data_3GIJ
# 
_entry.id   3GIJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3GIJ         
NDB   PD1253       
RCSB  RCSB051903   
WWPDB D_1000051903 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2ASD 'oxoG-modified Dpo4 insertion ternary complex'                                           unspecified 
PDB 2ASJ 'oxoG-modified Dpo4 pre-insertion binary complex'                                        unspecified 
PDB 2ASL 'oxoG-modified Dpo4 post-insertion binary complex'                                       unspecified 
PDB 3GII 'Dpo4 extension ternary complex with disordered A opposite an oxoG in anti conformation' unspecified 
PDB 3GIK 'Dpo4 extension ternary complex with the oxoG(anti)-C(anti) pair'                        unspecified 
PDB 3GIL 'Dpo4 extension ternary complex with oxoG(anti)-T(anti) pair'                            unspecified 
PDB 3GIM 'Dpo4 extension ternary complex with oxoG(anti)-G(syn) pair'                             unspecified 
# 
_pdbx_database_status.entry_id                        3GIJ 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2009-03-05 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rechkoblit, O.' 1 
'Malinina, L.'   2 
'Patel, D.J.'    3 
# 
_citation.id                        primary 
_citation.title                     
'Impact of conformational heterogeneity of OxoG lesions and their pairing partners on bypass fidelity by Y family polymerases.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            17 
_citation.page_first                725 
_citation.page_last                 736 
_citation.year                      2009 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19446528 
_citation.pdbx_database_id_DOI      10.1016/j.str.2009.03.011 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Rechkoblit, O.'  1 
primary 'Malinina, L.'    2 
primary 'Cheng, Y.'       3 
primary 'Geacintov, N.E.' 4 
primary 'Broyde, S.'      5 
primary 'Patel, D.J.'     6 
# 
_cell.length_a           51.264 
_cell.length_b           107.409 
_cell.length_c           97.867 
_cell.angle_alpha        90.000 
_cell.angle_beta         100.540 
_cell.angle_gamma        90.000 
_cell.entry_id           3GIJ 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.entry_id                         3GIJ 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                4 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase IV'                                                  38945.379 2   2.7.7.7 ? ? ? 
2 polymer     syn "5'-D(*GP*TP*TP*GP*GP*AP*TP*GP*GP*TP*AP*GP*(2DA))-3'"                4070.668  2   ?       ? ? 
;PRIMER STRAND (DIDEOXY-TERMINATED AT 3'-END)
;
3 polymer     syn "5'-D(*CP*TP*AP*AP*CP*(8OG)P*CP*TP*AP*CP*CP*AP*TP*CP*CP*AP*AP*C)-3'" 5405.521  2   ?       ? ? 
'oxoG-modified template strand'                
4 non-polymer syn "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE"                                  507.181   2   ?       ? ? ? 
5 non-polymer syn 'CALCIUM ION'                                                        40.078    6   ?       ? ? ? 
6 water       nat water                                                                18.015    244 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Pol IV' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;GIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEV
YQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKP
NGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTR
VRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQ
KILEEDERKIRRIGVRFSKFI
;
;GIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEV
YQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKP
NGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTR
VRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQ
KILEEDERKIRRIGVRFSKFI
;
A,B ? 
2 polydeoxyribonucleotide no yes '(DG)(DT)(DT)(DG)(DG)(DA)(DT)(DG)(DG)(DT)(DA)(DG)(2DA)' GTTGGATGGTAGA D,H ? 
3 polydeoxyribonucleotide no yes '(DC)(DT)(DA)(DA)(DC)(8OG)(DC)(DT)(DA)(DC)(DC)(DA)(DT)(DC)(DC)(DA)(DA)(DC)' CTAACGCTACCATCCAAC 
E,J ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ILE n 
1 3   VAL n 
1 4   LEU n 
1 5   PHE n 
1 6   VAL n 
1 7   ASP n 
1 8   PHE n 
1 9   ASP n 
1 10  TYR n 
1 11  PHE n 
1 12  TYR n 
1 13  ALA n 
1 14  GLN n 
1 15  VAL n 
1 16  GLU n 
1 17  GLU n 
1 18  VAL n 
1 19  LEU n 
1 20  ASN n 
1 21  PRO n 
1 22  SER n 
1 23  LEU n 
1 24  LYS n 
1 25  GLY n 
1 26  LYS n 
1 27  PRO n 
1 28  VAL n 
1 29  VAL n 
1 30  VAL n 
1 31  CYS n 
1 32  VAL n 
1 33  PHE n 
1 34  SER n 
1 35  GLY n 
1 36  ARG n 
1 37  PHE n 
1 38  GLU n 
1 39  ASP n 
1 40  SER n 
1 41  GLY n 
1 42  ALA n 
1 43  VAL n 
1 44  ALA n 
1 45  THR n 
1 46  ALA n 
1 47  ASN n 
1 48  TYR n 
1 49  GLU n 
1 50  ALA n 
1 51  ARG n 
1 52  LYS n 
1 53  PHE n 
1 54  GLY n 
1 55  VAL n 
1 56  LYS n 
1 57  ALA n 
1 58  GLY n 
1 59  ILE n 
1 60  PRO n 
1 61  ILE n 
1 62  VAL n 
1 63  GLU n 
1 64  ALA n 
1 65  LYS n 
1 66  LYS n 
1 67  ILE n 
1 68  LEU n 
1 69  PRO n 
1 70  ASN n 
1 71  ALA n 
1 72  VAL n 
1 73  TYR n 
1 74  LEU n 
1 75  PRO n 
1 76  MET n 
1 77  ARG n 
1 78  LYS n 
1 79  GLU n 
1 80  VAL n 
1 81  TYR n 
1 82  GLN n 
1 83  GLN n 
1 84  VAL n 
1 85  SER n 
1 86  SER n 
1 87  ARG n 
1 88  ILE n 
1 89  MET n 
1 90  ASN n 
1 91  LEU n 
1 92  LEU n 
1 93  ARG n 
1 94  GLU n 
1 95  TYR n 
1 96  SER n 
1 97  GLU n 
1 98  LYS n 
1 99  ILE n 
1 100 GLU n 
1 101 ILE n 
1 102 ALA n 
1 103 SER n 
1 104 ILE n 
1 105 ASP n 
1 106 GLU n 
1 107 ALA n 
1 108 TYR n 
1 109 LEU n 
1 110 ASP n 
1 111 ILE n 
1 112 SER n 
1 113 ASP n 
1 114 LYS n 
1 115 VAL n 
1 116 ARG n 
1 117 ASP n 
1 118 TYR n 
1 119 ARG n 
1 120 GLU n 
1 121 ALA n 
1 122 TYR n 
1 123 ASN n 
1 124 LEU n 
1 125 GLY n 
1 126 LEU n 
1 127 GLU n 
1 128 ILE n 
1 129 LYS n 
1 130 ASN n 
1 131 LYS n 
1 132 ILE n 
1 133 LEU n 
1 134 GLU n 
1 135 LYS n 
1 136 GLU n 
1 137 LYS n 
1 138 ILE n 
1 139 THR n 
1 140 VAL n 
1 141 THR n 
1 142 VAL n 
1 143 GLY n 
1 144 ILE n 
1 145 SER n 
1 146 LYS n 
1 147 ASN n 
1 148 LYS n 
1 149 VAL n 
1 150 PHE n 
1 151 ALA n 
1 152 LYS n 
1 153 ILE n 
1 154 ALA n 
1 155 ALA n 
1 156 ASP n 
1 157 MET n 
1 158 ALA n 
1 159 LYS n 
1 160 PRO n 
1 161 ASN n 
1 162 GLY n 
1 163 ILE n 
1 164 LYS n 
1 165 VAL n 
1 166 ILE n 
1 167 ASP n 
1 168 ASP n 
1 169 GLU n 
1 170 GLU n 
1 171 VAL n 
1 172 LYS n 
1 173 ARG n 
1 174 LEU n 
1 175 ILE n 
1 176 ARG n 
1 177 GLU n 
1 178 LEU n 
1 179 ASP n 
1 180 ILE n 
1 181 ALA n 
1 182 ASP n 
1 183 VAL n 
1 184 PRO n 
1 185 GLY n 
1 186 ILE n 
1 187 GLY n 
1 188 ASN n 
1 189 ILE n 
1 190 THR n 
1 191 ALA n 
1 192 GLU n 
1 193 LYS n 
1 194 LEU n 
1 195 LYS n 
1 196 LYS n 
1 197 LEU n 
1 198 GLY n 
1 199 ILE n 
1 200 ASN n 
1 201 LYS n 
1 202 LEU n 
1 203 VAL n 
1 204 ASP n 
1 205 THR n 
1 206 LEU n 
1 207 SER n 
1 208 ILE n 
1 209 GLU n 
1 210 PHE n 
1 211 ASP n 
1 212 LYS n 
1 213 LEU n 
1 214 LYS n 
1 215 GLY n 
1 216 MET n 
1 217 ILE n 
1 218 GLY n 
1 219 GLU n 
1 220 ALA n 
1 221 LYS n 
1 222 ALA n 
1 223 LYS n 
1 224 TYR n 
1 225 LEU n 
1 226 ILE n 
1 227 SER n 
1 228 LEU n 
1 229 ALA n 
1 230 ARG n 
1 231 ASP n 
1 232 GLU n 
1 233 TYR n 
1 234 ASN n 
1 235 GLU n 
1 236 PRO n 
1 237 ILE n 
1 238 ARG n 
1 239 THR n 
1 240 ARG n 
1 241 VAL n 
1 242 ARG n 
1 243 LYS n 
1 244 SER n 
1 245 ILE n 
1 246 GLY n 
1 247 ARG n 
1 248 ILE n 
1 249 VAL n 
1 250 THR n 
1 251 MET n 
1 252 LYS n 
1 253 ARG n 
1 254 ASN n 
1 255 SER n 
1 256 ARG n 
1 257 ASN n 
1 258 LEU n 
1 259 GLU n 
1 260 GLU n 
1 261 ILE n 
1 262 LYS n 
1 263 PRO n 
1 264 TYR n 
1 265 LEU n 
1 266 PHE n 
1 267 ARG n 
1 268 ALA n 
1 269 ILE n 
1 270 GLU n 
1 271 GLU n 
1 272 SER n 
1 273 TYR n 
1 274 TYR n 
1 275 LYS n 
1 276 LEU n 
1 277 ASP n 
1 278 LYS n 
1 279 ARG n 
1 280 ILE n 
1 281 PRO n 
1 282 LYS n 
1 283 ALA n 
1 284 ILE n 
1 285 HIS n 
1 286 VAL n 
1 287 VAL n 
1 288 ALA n 
1 289 VAL n 
1 290 THR n 
1 291 GLU n 
1 292 ASP n 
1 293 LEU n 
1 294 ASP n 
1 295 ILE n 
1 296 VAL n 
1 297 SER n 
1 298 ARG n 
1 299 GLY n 
1 300 ARG n 
1 301 THR n 
1 302 PHE n 
1 303 PRO n 
1 304 HIS n 
1 305 GLY n 
1 306 ILE n 
1 307 SER n 
1 308 LYS n 
1 309 GLU n 
1 310 THR n 
1 311 ALA n 
1 312 TYR n 
1 313 SER n 
1 314 GLU n 
1 315 SER n 
1 316 VAL n 
1 317 LYS n 
1 318 LEU n 
1 319 LEU n 
1 320 GLN n 
1 321 LYS n 
1 322 ILE n 
1 323 LEU n 
1 324 GLU n 
1 325 GLU n 
1 326 ASP n 
1 327 GLU n 
1 328 ARG n 
1 329 LYS n 
1 330 ILE n 
1 331 ARG n 
1 332 ARG n 
1 333 ILE n 
1 334 GLY n 
1 335 VAL n 
1 336 ARG n 
1 337 PHE n 
1 338 SER n 
1 339 LYS n 
1 340 PHE n 
1 341 ILE n 
2 1   DG  n 
2 2   DT  n 
2 3   DT  n 
2 4   DG  n 
2 5   DG  n 
2 6   DA  n 
2 7   DT  n 
2 8   DG  n 
2 9   DG  n 
2 10  DT  n 
2 11  DA  n 
2 12  DG  n 
2 13  2DA n 
3 1   DC  n 
3 2   DT  n 
3 3   DA  n 
3 4   DA  n 
3 5   DC  n 
3 6   8OG n 
3 7   DC  n 
3 8   DT  n 
3 9   DA  n 
3 10  DC  n 
3 11  DC  n 
3 12  DA  n 
3 13  DT  n 
3 14  DC  n 
3 15  DC  n 
3 16  DA  n 
3 17  DA  n 
3 18  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'dbh, dpo4, SSO2448' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'P2 / DSM 1617 / JCM 11322' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Sulfolobus solfataricus P2' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     273057 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 35092 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-RIL(STRATAGENE)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? ? ? ? 'DNA primer strand'                 
3 1 sample ? ? ? ? ? 'DNA OXOG-modified template strand' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPO42_SULSO Q97W02 1 
;IVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEVY
QQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKPN
GIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRV
RKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQK
ILEEDERKIRRIGVRFSKFI
;
2 ? 
2 PDB 3GIJ        3GIJ   2 GTTGGATGGTAGA 1 ? 
3 PDB 3GIJ        3GIJ   3 CTAACGCTACCATCCAAC 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3GIJ A 2 ? 341 ? Q97W02 2 ? 341 ? 2    341  
2 2 3GIJ D 1 ? 13  ? 3GIJ   1 ? 13  ? 802  814  
3 3 3GIJ E 1 ? 18  ? 3GIJ   1 ? 18  ? 901  918  
4 1 3GIJ B 2 ? 341 ? Q97W02 2 ? 341 ? 1002 1341 
5 2 3GIJ H 1 ? 13  ? 3GIJ   1 ? 13  ? 1802 1814 
6 3 3GIJ J 1 ? 18  ? 3GIJ   1 ? 18  ? 1901 1918 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3GIJ GLY A 1 ? UNP Q97W02 ? ? 'EXPRESSION TAG' 1    1 
2 3GIJ GLY B 1 ? UNP Q97W02 ? ? 'EXPRESSION TAG' 1001 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2DA 'DNA linking'       n "2',3'-DIDEOXYADENOSINE-5'-MONOPHOSPHATE"   ?                                                       
'C10 H14 N5 O5 P'   315.222 
8OG 'DNA linking'       n "8-OXO-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" "8-OXO-7,8-DIHYDRO-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" 
'C10 H14 N5 O8 P'   363.221 
ALA 'L-peptide linking' y ALANINE                                     ?                                                       
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                    ?                                                       
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                  ?                                                       
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                             ?                                                       
'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                               ?                                                       
'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                                    ?                                                       
'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"        ?                                                       
'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"         ?                                                       
'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"        ?                                                       
'C10 H14 N5 O7 P'   347.221 
DGT non-polymer         . "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE"         ?                                                       
'C10 H16 N5 O13 P3' 507.181 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                ?                                                       
'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                                   ?                                                       
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                             ?                                                       
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                     ?                                                       
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                   ?                                                       
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                       ?                                                       
'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                  ?                                                       
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                     ?                                                       
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                      ?                                                       
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                  ?                                                       
'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                               ?                                                       
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                     ?                                                       
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                      ?                                                       
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                   ?                                                       
'C4 H9 N O3'        119.119 
TYR 'L-peptide linking' y TYROSINE                                    ?                                                       
'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                      ?                                                       
'C5 H11 N O2'       117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3GIJ 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.74 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   55.03 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.pdbx_details    
'100 mM HEPES, 100 mM Calcium acetate, 10% PEG 4000, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 HEPES             ? ? ? 
1 2 2 'Calcium acetate' ? ? ? 
1 3 3 'PEG 4000'        ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2005-11-22 
_diffrn_detector.details                
'6144 x 6144 pixel elements with an effective pixel size less than 60x60 micron and resolution of order 90x90 micron' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97942 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 24-ID-C' 
_diffrn_source.pdbx_wavelength_list        0.97942 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-C 
# 
_reflns.entry_id                     3GIJ 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.35 
_reflns.d_resolution_low             20.0 
_reflns.number_all                   ? 
_reflns.number_obs                   40120 
_reflns.percent_possible_obs         92.7 
_reflns.pdbx_Rmerge_I_obs            0.064 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        20.1 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.35 
_reflns_shell.d_res_low              2.42 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   62.4 
_reflns_shell.Rmerge_I_obs           0.424 
_reflns_shell.meanI_over_sigI_obs    1.8 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3GIJ 
_refine.ls_d_res_high                            2.400 
_refine.ls_d_res_low                             20.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    94.750 
_refine.ls_number_reflns_obs                     38605 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.212 
_refine.ls_R_factor_R_work                       0.209 
_refine.ls_R_factor_R_free                       0.253 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  1950 
_refine.B_iso_mean                               61.170 
_refine.aniso_B[1][1]                            -1.550 
_refine.aniso_B[2][2]                            -0.040 
_refine.aniso_B[3][3]                            2.760 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            3.230 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.944 
_refine.correlation_coeff_Fo_to_Fc_free          0.925 
_refine.pdbx_overall_ESU_R                       0.472 
_refine.pdbx_overall_ESU_R_Free                  0.276 
_refine.overall_SU_ML                            0.215 
_refine.overall_SU_B                             17.440 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.B_iso_max                                102.64 
_refine.B_iso_min                                17.18 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            0.20 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      'PDB entry 3GII' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5480 
_refine_hist.pdbx_number_atoms_nucleic_acid   1180 
_refine_hist.pdbx_number_atoms_ligand         68 
_refine_hist.number_atoms_solvent             244 
_refine_hist.number_atoms_total               6972 
_refine_hist.d_res_high                       2.400 
_refine_hist.d_res_low                        20.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         7029 0.008  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      9700 1.601  2.222  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   682  5.191  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   243  31.895 23.621 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   1121 16.787 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   48   18.305 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           1103 0.125  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     4705 0.004  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            4324 0.243  0.300  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          4742 0.335  0.500  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    746  0.255  0.500  ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      3    0.184  0.500  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   122  0.236  0.300  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 22   0.332  0.500  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              3482 0.617  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             5529 0.836  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              4401 1.402  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             4171 1.835  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.400 
_refine_ls_shell.d_res_low                        2.461 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               69.820 
_refine_ls_shell.number_reflns_R_work             1987 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.267 
_refine_ls_shell.R_factor_R_free                  0.356 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             95 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                2082 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3GIJ 
_struct.title                     'Dpo4 extension ternary complex with oxoG(syn)-A(anti) and oxoG(anti)-A(syn) pairs' 
_struct.pdbx_descriptor           'DNA polymerase IV (E.C.2.7.7.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3GIJ 
_struct_keywords.text            
;DNA POLYMERASE, 8-OXOGUANINE, Y-FAMILY, LESION BYPASS, DNA damage, DNA repair, DNA replication, DNA-binding, DNA-directed DNA polymerase, Magnesium, Metal-binding, Mutator protein, Nucleotidyltransferase, Transferase, TRANSFERASE-DNA COMPLEX
;
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
K N N 4 ? 
L N N 5 ? 
M N N 5 ? 
N N N 5 ? 
O N N 6 ? 
P N N 6 ? 
Q N N 6 ? 
R N N 6 ? 
S N N 6 ? 
T N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 10  ? ASN A 20  ? TYR A 10   ASN A 20   1 ? 11 
HELX_P HELX_P2  2  ASN A 47  ? LYS A 52  ? ASN A 47   LYS A 52   1 ? 6  
HELX_P HELX_P3  3  PRO A 60  ? LEU A 68  ? PRO A 60   LEU A 68   1 ? 9  
HELX_P HELX_P4  4  ARG A 77  ? GLU A 94  ? ARG A 77   GLU A 94   1 ? 18 
HELX_P HELX_P5  5  ASP A 117 ? LYS A 137 ? ASP A 117  LYS A 137  1 ? 21 
HELX_P HELX_P6  6  ASN A 147 ? LYS A 159 ? ASN A 147  LYS A 159  1 ? 13 
HELX_P HELX_P7  7  ASP A 167 ? LEU A 178 ? ASP A 167  LEU A 178  1 ? 12 
HELX_P HELX_P8  8  ASP A 179 ? VAL A 183 ? ASP A 179  VAL A 183  5 ? 5  
HELX_P HELX_P9  9  GLY A 187 ? LEU A 197 ? GLY A 187  LEU A 197  1 ? 11 
HELX_P HELX_P10 10 LYS A 201 ? LEU A 206 ? LYS A 201  LEU A 206  5 ? 6  
HELX_P HELX_P11 11 GLU A 209 ? GLY A 218 ? GLU A 209  GLY A 218  1 ? 10 
HELX_P HELX_P12 12 GLY A 218 ? ARG A 230 ? GLY A 218  ARG A 230  1 ? 13 
HELX_P HELX_P13 13 ASN A 257 ? ASP A 277 ? ASN A 257  ASP A 277  1 ? 21 
HELX_P HELX_P14 14 SER A 307 ? ASP A 326 ? SER A 307  ASP A 326  1 ? 20 
HELX_P HELX_P15 15 TYR D 10  ? LEU D 19  ? TYR B 1010 LEU B 1019 1 ? 10 
HELX_P HELX_P16 16 ASN D 20  ? LYS D 24  ? ASN B 1020 LYS B 1024 5 ? 5  
HELX_P HELX_P17 17 ASN D 47  ? LYS D 52  ? ASN B 1047 LYS B 1052 1 ? 6  
HELX_P HELX_P18 18 PRO D 60  ? LEU D 68  ? PRO B 1060 LEU B 1068 1 ? 9  
HELX_P HELX_P19 19 ARG D 77  ? LEU D 92  ? ARG B 1077 LEU B 1092 1 ? 16 
HELX_P HELX_P20 20 ARG D 119 ? LYS D 137 ? ARG B 1119 LYS B 1137 1 ? 19 
HELX_P HELX_P21 21 ASN D 147 ? ALA D 158 ? ASN B 1147 ALA B 1158 1 ? 12 
HELX_P HELX_P22 22 ASP D 167 ? LEU D 178 ? ASP B 1167 LEU B 1178 1 ? 12 
HELX_P HELX_P23 23 ASP D 179 ? VAL D 183 ? ASP B 1179 VAL B 1183 5 ? 5  
HELX_P HELX_P24 24 GLY D 187 ? GLY D 198 ? GLY B 1187 GLY B 1198 1 ? 12 
HELX_P HELX_P25 25 LEU D 202 ? LEU D 206 ? LEU B 1202 LEU B 1206 5 ? 5  
HELX_P HELX_P26 26 GLU D 209 ? GLY D 218 ? GLU B 1209 GLY B 1218 1 ? 10 
HELX_P HELX_P27 27 GLY D 218 ? ARG D 230 ? GLY B 1218 ARG B 1230 1 ? 13 
HELX_P HELX_P28 28 ASN D 257 ? ASP D 277 ? ASN B 1257 ASP B 1277 1 ? 21 
HELX_P HELX_P29 29 SER D 307 ? ASP D 326 ? SER B 1307 ASP B 1326 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? B DG  12  "O3'" ? ? ? 1_555 B 2DA 13 P  A ? D DG  813  D 2DA 814  1_555 ? ? ? ? ? ? ?                 1.579 ? 
covale2  covale ? ? B DG  12  "O3'" ? ? ? 1_555 B 2DA 13 P  B ? D DG  813  D 2DA 814  1_555 ? ? ? ? ? ? ?                 1.635 ? 
covale3  covale ? ? C DC  5   "O3'" ? ? ? 1_555 C 8OG 6  P  A ? E DC  905  E 8OG 906  1_555 ? ? ? ? ? ? ?                 1.581 ? 
covale4  covale ? ? C DC  5   "O3'" ? ? ? 1_555 C 8OG 6  P  B ? E DC  905  E 8OG 906  1_555 ? ? ? ? ? ? ?                 1.599 ? 
