 143 ARG A CB  1 
ATOM   258  C CG  . ARG A 1 34 ? 12.415  42.358 23.332  1.00 20.83 ? 143 ARG A CG  1 
ATOM   259  C CD  . ARG A 1 34 ? 10.984  42.471 23.867  1.00 25.07 ? 143 ARG A CD  1 
ATOM   260  N NE  . ARG A 1 34 ? 10.713  43.877 24.158  1.00 29.97 ? 143 ARG A NE  1 
ATOM   261  C CZ  . ARG A 1 34 ? 9.976   44.714 23.415  1.00 33.33 ? 143 ARG A CZ  1 
ATOM   262  N NH1 . ARG A 1 34 ? 9.333   44.311 22.312  1.00 34.72 ? 143 ARG A NH1 1 
ATOM   263  N NH2 . ARG A 1 34 ? 9.850   45.980 23.808  1.00 33.98 ? 143 ARG A NH2 1 
ATOM   264  N N   . ILE A 1 35 ? 15.444  39.436 23.541  1.00 16.69 ? 144 ILE A N   1 
ATOM   265  C CA  . ILE A 1 35 ? 15.880  38.174 24.114  1.00 16.51 ? 144 ILE A CA  1 
ATOM   266  C C   . ILE A 1 35 ? 15.470  38.188 25.592  1.00 16.60 ? 144 ILE A C   1 
ATOM   267  O O   . ILE A 1 35 ? 15.840  39.087 26.345  1.00 15.61 ? 144 ILE A O   1 
ATOM   268  C CB  . ILE A 1 35 ? 17.406  37.980 23.962  1.00 16.36 ? 144 ILE A CB  1 
ATOM   269  C CG1 . ILE A 1 35 ? 17.764  37.845 22.480  1.00 15.96 ? 144 ILE A CG1 1 
ATOM   270  C CG2 . ILE A 1 35 ? 17.880  36.740 24.747  1.00 16.83 ? 144 ILE A CG2 1 
ATOM   271  C CD1 . ILE A 1 35 ? 19.247  37.943 22.191  1.00 14.63 ? 144 ILE A CD1 1 
ATOM   272  N N   . LYS A 1 36 ? 14.709  37.174 25.991  1.00 17.38 ? 145 LYS A N   1 
ATOM   273  C CA  . LYS A 1 36 ? 14.140  37.106 27.337  1.00 17.98 ? 145 LYS A CA  1 
ATOM   274  C C   . LYS A 1 36 ? 15.164  36.646 28.354  1.00 18.15 ? 145 LYS A C   1 
ATOM   275  O O   . LYS A 1 36 ? 15.745  35.599 28.187  1.00 18.57 ? 145 LYS A O   1 
ATOM   276  C CB  . LYS A 1 36 ? 12.944  36.154 27.358  1.00 18.04 ? 145 LYS A CB  1 
ATOM   277  C CG  . LYS A 1 36 ? 12.417  35.913 28.764  1.00 19.89 ? 145 LYS A CG  1 
ATOM   278  C CD  . LYS A 1 36 ? 10.952  35.508 28.828  1.00 21.62 ? 145 LYS A CD  1 
ATOM   279  C CE  . LYS A 1 36 ? 10.556  35.275 30.297  1.00 23.33 ? 145 LYS A CE  1 
ATOM   280  N NZ  . LYS A 1 36 ? 9.080   35.212 30.549  1.00 25.00 ? 145 LYS A NZ  1 
ATOM   281  N N   . ASP A 1 37 ? 15.362  37.418 29.410  1.00 18.71 ? 146 ASP A N   1 
ATOM   282  C CA  . ASP A 1 37 ? 16.280  37.049 30.491  1.00 19.57 ? 146 ASP A CA  1 
ATOM   283  C C   . ASP A 1 37 ? 15.980  35.659 31.055  1.00 18.77 ? 146 ASP A C   1 
ATOM   284  O O   . ASP A 1 37 ? 14.833  35.369 31.436  1.00 18.83 ? 146 ASP A O   1 
ATOM   285  C CB  . ASP A 1 37 ? 16.212  38.071 31.652  1.00 20.28 ? 146 ASP A CB  1 
ATOM   286  C CG  . ASP A 1 37 ? 16.997  39.374 31.354  1.00 24.15 ? 146 ASP A CG  1 
ATOM   287  O OD1 . ASP A 1 37 ? 17.675  39.486 30.295  1.00 29.19 ? 146 ASP A OD1 1 
ATOM   288  O OD2 . ASP A 1 37 ? 16.943  40.302 32.191  1.00 28.44 ? 146 ASP A OD2 1 
ATOM   289  N N   . GLY A 1 38 ? 17.021  34.826 31.113  1.00 17.62 ? 147 GLY A N   1 
ATOM   290  C CA  . GLY A 1 38 ? 16.946  33.511 31.701  1.00 16.94 ? 147 GLY A CA  1 
ATOM   291  C C   . GLY A 1 38 ? 16.350  32.434 30.823  1.00 16.35 ? 147 GLY A C   1 
ATOM   292  O O   . GLY A 1 38 ? 16.099  31.334 31.290  1.00 16.49 ? 147 GLY A O   1 
ATOM   293  N N   . GLY A 1 39 ? 16.127  32.743 29.551  1.00 15.71 ? 148 GLY A N   1 
ATOM   294  C CA  . GLY A 1 39 ? 15.645  31.770 28.576  1.00 14.81 ? 148 GLY A CA  1 
ATOM   295  C C   . GLY A 1 39 ? 16.804  31.105 27.862  1.00 14.24 ? 148 GLY A C   1 
ATOM   296  O O   . GLY A 1 39 ? 17.969  31.434 28.104  1.00 13.58 ? 148 GLY A O   1 
ATOM   297  N N   . VAL A 1 40 ? 16.472  30.154 26.990  1.00 13.99 ? 149 VAL A N   1 
ATOM   298  C CA  . VAL A 1 40 ? 17.480  29.370 26.293  1.00 13.80 ? 149 VAL A CA  1 
ATOM   299  C C   . VAL A 1 40 ? 18.374  30.271 25.454  1.00 13.93 ? 149 VAL A C   1 
ATOM   300  O O   . VAL A 1 40 ? 19.611  30.153 25.519  1.00 14.33 ? 149 VAL A O   1 
ATOM   301  C CB  . VAL A 1 40 ? 16.857  28.297 25.405  1.00 13.97 ? 149 VAL A CB  1 
ATOM   302  C CG1 . VAL A 1 40 ? 17.894  27.709 24.447  1.00 12.88 ? 149 VAL A CG1 1 
ATOM   303  C CG2 . VAL A 1 40 ? 16.217  27.229 26.282  1.00 13.02 ? 149 VAL A CG2 1 
ATOM   304  N N   . ILE A 1 41 ? 17.776  31.184 24.690  1.00 13.39 ? 150 ILE A N   1 
ATOM   305  C CA  . ILE A 1 41 ? 18.581  32.009 23.785  1.00 13.06 ? 150 ILE A CA  1 
ATOM   306  C C   . ILE A 1 41 ? 19.513  32.920 24.568  1.00 13.53 ? 150 ILE A C   1 
ATOM   307  O O   . ILE A 1 41 ? 20.665  33.127 24.150  1.00 13.99 ? 150 ILE A O   1 
ATOM   308  C CB  . ILE A 1 41 ? 17.730  32.828 22.789  1.00 12.91 ? 150 ILE A CB  1 
ATOM   309  C CG1 . ILE A 1 41 ? 16.940  31.898 21.865  1.00 12.46 ? 150 ILE A CG1 1 
ATOM   310  C CG2 . ILE A 1 41 ? 18.626  33.725 21.902  1.00 11.50 ? 150 ILE A CG2 1 
ATOM   311  C CD1 . ILE A 1 41 ? 17.803  31.094 20.941  1.00 10.11 ? 150 ILE A CD1 1 
ATOM   312  N N   . ASP A 1 42 ? 19.033  33.448 25.692  1.00 13.71 ? 151 ASP A N   1 
ATOM   313  C CA  . ASP A 1 42 ? 19.859  34.287 26.562  1.00 14.30 ? 151 ASP A CA  1 
ATOM   314  C C   . ASP A 1 42 ? 21.172  33.597 26.990  1.00 14.70 ? 151 ASP A C   1 
ATOM   315  O O   . ASP A 1 42 ? 22.217  34.253 27.110  1.00 14.98 ? 151 ASP A O   1 
ATOM   316  C CB  . ASP A 1 42 ? 19.068  34.722 27.812  1.00 14.69 ? 151 ASP A CB  1 
ATOM   317  C CG  . ASP A 1 42 ? 19.793  35.819 28.646  1.00 16.07 ? 151 ASP A CG  1 
ATOM   318  O OD1 . ASP A 1 42 ? 20.658  36.533 28.086  1.00 19.02 ? 151 ASP A OD1 1 
ATOM   319  O OD2 . ASP A 1 42 ? 19.484  36.000 29.853  1.00 17.20 ? 151 ASP A OD2 1 
ATOM   320  N N   . SER A 1 43 ? 21.133  32.279 27.214  1.00 14.99 ? 152 SER A N   1 
ATOM   321  C CA  . SER A 1 43 ? 22.323  31.551 27.625  1.00 14.90 ? 152 SER A CA  1 
ATOM   322  C C   . SER A 1 43 ? 23.360  31.411 26.509  1.00 15.13 ? 152 SER A C   1 
ATOM   323  O O   . SER A 1 43 ? 24.554  31.185 26.786  1.00 15.29 ? 152 SER A O   1 
ATOM   324  C CB  . SER A 1 43 ? 21.937  30.178 28.134  1.00 15.05 ? 152 SER A CB  1 
ATOM   325  O OG  . SER A 1 43 ? 21.589  29.334 27.054  1.00 16.64 ? 152 SER A OG  1 
ATOM   326  N N   . VAL A 1 44 ? 22.931  31.533 25.254  1.00 15.29 ? 153 VAL A N   1 
ATOM   327  C CA  . VAL A 1 44 ? 23.866  31.415 24.124  1.00 15.58 ? 153 VAL A CA  1 
ATOM   328  C C   . VAL A 1 44 ? 24.341  32.789 23.706  1.00 16.14 ? 153 VAL A C   1 
ATOM   329  O O   . VAL A 1 44 ? 23.704  33.432 22.881  1.00 16.97 ? 153 VAL A O   1 
ATOM   330  C CB  . VAL A 1 44 ? 23.194  30.713 22.925  1.00 15.75 ? 153 VAL A CB  1 
ATOM   331  C CG1 . VAL A 1 44 ? 24.185  30.529 21.775  1.00 14.60 ? 153 VAL A CG1 1 
ATOM   332  C CG2 . VAL A 1 44 ? 22.607  29.369 23.382  1.00 14.84 ? 153 VAL A CG2 1 
ATOM   333  N N   . LYS A 1 45 ? 25.475  33.231 24.232  1.00 16.82 ? 154 LYS A N   1 
ATOM   334  C CA  . LYS A 1 45 ? 25.832  34.644 24.177  1.00 17.59 ? 154 LYS A CA  1 
ATOM   335  C C   . LYS A 1 45 ? 26.370  35.150 22.850  1.00 17.97 ? 154 LYS A C   1 
ATOM   336  O O   . LYS A 1 45 ? 26.631  36.346 22.719  1.00 18.33 ? 154 LYS A O   1 
ATOM   337  C CB  . LYS A 1 45 ? 26.846  34.975 25.277  1.00 18.05 ? 154 LYS A CB  1 
ATOM   338  C CG  . LYS A 1 45 ? 26.359  34.653 26.721  1.00 18.78 ? 154 LYS A CG  1 
ATOM   339  C CD  . LYS A 1 45 ? 25.168  35.515 27.150  1.00 19.97 ? 154 LYS A CD  1 
ATOM   340  C CE  . LYS A 1 45 ? 24.898  35.361 28.650  1.00 20.44 ? 154 LYS A CE  1 
ATOM   341  N NZ  . LYS A 1 45 ? 23.483  35.688 29.014  1.00 20.92 ? 154 LYS A NZ  1 
ATOM   342  N N   . THR A 1 46 ? 26.549  34.268 21.870  1.00 18.00 ? 155 THR A N   1 
ATOM   343  C CA  . THR A 1 46 ? 26.901  34.707 20.531  1.00 17.79 ? 155 THR A CA  1 
ATOM   344  C C   . THR A 1 46 ? 25.678  35.224 19.785  1.00 17.83 ? 155 THR A C   1 
ATOM   345  O O   . THR A 1 46 ? 25.840  35.844 18.733  1.00 18.58 ? 155 THR A O   1 
ATOM   346  C CB  . THR A 1 46 ? 27.555  33.592 19.714  1.00 17.87 ? 155 THR A CB  1 
ATOM   347  O OG1 . THR A 1 46 ? 26.711  32.439 19.747  1.00 19.17 ? 155 THR A OG1 1 
ATOM   348  C CG2 . THR A 1 46 ? 28.918  33.218 20.280  1.00 17.52 ? 155 THR A CG2 1 
ATOM   349  N N   . ILE A 1 47 ? 24.468  34.985 20.304  1.00 17.16 ? 156 ILE A N   1 
ATOM   350  C CA  . ILE A 1 47 ? 23.236  35.498 19.674  1.00 16.67 ? 156 ILE A CA  1 
ATOM   351  C C   . ILE A 1 47 ? 22.870  36.860 20.279  1.00 16.99 ? 156 ILE A C   1 
ATOM   352  O O   . ILE A 1 47 ? 22.854  36.993 21.506  1.00 17.46 ? 156 ILE A O   1 
ATOM   353  C CB  . ILE A 1 47 ? 22.064  34.529 19.875  1.00 16.19 ? 156 ILE A CB  1 
ATOM   354  C CG1 . ILE A 1 47 ? 22.382  33.173 19.253  1.00 16.35 ? 156 ILE A CG1 1 
ATOM   355  C CG2 . ILE A 1 47 ? 20.812  35.085 19.233  1.00 14.96 ? 156 ILE A CG2 1 
ATOM   356  C CD1 . ILE A 1 47 ? 21.316  32.118 19.470  1.00 15.08 ? 156 ILE A CD1 1 
ATOM   357  N N   . CYS A 1 48 ? 22.580  37.862 19.435  1.00 16.96 ? 157 CYS A N   1 
ATOM   358  C CA  . CYS A 1 48 ? 22.256  39.236 19.922  1.00 17.33 ? 157 CYS A CA  1 
ATOM   359  C C   . CYS A 1 48 ? 21.021  39.881 19.338  1.00 15.85 ? 157 CYS A C   1 
ATOM   360  O O   . CYS A 1 48 ? 20.647  39.617 18.204  1.00 15.66 ? 157 CYS A O   1 
ATOM   361  C CB  . CYS A 1 48 ? 23.379  40.203 19.613  1.00 17.55 ? 157 CYS A CB  1 
ATOM   362  S SG  . CYS A 1 48 ? 24.938  39.554 20.052  1.00 23.87 ? 157 CYS A SG  1 
ATOM   363  N N   . VAL A 1 49 ? 20.437  40.780 20.120  1.00 14.57 ? 158 VAL A N   1 
ATOM   364  C CA  . VAL A 1 49 ? 19.397  41.652 19.624  1.00 13.74 ? 158 VAL A CA  1 
ATOM   365  C C   . VAL A 1 49 ? 19.948  42.335 18.389  1.00 13.57 ? 158 VAL A C   1 
ATOM   366  O O   . VAL A 1 49 ? 21.060  42.873 18.408  1.00 13.13 ? 158 VAL A O   1 
ATOM   367  C CB  . VAL A 1 49 ? 18.999  42.710 20.687  1.00 13.90 ? 158 VAL A CB  1 
ATOM   368  C CG1 . VAL A 1 49 ? 18.136  43.806 20.064  1.00 11.81 ? 158 VAL A CG1 1 
ATOM   369  C CG2 . VAL A 1 49 ? 18.270  42.026 21.856  1.00 12.58 ? 158 VAL A CG2 1 
ATOM   370  N N   . GLY A 1 50 ? 19.171  42.286 17.313  1.00 13.44 ? 159 GLY A N   1 
ATOM   371  C CA  . GLY A 1 50 ? 19.562  42.888 16.046  1.00 13.61 ? 159 GLY A CA  1 
ATOM   372  C C   . GLY A 1 50 ? 20.040  41.881 15.023  1.00 14.05 ? 159 GLY A C   1 
ATOM   373  O O   . GLY A 1 50 ? 20.091  42.177 13.824  1.00 14.44 ? 159 GLY A O   1 
ATOM   374  N N   . ASP A 1 51 ? 20.393  40.684 15.473  1.00 14.24 ? 160 ASP A N   1 
ATOM   375  C CA  . ASP A 1 51 ? 20.864  39.668 14.538  1.00 14.59 ? 160 ASP A CA  1 
ATOM   376  C C   . ASP A 1 51 ? 19.732  39.235 13.594  1.00 14.06 ? 160 ASP A C   1 
ATOM   377  O O   . ASP A 1 51 ? 18.593  39.007 14.019  1.00 13.34 ? 160 ASP A O   1 
ATOM   378  C CB  . ASP A 1 51 ? 21.449  38.444 15.276  1.00 15.05 ? 160 ASP A CB  1 
ATOM   379  C CG  . ASP A 1 51 ? 22.856  38.704 15.891  1.00 16.77 ? 160 ASP A CG  1 
ATOM   380  O OD1 . ASP A 1 51 ? 23.462  39.788 15.656  1.00 19.36 ? 160 ASP A OD1 1 
ATOM   381  O OD2 . ASP A 1 51 ? 23.359  37.800 16.614  1.00 18.69 ? 160 ASP A OD2 1 
ATOM   382  N N   . HIS A 1 52 ? 20.069  39.139 12.314  1.00 13.92 ? 161 HIS A N   1 
ATOM   383  C CA  . HIS A 1 52 ? 19.145  38.685 11.284  1.00 13.92 ? 161 HIS A CA  1 
ATOM   384  C C   . HIS A 1 52 ? 19.309  37.184 11.105  1.00 13.86 ? 161 HIS A C   1 
ATOM   385  O O   . HIS A 1 52 ? 20.429  36.708 11.087  1.00 13.87 ? 161 HIS A O   1 
ATOM   386  C CB  . HIS A 1 52 ? 19.459  39.394 9.974   1.00 13.71 ? 161 HIS A CB  1 
ATOM   387  C CG  . HIS A 1 52 ? 19.050  40.832 9.965   1.00 14.63 ? 161 HIS A CG  1 
ATOM   388  N ND1 . HIS A 1 52 ? 18.062  41.319 9.133   1.00 15.61 ? 161 HIS A ND1 1 
ATOM   389  C CD2 . HIS A 1 52 ? 19.486  41.888 10.692  1.00 15.52 ? 161 HIS A CD2 1 
ATOM   390  C CE1 . HIS A 1 52 ? 17.919  42.616 9.339   1.00 15.77 ? 161 HIS A CE1 1 
ATOM   391  N NE2 . HIS A 1 52 ? 18.772  42.987 10.279  1.00 15.51 ? 161 HIS A NE2 1 
ATOM   392  N N   . ILE A 1 53 ? 18.204  36.447 10.968  1.00 13.97 ? 162 ILE A N   1 
ATOM   393  C CA  . ILE A 1 53 ? 18.266  34.993 10.818  1.00 14.13 ? 162 ILE A CA  1 
ATOM   394  C C   . ILE A 1 53 ? 18.237  34.630 9.350   1.00 14.18 ? 162 ILE A C   1 
ATOM   395  O O   . ILE A 1 53 ? 17.227  34.802 8.685   1.00 14.02 ? 162 ILE A O   1 
ATOM   396  C CB  . ILE A 1 53 ? 17.096  34.260 11.509  1.00 14.16 ? 162 ILE A CB  1 
ATOM   397  C CG1 . ILE A 1 53 ? 17.110  34.519 13.015  1.00 15.15 ? 162 ILE A CG1 1 
ATOM   398  C CG2 . ILE A 1 53 ? 17.221  32.770 11.289  1.00 13.91 ? 162 ILE A CG2 1 
ATOM   399  C CD1 . ILE A 1 53 ? 15.808  34.963 13.567  1.00 15.91 ? 162 ILE A CD1 1 
ATOM   400  N N   . GLU A 1 54 ? 19.348  34.076 8.884   1.00 14.21 ? 163 GLU A N   1 
ATOM   401  C CA  . GLU A 1 54 ? 19.532  33.727 7.490   1.00 14.57 ? 163 GLU A CA  1 
ATOM   402  C C   . GLU A 1 54 ? 19.003  32.318 7.199   1.00 14.29 ? 163 GLU A C   1 
ATOM   403  O O   . GLU A 1 54 ? 18.488  32.072 6.103   1.00 13.83 ? 163 GLU A O   1 
ATOM   404  C CB  . GLU A 1 54 ? 21.013  33.839 7.146   1.00 14.80 ? 163 GLU A CB  1 
ATOM   405  C CG  . GLU A 1 54 ? 21.424  33.200 5.840   1.00 17.70 ? 163 GLU A CG  1 
ATOM   406  C CD  . GLU A 1 54 ? 22.826  33.655 5.366   1.00 21.99 ? 163 GLU A CD  1 
ATOM   407  O OE1 . GLU A 1 54 ? 23.617  34.151 6.214   1.00 23.04 ? 163 GLU A OE1 1 
ATOM   408  O OE2 . GLU A 1 54 ? 23.126  33.511 4.148   1.00 23.99 ? 163 GLU A OE2 1 
ATOM   409  N N   . SER A 1 55 ? 19.133  31.393 8.164   1.00 14.17 ? 164 SER A N   1 
ATOM   410  C CA  . SER A 1 55 ? 18.638  30.016 7.968   1.00 13.90 ? 164 SER A CA  1 
ATOM   411  C C   . SER A 1 55 ? 18.404  29.259 9.255   1.00 13.80 ? 164 SER A C   1 
ATOM   412  O O   . SER A 1 55 ? 18.937  29.620 10.293  1.00 13.59 ? 164 SER A O   1 
ATOM   413  C CB  . SER A 1 55 ? 19.592  29.213 7.084   1.00 14.08 ? 164 SER A CB  1 
ATOM   414  O OG  . SER A 1 55 ? 20.810  28.958 7.755   1.00 13.65 ? 164 SER A OG  1 
ATOM   415  N N   . ILE A 1 56 ? 17.571  28.221 9.173   1.00 14.17 ? 165 ILE A N   1 
ATOM   416  C CA  . ILE A 1 56 ? 17.287  27.307 10.291  1.00 14.50 ? 165 ILE A CA  1 
ATOM   417  C C   . ILE A 1 56 ? 17.455  25.867 9.801   1.00 14.35 ? 165 ILE A C   1 
ATOM   418  O O   . ILE A 1 56 ? 16.823  25.458 8.821   1.00 14.76 ? 165 ILE A O   1 
ATOM   419  C CB  . ILE A 1 56 ? 15.849  27.492 10.812  1.00 14.59 ? 165 ILE A CB  1 
ATOM   420  C CG1 . ILE A 1 56 ? 15.681  28.883 11.428  1.00 15.90 ? 165 ILE A CG1 1 
ATOM   421  C CG2 . ILE A 1 56 ? 15.502  26.437 11.853  1.00 15.07 ? 165 ILE A CG2 1 
ATOM   422  C CD1 . ILE A 1 56 ? 14.236  29.326 11.556  1.00 16.56 ? 165 ILE A CD1 1 
ATOM   423  N N   . ASN A 1 57 ? 18.315  25.112 10.478  1.00 14.11 ? 166 ASN A N   1 
ATOM   424  C CA  . ASN A 1 57 ? 18.694  23.776 10.026  1.00 14.06 ? 166 ASN A CA  1 
ATOM   425  C C   . ASN A 1 57 ? 18.973  23.767 8.517   1.00 14.36 ? 166 ASN A C   1 
ATOM   426  O O   . ASN A 1 57 ? 18.485  22.905 7.794   1.00 14.22 ? 166 ASN A O   1 
ATOM   427  C CB  . ASN A 1 57 ? 17.611  22.738 10.375  1.00 13.68 ? 166 ASN A CB  1 
ATOM   428  C CG  . ASN A 1 57 ? 17.554  22.404 11.863  1.00 13.25 ? 166 ASN A CG  1 
ATOM   429  O OD1 . ASN A 1 57 ? 18.550  22.489 12.601  1.00 11.84 ? 166 ASN A OD1 1 
ATOM   430  N ND2 . ASN A 1 57 ? 16.370  21.997 12.306  1.00 12.15 ? 166 ASN A ND2 1 
ATOM   431  N N   . GLY A 1 58 ? 19.731  24.749 8.034   1.00 14.77 ? 167 GLY A N   1 
ATOM   432  C CA  . GLY A 1 58 ? 20.145  24.760 6.634   1.00 15.07 ? 167 GLY A CA  1 
ATOM   433  C C   . GLY A 1 58 ? 19.090  25.189 5.629   1.00 15.49 ? 167 GLY A C   1 
ATOM   434  O O   . GLY A 1 58 ? 19.374  25.279 4.437   1.00 15.24 ? 167 GLY A O   1 
ATOM   435  N N   . GLU A 1 59 ? 17.875  25.451 6.097   1.00 16.15 ? 168 GLU A N   1 
ATOM   436  C CA  . GLU A 1 59 ? 16.796  25.901 5.220   1.00 16.72 ? 168 GLU A CA  1 
ATOM   437  C C   . GLU A 1 59 ? 16.826  27.419 5.142   1.00 16.51 ? 168 GLU A C   1 
ATOM   438  O O   . GLU A 1 59 ? 16.711  28.122 6.145   1.00 16.69 ? 168 GLU A O   1 
ATOM   439  C CB  . GLU A 1 59 ? 15.440  25.442 5.765   1.00 17.24 ? 168 GLU A CB  1 
ATOM   440  C CG  . GLU A 1 59 ? 14.247  25.788 4.873   1.00 18.70 ? 168 GLU A CG  1 
ATOM   441  C CD  . GLU A 1 59 ? 12.937  25.231 5.403   1.00 21.13 ? 168 GLU A CD  1 
ATOM   442  O OE1 . GLU A 1 59 ? 12.915  24.662 6.523   1.00 25.09 ? 168 GLU A OE1 1 
ATOM   443  O OE2 . GLU A 1 59 ? 11.915  25.363 4.714   1.00 22.12 ? 168 GLU A OE2 1 
ATOM   444  N N   . ASN A 1 60 ? 16.960  27.933 3.941   1.00 16.47 ? 169 ASN A N   1 
ATOM   445  C CA  . ASN A 1 60 ? 17.016  29.371 3.753   1.00 16.55 ? 169 ASN A CA  1 
ATOM   446  C C   . ASN A 1 60 ? 15.676  30.029 4.089   1.00 16.14 ? 169 ASN A C   1 
ATOM   447  O O   . ASN A 1 60 ? 14.637  29.595 3.598   1.00 16.02 ? 169 ASN A O   1 
ATOM   448  C CB  . ASN A 1 60 ? 17.394  29.685 2.313   1.00 16.53 ? 169 ASN A CB  1 
ATOM   449  C CG  . ASN A 1 60 ? 17.798  31.129 2.128   1.00 17.68 ? 169 ASN A CG  1 
ATOM   450  O OD1 . ASN A 1 60 ? 17.285  32.021 2.797   1.00 18.51 ? 169 ASN A OD1 1 
ATOM   451  N ND2 . ASN A 1 60 ? 18.724  31.367 1.216   1.00 19.36 ? 169 ASN A ND2 1 
ATOM   452  N N   . ILE A 1 61 ? 15.695  31.062 4.927   1.00 15.65 ? 170 ILE A N   1 
ATOM   453  C CA  . ILE A 1 61 ? 14.470  31.779 5.263   1.00 15.37 ? 170 ILE A CA  1 
ATOM   454  C C   . ILE A 1 61 ? 14.527  33.254 4.920   1.00 15.51 ? 170 ILE A C   1 
ATOM   455  O O   . ILE A 1 61 ? 13.703  34.043 5.382   1.00 15.93 ? 170 ILE A O   1 
ATOM   456  C CB  . ILE A 1 61 ? 14.109  31.605 6.743   1.00 15.61 ? 170 ILE A CB  1 
ATOM   457  C CG1 . ILE A 1 61 ? 15.078  32.374 7.649   1.00 15.59 ? 170 ILE A CG1 1 
ATOM   458  C CG2 . ILE A 1 61 ? 14.105  30.128 7.098   1.00 13.91 ? 170 ILE A CG2 1 
ATOM   459  C CD1 . ILE A 1 61 ? 14.715  32.263 9.114   1.00 16.12 ? 170 ILE A CD1 1 
ATOM   460  N N   . VAL A 1 62 ? 15.512  33.639 4.124   1.00 15.86 ? 171 VAL A N   1 
ATOM   461  C CA  . VAL A 1 62 ? 15.460  34.920 3.467   1.00 15.99 ? 171 VAL A CA  1 
ATOM   462  C C   . VAL A 1 62 ? 14.070  34.981 2.832   1.00 16.33 ? 171 VAL A C   1 
ATOM   463  O O   . VAL A 1 62 ? 13.696  34.108 2.032   1.00 15.99 ? 171 VAL A O   1 
ATOM   464  C CB  . VAL A 1 62 ? 16.546  35.012 2.374   1.00 16.28 ? 171 VAL A CB  1 
ATOM   465  C CG1 . VAL A 1 62 ? 16.321  36.258 1.476   1.00 16.00 ? 171 VAL A CG1 1 
ATOM   466  C CG2 . VAL A 1 62 ? 17.965  34.967 3.030   1.00 16.41 ? 171 VAL A CG2 1 
ATOM   467  N N   . GLY A 1 63 ? 13.293  35.976 3.238   1.00 16.54 ? 172 GLY A N   1 
ATOM   468  C CA  . GLY A 1 63 ? 11.966  36.216 2.657   1.00 16.83 ? 172 GLY A CA  1 
ATOM   469  C C   . GLY A 1 63 ? 10.763  35.516 3.285   1.00 16.87 ? 172 GLY A C   1 
ATOM   470  O O   . GLY A 1 63 ? 9.657   35.543 2.724   1.00 17.16 ? 172 GLY A O   1 
ATOM   471  N N   . TRP A 1 64 ? 10.960  34.866 4.427   1.00 16.64 ? 173 TRP A N   1 
ATOM   472  C CA  . TRP A 1 64 ? 9.830   34.447 5.243   1.00 16.45 ? 173 TRP A CA  1 
ATOM   473  C C   . TRP A 1 64 ? 9.433   35.617 6.129   1.00 16.07 ? 173 TRP A C   1 
ATOM   474  O O   . TRP A 1 64 ? 10.284  36.388 6.562   1.00 16.11 ? 173 TRP A O   1 
ATOM   475  C CB  . TRP A 1 64 ? 10.222  33.278 6.127   1.00 16.64 ? 173 TRP A CB  1 
ATOM   476  C CG  . TRP A 1 64 ? 10.384  31.978 5.416   1.00 17.19 ? 173 TRP A CG  1 
ATOM   477  C CD1 . TRP A 1 64 ? 10.736  31.775 4.113   1.00 17.15 ? 173 TRP A CD1 1 
ATOM   478  C CD2 . TRP A 1 64 ? 10.231  30.681 6.002   1.00 17.66 ? 173 TRP A CD2 1 
ATOM   479  N NE1 . TRP A 1 64 ? 10.793  30.427 3.848   1.00 16.75 ? 173 TRP A NE1 1 
ATOM   480  C CE2 . TRP A 1 64 ? 10.489  29.733 4.989   1.00 17.31 ? 173 TRP A CE2 1 
ATOM   481  C CE3 . TRP A 1 64 ? 9.892   30.233 7.285   1.00 18.37 ? 173 TRP A CE3 1 
ATOM   482  C CZ2 . TRP A 1 64 ? 10.419  28.358 5.215   1.00 18.14 ? 173 TRP A CZ2 1 
ATOM   483  C CZ3 . TRP A 1 64 ? 9.821   28.866 7.515   1.00 19.27 ? 173 TRP A CZ3 1 
ATOM   484  C CH2 . TRP A 1 64 ? 10.083  27.941 6.478   1.00 19.29 ? 173 TRP A CH2 1 
ATOM   485  N N   . ARG A 1 65 ? 8.145   35.743 6.411   1.00 15.75 ? 174 ARG A N   1 
ATOM   486  C CA  . ARG A 1 65 ? 7.685   36.731 7.377   1.00 15.45 ? 174 ARG A CA  1 
ATOM   487  C C   . ARG A 1 65 ? 7.935   36.224 8.802   1.00 15.68 ? 174 ARG A C   1 
ATOM   488  O O   . ARG A 1 65 ? 8.184   35.031 9.024   1.00 15.84 ? 174 ARG A O   1 
ATOM   489  C CB  . ARG A 1 65 ? 6.198   37.004 7.172   1.00 15.33 ? 174 ARG A CB  1 
ATOM   490  C CG  . ARG A 1 65 ? 5.849   37.543 5.787   1.00 14.87 ? 174 ARG A CG  1 
ATOM   491  C CD  . ARG A 1 65 ? 6.551   38.878 5.496   1.00 14.86 ? 174 ARG A CD  1 
ATOM   492  N NE  . ARG A 1 65 ? 6.376   39.855 6.579   1.00 15.00 ? 174 ARG A NE  1 
ATOM   493  C CZ  . ARG A 1 65 ? 5.271   40.581 6.788   1.00 13.83 ? 174 ARG A CZ  1 
ATOM   494  N NH1 . ARG A 1 65 ? 4.199   40.468 5.984   1.00 11.85 ? 174 ARG A NH1 1 
ATOM   495  N NH2 . ARG A 1 65 ? 5.237   41.437 7.816   1.00 13.60 ? 174 ARG A NH2 1 
ATOM   496  N N   . HIS A 1 66 ? 7.860   37.129 9.770   1.00 15.79 ? 175 HIS A N   1 
ATOM   497  C CA  . HIS A 1 66 ? 8.194   36.788 11.143  1.00 15.86 ? 175 HIS A CA  1 
ATOM   498  C C   . HIS A 1 66 ? 7.320   35.656 11.726  1.00 16.79 ? 175 HIS A C   1 
ATOM   499  O O   . HIS A 1 66 ? 7.825   34.735 12.382  1.00 17.28 ? 175 HIS A O   1 
ATOM   500  C CB  . HIS A 1 66 ? 8.172   38.032 12.026  1.00 15.52 ? 175 HIS A CB  1 
ATOM   501  C CG  . HIS A 1 66 ? 6.834   38.687 12.109  1.00 15.43 ? 175 HIS A CG  1 
ATOM   502  N ND1 . HIS A 1 66 ? 5.902   38.359 13.073  1.00 14.92 ? 175 HIS A ND1 1 
ATOM   503  C CD2 . HIS A 1 66 ? 6.267   39.659 11.347  1.00 14.71 ? 175 HIS A CD2 1 
ATOM   504  C CE1 . HIS A 1 66 ? 4.818   39.100 12.902  1.00 15.14 ? 175 HIS A CE1 1 
ATOM   505  N NE2 . HIS A 1 66 ? 5.011   39.894 11.859  1.00 15.10 ? 175 HIS A NE2 1 
ATOM   506  N N   . TYR A 1 67 ? 6.020   35.694 11.475  1.00 17.34 ? 176 TYR A N   1 
ATOM   507  C CA  . TYR A 1 67 ? 5.142   34.655 11.996  1.00 17.87 ? 176 TYR A CA  1 
ATOM   508  C C   . TYR A 1 67 ? 5.487   33.282 11.445  1.00 17.98 ? 176 TYR A C   1 
ATOM   509  O O   . TYR A 1 67 ? 5.349   32.288 12.155  1.00 18.07 ? 176 TYR A O   1 
ATOM   510  C CB  . TYR A 1 67 ? 3.663   34.972 11.753  1.00 18.05 ? 176 TYR A CB  1 
ATOM   511  C CG  . TYR A 1 67 ? 3.341   35.566 10.376  1.00 20.26 ? 176 TYR A CG  1 
ATOM   512  C CD1 . TYR A 1 67 ? 3.169   36.964 10.208  1.00 21.67 ? 176 TYR A CD1 1 
ATOM   513  C CD2 . TYR A 1 67 ? 3.191   34.748 9.240   1.00 21.41 ? 176 TYR A CD2 1 
ATOM   514  C CE1 . TYR A 1 67 ? 2.858   37.512 8.967   1.00 22.10 ? 176 TYR A CE1 1 
ATOM   515  C CE2 . TYR A 1 67 ? 2.867   35.304 7.981   1.00 21.66 ? 176 TYR A CE2 1 
ATOM   516  C CZ  . TYR A 1 67 ? 2.705   36.681 7.861   1.00 22.82 ? 176 TYR A CZ  1 
ATOM   517  O OH  . TYR A 1 67 ? 2.391   37.247 6.637   1.00 24.56 ? 176 TYR A OH  1 
ATOM   518  N N   . ASP A 1 68 ? 5.934   33.216 10.192  1.00 18.39 ? 177 ASP A N   1 
ATOM   519  C CA  . ASP A 1 68 ? 6.274   31.922 9.584   1.00 18.71 ? 177 ASP A CA  1 
ATOM   520  C C   . ASP A 1 68 ? 7.525   31.382 10.237  1.00 18.67 ? 177 ASP A C   1 
ATOM   521  O O   . ASP A 1 68 ? 7.653   30.172 10.462  1.00 18.42 ? 177 ASP A O   1 
ATOM   522  C CB  . ASP A 1 68 ? 6.522   32.052 8.077   1.00 18.67 ? 177 ASP A CB  1 
ATOM   523  C CG  . ASP A 1 68 ? 5.241   32.227 7.281   1.00 19.86 ? 177 ASP A CG  1 
ATOM   524  O OD1 . ASP A 1 68 ? 4.223   31.624 7.680   1.00 19.07 ? 177 ASP A OD1 1 
ATOM   525  O OD2 . ASP A 1 68 ? 5.252   32.958 6.249   1.00 21.85 ? 177 ASP A OD2 1 
ATOM   526  N N   . VAL A 1 69 ? 8.452   32.298 10.510  1.00 18.62 ? 178 VAL A N   1 
ATOM   527  C CA  . VAL A 1 69 ? 9.704   31.954 11.158  1.00 18.66 ? 178 VAL A CA  1 
ATOM   528  C C   . VAL A 1 69 ? 9.438   31.473 12.593  1.00 18.83 ? 178 VAL A C   1 
ATOM   529  O O   . VAL A 1 69 ? 9.996   30.463 13.010  1.00 18.82 ? 178 VAL A O   1 
ATOM   530  C CB  . VAL A 1 69 ? 10.670  33.166 11.168  1.00 18.84 ? 178 VAL A CB  1 
ATOM   531  C CG1 . VAL A 1 69 ? 11.822  32.938 12.109  1.00 18.69 ? 178 VAL A CG1 1 
ATOM   532  C CG2 . VAL A 1 69 ? 11.179  33.425 9.782   1.00 17.97 ? 178 VAL A CG2 1 
ATOM   533  N N   . ALA A 1 70 ? 8.582   32.191 13.328  1.00 18.81 ? 179 ALA A N   1 
ATOM   534  C CA  . ALA A 1 70 ? 8.290   31.826 14.705  1.00 18.87 ? 179 ALA A CA  1 
ATOM   535  C C   . ALA A 1 70 ? 7.553   30.502 14.721  1.00 19.11 ? 179 ALA A C   1 
ATOM   536  O O   . ALA A 1 70 ? 7.811   29.680 15.581  1.00 19.24 ? 179 ALA A O   1 
ATOM   537  C CB  . ALA A 1 70 ? 7.491   32.899 15.400  1.00 18.56 ? 179 ALA A CB  1 
ATOM   538  N N   . LYS A 1 71 ? 6.659   30.284 13.761  1.00 19.44 ? 180 LYS A N   1 
ATOM   539  C CA  . LYS A 1 71 ? 5.946   29.016 13.684  1.00 19.97 ? 180 LYS A CA  1 
ATOM   540  C C   . LYS A 1 71 ? 6.957   27.911 13.540  1.00 20.09 ? 180 LYS A C   1 
ATOM   541  O O   . LYS A 1 71 ? 6.851   26.861 14.179  1.00 20.30 ? 180 LYS A O   1 
ATOM   542  C CB  . LYS A 1 71 ? 5.003   28.969 12.486  1.00 20.20 ? 180 LYS A CB  1 
ATOM   543  C CG  . LYS A 1 71 ? 4.072   27.758 12.465  1.00 21.92 ? 180 LYS A CG  1 
ATOM   544  C CD  . LYS A 1 71 ? 2.737   28.112 11.811  1.00 24.54 ? 180 LYS A CD  1 
ATOM   545  C CE  . LYS A 1 71 ? 1.657   27.056 12.059  1.00 26.59 ? 180 LYS A CE  1 