covale5  covale ? ? C 8OG 6   "O3'" A ? ? 1_555 C DC  7  P  ? ? E 8OG 906  E DC  907  1_555 ? ? ? ? ? ? ?                 1.591 ? 
covale6  covale ? ? C 8OG 6   "O3'" B ? ? 1_555 C DC  7  P  ? ? E 8OG 906  E DC  907  1_555 ? ? ? ? ? ? ?                 1.604 ? 
covale7  covale ? ? E DG  12  "O3'" ? ? ? 1_555 E 2DA 13 P  ? ? H DG  1813 H 2DA 1814 1_555 ? ? ? ? ? ? ?                 1.630 ? 
covale8  covale ? ? F DC  5   "O3'" ? ? ? 1_555 F 8OG 6  P  ? ? J DC  1905 J 8OG 1906 1_555 ? ? ? ? ? ? ?                 1.609 ? 
covale9  covale ? ? F 8OG 6   "O3'" ? ? ? 1_555 F DC  7  P  ? ? J 8OG 1906 J DC  1907 1_555 ? ? ? ? ? ? ?                 1.595 ? 
metalc1  metalc ? ? A ASP 7   OD1   ? ? ? 1_555 I CA  .  CA ? ? A ASP 7    A CA  416  1_555 ? ? ? ? ? ? ?                 2.321 ? 
metalc2  metalc ? ? A ASP 7   OD2   ? ? ? 1_555 H CA  .  CA ? ? A ASP 7    A CA  415  1_555 ? ? ? ? ? ? ?                 2.333 ? 
metalc3  metalc ? ? A PHE 8   O     ? ? ? 1_555 I CA  .  CA ? ? A PHE 8    A CA  416  1_555 ? ? ? ? ? ? ?                 2.274 ? 
metalc4  metalc ? ? A ASP 105 OD2   ? ? ? 1_555 I CA  .  CA ? ? A ASP 105  A CA  416  1_555 ? ? ? ? ? ? ?                 2.294 ? 
metalc5  metalc ? ? A GLU 106 OE2   ? ? ? 1_555 H CA  .  CA ? ? A GLU 106  A CA  415  1_555 ? ? ? ? ? ? ?                 2.337 ? 
metalc6  metalc ? ? A ALA 181 O     ? ? ? 1_555 J CA  .  CA ? ? A ALA 181  A CA  417  1_555 ? ? ? ? ? ? ?                 2.296 ? 
metalc7  metalc ? ? A ILE 186 O     ? ? ? 1_555 J CA  .  CA ? ? A ILE 186  A CA  417  1_555 ? ? ? ? ? ? ?                 2.325 ? 
metalc8  metalc ? ? B 2DA 13  OP1   A ? ? 1_555 H CA  .  CA ? ? D 2DA 814  A CA  415  1_555 ? ? ? ? ? ? ?                 2.317 ? 
metalc9  metalc ? ? B 2DA 13  OP2   B ? ? 1_555 H CA  .  CA ? ? D 2DA 814  A CA  415  1_555 ? ? ? ? ? ? ?                 2.350 ? 
metalc10 metalc ? ? D ASP 7   OD1   ? ? ? 1_555 M CA  .  CA ? ? B ASP 1007 B CA  1416 1_555 ? ? ? ? ? ? ?                 2.318 ? 
metalc11 metalc ? ? D ASP 7   OD2   ? ? ? 1_555 L CA  .  CA ? ? B ASP 1007 B CA  1415 1_555 ? ? ? ? ? ? ?                 2.322 ? 
metalc12 metalc ? ? D PHE 8   O     ? ? ? 1_555 M CA  .  CA ? ? B PHE 1008 B CA  1416 1_555 ? ? ? ? ? ? ?                 2.306 ? 
metalc13 metalc ? ? D ASP 105 OD2   ? ? ? 1_555 M CA  .  CA ? ? B ASP 1105 B CA  1416 1_555 ? ? ? ? ? ? ?                 2.308 ? 
metalc14 metalc ? ? D GLU 106 OE2   ? ? ? 1_555 L CA  .  CA ? ? B GLU 1106 B CA  1415 1_555 ? ? ? ? ? ? ?                 2.321 ? 
metalc15 metalc ? ? D ALA 181 O     ? ? ? 1_555 N CA  .  CA ? ? B ALA 1181 B CA  1417 1_555 ? ? ? ? ? ? ?                 2.898 ? 
metalc16 metalc ? ? D VAL 183 O     ? ? ? 1_555 N CA  .  CA ? ? B VAL 1183 B CA  1417 1_555 ? ? ? ? ? ? ?                 2.698 ? 
metalc17 metalc ? ? D ILE 186 O     ? ? ? 1_555 N CA  .  CA ? ? B ILE 1186 B CA  1417 1_555 ? ? ? ? ? ? ?                 2.794 ? 
metalc18 metalc ? ? E DG  12  OP1   ? ? ? 1_555 N CA  .  CA ? ? H DG  1813 B CA  1417 1_555 ? ? ? ? ? ? ?                 2.324 ? 
metalc19 metalc ? ? E 2DA 13  OP1   ? ? ? 1_555 L CA  .  CA ? ? H 2DA 1814 B CA  1415 1_555 ? ? ? ? ? ? ?                 2.956 ? 
metalc20 metalc ? ? G DGT .   O1G   ? ? ? 1_555 I CA  .  CA ? ? A DGT 414  A CA  416  1_555 ? ? ? ? ? ? ?                 2.335 ? 
metalc21 metalc ? ? G DGT .   O1B   ? ? ? 1_555 I CA  .  CA ? ? A DGT 414  A CA  416  1_555 ? ? ? ? ? ? ?                 2.321 ? 
metalc22 metalc ? ? G DGT .   O2A   ? ? ? 1_555 I CA  .  CA ? ? A DGT 414  A CA  416  1_555 ? ? ? ? ? ? ?                 2.319 ? 
metalc23 metalc ? ? K DGT .   O1G   ? ? ? 1_555 M CA  .  CA ? ? B DGT 1414 B CA  1416 1_555 ? ? ? ? ? ? ?                 2.332 ? 
metalc24 metalc ? ? K DGT .   O1B   ? ? ? 1_555 M CA  .  CA ? ? B DGT 1414 B CA  1416 1_555 ? ? ? ? ? ? ?                 2.317 ? 
metalc25 metalc ? ? K DGT .   O2A   ? ? ? 1_555 M CA  .  CA ? ? B DGT 1414 B CA  1416 1_555 ? ? ? ? ? ? ?                 2.320 ? 
metalc26 metalc ? ? H CA  .   CA    ? ? ? 1_555 P HOH .  O  ? ? A CA  415  D HOH 502  1_555 ? ? ? ? ? ? ?                 2.345 ? 
metalc27 metalc ? ? H CA  .   CA    ? ? ? 1_555 O HOH .  O  ? ? A CA  415  A HOH 501  1_555 ? ? ? ? ? ? ?                 2.499 ? 
metalc28 metalc ? ? H CA  .   CA    ? ? ? 1_555 P HOH .  O  ? ? A CA  415  D HOH 717  1_555 ? ? ? ? ? ? ?                 2.429 ? 
metalc29 metalc ? ? J CA  .   CA    ? ? ? 1_555 O HOH .  O  ? ? A CA  417  A HOH 512  1_555 ? ? ? ? ? ? ?                 2.362 ? 
metalc30 metalc ? ? J CA  .   CA    ? ? ? 1_555 P HOH .  O  ? ? A CA  417  D HOH 514  1_555 ? ? ? ? ? ? ?                 2.467 ? 
metalc31 metalc ? ? J CA  .   CA    ? ? ? 1_555 P HOH .  O  ? ? A CA  417  D HOH 516  1_555 ? ? ? ? ? ? ?                 2.423 ? 
metalc32 metalc ? ? L CA  .   CA    ? ? ? 1_555 R HOH .  O  ? ? B CA  1415 B HOH 1501 1_555 ? ? ? ? ? ? ?                 2.115 ? 
metalc33 metalc ? ? L CA  .   CA    ? ? ? 1_555 R HOH .  O  ? ? B CA  1415 B HOH 1502 1_555 ? ? ? ? ? ? ?                 2.824 ? 
metalc34 metalc ? ? N CA  .   CA    ? ? ? 1_555 R HOH .  O  ? ? B CA  1417 B HOH 1515 1_555 ? ? ? ? ? ? ?                 2.796 ? 
metalc35 metalc ? ? N CA  .   CA    ? ? ? 1_555 R HOH .  O  ? ? B CA  1417 B HOH 1516 1_555 ? ? ? ? ? ? ?                 2.505 ? 
metalc36 metalc ? ? D ASP 7   OD1   ? ? ? 1_555 L CA  .  CA ? ? B ASP 1007 B CA  1415 1_555 ? ? ? ? ? ? ?                 3.146 ? 
hydrog1  hydrog ? ? B DG  1   N1    ? ? ? 1_555 C DC  18 N3 ? ? D DG  802  E DC  918  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog2  hydrog ? ? B DG  1   N2    ? ? ? 1_555 C DC  18 O2 ? ? D DG  802  E DC  918  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog3  hydrog ? ? B DG  1   O6    ? ? ? 1_555 C DC  18 N4 ? ? D DG  802  E DC  918  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog4  hydrog ? ? B DT  2   N3    ? ? ? 1_555 C DA  17 N1 ? ? D DT  803  E DA  917  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog5  hydrog ? ? B DT  2   O4    ? ? ? 1_555 C DA  17 N6 ? ? D DT  803  E DA  917  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog6  hydrog ? ? B DT  3   N3    ? ? ? 1_555 C DA  16 N1 ? ? D DT  804  E DA  916  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog7  hydrog ? ? B DT  3   O4    ? ? ? 1_555 C DA  16 N6 ? ? D DT  804  E DA  916  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog8  hydrog ? ? B DG  4   N1    ? ? ? 1_555 C DC  15 N3 ? ? D DG  805  E DC  915  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog9  hydrog ? ? B DG  4   N2    ? ? ? 1_555 C DC  15 O2 ? ? D DG  805  E DC  915  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog10 hydrog ? ? B DG  4   O6    ? ? ? 1_555 C DC  15 N4 ? ? D DG  805  E DC  915  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog11 hydrog ? ? B DG  5   N1    ? ? ? 1_555 C DC  14 N3 ? ? D DG  806  E DC  914  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog12 hydrog ? ? B DG  5   N2    ? ? ? 1_555 C DC  14 O2 ? ? D DG  806  E DC  914  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog13 hydrog ? ? B DG  5   O6    ? ? ? 1_555 C DC  14 N4 ? ? D DG  806  E DC  914  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog14 hydrog ? ? B DA  6   N1    ? ? ? 1_555 C DT  13 N3 ? ? D DA  807  E DT  913  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog15 hydrog ? ? B DA  6   N6    ? ? ? 1_555 C DT  13 O4 ? ? D DA  807  E DT  913  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog16 hydrog ? ? B DT  7   N3    ? ? ? 1_555 C DA  12 N1 ? ? D DT  808  E DA  912  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog17 hydrog ? ? B DT  7   O4    ? ? ? 1_555 C DA  12 N6 ? ? D DT  808  E DA  912  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog18 hydrog ? ? B DG  8   N1    ? ? ? 1_555 C DC  11 N3 ? ? D DG  809  E DC  911  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog19 hydrog ? ? B DG  8   N2    ? ? ? 1_555 C DC  11 O2 ? ? D DG  809  E DC  911  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog20 hydrog ? ? B DG  8   O6    ? ? ? 1_555 C DC  11 N4 ? ? D DG  809  E DC  911  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog21 hydrog ? ? B DG  9   N1    ? ? ? 1_555 C DC  10 N3 ? ? D DG  810  E DC  910  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog22 hydrog ? ? B DG  9   N2    ? ? ? 1_555 C DC  10 O2 ? ? D DG  810  E DC  910  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog23 hydrog ? ? B DG  9   O6    ? ? ? 1_555 C DC  10 N4 ? ? D DG  810  E DC  910  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog24 hydrog ? ? B DT  10  N3    ? ? ? 1_555 C DA  9  N1 ? ? D DT  811  E DA  909  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog25 hydrog ? ? B DT  10  O4    ? ? ? 1_555 C DA  9  N6 ? ? D DT  811  E DA  909  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog26 hydrog ? ? B DA  11  N1    ? ? ? 1_555 C DT  8  N3 ? ? D DA  812  E DT  908  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog27 hydrog ? ? B DA  11  N6    ? ? ? 1_555 C DT  8  O4 ? ? D DA  812  E DT  908  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog28 hydrog ? ? B DG  12  N1    ? ? ? 1_555 C DC  7  N3 ? ? D DG  813  E DC  907  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog29 hydrog ? ? B DG  12  N2    ? ? ? 1_555 C DC  7  O2 ? ? D DG  813  E DC  907  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog30 hydrog ? ? B DG  12  O6    ? ? ? 1_555 C DC  7  N4 ? ? D DG  813  E DC  907  1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog31 hydrog ? ? B 2DA 13  N6    A ? ? 1_555 C 8OG 6  O6 A ? D 2DA 814  E 8OG 906  1_555 ? ? ? ? ? ? TYPE_9_PAIR       ?     ? 
hydrog32 hydrog ? ? B 2DA 13  N7    A ? ? 1_555 C 8OG 6  N1 A ? D 2DA 814  E 8OG 906  1_555 ? ? ? ? ? ? TYPE_9_PAIR       ?     ? 
hydrog33 hydrog ? ? E DG  1   N1    ? ? ? 1_555 F DC  18 N3 ? ? H DG  1802 J DC  1918 1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog34 hydrog ? ? E DG  1   N2    ? ? ? 1_555 F DC  18 O2 ? ? H DG  1802 J DC  1918 1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog35 hydrog ? ? E DG  1   O6    ? ? ? 1_555 F DC  18 N4 ? ? H DG  1802 J DC  1918 1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog36 hydrog ? ? E DT  2   O4    ? ? ? 1_555 F DA  16 N6 ? ? H DT  1803 J DA  1916 1_555 ? ? ? ? ? ? 'DT-DA PAIR'      ?     ? 
hydrog37 hydrog ? ? E DT  2   N3    ? ? ? 1_555 F DA  17 N1 ? ? H DT  1803 J DA  1917 1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog38 hydrog ? ? E DT  2   O4    ? ? ? 1_555 F DA  17 N6 ? ? H DT  1803 J DA  1917 1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog39 hydrog ? ? E DT  3   N3    ? ? ? 1_555 F DA  16 N1 ? ? H DT  1804 J DA  1916 1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog40 hydrog ? ? E DT  3   O4    ? ? ? 1_555 F DA  16 N6 ? ? H DT  1804 J DA  1916 1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog41 hydrog ? ? E DG  4   N1    ? ? ? 1_555 F DC  15 N3 ? ? H DG  1805 J DC  1915 1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog42 hydrog ? ? E DG  4   N2    ? ? ? 1_555 F DC  15 O2 ? ? H DG  1805 J DC  1915 1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog43 hydrog ? ? E DG  4   O6    ? ? ? 1_555 F DC  15 N4 ? ? H DG  1805 J DC  1915 1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog44 hydrog ? ? E DG  5   N1    ? ? ? 1_555 F DC  14 N3 ? ? H DG  1806 J DC  1914 1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog45 hydrog ? ? E DG  5   N2    ? ? ? 1_555 F DC  14 O2 ? ? H DG  1806 J DC  1914 1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog46 hydrog ? ? E DG  5   O6    ? ? ? 1_555 F DC  14 N4 ? ? H DG  1806 J DC  1914 1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog47 hydrog ? ? E DG  5   N2    ? ? ? 1_555 F DC  15 O2 ? ? H DG  1806 J DC  1915 1_555 ? ? ? ? ? ? 'DG-DC PAIR'      ?     ? 
hydrog48 hydrog ? ? E DA  6   N1    ? ? ? 1_555 F DT  13 N3 ? ? H DA  1807 J DT  1913 1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog49 hydrog ? ? E DA  6   N6    ? ? ? 1_555 F DT  13 O4 ? ? H DA  1807 J DT  1913 1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog50 hydrog ? ? E DT  7   N3    ? ? ? 1_555 F DA  12 N1 ? ? H DT  1808 J DA  1912 1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog51 hydrog ? ? E DT  7   O4    ? ? ? 1_555 F DA  12 N6 ? ? H DT  1808 J DA  1912 1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog52 hydrog ? ? E DG  8   N1    ? ? ? 1_555 F DC  11 N3 ? ? H DG  1809 J DC  1911 1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog53 hydrog ? ? E DG  8   N2    ? ? ? 1_555 F DC  11 O2 ? ? H DG  1809 J DC  1911 1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog54 hydrog ? ? E DG  8   O6    ? ? ? 1_555 F DC  11 N4 ? ? H DG  1809 J DC  1911 1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog55 hydrog ? ? E DG  9   N1    ? ? ? 1_555 F DC  10 N3 ? ? H DG  1810 J DC  1910 1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog56 hydrog ? ? E DG  9   N2    ? ? ? 1_555 F DC  10 O2 ? ? H DG  1810 J DC  1910 1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog57 hydrog ? ? E DG  9   O6    ? ? ? 1_555 F DC  10 N4 ? ? H DG  1810 J DC  1910 1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog58 hydrog ? ? E DT  10  N3    ? ? ? 1_555 F DA  9  N1 ? ? H DT  1811 J DA  1909 1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog59 hydrog ? ? E DT  10  O4    ? ? ? 1_555 F DA  9  N6 ? ? H DT  1811 J DA  1909 1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog60 hydrog ? ? E DA  11  N1    ? ? ? 1_555 F DT  8  N3 ? ? H DA  1812 J DT  1908 1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog61 hydrog ? ? E DA  11  N6    ? ? ? 1_555 F DT  8  O4 ? ? H DA  1812 J DT  1908 1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog62 hydrog ? ? E DG  12  N1    ? ? ? 1_555 F DC  7  N3 ? ? H DG  1813 J DC  1907 1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog63 hydrog ? ? E DG  12  N2    ? ? ? 1_555 F DC  7  O2 ? ? H DG  1813 J DC  1907 1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog64 hydrog ? ? E DG  12  O6    ? ? ? 1_555 F DC  7  N4 ? ? H DG  1813 J DC  1907 1_555 ? ? ? ? ? ? WATSON-CRICK      ?     ? 
hydrog65 hydrog ? ? E 2DA 13  N6    ? ? ? 1_555 F 8OG 6  O6 ? ? H 2DA 1814 J 8OG 1906 1_555 ? ? ? ? ? ? '2DA-8OG MISPAIR' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LYS 
_struct_mon_prot_cis.label_seq_id           159 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LYS 
_struct_mon_prot_cis.auth_seq_id            159 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    160 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     160 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -1.04 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 4 ? 
D ? 5 ? 
E ? 3 ? 
F ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 99  ? SER A 103 ? ILE A 99   SER A 103  
A 2 GLU A 106 ? ASP A 110 ? GLU A 106  ASP A 110  
A 3 VAL A 3   ? PHE A 8   ? VAL A 3    PHE A 8    
A 4 VAL A 140 ? SER A 145 ? VAL A 140  SER A 145  
A 5 ILE A 163 ? VAL A 165 ? ILE A 163  VAL A 165  
B 1 GLY A 41  ? ALA A 46  ? GLY A 41   ALA A 46   
B 2 VAL A 28  ? PHE A 33  ? VAL A 28   PHE A 33   
B 3 VAL A 72  ? PRO A 75  ? VAL A 72   PRO A 75   
C 1 SER A 244 ? SER A 255 ? SER A 244  SER A 255  
C 2 ILE A 330 ? PHE A 340 ? ILE A 330  PHE A 340  
C 3 PRO A 281 ? THR A 290 ? PRO A 281  THR A 290  
C 4 ILE A 295 ? THR A 301 ? ILE A 295  THR A 301  
D 1 ILE D 99  ? SER D 103 ? ILE B 1099 SER B 1103 
D 2 GLU D 106 ? ILE D 111 ? GLU B 1106 ILE B 1111 
D 3 ILE D 2   ? PHE D 8   ? ILE B 1002 PHE B 1008 
D 4 VAL D 140 ? SER D 145 ? VAL B 1140 SER B 1145 
D 5 ILE D 163 ? VAL D 165 ? ILE B 1163 VAL B 1165 
E 1 GLY D 41  ? ALA D 46  ? GLY B 1041 ALA B 1046 
E 2 VAL D 28  ? PHE D 33  ? VAL B 1028 PHE B 1033 
E 3 VAL D 72  ? PRO D 75  ? VAL B 1072 PRO B 1075 
F 1 SER D 244 ? SER D 255 ? SER B 1244 SER B 1255 
F 2 ILE D 330 ? PHE D 340 ? ILE B 1330 PHE B 1340 
F 3 PRO D 281 ? THR D 290 ? PRO B 1281 THR B 1290 
F 4 ILE D 295 ? THR D 301 ? ILE B 1295 THR B 1301 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 100 ? N GLU A 100  O TYR A 108 ? O TYR A 108  
A 2 3 O LEU A 109 ? O LEU A 109  N LEU A 4   ? N LEU A 4    
A 3 4 N PHE A 5   ? N PHE A 5    O GLY A 143 ? O GLY A 143  
A 4 5 N ILE A 144 ? N ILE A 144  O LYS A 164 ? O LYS A 164  
B 1 2 O THR A 45  ? O THR A 45   N VAL A 30  ? N VAL A 30   
B 2 3 N VAL A 29  ? N VAL A 29   O VAL A 72  ? O VAL A 72   
C 1 2 N ILE A 245 ? N ILE A 245  O PHE A 337 ? O PHE A 337  
C 2 3 O ARG A 331 ? O ARG A 331  N VAL A 289 ? N VAL A 289  
C 3 4 N ALA A 288 ? N ALA A 288  O VAL A 296 ? O VAL A 296  
D 1 2 N GLU D 100 ? N GLU B 1100 O TYR D 108 ? O TYR B 1108 
D 2 3 O ALA D 107 ? O ALA B 1107 N VAL D 6   ? N VAL B 1006 
D 3 4 N VAL D 3   ? N VAL B 1003 O SER D 145 ? O SER B 1145 
D 4 5 N VAL D 142 ? N VAL B 1142 O LYS D 164 ? O LYS B 1164 
E 1 2 O THR D 45  ? O THR B 1045 N VAL D 30  ? N VAL B 1030 
E 2 3 N CYS D 31  ? N CYS B 1031 O LEU D 74  ? O LEU B 1074 
F 1 2 N ILE D 245 ? N ILE B 1245 O PHE D 337 ? O PHE B 1337 
F 2 3 O ARG D 332 ? O ARG B 1332 N VAL D 289 ? N VAL B 1289 
F 3 4 N ALA D 288 ? N ALA B 1288 O VAL D 296 ? O VAL B 1296 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE DGT A 414'  
AC2 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE CA A 415'   
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA A 416'   
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 417'   
AC5 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE DGT B 1414' 
AC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA B 1415'  
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA B 1416'  
AC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA B 1417'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 23 ASP A 7   ? ASP A 7    . ? 1_555 ? 