ATOM   546  N NZ  . LYS A 1 71 ? 0.267   27.641 12.010  1.00 27.52 ? 180 LYS A NZ  1 
ATOM   547  N N   . LYS A 1 72 ? 7.952   28.151 12.702  1.00 20.26 ? 181 LYS A N   1 
ATOM   548  C CA  . LYS A 1 72 ? 8.939   27.122 12.444  1.00 20.58 ? 181 LYS A CA  1 
ATOM   549  C C   . LYS A 1 72 ? 9.703   26.781 13.735  1.00 20.26 ? 181 LYS A C   1 
ATOM   550  O O   . LYS A 1 72 ? 9.878   25.620 14.076  1.00 20.17 ? 181 LYS A O   1 
ATOM   551  C CB  . LYS A 1 72 ? 9.896   27.579 11.353  1.00 20.76 ? 181 LYS A CB  1 
ATOM   552  C CG  . LYS A 1 72 ? 10.859  26.491 10.890  1.00 22.27 ? 181 LYS A CG  1 
ATOM   553  C CD  . LYS A 1 72 ? 10.135  25.349 10.200  1.00 25.16 ? 181 LYS A CD  1 
ATOM   554  N N   . LEU A 1 73 ? 10.140  27.810 14.445  1.00 20.11 ? 182 LEU A N   1 
ATOM   555  C CA  . LEU A 1 73 ? 10.863  27.630 15.677  1.00 19.91 ? 182 LEU A CA  1 
ATOM   556  C C   . LEU A 1 73 ? 9.993   26.908 16.743  1.00 20.73 ? 182 LEU A C   1 
ATOM   557  O O   . LEU A 1 73 ? 10.489  26.042 17.468  1.00 21.11 ? 182 LEU A O   1 
ATOM   558  C CB  . LEU A 1 73 ? 11.346  28.987 16.194  1.00 19.53 ? 182 LEU A CB  1 
ATOM   559  C CG  . LEU A 1 73 ? 12.464  29.676 15.396  1.00 18.44 ? 182 LEU A CG  1 
ATOM   560  C CD1 . LEU A 1 73 ? 12.724  31.072 15.946  1.00 16.29 ? 182 LEU A CD1 1 
ATOM   561  C CD2 . LEU A 1 73 ? 13.760  28.880 15.386  1.00 16.37 ? 182 LEU A CD2 1 
ATOM   562  N N   . LYS A 1 74 ? 8.711   27.262 16.837  1.00 20.90 ? 183 LYS A N   1 
ATOM   563  C CA  . LYS A 1 74 ? 7.811   26.608 17.769  1.00 21.35 ? 183 LYS A CA  1 
ATOM   564  C C   . LYS A 1 74 ? 7.619   25.135 17.431  1.00 21.46 ? 183 LYS A C   1 
ATOM   565  O O   . LYS A 1 74 ? 7.413   24.304 18.321  1.00 21.69 ? 183 LYS A O   1 
ATOM   566  C CB  . LYS A 1 74 ? 6.453   27.290 17.767  1.00 21.75 ? 183 LYS A CB  1 
ATOM   567  C CG  . LYS A 1 74 ? 6.380   28.560 18.602  1.00 23.46 ? 183 LYS A CG  1 
ATOM   568  C CD  . LYS A 1 74 ? 5.105   29.344 18.266  1.00 26.08 ? 183 LYS A CD  1 
ATOM   569  C CE  . LYS A 1 74 ? 4.489   30.014 19.486  1.00 27.95 ? 183 LYS A CE  1 
ATOM   570  N NZ  . LYS A 1 74 ? 3.158   30.582 19.147  1.00 29.14 ? 183 LYS A NZ  1 
ATOM   571  N N   . GLU A 1 75 ? 7.685   24.807 16.150  1.00 21.56 ? 184 GLU A N   1 
ATOM   572  C CA  . GLU A 1 75 ? 7.416   23.440 15.702  1.00 21.89 ? 184 GLU A CA  1 
ATOM   573  C C   . GLU A 1 75 ? 8.603   22.502 15.882  1.00 21.27 ? 184 GLU A C   1 
ATOM   574  O O   . GLU A 1 75 ? 8.429   21.290 15.861  1.00 21.09 ? 184 GLU A O   1 
ATOM   575  C CB  . GLU A 1 75 ? 6.936   23.433 14.236  1.00 22.36 ? 184 GLU A CB  1 
ATOM   576  C CG  . GLU A 1 75 ? 5.471   23.905 14.096  1.00 24.39 ? 184 GLU A CG  1 
ATOM   577  C CD  . GLU A 1 75 ? 4.974   24.030 12.634  1.00 27.58 ? 184 GLU A CD  1 
ATOM   578  O OE1 . GLU A 1 75 ? 5.811   24.200 11.690  1.00 27.83 ? 184 GLU A OE1 1 
ATOM   579  O OE2 . GLU A 1 75 ? 3.725   23.979 12.443  1.00 29.25 ? 184 GLU A OE2 1 
ATOM   580  N N   . LEU A 1 76 ? 9.801   23.048 16.047  1.00 20.98 ? 185 LEU A N   1 
ATOM   581  C CA  . LEU A 1 76 ? 10.976  22.211 16.284  1.00 20.89 ? 185 LEU A CA  1 
ATOM   582  C C   . LEU A 1 76 ? 10.753  21.341 17.501  1.00 21.29 ? 185 LEU A C   1 
ATOM   583  O O   . LEU A 1 76 ? 10.202  21.801 18.502  1.00 21.17 ? 185 LEU A O   1 
ATOM   584  C CB  . LEU A 1 76 ? 12.184  23.086 16.556  1.00 20.68 ? 185 LEU A CB  1 
ATOM   585  C CG  . LEU A 1 76 ? 12.748  23.846 15.375  1.00 19.50 ? 185 LEU A CG  1 
ATOM   586  C CD1 . LEU A 1 76 ? 13.777  24.857 15.871  1.00 18.60 ? 185 LEU A CD1 1 
ATOM   587  C CD2 . LEU A 1 76 ? 13.362  22.874 14.409  1.00 17.71 ? 185 LEU A CD2 1 
ATOM   588  N N   . LYS A 1 77 ? 11.202  20.095 17.438  1.00 22.07 ? 186 LYS A N   1 
ATOM   589  C CA  . LYS A 1 77 ? 10.983  19.171 18.561  1.00 22.45 ? 186 LYS A CA  1 
ATOM   590  C C   . LYS A 1 77 ? 11.736  19.555 19.827  1.00 22.22 ? 186 LYS A C   1 
ATOM   591  O O   . LYS A 1 77 ? 12.885  19.970 19.802  1.00 21.46 ? 186 LYS A O   1 
ATOM   592  C CB  . LYS A 1 77 ? 11.315  17.739 18.168  1.00 22.76 ? 186 LYS A CB  1 
ATOM   593  C CG  . LYS A 1 77 ? 10.244  17.148 17.275  1.00 24.73 ? 186 LYS A CG  1 
ATOM   594  C CD  . LYS A 1 77 ? 10.457  15.699 16.994  1.00 27.12 ? 186 LYS A CD  1 
ATOM   595  C CE  . LYS A 1 77 ? 9.632   15.254 15.789  1.00 28.89 ? 186 LYS A CE  1 
ATOM   596  N NZ  . LYS A 1 77 ? 9.305   13.767 15.780  1.00 29.50 ? 186 LYS A NZ  1 
ATOM   597  N N   . LYS A 1 78 ? 11.048  19.410 20.942  1.00 22.61 ? 187 LYS A N   1 
ATOM   598  C CA  . LYS A 1 78 ? 11.645  19.597 22.260  1.00 22.87 ? 187 LYS A CA  1 
ATOM   599  C C   . LYS A 1 78 ? 12.774  18.567 22.478  1.00 22.63 ? 187 LYS A C   1 
ATOM   600  O O   . LYS A 1 78 ? 12.760  17.467 21.895  1.00 22.36 ? 187 LYS A O   1 
ATOM   601  C CB  . LYS A 1 78 ? 10.553  19.459 23.331  1.00 23.03 ? 187 LYS A CB  1 
ATOM   602  C CG  . LYS A 1 78 ? 10.740  20.354 24.553  1.00 25.13 ? 187 LYS A CG  1 
ATOM   603  C CD  . LYS A 1 78 ? 9.421   20.638 25.272  1.00 27.52 ? 187 LYS A CD  1 
ATOM   604  C CE  . LYS A 1 78 ? 9.055   19.560 26.288  1.00 29.10 ? 187 LYS A CE  1 
ATOM   605  N NZ  . LYS A 1 78 ? 9.556   19.861 27.673  1.00 29.72 ? 187 LYS A NZ  1 
ATOM   606  N N   . GLU A 1 79 ? 13.762  18.945 23.286  1.00 22.39 ? 188 GLU A N   1 
ATOM   607  C CA  . GLU A 1 79 ? 14.908  18.084 23.599  1.00 22.41 ? 188 GLU A CA  1 
ATOM   608  C C   . GLU A 1 79 ? 15.690  17.658 22.351  1.00 21.67 ? 188 GLU A C   1 
ATOM   609  O O   . GLU A 1 79 ? 16.133  16.532 22.253  1.00 21.62 ? 188 GLU A O   1 
ATOM   610  C CB  . GLU A 1 79 ? 14.474  16.860 24.422  1.00 22.81 ? 188 GLU A CB  1 
ATOM   611  C CG  . GLU A 1 79 ? 13.610  17.173 25.665  1.00 25.22 ? 188 GLU A CG  1 
ATOM   612  C CD  . GLU A 1 79 ? 14.424  17.335 26.959  1.00 28.31 ? 188 GLU A CD  1 
ATOM   613  O OE1 . GLU A 1 79 ? 15.031  18.404 27.186  1.00 30.47 ? 188 GLU A OE1 1 
ATOM   614  O OE2 . GLU A 1 79 ? 14.450  16.384 27.767  1.00 30.07 ? 188 GLU A OE2 1 
ATOM   615  N N   . GLU A 1 80 ? 15.878  18.576 21.409  1.00 21.24 ? 189 GLU A N   1 
ATOM   616  C CA  . GLU A 1 80 ? 16.755  18.338 20.251  1.00 20.70 ? 189 GLU A CA  1 
ATOM   617  C C   . GLU A 1 80 ? 17.533  19.559 19.851  1.00 19.39 ? 189 GLU A C   1 
ATOM   618  O O   . GLU A 1 80 ? 17.011  20.663 19.898  1.00 18.97 ? 189 GLU A O   1 
ATOM   619  C CB  . GLU A 1 80 ? 15.946  17.925 19.046  1.00 21.12 ? 189 GLU A CB  1 
ATOM   620  C CG  . GLU A 1 80 ? 15.429  16.537 19.118  1.00 24.13 ? 189 GLU A CG  1 
ATOM   621  C CD  . GLU A 1 80 ? 14.904  16.013 17.786  1.00 27.78 ? 189 GLU A CD  1 
ATOM   622  O OE1 . GLU A 1 80 ? 14.772  16.788 16.800  1.00 29.13 ? 189 GLU A OE1 1 
ATOM   623  O OE2 . GLU A 1 80 ? 14.623  14.799 17.752  1.00 28.42 ? 189 GLU A OE2 1 
ATOM   624  N N   . LEU A 1 81 ? 18.780  19.340 19.435  1.00 18.59 ? 190 LEU A N   1 
ATOM   625  C CA  . LEU A 1 81 ? 19.620  20.389 18.825  1.00 17.90 ? 190 LEU A CA  1 
ATOM   626  C C   . LEU A 1 81 ? 19.023  20.855 17.497  1.00 17.18 ? 190 LEU A C   1 
ATOM   627  O O   . LEU A 1 81 ? 18.515  20.059 16.718  1.00 16.50 ? 190 LEU A O   1 
ATOM   628  C CB  . LEU A 1 81 ? 21.002  19.852 18.481  1.00 17.96 ? 190 LEU A CB  1 
ATOM   629  C CG  . LEU A 1 81 ? 22.228  20.182 19.335  1.00 19.33 ? 190 LEU A CG  1 
ATOM   630  C CD1 . LEU A 1 81 ? 23.455  19.816 18.459  1.00 19.36 ? 190 LEU A CD1 1 
ATOM   631  C CD2 . LEU A 1 81 ? 22.279  21.653 19.782  1.00 18.50 ? 190 LEU A CD2 1 
ATOM   632  N N   . PHE A 1 82 ? 19.089  22.158 17.254  1.00 16.53 ? 191 PHE A N   1 
ATOM   633  C CA  . PHE A 1 82 ? 18.905  22.703 15.912  1.00 15.77 ? 191 PHE A CA  1 
ATOM   634  C C   . PHE A 1 82 ? 19.981  23.723 15.650  1.00 15.43 ? 191 PHE A C   1 
ATOM   635  O O   . PHE A 1 82 ? 20.679  24.134 16.567  1.00 15.99 ? 191 PHE A O   1 
ATOM   636  C CB  . PHE A 1 82 ? 17.528  23.304 15.742  1.00 15.75 ? 191 PHE A CB  1 
ATOM   637  C CG  . PHE A 1 82 ? 17.288  24.550 16.541  1.00 15.52 ? 191 PHE A CG  1 
ATOM   638  C CD1 . PHE A 1 82 ? 17.409  25.803 15.956  1.00 15.52 ? 191 PHE A CD1 1 
ATOM   639  C CD2 . PHE A 1 82 ? 16.873  24.479 17.864  1.00 16.10 ? 191 PHE A CD2 1 
ATOM   640  C CE1 . PHE A 1 82 ? 17.139  26.972 16.675  1.00 15.20 ? 191 PHE A CE1 1 
ATOM   641  C CE2 . PHE A 1 82 ? 16.620  25.646 18.600  1.00 15.90 ? 191 PHE A CE2 1 
ATOM   642  C CZ  . PHE A 1 82 ? 16.750  26.892 18.001  1.00 15.70 ? 191 PHE A CZ  1 
ATOM   643  N N   . THR A 1 83 ? 20.171  24.084 14.390  1.00 15.25 ? 192 THR A N   1 
ATOM   644  C CA  . THR A 1 83 ? 21.239  25.026 14.016  1.00 14.72 ? 192 THR A CA  1 
ATOM   645  C C   . THR A 1 83 ? 20.630  26.222 13.334  1.00 14.30 ? 192 THR A C   1 
ATOM   646  O O   . THR A 1 83 ? 19.533  26.149 12.800  1.00 14.49 ? 192 THR A O   1 
ATOM   647  C CB  . THR A 1 83 ? 22.259  24.385 13.043  1.00 14.80 ? 192 THR A CB  1 
ATOM   648  O OG1 . THR A 1 83 ? 21.677  24.266 11.736  1.00 15.47 ? 192 THR A OG1 1 
ATOM   649  C CG2 . THR A 1 83 ? 22.693  23.003 13.524  1.00 14.11 ? 192 THR A CG2 1 
ATOM   650  N N   . MET A 1 84 ? 21.352  27.320 13.339  1.00 14.14 ? 193 MET A N   1 
ATOM   651  C CA  . MET A 1 84 ? 20.925  28.522 12.634  1.00 14.26 ? 193 MET A CA  1 
ATOM   652  C C   . MET A 1 84 ? 22.127  29.262 12.090  1.00 13.76 ? 193 MET A C   1 
ATOM   653  O O   . MET A 1 84 ? 23.184  29.276 12.754  1.00 13.06 ? 193 MET A O   1 
ATOM   654  C CB  . MET A 1 84 ? 20.279  29.497 13.585  1.00 14.58 ? 193 MET A CB  1 
ATOM   655  C CG  . MET A 1 84 ? 18.834  29.276 13.884  1.00 17.44 ? 193 MET A CG  1 
ATOM   656  S SD  . MET A 1 84 ? 18.350  30.528 15.162  1.00 24.33 ? 193 MET A SD  1 
ATOM   657  C CE  . MET A 1 84 ? 16.697  30.926 14.612  1.00 25.45 ? 193 MET A CE  1 
ATOM   658  N N   . LYS A 1 85 ? 21.955  29.887 10.916  1.00 13.19 ? 194 LYS A N   1 
ATOM   659  C CA  . LYS A 1 85 ? 22.909  30.865 10.424  1.00 13.18 ? 194 LYS A CA  1 
ATOM   660  C C   . LYS A 1 85 ? 22.298  32.249 10.664  1.00 12.91 ? 194 LYS A C   1 
ATOM   661  O O   . LYS A 1 85 ? 21.145  32.519 10.324  1.00 12.98 ? 194 LYS A O   1 
ATOM   662  C CB  . LYS A 1 85 ? 23.259  30.647 8.942   1.00 13.45 ? 194 LYS A CB  1 
ATOM   663  C CG  . LYS A 1 85 ? 24.147  29.383 8.632   1.00 15.20 ? 194 LYS A CG  1 
ATOM   664  N N   . LEU A 1 86 ? 23.088  33.114 11.275  1.00 12.47 ? 195 LEU A N   1 
ATOM   665  C CA  . LEU A 1 86 ? 22.677  34.461 11.581  1.00 12.28 ? 195 LEU A CA  1 
ATOM   666  C C   . LEU A 1 86 ? 23.681  35.401 10.978  1.00 12.77 ? 195 LEU A C   1 
ATOM   667  O O   . LEU A 1 86 ? 24.763  34.965 10.631  1.00 12.71 ? 195 LEU A O   1 
ATOM   668  C CB  . LEU A 1 86 ? 22.752  34.677 13.070  1.00 11.86 ? 195 LEU A CB  1 
ATOM   669  C CG  . LEU A 1 86 ? 21.937  33.744 13.941  1.00 11.20 ? 195 LEU A CG  1 
ATOM   670  C CD1 . LEU A 1 86 ? 22.293  33.946 15.412  1.00 11.24 ? 195 LEU A CD1 1 
ATOM   671  C CD2 . LEU A 1 86 ? 20.485  33.983 13.737  1.00 10.68 ? 195 LEU A CD2 1 
ATOM   672  N N   . ILE A 1 87 ? 23.368  36.695 10.925  1.00 14.55 ? 196 ILE A N   1 
ATOM   673  C CA  . ILE A 1 87 ? 24.268  37.719 10.349  1.00 15.82 ? 196 ILE A CA  1 
ATOM   674  C C   . ILE A 1 87 ? 24.116  38.959 11.182  1.00 16.64 ? 196 ILE A C   1 
ATOM   675  O O   . ILE A 1 87 ? 23.005  39.377 11.458  1.00 16.49 ? 196 ILE A O   1 
ATOM   676  C CB  . ILE A 1 87 ? 23.890  38.115 8.877   1.00 16.43 ? 196 ILE A CB  1 
ATOM   677  C CG1 . ILE A 1 87 ? 23.792  36.868 7.968   1.00 17.08 ? 196 ILE A CG1 1 
ATOM   678  C CG2 . ILE A 1 87 ? 24.922  39.131 8.319   1.00 16.24 ? 196 ILE A CG2 1 
ATOM   679  C CD1 . ILE A 1 87 ? 22.943  37.031 6.688   1.00 18.79 ? 196 ILE A CD1 1 
ATOM   680  N N   . GLU A 1 88 ? 25.231  39.552 11.568  1.00 18.14 ? 197 GLU A N   1 
ATOM   681  C CA  . GLU A 1 88 ? 25.226  40.727 12.427  1.00 19.53 ? 197 GLU A CA  1 
ATOM   682  C C   . GLU A 1 88 ? 25.565  41.906 11.521  1.00 19.67 ? 197 GLU A C   1 
ATOM   683  O O   . GLU A 1 88 ? 26.659  41.962 10.974  1.00 20.20 ? 197 GLU A O   1 
ATOM   684  C CB  . GLU A 1 88 ? 26.269  40.544 13.537  1.00 20.28 ? 197 GLU A CB  1 
ATOM   685  C CG  . GLU A 1 88 ? 26.193  41.552 14.688  1.00 23.17 ? 197 GLU A CG  1 
ATOM   686  C CD  . GLU A 1 88 ? 26.775  41.012 16.016  1.00 28.07 ? 197 GLU A CD  1 
ATOM   687  O OE1 . GLU A 1 88 ? 27.180  39.814 16.085  1.00 29.90 ? 197 GLU A OE1 1 
ATOM   688  O OE2 . GLU A 1 88 ? 26.814  41.797 16.999  1.00 30.32 ? 197 GLU A OE2 1 
ATOM   689  N N   . PRO A 1 89 ? 24.619  42.830 11.318  1.00 20.00 ? 198 PRO A N   1 
ATOM   690  C CA  . PRO A 1 89 ? 24.849  43.841 10.280  1.00 19.87 ? 198 PRO A CA  1 
ATOM   691  C C   . PRO A 1 89 ? 25.910  44.865 10.626  1.00 19.72 ? 198 PRO A C   1 
ATOM   692  O O   . PRO A 1 89 ? 26.283  45.016 11.793  1.00 19.58 ? 198 PRO A O   1 
ATOM   693  C CB  . PRO A 1 89 ? 23.479  44.535 10.136  1.00 19.82 ? 198 PRO A CB  1 
ATOM   694  C CG  . PRO A 1 89 ? 22.486  43.637 10.795  1.00 19.76 ? 198 PRO A CG  1 
ATOM   695  C CD  . PRO A 1 89 ? 23.259  42.931 11.882  1.00 20.20 ? 198 PRO A CD  1 
ATOM   696  N N   . LYS A 1 90 ? 26.376  45.557 9.591   1.00 19.90 ? 199 LYS A N   1 
ATOM   697  C CA  . LYS A 1 90 ? 27.428  46.551 9.708   1.00 20.03 ? 199 LYS A CA  1 
ATOM   698  C C   . LYS A 1 90 ? 26.827  47.872 10.097  1.00 19.45 ? 199 LYS A C   1 
ATOM   699  O O   . LYS A 1 90 ? 25.627  48.063 10.017  1.00 19.02 ? 199 LYS A O   1 
ATOM   700  C CB  . LYS A 1 90 ? 28.183  46.695 8.384   1.00 20.63 ? 199 LYS A CB  1 
ATOM   701  C CG  . LYS A 1 90 ? 29.168  45.564 8.096   1.00 23.13 ? 199 LYS A CG  1 
ATOM   702  C CD  . LYS A 1 90 ? 30.452  46.089 7.431   1.00 26.77 ? 199 LYS A CD  1 
ATOM   703  C CE  . LYS A 1 90 ? 31.381  44.946 6.953   1.00 29.21 ? 199 LYS A CE  1 
ATOM   704  N NZ  . LYS A 1 90 ? 31.753  45.068 5.465   1.00 31.13 ? 199 LYS A NZ  1 
ATOM   705  N N   . LYS A 1 91 ? 27.664  48.798 10.520  1.00 19.32 ? 200 LYS A N   1 
ATOM   706  C CA  . LYS A 1 91 ? 27.161  50.095 10.919  1.00 19.31 ? 200 LYS A CA  1 
ATOM   707  C C   . LYS A 1 91 ? 26.846  50.995 9.712   1.00 19.20 ? 200 LYS A C   1 
ATOM   708  O O   . LYS A 1 91 ? 26.031  51.902 9.831   1.00 19.40 ? 200 LYS A O   1 
ATOM   709  C CB  . LYS A 1 91 ? 28.137  50.748 11.899  1.00 19.15 ? 200 LYS A CB  1 
ATOM   710  C CG  . LYS A 1 91 ? 28.310  49.924 13.170  1.00 19.20 ? 200 LYS A CG  1 
ATOM   711  N N   . SER A 1 92 ? 27.483  50.738 8.566   1.00 18.86 ? 201 SER A N   1 
ATOM   712  C CA  . SER A 1 92 ? 27.314  51.556 7.347   1.00 18.95 ? 201 SER A CA  1 
ATOM   713  C C   . SER A 1 92 ? 27.157  50.676 6.133   1.00 18.49 ? 201 SER A C   1 
ATOM   714  O O   . SER A 1 92 ? 27.483  49.504 6.185   1.00 19.21 ? 201 SER A O   1 
ATOM   715  C CB  . SER A 1 92 ? 28.541  52.416 7.098   1.00 19.01 ? 201 SER A CB  1 
ATOM   716  O OG  . SER A 1 92 ? 28.791  53.262 8.199   1.00 20.85 ? 201 SER A OG  1 
ATOM   717  N N   . SER A 1 93 ? 26.683  51.244 5.037   1.00 17.77 ? 202 SER A N   1 
ATOM   718  C CA  . SER A 1 93 ? 26.548  50.504 3.785   1.00 17.84 ? 202 SER A CA  1 
ATOM   719  C C   . SER A 1 93 ? 26.958  51.370 2.607   1.00 17.33 ? 202 SER A C   1 
ATOM   720  O O   . SER A 1 93 ? 26.545  52.507 2.517   1.00 16.99 ? 202 SER A O   1 
ATOM   721  C CB  . SER A 1 93 ? 25.104  50.073 3.581   1.00 17.88 ? 202 SER A CB  1 
ATOM   722  O OG  . SER A 1 93 ? 24.584  49.515 4.769   1.00 19.48 ? 202 SER A OG  1 
ATOM   723  N N   . GLU A 1 94 ? 27.763  50.839 1.701   1.00 17.09 ? 203 GLU A N   1 
ATOM   724  C CA  . GLU A 1 94 ? 28.129  51.605 0.517   1.00 17.22 ? 203 GLU A CA  1 
ATOM   725  C C   . GLU A 1 94 ? 27.163  51.381 -0.633  1.00 16.33 ? 203 GLU A C   1 
ATOM   726  O O   . GLU A 1 94 ? 26.685  50.290 -0.840  1.00 16.70 ? 203 GLU A O   1 
ATOM   727  C CB  . GLU A 1 94 ? 29.562  51.295 0.085   1.00 17.51 ? 203 GLU A CB  1 
ATOM   728  C CG  . GLU A 1 94 ? 30.573  52.259 0.705   1.00 19.28 ? 203 GLU A CG  1 
ATOM   729  C CD  . GLU A 1 94 ? 31.984  51.681 0.799   1.00 21.93 ? 203 GLU A CD  1 
ATOM   730  O OE1 . GLU A 1 94 ? 32.581  51.343 -0.254  1.00 23.08 ? 203 GLU A OE1 1 
ATOM   731  O OE2 . GLU A 1 94 ? 32.505  51.578 1.941   1.00 25.48 ? 203 GLU A OE2 1 
ATOM   732  N N   . ALA A 1 95 ? 26.863  52.443 -1.360  1.00 15.75 ? 204 ALA A N   1 
ATOM   733  C CA  . ALA A 1 95 ? 26.208  52.339 -2.647  1.00 15.20 ? 204 ALA A CA  1 
ATOM   734  C C   . ALA A 1 95 ? 27.018  53.141 -3.653  1.00 14.67 ? 204 ALA A C   1 
ATOM   735  O O   . ALA A 1 95 ? 26.739  53.076 -4.834  1.00 14.39 ? 204 ALA A O   1 
ATOM   736  C CB  . ALA A 1 95 ? 24.794  52.851 -2.555  1.00 14.95 ? 204 ALA A CB  1 
ATOM   737  N N   . GLY B 1 4  ? 5.636   50.369 6.406   1.00 27.93 ? 113 GLY B N   1 
ATOM   738  C CA  . GLY B 1 4  ? 4.481   49.467 6.695   1.00 27.96 ? 113 GLY B CA  1 
ATOM   739  C C   . GLY B 1 4  ? 3.152   50.132 6.363   1.00 27.61 ? 113 GLY B C   1 
ATOM   740  O O   . GLY B 1 4  ? 3.097   51.065 5.526   1.00 28.33 ? 113 GLY B O   1 
ATOM   741  N N   . ILE B 1 5  ? 2.079   49.654 7.003   1.00 26.32 ? 114 ILE B N   1 
ATOM   742  C CA  . ILE B 1 5  ? 0.764   50.262 6.835   1.00 25.04 ? 114 ILE B CA  1 
ATOM   743  C C   . ILE B 1 5  ? 0.804   51.742 7.303   1.00 23.55 ? 114 ILE B C   1 
ATOM   744  O O   . ILE B 1 5  ? 1.067   52.085 8.461   1.00 22.58 ? 114 ILE B O   1 
ATOM   745  C CB  . ILE B 1 5  ? -0.403  49.377 7.425   1.00 25.12 ? 114 ILE B CB  1 
ATOM   746  C CG1 . ILE B 1 5  ? -0.685  48.179 6.486   1.00 26.38 ? 114 ILE B CG1 1 
ATOM   747  C CG2 . ILE B 1 5  ? -1.708  50.161 7.583   1.00 25.32 ? 114 ILE B CG2 1 
ATOM   748  C CD1 . ILE B 1 5  ? -0.968  48.535 4.961   1.00 26.65 ? 114 ILE B CD1 1 
ATOM   749  N N   . GLU B 1 6  ? 0.643   52.599 6.304   1.00 21.93 ? 115 GLU B N   1 
ATOM   750  C CA  . GLU B 1 6  ? 0.453   54.042 6.460   1.00 21.66 ? 115 GLU B CA  1 
ATOM   751  C C   . GLU B 1 6  ? -1.041  54.419 6.486   1.00 20.83 ? 115 GLU B C   1 
ATOM   752  O O   . GLU B 1 6  ? -1.848  53.846 5.780   1.00 20.85 ? 115 GLU B O   1 
ATOM   753  C CB  . GLU B 1 6  ? 1.180   54.757 5.323   1.00 21.89 ? 115 GLU B CB  1 
ATOM   754  C CG  . GLU B 1 6  ? 1.215   56.288 5.449   1.00 24.92 ? 115 GLU B CG  1 
ATOM   755  C CD  . GLU B 1 6  ? 2.095   56.999 4.416   1.00 29.04 ? 115 GLU B CD  1 
ATOM   756  O OE1 . GLU B 1 6  ? 1.575   57.674 3.502   1.00 31.83 ? 115 GLU B OE1 1 
ATOM   757  O OE2 . GLU B 1 6  ? 3.326   56.896 4.508   1.00 31.45 ? 115 GLU B OE2 1 
ATOM   758  N N   . LYS B 1 7  ? -1.416  55.356 7.337   1.00 20.13 ? 116 LYS B N   1 
ATOM   759  C CA  . LYS B 1 7  ? -2.799  55.813 7.430   1.00 19.65 ? 116 LYS B CA  1 
ATOM   760  C C   . LYS B 1 7  ? -2.829  57.330 7.358   1.00 19.29 ? 116 LYS B C   1 
ATOM   761  O O   . LYS B 1 7  ? -1.963  57.980 7.934   1.00 19.37 ? 116 LYS B O   1 
ATOM   762  C CB  . LYS B 1 7  ? -3.399  55.460 8.796   1.00 19.45 ? 116 LYS B CB  1 
ATOM   763  C CG  . LYS B 1 7  ? -3.391  54.016 9.145   1.00 20.04 ? 116 LYS B CG  1 
ATOM   764  C CD  . LYS B 1 7  ? -4.187  53.730 10.425  1.00 20.15 ? 116 LYS B CD  1 
ATOM   765  C CE  . LYS B 1 7  ? -3.368  54.016 11.698  1.00 20.38 ? 116 LYS B CE  1 
ATOM   766  N NZ  . LYS B 1 7  ? -3.780  53.190 12.897  1.00 19.39 ? 116 LYS B NZ  1 
ATOM   767  N N   . GLU B 1 8  ? -3.840  57.896 6.722   1.00 18.52 ? 117 GLU B N   1 
ATOM   768  C CA  . GLU B 1 8  ? -4.076  59.303 6.856   1.00 18.48 ? 117 GLU B CA  1 
ATOM   769  C C   . GLU B 1 8  ? -5.334  59.616 7.650   1.00 17.24 ? 117 GLU B C   1 
ATOM   770  O O   . GLU B 1 8  ? -6.342  59.012 7.435   1.00 17.30 ? 117 GLU B O   1 
ATOM   771  C CB  . GLU B 1 8  ? -4.155  59.972 5.498   1.00 19.07 ? 117 GLU B CB  1 
ATOM   772  C CG  . GLU B 1 8  ? -4.071  61.483 5.639   1.00 22.89 ? 117 GLU B CG  1 
ATOM   773  C CD  . GLU B 1 8  ? -4.251  62.210 4.347   1.00 28.69 ? 117 GLU B CD  1 
ATOM   774  O OE1 . GLU B 1 8  ? -5.394  62.648 4.092   1.00 33.06 ? 117 GLU B OE1 1 
ATOM   775  O OE2 . GLU B 1 8  ? -3.258  62.331 3.584   1.00 31.31 ? 117 GLU B OE2 1 
ATOM   776  N N   . VAL B 1 9  ? -5.282  60.613 8.524   1.00 16.11 ? 118 VAL B N   1 
ATOM   777  C CA  . VAL B 1 9  ? -6.426  60.972 9.349   1.00 15.61 ? 118 VAL B CA  1 
ATOM   778  C C   . VAL B 1 9  ? -6.672  62.469 9.396   1.00 15.53 ? 118 VAL B C   1 
ATOM   779  O O   . VAL B 1 9  ? -5.742  63.247 9.413   1.00 15.45 ? 118 VAL B O   1 
ATOM   780  C CB  . VAL B 1 9  ? -6.250  60.471 10.790  1.00 15.36 ? 118 VAL B CB  1 
ATOM   781  C CG1 . VAL B 1 9  ? -6.067  58.980 10.793  1.00 15.27 ? 118 VAL B CG1 1 
ATOM   782  C CG2 . VAL B 1 9  ? -5.085  61.131 11.461  1.00 15.15 ? 118 VAL B CG2 1 
ATOM   783  N N   . ASN B 1 10 ? -7.934  62.869 9.423   1.00 15.38 ? 119 ASN B N   1 
ATOM   784  C CA  . ASN B 1 10 ? -8.278  64.243 9.700   1.00 15.31 ? 119 ASN B CA  1 
ATOM   785  C C   . ASN B 1 10 ? -8.897  64.328 11.065  1.00 14.70 ? 119 ASN B C   1 
ATOM   786  O O   . ASN B 1 10 ? -9.679  63.475 11.468  1.00 15.06 ? 119 ASN B O   1 
ATOM   787  C CB  . ASN B 1 10 ? -9.241  64.762 8.668   1.00 15.69 ? 119 ASN B CB  1 
ATOM   788  C CG  . ASN B 1 10 ? -8.685  64.620 7.245   1.00 17.50 ? 119 ASN B CG  1 
ATOM   789  O OD1 . ASN B 1 10 ? -7.783  65.356 6.816   1.00 22.54 ? 119 ASN B OD1 1 
ATOM   790  N ND2 . ASN B 1 10 ? -9.228  63.665 6.508   1.00 17.67 ? 119 ASN B ND2 1 
ATOM   791  N N   . VAL B 1 11 ? -8.532  65.367 11.783  1.00 14.08 ? 120 VAL B N   1 
ATOM   792  C CA  . VAL B 1 11 ? -9.012  65.552 13.123  1.00 13.77 ? 120 VAL B CA  1 
ATOM   793  C C   . VAL B 1 11 ? -9.410  67.010 13.293  1.00 13.80 ? 120 VAL B C   1 
ATOM   794  O O   . VAL B 1 11 ? -8.728  67.928 12.833  1.00 13.75 ? 120 VAL B O   1 
ATOM   795  C CB  . VAL B 1 11 ? -7.923  65.177 14.131  1.00 13.73 ? 120 VAL B CB  1 
ATOM   796  C CG1 . VAL B 1 11 ? -8.454  65.356 15.547  1.00 12.85 ? 120 VAL B CG1 1 
ATOM   797  C CG2 . VAL B 1 11 ? -7.490  63.771 13.894  1.00 12.23 ? 120 VAL B CG2 1 
ATOM   798  N N   . TYR B 1 12 ? -10.524 67.216 13.964  1.00 13.94 ? 121 TYR B N   1 
ATOM   799  C CA  . TYR B 1 12 ? -10.956 68.565 14.297  1.00 14.25 ? 121 TYR B CA  1 
ATOM   800  C C   . TYR B 1 12 ? -10.556 68.878 15.736  1.00 14.73 ? 121 TYR B C   1 
ATOM   801  O O   . TYR B 1 12 ? -10.999 68.204 16.659  1.00 15.07 ? 121 TYR B O   1 
ATOM   802  C CB  . TYR B 1 12 ? -12.459 68.640 14.149  1.00 13.90 ? 121 TYR B CB  1 
ATOM   803  C CG  . TYR B 1 12 ? -13.020 70.015 14.297  1.00 13.84 ? 121 TYR B CG  1 
ATOM   804  C CD1 . TYR B 1 12 ? -12.888 70.958 13.272  1.00 13.98 ? 121 TYR B CD1 1 
ATOM   805  C CD2 . TYR B 1 12 ? -13.722 70.379 15.441  1.00 14.26 ? 121 TYR B CD2 1 
ATOM   806  C CE1 . TYR B 1 12 ? -13.425 72.237 13.395  1.00 14.09 ? 121 TYR B CE1 1 
ATOM   807  C CE2 . TYR B 1 12 ? -14.265 71.651 15.579  1.00 14.01 ? 121 TYR B CE2 1 
ATOM   808  C CZ  . TYR B 1 12 ? -14.114 72.576 14.556  1.00 14.91 ? 121 TYR B CZ  1 
ATOM   809  O OH  . TYR B 1 12 ? -14.650 73.841 14.704  1.00 16.40 ? 121 TYR B OH  1 
ATOM   810  N N   . LYS B 1 13 ? -9.705  69.885 15.915  1.00 15.56 ? 122 LYS B N   1 
ATOM   811  C CA  . LYS B 1 13 ? -9.246  70.286 17.242  1.00 16.18 ? 122 LYS B CA  1 
ATOM   812  C C   . LYS B 1 13 ? -10.321 71.162 17.859  1.00 17.25 ? 122 LYS B C   1 
ATOM   813  O O   . LYS B 1 13 ? -10.264 72.391 17.756  1.00 17.26 ? 122 LYS B O   1 
ATOM   814  C CB  . LYS B 1 13 ? -7.908  71.044 17.161  1.00 15.91 ? 122 LYS B CB  1 
ATOM   815  C CG  . LYS B 1 13 ? -7.303  71.365 18.513  1.00 16.20 ? 122 LYS B CG  1 
ATOM   816  C CD  . LYS B 1 13 ? -5.968  72.067 18.407  1.00 16.51 ? 122 LYS B CD  1 
ATOM   817  C CE  . LYS B 1 13 ? -5.279  72.191 19.780  1.00 17.19 ? 122 LYS B CE  1 
ATOM   818  N NZ  . LYS B 1 13 ? -4.050  73.021 19.690  1.00 16.48 ? 122 LYS B NZ  1 
ATOM   819  N N   . SER B 1 14 ? -11.306 70.534 18.492  1.00 18.45 ? 123 SER B N   1 
ATOM   820  C CA  . SER B 1 14 ? -12.405 71.280 19.115  1.00 19.74 ? 123 SER B CA  1 
ATOM   821  C C   . SER B 1 14 ? -12.020 71.890 20.464  1.00 20.46 ? 123 SER B C   1 
ATOM   822  O O   . SER B 1 14 ? -12.549 72.916 20.824  1.00 21.24 ? 123 SER B O   1 
ATOM   823  C CB  . SER B 1 14 ? -13.642 70.397 19.261  1.00 19.65 ? 123 SER B CB  1 
ATOM   824  O OG  . SER B 1 14 ? -13.285 69.122 19.727  1.00 20.60 ? 123 SER B OG  1 
ATOM   825  N N   . GLU B 1 15 ? -11.113 71.248 21.193  1.00 21.30 ? 124 GLU B N   1 
ATOM   826  C CA  . GLU B 1 15 ? -10.731 71.658 22.545  1.00 22.02 ? 124 GLU B CA  1 
ATOM   827  C C   . GLU B 1 15 ? -9.289  72.107 22.583  1.00 21.86 ? 124 GLU B C   1 
ATOM   828  O O   . GLU B 1 15 ? -8.523  71.906 21.641  1.00 21.94 ? 124 GLU B O   1 
ATOM   829  C CB  . GLU B 1 15 ? -10.840 70.483 23.524  1.00 22.40 ? 124 GLU B CB  1 
ATOM   830  C CG  . GLU B 1 15 ? -12.177 69.801 23.553  1.00 24.76 ? 124 GLU B CG  1 
ATOM   831  C CD  . GLU B 1 15 ? -13.227 70.646 24.198  1.00 27.14 ? 124 GLU B CD  1 
ATOM   832  O OE1 . GLU B 1 15 ? -12.894 71.324 25.182  1.00 29.17 ? 124 GLU B OE1 1 
ATOM   833  O OE2 . GLU B 1 15 ? -14.386 70.622 23.731  1.00 29.18 ? 124 GLU B OE2 1 