2  AC1 23 PHE A 8   ? PHE A 8    . ? 1_555 ? 
3  AC1 23 TYR A 10  ? TYR A 10   . ? 1_555 ? 
4  AC1 23 PHE A 11  ? PHE A 11   . ? 1_555 ? 
5  AC1 23 TYR A 12  ? TYR A 12   . ? 1_555 ? 
6  AC1 23 VAL A 32  ? VAL A 32   . ? 1_555 ? 
7  AC1 23 ALA A 44  ? ALA A 44   . ? 1_555 ? 
8  AC1 23 THR A 45  ? THR A 45   . ? 1_555 ? 
9  AC1 23 TYR A 48  ? TYR A 48   . ? 1_555 ? 
10 AC1 23 ARG A 51  ? ARG A 51   . ? 1_555 ? 
11 AC1 23 ASP A 105 ? ASP A 105  . ? 1_555 ? 
12 AC1 23 LYS A 159 ? LYS A 159  . ? 1_555 ? 
13 AC1 23 CA  H .   ? CA  A 415  . ? 1_555 ? 
14 AC1 23 CA  I .   ? CA  A 416  . ? 1_555 ? 
15 AC1 23 HOH O .   ? HOH A 501  . ? 1_555 ? 
16 AC1 23 HOH O .   ? HOH A 511  . ? 1_555 ? 
17 AC1 23 HOH O .   ? HOH A 640  . ? 1_555 ? 
18 AC1 23 HOH O .   ? HOH A 721  . ? 1_555 ? 
19 AC1 23 HOH O .   ? HOH A 731  . ? 1_555 ? 
20 AC1 23 HOH P .   ? HOH D 502  . ? 1_555 ? 
21 AC1 23 2DA B 13  ? 2DA D 814  . ? 1_555 ? 
22 AC1 23 DC  C 5   ? DC  E 905  . ? 1_555 ? 
23 AC1 23 8OG C 6   ? 8OG E 906  . ? 1_555 ? 
24 AC2 8  ASP A 7   ? ASP A 7    . ? 1_555 ? 
25 AC2 8  GLU A 106 ? GLU A 106  . ? 1_555 ? 
26 AC2 8  LYS A 159 ? LYS A 159  . ? 1_555 ? 
27 AC2 8  DGT G .   ? DGT A 414  . ? 1_555 ? 
28 AC2 8  HOH O .   ? HOH A 501  . ? 1_555 ? 
29 AC2 8  HOH P .   ? HOH D 502  . ? 1_555 ? 
30 AC2 8  HOH P .   ? HOH D 717  . ? 1_555 ? 
31 AC2 8  2DA B 13  ? 2DA D 814  . ? 1_555 ? 
32 AC3 4  ASP A 7   ? ASP A 7    . ? 1_555 ? 
33 AC3 4  PHE A 8   ? PHE A 8    . ? 1_555 ? 
34 AC3 4  ASP A 105 ? ASP A 105  . ? 1_555 ? 
35 AC3 4  DGT G .   ? DGT A 414  . ? 1_555 ? 
36 AC4 5  ALA A 181 ? ALA A 181  . ? 1_555 ? 
37 AC4 5  ILE A 186 ? ILE A 186  . ? 1_555 ? 
38 AC4 5  HOH O .   ? HOH A 512  . ? 1_555 ? 
39 AC4 5  HOH P .   ? HOH D 514  . ? 1_555 ? 
40 AC4 5  HOH P .   ? HOH D 516  . ? 1_555 ? 
41 AC5 19 HOH R .   ? HOH B 624  . ? 1_555 ? 
42 AC5 19 PHE D 8   ? PHE B 1008 . ? 1_555 ? 
43 AC5 19 ASP D 9   ? ASP B 1009 . ? 1_555 ? 
44 AC5 19 TYR D 10  ? TYR B 1010 . ? 1_555 ? 
45 AC5 19 PHE D 11  ? PHE B 1011 . ? 1_555 ? 
46 AC5 19 TYR D 12  ? TYR B 1012 . ? 1_555 ? 
47 AC5 19 VAL D 32  ? VAL B 1032 . ? 1_555 ? 
48 AC5 19 ALA D 44  ? ALA B 1044 . ? 1_555 ? 
49 AC5 19 THR D 45  ? THR B 1045 . ? 1_555 ? 
50 AC5 19 TYR D 48  ? TYR B 1048 . ? 1_555 ? 
51 AC5 19 ARG D 51  ? ARG B 1051 . ? 1_555 ? 
52 AC5 19 ALA D 57  ? ALA B 1057 . ? 1_555 ? 
53 AC5 19 ASP D 105 ? ASP B 1105 . ? 1_555 ? 
54 AC5 19 LYS D 159 ? LYS B 1159 . ? 1_555 ? 
55 AC5 19 CA  L .   ? CA  B 1415 . ? 1_555 ? 
56 AC5 19 CA  M .   ? CA  B 1416 . ? 1_555 ? 
57 AC5 19 2DA E 13  ? 2DA H 1814 . ? 1_555 ? 
58 AC5 19 DC  F 5   ? DC  J 1905 . ? 1_555 ? 
59 AC5 19 8OG F 6   ? 8OG J 1906 . ? 1_555 ? 
60 AC6 6  ASP D 7   ? ASP B 1007 . ? 1_555 ? 
61 AC6 6  GLU D 106 ? GLU B 1106 . ? 1_555 ? 
62 AC6 6  DGT K .   ? DGT B 1414 . ? 1_555 ? 
63 AC6 6  HOH R .   ? HOH B 1501 . ? 1_555 ? 
64 AC6 6  HOH R .   ? HOH B 1502 . ? 1_555 ? 
65 AC6 6  2DA E 13  ? 2DA H 1814 . ? 1_555 ? 
66 AC7 4  ASP D 7   ? ASP B 1007 . ? 1_555 ? 
67 AC7 4  PHE D 8   ? PHE B 1008 . ? 1_555 ? 
68 AC7 4  ASP D 105 ? ASP B 1105 . ? 1_555 ? 
69 AC7 4  DGT K .   ? DGT B 1414 . ? 1_555 ? 
70 AC8 6  ALA D 181 ? ALA B 1181 . ? 1_555 ? 
71 AC8 6  VAL D 183 ? VAL B 1183 . ? 1_555 ? 
72 AC8 6  ILE D 186 ? ILE B 1186 . ? 1_555 ? 
73 AC8 6  HOH R .   ? HOH B 1515 . ? 1_555 ? 
74 AC8 6  HOH R .   ? HOH B 1516 . ? 1_555 ? 
75 AC8 6  DG  E 12  ? DG  H 1813 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3GIJ 
_atom_sites.fract_transf_matrix[1][1]   0.019507 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003628 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009310 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010393 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 13.544  26.514  10.682  1.00 52.93  ? 1    GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 13.928  25.207  10.054  1.00 53.69  ? 1    GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 12.740  24.431  9.505   1.00 53.51  ? 1    GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 11.841  24.035  10.260  1.00 53.66  ? 1    GLY A O     1 
ATOM   5    N  N     . ILE A 1 2   ? 12.727  24.217  8.191   1.00 53.24  ? 2    ILE A N     1 
ATOM   6    C  CA    . ILE A 1 2   ? 11.570  23.600  7.543   1.00 52.92  ? 2    ILE A CA    1 
ATOM   7    C  C     . ILE A 1 2   ? 11.956  22.421  6.666   1.00 53.12  ? 2    ILE A C     1 
ATOM   8    O  O     . ILE A 1 2   ? 12.816  22.537  5.797   1.00 53.19  ? 2    ILE A O     1 
ATOM   9    C  CB    . ILE A 1 2   ? 10.773  24.626  6.724   1.00 53.01  ? 2    ILE A CB    1 
ATOM   10   C  CG1   . ILE A 1 2   ? 10.204  25.707  7.654   1.00 52.58  ? 2    ILE A CG1   1 
ATOM   11   C  CG2   . ILE A 1 2   ? 9.664   23.945  5.929   1.00 52.31  ? 2    ILE A CG2   1 
ATOM   12   C  CD1   . ILE A 1 2   ? 9.433   26.790  6.945   1.00 51.92  ? 2    ILE A CD1   1 
ATOM   13   N  N     . VAL A 1 3   ? 11.318  21.278  6.911   1.00 53.21  ? 3    VAL A N     1 
ATOM   14   C  CA    . VAL A 1 3   ? 11.598  20.082  6.150   1.00 53.06  ? 3    VAL A CA    1 
ATOM   15   C  C     . VAL A 1 3   ? 10.398  19.729  5.288   1.00 53.04  ? 3    VAL A C     1 
ATOM   16   O  O     . VAL A 1 3   ? 9.298   19.568  5.795   1.00 53.39  ? 3    VAL A O     1 
ATOM   17   C  CB    . VAL A 1 3   ? 11.940  18.910  7.079   1.00 53.32  ? 3    VAL A CB    1 
ATOM   18   C  CG1   . VAL A 1 3   ? 12.192  17.644  6.273   1.00 52.39  ? 3    VAL A CG1   1 
ATOM   19   C  CG2   . VAL A 1 3   ? 13.149  19.269  7.934   1.00 52.99  ? 3    VAL A CG2   1 
ATOM   20   N  N     . LEU A 1 4   ? 10.615  19.643  3.982   1.00 52.60  ? 4    LEU A N     1 
ATOM   21   C  CA    . LEU A 1 4   ? 9.585   19.199  3.080   1.00 52.40  ? 4    LEU A CA    1 
ATOM   22   C  C     . LEU A 1 4   ? 9.886   17.767  2.678   1.00 52.59  ? 4    LEU A C     1 
ATOM   23   O  O     . LEU A 1 4   ? 10.919  17.471  2.089   1.00 52.97  ? 4    LEU A O     1 
ATOM   24   C  CB    . LEU A 1 4   ? 9.513   20.114  1.857   1.00 52.62  ? 4    LEU A CB    1 
ATOM   25   C  CG    . LEU A 1 4   ? 8.394   19.895  0.837   1.00 51.83  ? 4    LEU A CG    1 
ATOM   26   C  CD1   . LEU A 1 4   ? 8.131   21.178  0.095   1.00 51.14  ? 4    LEU A CD1   1 
ATOM   27   C  CD2   . LEU A 1 4   ? 8.736   18.779  -0.152  1.00 50.68  ? 4    LEU A CD2   1 
ATOM   28   N  N     . PHE A 1 5   ? 8.977   16.872  3.020   1.00 52.57  ? 5    PHE A N     1 
ATOM   29   C  CA    . PHE A 1 5   ? 9.156   15.459  2.766   1.00 51.98  ? 5    PHE A CA    1 
ATOM   30   C  C     . PHE A 1 5   ? 8.269   15.107  1.584   1.00 52.59  ? 5    PHE A C     1 
ATOM   31   O  O     . PHE A 1 5   ? 7.113   15.500  1.541   1.00 52.78  ? 5    PHE A O     1 
ATOM   32   C  CB    . PHE A 1 5   ? 8.753   14.672  4.008   1.00 50.87  ? 5    PHE A CB    1 
ATOM   33   C  CG    . PHE A 1 5   ? 8.768   13.187  3.827   1.00 49.61  ? 5    PHE A CG    1 
ATOM   34   C  CD1   . PHE A 1 5   ? 9.963   12.503  3.662   1.00 49.44  ? 5    PHE A CD1   1 
ATOM   35   C  CD2   . PHE A 1 5   ? 7.586   12.464  3.850   1.00 47.63  ? 5    PHE A CD2   1 
ATOM   36   C  CE1   . PHE A 1 5   ? 9.976   11.122  3.513   1.00 49.51  ? 5    PHE A CE1   1 
ATOM   37   C  CE2   . PHE A 1 5   ? 7.585   11.087  3.697   1.00 45.39  ? 5    PHE A CE2   1 
ATOM   38   C  CZ    . PHE A 1 5   ? 8.774   10.413  3.529   1.00 48.28  ? 5    PHE A CZ    1 
ATOM   39   N  N     . VAL A 1 6   ? 8.825   14.388  0.615   1.00 53.27  ? 6    VAL A N     1 
ATOM   40   C  CA    . VAL A 1 6   ? 8.063   13.944  -0.526  1.00 53.44  ? 6    VAL A CA    1 
ATOM   41   C  C     . VAL A 1 6   ? 8.111   12.439  -0.533  1.00 53.56  ? 6    VAL A C     1 
ATOM   42   O  O     . VAL A 1 6   ? 9.174   11.860  -0.376  1.00 53.86  ? 6    VAL A O     1 
ATOM   43   C  CB    . VAL A 1 6   ? 8.645   14.472  -1.843  1.00 54.23  ? 6    VAL A CB    1 
ATOM   44   C  CG1   . VAL A 1 6   ? 7.776   14.007  -3.025  1.00 54.44  ? 6    VAL A CG1   1 
ATOM   45   C  CG2   . VAL A 1 6   ? 8.732   15.998  -1.819  1.00 52.50  ? 6    VAL A CG2   1 
ATOM   46   N  N     . ASP A 1 7   ? 6.946   11.815  -0.695  1.00 53.35  ? 7    ASP A N     1 
ATOM   47   C  CA    . ASP A 1 7   ? 6.806   10.362  -0.725  1.00 52.52  ? 7    ASP A CA    1 
ATOM   48   C  C     . ASP A 1 7   ? 5.956   10.141  -1.968  1.00 52.10  ? 7    ASP A C     1 
ATOM   49   O  O     . ASP A 1 7   ? 4.842   10.654  -2.068  1.00 52.16  ? 7    ASP A O     1 
ATOM   50   C  CB    . ASP A 1 7   ? 6.052   9.923   0.531   1.00 52.79  ? 7    ASP A CB    1 
ATOM   51   C  CG    . ASP A 1 7   ? 6.244   8.461   0.882   1.00 53.23  ? 7    ASP A CG    1 
ATOM   52   O  OD1   . ASP A 1 7   ? 6.388   7.618   -0.005  1.00 50.25  ? 7    ASP A OD1   1 
ATOM   53   O  OD2   . ASP A 1 7   ? 6.219   8.113   2.084   1.00 58.50  ? 7    ASP A OD2   1 
ATOM   54   N  N     . PHE A 1 8   ? 6.495   9.437   -2.949  1.00 51.24  ? 8    PHE A N     1 
ATOM   55   C  CA    . PHE A 1 8   ? 5.755   9.191   -4.172  1.00 50.32  ? 8    PHE A CA    1 
ATOM   56   C  C     . PHE A 1 8   ? 4.587   8.266   -3.913  1.00 50.29  ? 8    PHE A C     1 
ATOM   57   O  O     . PHE A 1 8   ? 4.710   7.299   -3.193  1.00 49.19  ? 8    PHE A O     1 
ATOM   58   C  CB    . PHE A 1 8   ? 6.677   8.613   -5.226  1.00 50.88  ? 8    PHE A CB    1 
ATOM   59   C  CG    . PHE A 1 8   ? 7.977   9.354   -5.357  1.00 49.83  ? 8    PHE A CG    1 
ATOM   60   C  CD1   . PHE A 1 8   ? 8.082   10.666  -4.938  1.00 51.14  ? 8    PHE A CD1   1 
ATOM   61   C  CD2   . PHE A 1 8   ? 9.074   8.753   -5.933  1.00 48.95  ? 8    PHE A CD2   1 
ATOM   62   C  CE1   . PHE A 1 8   ? 9.279   11.361  -5.075  1.00 51.64  ? 8    PHE A CE1   1 
ATOM   63   C  CE2   . PHE A 1 8   ? 10.265  9.444   -6.082  1.00 50.85  ? 8    PHE A CE2   1 
ATOM   64   C  CZ    . PHE A 1 8   ? 10.376  10.736  -5.634  1.00 50.59  ? 8    PHE A CZ    1 
ATOM   65   N  N     . ASP A 1 9   ? 3.440   8.558   -4.483  1.00 50.24  ? 9    ASP A N     1 
ATOM   66   C  CA    . ASP A 1 9   ? 2.262   7.773   -4.217  1.00 50.80  ? 9    ASP A CA    1 
ATOM   67   C  C     . ASP A 1 9   ? 2.362   6.426   -4.870  1.00 51.13  ? 9    ASP A C     1 
ATOM   68   O  O     . ASP A 1 9   ? 2.844   6.337   -5.995  1.00 51.75  ? 9    ASP A O     1 
ATOM   69   C  CB    . ASP A 1 9   ? 1.044   8.489   -4.783  1.00 50.79  ? 9    ASP A CB    1 
ATOM   70   C  CG    . ASP A 1 9   ? 0.706   9.701   -4.009  1.00 51.35  ? 9    ASP A CG    1 
ATOM   71   O  OD1   . ASP A 1 9   ? 1.033   9.738   -2.804  1.00 53.71  ? 9    ASP A OD1   1 
ATOM   72   O  OD2   . ASP A 1 9   ? 0.116   10.612  -4.590  1.00 53.25  ? 9    ASP A OD2   1 
ATOM   73   N  N     . TYR A 1 10  ? 1.863   5.398   -4.183  1.00 51.65  ? 10   TYR A N     1 
ATOM   74   C  CA    . TYR A 1 10  ? 1.922   4.001   -4.652  1.00 52.10  ? 10   TYR A CA    1 
ATOM   75   C  C     . TYR A 1 10  ? 2.990   3.802   -5.713  1.00 52.37  ? 10   TYR A C     1 
ATOM   76   O  O     . TYR A 1 10  ? 2.709   3.367   -6.818  1.00 52.88  ? 10   TYR A O     1 
ATOM   77   C  CB    . TYR A 1 10  ? 0.547   3.502   -5.125  1.00 51.83  ? 10   TYR A CB    1 
ATOM   78   C  CG    . TYR A 1 10  ? -0.125  4.324   -6.195  1.00 52.44  ? 10   TYR A CG    1 
ATOM   79   C  CD1   . TYR A 1 10  ? -0.278  3.820   -7.475  1.00 52.55  ? 10   TYR A CD1   1 
ATOM   80   C  CD2   . TYR A 1 10  ? -0.637  5.597   -5.924  1.00 53.52  ? 10   TYR A CD2   1 
ATOM   81   C  CE1   . TYR A 1 10  ? -0.903  4.548   -8.469  1.00 52.15  ? 10   TYR A CE1   1 
ATOM   82   C  CE2   . TYR A 1 10  ? -1.262  6.340   -6.918  1.00 53.53  ? 10   TYR A CE2   1 
ATOM   83   C  CZ    . TYR A 1 10  ? -1.392  5.798   -8.195  1.00 53.43  ? 10   TYR A CZ    1 
ATOM   84   O  OH    . TYR A 1 10  ? -1.996  6.504   -9.209  1.00 53.76  ? 10   TYR A OH    1 
ATOM   85   N  N     . PHE A 1 11  ? 4.231   4.091   -5.359  1.00 52.46  ? 11   PHE A N     1 
ATOM   86   C  CA    . PHE A 1 11  ? 5.227   4.370   -6.385  1.00 52.94  ? 11   PHE A CA    1 
ATOM   87   C  C     . PHE A 1 11  ? 5.290   3.401   -7.570  1.00 53.17  ? 11   PHE A C     1 
ATOM   88   O  O     . PHE A 1 11  ? 5.018   3.787   -8.700  1.00 53.94  ? 11   PHE A O     1 
ATOM   89   C  CB    . PHE A 1 11  ? 6.624   4.653   -5.783  1.00 52.67  ? 11   PHE A CB    1 
ATOM   90   C  CG    . PHE A 1 11  ? 7.599   5.161   -6.794  1.00 51.80  ? 11   PHE A CG    1 
ATOM   91   C  CD1   . PHE A 1 11  ? 7.229   6.170   -7.673  1.00 51.13  ? 11   PHE A CD1   1 
ATOM   92   C  CD2   . PHE A 1 11  ? 8.860   4.634   -6.886  1.00 50.10  ? 11   PHE A CD2   1 
ATOM   93   C  CE1   . PHE A 1 11  ? 8.110   6.628   -8.628  1.00 52.51  ? 11   PHE A CE1   1 
ATOM   94   C  CE2   . PHE A 1 11  ? 9.747   5.090   -7.853  1.00 50.94  ? 11   PHE A CE2   1 
ATOM   95   C  CZ    . PHE A 1 11  ? 9.379   6.070   -8.721  1.00 50.90  ? 11   PHE A CZ    1 
ATOM   96   N  N     . TYR A 1 12  ? 5.642   2.147   -7.318  1.00 53.28  ? 12   TYR A N     1 
ATOM   97   C  CA    . TYR A 1 12  ? 5.871   1.185   -8.386  1.00 53.22  ? 12   TYR A CA    1 
ATOM   98   C  C     . TYR A 1 12  ? 4.695   1.031   -9.325  1.00 53.76  ? 12   TYR A C     1 
ATOM   99   O  O     . TYR A 1 12  ? 4.868   1.004   -10.547 1.00 54.44  ? 12   TYR A O     1 
ATOM   100  C  CB    . TYR A 1 12  ? 6.179   -0.164  -7.788  1.00 52.96  ? 12   TYR A CB    1 
ATOM   101  C  CG    . TYR A 1 12  ? 7.502   -0.217  -7.115  1.00 53.04  ? 12   TYR A CG    1 
ATOM   102  C  CD1   . TYR A 1 12  ? 8.233   0.942   -6.874  1.00 52.09  ? 12   TYR A CD1   1 
ATOM   103  C  CD2   . TYR A 1 12  ? 8.023   -1.427  -6.695  1.00 52.94  ? 12   TYR A CD2   1 
ATOM   104  C  CE1   . TYR A 1 12  ? 9.456   0.885   -6.252  1.00 52.41  ? 12   TYR A CE1   1 
ATOM   105  C  CE2   . TYR A 1 12  ? 9.238   -1.491  -6.079  1.00 53.29  ? 12   TYR A CE2   1 
ATOM   106  C  CZ    . TYR A 1 12  ? 9.951   -0.335  -5.850  1.00 52.88  ? 12   TYR A CZ    1 
ATOM   107  O  OH    . TYR A 1 12  ? 11.168  -0.432  -5.226  1.00 53.42  ? 12   TYR A OH    1 
ATOM   108  N  N     . ALA A 1 13  ? 3.508   0.902   -8.741  1.00 53.74  ? 13   ALA A N     1 
ATOM   109  C  CA    . ALA A 1 13  ? 2.257   0.728   -9.485  1.00 53.59  ? 13   ALA A CA    1 
ATOM   110  C  C     . ALA A 1 13  ? 1.885   2.002   -10.216 1.00 53.59  ? 13   ALA A C     1 
ATOM   111  O  O     . ALA A 1 13  ? 1.265   1.973   -11.286 1.00 54.10  ? 13   ALA A O     1 
ATOM   112  C  CB    . ALA A 1 13  ? 1.117   0.323   -8.517  1.00 52.87  ? 13   ALA A CB    1 
ATOM   113  N  N     . GLN A 1 14  ? 2.231   3.138   -9.630  1.00 53.19  ? 14   GLN A N     1 
ATOM   114  C  CA    . GLN A 1 14  ? 1.972   4.369   -10.317 1.00 53.07  ? 14   GLN A CA    1 
ATOM   115  C  C     . GLN A 1 14  ? 2.854   4.515   -11.540 1.00 53.11  ? 14   GLN A C     1 
ATOM   116  O  O     . GLN A 1 14  ? 2.396   4.957   -12.587 1.00 53.19  ? 14   GLN A O     1 
ATOM   117  C  CB    . GLN A 1 14  ? 2.151   5.567   -9.421  1.00 52.82  ? 14   GLN A CB    1 
ATOM   118  C  CG    . GLN A 1 14  ? 1.525   6.761   -10.079 1.00 54.09  ? 14   GLN A CG    1 
ATOM   119  C  CD    . GLN A 1 14  ? 1.676   8.009   -9.301  1.00 53.14  ? 14   GLN A CD    1 
ATOM   120  O  OE1   . GLN A 1 14  ? 2.256   8.015   -8.214  1.00 57.26  ? 14   GLN A OE1   1 
ATOM   121  N  NE2   . GLN A 1 14  ? 1.154   9.078   -9.835  1.00 50.60  ? 14   GLN A NE2   1 
ATOM   122  N  N     . VAL A 1 15  ? 4.120   4.143   -11.405 1.00 53.56  ? 15   VAL A N     1 