ATOM   834  N N   . ASP B 1 16 ? -8.922  72.690 23.716  1.00 21.83 ? 125 ASP B N   1 
ATOM   835  C CA  . ASP B 1 16 ? -7.537  73.071 23.972  1.00 21.81 ? 125 ASP B CA  1 
ATOM   836  C C   . ASP B 1 16 ? -6.654  71.842 23.932  1.00 20.86 ? 125 ASP B C   1 
ATOM   837  O O   . ASP B 1 16 ? -5.555  71.899 23.413  1.00 21.05 ? 125 ASP B O   1 
ATOM   838  C CB  . ASP B 1 16 ? -7.397  73.739 25.347  1.00 22.29 ? 125 ASP B CB  1 
ATOM   839  C CG  . ASP B 1 16 ? -7.913  75.178 25.370  1.00 24.05 ? 125 ASP B CG  1 
ATOM   840  O OD1 . ASP B 1 16 ? -7.590  75.936 24.419  1.00 26.39 ? 125 ASP B OD1 1 
ATOM   841  O OD2 . ASP B 1 16 ? -8.616  75.547 26.357  1.00 25.16 ? 125 ASP B OD2 1 
ATOM   842  N N   . SER B 1 17 ? -7.157  70.740 24.478  1.00 19.89 ? 126 SER B N   1 
ATOM   843  C CA  . SER B 1 17 ? -6.376  69.528 24.659  1.00 19.18 ? 126 SER B CA  1 
ATOM   844  C C   . SER B 1 17 ? -6.930  68.438 23.766  1.00 18.31 ? 126 SER B C   1 
ATOM   845  O O   . SER B 1 17 ? -8.147  68.263 23.680  1.00 18.45 ? 126 SER B O   1 
ATOM   846  C CB  . SER B 1 17 ? -6.440  69.081 26.122  1.00 19.29 ? 126 SER B CB  1 
ATOM   847  O OG  . SER B 1 17 ? -5.861  67.796 26.282  1.00 20.00 ? 126 SER B OG  1 
ATOM   848  N N   . LEU B 1 18 ? -6.040  67.715 23.096  1.00 17.10 ? 127 LEU B N   1 
ATOM   849  C CA  . LEU B 1 18 ? -6.445  66.660 22.168  1.00 16.27 ? 127 LEU B CA  1 
ATOM   850  C C   . LEU B 1 18 ? -6.617  65.317 22.858  1.00 16.20 ? 127 LEU B C   1 
ATOM   851  O O   . LEU B 1 18 ? -7.266  64.427 22.306  1.00 16.43 ? 127 LEU B O   1 
ATOM   852  C CB  . LEU B 1 18 ? -5.411  66.520 21.056  1.00 16.08 ? 127 LEU B CB  1 
ATOM   853  C CG  . LEU B 1 18 ? -5.374  67.633 20.009  1.00 15.13 ? 127 LEU B CG  1 
ATOM   854  C CD1 . LEU B 1 18 ? -4.050  67.589 19.294  1.00 12.82 ? 127 LEU B CD1 1 
ATOM   855  C CD2 . LEU B 1 18 ? -6.564  67.490 19.031  1.00 14.13 ? 127 LEU B CD2 1 
ATOM   856  N N   . GLY B 1 19 ? -6.021  65.163 24.046  1.00 16.02 ? 128 GLY B N   1 
ATOM   857  C CA  . GLY B 1 19 ? -6.155  63.952 24.826  1.00 15.72 ? 128 GLY B CA  1 
ATOM   858  C C   . GLY B 1 19 ? -5.263  62.835 24.381  1.00 15.86 ? 128 GLY B C   1 
ATOM   859  O O   . GLY B 1 19 ? -5.736  61.708 24.218  1.00 16.77 ? 128 GLY B O   1 
ATOM   860  N N   . LEU B 1 20 ? -3.978  63.116 24.190  1.00 15.82 ? 129 LEU B N   1 
ATOM   861  C CA  . LEU B 1 20 ? -2.991  62.052 23.909  1.00 15.75 ? 129 LEU B CA  1 
ATOM   862  C C   . LEU B 1 20 ? -1.630  62.340 24.491  1.00 15.54 ? 129 LEU B C   1 
ATOM   863  O O   . LEU B 1 20 ? -1.327  63.473 24.816  1.00 15.53 ? 129 LEU B O   1 
ATOM   864  C CB  . LEU B 1 20 ? -2.849  61.771 22.411  1.00 15.80 ? 129 LEU B CB  1 
ATOM   865  C CG  . LEU B 1 20 ? -2.040  62.728 21.556  1.00 15.84 ? 129 LEU B CG  1 
ATOM   866  C CD1 . LEU B 1 20 ? -1.984  62.229 20.130  1.00 14.58 ? 129 LEU B CD1 1 
ATOM   867  C CD2 . LEU B 1 20 ? -2.686  64.068 21.592  1.00 16.01 ? 129 LEU B CD2 1 
ATOM   868  N N   . THR B 1 21 ? -0.845  61.278 24.665  1.00 15.46 ? 130 THR B N   1 
ATOM   869  C CA  . THR B 1 21 ? 0.500   61.359 25.219  1.00 15.03 ? 130 THR B CA  1 
ATOM   870  C C   . THR B 1 21 ? 1.443   60.765 24.204  1.00 14.78 ? 130 THR B C   1 
ATOM   871  O O   . THR B 1 21 ? 1.180   59.688 23.662  1.00 14.65 ? 130 THR B O   1 
ATOM   872  C CB  . THR B 1 21 ? 0.614   60.602 26.548  1.00 14.95 ? 130 THR B CB  1 
ATOM   873  O OG1 . THR B 1 21 ? -0.404  61.077 27.420  1.00 15.31 ? 130 THR B OG1 1 
ATOM   874  C CG2 . THR B 1 21 ? 1.980   60.829 27.224  1.00 14.53 ? 130 THR B CG2 1 
ATOM   875  N N   . ILE B 1 22 ? 2.544   61.469 23.972  1.00 14.77 ? 131 ILE B N   1 
ATOM   876  C CA  . ILE B 1 22 ? 3.502   61.141 22.934  1.00 14.89 ? 131 ILE B CA  1 
ATOM   877  C C   . ILE B 1 22 ? 4.815   60.785 23.586  1.00 14.66 ? 131 ILE B C   1 
ATOM   878  O O   . ILE B 1 22 ? 5.255   61.446 24.505  1.00 14.73 ? 131 ILE B O   1 
ATOM   879  C CB  . ILE B 1 22 ? 3.683   62.354 21.996  1.00 15.26 ? 131 ILE B CB  1 
ATOM   880  C CG1 . ILE B 1 22 ? 2.365   62.608 21.282  1.00 16.75 ? 131 ILE B CG1 1 
ATOM   881  C CG2 . ILE B 1 22 ? 4.766   62.120 20.927  1.00 14.57 ? 131 ILE B CG2 1 
ATOM   882  C CD1 . ILE B 1 22 ? 2.432   63.811 20.419  1.00 20.30 ? 131 ILE B CD1 1 
ATOM   883  N N   . THR B 1 23 ? 5.433   59.729 23.100  1.00 14.51 ? 132 THR B N   1 
ATOM   884  C CA  . THR B 1 23 ? 6.718   59.317 23.611  1.00 14.89 ? 132 THR B CA  1 
ATOM   885  C C   . THR B 1 23 ? 7.657   58.946 22.481  1.00 14.76 ? 132 THR B C   1 
ATOM   886  O O   . THR B 1 23 ? 7.269   58.927 21.333  1.00 14.62 ? 132 THR B O   1 
ATOM   887  C CB  . THR B 1 23 ? 6.556   58.101 24.525  1.00 15.05 ? 132 THR B CB  1 
ATOM   888  O OG1 . THR B 1 23 ? 7.700   57.972 25.348  1.00 15.84 ? 132 THR B OG1 1 
ATOM   889  C CG2 . THR B 1 23 ? 6.391   56.839 23.722  1.00 15.42 ? 132 THR B CG2 1 
ATOM   890  N N   . ASP B 1 24 ? 8.899   58.669 22.839  1.00 15.10 ? 133 ASP B N   1 
ATOM   891  C CA  . ASP B 1 24 ? 9.867   58.052 21.949  1.00 15.29 ? 133 ASP B CA  1 
ATOM   892  C C   . ASP B 1 24 ? 10.871  57.265 22.787  1.00 14.99 ? 133 ASP B C   1 
ATOM   893  O O   . ASP B 1 24 ? 10.811  57.301 24.000  1.00 14.47 ? 133 ASP B O   1 
ATOM   894  C CB  . ASP B 1 24 ? 10.566  59.094 21.066  1.00 15.30 ? 133 ASP B CB  1 
ATOM   895  C CG  . ASP B 1 24 ? 11.426  60.082 21.850  1.00 16.84 ? 133 ASP B CG  1 
ATOM   896  O OD1 . ASP B 1 24 ? 12.057  59.677 22.854  1.00 19.02 ? 133 ASP B OD1 1 
ATOM   897  O OD2 . ASP B 1 24 ? 11.502  61.276 21.439  1.00 16.97 ? 133 ASP B OD2 1 
ATOM   898  N N   . ASN B 1 25 ? 11.790  56.576 22.124  1.00 15.16 ? 134 ASN B N   1 
ATOM   899  C CA  . ASN B 1 25 ? 12.781  55.738 22.775  1.00 15.51 ? 134 ASN B CA  1 
ATOM   900  C C   . ASN B 1 25 ? 14.150  56.386 22.935  1.00 15.32 ? 134 ASN B C   1 
ATOM   901  O O   . ASN B 1 25 ? 15.178  55.705 22.849  1.00 14.86 ? 134 ASN B O   1 
ATOM   902  C CB  . ASN B 1 25 ? 12.936  54.454 21.976  1.00 16.03 ? 134 ASN B CB  1 
ATOM   903  C CG  . ASN B 1 25 ? 11.816  53.478 22.226  1.00 17.46 ? 134 ASN B CG  1 
ATOM   904  O OD1 . ASN B 1 25 ? 11.219  53.452 23.309  1.00 20.30 ? 134 ASN B OD1 1 
ATOM   905  N ND2 . ASN B 1 25 ? 11.526  52.649 21.226  1.00 18.44 ? 134 ASN B ND2 1 
ATOM   906  N N   . GLY B 1 26 ? 14.159  57.701 23.144  1.00 15.37 ? 135 GLY B N   1 
ATOM   907  C CA  . GLY B 1 26 ? 15.376  58.433 23.395  1.00 15.58 ? 135 GLY B CA  1 
ATOM   908  C C   . GLY B 1 26 ? 16.031  59.077 22.192  1.00 16.01 ? 135 GLY B C   1 
ATOM   909  O O   . GLY B 1 26 ? 16.757  60.044 22.354  1.00 16.13 ? 135 GLY B O   1 
ATOM   910  N N   . VAL B 1 27 ? 15.795  58.578 20.984  1.00 16.34 ? 136 VAL B N   1 
ATOM   911  C CA  . VAL B 1 27 ? 16.506  59.114 19.826  1.00 16.68 ? 136 VAL B CA  1 
ATOM   912  C C   . VAL B 1 27 ? 15.587  59.915 18.899  1.00 17.10 ? 136 VAL B C   1 
ATOM   913  O O   . VAL B 1 27 ? 15.929  61.009 18.455  1.00 17.67 ? 136 VAL B O   1 
ATOM   914  C CB  . VAL B 1 27 ? 17.226  58.025 19.059  1.00 16.62 ? 136 VAL B CB  1 
ATOM   915  C CG1 . VAL B 1 27 ? 17.892  58.610 17.855  1.00 16.30 ? 136 VAL B CG1 1 
ATOM   916  C CG2 . VAL B 1 27 ? 18.222  57.352 19.954  1.00 15.54 ? 136 VAL B CG2 1 
ATOM   917  N N   . GLY B 1 28 ? 14.414  59.384 18.617  1.00 17.20 ? 137 GLY B N   1 
ATOM   918  C CA  . GLY B 1 28 ? 13.424  60.141 17.857  1.00 17.04 ? 137 GLY B CA  1 
ATOM   919  C C   . GLY B 1 28 ? 12.272  59.290 17.408  1.00 16.55 ? 137 GLY B C   1 
ATOM   920  O O   . GLY B 1 28 ? 12.071  58.196 17.938  1.00 17.00 ? 137 GLY B O   1 
ATOM   921  N N   . TYR B 1 29 ? 11.513  59.821 16.447  1.00 16.62 ? 138 TYR B N   1 
ATOM   922  C CA  . TYR B 1 29 ? 10.405  59.127 15.773  1.00 15.92 ? 138 TYR B CA  1 
ATOM   923  C C   . TYR B 1 29 ? 9.312   58.832 16.761  1.00 15.35 ? 138 TYR B C   1 
ATOM   924  O O   . TYR B 1 29 ? 9.183   57.703 17.223  1.00 14.67 ? 138 TYR B O   1 
ATOM   925  C CB  . TYR B 1 29 ? 10.934  57.839 15.164  1.00 15.91 ? 138 TYR B CB  1 
ATOM   926  C CG  . TYR B 1 29 ? 10.060  57.156 14.157  1.00 17.53 ? 138 TYR B CG  1 
ATOM   927  C CD1 . TYR B 1 29 ? 10.150  55.780 13.975  1.00 18.62 ? 138 TYR B CD1 1 
ATOM   928  C CD2 . TYR B 1 29 ? 9.149   57.860 13.373  1.00 18.14 ? 138 TYR B CD2 1 
ATOM   929  C CE1 . TYR B 1 29 ? 9.372   55.125 13.046  1.00 18.40 ? 138 TYR B CE1 1 
ATOM   930  C CE2 . TYR B 1 29 ? 8.366   57.201 12.437  1.00 18.65 ? 138 TYR B CE2 1 
ATOM   931  C CZ  . TYR B 1 29 ? 8.486   55.833 12.283  1.00 18.59 ? 138 TYR B CZ  1 
ATOM   932  O OH  . TYR B 1 29 ? 7.721   55.161 11.358  1.00 18.79 ? 138 TYR B OH  1 
ATOM   933  N N   . ALA B 1 30 ? 8.510   59.848 17.063  1.00 15.40 ? 139 ALA B N   1 
ATOM   934  C CA  . ALA B 1 30 ? 7.625   59.791 18.202  1.00 14.92 ? 139 ALA B CA  1 
ATOM   935  C C   . ALA B 1 30 ? 6.398   58.941 17.903  1.00 14.95 ? 139 ALA B C   1 
ATOM   936  O O   . ALA B 1 30 ? 5.952   58.868 16.776  1.00 14.72 ? 139 ALA B O   1 
ATOM   937  C CB  . ALA B 1 30 ? 7.202   61.190 18.603  1.00 14.91 ? 139 ALA B CB  1 
ATOM   938  N N   . PHE B 1 31 ? 5.832   58.340 18.944  1.00 14.87 ? 140 PHE B N   1 
ATOM   939  C CA  . PHE B 1 31 ? 4.604   57.587 18.827  1.00 14.70 ? 140 PHE B CA  1 
ATOM   940  C C   . PHE B 1 31 ? 3.654   57.829 19.979  1.00 14.88 ? 140 PHE B C   1 
ATOM   941  O O   . PHE B 1 31 ? 4.010   58.477 20.957  1.00 16.10 ? 140 PHE B O   1 
ATOM   942  C CB  . PHE B 1 31 ? 4.925   56.122 18.675  1.00 14.73 ? 140 PHE B CB  1 
ATOM   943  C CG  . PHE B 1 31 ? 5.683   55.522 19.828  1.00 14.62 ? 140 PHE B CG  1 
ATOM   944  C CD1 . PHE B 1 31 ? 5.008   54.937 20.884  1.00 14.72 ? 140 PHE B CD1 1 
ATOM   945  C CD2 . PHE B 1 31 ? 7.069   55.459 19.809  1.00 13.97 ? 140 PHE B CD2 1 
ATOM   946  C CE1 . PHE B 1 31 ? 5.693   54.345 21.924  1.00 14.13 ? 140 PHE B CE1 1 
ATOM   947  C CE2 . PHE B 1 31 ? 7.763   54.868 20.842  1.00 14.57 ? 140 PHE B CE2 1 
ATOM   948  C CZ  . PHE B 1 31 ? 7.073   54.310 21.924  1.00 13.63 ? 140 PHE B CZ  1 
ATOM   949  N N   . ILE B 1 32 ? 2.437   57.328 19.839  1.00 14.60 ? 141 ILE B N   1 
ATOM   950  C CA  . ILE B 1 32 ? 1.374   57.564 20.794  1.00 14.31 ? 141 ILE B CA  1 
ATOM   951  C C   . ILE B 1 32 ? 1.481   56.547 21.946  1.00 14.77 ? 141 ILE B C   1 
ATOM   952  O O   . ILE B 1 32 ? 1.490   55.334 21.744  1.00 14.48 ? 141 ILE B O   1 
ATOM   953  C CB  . ILE B 1 32 ? -0.003  57.443 20.110  1.00 13.85 ? 141 ILE B CB  1 
ATOM   954  C CG1 . ILE B 1 32 ? -0.111  58.466 18.973  1.00 13.36 ? 141 ILE B CG1 1 
ATOM   955  C CG2 . ILE B 1 32 ? -1.116  57.674 21.121  1.00 13.26 ? 141 ILE B CG2 1 
ATOM   956  C CD1 . ILE B 1 32 ? -1.391  58.464 18.230  1.00 11.28 ? 141 ILE B CD1 1 
ATOM   957  N N   . LYS B 1 33 ? 1.574   57.053 23.165  1.00 15.26 ? 142 LYS B N   1 
ATOM   958  C CA  . LYS B 1 33 ? 1.709   56.186 24.318  1.00 15.89 ? 142 LYS B CA  1 
ATOM   959  C C   . LYS B 1 33 ? 0.347   55.949 24.961  1.00 16.26 ? 142 LYS B C   1 
ATOM   960  O O   . LYS B 1 33 ? 0.040   54.836 25.398  1.00 16.34 ? 142 LYS B O   1 
ATOM   961  C CB  . LYS B 1 33 ? 2.669   56.807 25.321  1.00 15.68 ? 142 LYS B CB  1 
ATOM   962  C CG  . LYS B 1 33 ? 3.152   55.823 26.349  1.00 16.70 ? 142 LYS B CG  1 
ATOM   963  C CD  . LYS B 1 33 ? 3.837   56.522 27.528  1.00 17.75 ? 142 LYS B CD  1 
ATOM   964  C CE  . LYS B 1 33 ? 4.437   55.530 28.505  1.00 18.25 ? 142 LYS B CE  1 
ATOM   965  N NZ  . LYS B 1 33 ? 4.922   56.273 29.713  1.00 20.21 ? 142 LYS B NZ  1 
ATOM   966  N N   . ARG B 1 34 ? -0.468  56.997 25.011  1.00 16.73 ? 143 ARG B N   1 
ATOM   967  C CA  . ARG B 1 34 ? -1.783  56.931 25.646  1.00 17.22 ? 143 ARG B CA  1 
ATOM   968  C C   . ARG B 1 34 ? -2.763  57.725 24.847  1.00 16.63 ? 143 ARG B C   1 
ATOM   969  O O   . ARG B 1 34 ? -2.402  58.736 24.240  1.00 16.39 ? 143 ARG B O   1 
ATOM   970  C CB  . ARG B 1 34 ? -1.744  57.538 27.055  1.00 17.88 ? 143 ARG B CB  1 
ATOM   971  C CG  . ARG B 1 34 ? -1.397  56.573 28.128  1.00 20.65 ? 143 ARG B CG  1 
ATOM   972  C CD  . ARG B 1 34 ? -1.131  57.259 29.440  1.00 25.00 ? 143 ARG B CD  1 
ATOM   973  N NE  . ARG B 1 34 ? -0.735  56.238 30.409  1.00 30.30 ? 143 ARG B NE  1 
ATOM   974  C CZ  . ARG B 1 34 ? 0.498   56.021 30.875  1.00 33.38 ? 143 ARG B CZ  1 
ATOM   975  N NH1 . ARG B 1 34 ? 1.526   56.787 30.511  1.00 34.73 ? 143 ARG B NH1 1 
ATOM   976  N NH2 . ARG B 1 34 ? 0.698   55.024 31.742  1.00 33.91 ? 143 ARG B NH2 1 
ATOM   977  N N   . ILE B 1 35 ? -4.007  57.265 24.866  1.00 16.63 ? 144 ILE B N   1 
ATOM   978  C CA  . ILE B 1 35 ? -5.135  58.015 24.328  1.00 16.56 ? 144 ILE B CA  1 
ATOM   979  C C   . ILE B 1 35 ? -6.163  58.131 25.441  1.00 16.54 ? 144 ILE B C   1 
ATOM   980  O O   . ILE B 1 35 ? -6.595  57.130 25.966  1.00 15.63 ? 144 ILE B O   1 
ATOM   981  C CB  . ILE B 1 35 ? -5.760  57.318 23.105  1.00 16.44 ? 144 ILE B CB  1 
ATOM   982  C CG1 . ILE B 1 35 ? -4.776  57.336 21.940  1.00 15.83 ? 144 ILE B CG1 1 
ATOM   983  C CG2 . ILE B 1 35 ? -7.047  58.035 22.669  1.00 16.60 ? 144 ILE B CG2 1 
ATOM   984  C CD1 . ILE B 1 35 ? -5.202  56.463 20.727  1.00 14.42 ? 144 ILE B CD1 1 
ATOM   985  N N   . LYS B 1 36 ? -6.532  59.366 25.783  1.00 17.31 ? 145 LYS B N   1 
ATOM   986  C CA  . LYS B 1 36 ? -7.409  59.646 26.915  1.00 17.99 ? 145 LYS B CA  1 
ATOM   987  C C   . LYS B 1 36 ? -8.871  59.374 26.589  1.00 18.25 ? 145 LYS B C   1 
ATOM   988  O O   . LYS B 1 36 ? -9.405  59.925 25.620  1.00 18.40 ? 145 LYS B O   1 
ATOM   989  C CB  . LYS B 1 36 ? -7.244  61.104 27.362  1.00 18.09 ? 145 LYS B CB  1 
ATOM   990  C CG  . LYS B 1 36 ? -8.237  61.509 28.438  1.00 19.95 ? 145 LYS B CG  1 
ATOM   991  C CD  . LYS B 1 36 ? -7.785  62.668 29.334  1.00 21.66 ? 145 LYS B CD  1 
ATOM   992  C CE  . LYS B 1 36 ? -8.878  62.984 30.359  1.00 23.21 ? 145 LYS B CE  1 
ATOM   993  N NZ  . LYS B 1 36 ? -8.390  63.870 31.461  1.00 25.05 ? 145 LYS B NZ  1 
ATOM   994  N N   . ASP B 1 37 ? -9.523  58.550 27.412  1.00 18.79 ? 146 ASP B N   1 
ATOM   995  C CA  . ASP B 1 37 ? -10.960 58.252 27.245  1.00 19.50 ? 146 ASP B CA  1 
ATOM   996  C C   . ASP B 1 37 ? -11.808 59.506 27.158  1.00 18.67 ? 146 ASP B C   1 
ATOM   997  O O   . ASP B 1 37 ? -11.740 60.393 28.024  1.00 18.45 ? 146 ASP B O   1 
ATOM   998  C CB  . ASP B 1 37 ? -11.505 57.393 28.403  1.00 20.38 ? 146 ASP B CB  1 
ATOM   999  C CG  . ASP B 1 37 ? -11.224 55.898 28.214  1.00 24.32 ? 146 ASP B CG  1 
ATOM   1000 O OD1 . ASP B 1 37 ? -10.753 55.516 27.111  1.00 29.69 ? 146 ASP B OD1 1 
ATOM   1001 O OD2 . ASP B 1 37 ? -11.453 55.098 29.159  1.00 28.54 ? 146 ASP B OD2 1 
ATOM   1002 N N   . GLY B 1 38 ? -12.604 59.572 26.099  1.00 17.68 ? 147 GLY B N   1 
ATOM   1003 C CA  . GLY B 1 38 ? -13.547 60.665 25.921  1.00 17.12 ? 147 GLY B CA  1 
ATOM   1004 C C   . GLY B 1 38 ? -12.975 61.942 25.361  1.00 16.45 ? 147 GLY B C   1 
ATOM   1005 O O   . GLY B 1 38 ? -13.684 62.938 25.307  1.00 16.74 ? 147 GLY B O   1 
ATOM   1006 N N   . GLY B 1 39 ? -11.709 61.927 24.951  1.00 15.64 ? 148 GLY B N   1 
ATOM   1007 C CA  . GLY B 1 39 ? -11.094 63.089 24.312  1.00 14.92 ? 148 GLY B CA  1 
ATOM   1008 C C   . GLY B 1 39 ? -11.275 63.071 22.809  1.00 14.51 ? 148 GLY B C   1 
ATOM   1009 O O   . GLY B 1 39 ? -11.886 62.135 22.244  1.00 14.15 ? 148 GLY B O   1 
ATOM   1010 N N   . VAL B 1 40 ? -10.720 64.092 22.147  1.00 14.20 ? 149 VAL B N   1 
ATOM   1011 C CA  . VAL B 1 40 ? -10.854 64.222 20.698  1.00 13.74 ? 149 VAL B CA  1 
ATOM   1012 C C   . VAL B 1 40 ? -10.216 63.070 19.924  1.00 13.72 ? 149 VAL B C   1 
ATOM   1013 O O   . VAL B 1 40 ? -10.812 62.575 18.988  1.00 14.37 ? 149 VAL B O   1 
ATOM   1014 C CB  . VAL B 1 40 ? -10.270 65.550 20.201  1.00 14.02 ? 149 VAL B CB  1 
ATOM   1015 C CG1 . VAL B 1 40 ? -10.178 65.583 18.632  1.00 13.24 ? 149 VAL B CG1 1 
ATOM   1016 C CG2 . VAL B 1 40 ? -11.115 66.717 20.711  1.00 12.84 ? 149 VAL B CG2 1 
ATOM   1017 N N   . ILE B 1 41 ? -9.020  62.643 20.311  1.00 13.15 ? 150 ILE B N   1 
ATOM   1018 C CA  . ILE B 1 41 ? -8.347  61.563 19.609  1.00 12.81 ? 150 ILE B CA  1 
ATOM   1019 C C   . ILE B 1 41 ? -9.057  60.248 19.814  1.00 13.46 ? 150 ILE B C   1 
ATOM   1020 O O   . ILE B 1 41 ? -9.131  59.445 18.897  1.00 14.08 ? 150 ILE B O   1 
ATOM   1021 C CB  . ILE B 1 41 ? -6.867  61.446 20.020  1.00 12.68 ? 150 ILE B CB  1 
ATOM   1022 C CG1 . ILE B 1 41 ? -6.110  62.732 19.650  1.00 12.75 ? 150 ILE B CG1 1 
ATOM   1023 C CG2 . ILE B 1 41 ? -6.180  60.290 19.340  1.00 10.92 ? 150 ILE B CG2 1 
ATOM   1024 C CD1 . ILE B 1 41 ? -6.044  63.038 18.176  1.00 9.98  ? 150 ILE B CD1 1 
ATOM   1025 N N   . ASP B 1 42 ? -9.600  60.031 21.010  1.00 14.06 ? 151 ASP B N   1 
ATOM   1026 C CA  . ASP B 1 42 ? -10.385 58.812 21.309  1.00 14.50 ? 151 ASP B CA  1 
ATOM   1027 C C   . ASP B 1 42 ? -11.574 58.609 20.377  1.00 14.53 ? 151 ASP B C   1 
ATOM   1028 O O   . ASP B 1 42 ? -11.924 57.491 20.051  1.00 15.32 ? 151 ASP B O   1 
ATOM   1029 C CB  . ASP B 1 42 ? -10.885 58.826 22.770  1.00 14.74 ? 151 ASP B CB  1 
ATOM   1030 C CG  . ASP B 1 42 ? -11.516 57.523 23.177  1.00 16.10 ? 151 ASP B CG  1 
ATOM   1031 O OD1 . ASP B 1 42 ? -11.031 56.469 22.727  1.00 19.15 ? 151 ASP B OD1 1 
ATOM   1032 O OD2 . ASP B 1 42 ? -12.510 57.538 23.940  1.00 17.82 ? 151 ASP B OD2 1 
ATOM   1033 N N   . SER B 1 43 ? -12.189 59.686 19.936  1.00 14.72 ? 152 SER B N   1 
ATOM   1034 C CA  . SER B 1 43 ? -13.328 59.575 19.051  1.00 15.08 ? 152 SER B CA  1 
ATOM   1035 C C   . SER B 1 43 ? -12.934 59.208 17.608  1.00 15.24 ? 152 SER B C   1 
ATOM   1036 O O   . SER B 1 43 ? -13.802 58.794 16.830  1.00 15.12 ? 152 SER B O   1 
ATOM   1037 C CB  . SER B 1 43 ? -14.089 60.893 19.039  1.00 15.16 ? 152 SER B CB  1 
ATOM   1038 O OG  . SER B 1 43 ? -13.327 61.850 18.325  1.00 16.68 ? 152 SER B OG  1 
ATOM   1039 N N   . VAL B 1 44 ? -11.654 59.375 17.249  1.00 15.25 ? 153 VAL B N   1 
ATOM   1040 C CA  . VAL B 1 44 ? -11.175 59.033 15.900  1.00 15.55 ? 153 VAL B CA  1 
ATOM   1041 C C   . VAL B 1 44 ? -10.530 57.662 15.916  1.00 15.99 ? 153 VAL B C   1 
ATOM   1042 O O   . VAL B 1 44 ? -9.357  57.541 16.123  1.00 16.48 ? 153 VAL B O   1 
ATOM   1043 C CB  . VAL B 1 44 ? -10.137 60.082 15.374  1.00 15.64 ? 153 VAL B CB  1 
ATOM   1044 C CG1 . VAL B 1 44 ? -9.624  59.710 14.004  1.00 14.50 ? 153 VAL B CG1 1 
ATOM   1045 C CG2 . VAL B 1 44 ? -10.732 61.485 15.348  1.00 14.72 ? 153 VAL B CG2 1 
ATOM   1046 N N   . LYS B 1 45 ? -11.303 56.621 15.650  1.00 17.03 ? 154 LYS B N   1 
ATOM   1047 C CA  . LYS B 1 45 ? -10.875 55.263 15.987  1.00 17.61 ? 154 LYS B CA  1 
ATOM   1048 C C   . LYS B 1 45 ? -9.780  54.673 15.102  1.00 17.98 ? 154 LYS B C   1 
ATOM   1049 O O   . LYS B 1 45 ? -9.219  53.642 15.431  1.00 18.40 ? 154 LYS B O   1 
ATOM   1050 C CB  . LYS B 1 45 ? -12.077 54.346 16.054  1.00 17.89 ? 154 LYS B CB  1 
ATOM   1051 C CG  . LYS B 1 45 ? -13.124 54.800 17.100  1.00 19.01 ? 154 LYS B CG  1 
ATOM   1052 C CD  . LYS B 1 45 ? -12.622 54.719 18.528  1.00 19.68 ? 154 LYS B CD  1 
ATOM   1053 C CE  . LYS B 1 45 ? -13.776 54.881 19.517  1.00 20.67 ? 154 LYS B CE  1 
ATOM   1054 N NZ  . LYS B 1 45 ? -13.299 55.312 20.863  1.00 20.64 ? 154 LYS B NZ  1 
ATOM   1055 N N   . THR B 1 46 ? -9.447  55.327 13.996  1.00 18.04 ? 155 THR B N   1 
ATOM   1056 C CA  . THR B 1 46 ? -8.364  54.849 13.167  1.00 17.87 ? 155 THR B CA  1 
ATOM   1057 C C   . THR B 1 46 ? -6.997  55.193 13.812  1.00 17.92 ? 155 THR B C   1 
ATOM   1058 O O   . THR B 1 46 ? -5.949  54.696 13.384  1.00 18.59 ? 155 THR B O   1 
ATOM   1059 C CB  . THR B 1 46 ? -8.445  55.437 11.746  1.00 18.02 ? 155 THR B CB  1 
ATOM   1060 O OG1 . THR B 1 46 ? -8.449  56.866 11.830  1.00 19.60 ? 155 THR B OG1 1 
ATOM   1061 C CG2 . THR B 1 46 ? -9.723  54.987 11.015  1.00 17.51 ? 155 THR B CG2 1 
ATOM   1062 N N   . ILE B 1 47 ? -6.989  56.043 14.829  1.00 17.09 ? 156 ILE B N   1 
ATOM   1063 C CA  . ILE B 1 47 ? -5.746  56.353 15.545  1.00 16.53 ? 156 ILE B CA  1 
ATOM   1064 C C   . ILE B 1 47 ? -5.568  55.411 16.745  1.00 16.79 ? 156 ILE B C   1 
ATOM   1065 O O   . ILE B 1 47 ? -6.482  55.308 17.556  1.00 17.51 ? 156 ILE B O   1 
ATOM   1066 C CB  . ILE B 1 47 ? -5.771  57.787 16.078  1.00 16.04 ? 156 ILE B CB  1 
ATOM   1067 C CG1 . ILE B 1 47 ? -5.915  58.764 14.919  1.00 16.49 ? 156 ILE B CG1 1 
ATOM   1068 C CG2 . ILE B 1 47 ? -4.493  58.106 16.791  1.00 14.66 ? 156 ILE B CG2 1 
ATOM   1069 C CD1 . ILE B 1 47 ? -5.983  60.222 15.321  1.00 15.09 ? 156 ILE B CD1 1 
ATOM   1070 N N   . CYS B 1 48 ? -4.406  54.765 16.879  1.00 16.53 ? 157 CYS B N   1 
ATOM   1071 C CA  . CYS B 1 48 ? -4.162  53.795 17.962  1.00 17.23 ? 157 CYS B CA  1 
ATOM   1072 C C   . CYS B 1 48 ? -2.891  53.999 18.745  1.00 15.93 ? 157 CYS B C   1 
ATOM   1073 O O   . CYS B 1 48 ? -1.888  54.449 18.174  1.00 15.29 ? 157 CYS B O   1 
ATOM   1074 C CB  . CYS B 1 48 ? -4.042  52.390 17.413  1.00 17.51 ? 157 CYS B CB  1 
ATOM   1075 S SG  . CYS B 1 48 ? -5.312  52.049 16.226  1.00 23.98 ? 157 CYS B SG  1 
ATOM   1076 N N   . VAL B 1 49 ? -2.935  53.562 20.012  1.00 14.40 ? 158 VAL B N   1 
ATOM   1077 C CA  . VAL B 1 49 ? -1.761  53.468 20.840  1.00 13.53 ? 158 VAL B CA  1 
ATOM   1078 C C   . VAL B 1 49 ? -0.731  52.688 20.051  1.00 13.47 ? 158 VAL B C   1 
ATOM   1079 O O   . VAL B 1 49 ? -1.066  51.660 19.432  1.00 13.35 ? 158 VAL B O   1 
ATOM   1080 C CB  . VAL B 1 49 ? -2.053  52.741 22.192  1.00 13.75 ? 158 VAL B CB  1 
ATOM   1081 C CG1 . VAL B 1 49 ? -0.761  52.372 22.882  1.00 11.55 ? 158 VAL B CG1 1 
ATOM   1082 C CG2 . VAL B 1 49 ? -2.878  53.618 23.096  1.00 12.15 ? 158 VAL B CG2 1 
ATOM   1083 N N   . GLY B 1 50 ? 0.496   53.213 20.011  1.00 13.21 ? 159 GLY B N   1 
ATOM   1084 C CA  . GLY B 1 50 ? 1.579   52.604 19.244  1.00 13.53 ? 159 GLY B CA  1 
ATOM   1085 C C   . GLY B 1 50 ? 1.831   53.231 17.879  1.00 14.15 ? 159 GLY B C   1 
ATOM   1086 O O   . GLY B 1 50 ? 2.914   53.057 17.314  1.00 14.69 ? 159 GLY B O   1 
ATOM   1087 N N   . ASP B 1 51 ? 0.848   53.941 17.322  1.00 14.28 ? 160 ASP B N   1 
ATOM   1088 C CA  . ASP B 1 51 ? 1.039   54.554 16.018  1.00 14.56 ? 160 ASP B CA  1 
ATOM   1089 C C   . ASP B 1 51 ? 2.163   55.594 16.094  1.00 14.09 ? 160 ASP B C   1 
ATOM   1090 O O   . ASP B 1 51 ? 2.225   56.377 17.025  1.00 13.41 ? 160 ASP B O   1 
ATOM   1091 C CB  . ASP B 1 51 ? -0.266  55.190 15.491  1.00 15.12 ? 160 ASP B CB  1 
ATOM   1092 C CG  . ASP B 1 51 ? -1.297  54.146 15.017  1.00 16.61 ? 160 ASP B CG  1 
ATOM   1093 O OD1 . ASP B 1 51 ? -1.006  52.934 15.023  1.00 19.41 ? 160 ASP B OD1 1 
ATOM   1094 O OD2 . ASP B 1 51 ? -2.425  54.536 14.668  1.00 18.65 ? 160 ASP B OD2 1 
ATOM   1095 N N   . HIS B 1 52 ? 3.044   55.577 15.095  1.00 13.86 ? 161 HIS B N   1 
ATOM   1096 C CA  . HIS B 1 52 ? 4.104   56.572 14.940  1.00 13.67 ? 161 HIS B CA  1 
ATOM   1097 C C   . HIS B 1 52 ? 3.568   57.733 14.089  1.00 13.82 ? 161 HIS B C   1 
ATOM   1098 O O   . HIS B 1 52 ? 2.842   57.492 13.115  1.00 14.05 ? 161 HIS B O   1 
ATOM   1099 C CB  . HIS B 1 52 ? 5.290   55.931 14.218  1.00 13.60 ? 161 HIS B CB  1 
ATOM   1100 C CG  . HIS B 1 52 ? 6.053   54.971 15.058  1.00 14.65 ? 161 HIS B CG  1 
ATOM   1101 N ND1 . HIS B 1 52 ? 7.335   55.218 15.501  1.00 15.05 ? 161 HIS B ND1 1 
ATOM   1102 C CD2 . HIS B 1 52 ? 5.692   53.770 15.573  1.00 15.72 ? 161 HIS B CD2 1 
ATOM   1103 C CE1 . HIS B 1 52 ? 7.738   54.197 16.234  1.00 15.86 ? 161 HIS B CE1 1 
ATOM   1104 N NE2 . HIS B 1 52 ? 6.758   53.311 16.302  1.00 15.92 ? 161 HIS B NE2 1 
ATOM   1105 N N   . ILE B 1 53 ? 3.896   58.976 14.449  1.00 13.77 ? 162 ILE B N   1 
ATOM   1106 C CA  . ILE B 1 53 ? 3.461   60.138 13.676  1.00 14.00 ? 162 ILE B CA  1 
ATOM   1107 C C   . ILE B 1 53 ? 4.516   60.561 12.658  1.00 14.28 ? 162 ILE B C   1 
ATOM   1108 O O   . ILE B 1 53 ? 5.597   61.039 13.016  1.00 14.08 ? 162 ILE B O   1 
ATOM   1109 C CB  . ILE B 1 53 ? 3.108   61.350 14.550  1.00 14.18 ? 162 ILE B CB  1 
ATOM   1110 C CG1 . ILE B 1 53 ? 1.961   61.035 15.519  1.00 15.21 ? 162 ILE B CG1 1 
ATOM   1111 C CG2 . ILE B 1 53 ? 2.548   62.491 13.681  1.00 14.06 ? 162 ILE B CG2 1 
ATOM   1112 C CD1 . ILE B 1 53 ? 2.251   61.370 16.918  1.00 16.14 ? 162 ILE B CD1 1 
ATOM   1113 N N   . GLU B 1 54 ? 4.171   60.410 11.388  1.00 13.85 ? 163 GLU B N   1 
ATOM   1114 C CA  . GLU B 1 54 ? 5.084   60.702 10.335  1.00 14.43 ? 163 GLU B CA  1 
ATOM   1115 C C   . GLU B 1 54 ? 5.037   62.197 9.946   1.00 14.21 ? 163 GLU B C   1 
ATOM   1116 O O   . GLU B 1 54 ? 6.052   62.809 9.609   1.00 13.70 ? 163 GLU B O   1 
ATOM   1117 C CB  . GLU B 1 54 ? 4.762   59.789 9.158   1.00 14.85 ? 163 GLU B CB  1 
ATOM   1118 C CG  . GLU B 1 54 ? 5.424   60.172 7.838   1.00 17.51 ? 163 GLU B CG  1 
ATOM   1119 C CD  . GLU B 1 54 ? 5.325   59.073 6.788   1.00 21.74 ? 163 GLU B CD  1 
ATOM   1120 O OE1 . GLU B 1 54 ? 4.416   58.226 6.868   1.00 23.05 ? 163 GLU B OE1 1 
ATOM   1121 O OE2 . GLU B 1 54 ? 6.161   59.055 5.864   1.00 24.29 ? 163 GLU B OE2 1 