ATOM   123  C  CA    . VAL A 1 15  ? 5.039   4.188   -12.532 1.00 53.79  ? 15   VAL A CA    1 
ATOM   124  C  C     . VAL A 1 15  ? 4.508   3.283   -13.625 1.00 54.24  ? 15   VAL A C     1 
ATOM   125  O  O     . VAL A 1 15  ? 4.457   3.673   -14.791 1.00 54.55  ? 15   VAL A O     1 
ATOM   126  C  CB    . VAL A 1 15  ? 6.464   3.769   -12.134 1.00 53.86  ? 15   VAL A CB    1 
ATOM   127  C  CG1   . VAL A 1 15  ? 7.381   3.831   -13.331 1.00 54.05  ? 15   VAL A CG1   1 
ATOM   128  C  CG2   . VAL A 1 15  ? 6.978   4.657   -11.054 1.00 51.25  ? 15   VAL A CG2   1 
ATOM   129  N  N     . GLU A 1 16  ? 4.082   2.090   -13.231 1.00 54.47  ? 16   GLU A N     1 
ATOM   130  C  CA    . GLU A 1 16  ? 3.431   1.163   -14.136 1.00 55.13  ? 16   GLU A CA    1 
ATOM   131  C  C     . GLU A 1 16  ? 2.210   1.770   -14.817 1.00 55.69  ? 16   GLU A C     1 
ATOM   132  O  O     . GLU A 1 16  ? 1.973   1.539   -16.004 1.00 55.79  ? 16   GLU A O     1 
ATOM   133  C  CB    . GLU A 1 16  ? 3.021   -0.108  -13.399 1.00 55.19  ? 16   GLU A CB    1 
ATOM   134  C  CG    . GLU A 1 16  ? 4.182   -0.951  -12.938 1.00 55.31  ? 16   GLU A CG    1 
ATOM   135  C  CD    . GLU A 1 16  ? 5.117   -1.342  -14.062 1.00 57.05  ? 16   GLU A CD    1 
ATOM   136  O  OE1   . GLU A 1 16  ? 4.774   -1.170  -15.243 1.00 58.15  ? 16   GLU A OE1   1 
ATOM   137  O  OE2   . GLU A 1 16  ? 6.206   -1.847  -13.763 1.00 59.40  ? 16   GLU A OE2   1 
ATOM   138  N  N     . GLU A 1 17  ? 1.439   2.542   -14.061 1.00 56.50  ? 17   GLU A N     1 
ATOM   139  C  CA    . GLU A 1 17  ? 0.260   3.227   -14.593 1.00 56.98  ? 17   GLU A CA    1 
ATOM   140  C  C     . GLU A 1 17  ? 0.619   4.372   -15.514 1.00 56.82  ? 17   GLU A C     1 
ATOM   141  O  O     . GLU A 1 17  ? -0.151  4.742   -16.394 1.00 57.15  ? 17   GLU A O     1 
ATOM   142  C  CB    . GLU A 1 17  ? -0.537  3.848   -13.459 1.00 57.31  ? 17   GLU A CB    1 
ATOM   143  C  CG    . GLU A 1 17  ? -1.354  2.905   -12.636 1.00 58.41  ? 17   GLU A CG    1 
ATOM   144  C  CD    . GLU A 1 17  ? -2.189  3.679   -11.658 1.00 59.16  ? 17   GLU A CD    1 
ATOM   145  O  OE1   . GLU A 1 17  ? -1.968  4.908   -11.539 1.00 59.62  ? 17   GLU A OE1   1 
ATOM   146  O  OE2   . GLU A 1 17  ? -3.062  3.074   -11.015 1.00 61.36  ? 17   GLU A OE2   1 
ATOM   147  N  N     . VAL A 1 18  ? 1.754   4.996   -15.251 1.00 56.67  ? 18   VAL A N     1 
ATOM   148  C  CA    . VAL A 1 18  ? 2.172   6.110   -16.056 1.00 56.46  ? 18   VAL A CA    1 
ATOM   149  C  C     . VAL A 1 18  ? 2.707   5.540   -17.356 1.00 56.78  ? 18   VAL A C     1 
ATOM   150  O  O     . VAL A 1 18  ? 2.421   6.062   -18.416 1.00 57.37  ? 18   VAL A O     1 
ATOM   151  C  CB    . VAL A 1 18  ? 3.212   6.969   -15.330 1.00 56.20  ? 18   VAL A CB    1 
ATOM   152  C  CG1   . VAL A 1 18  ? 3.922   7.875   -16.303 1.00 56.85  ? 18   VAL A CG1   1 
ATOM   153  C  CG2   . VAL A 1 18  ? 2.529   7.800   -14.244 1.00 56.41  ? 18   VAL A CG2   1 
ATOM   154  N  N     . LEU A 1 19  ? 3.444   4.437   -17.269 1.00 56.90  ? 19   LEU A N     1 
ATOM   155  C  CA    . LEU A 1 19  ? 3.930   3.743   -18.451 1.00 56.75  ? 19   LEU A CA    1 
ATOM   156  C  C     . LEU A 1 19  ? 2.784   3.184   -19.264 1.00 56.91  ? 19   LEU A C     1 
ATOM   157  O  O     . LEU A 1 19  ? 2.829   3.170   -20.489 1.00 57.48  ? 19   LEU A O     1 
ATOM   158  C  CB    . LEU A 1 19  ? 4.884   2.625   -18.065 1.00 56.68  ? 19   LEU A CB    1 
ATOM   159  C  CG    . LEU A 1 19  ? 6.357   3.023   -18.066 1.00 55.99  ? 19   LEU A CG    1 
ATOM   160  C  CD1   . LEU A 1 19  ? 6.515   4.479   -17.766 1.00 56.86  ? 19   LEU A CD1   1 
ATOM   161  C  CD2   . LEU A 1 19  ? 7.122   2.188   -17.080 1.00 55.97  ? 19   LEU A CD2   1 
ATOM   162  N  N     . ASN A 1 20  ? 1.749   2.728   -18.576 1.00 56.76  ? 20   ASN A N     1 
ATOM   163  C  CA    . ASN A 1 20  ? 0.603   2.159   -19.227 1.00 55.89  ? 20   ASN A CA    1 
ATOM   164  C  C     . ASN A 1 20  ? -0.622  2.769   -18.611 1.00 55.97  ? 20   ASN A C     1 
ATOM   165  O  O     . ASN A 1 20  ? -1.214  2.198   -17.703 1.00 55.92  ? 20   ASN A O     1 
ATOM   166  C  CB    . ASN A 1 20  ? 0.613   0.644   -19.045 1.00 56.11  ? 20   ASN A CB    1 
ATOM   167  C  CG    . ASN A 1 20  ? -0.526  -0.047  -19.770 1.00 56.14  ? 20   ASN A CG    1 
ATOM   168  O  OD1   . ASN A 1 20  ? -1.326  0.585   -20.464 1.00 56.16  ? 20   ASN A OD1   1 
ATOM   169  N  ND2   . ASN A 1 20  ? -0.601  -1.360  -19.614 1.00 56.18  ? 20   ASN A ND2   1 
ATOM   170  N  N     . PRO A 1 21  ? -1.010  3.951   -19.104 1.00 56.33  ? 21   PRO A N     1 
ATOM   171  C  CA    . PRO A 1 21  ? -2.125  4.735   -18.581 1.00 56.47  ? 21   PRO A CA    1 
ATOM   172  C  C     . PRO A 1 21  ? -3.491  4.074   -18.705 1.00 56.81  ? 21   PRO A C     1 
ATOM   173  O  O     . PRO A 1 21  ? -4.458  4.563   -18.123 1.00 56.74  ? 21   PRO A O     1 
ATOM   174  C  CB    . PRO A 1 21  ? -2.070  6.019   -19.417 1.00 56.24  ? 21   PRO A CB    1 
ATOM   175  C  CG    . PRO A 1 21  ? -0.669  6.077   -19.916 1.00 56.11  ? 21   PRO A CG    1 
ATOM   176  C  CD    . PRO A 1 21  ? -0.351  4.649   -20.217 1.00 56.25  ? 21   PRO A CD    1 
ATOM   177  N  N     . SER A 1 22  ? -3.575  2.970   -19.437 1.00 57.53  ? 22   SER A N     1 
ATOM   178  C  CA    . SER A 1 22  ? -4.822  2.220   -19.515 1.00 58.50  ? 22   SER A CA    1 
ATOM   179  C  C     . SER A 1 22  ? -5.050  1.522   -18.183 1.00 58.99  ? 22   SER A C     1 
ATOM   180  O  O     . SER A 1 22  ? -6.127  0.996   -17.917 1.00 59.55  ? 22   SER A O     1 
ATOM   181  C  CB    . SER A 1 22  ? -4.771  1.195   -20.646 1.00 58.37  ? 22   SER A CB    1 
ATOM   182  O  OG    . SER A 1 22  ? -3.774  0.219   -20.400 1.00 59.54  ? 22   SER A OG    1 
ATOM   183  N  N     . LEU A 1 23  ? -4.016  1.541   -17.350 1.00 59.67  ? 23   LEU A N     1 
ATOM   184  C  CA    . LEU A 1 23  ? -4.017  0.914   -16.045 1.00 60.03  ? 23   LEU A CA    1 
ATOM   185  C  C     . LEU A 1 23  ? -4.652  1.808   -14.997 1.00 60.27  ? 23   LEU A C     1 
ATOM   186  O  O     . LEU A 1 23  ? -5.318  1.321   -14.091 1.00 60.13  ? 23   LEU A O     1 
ATOM   187  C  CB    . LEU A 1 23  ? -2.579  0.594   -15.631 1.00 60.28  ? 23   LEU A CB    1 
ATOM   188  C  CG    . LEU A 1 23  ? -2.070  -0.841  -15.776 1.00 60.62  ? 23   LEU A CG    1 
ATOM   189  C  CD1   . LEU A 1 23  ? -2.768  -1.612  -16.909 1.00 59.32  ? 23   LEU A CD1   1 
ATOM   190  C  CD2   . LEU A 1 23  ? -0.553  -0.840  -15.942 1.00 60.67  ? 23   LEU A CD2   1 
ATOM   191  N  N     . LYS A 1 24  ? -4.438  3.115   -15.114 1.00 60.78  ? 24   LYS A N     1 
ATOM   192  C  CA    . LYS A 1 24  ? -4.979  4.055   -14.142 1.00 61.19  ? 24   LYS A CA    1 
ATOM   193  C  C     . LYS A 1 24  ? -6.462  3.744   -13.999 1.00 61.02  ? 24   LYS A C     1 
ATOM   194  O  O     . LYS A 1 24  ? -7.147  3.504   -14.989 1.00 61.37  ? 24   LYS A O     1 
ATOM   195  C  CB    . LYS A 1 24  ? -4.731  5.502   -14.593 1.00 61.43  ? 24   LYS A CB    1 
ATOM   196  C  CG    . LYS A 1 24  ? -5.379  6.585   -13.727 1.00 63.83  ? 24   LYS A CG    1 
ATOM   197  C  CD    . LYS A 1 24  ? -4.351  7.500   -13.057 1.00 68.39  ? 24   LYS A CD    1 
ATOM   198  C  CE    . LYS A 1 24  ? -4.910  8.159   -11.778 1.00 70.04  ? 24   LYS A CE    1 
ATOM   199  N  NZ    . LYS A 1 24  ? -5.039  7.195   -10.607 1.00 69.91  ? 24   LYS A NZ    1 
ATOM   200  N  N     . GLY A 1 25  ? -6.957  3.707   -12.767 1.00 60.99  ? 25   GLY A N     1 
ATOM   201  C  CA    . GLY A 1 25  ? -8.381  3.479   -12.538 1.00 60.67  ? 25   GLY A CA    1 
ATOM   202  C  C     . GLY A 1 25  ? -8.744  2.049   -12.185 1.00 60.77  ? 25   GLY A C     1 
ATOM   203  O  O     . GLY A 1 25  ? -9.792  1.798   -11.598 1.00 60.92  ? 25   GLY A O     1 
ATOM   204  N  N     . LYS A 1 26  ? -7.887  1.099   -12.539 1.00 60.74  ? 26   LYS A N     1 
ATOM   205  C  CA    . LYS A 1 26  ? -8.107  -0.282  -12.127 1.00 60.53  ? 26   LYS A CA    1 
ATOM   206  C  C     . LYS A 1 26  ? -6.970  -0.771  -11.220 1.00 59.86  ? 26   LYS A C     1 
ATOM   207  O  O     . LYS A 1 26  ? -5.914  -0.128  -11.129 1.00 59.53  ? 26   LYS A O     1 
ATOM   208  C  CB    . LYS A 1 26  ? -8.318  -1.194  -13.344 1.00 61.26  ? 26   LYS A CB    1 
ATOM   209  C  CG    . LYS A 1 26  ? -7.043  -1.633  -14.055 1.00 63.20  ? 26   LYS A CG    1 
ATOM   210  C  CD    . LYS A 1 26  ? -7.358  -2.608  -15.213 1.00 67.45  ? 26   LYS A CD    1 
ATOM   211  C  CE    . LYS A 1 26  ? -7.720  -4.011  -14.704 1.00 68.26  ? 26   LYS A CE    1 
ATOM   212  N  NZ    . LYS A 1 26  ? -7.928  -4.972  -15.825 1.00 69.56  ? 26   LYS A NZ    1 
ATOM   213  N  N     . PRO A 1 27  ? -7.197  -1.886  -10.504 1.00 58.99  ? 27   PRO A N     1 
ATOM   214  C  CA    . PRO A 1 27  ? -6.164  -2.402  -9.607  1.00 57.98  ? 27   PRO A CA    1 
ATOM   215  C  C     . PRO A 1 27  ? -4.905  -2.856  -10.323 1.00 57.04  ? 27   PRO A C     1 
ATOM   216  O  O     . PRO A 1 27  ? -4.965  -3.632  -11.275 1.00 57.12  ? 27   PRO A O     1 
ATOM   217  C  CB    . PRO A 1 27  ? -6.841  -3.593  -8.927  1.00 57.65  ? 27   PRO A CB    1 
ATOM   218  C  CG    . PRO A 1 27  ? -8.300  -3.364  -9.108  1.00 58.27  ? 27   PRO A CG    1 
ATOM   219  C  CD    . PRO A 1 27  ? -8.425  -2.694  -10.439 1.00 58.92  ? 27   PRO A CD    1 
ATOM   220  N  N     . VAL A 1 28  ? -3.773  -2.368  -9.836  1.00 55.50  ? 28   VAL A N     1 
ATOM   221  C  CA    . VAL A 1 28  ? -2.481  -2.754  -10.326 1.00 54.45  ? 28   VAL A CA    1 
ATOM   222  C  C     . VAL A 1 28  ? -1.719  -3.279  -9.136  1.00 54.29  ? 28   VAL A C     1 
ATOM   223  O  O     . VAL A 1 28  ? -1.602  -2.622  -8.109  1.00 53.84  ? 28   VAL A O     1 
ATOM   224  C  CB    . VAL A 1 28  ? -1.708  -1.561  -10.918 1.00 54.44  ? 28   VAL A CB    1 
ATOM   225  C  CG1   . VAL A 1 28  ? -0.301  -1.971  -11.299 1.00 53.17  ? 28   VAL A CG1   1 
ATOM   226  C  CG2   . VAL A 1 28  ? -2.453  -0.991  -12.126 1.00 54.37  ? 28   VAL A CG2   1 
ATOM   227  N  N     . VAL A 1 29  ? -1.217  -4.492  -9.272  1.00 54.14  ? 29   VAL A N     1 
ATOM   228  C  CA    . VAL A 1 29  ? -0.405  -5.068  -8.242  1.00 53.42  ? 29   VAL A CA    1 
ATOM   229  C  C     . VAL A 1 29  ? 0.922   -5.277  -8.881  1.00 53.23  ? 29   VAL A C     1 
ATOM   230  O  O     . VAL A 1 29  ? 1.038   -5.943  -9.906  1.00 52.91  ? 29   VAL A O     1 
ATOM   231  C  CB    . VAL A 1 29  ? -0.953  -6.406  -7.766  1.00 53.01  ? 29   VAL A CB    1 
ATOM   232  C  CG1   . VAL A 1 29  ? -0.144  -6.900  -6.590  1.00 52.77  ? 29   VAL A CG1   1 
ATOM   233  C  CG2   . VAL A 1 29  ? -2.384  -6.254  -7.380  1.00 52.85  ? 29   VAL A CG2   1 
ATOM   234  N  N     . VAL A 1 30  ? 1.922   -4.663  -8.282  1.00 53.52  ? 30   VAL A N     1 
ATOM   235  C  CA    . VAL A 1 30  ? 3.274   -4.823  -8.723  1.00 53.88  ? 30   VAL A CA    1 
ATOM   236  C  C     . VAL A 1 30  ? 3.860   -5.928  -7.854  1.00 54.45  ? 30   VAL A C     1 
ATOM   237  O  O     . VAL A 1 30  ? 3.865   -5.837  -6.621  1.00 53.56  ? 30   VAL A O     1 
ATOM   238  C  CB    . VAL A 1 30  ? 4.041   -3.499  -8.601  1.00 53.64  ? 30   VAL A CB    1 
ATOM   239  C  CG1   . VAL A 1 30  ? 5.540   -3.726  -8.801  1.00 53.97  ? 30   VAL A CG1   1 
ATOM   240  C  CG2   . VAL A 1 30  ? 3.490   -2.516  -9.605  1.00 53.13  ? 30   VAL A CG2   1 
ATOM   241  N  N     . CYS A 1 31  ? 4.308   -6.986  -8.512  1.00 55.21  ? 31   CYS A N     1 
ATOM   242  C  CA    . CYS A 1 31  ? 4.689   -8.191  -7.824  1.00 57.05  ? 31   CYS A CA    1 
ATOM   243  C  C     . CYS A 1 31  ? 6.140   -8.531  -8.001  1.00 57.69  ? 31   CYS A C     1 
ATOM   244  O  O     . CYS A 1 31  ? 6.722   -8.349  -9.070  1.00 57.39  ? 31   CYS A O     1 
ATOM   245  C  CB    . CYS A 1 31  ? 3.906   -9.386  -8.361  1.00 57.30  ? 31   CYS A CB    1 
ATOM   246  S  SG    . CYS A 1 31  ? 2.175   -9.166  -8.412  1.00 59.14  ? 31   CYS A SG    1 
ATOM   247  N  N     . VAL A 1 32  ? 6.689   -9.093  -6.939  1.00 58.92  ? 32   VAL A N     1 
ATOM   248  C  CA    . VAL A 1 32  ? 7.991   -9.706  -6.971  1.00 59.90  ? 32   VAL A CA    1 
ATOM   249  C  C     . VAL A 1 32  ? 7.763   -11.207 -6.975  1.00 60.58  ? 32   VAL A C     1 
ATOM   250  O  O     . VAL A 1 32  ? 7.528   -11.808 -5.933  1.00 60.52  ? 32   VAL A O     1 
ATOM   251  C  CB    . VAL A 1 32  ? 8.786   -9.329  -5.715  1.00 59.87  ? 32   VAL A CB    1 
ATOM   252  C  CG1   . VAL A 1 32  ? 10.234  -9.685  -5.884  1.00 59.88  ? 32   VAL A CG1   1 
ATOM   253  C  CG2   . VAL A 1 32  ? 8.595   -7.853  -5.397  1.00 58.92  ? 32   VAL A CG2   1 
ATOM   254  N  N     . PHE A 1 33  ? 7.821   -11.798 -8.160  1.00 61.63  ? 33   PHE A N     1 
ATOM   255  C  CA    . PHE A 1 33  ? 7.670   -13.228 -8.332  1.00 62.19  ? 33   PHE A CA    1 
ATOM   256  C  C     . PHE A 1 33  ? 8.930   -13.965 -7.897  1.00 62.85  ? 33   PHE A C     1 
ATOM   257  O  O     . PHE A 1 33  ? 9.997   -13.732 -8.457  1.00 63.67  ? 33   PHE A O     1 
ATOM   258  C  CB    . PHE A 1 33  ? 7.385   -13.525 -9.798  1.00 62.10  ? 33   PHE A CB    1 
ATOM   259  C  CG    . PHE A 1 33  ? 6.141   -12.864 -10.313 1.00 62.41  ? 33   PHE A CG    1 
ATOM   260  C  CD1   . PHE A 1 33  ? 4.892   -13.427 -10.079 1.00 62.73  ? 33   PHE A CD1   1 
ATOM   261  C  CD2   . PHE A 1 33  ? 6.215   -11.684 -11.036 1.00 61.69  ? 33   PHE A CD2   1 
ATOM   262  C  CE1   . PHE A 1 33  ? 3.729   -12.820 -10.554 1.00 62.21  ? 33   PHE A CE1   1 
ATOM   263  C  CE2   . PHE A 1 33  ? 5.070   -11.074 -11.514 1.00 61.90  ? 33   PHE A CE2   1 
ATOM   264  C  CZ    . PHE A 1 33  ? 3.819   -11.647 -11.274 1.00 62.58  ? 33   PHE A CZ    1 
ATOM   265  N  N     . SER A 1 34  ? 8.815   -14.854 -6.908  1.00 63.02  ? 34   SER A N     1 
ATOM   266  C  CA    . SER A 1 34  ? 9.993   -15.549 -6.389  1.00 63.02  ? 34   SER A CA    1 
ATOM   267  C  C     . SER A 1 34  ? 10.467  -16.658 -7.328  1.00 62.85  ? 34   SER A C     1 
ATOM   268  O  O     . SER A 1 34  ? 11.647  -16.978 -7.357  1.00 62.97  ? 34   SER A O     1 
ATOM   269  C  CB    . SER A 1 34  ? 9.775   -16.069 -4.960  1.00 63.03  ? 34   SER A CB    1 
ATOM   270  O  OG    . SER A 1 34  ? 8.583   -16.841 -4.845  1.00 63.38  ? 34   SER A OG    1 
ATOM   271  N  N     . GLY A 1 35  ? 9.554   -17.224 -8.112  1.00 62.75  ? 35   GLY A N     1 
ATOM   272  C  CA    . GLY A 1 35  ? 9.925   -18.256 -9.083  1.00 61.99  ? 35   GLY A CA    1 
ATOM   273  C  C     . GLY A 1 35  ? 9.659   -19.690 -8.656  1.00 61.98  ? 35   GLY A C     1 
ATOM   274  O  O     . GLY A 1 35  ? 9.627   -20.596 -9.496  1.00 62.09  ? 35   GLY A O     1 
ATOM   275  N  N     . ARG A 1 36  ? 9.463   -19.912 -7.358  1.00 61.61  ? 36   ARG A N     1 
ATOM   276  C  CA    . ARG A 1 36  ? 9.262   -21.269 -6.833  1.00 61.11  ? 36   ARG A CA    1 
ATOM   277  C  C     . ARG A 1 36  ? 8.120   -22.042 -7.478  1.00 61.28  ? 36   ARG A C     1 
ATOM   278  O  O     . ARG A 1 36  ? 8.214   -23.249 -7.702  1.00 61.94  ? 36   ARG A O     1 
ATOM   279  C  CB    . ARG A 1 36  ? 8.994   -21.233 -5.345  1.00 60.91  ? 36   ARG A CB    1 
ATOM   280  C  CG    . ARG A 1 36  ? 9.691   -20.155 -4.594  1.00 59.29  ? 36   ARG A CG    1 
ATOM   281  C  CD    . ARG A 1 36  ? 9.635   -20.542 -3.148  1.00 58.33  ? 36   ARG A CD    1 
ATOM   282  N  NE    . ARG A 1 36  ? 10.818  -21.300 -2.773  1.00 58.07  ? 36   ARG A NE    1 
ATOM   283  C  CZ    . ARG A 1 36  ? 10.854  -22.238 -1.838  1.00 56.93  ? 36   ARG A CZ    1 
ATOM   284  N  NH1   . ARG A 1 36  ? 9.758   -22.584 -1.181  1.00 56.19  ? 36   ARG A NH1   1 
ATOM   285  N  NH2   . ARG A 1 36  ? 12.003  -22.829 -1.562  1.00 57.78  ? 36   ARG A NH2   1 
ATOM   286  N  N     . PHE A 1 37  ? 7.020   -21.356 -7.734  1.00 61.34  ? 37   PHE A N     1 
ATOM   287  C  CA    . PHE A 1 37  ? 5.874   -21.982 -8.356  1.00 60.82  ? 37   PHE A CA    1 
ATOM   288  C  C     . PHE A 1 37  ? 5.058   -20.895 -9.018  1.00 61.32  ? 37   PHE A C     1 
ATOM   289  O  O     . PHE A 1 37  ? 5.406   -19.720 -8.936  1.00 61.06  ? 37   PHE A O     1 
ATOM   290  C  CB    . PHE A 1 37  ? 5.022   -22.713 -7.314  1.00 60.54  ? 37   PHE A CB    1 
ATOM   291  C  CG    . PHE A 1 37  ? 4.662   -21.872 -6.121  1.00 58.43  ? 37   PHE A CG    1 
ATOM   292  C  CD1   . PHE A 1 37  ? 3.484   -21.145 -6.100  1.00 56.80  ? 37   PHE A CD1   1 
ATOM   293  C  CD2   . PHE A 1 37  ? 5.497   -21.817 -5.018  1.00 57.30  ? 37   PHE A CD2   1 
ATOM   294  C  CE1   . PHE A 1 37  ? 3.146   -20.371 -5.007  1.00 55.43  ? 37   PHE A CE1   1 
ATOM   295  C  CE2   . PHE A 1 37  ? 5.165   -21.044 -3.924  1.00 56.80  ? 37   PHE A CE2   1 
ATOM   296  C  CZ    . PHE A 1 37  ? 3.981   -20.320 -3.922  1.00 55.51  ? 37   PHE A CZ    1 
ATOM   297  N  N     . GLU A 1 38  ? 3.971   -21.294 -9.668  1.00 61.88  ? 38   GLU A N     1 
ATOM   298  C  CA    . GLU A 1 38  ? 3.059   -20.344 -10.279 1.00 62.57  ? 38   GLU A CA    1 
ATOM   299  C  C     . GLU A 1 38  ? 2.697   -19.246 -9.283  1.00 62.54  ? 38   GLU A C     1 
ATOM   300  O  O     . GLU A 1 38  ? 2.173   -19.528 -8.205  1.00 62.73  ? 38   GLU A O     1 
ATOM   301  C  CB    . GLU A 1 38  ? 1.797   -21.059 -10.748 1.00 62.72  ? 38   GLU A CB    1 
ATOM   302  C  CG    . GLU A 1 38  ? 0.952   -20.246 -11.698 1.00 64.54  ? 38   GLU A CG    1 
ATOM   303  C  CD    . GLU A 1 38  ? -0.431  -20.831 -11.893 1.00 66.11  ? 38   GLU A CD    1 
ATOM   304  O  OE1   . GLU A 1 38  ? -1.248  -20.190 -12.587 1.00 67.43  ? 38   GLU A OE1   1 
ATOM   305  O  OE2   . GLU A 1 38  ? -0.703  -21.924 -11.349 1.00 66.91  ? 38   GLU A OE2   1 
ATOM   306  N  N     . ASP A 1 39  ? 3.011   -18.003 -9.638  1.00 62.26  ? 39   ASP A N     1 
ATOM   307  C  CA    . ASP A 1 39  ? 2.636   -16.837 -8.845  1.00 62.34  ? 39   ASP A CA    1 
ATOM   308  C  C     . ASP A 1 39  ? 3.238   -16.860 -7.443  1.00 61.72  ? 39   ASP A C     1 
ATOM   309  O  O     . ASP A 1 39  ? 2.706   -16.233 -6.515  1.00 61.78  ? 39   ASP A O     1 
ATOM   310  C  CB    . ASP A 1 39  ? 1.102   -16.672 -8.770  1.00 62.75  ? 39   ASP A CB    1 
ATOM   311  C  CG    . ASP A 1 39  ? 0.428   -16.720 -10.152 1.00 65.11  ? 39   ASP A CG    1 
ATOM   312  O  OD1   . ASP A 1 39  ? 1.066   -16.271 -11.135 1.00 67.63  ? 39   ASP A OD1   1 
ATOM   313  O  OD2   . ASP A 1 39  ? -0.732  -17.208 -10.258 1.00 66.23  ? 39   ASP A OD2   1 
ATOM   314  N  N     . SER A 1 40  ? 4.342   -17.576 -7.279  1.00 60.78  ? 40   SER A N     1 
ATOM   315  C  CA    . SER A 1 40  ? 5.074   -17.510 -6.029  1.00 60.34  ? 40   SER A CA    1 
ATOM   316  C  C     . SER A 1 40  ? 5.646   -16.100 -5.904  1.00 60.28  ? 40   SER A C     1 
ATOM   317  O  O     . SER A 1 40  ? 6.041   -15.498 -6.902  1.00 60.11  ? 40   SER A O     1 
ATOM   318  C  CB    . SER A 1 40  ? 6.191   -18.551 -5.995  1.00 60.44  ? 40   SER A CB    1 
ATOM   319  O  OG    . SER A 1 40  ? 7.439   -17.999 -6.379  1.00 61.38  ? 40   SER A OG    1 
ATOM   320  N  N     . GLY A 1 41  ? 5.666   -15.566 -4.687  1.00 60.08  ? 41   GLY A N     1 
ATOM   321  C  CA    . GLY A 1 41  ? 6.202   -14.241 -4.448  1.00 59.86  ? 41   GLY A CA    1 
ATOM   322  C  C     . GLY A 1 41  ? 5.316   -13.321 -3.630  1.00 60.16  ? 41   GLY A C     1 
ATOM   323  O  O     . GLY A 1 41  ? 4.302   -13.729 -3.077  1.00 60.08  ? 41   GLY A O     1 
ATOM   324  N  N     . ALA A 1 42  ? 5.703   -12.057 -3.550  1.00 60.64  ? 42   ALA A N     1 
ATOM   325  C  CA    . ALA A 1 42  ? 4.941   -11.094 -2.774  1.00 60.65  ? 42   ALA A CA    1 
ATOM   326  C  C     . ALA A 1 42  ? 4.669   -9.834  -3.576  1.00 60.88  ? 42   ALA A C     1 
ATOM   327  O  O     . ALA A 1 42  ? 5.353   -9.524  -4.558  1.00 61.59  ? 42   ALA A O     1 
ATOM   328  C  CB    . ALA A 1 42  ? 5.659   -10.758 -1.476  1.00 60.04  ? 42   ALA A CB    1 
ATOM   329  N  N     . VAL A 1 43  ? 3.647   -9.117  -3.142  1.00 60.91  ? 43   VAL A N     1 
ATOM   330  C  CA    . VAL A 1 43  ? 3.311   -7.832  -3.702  1.00 60.27  ? 43   VAL A CA    1 
ATOM   331  C  C     . VAL A 1 43  ? 4.304   -6.816  -3.187  1.00 60.21  ? 43   VAL A C     1 
ATOM   332  O  O     . VAL A 1 43  ? 4.567   -6.738  -1.984  1.00 60.13  ? 43   VAL A O     1 
ATOM   333  C  CB    . VAL A 1 43  ? 1.896   -7.436  -3.293  1.00 60.50  ? 43   VAL A CB    1 
ATOM   334  C  CG1   . VAL A 1 43  ? 1.545   -6.061  -3.826  1.00 59.73  ? 43   VAL A CG1   1 
ATOM   335  C  CG2   . VAL A 1 43  ? 0.906   -8.510  -3.775  1.00 59.58  ? 43   VAL A CG2   1 
ATOM   336  N  N     . ALA A 1 44  ? 4.867   -6.058  -4.125  1.00 59.94  ? 44   ALA A N     1 
ATOM   337  C  CA    . ALA A 1 44  ? 5.745   -4.944  -3.840  1.00 58.86  ? 44   ALA A CA    1 
ATOM   338  C  C     . ALA A 1 44  ? 4.899   -3.731  -3.514  1.00 58.46  ? 44   ALA A C     1 
ATOM   339  O  O     . ALA A 1 44  ? 5.126   -3.032  -2.533  1.00 59.31  ? 44   ALA A O     1 
ATOM   340  C  CB    . ALA A 1 44  ? 6.600   -4.669  -5.042  1.00 58.77  ? 44   ALA A CB    1 
ATOM   341  N  N     . THR A 1 45  ? 3.931   -3.461  -4.368  1.00 57.83  ? 45   THR A N     1 
ATOM   342  C  CA    . THR A 1 45  ? 2.976   -2.409  -4.118  1.00 57.19  ? 45   THR A CA    1 
ATOM   343  C  C     . THR A 1 45  ? 1.771   -2.682  -4.978  1.00 56.54  ? 45   THR A C     1 
ATOM   344  O  O     . THR A 1 45  ? 1.847   -3.376  -5.976  1.00 56.49  ? 45   THR A O     1 
ATOM   345  C  CB    . THR A 1 45  ? 3.528   -0.994  -4.463  1.00 57.42  ? 45   THR A CB    1 
ATOM   346  O  OG1   . THR A 1 45  ? 2.671   0.004   -3.884  1.00 59.82  ? 45   THR A OG1   1 
ATOM   347  C  CG2   . THR A 1 45  ? 3.570   -0.768  -5.939  1.00 55.30  ? 45   THR A CG2   1 
ATOM   348  N  N     . ALA A 1 46  ? 0.656   -2.115  -4.580  1.00 56.14  ? 46   ALA A N     1 
ATOM   349  C  CA    . ALA A 1 46  ? -0.529  -2.165  -5.375  1.00 55.53  ? 46   ALA A CA    1 
ATOM   350  C  C     . ALA A 1 46  ? -0.993  -0.732  -5.392  1.00 55.02  ? 46   ALA A C     1 
ATOM   351  O  O     . ALA A 1 46  ? -0.646  0.041   -4.504  1.00 54.39  ? 46   ALA A O     1 
ATOM   352  C  CB    . ALA A 1 46  ? -1.559  -3.094  -4.726  1.00 55.22  ? 46   ALA A CB    1 
ATOM   353  N  N     . ASN A 1 47  ? -1.735  -0.341  -6.418  1.00 55.09  ? 47   ASN A N     1 
ATOM   354  C  CA    . ASN A 1 47  ? -2.271  1.016   -6.405  1.00 54.76  ? 47   ASN A CA    1 
ATOM   355  C  C     . ASN A 1 47  ? -3.380  1.055   -5.384  1.00 54.59  ? 47   ASN A C     1 
ATOM   356  O  O     . ASN A 1 47  ? -3.692  0.051   -4.777  1.00 54.43  ? 47   ASN A O     1 
ATOM   357  C  CB    . ASN A 1 47  ? -2.740  1.472   -7.786  1.00 54.25  ? 47   ASN A CB    1 
ATOM   358  C  CG    . ASN A 1 47  ? -3.719  0.529   -8.411  1.00 53.15  ? 47   ASN A CG    1 
ATOM   359  O  OD1   . ASN A 1 47  ? -4.325  -0.309  -7.743  1.00 53.62  ? 47   ASN A OD1   1 
ATOM   360  N  ND2   . ASN A 1 47  ? -3.898  0.666   -9.710  1.00 53.41  ? 47   ASN A ND2   1 
ATOM   361  N  N     . TYR A 1 48  ? -3.966  2.214   -5.172  1.00 55.34  ? 48   TYR A N     1 
ATOM   362  C  CA    . TYR A 1 48  ? -5.026  2.310   -4.190  1.00 55.96  ? 48   TYR A CA    1 
ATOM   363  C  C     . TYR A 1 48  ? -6.310  1.573   -4.594  1.00 56.08  ? 48   TYR A C     1 
ATOM   364  O  O     . TYR A 1 48  ? -7.125  1.230   -3.739  1.00 56.49  ? 48   TYR A O     1 
ATOM   365  C  CB    . TYR A 1 48  ? -5.267  3.772   -3.809  1.00 56.36  ? 48   TYR A CB    1 
ATOM   366  C  CG    . TYR A 1 48  ? -4.183  4.286   -2.878  1.00 56.80  ? 48   TYR A CG    1 
ATOM   367  C  CD1   . TYR A 1 48  ? -2.882  4.453   -3.323  1.00 55.77  ? 48   TYR A CD1   1 
ATOM   368  C  CD2   . TYR A 1 48  ? -4.467  4.579   -1.545  1.00 57.22  ? 48   TYR A CD2   1 
ATOM   369  C  CE1   . TYR A 1 48  ? -1.890  4.902   -2.477  1.00 57.36  ? 48   TYR A CE1   1 
ATOM   370  C  CE2   . TYR A 1 48  ? -3.488  5.029   -0.684  1.00 57.87  ? 48   TYR A CE2   1 
ATOM   371  C  CZ    . TYR A 1 48  ? -2.191  5.190   -1.151  1.00 58.38  ? 48   TYR A CZ    1 
ATOM   372  O  OH    . TYR A 1 48  ? -1.214  5.638   -0.280  1.00 57.05  ? 48   TYR A OH    1 
ATOM   373  N  N     . GLU A 1 49  ? -6.480  1.295   -5.880  1.00 55.91  ? 49   GLU A N     1 
ATOM   374  C  CA    . GLU A 1 49  ? -7.605  0.470   -6.307  1.00 55.74  ? 49   GLU A CA    1 
ATOM   375  C  C     . GLU A 1 49  ? -7.425  -0.952  -5.764  1.00 55.24  ? 49   GLU A C     1 
ATOM   376  O  O     . GLU A 1 49  ? -8.335  -1.508  -5.159  1.00 54.98  ? 49   GLU A O     1 
ATOM   377  C  CB    . GLU A 1 49  ? -7.748  0.466   -7.836  1.00 56.10  ? 49   GLU A CB    1 
ATOM   378  C  CG    . GLU A 1 49  ? -8.374  1.717   -8.441  1.00 57.70  ? 49   GLU A CG    1 
ATOM   379  C  CD    . GLU A 1 49  ? -7.422  2.906   -8.506  1.00 61.57  ? 49   GLU A CD    1 
ATOM   380  O  OE1   . GLU A 1 49  ? -6.211  2.745   -8.237  1.00 62.18  ? 49   GLU A OE1   1 
ATOM   381  O  OE2   . GLU A 1 49  ? -7.892  4.026   -8.819  1.00 65.02  ? 49   GLU A OE2   1 
ATOM   382  N  N     . ALA A 1 50  ? -6.243  -1.530  -5.975  1.00 54.75  ? 50   ALA A N     1 
ATOM   383  C  CA    . ALA A 1 50  ? -5.898  -2.810  -5.354  1.00 54.33  ? 50   ALA A CA    1 
ATOM   384  C  C     . ALA A 1 50  ? -5.957  -2.774  -3.820  1.00 54.33  ? 50   ALA A C     1 
ATOM   385  O  O     . ALA A 1 50  ? -6.451  -3.702  -3.187  1.00 54.59  ? 50   ALA A O     1 
ATOM   386  C  CB    . ALA A 1 50  ? -4.545  -3.280  -5.817  1.00 53.58  ? 50   ALA A CB    1 
ATOM   387  N  N     . ARG A 1 51  ? -5.463  -1.703  -3.215  1.00 54.29  ? 51   ARG A N     1 
ATOM   388  C  CA    . ARG A 1 51  ? -5.432  -1.638  -1.762  1.00 54.26  ? 51   ARG A CA    1 
ATOM   389  C  C     . ARG A 1 51  ? -6.803  -1.639  -1.125  1.00 54.58  ? 51   ARG A C     1 
ATOM   390  O  O     . ARG A 1 51  ? -6.962  -2.111  -0.008  1.00 54.67  ? 51   ARG A O     1 
ATOM   391  C  CB    . ARG A 1 51  ? -4.682  -0.409  -1.305  1.00 54.11  ? 51   ARG A CB    1 
ATOM   392  C  CG    . ARG A 1 51  ? -3.229  -0.583  -1.403  1.00 53.31  ? 51   ARG A CG    1 
ATOM   393  C  CD    . ARG A 1 51  ? -2.608  0.711   -1.151  1.00 51.25  ? 51   ARG A CD    1 
ATOM   394  N  NE    . ARG A 1 51  ? -1.348  0.795   -1.853  1.00 50.65  ? 51   ARG A NE    1 
ATOM   395  C  CZ    . ARG A 1 51  ? -0.402  1.646   -1.517  1.00 47.76  ? 51   ARG A CZ    1 
ATOM   396  N  NH1   . ARG A 1 51  ? -0.604  2.457   -0.501  1.00 48.21  ? 51   ARG A NH1   1 
ATOM   397  N  NH2   . ARG A 1 51  ? 0.721   1.679   -2.195  1.00 47.85  ? 51   ARG A NH2   1 
ATOM   398  N  N     . LYS A 1 52  ? -7.783  -1.089  -1.830  1.00 54.76  ? 52   LYS A N     1 
ATOM   399  C  CA    . LYS A 1 52  ? -9.154  -1.098  -1.359  1.00 55.24  ? 52   LYS A CA    1 
ATOM   400  C  C     . LYS A 1 52  ? -9.633  -2.519  -1.076  1.00 55.02  ? 52   LYS A C     1 
ATOM   401  O  O     . LYS A 1 52  ? -10.611 -2.707  -0.366  1.00 55.11  ? 52   LYS A O     1 
ATOM   402  C  CB    . LYS A 1 52  ? -10.087 -0.379  -2.352  1.00 55.12  ? 52   LYS A CB    1 
ATOM   403  C  CG    . LYS A 1 52  ? -9.951  1.135   -2.311  1.00 56.50  ? 52   LYS A CG    1 
ATOM   404  C  CD    . LYS A 1 52  ? -11.079 1.871   -3.035  1.00 61.03  ? 52   LYS A CD    1 
ATOM   405  C  CE    . LYS A 1 52  ? -10.802 2.105   -4.541  1.00 62.52  ? 52   LYS A CE    1 
ATOM   406  N  NZ    . LYS A 1 52  ? -9.792  3.208   -4.822  1.00 63.13  ? 52   LYS A NZ    1 
ATOM   407  N  N     . PHE A 1 53  ? -8.934  -3.509  -1.623  1.00 54.90  ? 53   PHE A N     1 
ATOM   408  C  CA    . PHE A 1 53  ? -9.304  -4.914  -1.440  1.00 55.29  ? 53   PHE A CA    1 
ATOM   409  C  C     . PHE A 1 53  ? -8.264  -5.683  -0.660  1.00 56.04  ? 53   PHE A C     1 
ATOM   410  O  O     . PHE A 1 53  ? -8.306  -6.903  -0.604  1.00 56.44  ? 53   PHE A O     1 
ATOM   411  C  CB    . PHE A 1 53  ? -9.509  -5.606  -2.773  1.00 54.73  ? 53   PHE A CB    1 
ATOM   412  C  CG    . PHE A 1 53  ? -10.582 -4.998  -3.606  1.00 53.84  ? 53   PHE A CG    1 
ATOM   413  C  CD1   . PHE A 1 53  ? -11.890 -5.429  -3.493  1.00 52.18  ? 53   PHE A CD1   1 
ATOM   414  C  CD2   . PHE A 1 53  ? -10.285 -4.001  -4.520  1.00 52.62  ? 53   PHE A CD2   1 
ATOM   415  C  CE1   . PHE A 1 53  ? -12.880 -4.870  -4.272  1.00 51.76  ? 53   PHE A CE1   1 
ATOM   416  C  CE2   . PHE A 1 53  ? -11.277 -3.439  -5.300  1.00 52.20  ? 53   PHE A CE2   1 
ATOM   417  C  CZ    . PHE A 1 53  ? -12.577 -3.878  -5.173  1.00 50.76  ? 53   PHE A CZ    1 
ATOM   418  N  N     . GLY A 1 54  ? -7.316  -4.964  -0.074  1.00 56.81  ? 54   GLY A N     1 
ATOM   419  C  CA    . GLY A 1 54  ? -6.389  -5.557  0.853   1.00 57.61  ? 54   GLY A CA    1 
ATOM   420  C  C     . GLY A 1 54  ? -5.155  -6.049  0.166   1.00 58.65  ? 54   GLY A C     1 
ATOM   421  O  O     . GLY A 1 54  ? -4.320  -6.678  0.791   1.00 59.13  ? 54   GLY A O     1 
ATOM   422  N  N     . VAL A 1 55  ? -5.038  -5.786  -1.128  1.00 59.58  ? 55   VAL A N     1 
ATOM   423  C  CA    . VAL A 1 55  ? -3.798  -6.110  -1.814  1.00 60.73  ? 55   VAL A CA    1 
ATOM   424  C  C     . VAL A 1 55  ? -2.800  -5.013  -1.495  1.00 61.54  ? 55   VAL A C     1 
ATOM   425  O  O     . VAL A 1 55  ? -2.902  -3.907  -2.014  1.00 62.22  ? 55   VAL A O     1 
ATOM   426  C  CB    . VAL A 1 55  ? -3.975  -6.187  -3.319  1.00 60.55  ? 55   VAL A CB    1 
ATOM   427  C  CG1   . VAL A 1 55  ? -2.636  -6.498  -3.974  1.00 60.18  ? 55   VAL A CG1   1 
ATOM   428  C  CG2   . VAL A 1 55  ? -5.017  -7.232  -3.669  1.00 60.59  ? 55   VAL A CG2   1 
ATOM   429  N  N     . LYS A 1 56  ? -1.864  -5.298  -0.604  1.00 62.27  ? 56   LYS A N     1 
ATOM   430  C  CA    . LYS A 1 56  ? -0.877  -4.300  -0.232  1.00 63.16  ? 56   LYS A CA    1 
ATOM   431  C  C     . LYS A 1 56  ? 0.525   -4.887  -0.272  1.00 63.25  ? 56   LYS A C     1 
ATOM   432  O  O     . LYS A 1 56  ? 0.697   -6.100  -0.379  1.00 63.15  ? 56   LYS A O     1 
ATOM   433  C  CB    . LYS A 1 56  ? -1.185  -3.718  1.150   1.00 63.20  ? 56   LYS A CB    1 
ATOM   434  C  CG    . LYS A 1 56  ? -1.416  -4.762  2.228   1.00 65.00  ? 56   LYS A CG    1 
ATOM   435  C  CD    . LYS A 1 56  ? -1.733  -4.095  3.555   1.00 66.86  ? 56   LYS A CD    1 
ATOM   436  C  CE    . LYS A 1 56  ? -1.740  -5.116  4.685   1.00 69.07  ? 56   LYS A CE    1 
ATOM   437  N  NZ    . LYS A 1 56  ? -2.880  -6.075  4.567   1.00 71.15  ? 56   LYS A NZ    1 
ATOM   438  N  N     . ALA A 1 57  ? 1.525   -4.014  -0.209  1.00 63.61  ? 57   ALA A N     1 
ATOM   439  C  CA    . ALA A 1 57  ? 2.902   -4.449  -0.131  1.00 63.54  ? 57   ALA A CA    1 
ATOM   440  C  C     . ALA A 1 57  ? 3.045   -5.537  0.925   1.00 64.00  ? 57   ALA A C     1 
ATOM   441  O  O     . ALA A 1 57  ? 2.668   -5.350  2.076   1.00 64.23  ? 57   ALA A O     1 
ATOM   442  C  CB    . ALA A 1 57  ? 3.765   -3.302  0.208   1.00 63.52  ? 57   ALA A CB    1 
ATOM   443  N  N     . GLY A 1 58  ? 3.582   -6.681  0.531   1.00 64.37  ? 58   GLY A N     1 