ATOM   1122 N N   . SER B 1 55 ? 3.854   62.792 9.982   1.00 14.17 ? 164 SER B N   1 
ATOM   1123 C CA  . SER B 1 55 ? 3.716   64.190 9.618   1.00 13.79 ? 164 SER B CA  1 
ATOM   1124 C C   . SER B 1 55 ? 2.475   64.852 10.193  1.00 13.53 ? 164 SER B C   1 
ATOM   1125 O O   . SER B 1 55 ? 1.521   64.196 10.518  1.00 12.69 ? 164 SER B O   1 
ATOM   1126 C CB  . SER B 1 55 ? 3.723   64.341 8.098   1.00 13.98 ? 164 SER B CB  1 
ATOM   1127 O OG  . SER B 1 55 ? 2.566   63.793 7.482   1.00 12.94 ? 164 SER B OG  1 
ATOM   1128 N N   . ILE B 1 56 ? 2.527   66.171 10.313  1.00 14.04 ? 165 ILE B N   1 
ATOM   1129 C CA  . ILE B 1 56 ? 1.392   66.995 10.732  1.00 14.36 ? 165 ILE B CA  1 
ATOM   1130 C C   . ILE B 1 56 ? 1.182   68.111 9.694   1.00 14.24 ? 165 ILE B C   1 
ATOM   1131 O O   . ILE B 1 56 ? 2.106   68.867 9.357   1.00 15.02 ? 165 ILE B O   1 
ATOM   1132 C CB  . ILE B 1 56 ? 1.669   67.618 12.083  1.00 14.68 ? 165 ILE B CB  1 
ATOM   1133 C CG1 . ILE B 1 56 ? 1.761   66.532 13.163  1.00 16.05 ? 165 ILE B CG1 1 
ATOM   1134 C CG2 . ILE B 1 56 ? 0.581   68.603 12.457  1.00 15.22 ? 165 ILE B CG2 1 
ATOM   1135 C CD1 . ILE B 1 56 ? 2.457   66.997 14.443  1.00 16.46 ? 165 ILE B CD1 1 
ATOM   1136 N N   . ASN B 1 57 ? -0.022  68.207 9.169   1.00 13.92 ? 166 ASN B N   1 
ATOM   1137 C CA  . ASN B 1 57 ? -0.316  69.125 8.071   1.00 13.97 ? 166 ASN B CA  1 
ATOM   1138 C C   . ASN B 1 57 ? 0.751   69.089 6.971   1.00 14.19 ? 166 ASN B C   1 
ATOM   1139 O O   . ASN B 1 57 ? 1.153   70.121 6.457   1.00 14.05 ? 166 ASN B O   1 
ATOM   1140 C CB  . ASN B 1 57 ? -0.517  70.553 8.590   1.00 13.59 ? 166 ASN B CB  1 
ATOM   1141 C CG  . ASN B 1 57 ? -1.827  70.733 9.341   1.00 13.08 ? 166 ASN B CG  1 
ATOM   1142 O OD1 . ASN B 1 57 ? -2.820  70.077 9.046   1.00 11.79 ? 166 ASN B OD1 1 
ATOM   1143 N ND2 . ASN B 1 57 ? -1.837  71.642 10.308  1.00 12.15 ? 166 ASN B ND2 1 
ATOM   1144 N N   . GLY B 1 58 ? 1.221   67.899 6.614   1.00 14.56 ? 167 GLY B N   1 
ATOM   1145 C CA  . GLY B 1 58 ? 2.215   67.776 5.546   1.00 14.86 ? 167 GLY B CA  1 
ATOM   1146 C C   . GLY B 1 58 ? 3.662   68.094 5.910   1.00 15.32 ? 167 GLY B C   1 
ATOM   1147 O O   . GLY B 1 58 ? 4.559   67.948 5.079   1.00 15.01 ? 167 GLY B O   1 
ATOM   1148 N N   . GLU B 1 59 ? 3.896   68.501 7.159   1.00 15.97 ? 168 GLU B N   1 
ATOM   1149 C CA  . GLU B 1 59 ? 5.236   68.790 7.641   1.00 16.77 ? 168 GLU B CA  1 
ATOM   1150 C C   . GLU B 1 59 ? 5.905   67.547 8.249   1.00 16.61 ? 168 GLU B C   1 
ATOM   1151 O O   . GLU B 1 59 ? 5.428   66.983 9.231   1.00 16.75 ? 168 GLU B O   1 
ATOM   1152 C CB  . GLU B 1 59 ? 5.192   69.898 8.676   1.00 17.09 ? 168 GLU B CB  1 
ATOM   1153 C CG  . GLU B 1 59 ? 6.569   70.353 9.133   1.00 19.02 ? 168 GLU B CG  1 
ATOM   1154 C CD  . GLU B 1 59 ? 6.510   71.484 10.160  1.00 21.20 ? 168 GLU B CD  1 
ATOM   1155 O OE1 . GLU B 1 59 ? 5.401   71.899 10.519  1.00 24.96 ? 168 GLU B OE1 1 
ATOM   1156 O OE2 . GLU B 1 59 ? 7.572   71.952 10.630  1.00 22.48 ? 168 GLU B OE2 1 
ATOM   1157 N N   . ASN B 1 60 ? 7.006   67.115 7.653   1.00 16.35 ? 169 ASN B N   1 
ATOM   1158 C CA  . ASN B 1 60 ? 7.637   65.903 8.101   1.00 16.47 ? 169 ASN B CA  1 
ATOM   1159 C C   . ASN B 1 60 ? 8.194   66.034 9.538   1.00 16.05 ? 169 ASN B C   1 
ATOM   1160 O O   . ASN B 1 60 ? 8.918   66.952 9.839   1.00 15.82 ? 169 ASN B O   1 
ATOM   1161 C CB  . ASN B 1 60 ? 8.744   65.500 7.156   1.00 16.45 ? 169 ASN B CB  1 
ATOM   1162 C CG  . ASN B 1 60 ? 9.212   64.097 7.423   1.00 17.50 ? 169 ASN B CG  1 
ATOM   1163 O OD1 . ASN B 1 60 ? 9.448   63.738 8.554   1.00 18.24 ? 169 ASN B OD1 1 
ATOM   1164 N ND2 . ASN B 1 60 ? 9.364   63.306 6.380   1.00 19.46 ? 169 ASN B ND2 1 
ATOM   1165 N N   . ILE B 1 61 ? 7.861   65.104 10.415  1.00 15.39 ? 170 ILE B N   1 
ATOM   1166 C CA  . ILE B 1 61 ? 8.409   65.141 11.750  1.00 15.38 ? 170 ILE B CA  1 
ATOM   1167 C C   . ILE B 1 61 ? 9.132   63.844 12.232  1.00 15.39 ? 170 ILE B C   1 
ATOM   1168 O O   . ILE B 1 61 ? 9.518   63.734 13.389  1.00 15.63 ? 170 ILE B O   1 
ATOM   1169 C CB  . ILE B 1 61 ? 7.355   65.497 12.775  1.00 15.35 ? 170 ILE B CB  1 
ATOM   1170 C CG1 . ILE B 1 61 ? 6.442   64.306 12.962  1.00 15.62 ? 170 ILE B CG1 1 
ATOM   1171 C CG2 . ILE B 1 61 ? 6.640   66.766 12.386  1.00 13.66 ? 170 ILE B CG2 1 
ATOM   1172 C CD1 . ILE B 1 61 ? 5.307   64.523 13.943  1.00 15.81 ? 170 ILE B CD1 1 
ATOM   1173 N N   . VAL B 1 62 ? 9.297   62.846 11.384  1.00 14.84 ? 171 VAL B N   1 
ATOM   1174 C CA  . VAL B 1 62 ? 10.182  61.737 11.712  1.00 15.10 ? 171 VAL B CA  1 
ATOM   1175 C C   . VAL B 1 62 ? 11.539  62.267 12.270  1.00 16.59 ? 171 VAL B C   1 
ATOM   1176 O O   . VAL B 1 62 ? 12.152  63.237 11.745  1.00 17.82 ? 171 VAL B O   1 
ATOM   1177 C CB  . VAL B 1 62 ? 10.447  60.934 10.440  1.00 14.57 ? 171 VAL B CB  1 
ATOM   1178 C CG1 . VAL B 1 62 ? 11.285  59.735 10.700  1.00 14.29 ? 171 VAL B CG1 1 
ATOM   1179 C CG2 . VAL B 1 62 ? 9.159   60.532 9.824   1.00 13.93 ? 171 VAL B CG2 1 
ATOM   1180 N N   . GLY B 1 63 ? 12.051  61.656 13.319  1.00 16.66 ? 172 GLY B N   1 
ATOM   1181 C CA  . GLY B 1 63 ? 13.294  62.200 13.914  1.00 17.08 ? 172 GLY B CA  1 
ATOM   1182 C C   . GLY B 1 63 ? 13.133  63.462 14.756  1.00 16.81 ? 172 GLY B C   1 
ATOM   1183 O O   . GLY B 1 63 ? 14.116  64.033 15.206  1.00 17.29 ? 172 GLY B O   1 
ATOM   1184 N N   . TRP B 1 64 ? 11.908  63.907 14.971  1.00 16.46 ? 173 TRP B N   1 
ATOM   1185 C CA  . TRP B 1 64 ? 11.654  64.893 16.009  1.00 16.28 ? 173 TRP B CA  1 
ATOM   1186 C C   . TRP B 1 64 ? 11.510  64.150 17.330  1.00 15.96 ? 173 TRP B C   1 
ATOM   1187 O O   . TRP B 1 64 ? 11.050  63.028 17.343  1.00 16.14 ? 173 TRP B O   1 
ATOM   1188 C CB  . TRP B 1 64 ? 10.370  65.621 15.732  1.00 16.64 ? 173 TRP B CB  1 
ATOM   1189 C CG  . TRP B 1 64 ? 10.430  66.610 14.631  1.00 16.98 ? 173 TRP B CG  1 
ATOM   1190 C CD1 . TRP B 1 64 ? 11.238  66.585 13.551  1.00 17.27 ? 173 TRP B CD1 1 
ATOM   1191 C CD2 . TRP B 1 64 ? 9.589   67.745 14.480  1.00 17.38 ? 173 TRP B CD2 1 
ATOM   1192 N NE1 . TRP B 1 64 ? 10.984  67.660 12.745  1.00 16.59 ? 173 TRP B NE1 1 
ATOM   1193 C CE2 . TRP B 1 64 ? 9.964   68.384 13.285  1.00 16.99 ? 173 TRP B CE2 1 
ATOM   1194 C CE3 . TRP B 1 64 ? 8.550   68.288 15.246  1.00 18.24 ? 173 TRP B CE3 1 
ATOM   1195 C CZ2 . TRP B 1 64 ? 9.351   69.540 12.824  1.00 17.92 ? 173 TRP B CZ2 1 
ATOM   1196 C CZ3 . TRP B 1 64 ? 7.930   69.453 14.797  1.00 19.00 ? 173 TRP B CZ3 1 
ATOM   1197 C CH2 . TRP B 1 64 ? 8.342   70.069 13.585  1.00 19.13 ? 173 TRP B CH2 1 
ATOM   1198 N N   . ARG B 1 65 ? 11.916  64.762 18.431  1.00 15.55 ? 174 ARG B N   1 
ATOM   1199 C CA  . ARG B 1 65 ? 11.678  64.194 19.755  1.00 15.28 ? 174 ARG B CA  1 
ATOM   1200 C C   . ARG B 1 65 ? 10.246  64.457 20.179  1.00 15.49 ? 174 ARG B C   1 
ATOM   1201 O O   . ARG B 1 65 ? 9.580   65.314 19.615  1.00 15.79 ? 174 ARG B O   1 
ATOM   1202 C CB  . ARG B 1 65 ? 12.624  64.816 20.774  1.00 15.21 ? 174 ARG B CB  1 
ATOM   1203 C CG  . ARG B 1 65 ? 14.090  64.604 20.494  1.00 14.37 ? 174 ARG B CG  1 
ATOM   1204 C CD  . ARG B 1 65 ? 14.452  63.149 20.467  1.00 14.65 ? 174 ARG B CD  1 
ATOM   1205 N NE  . ARG B 1 65 ? 13.973  62.435 21.647  1.00 14.89 ? 174 ARG B NE  1 
ATOM   1206 C CZ  . ARG B 1 65 ? 14.549  62.463 22.850  1.00 13.64 ? 174 ARG B CZ  1 
ATOM   1207 N NH1 . ARG B 1 65 ? 15.633  63.188 23.061  1.00 11.59 ? 174 ARG B NH1 1 
ATOM   1208 N NH2 . ARG B 1 65 ? 14.036  61.753 23.843  1.00 13.25 ? 174 ARG B NH2 1 
ATOM   1209 N N   . HIS B 1 66 ? 9.767   63.709 21.163  1.00 15.78 ? 175 HIS B N   1 
ATOM   1210 C CA  . HIS B 1 66 ? 8.369   63.773 21.588  1.00 15.63 ? 175 HIS B CA  1 
ATOM   1211 C C   . HIS B 1 66 ? 7.902   65.143 22.013  1.00 16.24 ? 175 HIS B C   1 
ATOM   1212 O O   . HIS B 1 66 ? 6.829   65.544 21.647  1.00 16.72 ? 175 HIS B O   1 
ATOM   1213 C CB  . HIS B 1 66 ? 8.083   62.731 22.667  1.00 15.45 ? 175 HIS B CB  1 
ATOM   1214 C CG  . HIS B 1 66 ? 8.847   62.922 23.938  1.00 15.17 ? 175 HIS B CG  1 
ATOM   1215 N ND1 . HIS B 1 66 ? 8.385   63.709 24.966  1.00 14.56 ? 175 HIS B ND1 1 
ATOM   1216 C CD2 . HIS B 1 66 ? 10.014  62.393 24.366  1.00 14.17 ? 175 HIS B CD2 1 
ATOM   1217 C CE1 . HIS B 1 66 ? 9.247   63.681 25.960  1.00 14.63 ? 175 HIS B CE1 1 
ATOM   1218 N NE2 . HIS B 1 66 ? 10.235  62.873 25.628  1.00 14.61 ? 175 HIS B NE2 1 
ATOM   1219 N N   . TYR B 1 67 ? 8.721   65.886 22.738  1.00 16.96 ? 176 TYR B N   1 
ATOM   1220 C CA  . TYR B 1 67 ? 8.365   67.256 23.128  1.00 17.66 ? 176 TYR B CA  1 
ATOM   1221 C C   . TYR B 1 67 ? 8.193   68.213 21.957  1.00 17.55 ? 176 TYR B C   1 
ATOM   1222 O O   . TYR B 1 67 ? 7.401   69.135 22.024  1.00 17.64 ? 176 TYR B O   1 
ATOM   1223 C CB  . TYR B 1 67 ? 9.352   67.856 24.149  1.00 17.88 ? 176 TYR B CB  1 
ATOM   1224 C CG  . TYR B 1 67 ? 10.832  67.624 23.877  1.00 19.66 ? 176 TYR B CG  1 
ATOM   1225 C CD1 . TYR B 1 67 ? 11.522  66.611 24.539  1.00 21.36 ? 176 TYR B CD1 1 
ATOM   1226 C CD2 . TYR B 1 67 ? 11.534  68.397 22.970  1.00 20.67 ? 176 TYR B CD2 1 
ATOM   1227 C CE1 . TYR B 1 67 ? 12.858  66.377 24.308  1.00 21.81 ? 176 TYR B CE1 1 
ATOM   1228 C CE2 . TYR B 1 67 ? 12.869  68.160 22.723  1.00 21.38 ? 176 TYR B CE2 1 
ATOM   1229 C CZ  . TYR B 1 67 ? 13.522  67.160 23.402  1.00 22.58 ? 176 TYR B CZ  1 
ATOM   1230 O OH  . TYR B 1 67 ? 14.848  66.948 23.179  1.00 24.41 ? 176 TYR B OH  1 
ATOM   1231 N N   . ASP B 1 68 ? 8.951   68.025 20.893  1.00 18.04 ? 177 ASP B N   1 
ATOM   1232 C CA  . ASP B 1 68 ? 8.838   68.909 19.734  1.00 18.58 ? 177 ASP B CA  1 
ATOM   1233 C C   . ASP B 1 68 ? 7.560   68.596 18.997  1.00 18.49 ? 177 ASP B C   1 
ATOM   1234 O O   . ASP B 1 68 ? 6.926   69.492 18.451  1.00 18.38 ? 177 ASP B O   1 
ATOM   1235 C CB  . ASP B 1 68 ? 10.007  68.714 18.783  1.00 18.84 ? 177 ASP B CB  1 
ATOM   1236 C CG  . ASP B 1 68 ? 11.300  69.330 19.305  1.00 19.90 ? 177 ASP B CG  1 
ATOM   1237 O OD1 . ASP B 1 68 ? 11.250  70.424 19.924  1.00 18.63 ? 177 ASP B OD1 1 
ATOM   1238 O OD2 . ASP B 1 68 ? 12.375  68.705 19.065  1.00 22.17 ? 177 ASP B OD2 1 
ATOM   1239 N N   . VAL B 1 69 ? 7.206   67.316 18.981  1.00 18.32 ? 178 VAL B N   1 
ATOM   1240 C CA  . VAL B 1 69 ? 6.002   66.874 18.353  1.00 18.42 ? 178 VAL B CA  1 
ATOM   1241 C C   . VAL B 1 69 ? 4.782   67.374 19.105  1.00 18.71 ? 178 VAL B C   1 
ATOM   1242 O O   . VAL B 1 69 ? 3.843   67.879 18.488  1.00 18.98 ? 178 VAL B O   1 
ATOM   1243 C CB  . VAL B 1 69 ? 5.971   65.369 18.242  1.00 18.78 ? 178 VAL B CB  1 
ATOM   1244 C CG1 . VAL B 1 69 ? 4.553   64.900 17.873  1.00 18.68 ? 178 VAL B CG1 1 
ATOM   1245 C CG2 . VAL B 1 69 ? 6.983   64.903 17.212  1.00 17.36 ? 178 VAL B CG2 1 
ATOM   1246 N N   . ALA B 1 70 ? 4.802   67.271 20.424  1.00 18.55 ? 179 ALA B N   1 
ATOM   1247 C CA  . ALA B 1 70 ? 3.699   67.761 21.239  1.00 18.63 ? 179 ALA B CA  1 
ATOM   1248 C C   . ALA B 1 70 ? 3.579   69.279 21.125  1.00 18.75 ? 179 ALA B C   1 
ATOM   1249 O O   . ALA B 1 70 ? 2.498   69.821 21.121  1.00 18.79 ? 179 ALA B O   1 
ATOM   1250 C CB  . ALA B 1 70 ? 3.893   67.346 22.701  1.00 18.19 ? 179 ALA B CB  1 
ATOM   1251 N N   . LYS B 1 71 ? 4.695   69.975 21.041  1.00 19.28 ? 180 LYS B N   1 
ATOM   1252 C CA  . LYS B 1 71 ? 4.651   71.418 20.866  1.00 19.93 ? 180 LYS B CA  1 
ATOM   1253 C C   . LYS B 1 71 ? 3.881   71.786 19.596  1.00 19.86 ? 180 LYS B C   1 
ATOM   1254 O O   . LYS B 1 71 ? 3.041   72.671 19.620  1.00 19.73 ? 180 LYS B O   1 
ATOM   1255 C CB  . LYS B 1 71 ? 6.055   72.011 20.813  1.00 19.93 ? 180 LYS B CB  1 
ATOM   1256 C CG  . LYS B 1 71 ? 6.087   73.538 20.887  1.00 21.80 ? 180 LYS B CG  1 
ATOM   1257 C CD  . LYS B 1 71 ? 7.354   74.034 21.620  1.00 24.58 ? 180 LYS B CD  1 
ATOM   1258 C CE  . LYS B 1 71 ? 7.268   75.492 22.018  1.00 26.53 ? 180 LYS B CE  1 
ATOM   1259 N NZ  . LYS B 1 71 ? 8.079   75.783 23.220  1.00 27.53 ? 180 LYS B NZ  1 
ATOM   1260 N N   . LYS B 1 72 ? 4.181   71.116 18.492  1.00 19.84 ? 181 LYS B N   1 
ATOM   1261 C CA  . LYS B 1 72 ? 3.544   71.420 17.223  1.00 20.42 ? 181 LYS B CA  1 
ATOM   1262 C C   . LYS B 1 72 ? 2.053   71.210 17.324  1.00 20.09 ? 181 LYS B C   1 
ATOM   1263 O O   . LYS B 1 72 ? 1.266   72.046 16.909  1.00 19.95 ? 181 LYS B O   1 
ATOM   1264 C CB  . LYS B 1 72 ? 4.118   70.547 16.112  1.00 20.64 ? 181 LYS B CB  1 
ATOM   1265 C CG  . LYS B 1 72 ? 3.656   70.910 14.733  1.00 22.03 ? 181 LYS B CG  1 
ATOM   1266 C CD  . LYS B 1 72 ? 4.176   72.269 14.345  1.00 24.88 ? 181 LYS B CD  1 
ATOM   1267 C CE  . LYS B 1 72 ? 3.765   72.644 12.946  1.00 25.66 ? 181 LYS B CE  1 
ATOM   1268 N NZ  . LYS B 1 72 ? 4.538   73.869 12.556  1.00 26.58 ? 181 LYS B NZ  1 
ATOM   1269 N N   . LEU B 1 73 ? 1.668   70.088 17.905  1.00 20.05 ? 182 LEU B N   1 
ATOM   1270 C CA  . LEU B 1 73 ? 0.257   69.792 18.135  1.00 19.91 ? 182 LEU B CA  1 
ATOM   1271 C C   . LEU B 1 73 ? -0.455  70.830 19.011  1.00 20.44 ? 182 LEU B C   1 
ATOM   1272 O O   . LEU B 1 73 ? -1.596  71.207 18.725  1.00 20.82 ? 182 LEU B O   1 
ATOM   1273 C CB  . LEU B 1 73 ? 0.107   68.404 18.744  1.00 19.43 ? 182 LEU B CB  1 
ATOM   1274 C CG  . LEU B 1 73 ? 0.468   67.225 17.849  1.00 18.18 ? 182 LEU B CG  1 
ATOM   1275 C CD1 . LEU B 1 73 ? 0.465   65.934 18.618  1.00 15.60 ? 182 LEU B CD1 1 
ATOM   1276 C CD2 . LEU B 1 73 ? -0.483  67.122 16.708  1.00 16.35 ? 182 LEU B CD2 1 
ATOM   1277 N N   . LYS B 1 74 ? 0.221   71.306 20.054  1.00 20.71 ? 183 LYS B N   1 
ATOM   1278 C CA  . LYS B 1 74 ? -0.340  72.345 20.901  1.00 21.27 ? 183 LYS B CA  1 
ATOM   1279 C C   . LYS B 1 74 ? -0.522  73.648 20.137  1.00 21.22 ? 183 LYS B C   1 
ATOM   1280 O O   . LYS B 1 74 ? -1.442  74.385 20.406  1.00 21.40 ? 183 LYS B O   1 
ATOM   1281 C CB  . LYS B 1 74 ? 0.552   72.594 22.106  1.00 21.67 ? 183 LYS B CB  1 
ATOM   1282 C CG  . LYS B 1 74 ? 0.384   71.589 23.231  1.00 23.41 ? 183 LYS B CG  1 
ATOM   1283 C CD  . LYS B 1 74 ? 1.534   71.712 24.204  1.00 25.90 ? 183 LYS B CD  1 
ATOM   1284 C CE  . LYS B 1 74 ? 1.138   71.476 25.638  1.00 27.97 ? 183 LYS B CE  1 
ATOM   1285 N NZ  . LYS B 1 74 ? 2.291   71.831 26.529  1.00 29.11 ? 183 LYS B NZ  1 
ATOM   1286 N N   . GLU B 1 75 ? 0.358   73.930 19.191  1.00 21.33 ? 184 GLU B N   1 
ATOM   1287 C CA  . GLU B 1 75 ? 0.326   75.188 18.476  1.00 21.67 ? 184 GLU B CA  1 
ATOM   1288 C C   . GLU B 1 75 ? -0.738  75.256 17.391  1.00 21.19 ? 184 GLU B C   1 
ATOM   1289 O O   . GLU B 1 75 ? -1.082  76.337 16.965  1.00 21.03 ? 184 GLU B O   1 
ATOM   1290 C CB  . GLU B 1 75 ? 1.702   75.512 17.896  1.00 22.12 ? 184 GLU B CB  1 
ATOM   1291 C CG  . GLU B 1 75 ? 2.695   75.976 18.956  1.00 24.38 ? 184 GLU B CG  1 
ATOM   1292 C CD  . GLU B 1 75 ? 4.139   76.148 18.442  1.00 27.42 ? 184 GLU B CD  1 
ATOM   1293 O OE1 . GLU B 1 75 ? 4.514   75.515 17.429  1.00 27.17 ? 184 GLU B OE1 1 
ATOM   1294 O OE2 . GLU B 1 75 ? 4.910   76.915 19.090  1.00 29.64 ? 184 GLU B OE2 1 
ATOM   1295 N N   . LEU B 1 76 ? -1.275  74.120 16.960  1.00 20.85 ? 185 LEU B N   1 
ATOM   1296 C CA  . LEU B 1 76 ? -2.359  74.112 15.989  1.00 20.67 ? 185 LEU B CA  1 
ATOM   1297 C C   . LEU B 1 76 ? -3.560  74.897 16.472  1.00 21.11 ? 185 LEU B C   1 
ATOM   1298 O O   . LEU B 1 76 ? -3.935  74.793 17.624  1.00 20.93 ? 185 LEU B O   1 
ATOM   1299 C CB  . LEU B 1 76 ? -2.834  72.693 15.746  1.00 20.54 ? 185 LEU B CB  1 
ATOM   1300 C CG  . LEU B 1 76 ? -1.899  71.765 14.995  1.00 19.62 ? 185 LEU B CG  1 
ATOM   1301 C CD1 . LEU B 1 76 ? -2.398  70.374 15.153  1.00 18.10 ? 185 LEU B CD1 1 
ATOM   1302 C CD2 . LEU B 1 76 ? -1.801  72.158 13.538  1.00 17.67 ? 185 LEU B CD2 1 
ATOM   1303 N N   . LYS B 1 77 ? -4.187  75.654 15.578  1.00 21.94 ? 186 LYS B N   1 
ATOM   1304 C CA  . LYS B 1 77 ? -5.318  76.500 15.955  1.00 22.38 ? 186 LYS B CA  1 
ATOM   1305 C C   . LYS B 1 77 ? -6.552  75.722 16.378  1.00 22.22 ? 186 LYS B C   1 
ATOM   1306 O O   . LYS B 1 77 ? -6.900  74.710 15.783  1.00 21.47 ? 186 LYS B O   1 
ATOM   1307 C CB  . LYS B 1 77 ? -5.676  77.487 14.852  1.00 22.70 ? 186 LYS B CB  1 
ATOM   1308 C CG  . LYS B 1 77 ? -4.693  78.626 14.765  1.00 24.83 ? 186 LYS B CG  1 
ATOM   1309 C CD  . LYS B 1 77 ? -5.136  79.711 13.789  1.00 27.42 ? 186 LYS B CD  1 
ATOM   1310 C CE  . LYS B 1 77 ? -3.940  80.627 13.424  1.00 28.93 ? 186 LYS B CE  1 
ATOM   1311 N NZ  . LYS B 1 77 ? -4.353  81.999 12.982  1.00 29.23 ? 186 LYS B NZ  1 
ATOM   1312 N N   . LYS B 1 78 ? -7.188  76.215 17.438  1.00 22.52 ? 187 LYS B N   1 
ATOM   1313 C CA  . LYS B 1 78 ? -8.421  75.654 17.960  1.00 22.74 ? 187 LYS B CA  1 
ATOM   1314 C C   . LYS B 1 78 ? -9.519  75.820 16.905  1.00 22.35 ? 187 LYS B C   1 
ATOM   1315 O O   . LYS B 1 78 ? -9.484  76.726 16.091  1.00 22.05 ? 187 LYS B O   1 
ATOM   1316 C CB  . LYS B 1 78 ? -8.777  76.358 19.288  1.00 23.08 ? 187 LYS B CB  1 
ATOM   1317 C CG  . LYS B 1 78 ? -9.485  75.489 20.315  1.00 24.98 ? 187 LYS B CG  1 
ATOM   1318 C CD  . LYS B 1 78 ? -9.308  76.010 21.739  1.00 27.51 ? 187 LYS B CD  1 
ATOM   1319 C CE  . LYS B 1 78 ? -10.331 77.075 22.127  1.00 28.88 ? 187 LYS B CE  1 
ATOM   1320 N NZ  . LYS B 1 78 ? -11.521 76.521 22.821  1.00 29.67 ? 187 LYS B NZ  1 
ATOM   1321 N N   . GLU B 1 79 ? -10.482 74.920 16.918  1.00 22.23 ? 188 GLU B N   1 
ATOM   1322 C CA  . GLU B 1 79 ? -11.585 74.947 15.981  1.00 22.37 ? 188 GLU B CA  1 
ATOM   1323 C C   . GLU B 1 79 ? -11.124 74.882 14.517  1.00 21.74 ? 188 GLU B C   1 
ATOM   1324 O O   . GLU B 1 79 ? -11.670 75.573 13.659  1.00 21.56 ? 188 GLU B O   1 
ATOM   1325 C CB  . GLU B 1 79 ? -12.474 76.171 16.221  1.00 22.89 ? 188 GLU B CB  1 
ATOM   1326 C CG  . GLU B 1 79 ? -12.901 76.414 17.698  1.00 25.29 ? 188 GLU B CG  1 
ATOM   1327 C CD  . GLU B 1 79 ? -14.244 75.796 18.085  1.00 28.43 ? 188 GLU B CD  1 
ATOM   1328 O OE1 . GLU B 1 79 ? -14.300 74.565 18.353  1.00 30.63 ? 188 GLU B OE1 1 
ATOM   1329 O OE2 . GLU B 1 79 ? -15.239 76.556 18.154  1.00 29.98 ? 188 GLU B OE2 1 
ATOM   1330 N N   . GLU B 1 80 ? -10.132 74.038 14.234  1.00 21.06 ? 189 GLU B N   1 
ATOM   1331 C CA  . GLU B 1 80 ? -9.713  73.769 12.850  1.00 20.71 ? 189 GLU B CA  1 
ATOM   1332 C C   . GLU B 1 80 ? -9.313  72.317 12.629  1.00 19.49 ? 189 GLU B C   1 
ATOM   1333 O O   . GLU B 1 80 ? -8.736  71.678 13.512  1.00 19.03 ? 189 GLU B O   1 
ATOM   1334 C CB  . GLU B 1 80 ? -8.525  74.641 12.444  1.00 21.23 ? 189 GLU B CB  1 
ATOM   1335 C CG  . GLU B 1 80 ? -8.873  76.096 12.187  1.00 24.11 ? 189 GLU B CG  1 
ATOM   1336 C CD  . GLU B 1 80 ? -7.760  76.870 11.450  1.00 28.03 ? 189 GLU B CD  1 
ATOM   1337 O OE1 . GLU B 1 80 ? -6.625  76.332 11.293  1.00 29.37 ? 189 GLU B OE1 1 
ATOM   1338 O OE2 . GLU B 1 80 ? -8.029  78.028 11.031  1.00 28.63 ? 189 GLU B OE2 1 
ATOM   1339 N N   . LEU B 1 81 ? -9.633  71.813 11.437  1.00 18.46 ? 190 LEU B N   1 
ATOM   1340 C CA  . LEU B 1 81 ? -9.187  70.508 10.984  1.00 17.76 ? 190 LEU B CA  1 
ATOM   1341 C C   . LEU B 1 81 ? -7.695  70.497 10.752  1.00 16.89 ? 190 LEU B C   1 
ATOM   1342 O O   . LEU B 1 81 ? -7.157  71.423 10.168  1.00 16.32 ? 190 LEU B O   1 
ATOM   1343 C CB  . LEU B 1 81 ? -9.799  70.182 9.639   1.00 17.81 ? 190 LEU B CB  1 
ATOM   1344 C CG  . LEU B 1 81 ? -10.928 69.185 9.501   1.00 18.85 ? 190 LEU B CG  1 
ATOM   1345 C CD1 . LEU B 1 81 ? -11.004 68.906 8.009   1.00 19.07 ? 190 LEU B CD1 1 
ATOM   1346 C CD2 . LEU B 1 81 ? -10.725 67.916 10.300  1.00 18.36 ? 190 LEU B CD2 1 
ATOM   1347 N N   . PHE B 1 82 ? -7.037  69.427 11.171  1.00 16.21 ? 191 PHE B N   1 
ATOM   1348 C CA  . PHE B 1 82 ? -5.677  69.153 10.729  1.00 15.64 ? 191 PHE B CA  1 
ATOM   1349 C C   . PHE B 1 82 ? -5.583  67.722 10.274  1.00 15.17 ? 191 PHE B C   1 
ATOM   1350 O O   . PHE B 1 82 ? -6.488  66.946 10.530  1.00 15.21 ? 191 PHE B O   1 
ATOM   1351 C CB  . PHE B 1 82 ? -4.668  69.471 11.819  1.00 15.64 ? 191 PHE B CB  1 
ATOM   1352 C CG  . PHE B 1 82 ? -4.722  68.565 13.007  1.00 15.20 ? 191 PHE B CG  1 
ATOM   1353 C CD1 . PHE B 1 82 ? -3.830  67.509 13.128  1.00 15.18 ? 191 PHE B CD1 1 
ATOM   1354 C CD2 . PHE B 1 82 ? -5.610  68.796 14.030  1.00 15.75 ? 191 PHE B CD2 1 
ATOM   1355 C CE1 . PHE B 1 82 ? -3.842  66.686 14.243  1.00 14.89 ? 191 PHE B CE1 1 
ATOM   1356 C CE2 . PHE B 1 82 ? -5.621  67.971 15.158  1.00 15.66 ? 191 PHE B CE2 1 
ATOM   1357 C CZ  . PHE B 1 82 ? -4.739  66.923 15.264  1.00 15.56 ? 191 PHE B CZ  1 
ATOM   1358 N N   . THR B 1 83 ? -4.516  67.388 9.555   1.00 14.92 ? 192 THR B N   1 
ATOM   1359 C CA  . THR B 1 83 ? -4.331  66.029 9.055   1.00 14.62 ? 192 THR B CA  1 
ATOM   1360 C C   . THR B 1 83 ? -3.048  65.430 9.612   1.00 14.32 ? 192 THR B C   1 
ATOM   1361 O O   . THR B 1 83 ? -2.171  66.149 10.070  1.00 14.40 ? 192 THR B O   1 
ATOM   1362 C CB  . THR B 1 83 ? -4.291  65.978 7.511   1.00 14.68 ? 192 THR B CB  1 
ATOM   1363 O OG1 . THR B 1 83 ? -2.986  66.353 7.060   1.00 15.53 ? 192 THR B OG1 1 
ATOM   1364 C CG2 . THR B 1 83 ? -5.358  66.892 6.889   1.00 13.62 ? 192 THR B CG2 1 
ATOM   1365 N N   . MET B 1 84 ? -2.958  64.111 9.592   1.00 14.00 ? 193 MET B N   1 
ATOM   1366 C CA  . MET B 1 84 ? -1.743  63.418 9.978   1.00 13.91 ? 193 MET B CA  1 
ATOM   1367 C C   . MET B 1 84 ? -1.598  62.154 9.174   1.00 13.33 ? 193 MET B C   1 
ATOM   1368 O O   . MET B 1 84 ? -2.602  61.533 8.788   1.00 12.23 ? 193 MET B O   1 
ATOM   1369 C CB  . MET B 1 84 ? -1.829  62.997 11.427  1.00 14.53 ? 193 MET B CB  1 
ATOM   1370 C CG  . MET B 1 84 ? -1.501  64.031 12.444  1.00 16.84 ? 193 MET B CG  1 
ATOM   1371 S SD  . MET B 1 84 ? -1.903  63.309 14.032  1.00 23.51 ? 193 MET B SD  1 
ATOM   1372 C CE  . MET B 1 84 ? -0.592  63.840 15.097  1.00 25.42 ? 193 MET B CE  1 
ATOM   1373 N N   . LYS B 1 85 ? -0.348  61.772 8.933   1.00 12.88 ? 194 LYS B N   1 
ATOM   1374 C CA  . LYS B 1 85 ? -0.050  60.466 8.423   1.00 13.04 ? 194 LYS B CA  1 
ATOM   1375 C C   . LYS B 1 85 ? 0.572   59.706 9.575   1.00 12.66 ? 194 LYS B C   1 
ATOM   1376 O O   . LYS B 1 85 ? 1.393   60.241 10.293  1.00 12.68 ? 194 LYS B O   1 
ATOM   1377 C CB  . LYS B 1 85 ? 0.842   60.524 7.180   1.00 13.15 ? 194 LYS B CB  1 
ATOM   1378 C CG  . LYS B 1 85 ? 0.101   61.051 5.986   1.00 14.42 ? 194 LYS B CG  1 
ATOM   1379 C CD  . LYS B 1 85 ? 0.925   61.183 4.758   1.00 15.50 ? 194 LYS B CD  1 
ATOM   1380 C CE  . LYS B 1 85 ? 0.043   61.473 3.537   1.00 15.55 ? 194 LYS B CE  1 
ATOM   1381 N NZ  . LYS B 1 85 ? 0.875   61.489 2.316   1.00 15.91 ? 194 LYS B NZ  1 
ATOM   1382 N N   . LEU B 1 86 ? 0.102   58.479 9.777   1.00 12.28 ? 195 LEU B N   1 
ATOM   1383 C CA  . LEU B 1 86 ? 0.547   57.639 10.849  1.00 11.73 ? 195 LEU B CA  1 
ATOM   1384 C C   . LEU B 1 86 ? 1.083   56.363 10.249  1.00 11.90 ? 195 LEU B C   1 
ATOM   1385 O O   . LEU B 1 86 ? 0.608   55.898 9.195   1.00 12.08 ? 195 LEU B O   1 
ATOM   1386 C CB  . LEU B 1 86 ? -0.614  57.320 11.776  1.00 11.46 ? 195 LEU B CB  1 
ATOM   1387 C CG  . LEU B 1 86 ? -1.285  58.493 12.439  1.00 10.72 ? 195 LEU B CG  1 
ATOM   1388 C CD1 . LEU B 1 86 ? -2.450  57.995 13.162  1.00 11.15 ? 195 LEU B CD1 1 
ATOM   1389 C CD2 . LEU B 1 86 ? -0.391  59.165 13.386  1.00 10.57 ? 195 LEU B CD2 1 
ATOM   1390 N N   . ILE B 1 87 ? 2.113   55.829 10.904  1.00 10.48 ? 196 ILE B N   1 
ATOM   1391 C CA  . ILE B 1 87 ? 2.653   54.528 10.552  1.00 10.00 ? 196 ILE B CA  1 
ATOM   1392 C C   . ILE B 1 87 ? 2.397   53.557 11.658  1.00 9.99  ? 196 ILE B C   1 
ATOM   1393 O O   . ILE B 1 87 ? 2.720   53.824 12.794  1.00 9.54  ? 196 ILE B O   1 
ATOM   1394 C CB  . ILE B 1 87 ? 4.177   54.535 10.336  1.00 9.65  ? 196 ILE B CB  1 
ATOM   1395 C CG1 . ILE B 1 87 ? 4.555   55.569 9.265   1.00 9.03  ? 196 ILE B CG1 1 
ATOM   1396 C CG2 . ILE B 1 87 ? 4.628   53.122 9.943   1.00 6.35  ? 196 ILE B CG2 1 
ATOM   1397 C CD1 . ILE B 1 87 ? 4.050   55.209 7.840   1.00 7.21  ? 196 ILE B CD1 1 
ATOM   1398 N N   . GLU B 1 88 ? 1.856   52.406 11.312  1.00 10.47 ? 197 GLU B N   1 
ATOM   1399 C CA  . GLU B 1 88 ? 1.554   51.412 12.301  1.00 11.12 ? 197 GLU B CA  1 
ATOM   1400 C C   . GLU B 1 88 ? 2.813   50.742 12.800  1.00 11.44 ? 197 GLU B C   1 
ATOM   1401 O O   . GLU B 1 88 ? 3.774   50.627 12.065  1.00 11.54 ? 197 GLU B O   1 
ATOM   1402 C CB  . GLU B 1 88 ? 0.579   50.397 11.748  1.00 11.37 ? 197 GLU B CB  1 
ATOM   1403 C CG  . GLU B 1 88 ? -0.838  50.936 11.653  1.00 12.25 ? 197 GLU B CG  1 
ATOM   1404 C CD  . GLU B 1 88 ? -1.832  49.897 11.179  1.00 14.75 ? 197 GLU B CD  1 
ATOM   1405 O OE1 . GLU B 1 88 ? -3.054  50.191 11.182  1.00 15.81 ? 197 GLU B OE1 1 
ATOM   1406 O OE2 . GLU B 1 88 ? -1.392  48.782 10.807  1.00 16.82 ? 197 GLU B OE2 1 
ATOM   1407 N N   . PRO B 1 89 ? 2.821   50.338 14.076  1.00 12.13 ? 198 PRO B N   1 
ATOM   1408 C CA  . PRO B 1 89 ? 3.951   49.606 14.591  1.00 13.19 ? 198 PRO B CA  1 
ATOM   1409 C C   . PRO B 1 89 ? 4.073   48.246 13.904  1.00 14.38 ? 198 PRO B C   1 
ATOM   1410 O O   . PRO B 1 89 ? 3.047   47.639 13.611  1.00 13.49 ? 198 PRO B O   1 
ATOM   1411 C CB  . PRO B 1 89 ? 3.601   49.433 16.068  1.00 13.09 ? 198 PRO B CB  1 
ATOM   1412 C CG  . PRO B 1 89 ? 2.143   49.489 16.122  1.00 12.49 ? 198 PRO B CG  1 
ATOM   1413 C CD  . PRO B 1 89 ? 1.727   50.424 15.058  1.00 11.96 ? 198 PRO B CD  1 
ATOM   1414 N N   . LYS B 1 90 ? 5.309   47.794 13.647  1.00 16.24 ? 199 LYS B N   1 
ATOM   1415 C CA  . LYS B 1 90 ? 5.568   46.480 13.037  1.00 17.95 ? 199 LYS B CA  1 
ATOM   1416 C C   . LYS B 1 90 ? 5.238   45.285 13.953  1.00 19.12 ? 199 LYS B C   1 
ATOM   1417 O O   . LYS B 1 90 ? 5.656   45.235 15.108  1.00 18.73 ? 199 LYS B O   1 
ATOM   1418 C CB  . LYS B 1 90 ? 7.017   46.385 12.593  1.00 18.25 ? 199 LYS B CB  1 
ATOM   1419 C CG  . LYS B 1 90 ? 7.370   47.209 11.354  1.00 20.23 ? 199 LYS B CG  1 
ATOM   1420 C CD  . LYS B 1 90 ? 8.583   46.584 10.612  1.00 23.36 ? 199 LYS B CD  1 
ATOM   1421 C CE  . LYS B 1 90 ? 9.370   47.568 9.686   1.00 24.89 ? 199 LYS B CE  1 
ATOM   1422 N NZ  . LYS B 1 90 ? 10.605  46.936 9.049   1.00 24.54 ? 199 LYS B NZ  1 
ATOM   1423 N N   . LYS B 1 91 ? 4.490   44.324 13.413  1.00 21.22 ? 200 LYS B N   1 
ATOM   1424 C CA  . LYS B 1 91 ? 4.011   43.140 14.177  1.00 23.01 ? 200 LYS B CA  1 
ATOM   1425 C C   . LYS B 1 91 ? 5.187   42.180 14.522  1.00 24.01 ? 200 LYS B C   1 
ATOM   1426 O O   . LYS B 1 91 ? 6.078   41.933 13.695  1.00 23.23 ? 200 LYS B O   1 
ATOM   1427 C CB  . LYS B 1 91 ? 2.935   42.337 13.382  1.00 23.40 ? 200 LYS B CB  1 
ATOM   1428 C CG  . LYS B 1 91 ? 1.779   43.136 12.692  1.00 23.96 ? 200 LYS B CG  1 
ATOM   1429 C CD  . LYS B 1 91 ? 1.211   42.381 11.449  1.00 24.68 ? 200 LYS B CD  1 
ATOM   1430 C CE  . LYS B 1 91 ? 2.134   42.475 10.181  1.00 24.92 ? 200 LYS B CE  1 
ATOM   1431 N NZ  . LYS B 1 91 ? 2.033   41.271 9.252   1.00 22.15 ? 200 LYS B NZ  1 
ATOM   1432 N N   . SER B 1 92 ? 5.165   41.630 15.737  1.00 25.51 ? 201 SER B N   1 
ATOM   1433 C CA  . SER B 1 92 ? 6.255   40.768 16.214  1.00 26.42 ? 201 SER B CA  1 
ATOM   1434 C C   . SER B 1 92 ? 5.756   39.508 16.899  1.00 26.73 ? 201 SER B C   1 
ATOM   1435 O O   . SER B 1 92 ? 5.246   39.582 18.020  1.00 27.01 ? 201 SER B O   1 
ATOM   1436 C CB  . SER B 1 92 ? 7.143   41.543 17.200  1.00 26.44 ? 201 SER B CB  1 
ATOM   1437 O OG  . SER B 1 92 ? 6.409   41.940 18.341  1.00 26.95 ? 201 SER B OG  1 
ATOM   1438 N N   . SER B 1 93 ? 5.954   38.359 16.257  1.00 26.91 ? 202 SER B N   1 
ATOM   1439 C CA  . SER B 1 93 ? 5.558   37.068 16.834  1.00 27.08 ? 202 SER B CA  1 
ATOM   1440 C C   . SER B 1 93 ? 6.665   36.416 17.716  1.00 26.91 ? 202 SER B C   1 
ATOM   1441 O O   . SER B 1 93 ? 7.835   36.457 17.367  1.00 26.61 ? 202 SER B O   1 
ATOM   1442 C CB  . SER B 1 93 ? 5.055   36.111 15.720  1.00 27.44 ? 202 SER B CB  1 
ATOM   1443 O OG  . SER B 1 93 ? 5.839   36.173 14.523  1.00 27.37 ? 202 SER B OG  1 
ATOM   1444 N N   . GLU B 1 94 ? 6.265   35.820 18.848  1.00 26.93 ? 203 GLU B N   1 
ATOM   1445 C CA  . GLU B 1 94 ? 7.183   35.134 19.797  1.00 27.08 ? 203 GLU B CA  1 
ATOM   1446 C C   . GLU B 1 94 ? 7.422   33.651 19.527  1.00 26.46 ? 203 GLU B C   1 
ATOM   1447 O O   . GLU B 1 94 ? 6.584   32.971 18.930  1.00 26.77 ? 203 GLU B O   1 
ATOM   1448 C CB  . GLU B 1 94 ? 6.672   35.244 21.236  1.00 27.28 ? 203 GLU B CB  1 
ATOM   1449 C CG  . GLU B 1 94 ? 7.091   36.520 21.932  1.00 29.00 ? 203 GLU B CG  1 
ATOM   1450 C CD  . GLU B 1 94 ? 6.460   36.675 23.304  1.00 30.88 ? 203 GLU B CD  1 
ATOM   1451 O OE1 . GLU B 1 94 ? 5.850   35.705 23.799  1.00 32.82 ? 203 GLU B OE1 1 
ATOM   1452 O OE2 . GLU B 1 94 ? 6.571   37.767 23.900  1.00 32.59 ? 203 GLU B OE2 1 
ATOM   1453 N N   . ALA B 1 95 ? 8.557   33.160 20.026  1.00 25.78 ? 204 ALA B N   1 
ATOM   1454 C CA  . ALA B 1 95 ? 9.007   31.773 19.816  1.00 25.56 ? 204 ALA B CA  1 
ATOM   1455 C C   . ALA B 1 95 ? 9.655   31.094 21.065  1.00 25.29 ? 204 ALA B C   1 
ATOM   1456 O O   . ALA B 1 95 ? 10.025  31.742 22.056  1.00 24.25 ? 204 ALA B O   1 
ATOM   1457 C CB  . ALA B 1 95 ? 9.970   31.733 18.646  1.00 25.35 ? 204 ALA B CB  1 
ATOM   1458 N N   . SER C 1 1  ? 11.082  73.250 7.802   1.00 12.17 ? -1  SER C N   1 
ATOM   1459 C CA  . SER C 1 1  ? 10.788  73.544 9.227   1.00 13.05 ? -1  SER C CA  1 
ATOM   1460 C C   . SER C 1 1  ? 12.035  74.096 9.895   1.00 13.22 ? -1  SER C C   1 
ATOM   1461 O O   . SER C 1 1  ? 13.077  74.173 9.266   1.00 12.88 ? -1  SER C O   1 
ATOM   1462 C CB  . SER C 1 1  ? 10.374  72.257 9.937   1.00 13.04 ? -1  SER C CB  1 
ATOM   1463 O OG  . SER C 1 1  ? 11.461  71.348 10.059  1.00 12.78 ? -1  SER C OG  1 
ATOM   1464 N N   . MET C 1 2  ? 11.952  74.447 11.177  1.00 13.65 ? 0   MET C N   1 
ATOM   1465 C CA  . MET C 1 2  ? 13.154  74.921 11.910  1.00 13.67 ? 0   MET C CA  1 
ATOM   1466 C C   . MET C 1 2  ? 14.193  73.802 12.115  1.00 12.82 ? 0   MET C C   1 
ATOM   1467 O O   . MET C 1 2  ? 15.316  74.072 12.450  1.00 12.58 ? 0   MET C O   1 
ATOM   1468 C CB  . MET C 1 2  ? 12.777  75.483 13.278  1.00 13.85 ? 0   MET C CB  1 
ATOM   1469 C CG  . MET C 1 2  ? 12.127  76.849 13.267  1.00 15.71 ? 0   MET C CG  1 
ATOM   1470 S SD  . MET C 1 2  ? 12.182  77.493 14.959  1.00 20.92 ? 0   MET C SD  1 
ATOM   1471 C CE  . MET C 1 2  ? 10.467  78.076 15.205  1.00 23.27 ? 0   MET C CE  1 
ATOM   1472 N N   . LYS C 1 3  ? 13.813  72.555 11.894  1.00 12.46 ? 112 LYS C N   1 
ATOM   1473 C CA  . LYS C 1 3  ? 14.678  71.423 12.211  1.00 12.97 ? 112 LYS C CA  1 
ATOM   1474 C C   . LYS C 1 3  ? 15.298  70.869 10.960  1.00 12.92 ? 112 LYS C C   1 
ATOM   1475 O O   . LYS C 1 3  ? 16.388  70.344 10.992  1.00 12.71 ? 112 LYS C O   1 
ATOM   1476 C CB  . LYS C 1 3  ? 13.876  70.342 12.998  1.00 13.17 ? 112 LYS C CB  1 
ATOM   1477 C CG  . LYS C 1 3  ? 12.702  70.982 13.761  1.00 13.16 ? 112 LYS C CG  1 
ATOM   1478 C CD  . LYS C 1 3  ? 12.502  70.427 15.098  1.00 14.55 ? 112 LYS C CD  1 
ATOM   1479 C CE  . LYS C 1 3  ? 11.225  70.994 15.779  1.00 14.64 ? 112 LYS C CE  1 
ATOM   1480 N NZ  . LYS C 1 3  ? 10.918  72.365 15.349  1.00 12.87 ? 112 LYS C NZ  1 
ATOM   1481 N N   . GLY C 1 4  ? 14.618  71.016 9.841   1.00 13.94 ? 113 GLY C N   1 
ATOM   1482 C CA  . GLY C 1 4  ? 15.184  70.591 8.572   1.00 15.23 ? 113 GLY C CA  1 
ATOM   1483 C C   . GLY C 1 4  ? 14.380  71.027 7.368   1.00 16.04 ? 113 GLY C C   1 
ATOM   1484 O O   . GLY C 1 4  ? 13.185  71.348 7.500   1.00 15.86 ? 113 GLY C O   1 
ATOM   1485 N N   . ILE C 1 5  ? 15.068  71.073 6.220   1.00 16.60 ? 114 ILE C N   1 
ATOM   1486 C CA  . ILE C 1 5  ? 14.495  71.510 4.961   1.00 17.68 ? 114 ILE C CA  1 
ATOM   1487 C C   . ILE C 1 5  ? 14.310  70.325 3.977   1.00 18.67 ? 114 ILE C C   1 
ATOM   1488 O O   . ILE C 1 5  ? 15.259  69.581 3.713   1.00 18.31 ? 114 ILE C O   1 
ATOM   1489 C CB  . ILE C 1 5  ? 15.422  72.580 4.310   1.00 18.01 ? 114 ILE C CB  1 
ATOM   1490 C CG1 . ILE C 1 5  ? 15.803  73.672 5.326   1.00 18.78 ? 114 ILE C CG1 1 
ATOM   1491 C CG2 . ILE C 1 5  ? 14.769  73.188 3.092   1.00 15.54 ? 114 ILE C CG2 1 
ATOM   1492 C CD1 . ILE C 1 5  ? 14.616  74.531 5.858   1.00 17.83 ? 114 ILE C CD1 1 
ATOM   1493 N N   . GLU C 1 6  ? 13.116  70.177 3.398   1.00 20.74 ? 115 GLU C N   1 
ATOM   1494 C CA  . GLU C 1 6  ? 12.887  69.122 2.392   1.00 21.52 ? 115 GLU C CA  1 
ATOM   1495 C C   . GLU C 1 6  ? 13.381  69.546 0.986   1.00 20.72 ? 115 GLU C C   1 
ATOM   1496 O O   . GLU C 1 6  ? 13.127  70.670 0.550   1.00 20.28 ? 115 GLU C O   1 
ATOM   1497 C CB  . GLU C 1 6  ? 11.407  68.715 2.341   1.00 21.99 ? 115 GLU C CB  1 
ATOM   1498 C CG  . GLU C 1 6  ? 11.115  67.456 1.500   1.00 25.25 ? 115 GLU C CG  1 
ATOM   1499 C CD  . GLU C 1 6  ? 9.634   66.987 1.608   1.00 29.37 ? 115 GLU C CD  1 
ATOM   1500 O OE1 . GLU C 1 6  ? 8.922   67.039 0.561   1.00 32.07 ? 115 GLU C OE1 1 
ATOM   1501 O OE2 . GLU C 1 6  ? 9.195   66.581 2.729   1.00 31.14 ? 115 GLU C OE2 1 
ATOM   1502 N N   . LYS C 1 7  ? 14.104  68.644 0.316   1.00 20.22 ? 116 LYS C N   1 
ATOM   1503 C CA  . LYS C 1 7  ? 14.657  68.886 -1.043  1.00 19.61 ? 116 LYS C CA  1 
ATOM   1504 C C   . LYS C 1 7  ? 14.240  67.742 -1.965  1.00 19.10 ? 116 LYS C C   1 
ATOM   1505 O O   . LYS C 1 7  ? 14.196  66.582 -1.565  1.00 19.12 ? 116 LYS C O   1 
ATOM   1506 C CB  . LYS C 1 7  ? 16.201  68.873 -1.025  1.00 19.35 ? 116 LYS C CB  1 
ATOM   1507 C CG  . LYS C 1 7  ? 16.850  69.811 -0.060  1.00 20.16 ? 116 LYS C CG  1 
ATOM   1508 C CD  . LYS C 1 7  ? 18.388  69.862 -0.214  1.00 20.15 ? 116 LYS C CD  1 
ATOM   1509 C CE  . LYS C 1 7  ? 19.096  68.703 0.477   1.00 20.03 ? 116 LYS C CE  1 
ATOM   1510 N NZ  . LYS C 1 7  ? 20.502  69.046 0.814   1.00 19.33 ? 116 LYS C NZ  1 
ATOM   1511 N N   . GLU C 1 8  ? 14.009  68.047 -3.222  1.00 18.57 ? 117 GLU C N   1 
ATOM   1512 C CA  . GLU C 1 8  ? 13.967  66.993 -4.204  1.00 18.42 ? 117 GLU C CA  1 
ATOM   1513 C C   . GLU C 1 8  ? 15.147  67.013 -5.185  1.00 17.29 ? 117 GLU C C   1 
ATOM   1514 O O   . GLU C 1 8  ? 15.606  68.086 -5.581  1.00 16.89 ? 117 GLU C O   1 
ATOM   1515 C CB  . GLU C 1 8  ? 12.682  67.038 -4.945  1.00 18.87 ? 117 GLU C CB  1 
ATOM   1516 C CG  . GLU C 1 8  ? 12.506  65.775 -5.685  1.00 22.81 ? 117 GLU C CG  1 
ATOM   1517 C CD  . GLU C 1 8  ? 11.390  65.862 -6.627  1.00 29.17 ? 117 GLU C CD  1 
ATOM   1518 O OE1 . GLU C 1 8  ? 11.709  65.982 -7.866  1.00 33.40 ? 117 GLU C OE1 1 
ATOM   1519 O OE2 . GLU C 1 8  ? 10.213  65.847 -6.117  1.00 31.83 ? 117 GLU C OE2 1 
ATOM   1520 N N   . VAL C 1 9  ? 15.652  65.824 -5.541  1.00 15.95 ? 118 VAL C N   1 
ATOM   1521 C CA  . VAL C 1 9  ? 16.783  65.722 -6.435  1.00 15.53 ? 118 VAL C CA  1 
ATOM   1522 C C   . VAL C 1 9  ? 16.599  64.665 -7.492  1.00 15.40 ? 118 VAL C C   1 
ATOM   1523 O O   . VAL C 1 9  ? 16.073  63.614 -7.199  1.00 15.41 ? 118 VAL C O   1 
ATOM   1524 C CB  . VAL C 1 9  ? 18.101  65.450 -5.680  1.00 15.34 ? 118 VAL C CB  1 
ATOM   1525 C CG1 . VAL C 1 9  ? 18.356  66.544 -4.671  1.00 15.18 ? 118 VAL C CG1 1 
ATOM   1526 C CG2 . VAL C 1 9  ? 18.070  64.128 -5.001  1.00 15.14 ? 118 VAL C CG2 1 
ATOM   1527 N N   . ASN C 1 10 ? 17.021  64.951 -8.721  1.00 15.26 ? 119 ASN C N   1 
ATOM   1528 C CA  . ASN C 1 10 ? 17.095  63.933 -9.770  1.00 15.25 ? 119 ASN C CA  1 
ATOM   1529 C C   . ASN C 1 10 ? 18.530  63.559 -9.999  1.00 14.44 ? 119 ASN C C   1 
ATOM   1530 O O   . ASN C 1 10 ? 19.372  64.428 -10.121 1.00 15.09 ? 119 ASN C O   1 
ATOM   1531 C CB  . ASN C 1 10 ? 16.545  64.447 -11.099 1.00 15.70 ? 119 ASN C CB  1 
ATOM   1532 C CG  . ASN C 1 10 ? 15.095  64.853 -11.024 1.00 17.47 ? 119 ASN C CG  1 
ATOM   1533 O OD1 . ASN C 1 10 ? 14.237  64.077 -10.599 1.00 22.55 ? 119 ASN C OD1 1 
ATOM   1534 N ND2 . ASN C 1 10 ? 14.807  66.073 -11.450 1.00 17.39 ? 119 ASN C ND2 1 
ATOM   1535 N N   . VAL C 1 11 ? 18.800  62.274 -10.102 1.00 13.51 ? 120 VAL C N   1 
ATOM   1536 C CA  . VAL C 1 11 ? 20.148  61.792 -10.277 1.00 13.52 ? 120 VAL C CA  1 
ATOM   1537 C C   . VAL C 1 11 ? 20.202  60.752 -11.379 1.00 13.62 ? 120 VAL C C   1 
ATOM   1538 O O   . VAL C 1 11 ? 19.385  59.863 -11.454 1.00 13.86 ? 120 VAL C O   1 
ATOM   1539 C CB  . VAL C 1 11 ? 20.679  61.158 -8.978  1.00 13.72 ? 120 VAL C CB  1 
ATOM   1540 C CG1 . VAL C 1 11 ? 22.083  60.672 -9.179  1.00 12.69 ? 120 VAL C CG1 1 
ATOM   1541 C CG2 . VAL C 1 11 ? 20.603  62.152 -7.837  1.00 12.06 ? 120 VAL C CG2 1 
ATOM   1542 N N   . TYR C 1 12 ? 21.187  60.860 -12.244 1.00 14.09 ? 121 TYR C N   1 
ATOM   1543 C CA  . TYR C 1 12 ? 21.349  59.910 -13.327 1.00 14.17 ? 121 TYR C CA  1 
ATOM   1544 C C   . TYR C 1 12 ? 22.379  58.903 -12.889 1.00 14.88 ? 121 TYR C C   1 
ATOM   1545 O O   . TYR C 1 12 ? 23.530  59.277 -12.641 1.00 15.70 ? 121 TYR C O   1 
ATOM   1546 C CB  . TYR C 1 12 ? 21.815  60.637 -14.566 1.00 13.82 ? 121 TYR C CB  1 
ATOM   1547 C CG  . TYR C 1 12 ? 21.881  59.788 -15.785 1.00 13.75 ? 121 TYR C CG  1 
ATOM   1548 C CD1 . TYR C 1 12 ? 20.726  59.387 -16.423 1.00 13.69 ? 121 TYR C CD1 1 
ATOM   1549 C CD2 . TYR C 1 12 ? 23.107  59.419 -16.337 1.00 14.05 ? 121 TYR C CD2 1 
ATOM   1550 C CE1 . TYR C 1 12 ? 20.776  58.611 -17.583 1.00 14.18 ? 121 TYR C CE1 1 
ATOM   1551 C CE2 . TYR C 1 12 ? 23.174  58.650 -17.486 1.00 14.10 ? 121 TYR C CE2 1 
ATOM   1552 C CZ  . TYR C 1 12 ? 21.997  58.244 -18.107 1.00 14.79 ? 121 TYR C CZ  1 
ATOM   1553 O OH  . TYR C 1 12 ? 22.007  57.481 -19.246 1.00 16.28 ? 121 TYR C OH  1 
ATOM   1554 N N   . LYS C 1 13 ? 21.979  57.638 -12.779 1.00 15.56 ? 122 LYS C N   1 
ATOM   1555 C CA  . LYS C 1 13 ? 22.891  56.559 -12.393 1.00 16.13 ? 122 LYS C CA  1 
ATOM   1556 C C   . LYS C 1 13 ? 23.716  56.117 -13.618 1.00 17.30 ? 122 LYS C C   1 
ATOM   1557 O O   . LYS C 1 13 ? 23.381  55.143 -14.302 1.00 17.07 ? 122 LYS C O   1 
ATOM   1558 C CB  . LYS C 1 13 ? 22.105  55.378 -11.803 1.00 15.91 ? 122 LYS C CB  1 
ATOM   1559 C CG  . LYS C 1 13 ? 22.967  54.269 -11.246 1.00 16.06 ? 122 LYS C CG  1 
ATOM   1560 C CD  . LYS C 1 13 ? 22.161  53.120 -10.675 1.00 16.57 ? 122 LYS C CD  1 
ATOM   1561 C CE  . LYS C 1 13 ? 23.038  52.117 -9.918  1.00 17.31 ? 122 LYS C CE  1 
ATOM   1562 N NZ  . LYS C 1 13 ? 22.299  50.906 -9.452  1.00 16.48 ? 122 LYS C NZ  1 
ATOM   1563 N N   . SER C 1 14 ? 24.807  56.831 -13.883 1.00 18.57 ? 123 SER C N   1 
ATOM   1564 C CA  . SER C 1 14 ? 25.657  56.509 -15.038 1.00 19.87 ? 123 SER C CA  1 
ATOM   1565 C C   . SER C 1 14 ? 26.551  55.292 -14.819 1.00 20.54 ? 123 SER C C   1 
ATOM   1566 O O   . SER C 1 14 ? 26.847  54.569 -15.769 1.00 21.39 ? 123 SER C O   1 
ATOM   1567 C CB  . SER C 1 14 ? 26.511  57.714 -15.427 1.00 19.75 ? 123 SER C CB  1 
ATOM   1568 O OG  . SER C 1 14 ? 27.042  58.323 -14.275 1.00 20.99 ? 123 SER C OG  1 
ATOM   1569 N N   . GLU C 1 15 ? 26.964  55.075 -13.574 1.00 21.35 ? 124 GLU C N   1 
ATOM   1570 C CA  . GLU C 1 15 ? 27.914  54.013 -13.202 1.00 22.12 ? 124 GLU C CA  1 
ATOM   1571 C C   . GLU C 1 15 ? 27.263  52.933 -12.330 1.00 22.02 ? 124 GLU C C   1 
ATOM   1572 O O   . GLU C 1 15 ? 26.172  53.119 -11.774 1.00 22.18 ? 124 GLU C O   1 
ATOM   1573 C CB  . GLU C 1 15 ? 29.066  54.607 -12.362 1.00 22.46 ? 124 GLU C CB  1 
ATOM   1574 C CG  . GLU C 1 15 ? 29.777  55.779 -12.992 1.00 24.85 ? 124 GLU C CG  1 
ATOM   1575 C CD  . GLU C 1 15 ? 30.563  55.384 -14.234 1.00 27.13 ? 124 GLU C CD  1 
ATOM   1576 O OE1 . GLU C 1 15 ? 31.223  54.323 -14.199 1.00 29.18 ? 124 GLU C OE1 1 
ATOM   1577 O OE2 . GLU C 1 15 ? 30.514  56.133 -15.234 1.00 28.91 ? 124 GLU C OE2 1 
ATOM   1578 N N   . ASP C 1 16 ? 27.988  51.834 -12.151 1.00 21.78 ? 125 ASP C N   1 
ATOM   1579 C CA  . ASP C 1 16 ? 27.574  50.795 -11.217 1.00 21.81 ? 125 ASP C CA  1 
ATOM   1580 C C   . ASP C 1 16 ? 27.424  51.338 -9.802  1.00 20.95 ? 125 ASP C C   1 
ATOM   1581 O O   . ASP C 1 16 ? 26.499  50.964 -9.090  1.00 21.16 ? 125 ASP C O   1 
ATOM   1582 C CB  . ASP C 1 16 ? 28.576  49.654 -11.209 1.00 22.09 ? 125 ASP C CB  1 
ATOM   1583 C CG  . ASP C 1 16 ? 28.529  48.837 -12.488 1.00 24.04 ? 125 ASP C CG  1 
ATOM   1584 O OD1 . ASP C 1 16 ? 27.396  48.483 -12.908 1.00 26.68 ? 125 ASP C OD1 1 
ATOM   1585 O OD2 . ASP C 1 16 ? 29.613  48.557 -13.069 1.00 24.88 ? 125 ASP C OD2 1 
ATOM   1586 N N   . SER C 1 17 ? 28.316  52.242 -9.421  1.00 19.95 ? 126 SER C N   1 
ATOM   1587 C CA  . SER C 1 17 ? 28.396  52.724 -8.062  1.00 19.05 ? 126 SER C CA  1 
ATOM   1588 C C   . SER C 1 17 ? 28.094  54.207 -8.044  1.00 18.20 ? 126 SER C C   1 
ATOM   1589 O O   . SER C 1 17 ? 28.601  54.952 -8.884  1.00 18.30 ? 126 SER C O   1 
ATOM   1590 C CB  . SER C 1 17 ? 29.806  52.479 -7.540  1.00 19.33 ? 126 SER C CB  1 
ATOM   1591 O OG  . SER C 1 17 ? 30.020  53.161 -6.321  1.00 20.42 ? 126 SER C OG  1 
ATOM   1592 N N   . LEU C 1 18 ? 27.279  54.635 -7.079  1.00 17.10 ? 127 LEU C N   1 
ATOM   1593 C CA  . LEU C 1 18 ? 26.857  56.027 -6.960  1.00 16.12 ? 127 LEU C CA  1 
ATOM   1594 C C   . LEU C 1 18 ? 27.834  56.869 -6.136  1.00 15.96 ? 127 LEU C C   1 
ATOM   1595 O O   . LEU C 1 18 ? 27.821  58.093 -6.194  1.00 16.16 ? 127 LEU C O   1 
ATOM   1596 C CB  . LEU C 1 18 ? 25.467  56.103 -6.332  1.00 16.02 ? 127 LEU C CB  1 
ATOM   1597 C CG  . LEU C 1 18 ? 24.264  55.689 -7.185  1.00 15.12 ? 127 LEU C CG  1 
ATOM   1598 C CD1 . LEU C 1 18 ? 23.079  55.507 -6.258  1.00 12.52 ? 127 LEU C CD1 1 
ATOM   1599 C CD2 . LEU C 1 18 ? 23.962  56.745 -8.256  1.00 13.72 ? 127 LEU C CD2 1 
ATOM   1600 N N   . GLY C 1 19 ? 28.672  56.218 -5.355  1.00 15.82 ? 128 GLY C N   1 
ATOM   1601 C CA  . GLY C 1 19 ? 29.658  56.925 -4.568  1.00 15.92 ? 128 GLY C CA  1 
ATOM   1602 C C   . GLY C 1 19 ? 29.122  57.545 -3.292  1.00 16.00 ? 128 GLY C C   1 
ATOM   1603 O O   . GLY C 1 19 ? 29.417  58.689 -2.986  1.00 16.60 ? 128 GLY C O   1 
ATOM   1604 N N   . LEU C 1 20 ? 28.357  56.791 -2.523  1.00 15.94 ? 129 LEU C N   1 
ATOM   1605 C CA  . LEU C 1 20 ? 27.983  57.250 -1.188  1.00 15.78 ? 129 LEU C CA  1 
ATOM   1606 C C   . LEU C 1 20 ? 27.926  56.120 -0.194  1.00 15.60 ? 129 LEU C C   1 
ATOM   1607 O O   . LEU C 1 20 ? 27.870  54.950 -0.570  1.00 15.64 ? 129 LEU C O   1 
ATOM   1608 C CB  . LEU C 1 20 ? 26.658  57.999 -1.210  1.00 15.75 ? 129 LEU C CB  1 
ATOM   1609 C CG  . LEU C 1 20 ? 25.362  57.208 -1.339  1.00 15.94 ? 129 LEU C CG  1 
ATOM   1610 C CD1 . LEU C 1 20 ? 24.179  58.175 -1.282  1.00 14.43 ? 129 LEU C CD1 1 
ATOM   1611 C CD2 . LEU C 1 20 ? 25.370  56.380 -2.665  1.00 15.59 ? 129 LEU C CD2 1 
ATOM   1612 N N   . THR C 1 21 ? 27.960  56.498 1.083   1.00 15.68 ? 130 THR C N   1 
ATOM   1613 C CA  . THR C 1 21 ? 27.831  55.575 2.220   1.00 15.00 ? 130 THR C CA  1 
ATOM   1614 C C   . THR C 1 21 ? 26.629  56.001 3.065   1.00 14.83 ? 130 THR C C   1 
ATOM   1615 O O   . THR C 1 21 ? 26.434  57.178 3.331   1.00 14.65 ? 130 THR C O   1 
ATOM   1616 C CB  . THR C 1 21 ? 29.089  55.603 3.051   1.00 14.93 ? 130 THR C CB  1 
ATOM   1617 O OG1 . THR C 1 21 ? 30.191  55.404 2.177   1.00 15.75 ? 130 THR C OG1 1 
ATOM   1618 C CG2 . THR C 1 21 ? 29.095  54.517 4.139   1.00 14.83 ? 130 THR C CG2 1 
ATOM   1619 N N   . ILE C 1 22 ? 25.829  55.027 3.485   1.00 14.86 ? 131 ILE C N   1 
ATOM   1620 C CA  . ILE C 1 22 ? 24.565  55.270 4.180   1.00 14.90 ? 131 ILE C CA  1 
ATOM   1621 C C   . ILE C 1 22 ? 24.597  54.651 5.577   1.00 14.91 ? 131 ILE C C   1 
ATOM   1622 O O   . ILE C 1 22 ? 25.099  53.534 5.750   1.00 15.17 ? 131 ILE C O   1 
ATOM   1623 C CB  . ILE C 1 22 ? 23.423  54.641 3.376   1.00 15.15 ? 131 ILE C CB  1 
ATOM   1624 C CG1 . ILE C 1 22 ? 23.281  55.372 2.053   1.00 16.71 ? 131 ILE C CG1 1 
ATOM   1625 C CG2 . ILE C 1 22 ? 22.105  54.731 4.082   1.00 14.76 ? 131 ILE C CG2 1 
ATOM   1626 C CD1 . ILE C 1 22 ? 22.230  54.809 1.208   1.00 19.84 ? 131 ILE C CD1 1 
ATOM   1627 N N   . THR C 1 23 ? 24.052  55.368 6.566   1.00 14.72 ? 132 THR C N   1 
ATOM   1628 C CA  . THR C 1 23 ? 23.943  54.856 7.926   1.00 14.53 ? 132 THR C CA  1 
ATOM   1629 C C   . THR C 1 23 ? 22.614  55.261 8.586   1.00 15.25 ? 132 THR C C   1 
ATOM   1630 O O   . THR C 1 23 ? 21.762  55.828 7.913   1.00 15.79 ? 132 THR C O   1 
ATOM   1631 C CB  . THR C 1 23 ? 25.120  55.330 8.744   1.00 13.90 ? 132 THR C CB  1 
ATOM   1632 O OG1 . THR C 1 23 ? 25.365  54.387 9.770   1.00 12.46 ? 132 THR C OG1 1 
ATOM   1633 C CG2 . THR C 1 23 ? 24.865  56.690 9.333   1.00 13.97 ? 132 THR C CG2 1 
ATOM   1634 N N   . ASP C 1 24 ? 22.421  54.958 9.879   1.00 15.61 ? 133 ASP C N   1 
ATOM   1635 C CA  . ASP C 1 24 ? 21.225  55.421 10.600  1.00 15.81 ? 133 ASP C CA  1 
ATOM   1636 C C   . ASP C 1 24 ? 21.346  55.398 12.104  1.00 15.55 ? 133 ASP C C   1 
ATOM   1637 O O   . ASP C 1 24 ? 22.256  54.824 12.630  1.00 15.01 ? 133 ASP C O   1 
ATOM   1638 C CB  . ASP C 1 24 ? 20.003  54.601 10.193  1.00 16.24 ? 133 ASP C CB  1 
ATOM   1639 C CG  . ASP C 1 24 ? 20.066  53.164 10.674  1.00 17.92 ? 133 ASP C CG  1 
ATOM   1640 O OD1 . ASP C 1 24 ? 20.270  52.947 11.899  1.00 18.94 ? 133 ASP C OD1 1 
ATOM   1641 O OD2 . ASP C 1 24 ? 19.870  52.255 9.828   1.00 18.68 ? 133 ASP C OD2 1 
ATOM   1642 N N   . ASN C 1 25 ? 20.380  56.010 12.775  1.00 15.90 ? 134 ASN C N   1 
ATOM   1643 C CA  . ASN C 1 25 ? 20.306  56.062 14.230  1.00 16.00 ? 134 ASN C CA  1 
ATOM   1644 C C   . ASN C 1 25 ? 19.573  54.917 14.855  1.00 16.04 ? 134 ASN C C   1 
ATOM   1645 O O   . ASN C 1 25 ? 19.260  54.963 16.037  1.00 16.31 ? 134 ASN C O   1 
ATOM   1646 C CB  . ASN C 1 25 ? 19.487  57.270 14.622  1.00 16.45 ? 134 ASN C CB  1 
ATOM   1647 C CG  . ASN C 1 25 ? 20.286  58.518 14.656  1.00 19.18 ? 134 ASN C CG  1 
ATOM   1648 O OD1 . ASN C 1 25 ? 21.476  58.538 14.297  1.00 21.55 ? 134 ASN C OD1 1 
ATOM   1649 N ND2 . ASN C 1 25 ? 19.643  59.603 15.103  1.00 21.68 ? 134 ASN C ND2 1 
ATOM   1650 N N   . GLY C 1 26 ? 19.225  53.915 14.068  1.00 16.40 ? 135 GLY C N   1 
ATOM   1651 C CA  . GLY C 1 26 ? 18.348  52.857 14.545  1.00 16.37 ? 135 GLY C CA  1 
ATOM   1652 C C   . GLY C 1 26 ? 16.862  53.134 14.361  1.00 16.57 ? 135 GLY C C   1 
ATOM   1653 O O   . GLY C 1 26 ? 16.063  52.227 14.475  1.00 16.37 ? 135 GLY C O   1 
ATOM   1654 N N   . VAL C 1 27 ? 16.447  54.356 14.057  1.00 16.92 ? 136 VAL C N   1 
ATOM   1655 C CA  . VAL C 1 27 ? 15.033  54.615 14.151  1.00 17.20 ? 136 VAL C CA  1 
ATOM   1656 C C   . VAL C 1 27 ? 14.392  55.423 13.037  1.00 18.02 ? 136 VAL C C   1 
ATOM   1657 O O   . VAL C 1 27 ? 13.266  55.102 12.576  1.00 19.69 ? 136 VAL C O   1 
ATOM   1658 C CB  . VAL C 1 27 ? 14.681  55.159 15.544  1.00 17.01 ? 136 VAL C CB  1 
ATOM   1659 C CG1 . VAL C 1 27 ? 13.832  56.366 15.460  1.00 17.02 ? 136 VAL C CG1 1 
ATOM   1660 C CG2 . VAL C 1 27 ? 14.015  54.095 16.366  1.00 16.41 ? 136 VAL C CG2 1 
ATOM   1661 N N   . GLY C 1 28 ? 15.033  56.462 12.566  1.00 17.62 ? 137 GLY C N   1 
ATOM   1662 C CA  . GLY C 1 28 ? 14.242  57.354 11.739  1.00 17.73 ? 137 GLY C CA  1 
ATOM   1663 C C   . GLY C 1 28 ? 14.227  56.968 10.280  1.00 17.61 ? 137 GLY C C   1 
ATOM   1664 O O   . GLY C 1 28 ? 13.668  55.934 9.903   1.00 17.96 ? 137 GLY C O   1 
ATOM   1665 N N   . TYR C 1 29 ? 14.805  57.868 9.479   1.00 16.77 ? 138 TYR C N   1 
ATOM   1666 C CA  . TYR C 1 29 ? 15.271  57.604 8.144   1.00 16.23 ? 138 TYR C CA  1 
ATOM   1667 C C   . TYR C 1 29 ? 16.791  57.367 8.169   1.00 15.68 ? 138 TYR C C   1 
ATOM   1668 O O   . TYR C 1 29 ? 17.517  57.922 8.982   1.00 15.51 ? 138 TYR C O   1 
ATOM   1669 C CB  . TYR C 1 29 ? 15.043  58.843 7.259   1.00 16.43 ? 138 TYR C CB  1 
ATOM   1670 C CG  . TYR C 1 29 ? 13.611  59.250 7.001   1.00 15.56 ? 138 TYR C CG  1 
ATOM   1671 C CD1 . TYR C 1 29 ? 12.802  58.492 6.199   1.00 16.74 ? 138 TYR C CD1 1 
ATOM   1672 C CD2 . TYR C 1 29 ? 13.096  60.428 7.514   1.00 15.29 ? 138 TYR C CD2 1 
ATOM   1673 C CE1 . TYR C 1 29 ? 11.497  58.865 5.944   1.00 17.21 ? 138 TYR C CE1 1 
ATOM   1674 C CE2 . TYR C 1 29 ? 11.806  60.812 7.271   1.00 15.69 ? 138 TYR C CE2 1 
ATOM   1675 C CZ  . TYR C 1 29 ? 11.002  60.023 6.474   1.00 16.72 ? 138 TYR C CZ  1 
ATOM   1676 O OH  . TYR C 1 29 ? 9.701   60.373 6.196   1.00 14.67 ? 138 TYR C OH  1 
ATOM   1677 N N   . ALA C 1 30 ? 17.269  56.562 7.238   1.00 15.46 ? 139 ALA C N   1 
ATOM   1678 C CA  . ALA C 1 30 ? 18.692  56.441 6.969   1.00 15.33 ? 139 ALA C CA  1 
ATOM   1679 C C   . ALA C 1 30 ? 19.200  57.787 6.461   1.00 15.24 ? 139 ALA C C   1 
ATOM   1680 O O   . ALA C 1 30 ? 18.417  58.589 5.967   1.00 15.24 ? 139 ALA C O   1 
ATOM   1681 C CB  . ALA C 1 30 ? 18.921  55.366 5.903   1.00 15.22 ? 139 ALA C CB  1 
ATOM   1682 N N   . PHE C 1 31 ? 20.496  58.043 6.596   1.00 14.83 ? 140 PHE C N   1 
ATOM   1683 C CA  . PHE C 1 31 ? 21.055  59.285 6.120   1.00 14.81 ? 140 PHE C CA  1 
ATOM   1684 C C   . PHE C 1 31 ? 22.445  59.071 5.541   1.00 15.17 ? 140 PHE C C   1 
ATOM   1685 O O   . PHE C 1 31 ? 23.050  57.999 5.706   1.00 16.30 ? 140 PHE C O   1 
ATOM   1686 C CB  . PHE C 1 31 ? 21.077  60.338 7.236   1.00 14.81 ? 140 PHE C CB  1 
ATOM   1687 C CG  . PHE C 1 31 ? 21.899  59.969 8.431   1.00 14.45 ? 140 PHE C CG  1 
ATOM   1688 C CD1 . PHE C 1 31 ? 23.242  60.313 8.502   1.00 15.08 ? 140 PHE C CD1 1 
ATOM   1689 C CD2 . PHE C 1 31 ? 21.332  59.345 9.511   1.00 13.92 ? 140 PHE C CD2 1 
ATOM   1690 C CE1 . PHE C 1 31 ? 24.002  60.016 9.643   1.00 14.28 ? 140 PHE C CE1 1 
ATOM   1691 C CE2 . PHE C 1 31 ? 22.086  59.046 10.644  1.00 14.56 ? 140 PHE C CE2 1 
ATOM   1692 C CZ  . PHE C 1 31 ? 23.418  59.379 10.703  1.00 13.73 ? 140 PHE C CZ  1 
ATOM   1693 N N   . ILE C 1 32 ? 22.954  60.095 4.871   1.00 14.76 ? 141 ILE C N   1 
ATOM   1694 C CA  . ILE C 1 32 ? 24.207  59.995 4.155   1.00 14.33 ? 141 ILE C CA  1 
ATOM   1695 C C   . ILE C 1 32 ? 25.345  60.296 5.119   1.00 14.59 ? 141 ILE C C   1 
ATOM   1696 O O   . ILE C 1 32 ? 25.411  61.364 5.716   1.00 14.12 ? 141 ILE C O   1 
ATOM   1697 C CB  . ILE C 1 32 ? 24.250  60.983 2.965   1.00 14.05 ? 141 ILE C CB  1 