ATOM   444  C  CA    . GLY A 1 58  ? 3.883   -7.717  1.489   1.00 64.66  ? 58   GLY A CA    1 
ATOM   445  C  C     . GLY A 1 58  ? 3.011   -8.941  1.376   1.00 65.20  ? 58   GLY A C     1 
ATOM   446  O  O     . GLY A 1 58  ? 3.468   -10.048 1.649   1.00 66.05  ? 58   GLY A O     1 
ATOM   447  N  N     . ILE A 1 59  ? 1.746   -8.783  1.005   1.00 65.26  ? 59   ILE A N     1 
ATOM   448  C  CA    . ILE A 1 59  ? 0.938   -9.985  0.900   1.00 65.24  ? 59   ILE A CA    1 
ATOM   449  C  C     . ILE A 1 59  ? 1.486   -10.851 -0.229  1.00 64.89  ? 59   ILE A C     1 
ATOM   450  O  O     . ILE A 1 59  ? 2.096   -10.339 -1.170  1.00 65.08  ? 59   ILE A O     1 
ATOM   451  C  CB    . ILE A 1 59  ? -0.591  -9.722  0.750   1.00 65.30  ? 59   ILE A CB    1 
ATOM   452  C  CG1   . ILE A 1 59  ? -1.007  -9.624  -0.713  1.00 65.19  ? 59   ILE A CG1   1 
ATOM   453  C  CG2   . ILE A 1 59  ? -1.025  -8.509  1.564   1.00 65.51  ? 59   ILE A CG2   1 
ATOM   454  C  CD1   . ILE A 1 59  ? -2.494  -9.598  -0.879  1.00 65.63  ? 59   ILE A CD1   1 
ATOM   455  N  N     . PRO A 1 60  ? 1.344   -12.174 -0.094  1.00 64.34  ? 60   PRO A N     1 
ATOM   456  C  CA    . PRO A 1 60  ? 1.661   -13.083 -1.172  1.00 63.81  ? 60   PRO A CA    1 
ATOM   457  C  C     . PRO A 1 60  ? 0.874   -12.785 -2.421  1.00 63.33  ? 60   PRO A C     1 
ATOM   458  O  O     . PRO A 1 60  ? -0.310  -12.512 -2.349  1.00 63.87  ? 60   PRO A O     1 
ATOM   459  C  CB    . PRO A 1 60  ? 1.253   -14.443 -0.609  1.00 63.65  ? 60   PRO A CB    1 
ATOM   460  C  CG    . PRO A 1 60  ? 1.395   -14.288 0.847   1.00 64.03  ? 60   PRO A CG    1 
ATOM   461  C  CD    . PRO A 1 60  ? 0.963   -12.888 1.135   1.00 64.26  ? 60   PRO A CD    1 
ATOM   462  N  N     . ILE A 1 61  ? 1.534   -12.857 -3.566  1.00 63.00  ? 61   ILE A N     1 
ATOM   463  C  CA    . ILE A 1 61  ? 0.864   -12.729 -4.845  1.00 62.48  ? 61   ILE A CA    1 
ATOM   464  C  C     . ILE A 1 61  ? -0.380  -13.613 -4.925  1.00 62.62  ? 61   ILE A C     1 
ATOM   465  O  O     . ILE A 1 61  ? -1.420  -13.188 -5.419  1.00 62.54  ? 61   ILE A O     1 
ATOM   466  C  CB    . ILE A 1 61  ? 1.821   -13.056 -5.998  1.00 62.32  ? 61   ILE A CB    1 
ATOM   467  C  CG1   . ILE A 1 61  ? 2.984   -12.063 -6.004  1.00 61.70  ? 61   ILE A CG1   1 
ATOM   468  C  CG2   . ILE A 1 61  ? 1.086   -13.078 -7.339  1.00 61.38  ? 61   ILE A CG2   1 
ATOM   469  C  CD1   . ILE A 1 61  ? 4.163   -12.544 -6.809  1.00 61.47  ? 61   ILE A CD1   1 
ATOM   470  N  N     . VAL A 1 62  ? -0.285  -14.846 -4.440  1.00 62.86  ? 62   VAL A N     1 
ATOM   471  C  CA    . VAL A 1 62  ? -1.455  -15.731 -4.492  1.00 62.65  ? 62   VAL A CA    1 
ATOM   472  C  C     . VAL A 1 62  ? -2.599  -15.266 -3.578  1.00 62.70  ? 62   VAL A C     1 
ATOM   473  O  O     . VAL A 1 62  ? -3.755  -15.496 -3.899  1.00 62.35  ? 62   VAL A O     1 
ATOM   474  C  CB    . VAL A 1 62  ? -1.121  -17.225 -4.253  1.00 62.20  ? 62   VAL A CB    1 
ATOM   475  C  CG1   . VAL A 1 62  ? -0.197  -17.731 -5.333  1.00 62.39  ? 62   VAL A CG1   1 
ATOM   476  C  CG2   . VAL A 1 62  ? -0.547  -17.445 -2.867  1.00 61.60  ? 62   VAL A CG2   1 
ATOM   477  N  N     . GLU A 1 63  ? -2.266  -14.620 -2.459  1.00 63.06  ? 63   GLU A N     1 
ATOM   478  C  CA    . GLU A 1 63  ? -3.266  -13.996 -1.595  1.00 63.88  ? 63   GLU A CA    1 
ATOM   479  C  C     . GLU A 1 63  ? -3.938  -12.849 -2.323  1.00 63.77  ? 63   GLU A C     1 
ATOM   480  O  O     . GLU A 1 63  ? -5.163  -12.735 -2.321  1.00 64.07  ? 63   GLU A O     1 
ATOM   481  C  CB    . GLU A 1 63  ? -2.635  -13.459 -0.315  1.00 64.03  ? 63   GLU A CB    1 
ATOM   482  C  CG    . GLU A 1 63  ? -2.227  -14.527 0.674   1.00 67.54  ? 63   GLU A CG    1 
ATOM   483  C  CD    . GLU A 1 63  ? -2.049  -13.986 2.090   1.00 71.13  ? 63   GLU A CD    1 
ATOM   484  O  OE1   . GLU A 1 63  ? -1.745  -14.802 3.001   1.00 73.09  ? 63   GLU A OE1   1 
ATOM   485  O  OE2   . GLU A 1 63  ? -2.213  -12.756 2.287   1.00 71.35  ? 63   GLU A OE2   1 
ATOM   486  N  N     . ALA A 1 64  ? -3.116  -12.005 -2.942  1.00 63.36  ? 64   ALA A N     1 
ATOM   487  C  CA    . ALA A 1 64  ? -3.584  -10.891 -3.738  1.00 63.22  ? 64   ALA A CA    1 
ATOM   488  C  C     . ALA A 1 64  ? -4.480  -11.378 -4.857  1.00 63.21  ? 64   ALA A C     1 
ATOM   489  O  O     . ALA A 1 64  ? -5.546  -10.811 -5.102  1.00 63.21  ? 64   ALA A O     1 
ATOM   490  C  CB    . ALA A 1 64  ? -2.392  -10.111 -4.310  1.00 63.19  ? 64   ALA A CB    1 
ATOM   491  N  N     . LYS A 1 65  ? -4.037  -12.428 -5.541  1.00 63.16  ? 65   LYS A N     1 
ATOM   492  C  CA    . LYS A 1 65  ? -4.783  -12.996 -6.655  1.00 63.29  ? 65   LYS A CA    1 
ATOM   493  C  C     . LYS A 1 65  ? -6.015  -13.747 -6.145  1.00 63.75  ? 65   LYS A C     1 
ATOM   494  O  O     . LYS A 1 65  ? -6.956  -14.005 -6.897  1.00 63.51  ? 65   LYS A O     1 
ATOM   495  C  CB    . LYS A 1 65  ? -3.881  -13.915 -7.484  1.00 63.09  ? 65   LYS A CB    1 
ATOM   496  C  CG    . LYS A 1 65  ? -2.910  -13.181 -8.396  1.00 62.66  ? 65   LYS A CG    1 
ATOM   497  C  CD    . LYS A 1 65  ? -2.013  -14.133 -9.161  1.00 62.59  ? 65   LYS A CD    1 
ATOM   498  C  CE    . LYS A 1 65  ? -1.418  -13.491 -10.405 1.00 61.47  ? 65   LYS A CE    1 
ATOM   499  N  NZ    . LYS A 1 65  ? -2.426  -13.403 -11.498 1.00 61.46  ? 65   LYS A NZ    1 
ATOM   500  N  N     . LYS A 1 66  ? -5.992  -14.092 -4.858  1.00 64.27  ? 66   LYS A N     1 
ATOM   501  C  CA    . LYS A 1 66  ? -7.121  -14.727 -4.199  1.00 65.03  ? 66   LYS A CA    1 
ATOM   502  C  C     . LYS A 1 66  ? -8.155  -13.647 -3.927  1.00 65.11  ? 66   LYS A C     1 
ATOM   503  O  O     . LYS A 1 66  ? -9.313  -13.774 -4.317  1.00 64.93  ? 66   LYS A O     1 
ATOM   504  C  CB    . LYS A 1 66  ? -6.684  -15.370 -2.874  1.00 65.18  ? 66   LYS A CB    1 
ATOM   505  C  CG    . LYS A 1 66  ? -7.680  -16.374 -2.265  1.00 66.55  ? 66   LYS A CG    1 
ATOM   506  C  CD    . LYS A 1 66  ? -7.642  -16.379 -0.727  1.00 67.95  ? 66   LYS A CD    1 
ATOM   507  C  CE    . LYS A 1 66  ? -6.297  -15.871 -0.188  1.00 69.89  ? 66   LYS A CE    1 
ATOM   508  N  NZ    . LYS A 1 66  ? -6.176  -14.362 -0.179  1.00 70.61  ? 66   LYS A NZ    1 
ATOM   509  N  N     . ILE A 1 67  ? -7.720  -12.574 -3.267  1.00 65.50  ? 67   ILE A N     1 
ATOM   510  C  CA    . ILE A 1 67  ? -8.624  -11.483 -2.908  1.00 65.58  ? 67   ILE A CA    1 
ATOM   511  C  C     . ILE A 1 67  ? -8.894  -10.517 -4.060  1.00 65.55  ? 67   ILE A C     1 
ATOM   512  O  O     . ILE A 1 67  ? -9.860  -9.768  -4.018  1.00 65.91  ? 67   ILE A O     1 
ATOM   513  C  CB    . ILE A 1 67  ? -8.173  -10.732 -1.625  1.00 65.53  ? 67   ILE A CB    1 
ATOM   514  C  CG1   . ILE A 1 67  ? -6.864  -9.985  -1.835  1.00 65.82  ? 67   ILE A CG1   1 
ATOM   515  C  CG2   . ILE A 1 67  ? -8.012  -11.700 -0.466  1.00 66.23  ? 67   ILE A CG2   1 
ATOM   516  C  CD1   . ILE A 1 67  ? -6.309  -9.404  -0.540  1.00 65.95  ? 67   ILE A CD1   1 
ATOM   517  N  N     . LEU A 1 68  ? -8.064  -10.559 -5.096  1.00 65.80  ? 68   LEU A N     1 
ATOM   518  C  CA    . LEU A 1 68  ? -8.222  -9.673  -6.257  1.00 66.00  ? 68   LEU A CA    1 
ATOM   519  C  C     . LEU A 1 68  ? -7.790  -10.298 -7.580  1.00 66.18  ? 68   LEU A C     1 
ATOM   520  O  O     . LEU A 1 68  ? -6.823  -9.862  -8.186  1.00 66.07  ? 68   LEU A O     1 
ATOM   521  C  CB    . LEU A 1 68  ? -7.443  -8.371  -6.062  1.00 65.65  ? 68   LEU A CB    1 
ATOM   522  C  CG    . LEU A 1 68  ? -8.198  -7.075  -5.788  1.00 65.19  ? 68   LEU A CG    1 
ATOM   523  C  CD1   . LEU A 1 68  ? -7.343  -5.923  -6.267  1.00 63.86  ? 68   LEU A CD1   1 
ATOM   524  C  CD2   . LEU A 1 68  ? -9.548  -7.044  -6.472  1.00 62.66  ? 68   LEU A CD2   1 
ATOM   525  N  N     . PRO A 1 69  ? -8.520  -11.314 -8.041  1.00 66.52  ? 69   PRO A N     1 
ATOM   526  C  CA    . PRO A 1 69  ? -8.162  -12.055 -9.256  1.00 66.68  ? 69   PRO A CA    1 
ATOM   527  C  C     . PRO A 1 69  ? -7.975  -11.197 -10.518 1.00 66.80  ? 69   PRO A C     1 
ATOM   528  O  O     . PRO A 1 69  ? -7.024  -11.411 -11.269 1.00 66.73  ? 69   PRO A O     1 
ATOM   529  C  CB    . PRO A 1 69  ? -9.345  -13.010 -9.436  1.00 66.64  ? 69   PRO A CB    1 
ATOM   530  C  CG    . PRO A 1 69  ? -9.871  -13.196 -8.060  1.00 66.67  ? 69   PRO A CG    1 
ATOM   531  C  CD    . PRO A 1 69  ? -9.731  -11.851 -7.405  1.00 66.56  ? 69   PRO A CD    1 
ATOM   532  N  N     . ASN A 1 70  ? -8.880  -10.251 -10.755 1.00 66.93  ? 70   ASN A N     1 
ATOM   533  C  CA    . ASN A 1 70  ? -8.893  -9.510  -12.020 1.00 66.73  ? 70   ASN A CA    1 
ATOM   534  C  C     . ASN A 1 70  ? -7.804  -8.458  -12.188 1.00 66.33  ? 70   ASN A C     1 
ATOM   535  O  O     . ASN A 1 70  ? -7.486  -8.076  -13.318 1.00 66.69  ? 70   ASN A O     1 
ATOM   536  C  CB    . ASN A 1 70  ? -10.248 -8.858  -12.231 1.00 67.13  ? 70   ASN A CB    1 
ATOM   537  C  CG    . ASN A 1 70  ? -11.253 -9.809  -12.809 1.00 68.28  ? 70   ASN A CG    1 
ATOM   538  O  OD1   . ASN A 1 70  ? -10.890 -10.796 -13.458 1.00 69.73  ? 70   ASN A OD1   1 
ATOM   539  N  ND2   . ASN A 1 70  ? -12.528 -9.532  -12.573 1.00 69.02  ? 70   ASN A ND2   1 
ATOM   540  N  N     . ALA A 1 71  ? -7.251  -7.987  -11.070 1.00 65.06  ? 71   ALA A N     1 
ATOM   541  C  CA    . ALA A 1 71  ? -6.275  -6.914  -11.075 1.00 63.51  ? 71   ALA A CA    1 
ATOM   542  C  C     . ALA A 1 71  ? -5.212  -7.130  -12.131 1.00 62.45  ? 71   ALA A C     1 
ATOM   543  O  O     . ALA A 1 71  ? -5.072  -8.220  -12.658 1.00 62.15  ? 71   ALA A O     1 
ATOM   544  C  CB    . ALA A 1 71  ? -5.635  -6.790  -9.708  1.00 63.71  ? 71   ALA A CB    1 
ATOM   545  N  N     . VAL A 1 72  ? -4.474  -6.074  -12.454 1.00 61.67  ? 72   VAL A N     1 
ATOM   546  C  CA    . VAL A 1 72  ? -3.288  -6.216  -13.287 1.00 60.86  ? 72   VAL A CA    1 
ATOM   547  C  C     . VAL A 1 72  ? -2.097  -6.484  -12.369 1.00 60.16  ? 72   VAL A C     1 
ATOM   548  O  O     . VAL A 1 72  ? -1.776  -5.674  -11.510 1.00 60.13  ? 72   VAL A O     1 
ATOM   549  C  CB    . VAL A 1 72  ? -3.028  -4.969  -14.168 1.00 61.06  ? 72   VAL A CB    1 
ATOM   550  C  CG1   . VAL A 1 72  ? -1.717  -5.114  -14.925 1.00 60.65  ? 72   VAL A CG1   1 
ATOM   551  C  CG2   . VAL A 1 72  ? -4.171  -4.762  -15.146 1.00 61.00  ? 72   VAL A CG2   1 
ATOM   552  N  N     . TYR A 1 73  ? -1.483  -7.650  -12.540 1.00 59.42  ? 73   TYR A N     1 
ATOM   553  C  CA    . TYR A 1 73  ? -0.334  -8.065  -11.769 1.00 58.63  ? 73   TYR A CA    1 
ATOM   554  C  C     . TYR A 1 73  ? 0.883   -7.904  -12.638 1.00 58.79  ? 73   TYR A C     1 
ATOM   555  O  O     . TYR A 1 73  ? 0.976   -8.518  -13.698 1.00 59.01  ? 73   TYR A O     1 
ATOM   556  C  CB    . TYR A 1 73  ? -0.486  -9.517  -11.317 1.00 58.28  ? 73   TYR A CB    1 
ATOM   557  C  CG    . TYR A 1 73  ? -1.598  -9.662  -10.317 1.00 57.12  ? 73   TYR A CG    1 
ATOM   558  C  CD1   . TYR A 1 73  ? -1.335  -9.589  -8.959  1.00 55.65  ? 73   TYR A CD1   1 
ATOM   559  C  CD2   . TYR A 1 73  ? -2.916  -9.828  -10.728 1.00 56.57  ? 73   TYR A CD2   1 
ATOM   560  C  CE1   . TYR A 1 73  ? -2.331  -9.682  -8.035  1.00 55.53  ? 73   TYR A CE1   1 
ATOM   561  C  CE2   . TYR A 1 73  ? -3.934  -9.931  -9.802  1.00 56.85  ? 73   TYR A CE2   1 
ATOM   562  C  CZ    . TYR A 1 73  ? -3.625  -9.843  -8.453  1.00 57.51  ? 73   TYR A CZ    1 
ATOM   563  O  OH    . TYR A 1 73  ? -4.606  -9.936  -7.502  1.00 60.11  ? 73   TYR A OH    1 
ATOM   564  N  N     . LEU A 1 74  ? 1.817   -7.073  -12.180 1.00 58.46  ? 74   LEU A N     1 
ATOM   565  C  CA    . LEU A 1 74  ? 2.969   -6.694  -12.977 1.00 58.08  ? 74   LEU A CA    1 
ATOM   566  C  C     . LEU A 1 74  ? 4.259   -7.041  -12.263 1.00 58.35  ? 74   LEU A C     1 
ATOM   567  O  O     . LEU A 1 74  ? 4.417   -6.745  -11.084 1.00 58.20  ? 74   LEU A O     1 
ATOM   568  C  CB    . LEU A 1 74  ? 2.927   -5.193  -13.258 1.00 58.00  ? 74   LEU A CB    1 
ATOM   569  C  CG    . LEU A 1 74  ? 1.759   -4.750  -14.135 1.00 57.05  ? 74   LEU A CG    1 
ATOM   570  C  CD1   . LEU A 1 74  ? 1.691   -3.273  -14.172 1.00 56.18  ? 74   LEU A CD1   1 
ATOM   571  C  CD2   . LEU A 1 74  ? 1.899   -5.321  -15.548 1.00 56.66  ? 74   LEU A CD2   1 
ATOM   572  N  N     . PRO A 1 75  ? 5.205   -7.662  -12.979 1.00 58.81  ? 75   PRO A N     1 
ATOM   573  C  CA    . PRO A 1 75  ? 6.444   -7.944  -12.280 1.00 59.17  ? 75   PRO A CA    1 
ATOM   574  C  C     . PRO A 1 75  ? 7.074   -6.625  -11.861 1.00 59.55  ? 75   PRO A C     1 
ATOM   575  O  O     . PRO A 1 75  ? 6.965   -5.628  -12.577 1.00 59.71  ? 75   PRO A O     1 
ATOM   576  C  CB    . PRO A 1 75  ? 7.299   -8.654  -13.337 1.00 58.64  ? 75   PRO A CB    1 
ATOM   577  C  CG    . PRO A 1 75  ? 6.722   -8.234  -14.632 1.00 58.65  ? 75   PRO A CG    1 
ATOM   578  C  CD    . PRO A 1 75  ? 5.251   -8.095  -14.384 1.00 58.67  ? 75   PRO A CD    1 
ATOM   579  N  N     . MET A 1 76  ? 7.693   -6.614  -10.690 1.00 59.87  ? 76   MET A N     1 
ATOM   580  C  CA    . MET A 1 76  ? 8.466   -5.478  -10.274 1.00 60.56  ? 76   MET A CA    1 
ATOM   581  C  C     . MET A 1 76  ? 9.664   -5.259  -11.209 1.00 60.95  ? 76   MET A C     1 
ATOM   582  O  O     . MET A 1 76  ? 10.545  -6.108  -11.326 1.00 61.27  ? 76   MET A O     1 
ATOM   583  C  CB    . MET A 1 76  ? 8.942   -5.665  -8.839  1.00 60.93  ? 76   MET A CB    1 
ATOM   584  C  CG    . MET A 1 76  ? 9.653   -4.453  -8.269  1.00 61.04  ? 76   MET A CG    1 
ATOM   585  S  SD    . MET A 1 76  ? 10.400  -4.859  -6.696  1.00 64.68  ? 76   MET A SD    1 
ATOM   586  C  CE    . MET A 1 76  ? 11.393  -6.297  -7.117  1.00 62.82  ? 76   MET A CE    1 
ATOM   587  N  N     . ARG A 1 77  ? 9.670   -4.116  -11.880 1.00 61.15  ? 77   ARG A N     1 
ATOM   588  C  CA    . ARG A 1 77  ? 10.786  -3.689  -12.705 1.00 61.06  ? 77   ARG A CA    1 
ATOM   589  C  C     . ARG A 1 77  ? 11.500  -2.627  -11.932 1.00 60.45  ? 77   ARG A C     1 
ATOM   590  O  O     . ARG A 1 77  ? 11.354  -1.462  -12.222 1.00 60.05  ? 77   ARG A O     1 
ATOM   591  C  CB    . ARG A 1 77  ? 10.273  -3.065  -13.998 1.00 61.37  ? 77   ARG A CB    1 
ATOM   592  C  CG    . ARG A 1 77  ? 9.545   -4.014  -14.901 1.00 63.02  ? 77   ARG A CG    1 
ATOM   593  C  CD    . ARG A 1 77  ? 9.269   -3.365  -16.245 1.00 66.49  ? 77   ARG A CD    1 
ATOM   594  N  NE    . ARG A 1 77  ? 8.164   -2.418  -16.187 1.00 66.93  ? 77   ARG A NE    1 
ATOM   595  C  CZ    . ARG A 1 77  ? 7.777   -1.671  -17.213 1.00 68.86  ? 77   ARG A CZ    1 
ATOM   596  N  NH1   . ARG A 1 77  ? 8.413   -1.757  -18.374 1.00 69.72  ? 77   ARG A NH1   1 
ATOM   597  N  NH2   . ARG A 1 77  ? 6.759   -0.833  -17.081 1.00 69.97  ? 77   ARG A NH2   1 
ATOM   598  N  N     . LYS A 1 78  ? 12.270  -3.029  -10.935 1.00 60.86  ? 78   LYS A N     1 
ATOM   599  C  CA    . LYS A 1 78  ? 12.826  -2.084  -9.980  1.00 61.06  ? 78   LYS A CA    1 
ATOM   600  C  C     . LYS A 1 78  ? 13.713  -1.035  -10.644 1.00 60.80  ? 78   LYS A C     1 
ATOM   601  O  O     . LYS A 1 78  ? 13.726  0.115   -10.237 1.00 61.30  ? 78   LYS A O     1 
ATOM   602  C  CB    . LYS A 1 78  ? 13.563  -2.848  -8.881  1.00 61.30  ? 78   LYS A CB    1 
ATOM   603  C  CG    . LYS A 1 78  ? 14.438  -2.026  -7.995  1.00 63.15  ? 78   LYS A CG    1 