ATOM   1698 C CG1 . ILE C 1 32 ? 23.060  60.727 2.022   1.00 13.72 ? 141 ILE C CG1 1 
ATOM   1699 C CG2 . ILE C 1 32 ? 25.540  60.874 2.221   1.00 12.53 ? 141 ILE C CG2 1 
ATOM   1700 C CD1 . ILE C 1 32 ? 22.929  61.757 0.915   1.00 11.33 ? 141 ILE C CD1 1 
ATOM   1701 N N   . LYS C 1 33 ? 26.258  59.347 5.227   1.00 15.05 ? 142 LYS C N   1 
ATOM   1702 C CA  . LYS C 1 33 ? 27.405  59.484 6.091   1.00 15.88 ? 142 LYS C CA  1 
ATOM   1703 C C   . LYS C 1 33 ? 28.612  60.000 5.346   1.00 16.24 ? 142 LYS C C   1 
ATOM   1704 O O   . LYS C 1 33 ? 29.397  60.758 5.914   1.00 16.46 ? 142 LYS C O   1 
ATOM   1705 C CB  . LYS C 1 33 ? 27.749  58.133 6.712   1.00 16.07 ? 142 LYS C CB  1 
ATOM   1706 C CG  . LYS C 1 33 ? 28.658  58.227 7.911   1.00 16.59 ? 142 LYS C CG  1 
ATOM   1707 C CD  . LYS C 1 33 ? 29.242  56.870 8.299   1.00 17.51 ? 142 LYS C CD  1 
ATOM   1708 C CE  . LYS C 1 33 ? 30.060  56.965 9.585   1.00 18.34 ? 142 LYS C CE  1 
ATOM   1709 N NZ  . LYS C 1 33 ? 30.726  55.658 9.881   1.00 20.15 ? 142 LYS C NZ  1 
ATOM   1710 N N   . ARG C 1 34 ? 28.782  59.556 4.098   1.00 16.78 ? 143 ARG C N   1 
ATOM   1711 C CA  . ARG C 1 34 ? 29.928  59.966 3.258   1.00 17.31 ? 143 ARG C CA  1 
ATOM   1712 C C   . ARG C 1 34 ? 29.512  60.152 1.814   1.00 16.87 ? 143 ARG C C   1 
ATOM   1713 O O   . ARG C 1 34 ? 28.655  59.436 1.316   1.00 16.48 ? 143 ARG C O   1 
ATOM   1714 C CB  . ARG C 1 34 ? 31.018  58.902 3.268   1.00 17.80 ? 143 ARG C CB  1 
ATOM   1715 C CG  . ARG C 1 34 ? 32.033  59.062 4.357   1.00 20.73 ? 143 ARG C CG  1 
ATOM   1716 C CD  . ARG C 1 34 ? 32.940  57.856 4.460   1.00 24.84 ? 143 ARG C CD  1 
ATOM   1717 N NE  . ARG C 1 34 ? 33.821  58.070 5.598   1.00 30.14 ? 143 ARG C NE  1 
ATOM   1718 C CZ  . ARG C 1 34 ? 33.728  57.486 6.800   1.00 33.35 ? 143 ARG C CZ  1 
ATOM   1719 N NH1 . ARG C 1 34 ? 32.812  56.552 7.070   1.00 34.57 ? 143 ARG C NH1 1 
ATOM   1720 N NH2 . ARG C 1 34 ? 34.609  57.820 7.740   1.00 33.92 ? 143 ARG C NH2 1 
ATOM   1721 N N   . ILE C 1 35 ? 30.154  61.103 1.146   1.00 16.67 ? 144 ILE C N   1 
ATOM   1722 C CA  . ILE C 1 35 ? 30.040  61.246 -0.282  1.00 16.51 ? 144 ILE C CA  1 
ATOM   1723 C C   . ILE C 1 35 ? 31.418  61.144 -0.869  1.00 16.43 ? 144 ILE C C   1 
ATOM   1724 O O   . ILE C 1 35 ? 32.307  61.879 -0.485  1.00 15.59 ? 144 ILE C O   1 
ATOM   1725 C CB  . ILE C 1 35 ? 29.376  62.583 -0.678  1.00 16.69 ? 144 ILE C CB  1 
ATOM   1726 C CG1 . ILE C 1 35 ? 27.911  62.615 -0.182  1.00 15.99 ? 144 ILE C CG1 1 
ATOM   1727 C CG2 . ILE C 1 35 ? 29.432  62.760 -2.210  1.00 16.51 ? 144 ILE C CG2 1 
ATOM   1728 C CD1 . ILE C 1 35 ? 27.286  64.012 -0.164  1.00 14.63 ? 144 ILE C CD1 1 
ATOM   1729 N N   . LYS C 1 36 ? 31.586  60.220 -1.807  1.00 17.31 ? 145 LYS C N   1 
ATOM   1730 C CA  . LYS C 1 36 ? 32.895  59.942 -2.392  1.00 17.98 ? 145 LYS C CA  1 
ATOM   1731 C C   . LYS C 1 36 ? 33.273  60.991 -3.434  1.00 18.16 ? 145 LYS C C   1 
ATOM   1732 O O   . LYS C 1 36 ? 32.500  61.263 -4.345  1.00 18.40 ? 145 LYS C O   1 
ATOM   1733 C CB  . LYS C 1 36 ? 32.901  58.543 -3.013  1.00 18.10 ? 145 LYS C CB  1 
ATOM   1734 C CG  . LYS C 1 36 ? 34.167  58.234 -3.766  1.00 19.95 ? 145 LYS C CG  1 
ATOM   1735 C CD  . LYS C 1 36 ? 34.511  56.744 -3.892  1.00 21.63 ? 145 LYS C CD  1 
ATOM   1736 C CE  . LYS C 1 36 ? 35.830  56.614 -4.709  1.00 23.22 ? 145 LYS C CE  1 
ATOM   1737 N NZ  . LYS C 1 36 ? 36.495  55.283 -4.604  1.00 25.11 ? 145 LYS C NZ  1 
ATOM   1738 N N   . ASP C 1 37 ? 34.469  61.563 -3.294  1.00 18.82 ? 146 ASP C N   1 
ATOM   1739 C CA  . ASP C 1 37 ? 35.011  62.526 -4.265  1.00 19.50 ? 146 ASP C CA  1 
ATOM   1740 C C   . ASP C 1 37 ? 35.010  61.973 -5.671  1.00 18.62 ? 146 ASP C C   1 
ATOM   1741 O O   . ASP C 1 37 ? 35.513  60.891 -5.908  1.00 18.52 ? 146 ASP C O   1 
ATOM   1742 C CB  . ASP C 1 37 ? 36.443  62.952 -3.907  1.00 20.15 ? 146 ASP C CB  1 
ATOM   1743 C CG  . ASP C 1 37 ? 36.491  64.026 -2.815  1.00 24.11 ? 146 ASP C CG  1 
ATOM   1744 O OD1 . ASP C 1 37 ? 35.420  64.473 -2.341  1.00 29.43 ? 146 ASP C OD1 1 
ATOM   1745 O OD2 . ASP C 1 37 ? 37.605  64.444 -2.425  1.00 28.30 ? 146 ASP C OD2 1 
ATOM   1746 N N   . GLY C 1 38 ? 34.414  62.722 -6.591  1.00 17.72 ? 147 GLY C N   1 
ATOM   1747 C CA  . GLY C 1 38 ? 34.441  62.381 -8.008  1.00 17.09 ? 147 GLY C CA  1 
ATOM   1748 C C   . GLY C 1 38 ? 33.423  61.333 -8.432  1.00 16.57 ? 147 GLY C C   1 
ATOM   1749 O O   . GLY C 1 38 ? 33.486  60.820 -9.547  1.00 16.59 ? 147 GLY C O   1 
ATOM   1750 N N   . GLY C 1 39 ? 32.503  60.990 -7.539  1.00 15.63 ? 148 GLY C N   1 
ATOM   1751 C CA  . GLY C 1 39 ? 31.442  60.053 -7.873  1.00 14.87 ? 148 GLY C CA  1 
ATOM   1752 C C   . GLY C 1 39 ? 30.210  60.799 -8.331  1.00 14.31 ? 148 GLY C C   1 
ATOM   1753 O O   . GLY C 1 39 ? 30.176  62.033 -8.345  1.00 13.73 ? 148 GLY C O   1 
ATOM   1754 N N   . VAL C 1 40 ? 29.186  60.046 -8.693  1.00 13.92 ? 149 VAL C N   1 
ATOM   1755 C CA  . VAL C 1 40 ? 27.955  60.635 -9.208  1.00 13.78 ? 149 VAL C CA  1 
ATOM   1756 C C   . VAL C 1 40 ? 27.286  61.564 -8.197  1.00 13.80 ? 149 VAL C C   1 
ATOM   1757 O O   . VAL C 1 40 ? 26.914  62.691 -8.524  1.00 14.25 ? 149 VAL C O   1 
ATOM   1758 C CB  . VAL C 1 40 ? 26.961  59.568 -9.649  1.00 13.90 ? 149 VAL C CB  1 
ATOM   1759 C CG1 . VAL C 1 40 ? 25.614  60.217 -9.951  1.00 13.05 ? 149 VAL C CG1 1 
ATOM   1760 C CG2 . VAL C 1 40 ? 27.501  58.827 -10.880 1.00 12.97 ? 149 VAL C CG2 1 
ATOM   1761 N N   . ILE C 1 41 ? 27.164  61.116 -6.956  1.00 13.49 ? 150 ILE C N   1 
ATOM   1762 C CA  . ILE C 1 41 ? 26.501  61.928 -5.951  1.00 13.00 ? 150 ILE C CA  1 
ATOM   1763 C C   . ILE C 1 41 ? 27.276  63.203 -5.688  1.00 13.44 ? 150 ILE C C   1 
ATOM   1764 O O   . ILE C 1 41 ? 26.680  64.243 -5.508  1.00 14.08 ? 150 ILE C O   1 
ATOM   1765 C CB  . ILE C 1 41 ? 26.260  61.157 -4.619  1.00 12.73 ? 150 ILE C CB  1 
ATOM   1766 C CG1 . ILE C 1 41 ? 25.313  59.960 -4.836  1.00 12.54 ? 150 ILE C CG1 1 
ATOM   1767 C CG2 . ILE C 1 41 ? 25.668  62.076 -3.562  1.00 11.07 ? 150 ILE C CG2 1 
ATOM   1768 C CD1 . ILE C 1 41 ? 23.881  60.324 -5.196  1.00 10.23 ? 150 ILE C CD1 1 
ATOM   1769 N N   . ASP C 1 42 ? 28.595  63.136 -5.665  1.00 13.66 ? 151 ASP C N   1 
ATOM   1770 C CA  . ASP C 1 42 ? 29.411  64.338 -5.476  1.00 14.25 ? 151 ASP C CA  1 
ATOM   1771 C C   . ASP C 1 42 ? 29.131  65.437 -6.512  1.00 14.48 ? 151 ASP C C   1 
ATOM   1772 O O   . ASP C 1 42 ? 29.261  66.613 -6.215  1.00 14.80 ? 151 ASP C O   1 
ATOM   1773 C CB  . ASP C 1 42 ? 30.913  63.979 -5.527  1.00 14.97 ? 151 ASP C CB  1 
ATOM   1774 C CG  . ASP C 1 42 ? 31.853  65.174 -5.179  1.00 15.95 ? 151 ASP C CG  1 
ATOM   1775 O OD1 . ASP C 1 42 ? 31.440  66.085 -4.441  1.00 19.13 ? 151 ASP C OD1 1 
ATOM   1776 O OD2 . ASP C 1 42 ? 33.015  65.197 -5.621  1.00 16.98 ? 151 ASP C OD2 1 
ATOM   1777 N N   . SER C 1 43 ? 28.777  65.060 -7.735  1.00 14.89 ? 152 SER C N   1 
ATOM   1778 C CA  . SER C 1 43 ? 28.499  66.040 -8.778  1.00 14.99 ? 152 SER C CA  1 
ATOM   1779 C C   . SER C 1 43 ? 27.180  66.767 -8.570  1.00 15.16 ? 152 SER C C   1 
ATOM   1780 O O   . SER C 1 43 ? 26.977  67.841 -9.118  1.00 15.37 ? 152 SER C O   1 
ATOM   1781 C CB  . SER C 1 43 ? 28.510  65.372 -10.152 1.00 15.02 ? 152 SER C CB  1 
ATOM   1782 O OG  . SER C 1 43 ? 27.371  64.560 -10.320 1.00 16.07 ? 152 SER C OG  1 
ATOM   1783 N N   . VAL C 1 44 ? 26.271  66.187 -7.796  1.00 15.38 ? 153 VAL C N   1 
ATOM   1784 C CA  . VAL C 1 44 ? 24.964  66.815 -7.559  1.00 15.48 ? 153 VAL C CA  1 
ATOM   1785 C C   . VAL C 1 44 ? 25.042  67.575 -6.259  1.00 16.00 ? 153 VAL C C   1 
ATOM   1786 O O   . VAL C 1 44 ? 24.898  67.010 -5.184  1.00 16.91 ? 153 VAL C O   1 
ATOM   1787 C CB  . VAL C 1 44 ? 23.856  65.753 -7.487  1.00 15.57 ? 153 VAL C CB  1 
ATOM   1788 C CG1 . VAL C 1 44 ? 22.501  66.399 -7.259  1.00 14.32 ? 153 VAL C CG1 1 
ATOM   1789 C CG2 . VAL C 1 44 ? 23.909  64.875 -8.728  1.00 14.76 ? 153 VAL C CG2 1 
ATOM   1790 N N   . LYS C 1 45 ? 25.277  68.865 -6.338  1.00 16.84 ? 154 LYS C N   1 
ATOM   1791 C CA  . LYS C 1 45 ? 25.680  69.604 -5.147  1.00 17.68 ? 154 LYS C CA  1 
ATOM   1792 C C   . LYS C 1 45 ? 24.559  69.973 -4.169  1.00 18.05 ? 154 LYS C C   1 
ATOM   1793 O O   . LYS C 1 45 ? 24.832  70.492 -3.089  1.00 18.47 ? 154 LYS C O   1 
ATOM   1794 C CB  . LYS C 1 45 ? 26.462  70.848 -5.546  1.00 17.83 ? 154 LYS C CB  1 
ATOM   1795 C CG  . LYS C 1 45 ? 27.727  70.549 -6.403  1.00 18.67 ? 154 LYS C CG  1 
ATOM   1796 C CD  . LYS C 1 45 ? 28.790  69.758 -5.641  1.00 19.88 ? 154 LYS C CD  1 
ATOM   1797 C CE  . LYS C 1 45 ? 30.128  69.750 -6.404  1.00 20.46 ? 154 LYS C CE  1 
ATOM   1798 N NZ  . LYS C 1 45 ? 31.051  68.635 -6.023  1.00 20.86 ? 154 LYS C NZ  1 
ATOM   1799 N N   . THR C 1 46 ? 23.313  69.702 -4.523  1.00 17.95 ? 155 THR C N   1 
ATOM   1800 C CA  . THR C 1 46 ? 22.224  69.891 -3.587  1.00 17.85 ? 155 THR C CA  1 
ATOM   1801 C C   . THR C 1 46 ? 22.133  68.727 -2.603  1.00 17.92 ? 155 THR C C   1 
ATOM   1802 O O   . THR C 1 46 ? 21.342  68.817 -1.667  1.00 18.56 ? 155 THR C O   1 
ATOM   1803 C CB  . THR C 1 46 ? 20.854  70.066 -4.311  1.00 17.92 ? 155 THR C CB  1 
ATOM   1804 O OG1 . THR C 1 46 ? 20.587  68.952 -5.176  1.00 18.89 ? 155 THR C OG1 1 
ATOM   1805 C CG2 . THR C 1 46 ? 20.862  71.331 -5.146  1.00 17.36 ? 155 THR C CG2 1 
ATOM   1806 N N   . ILE C 1 47 ? 22.893  67.637 -2.820  1.00 17.08 ? 156 ILE C N   1 
ATOM   1807 C CA  . ILE C 1 47 ? 22.917  66.505 -1.881  1.00 16.61 ? 156 ILE C CA  1 
ATOM   1808 C C   . ILE C 1 47 ? 24.090  66.676 -0.903  1.00 17.12 ? 156 ILE C C   1 
ATOM   1809 O O   . ILE C 1 47 ? 25.225  66.903 -1.345  1.00 17.68 ? 156 ILE C O   1 
ATOM   1810 C CB  . ILE C 1 47 ? 23.076  65.150 -2.632  1.00 16.28 ? 156 ILE C CB  1 
ATOM   1811 C CG1 . ILE C 1 47 ? 21.895  64.927 -3.591  1.00 16.58 ? 156 ILE C CG1 1 
ATOM   1812 C CG2 . ILE C 1 47 ? 23.154  63.977 -1.664  1.00 14.59 ? 156 ILE C CG2 1 
ATOM   1813 C CD1 . ILE C 1 47 ? 21.993  63.673 -4.470  1.00 14.74 ? 156 ILE C CD1 1 
ATOM   1814 N N   . CYS C 1 48 ? 23.839  66.550 0.405   1.00 16.87 ? 157 CYS C N   1 
ATOM   1815 C CA  . CYS C 1 48 ? 24.895  66.734 1.426   1.00 17.20 ? 157 CYS C CA  1 
ATOM   1816 C C   . CYS C 1 48 ? 24.999  65.652 2.454   1.00 15.66 ? 157 CYS C C   1 
ATOM   1817 O O   . CYS C 1 48 ? 24.017  65.045 2.788   1.00 15.59 ? 157 CYS C O   1 
ATOM   1818 C CB  . CYS C 1 48 ? 24.653  67.980 2.255   1.00 17.62 ? 157 CYS C CB  1 
ATOM   1819 S SG  . CYS C 1 48 ? 24.216  69.365 1.300   1.00 24.01 ? 157 CYS C SG  1 
ATOM   1820 N N   . VAL C 1 49 ? 26.201  65.490 3.001   1.00 14.56 ? 158 VAL C N   1 
ATOM   1821 C CA  . VAL C 1 49 ? 26.438  64.691 4.181   1.00 13.63 ? 158 VAL C CA  1 
ATOM   1822 C C   . VAL C 1 49 ? 25.453  65.156 5.251   1.00 13.40 ? 158 VAL C C   1 
ATOM   1823 O O   . VAL C 1 49 ? 25.306  66.347 5.488   1.00 13.07 ? 158 VAL C O   1 
ATOM   1824 C CB  . VAL C 1 49 ? 27.904  64.856 4.680   1.00 13.70 ? 158 VAL C CB  1 
ATOM   1825 C CG1 . VAL C 1 49 ? 28.106  64.250 6.075   1.00 11.50 ? 158 VAL C CG1 1 
ATOM   1826 C CG2 . VAL C 1 49 ? 28.853  64.229 3.699   1.00 12.42 ? 158 VAL C CG2 1 
ATOM   1827 N N   . GLY C 1 50 ? 24.742  64.208 5.842   1.00 13.11 ? 159 GLY C N   1 
ATOM   1828 C CA  . GLY C 1 50 ? 23.759  64.513 6.858   1.00 13.44 ? 159 GLY C CA  1 
ATOM   1829 C C   . GLY C 1 50 ? 22.340  64.467 6.375   1.00 13.83 ? 159 GLY C C   1 
ATOM   1830 O O   . GLY C 1 50 ? 21.437  64.352 7.187   1.00 14.49 ? 159 GLY C O   1 
ATOM   1831 N N   . ASP C 1 51 ? 22.131  64.530 5.063   1.00 14.16 ? 160 ASP C N   1 
ATOM   1832 C CA  . ASP C 1 51 ? 20.790  64.461 4.498   1.00 14.41 ? 160 ASP C CA  1 
ATOM   1833 C C   . ASP C 1 51 ? 20.098  63.113 4.761   1.00 13.90 ? 160 ASP C C   1 
ATOM   1834 O O   . ASP C 1 51 ? 20.665  62.062 4.577   1.00 13.32 ? 160 ASP C O   1 
ATOM   1835 C CB  . ASP C 1 51 ? 20.802  64.761 2.988   1.00 14.78 ? 160 ASP C CB  1 
ATOM   1836 C CG  . ASP C 1 51 ? 21.052  66.250 2.655   1.00 16.68 ? 160 ASP C CG  1 
ATOM   1837 O OD1 . ASP C 1 51 ? 21.171  67.106 3.558   1.00 19.16 ? 160 ASP C OD1 1 
ATOM   1838 O OD2 . ASP C 1 51 ? 21.119  66.553 1.439   1.00 18.94 ? 160 ASP C OD2 1 
ATOM   1839 N N   . HIS C 1 52 ? 18.858  63.163 5.216   1.00 13.77 ? 161 HIS C N   1 
ATOM   1840 C CA  . HIS C 1 52 ? 18.098  61.967 5.475   1.00 13.72 ? 161 HIS C CA  1 
ATOM   1841 C C   . HIS C 1 52 ? 17.320  61.652 4.211   1.00 13.64 ? 161 HIS C C   1 
ATOM   1842 O O   . HIS C 1 52 ? 16.825  62.585 3.604   1.00 13.69 ? 161 HIS C O   1 
ATOM   1843 C CB  . HIS C 1 52 ? 17.145  62.256 6.622   1.00 13.49 ? 161 HIS C CB  1 
ATOM   1844 C CG  . HIS C 1 52 ? 17.816  62.311 7.944   1.00 14.37 ? 161 HIS C CG  1 
ATOM   1845 N ND1 . HIS C 1 52 ? 17.608  61.357 8.916   1.00 15.82 ? 161 HIS C ND1 1 
ATOM   1846 C CD2 . HIS C 1 52 ? 18.726  63.172 8.454   1.00 15.26 ? 161 HIS C CD2 1 
ATOM   1847 C CE1 . HIS C 1 52 ? 18.338  61.642 9.981   1.00 15.68 ? 161 HIS C CE1 1 
ATOM   1848 N NE2 . HIS C 1 52 ? 19.034  62.733 9.720   1.00 15.36 ? 161 HIS C NE2 1 
ATOM   1849 N N   . ILE C 1 53 ? 17.235  60.376 3.809   1.00 13.56 ? 162 ILE C N   1 
ATOM   1850 C CA  . ILE C 1 53 ? 16.496  59.983 2.607   1.00 14.01 ? 162 ILE C CA  1 
ATOM   1851 C C   . ILE C 1 53 ? 15.074  59.537 2.926   1.00 14.17 ? 162 ILE C C   1 
ATOM   1852 O O   . ILE C 1 53 ? 14.852  58.487 3.546   1.00 14.16 ? 162 ILE C O   1 
ATOM   1853 C CB  . ILE C 1 53 ? 17.141  58.844 1.840   1.00 14.29 ? 162 ILE C CB  1 
ATOM   1854 C CG1 . ILE C 1 53 ? 18.551  59.203 1.410   1.00 15.49 ? 162 ILE C CG1 1 
ATOM   1855 C CG2 . ILE C 1 53 ? 16.352  58.580 0.547   1.00 13.87 ? 162 ILE C CG2 1 
ATOM   1856 C CD1 . ILE C 1 53 ? 19.545  58.186 1.795   1.00 15.97 ? 162 ILE C CD1 1 
ATOM   1857 N N   . GLU C 1 54 ? 14.116  60.327 2.458   1.00 14.23 ? 163 GLU C N   1 
ATOM   1858 C CA  . GLU C 1 54 ? 12.698  60.135 2.746   1.00 14.56 ? 163 GLU C CA  1 
ATOM   1859 C C   . GLU C 1 54 ? 12.024  59.182 1.766   1.00 13.89 ? 163 GLU C C   1 
ATOM   1860 O O   . GLU C 1 54 ? 11.125  58.431 2.135   1.00 13.10 ? 163 GLU C O   1 
ATOM   1861 C CB  . GLU C 1 54 ? 12.028  61.512 2.723   1.00 15.02 ? 163 GLU C CB  1 
ATOM   1862 C CG  . GLU C 1 54 ? 10.529  61.497 2.721   1.00 17.76 ? 163 GLU C CG  1 
ATOM   1863 C CD  . GLU C 1 54 ? 9.957   62.896 3.019   1.00 22.14 ? 163 GLU C CD  1 
ATOM   1864 O OE1 . GLU C 1 54 ? 10.758  63.873 3.048   1.00 22.57 ? 163 GLU C OE1 1 
ATOM   1865 O OE2 . GLU C 1 54 ? 8.703   63.000 3.220   1.00 24.74 ? 163 GLU C OE2 1 
ATOM   1866 N N   . SER C 1 55 ? 12.481  59.217 0.519   1.00 13.83 ? 164 SER C N   1 
ATOM   1867 C CA  . SER C 1 55 ? 11.967  58.338 -0.508  1.00 13.82 ? 164 SER C CA  1 
ATOM   1868 C C   . SER C 1 55 ? 12.899  58.163 -1.709  1.00 13.84 ? 164 SER C C   1 
ATOM   1869 O O   . SER C 1 55 ? 13.742  59.009 -1.985  1.00 13.26 ? 164 SER C O   1 
ATOM   1870 C CB  . SER C 1 55 ? 10.585  58.829 -0.980  1.00 13.92 ? 164 SER C CB  1 
ATOM   1871 O OG  . SER C 1 55 ? 10.658  60.072 -1.631  1.00 13.43 ? 164 SER C OG  1 
ATOM   1872 N N   . ILE C 1 56 ? 12.703  57.048 -2.415  1.00 14.14 ? 165 ILE C N   1 
ATOM   1873 C CA  . ILE C 1 56 ? 13.369  56.747 -3.683  1.00 14.54 ? 165 ILE C CA  1 
ATOM   1874 C C   . ILE C 1 56 ? 12.292  56.410 -4.748  1.00 14.34 ? 165 ILE C C   1 
ATOM   1875 O O   . ILE C 1 56 ? 11.437  55.557 -4.507  1.00 14.60 ? 165 ILE C O   1 
ATOM   1876 C CB  . ILE C 1 56 ? 14.286  55.561 -3.502  1.00 14.51 ? 165 ILE C CB  1 
ATOM   1877 C CG1 . ILE C 1 56 ? 15.413  55.930 -2.552  1.00 16.05 ? 165 ILE C CG1 1 
ATOM   1878 C CG2 . ILE C 1 56 ? 14.856  55.100 -4.825  1.00 15.28 ? 165 ILE C CG2 1 
ATOM   1879 C CD1 . ILE C 1 56 ? 16.145  54.732 -1.921  1.00 16.31 ? 165 ILE C CD1 1 
ATOM   1880 N N   . ASN C 1 57 ? 12.326  57.113 -5.882  1.00 14.03 ? 166 ASN C N   1 
ATOM   1881 C CA  . ASN C 1 57 ? 11.303  57.005 -6.927  1.00 14.01 ? 166 ASN C CA  1 
ATOM   1882 C C   . ASN C 1 57 ? 9.882   56.980 -6.367  1.00 14.17 ? 166 ASN C C   1 
ATOM   1883 O O   . ASN C 1 57 ? 9.058   56.179 -6.776  1.00 13.89 ? 166 ASN C O   1 
ATOM   1884 C CB  . ASN C 1 57 ? 11.557  55.773 -7.817  1.00 13.70 ? 166 ASN C CB  1 
ATOM   1885 C CG  . ASN C 1 57 ? 12.766  55.941 -8.749  1.00 13.08 ? 166 ASN C CG  1 
ATOM   1886 O OD1 . ASN C 1 57 ? 13.124  57.052 -9.157  1.00 11.43 ? 166 ASN C OD1 1 
ATOM   1887 N ND2 . ASN C 1 57 ? 13.385  54.828 -9.099  1.00 11.92 ? 166 ASN C ND2 1 
ATOM   1888 N N   . GLY C 1 58 ? 9.610   57.847 -5.399  1.00 14.97 ? 167 GLY C N   1 
ATOM   1889 C CA  . GLY C 1 58 ? 8.263   57.956 -4.823  1.00 15.05 ? 167 GLY C CA  1 
ATOM   1890 C C   . GLY C 1 58 ? 7.907   56.886 -3.813  1.00 15.24 ? 167 GLY C C   1 
ATOM   1891 O O   . GLY C 1 58 ? 6.840   56.938 -3.241  1.00 15.15 ? 167 GLY C O   1 
ATOM   1892 N N   . GLU C 1 59 ? 8.784   55.917 -3.588  1.00 15.83 ? 168 GLU C N   1 
ATOM   1893 C CA  . GLU C 1 59 ? 8.529   54.885 -2.592  1.00 16.64 ? 168 GLU C CA  1 
ATOM   1894 C C   . GLU C 1 59 ? 8.997   55.360 -1.202  1.00 16.35 ? 168 GLU C C   1 
ATOM   1895 O O   . GLU C 1 59 ? 10.155  55.707 -1.005  1.00 16.18 ? 168 GLU C O   1 
ATOM   1896 C CB  . GLU C 1 59 ? 9.263   53.617 -2.986  1.00 16.93 ? 168 GLU C CB  1 
ATOM   1897 C CG  . GLU C 1 59 ? 8.992   52.423 -2.062  1.00 19.01 ? 168 GLU C CG  1 
ATOM   1898 C CD  . GLU C 1 59 ? 9.584   51.096 -2.568  1.00 21.11 ? 168 GLU C CD  1 
ATOM   1899 O OE1 . GLU C 1 59 ? 10.313  51.080 -3.587  1.00 24.86 ? 168 GLU C OE1 1 
ATOM   1900 O OE2 . GLU C 1 59 ? 9.304   50.060 -1.936  1.00 22.25 ? 168 GLU C OE2 1 
ATOM   1901 N N   . ASN C 1 60 ? 8.089   55.384 -0.241  1.00 16.28 ? 169 ASN C N   1 
ATOM   1902 C CA  . ASN C 1 60 ? 8.452   55.800 1.118   1.00 16.65 ? 169 ASN C CA  1 
ATOM   1903 C C   . ASN C 1 60 ? 9.404   54.822 1.827   1.00 15.95 ? 169 ASN C C   1 
ATOM   1904 O O   . ASN C 1 60 ? 9.062   53.662 1.971   1.00 15.49 ? 169 ASN C O   1 
ATOM   1905 C CB  . ASN C 1 60 ? 7.189   55.933 1.947   1.00 16.43 ? 169 ASN C CB  1 
ATOM   1906 C CG  . ASN C 1 60 ? 7.418   56.606 3.251   1.00 17.80 ? 169 ASN C CG  1 
ATOM   1907 O OD1 . ASN C 1 60 ? 8.521   56.544 3.853   1.00 18.71 ? 169 ASN C OD1 1 
ATOM   1908 N ND2 . ASN C 1 60 ? 6.374   57.258 3.728   1.00 18.98 ? 169 ASN C ND2 1 
ATOM   1909 N N   . ILE C 1 61 ? 10.574  55.296 2.263   1.00 15.52 ? 170 ILE C N   1 
ATOM   1910 C CA  . ILE C 1 61 ? 11.503  54.417 2.971   1.00 15.44 ? 170 ILE C CA  1 
ATOM   1911 C C   . ILE C 1 61 ? 11.618  54.670 4.460   1.00 15.20 ? 170 ILE C C   1 
ATOM   1912 O O   . ILE C 1 61 ? 12.646  54.406 5.062   1.00 15.89 ? 170 ILE C O   1 
ATOM   1913 C CB  . ILE C 1 61 ? 12.830  54.336 2.248   1.00 15.62 ? 170 ILE C CB  1 
ATOM   1914 C CG1 . ILE C 1 61 ? 13.625  55.648 2.345   1.00 15.51 ? 170 ILE C CG1 1 
ATOM   1915 C CG2 . ILE C 1 61 ? 12.540  53.934 0.822   1.00 13.65 ? 170 ILE C CG2 1 
ATOM   1916 C CD1 . ILE C 1 61 ? 14.966  55.594 1.657   1.00 15.89 ? 170 ILE C CD1 1 
ATOM   1917 N N   . VAL C 1 62 ? 10.496  55.073 5.055   1.00 14.71 ? 171 VAL C N   1 
ATOM   1918 C CA  . VAL C 1 62 ? 10.465  55.378 6.445   1.00 14.71 ? 171 VAL C CA  1 
ATOM   1919 C C   . VAL C 1 62 ? 10.679  54.079 7.172   1.00 15.76 ? 171 VAL C C   1 
ATOM   1920 O O   . VAL C 1 62 ? 9.968   53.097 6.930   1.00 15.93 ? 171 VAL C O   1 
ATOM   1921 C CB  . VAL C 1 62 ? 9.156   56.074 6.920   1.00 14.61 ? 171 VAL C CB  1 
ATOM   1922 C CG1 . VAL C 1 62 ? 7.945   55.226 6.724   1.00 13.96 ? 171 VAL C CG1 1 
ATOM   1923 C CG2 . VAL C 1 62 ? 9.268   56.496 8.369   1.00 11.82 ? 171 VAL C CG2 1 
ATOM   1924 N N   . GLY C 1 63 ? 11.694  54.048 8.035   1.00 16.47 ? 172 GLY C N   1 
ATOM   1925 C CA  . GLY C 1 63 ? 11.872  52.863 8.837   1.00 16.72 ? 172 GLY C CA  1 
ATOM   1926 C C   . GLY C 1 63 ? 12.579  51.700 8.154   1.00 16.80 ? 172 GLY C C   1 
ATOM   1927 O O   . GLY C 1 63 ? 12.612  50.594 8.696   1.00 16.95 ? 172 GLY C O   1 
ATOM   1928 N N   . TRP C 1 64 ? 13.134  51.923 6.962   1.00 16.60 ? 173 TRP C N   1 
ATOM   1929 C CA  . TRP C 1 64 ? 14.051  50.948 6.391   1.00 16.40 ? 173 TRP C CA  1 
ATOM   1930 C C   . TRP C 1 64 ? 15.413  51.163 7.020   1.00 15.86 ? 173 TRP C C   1 
ATOM   1931 O O   . TRP C 1 64 ? 15.790  52.286 7.292   1.00 15.40 ? 173 TRP C O   1 
ATOM   1932 C CB  . TRP C 1 64 ? 14.204  51.162 4.900   1.00 16.61 ? 173 TRP C CB  1 
ATOM   1933 C CG  . TRP C 1 64 ? 13.031  50.795 4.077   1.00 17.10 ? 173 TRP C CG  1 
ATOM   1934 C CD1 . TRP C 1 64 ? 11.734  50.795 4.445   1.00 17.31 ? 173 TRP C CD1 1 
ATOM   1935 C CD2 . TRP C 1 64 ? 13.065  50.383 2.714   1.00 17.55 ? 173 TRP C CD2 1 
ATOM   1936 N NE1 . TRP C 1 64 ? 10.945  50.393 3.393   1.00 16.68 ? 173 TRP C NE1 1 
ATOM   1937 C CE2 . TRP C 1 64 ? 11.743  50.139 2.318   1.00 17.11 ? 173 TRP C CE2 1 
ATOM   1938 C CE3 . TRP C 1 64 ? 14.096  50.187 1.788   1.00 18.43 ? 173 TRP C CE3 1 
ATOM   1939 C CZ2 . TRP C 1 64 ? 11.414  49.710 1.039   1.00 18.00 ? 173 TRP C CZ2 1 
ATOM   1940 C CZ3 . TRP C 1 64 ? 13.766  49.768 0.512   1.00 19.25 ? 173 TRP C CZ3 1 
ATOM   1941 C CH2 . TRP C 1 64 ? 12.436  49.527 0.153   1.00 19.03 ? 173 TRP C CH2 1 
ATOM   1942 N N   . ARG C 1 65 ? 16.149  50.077 7.231   1.00 15.79 ? 174 ARG C N   1 
ATOM   1943 C CA  . ARG C 1 65 ? 17.519  50.177 7.723   1.00 15.45 ? 174 ARG C CA  1 
ATOM   1944 C C   . ARG C 1 65 ? 18.453  50.535 6.565   1.00 15.61 ? 174 ARG C C   1 
ATOM   1945 O O   . ARG C 1 65 ? 18.089  50.399 5.388   1.00 15.68 ? 174 ARG C O   1 
ATOM   1946 C CB  . ARG C 1 65 ? 17.945  48.869 8.364   1.00 15.27 ? 174 ARG C CB  1 
ATOM   1947 C CG  . ARG C 1 65 ? 17.084  48.443 9.540   1.00 14.83 ? 174 ARG C CG  1 
ATOM   1948 C CD  . ARG C 1 65 ? 17.113  49.473 10.695  1.00 14.92 ? 174 ARG C CD  1 
ATOM   1949 N NE  . ARG C 1 65 ? 18.487  49.843 11.098  1.00 15.32 ? 174 ARG C NE  1 
ATOM   1950 C CZ  . ARG C 1 65 ? 19.310  49.087 11.849  1.00 13.88 ? 174 ARG C CZ  1 
ATOM   1951 N NH1 . ARG C 1 65 ? 18.954  47.883 12.296  1.00 11.84 ? 174 ARG C NH1 1 
ATOM   1952 N NH2 . ARG C 1 65 ? 20.533  49.534 12.135  1.00 13.91 ? 174 ARG C NH2 1 
ATOM   1953 N N   . HIS C 1 66 ? 19.651  50.992 6.907   1.00 15.57 ? 175 HIS C N   1 
ATOM   1954 C CA  . HIS C 1 66 ? 20.581  51.479 5.925   1.00 15.66 ? 175 HIS C CA  1 
ATOM   1955 C C   . HIS C 1 66 ? 20.960  50.456 4.864   1.00 16.42 ? 175 HIS C C   1 
ATOM   1956 O O   . HIS C 1 66 ? 21.073  50.791 3.691   1.00 16.86 ? 175 HIS C O   1 
ATOM   1957 C CB  . HIS C 1 66 ? 21.816  52.069 6.587   1.00 15.52 ? 175 HIS C CB  1 
ATOM   1958 C CG  . HIS C 1 66 ? 22.626  51.085 7.371   1.00 15.41 ? 175 HIS C CG  1 
ATOM   1959 N ND1 . HIS C 1 66 ? 23.613  50.308 6.798   1.00 14.81 ? 175 HIS C ND1 1 
ATOM   1960 C CD2 . HIS C 1 66 ? 22.620  50.777 8.687   1.00 14.18 ? 175 HIS C CD2 1 
ATOM   1961 C CE1 . HIS C 1 66 ? 24.165  49.552 7.728   1.00 14.84 ? 175 HIS C CE1 1 
ATOM   1962 N NE2 . HIS C 1 66 ? 23.577  49.813 8.880   1.00 14.92 ? 175 HIS C NE2 1 
ATOM   1963 N N   . TYR C 1 67 ? 21.150  49.211 5.253   1.00 17.07 ? 176 TYR C N   1 
ATOM   1964 C CA  . TYR C 1 67 ? 21.470  48.167 4.270   1.00 17.88 ? 176 TYR C CA  1 
ATOM   1965 C C   . TYR C 1 67 ? 20.344  47.896 3.271   1.00 17.77 ? 176 TYR C C   1 
ATOM   1966 O O   . TYR C 1 67 ? 20.596  47.527 2.134   1.00 17.71 ? 176 TYR C O   1 
ATOM   1967 C CB  . TYR C 1 67 ? 21.908  46.851 4.943   1.00 18.07 ? 176 TYR C CB  1 
ATOM   1968 C CG  . TYR C 1 67 ? 21.098  46.462 6.168   1.00 19.84 ? 176 TYR C CG  1 
ATOM   1969 C CD1 . TYR C 1 67 ? 21.562  46.738 7.449   1.00 21.30 ? 176 TYR C CD1 1 
ATOM   1970 C CD2 . TYR C 1 67 ? 19.872  45.819 6.041   1.00 21.25 ? 176 TYR C CD2 1 
ATOM   1971 C CE1 . TYR C 1 67 ? 20.830  46.389 8.569   1.00 22.04 ? 176 TYR C CE1 1 
ATOM   1972 C CE2 . TYR C 1 67 ? 19.122  45.460 7.162   1.00 21.57 ? 176 TYR C CE2 1 
ATOM   1973 C CZ  . TYR C 1 67 ? 19.610  45.754 8.428   1.00 22.84 ? 176 TYR C CZ  1 
ATOM   1974 O OH  . TYR C 1 67 ? 18.893  45.438 9.577   1.00 24.60 ? 176 TYR C OH  1 
ATOM   1975 N N   . ASP C 1 68 ? 19.104  48.058 3.707   1.00 18.23 ? 177 ASP C N   1 
ATOM   1976 C CA  . ASP C 1 68 ? 17.968  47.835 2.820   1.00 18.63 ? 177 ASP C CA  1 
ATOM   1977 C C   . ASP C 1 68 ? 17.921  48.971 1.810   1.00 18.61 ? 177 ASP C C   1 
ATOM   1978 O O   . ASP C 1 68 ? 17.579  48.775 0.635   1.00 18.52 ? 177 ASP C O   1 
ATOM   1979 C CB  . ASP C 1 68 ? 16.648  47.806 3.598   1.00 18.60 ? 177 ASP C CB  1 
ATOM   1980 C CG  . ASP C 1 68 ? 16.459  46.549 4.385   1.00 19.76 ? 177 ASP C CG  1 
ATOM   1981 O OD1 . ASP C 1 68 ? 16.826  45.456 3.877   1.00 19.15 ? 177 ASP C OD1 1 
ATOM   1982 O OD2 . ASP C 1 68 ? 15.925  46.672 5.509   1.00 21.67 ? 177 ASP C OD2 1 
ATOM   1983 N N   . VAL C 1 69 ? 18.231  50.164 2.292   1.00 18.42 ? 178 VAL C N   1 
ATOM   1984 C CA  . VAL C 1 69 ? 18.192  51.336 1.474   1.00 18.37 ? 178 VAL C CA  1 
ATOM   1985 C C   . VAL C 1 69 ? 19.318  51.264 0.453   1.00 18.89 ? 178 VAL C C   1 