ATOM   604  C  CD    . LYS A 1 78  ? 13.688  -1.379  -6.866  1.00 66.92  ? 78   LYS A CD    1 
ATOM   605  C  CE    . LYS A 1 78  ? 14.677  -0.753  -5.845  1.00 70.69  ? 78   LYS A CE    1 
ATOM   606  N  NZ    . LYS A 1 78  ? 15.356  -1.775  -4.984  1.00 71.31  ? 78   LYS A NZ    1 
ATOM   607  N  N     . GLU A 1 79  ? 14.436  -1.422  -11.684 1.00 60.41  ? 79   GLU A N     1 
ATOM   608  C  CA    . GLU A 1 79  ? 15.294  -0.477  -12.395 1.00 59.95  ? 79   GLU A CA    1 
ATOM   609  C  C     . GLU A 1 79  ? 14.487  0.643   -13.050 1.00 58.36  ? 79   GLU A C     1 
ATOM   610  O  O     . GLU A 1 79  ? 14.937  1.780   -13.102 1.00 58.70  ? 79   GLU A O     1 
ATOM   611  C  CB    . GLU A 1 79  ? 16.141  -1.198  -13.442 1.00 60.25  ? 79   GLU A CB    1 
ATOM   612  C  CG    . GLU A 1 79  ? 16.261  -2.724  -13.208 1.00 65.53  ? 79   GLU A CG    1 
ATOM   613  C  CD    . GLU A 1 79  ? 14.905  -3.474  -13.278 1.00 69.86  ? 79   GLU A CD    1 
ATOM   614  O  OE1   . GLU A 1 79  ? 14.161  -3.323  -14.291 1.00 71.22  ? 79   GLU A OE1   1 
ATOM   615  O  OE2   . GLU A 1 79  ? 14.597  -4.223  -12.316 1.00 71.33  ? 79   GLU A OE2   1 
ATOM   616  N  N     . VAL A 1 80  ? 13.310  0.315   -13.567 1.00 56.54  ? 80   VAL A N     1 
ATOM   617  C  CA    . VAL A 1 80  ? 12.450  1.304   -14.203 1.00 55.05  ? 80   VAL A CA    1 
ATOM   618  C  C     . VAL A 1 80  ? 11.976  2.331   -13.193 1.00 54.15  ? 80   VAL A C     1 
ATOM   619  O  O     . VAL A 1 80  ? 11.954  3.533   -13.467 1.00 54.04  ? 80   VAL A O     1 
ATOM   620  C  CB    . VAL A 1 80  ? 11.205  0.641   -14.851 1.00 55.36  ? 80   VAL A CB    1 
ATOM   621  C  CG1   . VAL A 1 80  ? 10.156  1.707   -15.252 1.00 54.91  ? 80   VAL A CG1   1 
ATOM   622  C  CG2   . VAL A 1 80  ? 11.625  -0.186  -16.048 1.00 54.35  ? 80   VAL A CG2   1 
ATOM   623  N  N     . TYR A 1 81  ? 11.597  1.839   -12.021 1.00 52.91  ? 81   TYR A N     1 
ATOM   624  C  CA    . TYR A 1 81  ? 11.100  2.672   -10.945 1.00 52.04  ? 81   TYR A CA    1 
ATOM   625  C  C     . TYR A 1 81  ? 12.230  3.528   -10.411 1.00 52.09  ? 81   TYR A C     1 
ATOM   626  O  O     . TYR A 1 81  ? 12.020  4.655   -10.017 1.00 51.63  ? 81   TYR A O     1 
ATOM   627  C  CB    . TYR A 1 81  ? 10.528  1.798   -9.823  1.00 51.59  ? 81   TYR A CB    1 
ATOM   628  C  CG    . TYR A 1 81  ? 9.623   0.716   -10.313 1.00 49.61  ? 81   TYR A CG    1 
ATOM   629  C  CD1   . TYR A 1 81  ? 8.758   0.946   -11.368 1.00 50.81  ? 81   TYR A CD1   1 
ATOM   630  C  CD2   . TYR A 1 81  ? 9.617   -0.529  -9.722  1.00 50.32  ? 81   TYR A CD2   1 
ATOM   631  C  CE1   . TYR A 1 81  ? 7.937   -0.036  -11.842 1.00 51.39  ? 81   TYR A CE1   1 
ATOM   632  C  CE2   . TYR A 1 81  ? 8.772   -1.526  -10.182 1.00 49.64  ? 81   TYR A CE2   1 
ATOM   633  C  CZ    . TYR A 1 81  ? 7.949   -1.270  -11.242 1.00 50.53  ? 81   TYR A CZ    1 
ATOM   634  O  OH    . TYR A 1 81  ? 7.118   -2.242  -11.713 1.00 52.77  ? 81   TYR A OH    1 
ATOM   635  N  N     . GLN A 1 82  ? 13.433  2.969   -10.400 1.00 52.39  ? 82   GLN A N     1 
ATOM   636  C  CA    . GLN A 1 82  ? 14.621  3.699   -9.981  1.00 53.03  ? 82   GLN A CA    1 
ATOM   637  C  C     . GLN A 1 82  ? 14.978  4.825   -10.947 1.00 52.58  ? 82   GLN A C     1 
ATOM   638  O  O     . GLN A 1 82  ? 15.390  5.900   -10.535 1.00 52.59  ? 82   GLN A O     1 
ATOM   639  C  CB    . GLN A 1 82  ? 15.814  2.766   -9.848  1.00 53.07  ? 82   GLN A CB    1 
ATOM   640  C  CG    . GLN A 1 82  ? 17.038  3.512   -9.363  1.00 55.80  ? 82   GLN A CG    1 
ATOM   641  C  CD    . GLN A 1 82  ? 16.766  4.275   -8.087  1.00 57.80  ? 82   GLN A CD    1 
ATOM   642  O  OE1   . GLN A 1 82  ? 16.509  3.676   -7.053  1.00 60.34  ? 82   GLN A OE1   1 
ATOM   643  N  NE2   . GLN A 1 82  ? 16.814  5.602   -8.155  1.00 56.88  ? 82   GLN A NE2   1 
ATOM   644  N  N     . GLN A 1 83  ? 14.825  4.574   -12.238 1.00 52.09  ? 83   GLN A N     1 
ATOM   645  C  CA    . GLN A 1 83  ? 15.026  5.625   -13.204 1.00 52.16  ? 83   GLN A CA    1 
ATOM   646  C  C     . GLN A 1 83  ? 14.036  6.780   -13.028 1.00 52.43  ? 83   GLN A C     1 
ATOM   647  O  O     . GLN A 1 83  ? 14.432  7.945   -13.006 1.00 53.13  ? 83   GLN A O     1 
ATOM   648  C  CB    . GLN A 1 83  ? 14.963  5.057   -14.612 1.00 52.34  ? 83   GLN A CB    1 
ATOM   649  C  CG    . GLN A 1 83  ? 16.140  4.162   -14.923 1.00 51.35  ? 83   GLN A CG    1 
ATOM   650  C  CD    . GLN A 1 83  ? 15.907  3.350   -16.155 1.00 52.58  ? 83   GLN A CD    1 
ATOM   651  O  OE1   . GLN A 1 83  ? 14.761  3.076   -16.526 1.00 54.51  ? 83   GLN A OE1   1 
ATOM   652  N  NE2   . GLN A 1 83  ? 16.986  2.957   -16.813 1.00 53.03  ? 83   GLN A NE2   1 
ATOM   653  N  N     . VAL A 1 84  ? 12.753  6.466   -12.910 1.00 52.44  ? 84   VAL A N     1 
ATOM   654  C  CA    . VAL A 1 84  ? 11.758  7.488   -12.692 1.00 52.50  ? 84   VAL A CA    1 
ATOM   655  C  C     . VAL A 1 84  ? 12.060  8.223   -11.397 1.00 52.95  ? 84   VAL A C     1 
ATOM   656  O  O     . VAL A 1 84  ? 12.031  9.447   -11.358 1.00 53.27  ? 84   VAL A O     1 
ATOM   657  C  CB    . VAL A 1 84  ? 10.337  6.898   -12.609 1.00 52.81  ? 84   VAL A CB    1 
ATOM   658  C  CG1   . VAL A 1 84  ? 9.325   7.995   -12.285 1.00 52.99  ? 84   VAL A CG1   1 
ATOM   659  C  CG2   . VAL A 1 84  ? 9.980   6.223   -13.899 1.00 51.38  ? 84   VAL A CG2   1 
ATOM   660  N  N     . SER A 1 85  ? 12.367  7.465   -10.345 1.00 52.77  ? 85   SER A N     1 
ATOM   661  C  CA    . SER A 1 85  ? 12.671  8.026   -9.035  1.00 52.44  ? 85   SER A CA    1 
ATOM   662  C  C     . SER A 1 85  ? 13.827  8.999   -9.070  1.00 52.98  ? 85   SER A C     1 
ATOM   663  O  O     . SER A 1 85  ? 13.768  10.061  -8.460  1.00 52.86  ? 85   SER A O     1 
ATOM   664  C  CB    . SER A 1 85  ? 13.031  6.912   -8.066  1.00 52.59  ? 85   SER A CB    1 
ATOM   665  O  OG    . SER A 1 85  ? 13.436  7.448   -6.819  1.00 53.02  ? 85   SER A OG    1 
ATOM   666  N  N     . SER A 1 86  ? 14.893  8.621   -9.767  1.00 53.39  ? 86   SER A N     1 
ATOM   667  C  CA    . SER A 1 86  ? 16.078  9.438   -9.851  1.00 53.83  ? 86   SER A CA    1 
ATOM   668  C  C     . SER A 1 86  ? 15.780  10.710  -10.600 1.00 53.83  ? 86   SER A C     1 
ATOM   669  O  O     . SER A 1 86  ? 16.352  11.754  -10.312 1.00 54.29  ? 86   SER A O     1 
ATOM   670  C  CB    . SER A 1 86  ? 17.205  8.668   -10.543 1.00 54.25  ? 86   SER A CB    1 
ATOM   671  O  OG    . SER A 1 86  ? 17.705  7.696   -9.650  1.00 55.13  ? 86   SER A OG    1 
ATOM   672  N  N     . ARG A 1 87  ? 14.887  10.622  -11.578 1.00 54.03  ? 87   ARG A N     1 
ATOM   673  C  CA    . ARG A 1 87  ? 14.504  11.805  -12.334 1.00 53.52  ? 87   ARG A CA    1 
ATOM   674  C  C     . ARG A 1 87  ? 13.720  12.729  -11.430 1.00 53.62  ? 87   ARG A C     1 
ATOM   675  O  O     . ARG A 1 87  ? 13.917  13.951  -11.458 1.00 53.81  ? 87   ARG A O     1 
ATOM   676  C  CB    . ARG A 1 87  ? 13.665  11.423  -13.544 1.00 53.56  ? 87   ARG A CB    1 
ATOM   677  C  CG    . ARG A 1 87  ? 14.494  10.886  -14.678 1.00 53.00  ? 87   ARG A CG    1 
ATOM   678  C  CD    . ARG A 1 87  ? 13.739  10.991  -15.985 1.00 51.69  ? 87   ARG A CD    1 
ATOM   679  N  NE    . ARG A 1 87  ? 12.411  10.383  -15.905 1.00 51.27  ? 87   ARG A NE    1 
ATOM   680  C  CZ    . ARG A 1 87  ? 12.146  9.126   -16.248 1.00 49.51  ? 87   ARG A CZ    1 
ATOM   681  N  NH1   . ARG A 1 87  ? 13.121  8.342   -16.680 1.00 49.30  ? 87   ARG A NH1   1 
ATOM   682  N  NH2   . ARG A 1 87  ? 10.910  8.656   -16.170 1.00 50.43  ? 87   ARG A NH2   1 
ATOM   683  N  N     . ILE A 1 88  ? 12.843  12.141  -10.617 1.00 53.12  ? 88   ILE A N     1 
ATOM   684  C  CA    . ILE A 1 88  ? 12.081  12.916  -9.665  1.00 53.21  ? 88   ILE A CA    1 
ATOM   685  C  C     . ILE A 1 88  ? 12.985  13.485  -8.597  1.00 53.56  ? 88   ILE A C     1 
ATOM   686  O  O     . ILE A 1 88  ? 12.856  14.634  -8.233  1.00 53.86  ? 88   ILE A O     1 
ATOM   687  C  CB    . ILE A 1 88  ? 10.956  12.119  -8.978  1.00 52.94  ? 88   ILE A CB    1 
ATOM   688  C  CG1   . ILE A 1 88  ? 9.967   11.572  -10.011 1.00 52.11  ? 88   ILE A CG1   1 
ATOM   689  C  CG2   . ILE A 1 88  ? 10.264  13.027  -8.002  1.00 52.02  ? 88   ILE A CG2   1 
ATOM   690  C  CD1   . ILE A 1 88  ? 8.866   10.666  -9.448  1.00 53.36  ? 88   ILE A CD1   1 
ATOM   691  N  N     . MET A 1 89  ? 13.907  12.684  -8.095  1.00 54.64  ? 89   MET A N     1 
ATOM   692  C  CA    . MET A 1 89  ? 14.809  13.155  -7.051  1.00 55.63  ? 89   MET A CA    1 
ATOM   693  C  C     . MET A 1 89  ? 15.622  14.306  -7.569  1.00 55.87  ? 89   MET A C     1 
ATOM   694  O  O     . MET A 1 89  ? 16.003  15.180  -6.802  1.00 56.00  ? 89   MET A O     1 
ATOM   695  C  CB    . MET A 1 89  ? 15.758  12.048  -6.588  1.00 55.57  ? 89   MET A CB    1 
ATOM   696  C  CG    . MET A 1 89  ? 15.053  10.909  -5.946  1.00 56.12  ? 89   MET A CG    1 
ATOM   697  S  SD    . MET A 1 89  ? 13.962  11.414  -4.608  1.00 58.05  ? 89   MET A SD    1 
ATOM   698  C  CE    . MET A 1 89  ? 13.316  9.811   -4.146  1.00 54.28  ? 89   MET A CE    1 
ATOM   699  N  N     . ASN A 1 90  ? 15.894  14.292  -8.874  1.00 56.58  ? 90   ASN A N     1 
ATOM   700  C  CA    . ASN A 1 90  ? 16.594  15.395  -9.527  1.00 57.15  ? 90   ASN A CA    1 
ATOM   701  C  C     . ASN A 1 90  ? 15.748  16.633  -9.638  1.00 57.35  ? 90   ASN A C     1 
ATOM   702  O  O     . ASN A 1 90  ? 16.255  17.737  -9.480  1.00 57.86  ? 90   ASN A O     1 
ATOM   703  C  CB    . ASN A 1 90  ? 17.061  15.004  -10.919 1.00 57.38  ? 90   ASN A CB    1 
ATOM   704  C  CG    . ASN A 1 90  ? 18.336  14.238  -10.888 1.00 58.44  ? 90   ASN A CG    1 
ATOM   705  O  OD1   . ASN A 1 90  ? 19.174  14.450  -10.005 1.00 60.15  ? 90   ASN A OD1   1 
ATOM   706  N  ND2   . ASN A 1 90  ? 18.502  13.325  -11.843 1.00 59.08  ? 90   ASN A ND2   1 
ATOM   707  N  N     . LEU A 1 91  ? 14.474  16.449  -9.968  1.00 57.61  ? 91   LEU A N     1 
ATOM   708  C  CA    . LEU A 1 91  ? 13.503  17.535  -9.937  1.00 57.59  ? 91   LEU A CA    1 
ATOM   709  C  C     . LEU A 1 91  ? 13.554  18.186  -8.571  1.00 57.83  ? 91   LEU A C     1 
ATOM   710  O  O     . LEU A 1 91  ? 13.619  19.394  -8.452  1.00 58.43  ? 91   LEU A O     1 
ATOM   711  C  CB    . LEU A 1 91  ? 12.087  16.996  -10.163 1.00 57.36  ? 91   LEU A CB    1 
ATOM   712  C  CG    . LEU A 1 91  ? 11.685  16.645  -11.589 1.00 56.50  ? 91   LEU A CG    1 
ATOM   713  C  CD1   . LEU A 1 91  ? 10.188  16.504  -11.648 1.00 55.22  ? 91   LEU A CD1   1 
ATOM   714  C  CD2   . LEU A 1 91  ? 12.152  17.745  -12.534 1.00 56.74  ? 91   LEU A CD2   1 
ATOM   715  N  N     . LEU A 1 92  ? 13.540  17.367  -7.537  1.00 58.10  ? 92   LEU A N     1 
ATOM   716  C  CA    . LEU A 1 92  ? 13.513  17.858  -6.175  1.00 58.57  ? 92   LEU A CA    1 
ATOM   717  C  C     . LEU A 1 92  ? 14.776  18.605  -5.808  1.00 59.41  ? 92   LEU A C     1 
ATOM   718  O  O     . LEU A 1 92  ? 14.742  19.477  -4.944  1.00 59.47  ? 92   LEU A O     1 
ATOM   719  C  CB    . LEU A 1 92  ? 13.331  16.702  -5.204  1.00 58.35  ? 92   LEU A CB    1 
ATOM   720  C  CG    . LEU A 1 92  ? 12.075  15.892  -5.365  1.00 56.52  ? 92   LEU A CG    1 
ATOM   721  C  CD1   . LEU A 1 92  ? 12.072  14.804  -4.306  1.00 57.50  ? 92   LEU A CD1   1 
ATOM   722  C  CD2   . LEU A 1 92  ? 10.914  16.815  -5.198  1.00 57.80  ? 92   LEU A CD2   1 
ATOM   723  N  N     . ARG A 1 93  ? 15.889  18.245  -6.445  1.00 60.51  ? 93   ARG A N     1 
ATOM   724  C  CA    . ARG A 1 93  ? 17.157  18.945  -6.249  1.00 61.28  ? 93   ARG A CA    1 
ATOM   725  C  C     . ARG A 1 93  ? 17.080  20.358  -6.802  1.00 61.63  ? 93   ARG A C     1 
ATOM   726  O  O     . ARG A 1 93  ? 17.819  21.235  -6.381  1.00 61.75  ? 93   ARG A O     1 
ATOM   727  C  CB    . ARG A 1 93  ? 18.303  18.200  -6.934  1.00 61.43  ? 93   ARG A CB    1 
ATOM   728  C  CG    . ARG A 1 93  ? 18.796  16.988  -6.195  1.00 62.86  ? 93   ARG A CG    1 
ATOM   729  C  CD    . ARG A 1 93  ? 19.870  16.267  -7.007  1.00 65.60  ? 93   ARG A CD    1 
ATOM   730  N  NE    . ARG A 1 93  ? 19.644  14.819  -7.040  1.00 67.31  ? 93   ARG A NE    1 
ATOM   731  C  CZ    . ARG A 1 93  ? 20.116  13.971  -6.136  1.00 67.64  ? 93   ARG A CZ    1 
ATOM   732  N  NH1   . ARG A 1 93  ? 20.856  14.418  -5.124  1.00 67.68  ? 93   ARG A NH1   1 
ATOM   733  N  NH2   . ARG A 1 93  ? 19.858  12.676  -6.253  1.00 69.03  ? 93   ARG A NH2   1 
ATOM   734  N  N     . GLU A 1 94  ? 16.194  20.563  -7.767  1.00 62.39  ? 94   GLU A N     1 
ATOM   735  C  CA    . GLU A 1 94  ? 15.958  21.886  -8.305  1.00 63.43  ? 94   GLU A CA    1 
ATOM   736  C  C     . GLU A 1 94  ? 15.069  22.727  -7.395  1.00 63.54  ? 94   GLU A C     1 
ATOM   737  O  O     . GLU A 1 94  ? 14.600  23.786  -7.789  1.00 64.45  ? 94   GLU A O     1 
ATOM   738  C  CB    . GLU A 1 94  ? 15.371  21.797  -9.717  1.00 63.67  ? 94   GLU A CB    1 
ATOM   739  C  CG    . GLU A 1 94  ? 16.387  22.176  -10.809 1.00 65.64  ? 94   GLU A CG    1 
ATOM   740  C  CD    . GLU A 1 94  ? 16.830  23.641  -10.717 1.00 66.68  ? 94   GLU A CD    1 
ATOM   741  O  OE1   . GLU A 1 94  ? 15.956  24.533  -10.605 1.00 66.68  ? 94   GLU A OE1   1 
ATOM   742  O  OE2   . GLU A 1 94  ? 18.053  23.902  -10.750 1.00 67.47  ? 94   GLU A OE2   1 
ATOM   743  N  N     . TYR A 1 95  ? 14.843  22.246  -6.179  1.00 63.71  ? 95   TYR A N     1 
ATOM   744  C  CA    . TYR A 1 95  ? 14.078  22.969  -5.171  1.00 63.44  ? 95   TYR A CA    1 
ATOM   745  C  C     . TYR A 1 95  ? 14.907  23.113  -3.916  1.00 63.58  ? 95   TYR A C     1 
ATOM   746  O  O     . TYR A 1 95  ? 14.721  24.048  -3.148  1.00 63.96  ? 95   TYR A O     1 
ATOM   747  C  CB    . TYR A 1 95  ? 12.776  22.241  -4.844  1.00 63.16  ? 95   TYR A CB    1 
ATOM   748  C  CG    . TYR A 1 95  ? 11.780  22.373  -5.949  1.00 62.93  ? 95   TYR A CG    1 
ATOM   749  C  CD1   . TYR A 1 95  ? 11.055  23.547  -6.109  1.00 61.69  ? 95   TYR A CD1   1 
ATOM   750  C  CD2   . TYR A 1 95  ? 11.589  21.345  -6.862  1.00 61.83  ? 95   TYR A CD2   1 
ATOM   751  C  CE1   . TYR A 1 95  ? 10.159  23.693  -7.134  1.00 61.49  ? 95   TYR A CE1   1 
ATOM   752  C  CE2   . TYR A 1 95  ? 10.690  21.483  -7.893  1.00 62.25  ? 95   TYR A CE2   1 
ATOM   753  C  CZ    . TYR A 1 95  ? 9.979   22.662  -8.023  1.00 62.19  ? 95   TYR A CZ    1 
ATOM   754  O  OH    . TYR A 1 95  ? 9.079   22.808  -9.046  1.00 63.17  ? 95   TYR A OH    1 
ATOM   755  N  N     . SER A 1 96  ? 15.807  22.166  -3.706  1.00 63.40  ? 96   SER A N     1 
ATOM   756  C  CA    . SER A 1 96  ? 16.762  22.247  -2.625  1.00 63.78  ? 96   SER A CA    1 
ATOM   757  C  C     . SER A 1 96  ? 17.852  21.230  -2.885  1.00 64.04  ? 96   SER A C     1 
ATOM   758  O  O     . SER A 1 96  ? 17.580  20.044  -3.016  1.00 64.51  ? 96   SER A O     1 
ATOM   759  C  CB    . SER A 1 96  ? 16.102  21.989  -1.271  1.00 63.71  ? 96   SER A CB    1 
ATOM   760  O  OG    . SER A 1 96  ? 17.060  22.080  -0.228  1.00 63.48  ? 96   SER A OG    1 
ATOM   761  N  N     . GLU A 1 97  ? 19.084  21.707  -3.001  1.00 64.47  ? 97   GLU A N     1 
ATOM   762  C  CA    . GLU A 1 97  ? 20.228  20.830  -3.181  1.00 64.71  ? 97   GLU A CA    1 
ATOM   763  C  C     . GLU A 1 97  ? 20.402  20.083  -1.875  1.00 64.17  ? 97   GLU A C     1 
ATOM   764  O  O     . GLU A 1 97  ? 21.016  19.017  -1.839  1.00 64.33  ? 97   GLU A O     1 