ATOM   1986 O O   . VAL C 1 69 ? 19.113  51.551 -0.740  1.00 19.03 ? 178 VAL C O   1 
ATOM   1987 C CB  . VAL C 1 69 ? 18.325  52.601 2.312   1.00 18.62 ? 178 VAL C CB  1 
ATOM   1988 C CG1 . VAL C 1 69 ? 18.618  53.784 1.428   1.00 18.34 ? 178 VAL C CG1 1 
ATOM   1989 C CG2 . VAL C 1 69 ? 17.079  52.835 3.138   1.00 17.60 ? 178 VAL C CG2 1 
ATOM   1990 N N   . ALA C 1 70 ? 20.507  50.850 0.891   1.00 18.82 ? 179 ALA C N   1 
ATOM   1991 C CA  . ALA C 1 70 ? 21.618  50.723 -0.039  1.00 18.77 ? 179 ALA C CA  1 
ATOM   1992 C C   . ALA C 1 70 ? 21.337  49.629 -1.062  1.00 19.05 ? 179 ALA C C   1 
ATOM   1993 O O   . ALA C 1 70 ? 21.679  49.776 -2.235  1.00 19.19 ? 179 ALA C O   1 
ATOM   1994 C CB  . ALA C 1 70 ? 22.895  50.471 0.672   1.00 18.36 ? 179 ALA C CB  1 
ATOM   1995 N N   . LYS C 1 71 ? 20.698  48.547 -0.636  1.00 19.41 ? 180 LYS C N   1 
ATOM   1996 C CA  . LYS C 1 71 ? 20.338  47.475 -1.564  1.00 20.00 ? 180 LYS C CA  1 
ATOM   1997 C C   . LYS C 1 71 ? 19.444  47.994 -2.668  1.00 19.96 ? 180 LYS C C   1 
ATOM   1998 O O   . LYS C 1 71 ? 19.611  47.651 -3.822  1.00 20.07 ? 180 LYS C O   1 
ATOM   1999 C CB  . LYS C 1 71 ? 19.631  46.334 -0.846  1.00 20.05 ? 180 LYS C CB  1 
ATOM   2000 C CG  . LYS C 1 71 ? 19.464  45.068 -1.707  1.00 22.01 ? 180 LYS C CG  1 
ATOM   2001 C CD  . LYS C 1 71 ? 19.521  43.786 -0.835  1.00 24.52 ? 180 LYS C CD  1 
ATOM   2002 C CE  . LYS C 1 71 ? 19.698  42.509 -1.647  1.00 26.53 ? 180 LYS C CE  1 
ATOM   2003 N NZ  . LYS C 1 71 ? 20.364  41.395 -0.858  1.00 27.53 ? 180 LYS C NZ  1 
ATOM   2004 N N   . LYS C 1 72 ? 18.500  48.839 -2.300  1.00 20.16 ? 181 LYS C N   1 
ATOM   2005 C CA  . LYS C 1 72 ? 17.561  49.398 -3.255  1.00 20.49 ? 181 LYS C CA  1 
ATOM   2006 C C   . LYS C 1 72 ? 18.289  50.283 -4.259  1.00 20.12 ? 181 LYS C C   1 
ATOM   2007 O O   . LYS C 1 72 ? 18.026  50.219 -5.439  1.00 20.05 ? 181 LYS C O   1 
ATOM   2008 C CB  . LYS C 1 72 ? 16.501  50.216 -2.513  1.00 20.73 ? 181 LYS C CB  1 
ATOM   2009 C CG  . LYS C 1 72 ? 15.399  50.748 -3.389  1.00 22.40 ? 181 LYS C CG  1 
ATOM   2010 C CD  . LYS C 1 72 ? 14.488  49.655 -3.896  1.00 25.37 ? 181 LYS C CD  1 
ATOM   2011 C CE  . LYS C 1 72 ? 13.362  50.270 -4.781  1.00 28.25 ? 181 LYS C CE  1 
ATOM   2012 N NZ  . LYS C 1 72 ? 12.264  49.286 -5.092  1.00 29.50 ? 181 LYS C NZ  1 
ATOM   2013 N N   . LEU C 1 73 ? 19.191  51.122 -3.767  1.00 20.17 ? 182 LEU C N   1 
ATOM   2014 C CA  . LEU C 1 73 ? 19.994  51.991 -4.623  1.00 20.02 ? 182 LEU C CA  1 
ATOM   2015 C C   . LEU C 1 73 ? 20.866  51.189 -5.594  1.00 20.54 ? 182 LEU C C   1 
ATOM   2016 O O   . LEU C 1 73 ? 21.002  51.574 -6.766  1.00 21.23 ? 182 LEU C O   1 
ATOM   2017 C CB  . LEU C 1 73 ? 20.859  52.939 -3.779  1.00 19.59 ? 182 LEU C CB  1 
ATOM   2018 C CG  . LEU C 1 73 ? 20.113  54.029 -3.003  1.00 18.19 ? 182 LEU C CG  1 
ATOM   2019 C CD1 . LEU C 1 73 ? 21.024  54.794 -2.096  1.00 15.75 ? 182 LEU C CD1 1 
ATOM   2020 C CD2 . LEU C 1 73 ? 19.422  54.966 -3.941  1.00 16.39 ? 182 LEU C CD2 1 
ATOM   2021 N N   . LYS C 1 74 ? 21.441  50.085 -5.122  1.00 20.76 ? 183 LYS C N   1 
ATOM   2022 C CA  . LYS C 1 74 ? 22.241  49.220 -5.988  1.00 21.40 ? 183 LYS C CA  1 
ATOM   2023 C C   . LYS C 1 74 ? 21.414  48.570 -7.082  1.00 21.27 ? 183 LYS C C   1 
ATOM   2024 O O   . LYS C 1 74 ? 21.906  48.342 -8.181  1.00 21.26 ? 183 LYS C O   1 
ATOM   2025 C CB  . LYS C 1 74 ? 22.923  48.120 -5.189  1.00 21.81 ? 183 LYS C CB  1 
ATOM   2026 C CG  . LYS C 1 74 ? 24.205  48.546 -4.503  1.00 23.70 ? 183 LYS C CG  1 
ATOM   2027 C CD  . LYS C 1 74 ? 24.619  47.492 -3.470  1.00 26.13 ? 183 LYS C CD  1 
ATOM   2028 C CE  . LYS C 1 74 ? 26.138  47.344 -3.355  1.00 28.07 ? 183 LYS C CE  1 
ATOM   2029 N NZ  . LYS C 1 74 ? 26.518  46.160 -2.510  1.00 29.46 ? 183 LYS C NZ  1 
ATOM   2030 N N   . GLU C 1 75 ? 20.161  48.279 -6.772  1.00 21.37 ? 184 GLU C N   1 
ATOM   2031 C CA  . GLU C 1 75 ? 19.299  47.590 -7.705  1.00 21.71 ? 184 GLU C CA  1 
ATOM   2032 C C   . GLU C 1 75 ? 18.762  48.489 -8.808  1.00 21.09 ? 184 GLU C C   1 
ATOM   2033 O O   . GLU C 1 75 ? 18.364  47.999 -9.836  1.00 20.97 ? 184 GLU C O   1 
ATOM   2034 C CB  . GLU C 1 75 ? 18.175  46.883 -6.964  1.00 22.20 ? 184 GLU C CB  1 
ATOM   2035 C CG  . GLU C 1 75 ? 18.671  45.617 -6.242  1.00 24.45 ? 184 GLU C CG  1 
ATOM   2036 C CD  . GLU C 1 75 ? 17.607  44.932 -5.346  1.00 27.46 ? 184 GLU C CD  1 
ATOM   2037 O OE1 . GLU C 1 75 ? 16.616  45.601 -4.933  1.00 27.55 ? 184 GLU C OE1 1 
ATOM   2038 O OE2 . GLU C 1 75 ? 17.783  43.716 -5.052  1.00 29.19 ? 184 GLU C OE2 1 
ATOM   2039 N N   . LEU C 1 76 ? 18.771  49.800 -8.617  1.00 20.97 ? 185 LEU C N   1 
ATOM   2040 C CA  . LEU C 1 76 ? 18.302  50.721 -9.657  1.00 20.87 ? 185 LEU C CA  1 
ATOM   2041 C C   . LEU C 1 76 ? 19.062  50.509 -10.945 1.00 21.36 ? 185 LEU C C   1 
ATOM   2042 O O   . LEU C 1 76 ? 20.284  50.331 -10.921 1.00 21.20 ? 185 LEU C O   1 
ATOM   2043 C CB  . LEU C 1 76 ? 18.524  52.161 -9.225  1.00 20.73 ? 185 LEU C CB  1 
ATOM   2044 C CG  . LEU C 1 76 ? 17.657  52.684 -8.080  1.00 19.48 ? 185 LEU C CG  1 
ATOM   2045 C CD1 . LEU C 1 76 ? 18.211  54.003 -7.629  1.00 18.47 ? 185 LEU C CD1 1 
ATOM   2046 C CD2 . LEU C 1 76 ? 16.217  52.848 -8.497  1.00 17.81 ? 185 LEU C CD2 1 
ATOM   2047 N N   . LYS C 1 77 ? 18.354  50.551 -12.077 1.00 22.17 ? 186 LYS C N   1 
ATOM   2048 C CA  . LYS C 1 77 ? 18.992  50.318 -13.372 1.00 22.34 ? 186 LYS C CA  1 
ATOM   2049 C C   . LYS C 1 77 ? 20.033  51.362 -13.726 1.00 22.10 ? 186 LYS C C   1 
ATOM   2050 O O   . LYS C 1 77 ? 19.843  52.539 -13.496 1.00 21.34 ? 186 LYS C O   1 
ATOM   2051 C CB  . LYS C 1 77 ? 17.965  50.185 -14.490 1.00 22.76 ? 186 LYS C CB  1 
ATOM   2052 C CG  . LYS C 1 77 ? 17.270  48.841 -14.448 1.00 25.05 ? 186 LYS C CG  1 
ATOM   2053 C CD  . LYS C 1 77 ? 16.375  48.584 -15.646 1.00 27.41 ? 186 LYS C CD  1 
ATOM   2054 C CE  . LYS C 1 77 ? 15.355  47.444 -15.312 1.00 29.13 ? 186 LYS C CE  1 
ATOM   2055 N NZ  . LYS C 1 77 ? 14.812  46.740 -16.544 1.00 29.24 ? 186 LYS C NZ  1 
ATOM   2056 N N   . LYS C 1 78 ? 21.146  50.888 -14.272 1.00 22.44 ? 187 LYS C N   1 
ATOM   2057 C CA  . LYS C 1 78 ? 22.193  51.740 -14.827 1.00 22.78 ? 187 LYS C CA  1 
ATOM   2058 C C   . LYS C 1 78 ? 21.665  52.525 -16.065 1.00 22.51 ? 187 LYS C C   1 
ATOM   2059 O O   . LYS C 1 78 ? 20.760  52.082 -16.783 1.00 21.88 ? 187 LYS C O   1 
ATOM   2060 C CB  . LYS C 1 78 ? 23.385  50.860 -15.225 1.00 23.15 ? 187 LYS C CB  1 
ATOM   2061 C CG  . LYS C 1 78 ? 24.750  51.491 -15.046 1.00 25.14 ? 187 LYS C CG  1 
ATOM   2062 C CD  . LYS C 1 78 ? 25.860  50.429 -14.904 1.00 27.66 ? 187 LYS C CD  1 
ATOM   2063 C CE  . LYS C 1 78 ? 26.415  49.956 -16.237 1.00 29.00 ? 187 LYS C CE  1 
ATOM   2064 N NZ  . LYS C 1 78 ? 27.627  50.729 -16.608 1.00 29.71 ? 187 LYS C NZ  1 
ATOM   2065 N N   . GLU C 1 79 ? 22.216  53.711 -16.270 1.00 22.37 ? 188 GLU C N   1 
ATOM   2066 C CA  . GLU C 1 79 ? 21.784  54.615 -17.328 1.00 22.37 ? 188 GLU C CA  1 
ATOM   2067 C C   . GLU C 1 79 ? 20.288  54.985 -17.242 1.00 21.64 ? 188 GLU C C   1 
ATOM   2068 O O   . GLU C 1 79 ? 19.602  55.028 -18.257 1.00 21.27 ? 188 GLU C O   1 
ATOM   2069 C CB  . GLU C 1 79 ? 22.125  54.029 -18.700 1.00 23.05 ? 188 GLU C CB  1 
ATOM   2070 C CG  . GLU C 1 79 ? 23.589  53.516 -18.871 1.00 25.47 ? 188 GLU C CG  1 
ATOM   2071 C CD  . GLU C 1 79 ? 24.567  54.552 -19.483 1.00 28.32 ? 188 GLU C CD  1 
ATOM   2072 O OE1 . GLU C 1 79 ? 25.130  55.409 -18.744 1.00 30.34 ? 188 GLU C OE1 1 
ATOM   2073 O OE2 . GLU C 1 79 ? 24.789  54.476 -20.713 1.00 30.09 ? 188 GLU C OE2 1 
ATOM   2074 N N   . GLU C 1 80 ? 19.802  55.270 -16.026 1.00 21.04 ? 189 GLU C N   1 
ATOM   2075 C CA  . GLU C 1 80 ? 18.450  55.807 -15.818 1.00 20.58 ? 189 GLU C CA  1 
ATOM   2076 C C   . GLU C 1 80 ? 18.381  56.827 -14.703 1.00 19.28 ? 189 GLU C C   1 
ATOM   2077 O O   . GLU C 1 80 ? 19.056  56.679 -13.697 1.00 18.87 ? 189 GLU C O   1 
ATOM   2078 C CB  . GLU C 1 80 ? 17.473  54.697 -15.473 1.00 21.01 ? 189 GLU C CB  1 
ATOM   2079 C CG  . GLU C 1 80 ? 17.107  53.813 -16.632 1.00 24.26 ? 189 GLU C CG  1 
ATOM   2080 C CD  . GLU C 1 80 ? 15.859  52.931 -16.362 1.00 28.18 ? 189 GLU C CD  1 
ATOM   2081 O OE1 . GLU C 1 80 ? 15.328  52.949 -15.195 1.00 29.38 ? 189 GLU C OE1 1 
ATOM   2082 O OE2 . GLU C 1 80 ? 15.399  52.250 -17.337 1.00 28.69 ? 189 GLU C OE2 1 
ATOM   2083 N N   . LEU C 1 81 ? 17.548  57.848 -14.899 1.00 18.27 ? 190 LEU C N   1 
ATOM   2084 C CA  . LEU C 1 81 ? 17.232  58.836 -13.870 1.00 17.77 ? 190 LEU C CA  1 
ATOM   2085 C C   . LEU C 1 81 ? 16.462  58.208 -12.728 1.00 17.04 ? 190 LEU C C   1 
ATOM   2086 O O   . LEU C 1 81 ? 15.569  57.418 -12.969 1.00 16.61 ? 190 LEU C O   1 
ATOM   2087 C CB  . LEU C 1 81 ? 16.304  59.910 -14.417 1.00 17.88 ? 190 LEU C CB  1 
ATOM   2088 C CG  . LEU C 1 81 ? 16.781  61.329 -14.666 1.00 19.12 ? 190 LEU C CG  1 
ATOM   2089 C CD1 . LEU C 1 81 ? 15.529  62.232 -14.794 1.00 19.27 ? 190 LEU C CD1 1 
ATOM   2090 C CD2 . LEU C 1 81 ? 17.690  61.860 -13.579 1.00 18.35 ? 190 LEU C CD2 1 
ATOM   2091 N N   . PHE C 1 82 ? 16.783  58.584 -11.500 1.00 15.90 ? 191 PHE C N   1 
ATOM   2092 C CA  . PHE C 1 82 ? 15.903  58.307 -10.392 1.00 15.65 ? 191 PHE C CA  1 
ATOM   2093 C C   . PHE C 1 82 ? 15.745  59.551 -9.543  1.00 15.25 ? 191 PHE C C   1 
ATOM   2094 O O   . PHE C 1 82 ? 16.519  60.471 -9.658  1.00 15.31 ? 191 PHE C O   1 
ATOM   2095 C CB  . PHE C 1 82 ? 16.388  57.123 -9.562  1.00 15.71 ? 191 PHE C CB  1 
ATOM   2096 C CG  . PHE C 1 82 ? 17.643  57.380 -8.792  1.00 15.14 ? 191 PHE C CG  1 
ATOM   2097 C CD1 . PHE C 1 82 ? 17.593  57.727 -7.462  1.00 14.94 ? 191 PHE C CD1 1 
ATOM   2098 C CD2 . PHE C 1 82 ? 18.870  57.233 -9.399  1.00 16.14 ? 191 PHE C CD2 1 
ATOM   2099 C CE1 . PHE C 1 82 ? 18.735  57.951 -6.747  1.00 15.02 ? 191 PHE C CE1 1 
ATOM   2100 C CE2 . PHE C 1 82 ? 20.045  57.464 -8.707  1.00 15.67 ? 191 PHE C CE2 1 
ATOM   2101 C CZ  . PHE C 1 82 ? 19.983  57.813 -7.377  1.00 16.03 ? 191 PHE C CZ  1 
ATOM   2102 N N   . THR C 1 83 ? 14.729  59.582 -8.696  1.00 14.86 ? 192 THR C N   1 
ATOM   2103 C CA  . THR C 1 83 ? 14.486  60.746 -7.880  1.00 14.49 ? 192 THR C CA  1 
ATOM   2104 C C   . THR C 1 83 ? 14.576  60.359 -6.418  1.00 14.40 ? 192 THR C C   1 
ATOM   2105 O O   . THR C 1 83 ? 14.394  59.188 -6.064  1.00 14.27 ? 192 THR C O   1 
ATOM   2106 C CB  . THR C 1 83 ? 13.094  61.336 -8.125  1.00 14.45 ? 192 THR C CB  1 
ATOM   2107 O OG1 . THR C 1 83 ? 12.127  60.491 -7.507  1.00 15.32 ? 192 THR C OG1 1 
ATOM   2108 C CG2 . THR C 1 83 ? 12.788  61.472 -9.587  1.00 13.79 ? 192 THR C CG2 1 
ATOM   2109 N N   . MET C 1 84 ? 14.814  61.355 -5.571  1.00 14.00 ? 193 MET C N   1 
ATOM   2110 C CA  . MET C 1 84 ? 14.757  61.171 -4.134  1.00 13.85 ? 193 MET C CA  1 
ATOM   2111 C C   . MET C 1 84 ? 14.247  62.408 -3.459  1.00 13.14 ? 193 MET C C   1 
ATOM   2112 O O   . MET C 1 84 ? 14.503  63.514 -3.923  1.00 12.00 ? 193 MET C O   1 
ATOM   2113 C CB  . MET C 1 84 ? 16.143  60.974 -3.594  1.00 14.59 ? 193 MET C CB  1 
ATOM   2114 C CG  . MET C 1 84 ? 16.722  59.602 -3.692  1.00 17.23 ? 193 MET C CG  1 
ATOM   2115 S SD  . MET C 1 84 ? 18.439  59.739 -3.119  1.00 23.63 ? 193 MET C SD  1 
ATOM   2116 C CE  . MET C 1 84 ? 18.624  58.238 -2.202  1.00 25.21 ? 193 MET C CE  1 
ATOM   2117 N N   . LYS C 1 85 ? 13.557  62.215 -2.337  1.00 13.05 ? 194 LYS C N   1 
ATOM   2118 C CA  . LYS C 1 85 ? 13.227  63.311 -1.432  1.00 13.05 ? 194 LYS C CA  1 
ATOM   2119 C C   . LYS C 1 85 ? 14.141  63.160 -0.255  1.00 12.88 ? 194 LYS C C   1 
ATOM   2120 O O   . LYS C 1 85 ? 14.282  62.060 0.292   1.00 13.20 ? 194 LYS C O   1 
ATOM   2121 C CB  . LYS C 1 85 ? 11.774  63.290 -0.974  1.00 13.15 ? 194 LYS C CB  1 
ATOM   2122 C CG  . LYS C 1 85 ? 10.791  63.775 -2.054  1.00 15.27 ? 194 LYS C CG  1 
ATOM   2123 C CD  . LYS C 1 85 ? 9.780   64.826 -1.466  1.00 18.51 ? 194 LYS C CD  1 
ATOM   2124 N N   . LEU C 1 86 ? 14.789  64.258 0.106   1.00 12.34 ? 195 LEU C N   1 
ATOM   2125 C CA  . LEU C 1 86 ? 15.736  64.287 1.203   1.00 12.25 ? 195 LEU C CA  1 
ATOM   2126 C C   . LEU C 1 86 ? 15.268  65.355 2.177   1.00 12.60 ? 195 LEU C C   1 
ATOM   2127 O O   . LEU C 1 86 ? 14.578  66.304 1.782   1.00 12.27 ? 195 LEU C O   1 
ATOM   2128 C CB  . LEU C 1 86 ? 17.115  64.703 0.684   1.00 11.93 ? 195 LEU C CB  1 
ATOM   2129 C CG  . LEU C 1 86 ? 17.741  63.853 -0.419  1.00 10.91 ? 195 LEU C CG  1 
ATOM   2130 C CD1 . LEU C 1 86 ? 18.960  64.533 -0.916  1.00 11.06 ? 195 LEU C CD1 1 
ATOM   2131 C CD2 . LEU C 1 86 ? 18.127  62.483 0.100   1.00 10.79 ? 195 LEU C CD2 1 
ATOM   2132 N N   . ILE C 1 87 ? 15.671  65.199 3.430   1.00 13.01 ? 196 ILE C N   1 
ATOM   2133 C CA  . ILE C 1 87 ? 15.520  66.232 4.435   1.00 13.39 ? 196 ILE C CA  1 
ATOM   2134 C C   . ILE C 1 87 ? 16.905  66.634 4.870   1.00 12.81 ? 196 ILE C C   1 
ATOM   2135 O O   . ILE C 1 87 ? 17.676  65.796 5.309   1.00 12.43 ? 196 ILE C O   1 
ATOM   2136 C CB  . ILE C 1 87 ? 14.795  65.697 5.672   1.00 13.98 ? 196 ILE C CB  1 
ATOM   2137 C CG1 . ILE C 1 87 ? 13.405  65.241 5.271   1.00 15.75 ? 196 ILE C CG1 1 
ATOM   2138 C CG2 . ILE C 1 87 ? 14.632  66.791 6.723   1.00 13.45 ? 196 ILE C CG2 1 
ATOM   2139 C CD1 . ILE C 1 87 ? 12.649  64.616 6.395   1.00 15.07 ? 196 ILE C CD1 1 
ATOM   2140 N N   . GLU C 1 88 ? 17.215  67.910 4.746   1.00 12.81 ? 197 GLU C N   1 
ATOM   2141 C CA  . GLU C 1 88 ? 18.509  68.425 5.159   1.00 13.68 ? 197 GLU C CA  1 
ATOM   2142 C C   . GLU C 1 88 ? 18.441  69.063 6.538   1.00 12.75 ? 197 GLU C C   1 
ATOM   2143 O O   . GLU C 1 88 ? 17.841  70.116 6.690   1.00 12.44 ? 197 GLU C O   1 
ATOM   2144 C CB  . GLU C 1 88 ? 18.983  69.459 4.137   1.00 14.10 ? 197 GLU C CB  1 
ATOM   2145 C CG  . GLU C 1 88 ? 20.289  70.088 4.507   1.00 16.23 ? 197 GLU C CG  1 
ATOM   2146 C CD  . GLU C 1 88 ? 20.737  71.165 3.529   1.00 21.13 ? 197 GLU C CD  1 
ATOM   2147 O OE1 . GLU C 1 88 ? 20.303  71.164 2.354   1.00 22.85 ? 197 GLU C OE1 1 
ATOM   2148 O OE2 . GLU C 1 88 ? 21.561  72.018 3.945   1.00 25.62 ? 197 GLU C OE2 1 
ATOM   2149 N N   . PRO C 1 89 ? 19.064  68.448 7.548   1.00 13.29 ? 198 PRO C N   1 
ATOM   2150 C CA  . PRO C 1 89 ? 18.941  69.098 8.891   1.00 14.02 ? 198 PRO C CA  1 
ATOM   2151 C C   . PRO C 1 89 ? 19.519  70.487 8.883   1.00 14.35 ? 198 PRO C C   1 
ATOM   2152 O O   . PRO C 1 89 ? 20.539  70.748 8.218   1.00 14.46 ? 198 PRO C O   1 
ATOM   2153 C CB  . PRO C 1 89 ? 19.750  68.201 9.821   1.00 13.04 ? 198 PRO C CB  1 
ATOM   2154 C CG  . PRO C 1 89 ? 19.821  66.879 9.056   1.00 14.19 ? 198 PRO C CG  1 
ATOM   2155 C CD  . PRO C 1 89 ? 19.885  67.234 7.605   1.00 13.13 ? 198 PRO C CD  1 
ATOM   2156 N N   . LYS C 1 90 ? 18.831  71.383 9.562   1.00 15.11 ? 199 LYS C N   1 
ATOM   2157 C CA  . LYS C 1 90 ? 19.335  72.731 9.729   1.00 15.86 ? 199 LYS C CA  1 
ATOM   2158 C C   . LYS C 1 90 ? 20.421  72.710 10.771  1.00 15.81 ? 199 LYS C C   1 
ATOM   2159 O O   . LYS C 1 90 ? 20.254  72.154 11.850  1.00 16.48 ? 199 LYS C O   1 
ATOM   2160 C CB  . LYS C 1 90 ? 18.222  73.698 10.098  1.00 16.18 ? 199 LYS C CB  1 
ATOM   2161 C CG  . LYS C 1 90 ? 17.712  74.500 8.887   1.00 18.70 ? 199 LYS C CG  1 
ATOM   2162 C CD  . LYS C 1 90 ? 16.272  74.887 9.059   1.00 22.30 ? 199 LYS C CD  1 
ATOM   2163 C CE  . LYS C 1 90 ? 15.911  76.243 8.398   1.00 24.63 ? 199 LYS C CE  1 
ATOM   2164 N NZ  . LYS C 1 90 ? 14.404  76.558 8.488   1.00 23.13 ? 199 LYS C NZ  1 
ATOM   2165 N N   . LYS C 1 91 ? 21.553  73.286 10.410  1.00 15.88 ? 200 LYS C N   1 
ATOM   2166 C CA  . LYS C 1 91 ? 22.674  73.412 11.311  1.00 15.97 ? 200 LYS C CA  1 
ATOM   2167 C C   . LYS C 1 91 ? 22.638  74.681 12.155  1.00 14.55 ? 200 LYS C C   1 
ATOM   2168 O O   . LYS C 1 91 ? 23.411  74.803 13.085  1.00 14.34 ? 200 LYS C O   1 
ATOM   2169 C CB  . LYS C 1 91 ? 23.971  73.431 10.514  1.00 16.86 ? 200 LYS C CB  1 
ATOM   2170 C CG  . LYS C 1 91 ? 24.289  72.159 9.725   1.00 19.71 ? 200 LYS C CG  1 
ATOM   2171 C CD  . LYS C 1 91 ? 25.818  72.011 9.529   1.00 23.42 ? 200 LYS C CD  1 
ATOM   2172 C CE  . LYS C 1 91 ? 26.201  70.842 8.596   1.00 24.97 ? 200 LYS C CE  1 
ATOM   2173 N NZ  . LYS C 1 91 ? 25.730  71.081 7.191   1.00 26.27 ? 200 LYS C NZ  1 
ATOM   2174 N N   . SER C 1 92 ? 21.765  75.624 11.822  1.00 13.47 ? 201 SER C N   1 
ATOM   2175 C CA  . SER C 1 92 ? 21.716  76.930 12.486  1.00 12.53 ? 201 SER C CA  1 
ATOM   2176 C C   . SER C 1 92 ? 20.317  77.460 12.537  1.00 11.48 ? 201 SER C C   1 
ATOM   2177 O O   . SER C 1 92 ? 19.484  77.019 11.796  1.00 11.33 ? 201 SER C O   1 
ATOM   2178 C CB  . SER C 1 92 ? 22.561  77.917 11.706  1.00 12.70 ? 201 SER C CB  1 
ATOM   2179 O OG  . SER C 1 92 ? 23.855  77.914 12.257  1.00 14.15 ? 201 SER C OG  1 
ATOM   2180 N N   . SER C 1 93 ? 20.069  78.437 13.391  1.00 11.09 ? 202 SER C N   1 
ATOM   2181 C CA  . SER C 1 93 ? 18.736  79.001 13.548  1.00 10.84 ? 202 SER C CA  1 
ATOM   2182 C C   . SER C 1 93 ? 18.806  80.502 13.799  1.00 11.34 ? 202 SER C C   1 
ATOM   2183 O O   . SER C 1 93 ? 19.672  80.977 14.536  1.00 11.27 ? 202 SER C O   1 
ATOM   2184 C CB  . SER C 1 93 ? 18.047  78.328 14.731  1.00 10.69 ? 202 SER C CB  1 
ATOM   2185 O OG  . SER C 1 93 ? 17.913  76.937 14.536  1.00 9.92  ? 202 SER C OG  1 
ATOM   2186 N N   . GLU C 1 94 ? 17.894  81.258 13.200  1.00 11.99 ? 203 GLU C N   1 
ATOM   2187 C CA  . GLU C 1 94 ? 17.871  82.712 13.399  1.00 12.56 ? 203 GLU C CA  1 
ATOM   2188 C C   . GLU C 1 94 ? 16.895  83.097 14.485  1.00 12.12 ? 203 GLU C C   1 
ATOM   2189 O O   . GLU C 1 94 ? 15.895  82.463 14.685  1.00 12.44 ? 203 GLU C O   1 
ATOM   2190 C CB  . GLU C 1 94 ? 17.450  83.441 12.141  1.00 12.66 ? 203 GLU C CB  1 
ATOM   2191 C CG  . GLU C 1 94 ? 18.147  82.983 10.884  1.00 16.09 ? 203 GLU C CG  1 
ATOM   2192 C CD  . GLU C 1 94 ? 19.446  83.688 10.637  1.00 19.96 ? 203 GLU C CD  1 
ATOM   2193 O OE1 . GLU C 1 94 ? 20.303  83.068 9.968   1.00 23.45 ? 203 GLU C OE1 1 
ATOM   2194 O OE2 . GLU C 1 94 ? 19.609  84.848 11.089  1.00 21.66 ? 203 GLU C OE2 1 
ATOM   2195 N N   . ALA C 1 95 ? 17.188  84.173 15.167  1.00 12.14 ? 204 ALA C N   1 
ATOM   2196 C CA  . ALA C 1 95 ? 16.244  84.751 16.073  1.00 12.36 ? 204 ALA C CA  1 
ATOM   2197 C C   . ALA C 1 95 ? 16.459  86.254 16.067  1.00 11.98 ? 204 ALA C C   1 
ATOM   2198 O O   . ALA C 1 95 ? 15.628  86.977 16.591  1.00 12.13 ? 204 ALA C O   1 
ATOM   2199 C CB  . ALA C 1 95 ? 16.431  84.171 17.473  1.00 12.31 ? 204 ALA C CB  1 
HETATM 2200 S S   . SO4 D 2 .  ? 8.671   74.357 13.157  1.00 37.57 ? 1   SO4 B S   1 
HETATM 2201 O O1  . SO4 D 2 .  ? 9.430   75.059 12.135  1.00 39.88 ? 1   SO4 B O1  1 
HETATM 2202 O O2  . SO4 D 2 .  ? 7.429   73.848 12.591  1.00 35.94 ? 1   SO4 B O2  1 
HETATM 2203 O O3  . SO4 D 2 .  ? 9.566   73.324 13.644  1.00 37.98 ? 1   SO4 B O3  1 
HETATM 2204 O O4  . SO4 D 2 .  ? 8.338   75.247 14.248  1.00 40.59 ? 1   SO4 B O4  1 
HETATM 2205 S S   . SO4 E 2 .  ? 8.134   49.825 15.356  1.00 69.18 ? 2   SO4 B S   1 
HETATM 2206 O O1  . SO4 E 2 .  ? 9.232   48.896 15.112  1.00 68.32 ? 2   SO4 B O1  1 
HETATM 2207 O O2  . SO4 E 2 .  ? 7.327   49.838 14.128  1.00 70.67 ? 2   SO4 B O2  1 
HETATM 2208 O O3  . SO4 E 2 .  ? 7.330   49.456 16.532  1.00 68.68 ? 2   SO4 B O3  1 
HETATM 2209 O O4  . SO4 E 2 .  ? 8.666   51.156 15.585  1.00 70.10 ? 2   SO4 B O4  1 
HETATM 2210 C C1  . GOL F 3 .  ? 12.659  68.326 9.616   1.00 51.71 ? 3   GOL B C1  1 
HETATM 2211 O O1  . GOL F 3 .  ? 11.233  68.444 9.543   1.00 48.77 ? 3   GOL B O1  1 
HETATM 2212 C C2  . GOL F 3 .  ? 13.279  67.160 10.425  1.00 52.11 ? 3   GOL B C2  1 
HETATM 2213 O O2  . GOL F 3 .  ? 12.485  65.987 10.267  1.00 53.82 ? 3   GOL B O2  1 
HETATM 2214 C C3  . GOL F 3 .  ? 14.755  66.892 9.993   1.00 54.31 ? 3   GOL B C3  1 
HETATM 2215 O O3  . GOL F 3 .  ? 15.716  66.785 11.038  1.00 54.63 ? 3   GOL B O3  1 
HETATM 2216 O O   . HOH G 4 .  ? 22.166  41.420 22.916  1.00 30.11 ? 7   HOH A O   1 
HETATM 2217 O O   . HOH G 4 .  ? 21.833  35.815 23.988  1.00 34.99 ? 12  HOH A O   1 
HETATM 2218 O O   . HOH G 4 .  ? 29.040  47.822 1.810   1.00 43.66 ? 14  HOH A O   1 
HETATM 2219 O O   . HOH G 4 .  ? 7.844   24.351 21.561  1.00 45.31 ? 15  HOH A O   1 
HETATM 2220 O O   . HOH G 4 .  ? 8.316   27.484 28.057  1.00 40.94 ? 16  HOH A O   1 
HETATM 2221 O O   . HOH G 4 .  ? 25.257  51.680 -6.627  1.00 48.24 ? 21  HOH A O   1 
HETATM 2222 O O   . HOH G 4 .  ? 14.622  20.871 17.975  1.00 41.30 ? 22  HOH A O   1 
HETATM 2223 O O   . HOH G 4 .  ? 13.855  21.578 10.457  1.00 37.57 ? 43  HOH A O   1 
HETATM 2224 O O   . HOH G 4 .  ? 7.156   43.919 20.832  1.00 51.45 ? 55  HOH A O   1 
HETATM 2225 O O   . HOH G 4 .  ? 20.255  38.068 32.016  1.00 40.55 ? 57  HOH A O   1 
HETATM 2226 O O   . HOH G 4 .  ? 12.916  39.810 29.871  1.00 36.63 ? 58  HOH A O   1 
HETATM 2227 O O   . HOH G 4 .  ? 9.004   34.985 33.423  1.00 37.57 ? 62  HOH A O   1 
HETATM 2228 O O   . HOH G 4 .  ? 31.281  48.045 11.073  1.00 37.64 ? 68  HOH A O   1 
HETATM 2229 O O   . HOH G 4 .  ? 30.698  49.378 8.986   1.00 47.68 ? 69  HOH A O   1 
HETATM 2230 O O   . HOH G 4 .  ? 22.013  37.319 25.863  1.00 42.50 ? 72  HOH A O   1 
HETATM 2231 O O   . HOH G 4 .  ? 12.869  40.846 0.978   1.00 56.62 ? 78  HOH A O   1 
HETATM 2232 O O   . HOH G 4 .  ? 9.434   24.372 5.416   1.00 69.94 ? 81  HOH A O   1 
HETATM 2233 O O   . HOH G 4 .  ? 21.176  26.707 9.727   1.00 50.45 ? 82  HOH A O   1 
HETATM 2234 O O   . HOH G 4 .  ? 25.071  38.984 28.832  1.00 40.87 ? 85  HOH A O   1 
HETATM 2235 O O   . HOH G 4 .  ? 13.332  33.011 31.732  1.00 45.06 ? 88  HOH A O   1 
HETATM 2236 O O   . HOH G 4 .  ? 16.165  33.706 26.040  1.00 28.30 ? 89  HOH A O   1 
HETATM 2237 O O   . HOH G 4 .  ? 10.826  45.941 13.142  1.00 42.20 ? 92  HOH A O   1 
HETATM 2238 O O   . HOH G 4 .  ? 11.470  36.988 23.780  1.00 41.57 ? 93  HOH A O   1 
HETATM 2239 O O   . HOH G 4 .  ? 12.733  45.770 3.388   1.00 43.20 ? 100 HOH A O   1 
HETATM 2240 O O   . HOH H 4 .  ? 4.380   52.858 3.522   1.00 38.59 ? 4   HOH B O   1 
HETATM 2241 O O   . HOH H 4 .  ? -8.514  56.940 18.805  1.00 30.19 ? 5   HOH B O   1 
HETATM 2242 O O   . HOH H 4 .  ? -6.276  78.764 18.627  1.00 45.99 ? 6   HOH B O   1 
HETATM 2243 O O   . HOH H 4 .  ? -11.094 74.477 25.395  1.00 46.66 ? 10  HOH B O   1 
HETATM 2244 O O   . HOH H 4 .  ? 14.154  56.629 19.882  1.00 26.56 ? 11  HOH B O   1 
HETATM 2245 O O   . HOH H 4 .  ? -4.670  58.931 28.828  1.00 40.23 ? 13  HOH B O   1 
HETATM 2246 O O   . HOH H 4 .  ? 10.970  73.603 20.258  0.50 20.64 ? 18  HOH B O   1 
HETATM 2247 O O   . HOH H 4 .  ? -10.760 60.060 30.571  1.00 52.70 ? 20  HOH B O   1 
HETATM 2248 O O   . HOH H 4 .  ? -6.280  72.790 14.062  1.00 28.76 ? 25  HOH B O   1 
HETATM 2249 O O   . HOH H 4 .  ? 1.305   53.625 29.202  1.00 48.65 ? 27  HOH B O   1 
HETATM 2250 O O   . HOH H 4 .  ? -16.049 73.085 18.537  1.00 44.00 ? 30  HOH B O   1 
HETATM 2251 O O   . HOH H 4 .  ? 16.884  68.141 25.072  1.00 42.32 ? 32  HOH B O   1 
HETATM 2252 O O   . HOH H 4 .  ? 0.197   65.272 7.259   1.00 25.01 ? 34  HOH B O   1 
HETATM 2253 O O   . HOH H 4 .  ? -9.725  66.231 23.825  1.00 41.35 ? 38  HOH B O   1 
HETATM 2254 O O   . HOH H 4 .  ? -8.416  61.324 23.415  1.00 31.84 ? 39  HOH B O   1 
HETATM 2255 O O   . HOH H 4 .  ? 4.571   62.900 5.040   1.00 44.43 ? 41  HOH B O   1 
HETATM 2256 O O   . HOH H 4 .  ? 0.572   59.234 1.242   1.00 43.53 ? 42  HOH B O   1 
HETATM 2257 O O   . HOH H 4 .  ? -1.763  75.208 24.002  1.00 39.68 ? 48  HOH B O   1 
HETATM 2258 O O   . HOH H 4 .  ? 0.887   74.234 27.233  1.00 45.31 ? 49  HOH B O   1 
HETATM 2259 O O   . HOH H 4 .  ? -3.802  74.315 22.340  1.00 35.61 ? 50  HOH B O   1 
HETATM 2260 O O   . HOH H 4 .  ? 14.372  63.218 9.531   1.00 27.67 ? 51  HOH B O   1 
HETATM 2261 O O   . HOH H 4 .  ? -8.303  57.277 30.163  1.00 43.11 ? 53  HOH B O   1 
HETATM 2262 O O   . HOH H 4 .  ? -6.868  59.243 31.239  1.00 50.37 ? 54  HOH B O   1 
HETATM 2263 O O   . HOH H 4 .  ? -14.792 56.460 25.340  1.00 56.37 ? 59  HOH B O   1 
HETATM 2264 O O   . HOH H 4 .  ? -14.222 65.880 23.554  1.00 39.11 ? 64  HOH B O   1 
HETATM 2265 O O   . HOH H 4 .  ? -15.304 64.591 21.680  1.00 31.32 ? 65  HOH B O   1 
HETATM 2266 O O   . HOH H 4 .  ? 15.261  63.105 26.802  1.00 37.71 ? 66  HOH B O   1 
HETATM 2267 O O   . HOH H 4 .  ? -5.720  52.105 20.762  1.00 39.90 ? 71  HOH B O   1 
HETATM 2268 O O   . HOH H 4 .  ? -3.919  63.484 27.396  1.00 44.52 ? 75  HOH B O   1 
HETATM 2269 O O   . HOH H 4 .  ? -3.432  61.083 27.052  1.00 34.07 ? 76  HOH B O   1 
HETATM 2270 O O   . HOH H 4 .  ? 12.935  47.107 8.490   1.00 34.26 ? 77  HOH B O   1 
HETATM 2271 O O   . HOH H 4 .  ? 6.290   73.744 16.721  1.00 29.71 ? 79  HOH B O   1 
HETATM 2272 O O   . HOH H 4 .  ? 6.115   39.634 21.569  1.00 54.78 ? 84  HOH B O   1 
HETATM 2273 O O   . HOH H 4 .  ? -16.046 57.824 17.348  1.00 24.48 ? 90  HOH B O   1 
HETATM 2274 O O   . HOH H 4 .  ? 8.067   72.133 17.661  1.00 29.49 ? 91  HOH B O   1 
HETATM 2275 O O   . HOH H 4 .  ? -10.318 79.852 23.110  1.00 44.20 ? 97  HOH B O   1 
HETATM 2276 O O   . HOH H 4 .  ? 15.093  54.340 19.489  1.00 28.17 ? 98  HOH B O   1 
HETATM 2277 O O   . HOH I 4 .  ? 14.868  60.825 10.529  1.00 23.85 ? 1   HOH C O   1 
HETATM 2278 O O   . HOH I 4 .  ? 11.380  60.425 -4.557  1.00 9.48  ? 2   HOH C O   1 
HETATM 2279 O O   . HOH I 4 .  ? 28.492  67.476 2.203   1.00 44.20 ? 3   HOH C O   1 
HETATM 2280 O O   . HOH I 4 .  ? 18.184  54.440 -12.237 1.00 26.42 ? 8   HOH C O   1 
HETATM 2281 O O   . HOH I 4 .  ? 27.125  65.846 -3.378  1.00 33.66 ? 9   HOH C O   1 
HETATM 2282 O O   . HOH I 4 .  ? 15.519  55.776 5.513   1.00 41.17 ? 17  HOH C O   1 
HETATM 2283 O O   . HOH I 4 .  ? 17.808  54.155 18.029  1.00 43.02 ? 19  HOH C O   1 
HETATM 2284 O O   . HOH I 4 .  ? 7.590   51.430 0.778   1.00 54.86 ? 23  HOH C O   1 
HETATM 2285 O O   . HOH I 4 .  ? 13.913  51.371 11.779  1.00 31.67 ? 24  HOH C O   1 
HETATM 2286 O O   . HOH I 4 .  ? 5.412   54.430 -0.980  1.00 38.37 ? 26  HOH C O   1 
HETATM 2287 O O   . HOH I 4 .  ? 16.124  44.751 -15.143 1.00 68.20 ? 28  HOH C O   1 
HETATM 2288 O O   . HOH I 4 .  ? 22.759  67.640 5.557   1.00 50.60 ? 29  HOH C O   1 
HETATM 2289 O O   . HOH I 4 .  ? 9.979   59.663 -9.736  1.00 54.86 ? 31  HOH C O   1 
HETATM 2290 O O   . HOH I 4 .  ? 24.248  71.942 14.164  1.00 34.94 ? 33  HOH C O   1 
HETATM 2291 O O   . HOH I 4 .  ? 32.043  62.833 2.588   1.00 26.67 ? 35  HOH C O   1 
HETATM 2292 O O   . HOH I 4 .  ? 32.845  64.441 -1.978  1.00 41.71 ? 36  HOH C O   1 
HETATM 2293 O O   . HOH I 4 .  ? 32.240  62.442 5.693   1.00 29.51 ? 37  HOH C O   1 
HETATM 2294 O O   . HOH I 4 .  ? 16.380  76.579 12.070  1.00 30.18 ? 40  HOH C O   1 
HETATM 2295 O O   . HOH I 4 .  ? 27.027  46.139 -10.952 1.00 50.60 ? 44  HOH C O   1 
HETATM 2296 O O   . HOH I 4 .  ? 29.977  60.614 -5.087  1.00 28.54 ? 45  HOH C O   1 
HETATM 2297 O O   . HOH I 4 .  ? 16.886  53.072 -19.295 1.00 40.37 ? 46  HOH C O   1 
HETATM 2298 O O   . HOH I 4 .  ? 6.788   64.595 4.244   1.00 46.94 ? 47  HOH C O   1 
HETATM 2299 O O   . HOH I 4 .  ? 19.604  67.561 -10.419 1.00 42.22 ? 52  HOH C O   1 
HETATM 2300 O O   . HOH I 4 .  ? 35.391  66.548 -5.496  1.00 48.06 ? 56  HOH C O   1 
HETATM 2301 O O   . HOH I 4 .  ? 27.856  69.833 2.752   1.00 53.84 ? 60  HOH C O   1 
HETATM 2302 O O   . HOH I 4 .  ? 15.504  54.682 -11.739 1.00 37.42 ? 61  HOH C O   1 
HETATM 2303 O O   . HOH I 4 .  ? 15.432  46.593 -0.604  1.00 33.24 ? 63  HOH C O   1 
HETATM 2304 O O   . HOH I 4 .  ? 32.993  56.886 11.532  1.00 44.09 ? 67  HOH C O   1 
HETATM 2305 O O   . HOH I 4 .  ? 29.369  66.991 -2.960  1.00 34.72 ? 70  HOH C O   1 
HETATM 2306 O O   . HOH I 4 .  ? 6.760   61.155 3.588   1.00 40.46 ? 73  HOH C O   1 
HETATM 2307 O O   . HOH I 4 .  ? 17.561  70.567 -3.975  1.00 32.43 ? 74  HOH C O   1 
HETATM 2308 O O   . HOH I 4 .  ? 21.489  47.623 -14.888 1.00 34.99 ? 80  HOH C O   1 
HETATM 2309 O O   . HOH I 4 .  ? 15.215  53.324 10.739  1.00 56.04 ? 83  HOH C O   1 
HETATM 2310 O O   . HOH I 4 .  ? 32.202  71.120 -4.142  1.00 43.14 ? 86  HOH C O   1 
HETATM 2311 O O   . HOH I 4 .  ? 7.837   72.721 6.883   1.00 28.49 ? 87  HOH C O   1 
HETATM 2312 O O   . HOH I 4 .  ? 29.652  57.338 -8.689  1.00 41.57 ? 94  HOH C O   1 
HETATM 2313 O O   . HOH I 4 .  ? 32.095  64.125 -9.629  1.00 42.05 ? 95  HOH C O   1 
HETATM 2314 O O   . HOH I 4 .  ? 18.006  57.231 11.395  1.00 48.24 ? 96  HOH C O   1 
HETATM 2315 O O   . HOH I 4 .  ? 8.256   59.161 4.053   1.00 37.87 ? 99  HOH C O   1 
HETATM 2316 O O   . HOH I 4 .  ? 9.333   47.463 -2.772  1.00 46.88 ? 101 HOH C O   1 
HETATM 2317 O O   . HOH I 4 .  ? 21.769  75.444 8.120   1.00 33.20 ? 102 HOH C O   1 
HETATM 2318 O O   . HOH I 4 .  ? 35.326  54.723 6.089   1.00 64.76 ? 103 HOH C O   1 
HETATM 2319 O O   . HOH I 4 .  ? 28.262  44.120 -4.082  1.00 55.14 ? 104 HOH C O   1 
HETATM 2320 O O   . HOH I 4 .  ? 36.388  59.969 -1.041  1.00 37.01 ? 105 HOH C O   1 
HETATM 2321 O O   . HOH I 4 .  ? 10.083  46.555 2.274   1.00 52.62 ? 106 HOH C O   1 
HETATM 2322 O O   . HOH I 4 .  ? 8.302   48.153 3.668   1.00 47.34 ? 107 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  SER 1  -1  -1  SER SER A . n 
A 1 2  MET 2  0   0   MET MET A . n 
A 1 3  LYS 3  112 112 LYS LYS A . n 
A 1 4  GLY 4  113 113 GLY GLY A . n 
A 1 5  ILE 5  114 114 ILE ILE A . n 
A 1 6  GLU 6  115 115 GLU GLU A . n 
A 1 7  LYS 7  116 116 LYS LYS A . n 
A 1 8  GLU 8  117 117 GLU GLU A . n 
A 1 9  VAL 9  118 118 VAL VAL A . n 
A 1 10 ASN 10 119 119 ASN ASN A . n 
A 1 11 VAL 11 120 120 VAL VAL A . n 
A 1 12 TYR 12 121 121 TYR TYR A . n 
A 1 13 LYS 13 122 122 LYS LYS A . n 
A 1 14 SER 14 123 123 SER SER A . n 
A 1 15 GLU 15 124 124 GLU GLU A . n 
A 1 16 ASP 16 125 125 ASP ASP A . n 
A 1 17 SER 17 126 126 SER SER A . n 
A 1 18 LEU 18 127 127 LEU LEU A . n 
A 1 19 GLY 19 128 128 GLY GLY A . n 
A 1 20 LEU 20 129 129 LEU LEU A . n 
A 1 21 THR 21 130 130 THR THR A . n 
A 1 22 ILE 22 131 131 ILE ILE A . n 
A 1 23 THR 23 132 132 THR THR A . n 
A 1 24 ASP 24 133 133 ASP ASP A . n 
A 1 25 ASN 25 134 134 ASN ASN A . n 
A 1 26 GLY 26 135 135 GLY GLY A . n 
A 1 27 VAL 27 136 136 VAL VAL A . n 
A 1 28 GLY 28 137 137 GLY GLY A . n 
A 1 29 TYR 29 138 138 TYR TYR A . n 
A 1 30 ALA 30 139 139 ALA ALA A . n 
A 1 31 PHE 31 140 140 PHE PHE A . n 
A 1 32 ILE 32 141 141 ILE ILE A . n 
A 1 33 LYS 33 142 142 LYS LYS A . n 
A 1 34 ARG 34 143 143 ARG ARG A . n 
A 1 35 ILE 35 144 144 ILE ILE A . n 
A 1 36 LYS 36 145 145 LYS LYS A . n 
A 1 37 ASP 37 146 146 ASP ASP A . n 
A 1 38 GLY 38 147 147 GLY GLY A . n 
A 1 39 GLY 39 148 148 GLY GLY A . n 
A 1 40 VAL 40 149 149 VAL VAL A . n 
A 1 41 ILE 41 150 150 ILE ILE A . n 
A 1 42 ASP 42 151 151 ASP ASP A . n 
A 1 43 SER 43 152 152 SER SER A . n 
A 1 44 VAL 44 153 153 VAL VAL A . n 
A 1 45 LYS 45 154 154 LYS LYS A . n 
A 1 46 THR 46 155 155 THR THR A . n 
A 1 47 ILE 47 156 156 ILE ILE A . n 
A 1 48 CYS 48 157 157 CYS CYS A . n 
A 1 49 VAL 49 158 158 VAL VAL A . n 
A 1 50 GLY 50 159 159 GLY GLY A . n 
A 1 51 ASP 51 160 160 ASP ASP A . n 
A 1 52 HIS 52 161 161 HIS HIS A . n 
A 1 53 ILE 53 162 162 ILE ILE A . n 
A 1 54 GLU 54 163 163 GLU GLU A . n 
A 1 55 SER 55 164 164 SER SER A . n 
A 1 56 ILE 56 165 165 ILE ILE A . n 
A 1 57 ASN 57 166 166 ASN ASN A . n 
A 1 58 GLY 58 167 167 GLY GLY A . n 
A 1 59 GLU 59 168 168 GLU GLU A . n 
A 1 60 ASN 60 169 169 ASN ASN A . n 
A 1 61 ILE 61 170 170 ILE ILE A . n 
A 1 62 VAL 62 171 171 VAL VAL A . n 
A 1 63 GLY 63 172 172 GLY GLY A . n 
A 1 64 TRP 64 173 173 TRP TRP A . n 
A 1 65 ARG 65 174 174 ARG ARG A . n 
A 1 66 HIS 66 175 175 HIS HIS A . n 
A 1 67 TYR 67 176 176 TYR TYR A . n 
A 1 68 ASP 68 177 177 ASP ASP A . n 
A 1 69 VAL 69 178 178 VAL VAL A . n 
A 1 70 ALA 70 179 179 ALA ALA A . n 
A 1 71 LYS 71 180 180 LYS LYS A . n 
A 1 72 LYS 72 181 181 LYS LYS A . n 
A 1 73 LEU 73 182 182 LEU LEU A . n 
A 1 74 LYS 74 183 183 LYS LYS A . n 
A 1 75 GLU 75 184 184 GLU GLU A . n 
A 1 76 LEU 76 185 185 LEU LEU A . n 
A 1 77 LYS 77 186 186 LYS LYS A . n 
A 1 78 LYS 78 187 187 LYS LYS A . n 
A 1 79 GLU 79 188 188 GLU GLU A . n 
A 1 80 GLU 80 189 189 GLU GLU A . n 
A 1 81 LEU 81 190 190 LEU LEU A . n 
A 1 82 PHE 82 191 191 PHE PHE A . n 
A 1 83 THR 83 192 192 THR THR A . n 
A 1 84 MET 84 193 193 MET MET A . n 
A 1 85 LYS 85 194 194 LYS LYS A . n 
A 1 86 LEU 86 195 195 LEU LEU A . n 
A 1 87 ILE 87 196 196 ILE ILE A . n 
A 1 88 GLU 88 197 197 GLU GLU A . n 
A 1 89 PRO 89 198 198 PRO PRO A . n 
A 1 90 LYS 90 199 199 LYS LYS A . n 
A 1 91 LYS 91 200 200 LYS LYS A . n 
A 1 92 SER 92 201 201 SER SER A . n 
A 1 93 SER 93 202 202 SER SER A . n 
A 1 94 GLU 94 203 203 GLU GLU A . n 
A 1 95 ALA 95 204 204 ALA ALA A . n 
B 1 1  SER 1  110 ?   ?   ?   B . n 
B 1 2  MET 2  111 ?   ?   ?   B . n 
B 1 3  LYS 3  112 ?   ?   ?   B . n 
B 1 4  GLY 4  113 113 GLY GLY B . n 
B 1 5  ILE 5  114 114 ILE ILE B . n 
B 1 6  GLU 6  115 115 GLU GLU B . n 
B 1 7  LYS 7  116 116 LYS LYS B . n 
B 1 8  GLU 8  117 117 GLU GLU B . n 
B 1 9  VAL 9  118 118 VAL VAL B . n 
B 1 10 ASN 10 119 119 ASN ASN B . n 
B 1 11 VAL 11 120 120 VAL VAL B . n 
B 1 12 TYR 12 121 121 TYR TYR B . n 
B 1 13 LYS 13 122 122 LYS LYS B . n 
B 1 14 SER 14 123 123 SER SER B . n 
B 1 15 GLU 15 124 124 GLU GLU B . n 
B 1 16 ASP 16 125 125 ASP ASP B . n 
B 1 17 SER 17 126 126 SER SER B . n 
B 1 18 LEU 18 127 127 LEU LEU B . n 
B 1 19 GLY 19 128 128 GLY GLY B . n 
B 1 20 LEU 20 129 129 LEU LEU B . n 
B 1 21 THR 21 130 130 THR THR B . n 
B 1 22 ILE 22 131 131 ILE ILE B . n 
B 1 23 THR 23 132 132 THR THR B . n 
B 1 24 ASP 24 133 133 ASP ASP B . n 
B 1 25 ASN 25 134 134 ASN ASN B . n 
B 1 26 GLY 26 135 135 GLY GLY B . n 
B 1 27 VAL 27 136 136 VAL VAL B . n 
B 1 28 GLY 28 137 137 GLY GLY B . n 
B 1 29 TYR 29 138 138 TYR TYR B . n 
B 1 30 ALA 30 139 139 ALA ALA B . n 
B 1 31 PHE 31 140 140 PHE PHE B . n 
B 1 32 ILE 32 141 141 ILE ILE B . n 
B 1 33 LYS 33 142 142 LYS LYS B . n 
B 1 34 ARG 34 143 143 ARG ARG B . n 
B 1 35 ILE 35 144 144 ILE ILE B . n 
B 1 36 LYS 36 145 145 LYS LYS B . n 
B 1 37 ASP 37 146 146 ASP ASP B . n 
B 1 38 GLY 38 147 147 GLY GLY B . n 
B 1 39 GLY 39 148 148 GLY GLY B . n 
B 1 40 VAL 40 149 149 VAL VAL B . n 
B 1 41 ILE 41 150 150 ILE ILE B . n 
B 1 42 ASP 42 151 151 ASP ASP B . n 
B 1 43 SER 43 152 152 SER SER B . n 
B 1 44 VAL 44 153 153 VAL VAL B . n 
B 1 45 LYS 45 154 154 LYS LYS B . n 
B 1 46 THR 46 155 155 THR THR B . n 
B 1 47 ILE 47 156 156 ILE ILE B . n 
B 1 48 CYS 48 157 157 CYS CYS B . n 
B 1 49 VAL 49 158 158 VAL VAL B . n 
B 1 50 GLY 50 159 159 GLY GLY B . n 
B 1 51 ASP 51 160 160 ASP ASP B . n 
B 1 52 HIS 52 161 161 HIS HIS B . n 
B 1 53 ILE 53 162 162 ILE ILE B . n 
B 1 54 GLU 54 163 163 GLU GLU B . n 
B 1 55 SER 55 164 164 SER SER B . n 
B 1 56 ILE 56 165 165 ILE ILE B . n 
B 1 57 ASN 57 166 166 ASN ASN B . n 
B 1 58 GLY 58 167 167 GLY GLY B . n 
B 1 59 GLU 59 168 168 GLU GLU B . n 
B 1 60 ASN 60 169 169 ASN ASN B . n 
B 1 61 ILE 61 170 170 ILE ILE B . n 
B 1 62 VAL 62 171 171 VAL VAL B . n 
B 1 63 GLY 63 172 172 GLY GLY B . n 
B 1 64 TRP 64 173 173 TRP TRP B . n 
B 1 65 ARG 65 174 174 ARG ARG B . n 
B 1 66 HIS 66 175 175 HIS HIS B . n 
B 1 67 TYR 67 176 176 TYR TYR B . n 
B 1 68 ASP 68 177 177 ASP ASP B . n 
B 1 69 VAL 69 178 178 VAL VAL B . n 
B 1 70 ALA 70 179 179 ALA ALA B . n 
B 1 71 LYS 71 180 180 LYS LYS B . n 
B 1 72 LYS 72 181 181 LYS LYS B . n 
B 1 73 LEU 73 182 182 LEU LEU B . n 
B 1 74 LYS 74 183 183 LYS LYS B . n 
B 1 75 GLU 75 184 184 GLU GLU B . n 
B 1 76 LEU 76 185 185 LEU LEU B . n 
B 1 77 LYS 77 186 186 LYS LYS B . n 
B 1 78 LYS 78 187 187 LYS LYS B . n 
B 1 79 GLU 79 188 188 GLU GLU B . n 
B 1 80 GLU 80 189 189 GLU GLU B . n 
B 1 81 LEU 81 190 190 LEU LEU B . n 
B 1 82 PHE 82 191 191 PHE PHE B . n 
B 1 83 THR 83 192 192 THR THR B . n 
B 1 84 MET 84 193 193 MET MET B . n 
B 1 85 LYS 85 194 194 LYS LYS B . n 
B 1 86 LEU 86 195 195 LEU LEU B . n 
B 1 87 ILE 87 196 196 ILE ILE B . n 
B 1 88 GLU 88 197 197 GLU GLU B . n 
B 1 89 PRO 89 198 198 PRO PRO B . n 
B 1 90 LYS 90 199 199 LYS LYS B . n 
B 1 91 LYS 91 200 200 LYS LYS B . n 
B 1 92 SER 92 201 201 SER SER B . n 
B 1 93 SER 93 202 202 SER SER B . n 
B 1 94 GLU 94 203 203 GLU GLU B . n 
B 1 95 ALA 95 204 204 ALA ALA B . n 
C 1 1  SER 1  -1  -1  SER SER C . n 
C 1 2  MET 2  0   0   MET MET C . n 
C 1 3  LYS 3  112 112 LYS LYS C . n 
C 1 4  GLY 4  113 113 GLY GLY C . n 
C 1 5  ILE 5  114 114 ILE ILE C . n 
C 1 6  GLU 6  115 115 GLU GLU C . n 
C 1 7  LYS 7  116 116 LYS LYS C . n 
C 1 8  GLU 8  117 117 GLU GLU C . n 
C 1 9  VAL 9  118 118 VAL VAL C . n 
C 1 10 ASN 10 119 119 ASN ASN C . n 
C 1 11 VAL 11 120 120 VAL VAL C . n 
C 1 12 TYR 12 121 121 TYR TYR C . n 
C 1 13 LYS 13 122 122 LYS LYS C . n 
C 1 14 SER 14 123 123 SER SER C . n 
C 1 15 GLU 15 124 124 GLU GLU C . n 
C 1 16 ASP 16 125 125 ASP ASP C . n 
C 1 17 SER 17 126 126 SER SER C . n 
C 1 18 LEU 18 127 127 LEU LEU C . n 
C 1 19 GLY 19 128 128 GLY GLY C . n 
C 1 20 LEU 20 129 129 LEU LEU C . n 
C 1 21 THR 21 130 130 THR THR C . n 
C 1 22 ILE 22 131 131 ILE ILE C . n 
C 1 23 THR 23 132 132 THR THR C . n 
C 1 24 ASP 24 133 133 ASP ASP C . n 
C 1 25 ASN 25 134 134 ASN ASN C . n 
C 1 26 GLY 26 135 135 GLY GLY C . n 
C 1 27 VAL 27 136 136 VAL VAL C . n 
C 1 28 GLY 28 137 137 GLY GLY C . n 
C 1 29 TYR 29 138 138 TYR TYR C . n 
C 1 30 ALA 30 139 139 ALA ALA C . n 
C 1 31 PHE 31 140 140 PHE PHE C . n 
C 1 32 ILE 32 141 141 ILE ILE C . n 
C 1 33 LYS 33 142 142 LYS LYS C . n 
C 1 34 ARG 34 143 143 ARG ARG C . n 
C 1 35 ILE 35 144 144 ILE ILE C . n 
C 1 36 LYS 36 145 145 LYS LYS C . n 
C 1 37 ASP 37 146 146 ASP ASP C . n 
C 1 38 GLY 38 147 147 GLY GLY C . n 
C 1 39 GLY 39 148 148 GLY GLY C . n 
C 1 40 VAL 40 149 149 VAL VAL C . n 
C 1 41 ILE 41 150 150 ILE ILE C . n 
C 1 42 ASP 42 151 151 ASP ASP C . n 
C 1 43 SER 43 152 152 SER SER C . n 
C 1 44 VAL 44 153 153 VAL VAL C . n 
C 1 45 LYS 45 154 154 LYS LYS C . n 
C 1 46 THR 46 155 155 THR THR C . n 
C 1 47 ILE 47 156 156 ILE ILE C . n 
C 1 48 CYS 48 157 157 CYS CYS C . n 
C 1 49 VAL 49 158 158 VAL VAL C . n 
C 1 50 GLY 50 159 159 GLY GLY C . n 
C 1 51 ASP 51 160 160 ASP ASP C . n 
C 1 52 HIS 52 161 161 HIS HIS C . n 
C 1 53 ILE 53 162 162 ILE ILE C . n 
C 1 54 GLU 54 163 163 GLU GLU C . n 
C 1 55 SER 55 164 164 SER SER C . n 
C 1 56 ILE 56 165 165 ILE ILE C . n 
C 1 57 ASN 57 166 166 ASN ASN C . n 
C 1 58 GLY 58 167 167 GLY GLY C . n 
C 1 59 GLU 59 168 168 GLU GLU C . n 
C 1 60 ASN 60 169 169 ASN ASN C . n 
C 1 61 ILE 61 170 170 ILE ILE C . n 
C 1 62 VAL 62 171 171 VAL VAL C . n 
C 1 63 GLY 63 172 172 GLY GLY C . n 
C 1 64 TRP 64 173 173 TRP TRP C . n 
C 1 65 ARG 65 174 174 ARG ARG C . n 
C 1 66 HIS 66 175 175 HIS HIS C . n 
C 1 67 TYR 67 176 176 TYR TYR C . n 
C 1 68 ASP 68 177 177 ASP ASP C . n 
C 1 69 VAL 69 178 178 VAL VAL C . n 
C 1 70 ALA 70 179 179 ALA ALA C . n 
C 1 71 LYS 71 180 180 LYS LYS C . n 
C 1 72 LYS 72 181 181 LYS LYS C . n 
C 1 73 LEU 73 182 182 LEU LEU C . n 
C 1 74 LYS 74 183 183 LYS LYS C . n 
C 1 75 GLU 75 184 184 GLU GLU C . n 
C 1 76 LEU 76 185 185 LEU LEU C . n 
C 1 77 LYS 77 186 186 LYS LYS C . n 
C 1 78 LYS 78 187 187 LYS LYS C . n 
C 1 79 GLU 79 188 188 GLU GLU C . n 
C 1 80 GLU 80 189 189 GLU GLU C . n 
C 1 81 LEU 81 190 190 LEU LEU C . n 
C 1 82 PHE 82 191 191 PHE PHE C . n 
C 1 83 THR 83 192 192 THR THR C . n 
C 1 84 MET 84 193 193 MET MET C . n 
C 1 85 LYS 85 194 194 LYS LYS C . n 
C 1 86 LEU 86 195 195 LEU LEU C . n 
C 1 87 ILE 87 196 196 ILE ILE C . n 
C 1 88 GLU 88 197 197 GLU GLU C . n 
C 1 89 PRO 89 198 198 PRO PRO C . n 
C 1 90 LYS 90 199 199 LYS LYS C . n 
C 1 91 LYS 91 200 200 LYS LYS C . n 
C 1 92 SER 92 201 201 SER SER C . n 
C 1 93 SER 93 202 202 SER SER C . n 
C 1 94 GLU 94 203 203 GLU GLU C . n 
C 1 95 ALA 95 204 204 ALA ALA C . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 SO4 1  1   1   SO4 SO4 B . 
E 2 SO4 1  2   2   SO4 SO4 B . 
F 3 GOL 1  3   3   GOL GOL B . 
G 4 HOH 1  7   7   HOH HOH A . 
G 4 HOH 2  12  12  HOH HOH A . 
G 4 HOH 3  14  14  HOH HOH A . 
G 4 HOH 4  15  15  HOH HOH A . 
G 4 HOH 5  16  16  HOH HOH A . 
G 4 HOH 6  21  21  HOH HOH A . 
G 4 HOH 7  22  22  HOH HOH A . 
G 4 HOH 8  43  43  HOH HOH A . 
G 4 HOH 9  55  55  HOH HOH A . 
G 4 HOH 10 57  57  HOH HOH A . 
G 4 HOH 11 58  58  HOH HOH A . 
G 4 HOH 12 62  62  HOH HOH A . 
G 4 HOH 13 68  68  HOH HOH A . 
G 4 HOH 14 69  69  HOH HOH A . 
G 4 HOH 15 72  72  HOH HOH A . 
G 4 HOH 16 78  78  HOH HOH A . 
G 4 HOH 17 81  81  HOH HOH A . 
G 4 HOH 18 82  82  HOH HOH A . 
G 4 HOH 19 85  85  HOH HOH A . 
G 4 HOH 20 88  88  HOH HOH A . 
G 4 HOH 21 89  89  HOH HOH A . 
G 4 HOH 22 92  92  HOH HOH A . 
G 4 HOH 23 93  93  HOH HOH A . 
G 4 HOH 24 100 100 HOH HOH A . 
H 4 HOH 1  4   4   HOH HOH B . 
H 4 HOH 2  5   5   HOH HOH B . 
H 4 HOH 3  6   6   HOH HOH B . 
H 4 HOH 4  10  10  HOH HOH B . 
H 4 HOH 5  11  11  HOH HOH B . 
H 4 HOH 6  13  13  HOH HOH B . 
H 4 HOH 7  18  18  HOH HOH B . 
H 4 HOH 8  20  20  HOH HOH B . 
H 4 HOH 9  25  25  HOH HOH B . 
H 4 HOH 10 27  27  HOH HOH B . 
H 4 HOH 11 30  30  HOH HOH B . 
H 4 HOH 12 32  32  HOH HOH B . 
H 4 HOH 13 34  34  HOH HOH B . 
H 4 HOH 14 38  38  HOH HOH B . 
H 4 HOH 15 39  39  HOH HOH B . 
H 4 HOH 16 41  41  HOH HOH B . 
H 4 HOH 17 42  42  HOH HOH B . 
H 4 HOH 18 48  48  HOH HOH B . 
H 4 HOH 19 49  49  HOH HOH B . 
H 4 HOH 20 50  50  HOH HOH B . 
H 4 HOH 21 51  51  HOH HOH B . 
H 4 HOH 22 53  53  HOH HOH B . 
H 4 HOH 23 54  54  HOH HOH B . 
H 4 HOH 24 59  59  HOH HOH B . 
H 4 HOH 25 64  64  HOH HOH B . 
H 4 HOH 26 65  65  HOH HOH B . 
H 4 HOH 27 66  66  HOH HOH B . 
H 4 HOH 28 71  71  HOH HOH B . 
H 4 HOH 29 75  75  HOH HOH B . 
H 4 HOH 30 76  76  HOH HOH B . 
H 4 HOH 31 77  77  HOH HOH B . 
H 4 HOH 32 79  79  HOH HOH B . 
H 4 HOH 33 84  84  HOH HOH B . 
H 4 HOH 34 90  90  HOH HOH B . 
H 4 HOH 35 91  91  HOH HOH B . 
H 4 HOH 36 97  97  HOH HOH B . 
H 4 HOH 37 98  98  HOH HOH B . 
I 4 HOH 1  1   1   HOH HOH C . 
I 4 HOH 2  2   2   HOH HOH C . 
I 4 HOH 3  3   3   HOH HOH C . 
I 4 HOH 4  8   8   HOH HOH C . 
I 4 HOH 5  9   9   HOH HOH C . 
I 4 HOH 6  17  17  HOH HOH C . 
I 4 HOH 7  19  19  HOH HOH C . 
I 4 HOH 8  23  23  HOH HOH C . 
I 4 HOH 9  24  24  HOH HOH C . 
I 4 HOH 10 26  26  HOH HOH C . 
I 4 HOH 11 28  28  HOH HOH C . 
I 4 HOH 12 29  29  HOH HOH C . 
I 4 HOH 13 31  31  HOH HOH C . 
I 4 HOH 14 33  33  HOH HOH C . 
I 4 HOH 15 35  35  HOH HOH C . 
I 4 HOH 16 36  36  HOH HOH C . 
I 4 HOH 17 37  37  HOH HOH C . 
I 4 HOH 18 40  40  HOH HOH C . 
I 4 HOH 19 44  44  HOH HOH C . 
I 4 HOH 20 45  45  HOH HOH C . 
I 4 HOH 21 46  46  HOH HOH C . 
I 4 HOH 22 47  47  HOH HOH C . 
I 4 HOH 23 52  52  HOH HOH C . 
I 4 HOH 24 56  56  HOH HOH C . 
I 4 HOH 25 60  60  HOH HOH C . 
I 4 HOH 26 61  61  HOH HOH C . 
I 4 HOH 27 63  63  HOH HOH C . 
I 4 HOH 28 67  67  HOH HOH C . 
I 4 HOH 29 70  70  HOH HOH C . 
I 4 HOH 30 73  73  HOH HOH C . 
I 4 HOH 31 74  74  HOH HOH C . 
I 4 HOH 32 80  80  HOH HOH C . 
I 4 HOH 33 83  83  HOH HOH C . 
I 4 HOH 34 86  86  HOH HOH C . 
I 4 HOH 35 87  87  HOH HOH C . 
I 4 HOH 36 94  94  HOH HOH C . 
I 4 HOH 37 95  95  HOH HOH C . 
I 4 HOH 38 96  96  HOH HOH C . 
I 4 HOH 39 99  99  HOH HOH C . 
I 4 HOH 40 101 101 HOH HOH C . 
I 4 HOH 41 102 102 HOH HOH C . 
I 4 HOH 42 103 103 HOH HOH C . 
I 4 HOH 43 104 104 HOH HOH C . 
I 4 HOH 44 105 105 HOH HOH C . 
I 4 HOH 45 106 106 HOH HOH C . 
I 4 HOH 46 107 107 HOH HOH C . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 software_defined_assembly PISA trimeric  3 
2 software_defined_assembly PISA hexameric 6 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D,E,F,G,H,I 
2 1,2 A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3680  ? 
1 MORE         -39   ? 
1 'SSA (A^2)'  15450 ? 
2 'ABSA (A^2)' 9760  ? 
2 MORE         -89   ? 
2 'SSA (A^2)'  28500 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z            1.0000000000 0.0000000000  0.0000000000 0.0000000000  0.0000000000  
1.0000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 8_665 -y+1,-x+1,-z+1/4 0.0000000000 -1.0000000000 0.0000000000 83.5100000000 -1.0000000000 
0.0000000000 0.0000000000 83.5100000000 0.0000000000 0.0000000000 -1.0000000000 40.0775000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-03-24 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2018-01-31 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Database references'       
4 3 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' audit_author    
2 3 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_audit_author.name'    
2 3 'Structure model' '_citation_author.name' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1  ? refined 22.7380 30.8020 14.8330 0.2865 0.2781 0.1169 -0.0033 -0.0212 -0.0140 3.7180  12.0040 5.3132  2.4379  -1.4895 -6.7163 
-0.0056 0.3730  -0.2015 -0.5123 -0.2102 -0.6671 0.1538  0.2696  0.2158  'X-RAY DIFFRACTION' 
2  ? refined 14.6380 36.8100 18.5830 0.2024 0.2332 0.2621 0.0556  0.0558  0.1358  5.5414  9.6347  9.0824  -0.9509 4.4644  -3.8058 
0.1509  0.6715  0.4623  -0.2028 0.0832  0.6295  -0.2573 0.1124  -0.2341 'X-RAY DIFFRACTION' 
3  ? refined 17.0630 33.5060 10.0490 0.4451 0.5546 0.2112 0.0448  0.0001  0.2233  6.9158  6.3143  9.5915  2.3599  2.7187  3.3236  
-0.0605 1.2557  0.6220  -0.8626 0.2168  0.0225  -0.1398 -0.0662 -0.1563 'X-RAY DIFFRACTION' 
4  ? refined 12.4110 26.6770 14.9740 0.3156 0.3087 0.0988 -0.0124 -0.0785 0.0688  4.6993  9.7200  2.8195  -0.5035 0.0193  -2.1354 
0.1508  0.4536  -0.0861 -0.3467 0.3020  0.6689  0.1873  -0.3203 -0.4528 'X-RAY DIFFRACTION' 
5  ? refined 26.9020 46.8840 7.6470  0.2549 0.4654 0.2874 0.0835  -0.0093 0.0715  0.6706  10.4136 7.8434  2.1170  0.7539  -2.5097 
0.0539  -0.0949 -0.1654 0.4450  -0.2774 -0.7681 -0.1868 0.3792  0.2234  'X-RAY DIFFRACTION' 
6  ? refined -6.4170 64.1000 14.1180 0.1013 0.1646 0.1337 -0.0870 -0.0431 0.0624  9.3906  7.8296  6.5462  -4.3483 -1.8329 0.8369  
0.1861  0.3488  0.2089  -0.1327 -0.2472 0.3454  -0.3115 -0.3435 0.0611  'X-RAY DIFFRACTION' 
7  ? refined -0.5120 58.8860 21.8760 0.2347 0.1798 0.0731 -0.0622 -0.0023 0.0395  10.3228 1.8772  1.5678  -1.4595 0.8412  0.3655  
-0.1058 -0.2392 -0.1975 0.2340  0.0518  0.0570  0.0656  -0.0491 0.0540  'X-RAY DIFFRACTION' 
8  ? refined 4.0680  61.7610 13.4540 0.1059 0.1913 0.0194 -0.0586 -0.0186 0.0114  6.3546  9.3532  2.8304  4.9140  -2.3592 -0.1258 
-0.1497 -0.1999 -0.2478 -0.3483 0.1737  -0.2583 0.3246  0.0848  -0.0239 'X-RAY DIFFRACTION' 
9  ? refined -0.2020 69.0180 16.1640 0.4037 0.1802 0.1070 -0.0003 0.0101  -0.0067 9.8358  2.0730  2.0093  -0.1436 3.1291  -1.1479 
-0.1307 -0.2131 0.7418  0.0361  0.0796  0.3126  -0.4479 -0.1989 0.0511  'X-RAY DIFFRACTION' 
10 ? refined 5.0060  42.4190 15.3520 0.3127 0.3316 0.4510 0.0085  -0.0037 0.1017  1.5774  22.1150 5.2819  -5.8502 2.3794  -8.0648 
0.2431  0.1594  -0.0362 -0.7562 -0.5023 0.2272  0.3306  0.5716  0.2592  'X-RAY DIFFRACTION' 
11 ? refined 14.6140 68.8390 1.4630  0.2393 0.2076 0.1620 -0.0338 -0.0434 0.0507  2.2672  4.6486  20.9839 -2.1790 -4.8278 9.8303  
0.1540  0.1614  -0.0781 -0.3336 -0.3401 0.1371  -0.6683 -0.8780 0.1861  'X-RAY DIFFRACTION' 
12 ? refined 24.8150 57.1310 0.3870  0.1531 0.2302 0.0551 0.0360  -0.0340 0.0104  6.0806  3.3273  6.6176  1.0296  -1.7602 -1.1129 
-0.1484 -0.5060 -0.2112 0.1548  0.0049  -0.3844 0.4403  1.0075  0.1435  'X-RAY DIFFRACTION' 
13 ? refined 18.8190 59.9010 -0.3050 0.1599 0.1921 0.0205 0.0023  -0.0309 0.0224  9.7274  4.7240  2.7332  4.0582  -2.6821 0.0211  
0.0022  -0.1389 0.1807  -0.0690 -0.0048 0.0235  0.1423  0.1913  0.0027  'X-RAY DIFFRACTION' 
14 ? refined 18.7510 58.9650 -1.2120 0.1983 0.2634 0.0061 -0.0611 0.0046  0.0257  1.8171  3.1369  7.6160  -0.9134 -0.6527 3.9147  
-0.1943 0.0472  -0.0696 -0.2898 0.1914  0.0223  0.1022  0.3101  0.0029  'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1  1  A -1  A 124 ? . . . . 'X-RAY DIFFRACTION' ? 
2  2  A 125 A 154 ? . . . . 'X-RAY DIFFRACTION' ? 
3  3  A 155 A 174 ? . . . . 'X-RAY DIFFRACTION' ? 
4  4  A 175 A 195 ? . . . . 'X-RAY DIFFRACTION' ? 
5  5  A 196 A 204 ? . . . . 'X-RAY DIFFRACTION' ? 
6  6  B 113 B 127 ? . . . . 'X-RAY DIFFRACTION' ? 
7  7  B 128 B 154 ? . . . . 'X-RAY DIFFRACTION' ? 
8  8  B 155 B 174 ? . . . . 'X-RAY DIFFRACTION' ? 
9  9  B 175 B 196 ? . . . . 'X-RAY DIFFRACTION' ? 
10 10 B 197 B 204 ? . . . . 'X-RAY DIFFRACTION' ? 
11 11 C -1  C 120 ? . . . . 'X-RAY DIFFRACTION' ? 
12 12 C 121 C 146 ? . . . . 'X-RAY DIFFRACTION' ? 
13 13 C 147 C 174 ? . . . . 'X-RAY DIFFRACTION' ? 
14 14 C 175 C 204 ? . . . . 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHASER phasing          .        ? 1 
REFMAC refinement       5.5.0085 ? 2 
MOSFLM 'data reduction' .        ? 3 
SCALA  'data scaling'   .        ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 VAL A 136 ? ? -135.58 -52.02 
2 1 TYR A 138 ? ? 57.64   72.25  
3 1 ASN B 134 ? ? -99.20  33.69  
4 1 TYR B 138 ? ? 64.59   79.17  
5 1 VAL C 136 ? ? -137.29 -41.42 
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   GLY 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    137 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   TYR 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    138 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -149.58 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 181 ? CE ? A LYS 72 CE 
2  1 Y 1 A LYS 181 ? NZ ? A LYS 72 NZ 
3  1 Y 1 A LYS 194 ? CD ? A LYS 85 CD 
4  1 Y 1 A LYS 194 ? CE ? A LYS 85 CE 
5  1 Y 1 A LYS 194 ? NZ ? A LYS 85 NZ 
6  1 Y 1 A LYS 200 ? CD ? A LYS 91 CD 
7  1 Y 1 A LYS 200 ? CE ? A LYS 91 CE 
8  1 Y 1 A LYS 200 ? NZ ? A LYS 91 NZ 
9  1 Y 1 C LYS 194 ? CE ? C LYS 85 CE 
10 1 Y 1 C LYS 194 ? NZ ? C LYS 85 NZ 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 B SER 110 ? B SER 1 
2 1 Y 1 B MET 111 ? B MET 2 
3 1 Y 1 B LYS 112 ? B LYS 3 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 GLYCEROL      GOL 
4 water         HOH 
#