ATOM   765  C  CB    . GLU A 1 97  ? 21.505  21.634  -3.476  1.00 65.09  ? 97   GLU A CB    1 
ATOM   766  C  CG    . GLU A 1 97  ? 21.279  23.053  -4.005  1.00 66.53  ? 97   GLU A CG    1 
ATOM   767  C  CD    . GLU A 1 97  ? 20.503  23.930  -3.023  1.00 68.41  ? 97   GLU A CD    1 
ATOM   768  O  OE1   . GLU A 1 97  ? 20.788  23.867  -1.804  1.00 68.91  ? 97   GLU A OE1   1 
ATOM   769  O  OE2   . GLU A 1 97  ? 19.601  24.671  -3.475  1.00 68.55  ? 97   GLU A OE2   1 
ATOM   770  N  N     . LYS A 1 98  ? 19.867  20.670  -0.803  1.00 63.40  ? 98   LYS A N     1 
ATOM   771  C  CA    . LYS A 1 98  ? 19.875  20.053  0.518   1.00 62.76  ? 98   LYS A CA    1 
ATOM   772  C  C     . LYS A 1 98  ? 18.764  19.012  0.604   1.00 61.88  ? 98   LYS A C     1 
ATOM   773  O  O     . LYS A 1 98  ? 17.696  19.240  1.173   1.00 61.45  ? 98   LYS A O     1 
ATOM   774  C  CB    . LYS A 1 98  ? 19.715  21.119  1.606   1.00 63.25  ? 98   LYS A CB    1 
ATOM   775  C  CG    . LYS A 1 98  ? 20.207  20.660  2.978   1.00 64.62  ? 98   LYS A CG    1 
ATOM   776  C  CD    . LYS A 1 98  ? 20.328  21.826  3.955   1.00 65.65  ? 98   LYS A CD    1 
ATOM   777  C  CE    . LYS A 1 98  ? 20.931  21.364  5.279   1.00 66.56  ? 98   LYS A CE    1 
ATOM   778  N  NZ    . LYS A 1 98  ? 21.695  22.470  5.963   1.00 66.85  ? 98   LYS A NZ    1 
ATOM   779  N  N     . ILE A 1 99  ? 19.029  17.856  0.012   1.00 61.16  ? 99   ILE A N     1 
ATOM   780  C  CA    . ILE A 1 99  ? 18.032  16.814  -0.098  1.00 60.26  ? 99   ILE A CA    1 
ATOM   781  C  C     . ILE A 1 99  ? 18.517  15.538  0.568   1.00 59.83  ? 99   ILE A C     1 
ATOM   782  O  O     . ILE A 1 99  ? 19.689  15.184  0.493   1.00 59.98  ? 99   ILE A O     1 
ATOM   783  C  CB    . ILE A 1 99  ? 17.688  16.549  -1.573  1.00 60.28  ? 99   ILE A CB    1 
ATOM   784  C  CG1   . ILE A 1 99  ? 16.364  15.806  -1.698  1.00 59.69  ? 99   ILE A CG1   1 
ATOM   785  C  CG2   . ILE A 1 99  ? 18.818  15.792  -2.275  1.00 60.45  ? 99   ILE A CG2   1 
ATOM   786  C  CD1   . ILE A 1 99  ? 16.076  15.334  -3.121  1.00 59.58  ? 99   ILE A CD1   1 
ATOM   787  N  N     . GLU A 1 100 ? 17.618  14.854  1.257   1.00 59.45  ? 100  GLU A N     1 
ATOM   788  C  CA    . GLU A 1 100 ? 17.930  13.535  1.742   1.00 58.51  ? 100  GLU A CA    1 
ATOM   789  C  C     . GLU A 1 100 ? 17.027  12.527  1.064   1.00 58.41  ? 100  GLU A C     1 
ATOM   790  O  O     . GLU A 1 100 ? 15.829  12.446  1.332   1.00 58.44  ? 100  GLU A O     1 
ATOM   791  C  CB    . GLU A 1 100 ? 17.795  13.458  3.249   1.00 58.67  ? 100  GLU A CB    1 
ATOM   792  C  CG    . GLU A 1 100 ? 17.928  12.070  3.804   1.00 58.53  ? 100  GLU A CG    1 
ATOM   793  C  CD    . GLU A 1 100 ? 17.969  12.051  5.330   1.00 61.81  ? 100  GLU A CD    1 
ATOM   794  O  OE1   . GLU A 1 100 ? 18.208  13.107  5.963   1.00 61.37  ? 100  GLU A OE1   1 
ATOM   795  O  OE2   . GLU A 1 100 ? 17.760  10.965  5.905   1.00 64.45  ? 100  GLU A OE2   1 
ATOM   796  N  N     . ILE A 1 101 ? 17.623  11.752  0.171   1.00 58.04  ? 101  ILE A N     1 
ATOM   797  C  CA    . ILE A 1 101 ? 16.925  10.676  -0.458  1.00 57.56  ? 101  ILE A CA    1 
ATOM   798  C  C     . ILE A 1 101 ? 16.853  9.532   0.534   1.00 57.65  ? 101  ILE A C     1 
ATOM   799  O  O     . ILE A 1 101 ? 17.858  8.908   0.843   1.00 58.08  ? 101  ILE A O     1 
ATOM   800  C  CB    . ILE A 1 101 ? 17.613  10.275  -1.739  1.00 57.28  ? 101  ILE A CB    1 
ATOM   801  C  CG1   . ILE A 1 101 ? 17.600  11.474  -2.682  1.00 56.17  ? 101  ILE A CG1   1 
ATOM   802  C  CG2   . ILE A 1 101 ? 16.909  9.069   -2.352  1.00 58.29  ? 101  ILE A CG2   1 
ATOM   803  C  CD1   . ILE A 1 101 ? 18.226  11.212  -4.012  1.00 57.12  ? 101  ILE A CD1   1 
ATOM   804  N  N     . ALA A 1 102 ? 15.655  9.283   1.054   1.00 56.98  ? 102  ALA A N     1 
ATOM   805  C  CA    . ALA A 1 102 ? 15.487  8.331   2.121   1.00 56.42  ? 102  ALA A CA    1 
ATOM   806  C  C     . ALA A 1 102 ? 15.160  6.962   1.557   1.00 56.87  ? 102  ALA A C     1 
ATOM   807  O  O     . ALA A 1 102 ? 15.355  5.924   2.225   1.00 57.67  ? 102  ALA A O     1 
ATOM   808  C  CB    . ALA A 1 102 ? 14.401  8.789   3.048   1.00 56.26  ? 102  ALA A CB    1 
ATOM   809  N  N     . SER A 1 103 ? 14.648  6.942   0.334   1.00 55.82  ? 103  SER A N     1 
ATOM   810  C  CA    . SER A 1 103 ? 14.309  5.679   -0.273  1.00 55.08  ? 103  SER A CA    1 
ATOM   811  C  C     . SER A 1 103 ? 14.080  5.895   -1.734  1.00 54.51  ? 103  SER A C     1 
ATOM   812  O  O     . SER A 1 103 ? 14.290  6.991   -2.243  1.00 54.86  ? 103  SER A O     1 
ATOM   813  C  CB    . SER A 1 103 ? 13.051  5.107   0.363   1.00 54.85  ? 103  SER A CB    1 
ATOM   814  O  OG    . SER A 1 103 ? 11.914  5.527   -0.356  1.00 56.59  ? 103  SER A OG    1 
ATOM   815  N  N     . ILE A 1 104 ? 13.641  4.849   -2.411  1.00 54.22  ? 104  ILE A N     1 
ATOM   816  C  CA    . ILE A 1 104 ? 13.378  4.940   -3.829  1.00 54.07  ? 104  ILE A CA    1 
ATOM   817  C  C     . ILE A 1 104 ? 12.302  5.976   -4.100  1.00 54.41  ? 104  ILE A C     1 
ATOM   818  O  O     . ILE A 1 104 ? 12.240  6.552   -5.192  1.00 54.65  ? 104  ILE A O     1 
ATOM   819  C  CB    . ILE A 1 104 ? 12.999  3.575   -4.440  1.00 53.76  ? 104  ILE A CB    1 
ATOM   820  C  CG1   . ILE A 1 104 ? 13.030  3.644   -5.962  1.00 54.66  ? 104  ILE A CG1   1 
ATOM   821  C  CG2   . ILE A 1 104 ? 11.647  3.080   -3.926  1.00 54.43  ? 104  ILE A CG2   1 
ATOM   822  C  CD1   . ILE A 1 104 ? 13.300  2.314   -6.609  1.00 57.07  ? 104  ILE A CD1   1 
ATOM   823  N  N     . ASP A 1 105 ? 11.463  6.245   -3.105  1.00 54.26  ? 105  ASP A N     1 
ATOM   824  C  CA    . ASP A 1 105 ? 10.335  7.096   -3.391  1.00 54.59  ? 105  ASP A CA    1 
ATOM   825  C  C     . ASP A 1 105 ? 10.142  8.246   -2.405  1.00 54.74  ? 105  ASP A C     1 
ATOM   826  O  O     . ASP A 1 105 ? 9.084   8.855   -2.344  1.00 55.00  ? 105  ASP A O     1 
ATOM   827  C  CB    . ASP A 1 105 ? 9.069   6.255   -3.486  1.00 54.08  ? 105  ASP A CB    1 
ATOM   828  C  CG    . ASP A 1 105 ? 8.478   5.964   -2.155  1.00 53.64  ? 105  ASP A CG    1 
ATOM   829  O  OD1   . ASP A 1 105 ? 9.221   5.639   -1.202  1.00 56.51  ? 105  ASP A OD1   1 
ATOM   830  O  OD2   . ASP A 1 105 ? 7.245   6.039   -2.059  1.00 48.85  ? 105  ASP A OD2   1 
ATOM   831  N  N     . GLU A 1 106 ? 11.153  8.552   -1.622  1.00 54.97  ? 106  GLU A N     1 
ATOM   832  C  CA    . GLU A 1 106 ? 10.971  9.649   -0.697  1.00 55.16  ? 106  GLU A CA    1 
ATOM   833  C  C     . GLU A 1 106 ? 12.224  10.415  -0.471  1.00 54.86  ? 106  GLU A C     1 
ATOM   834  O  O     . GLU A 1 106 ? 13.317  9.857   -0.471  1.00 55.61  ? 106  GLU A O     1 
ATOM   835  C  CB    . GLU A 1 106 ? 10.376  9.182   0.612   1.00 55.33  ? 106  GLU A CB    1 
ATOM   836  C  CG    . GLU A 1 106 ? 10.844  7.861   1.059   1.00 56.86  ? 106  GLU A CG    1 
ATOM   837  C  CD    . GLU A 1 106 ? 10.197  7.480   2.338   1.00 58.93  ? 106  GLU A CD    1 
ATOM   838  O  OE1   . GLU A 1 106 ? 10.891  7.539   3.373   1.00 60.82  ? 106  GLU A OE1   1 
ATOM   839  O  OE2   . GLU A 1 106 ? 8.980   7.160   2.309   1.00 59.97  ? 106  GLU A OE2   1 
ATOM   840  N  N     . ALA A 1 107 ? 12.063  11.722  -0.363  1.00 54.24  ? 107  ALA A N     1 
ATOM   841  C  CA    . ALA A 1 107 ? 13.176  12.581  -0.069  1.00 53.82  ? 107  ALA A CA    1 
ATOM   842  C  C     . ALA A 1 107 ? 12.726  13.569  0.977   1.00 53.86  ? 107  ALA A C     1 
ATOM   843  O  O     . ALA A 1 107 ? 11.554  13.915  1.051   1.00 53.83  ? 107  ALA A O     1 
ATOM   844  C  CB    . ALA A 1 107 ? 13.640  13.289  -1.323  1.00 53.41  ? 107  ALA A CB    1 
ATOM   845  N  N     . TYR A 1 108 ? 13.652  13.973  1.823   1.00 54.09  ? 108  TYR A N     1 
ATOM   846  C  CA    . TYR A 1 108 ? 13.471  15.173  2.603   1.00 54.52  ? 108  TYR A CA    1 
ATOM   847  C  C     . TYR A 1 108 ? 14.244  16.285  1.929   1.00 54.34  ? 108  TYR A C     1 
ATOM   848  O  O     . TYR A 1 108 ? 15.397  16.104  1.560   1.00 53.55  ? 108  TYR A O     1 
ATOM   849  C  CB    . TYR A 1 108 ? 13.998  14.979  4.016   1.00 54.90  ? 108  TYR A CB    1 
ATOM   850  C  CG    . TYR A 1 108 ? 13.412  13.782  4.683   1.00 55.09  ? 108  TYR A CG    1 
ATOM   851  C  CD1   . TYR A 1 108 ? 12.319  13.905  5.520   1.00 55.76  ? 108  TYR A CD1   1 
ATOM   852  C  CD2   . TYR A 1 108 ? 13.943  12.521  4.466   1.00 56.71  ? 108  TYR A CD2   1 
ATOM   853  C  CE1   . TYR A 1 108 ? 11.772  12.802  6.133   1.00 56.75  ? 108  TYR A CE1   1 
ATOM   854  C  CE2   . TYR A 1 108 ? 13.406  11.413  5.078   1.00 56.99  ? 108  TYR A CE2   1 
ATOM   855  C  CZ    . TYR A 1 108 ? 12.320  11.563  5.914   1.00 57.52  ? 108  TYR A CZ    1 
ATOM   856  O  OH    . TYR A 1 108 ? 11.759  10.458  6.515   1.00 60.01  ? 108  TYR A OH    1 
ATOM   857  N  N     . LEU A 1 109 ? 13.581  17.421  1.748   1.00 54.64  ? 109  LEU A N     1 
ATOM   858  C  CA    . LEU A 1 109 ? 14.228  18.640  1.336   1.00 55.14  ? 109  LEU A CA    1 
ATOM   859  C  C     . LEU A 1 109 ? 14.206  19.595  2.515   1.00 55.52  ? 109  LEU A C     1 
ATOM   860  O  O     . LEU A 1 109 ? 13.151  19.915  3.060   1.00 56.04  ? 109  LEU A O     1 
ATOM   861  C  CB    . LEU A 1 109 ? 13.492  19.288  0.163   1.00 55.19  ? 109  LEU A CB    1 
ATOM   862  C  CG    . LEU A 1 109 ? 13.460  18.664  -1.231  1.00 55.53  ? 109  LEU A CG    1 
ATOM   863  C  CD1   . LEU A 1 109 ? 12.645  17.371  -1.273  1.00 55.93  ? 109  LEU A CD1   1 
ATOM   864  C  CD2   . LEU A 1 109 ? 12.872  19.684  -2.196  1.00 55.41  ? 109  LEU A CD2   1 
ATOM   865  N  N     . ASP A 1 110 ? 15.380  20.028  2.929   1.00 56.17  ? 110  ASP A N     1 
ATOM   866  C  CA    . ASP A 1 110 ? 15.495  21.167  3.829   1.00 56.49  ? 110  ASP A CA    1 
ATOM   867  C  C     . ASP A 1 110 ? 15.219  22.389  2.974   1.00 56.18  ? 110  ASP A C     1 
ATOM   868  O  O     . ASP A 1 110 ? 15.964  22.676  2.049   1.00 55.69  ? 110  ASP A O     1 
ATOM   869  C  CB    . ASP A 1 110 ? 16.906  21.244  4.391   1.00 56.65  ? 110  ASP A CB    1 
ATOM   870  C  CG    . ASP A 1 110 ? 17.024  22.208  5.548   1.00 58.54  ? 110  ASP A CG    1 
ATOM   871  O  OD1   . ASP A 1 110 ? 16.366  23.269  5.519   1.00 59.19  ? 110  ASP A OD1   1 
ATOM   872  O  OD2   . ASP A 1 110 ? 17.794  21.903  6.487   1.00 61.51  ? 110  ASP A OD2   1 
ATOM   873  N  N     . ILE A 1 111 ? 14.124  23.083  3.253   1.00 56.10  ? 111  ILE A N     1 
ATOM   874  C  CA    . ILE A 1 111 ? 13.724  24.190  2.407   1.00 55.96  ? 111  ILE A CA    1 
ATOM   875  C  C     . ILE A 1 111 ? 13.731  25.500  3.183   1.00 56.35  ? 111  ILE A C     1 
ATOM   876  O  O     . ILE A 1 111 ? 13.107  26.469  2.781   1.00 56.47  ? 111  ILE A O     1 
ATOM   877  C  CB    . ILE A 1 111 ? 12.353  23.935  1.744   1.00 55.96  ? 111  ILE A CB    1 
ATOM   878  C  CG1   . ILE A 1 111 ? 11.298  23.564  2.789   1.00 55.22  ? 111  ILE A CG1   1 
ATOM   879  C  CG2   . ILE A 1 111 ? 12.467  22.833  0.703   1.00 55.50  ? 111  ILE A CG2   1 
ATOM   880  C  CD1   . ILE A 1 111 ? 9.875   23.800  2.325   1.00 54.01  ? 111  ILE A CD1   1 
ATOM   881  N  N     . SER A 1 112 ? 14.472  25.516  4.286   1.00 56.67  ? 112  SER A N     1 
ATOM   882  C  CA    . SER A 1 112 ? 14.611  26.688  5.137   1.00 56.78  ? 112  SER A CA    1 
ATOM   883  C  C     . SER A 1 112 ? 15.083  27.939  4.381   1.00 57.23  ? 112  SER A C     1 
ATOM   884  O  O     . SER A 1 112 ? 14.733  29.063  4.743   1.00 57.50  ? 112  SER A O     1 
ATOM   885  C  CB    . SER A 1 112 ? 15.596  26.376  6.266   1.00 56.72  ? 112  SER A CB    1 
ATOM   886  O  OG    . SER A 1 112 ? 15.314  25.124  6.864   1.00 56.20  ? 112  SER A OG    1 
ATOM   887  N  N     . ASP A 1 113 ? 15.898  27.742  3.350   1.00 57.48  ? 113  ASP A N     1 
ATOM   888  C  CA    . ASP A 1 113 ? 16.455  28.852  2.582   1.00 57.39  ? 113  ASP A CA    1 
ATOM   889  C  C     . ASP A 1 113 ? 15.595  29.178  1.370   1.00 57.49  ? 113  ASP A C     1 
ATOM   890  O  O     . ASP A 1 113 ? 15.796  30.192  0.702   1.00 58.17  ? 113  ASP A O     1 
ATOM   891  C  CB    . ASP A 1 113 ? 17.857  28.501  2.102   1.00 57.06  ? 113  ASP A CB    1 
ATOM   892  C  CG    . ASP A 1 113 ? 18.807  28.215  3.242   1.00 57.87  ? 113  ASP A CG    1 
ATOM   893  O  OD1   . ASP A 1 113 ? 18.998  29.112  4.105   1.00 56.85  ? 113  ASP A OD1   1 
ATOM   894  O  OD2   . ASP A 1 113 ? 19.368  27.089  3.260   1.00 58.44  ? 113  ASP A OD2   1 
ATOM   895  N  N     . LYS A 1 114 ? 14.654  28.300  1.070   1.00 57.40  ? 114  LYS A N     1 
ATOM   896  C  CA    . LYS A 1 114 ? 13.805  28.473  -0.087  1.00 57.18  ? 114  LYS A CA    1 
ATOM   897  C  C     . LYS A 1 114 ? 12.548  29.162  0.375   1.00 56.92  ? 114  LYS A C     1 
ATOM   898  O  O     . LYS A 1 114 ? 11.870  29.832  -0.402  1.00 57.10  ? 114  LYS A O     1 
ATOM   899  C  CB    . LYS A 1 114 ? 13.454  27.106  -0.679  1.00 57.34  ? 114  LYS A CB    1 
ATOM   900  C  CG    . LYS A 1 114 ? 14.653  26.198  -0.821  1.00 57.54  ? 114  LYS A CG    1 
ATOM   901  C  CD    . LYS A 1 114 ? 15.614  26.755  -1.857  1.00 59.25  ? 114  LYS A CD    1 
ATOM   902  C  CE    . LYS A 1 114 ? 16.883  25.943  -1.943  1.00 60.29  ? 114  LYS A CE    1 
ATOM   903  N  NZ    . LYS A 1 114 ? 17.447  26.084  -3.315  1.00 62.35  ? 114  LYS A NZ    1 
ATOM   904  N  N     . VAL A 1 115 ? 12.245  28.993  1.657   1.00 56.43  ? 115  VAL A N     1 
ATOM   905  C  CA    . VAL A 1 115 ? 10.997  29.476  2.214   1.00 56.03  ? 115  VAL A CA    1 
ATOM   906  C  C     . VAL A 1 115 ? 11.202  30.180  3.555   1.00 56.02  ? 115  VAL A C     1 
ATOM   907  O  O     . VAL A 1 115 ? 12.109  29.846  4.316   1.00 55.91  ? 115  VAL A O     1 
ATOM   908  C  CB    . VAL A 1 115 ? 9.987   28.327  2.391   1.00 55.78  ? 115  VAL A CB    1 
ATOM   909  C  CG1   . VAL A 1 115 ? 9.701   27.658  1.060   1.00 55.64  ? 115  VAL A CG1   1 
ATOM   910  C  CG2   . VAL A 1 115 ? 10.489  27.332  3.415   1.00 54.78  ? 115  VAL A CG2   1 
ATOM   911  N  N     . ARG A 1 116 ? 10.348  31.151  3.846   1.00 55.90  ? 116  ARG A N     1 
ATOM   912  C  CA    . ARG A 1 116 ? 10.424  31.848  5.125   1.00 56.16  ? 116  ARG A CA    1 
ATOM   913  C  C     . ARG A 1 116 ? 9.434   31.311  6.141   1.00 55.84  ? 116  ARG A C     1 
ATOM   914  O  O     . ARG A 1 116 ? 9.481   31.685  7.321   1.00 56.11  ? 116  ARG A O     1 
ATOM   915  C  CB    . ARG A 1 116 ? 10.219  33.363  4.961   1.00 56.18  ? 116  ARG A CB    1 
ATOM   916  C  CG    . ARG A 1 116 ? 11.446  34.170  5.370   1.00 57.70  ? 116  ARG A CG    1 
ATOM   917  C  CD    . ARG A 1 116 ? 11.185  35.666  5.326   1.00 60.50  ? 116  ARG A CD    1 
ATOM   918  N  NE    . ARG A 1 116 ? 11.100  36.146  3.952   1.00 62.44  ? 116  ARG A NE    1 
ATOM   919  C  CZ    . ARG A 1 116 ? 11.206  37.421  3.597   1.00 64.24  ? 116  ARG A CZ    1 
ATOM   920  N  NH1   . ARG A 1 116 ? 11.410  38.356  4.516   1.00 64.76  ? 116  ARG A NH1   1 
ATOM   921  N  NH2   . ARG A 1 116 ? 11.119  37.764  2.318   1.00 65.78  ? 116  ARG A NH2   1 
ATOM   922  N  N     . ASP A 1 117 ? 8.527   30.449  5.689   1.00 54.99  ? 117  ASP A N     1 
ATOM   923  C  CA    . ASP A 1 117 ? 7.446   30.017  6.558   1.00 54.21  ? 117  ASP A CA    1 
ATOM   924  C  C     . ASP A 1 117 ? 6.674   28.842  6.004   1.00 53.81  ? 117  ASP A C     1 
ATOM   925  O  O     . ASP A 1 117 ? 6.824   28.461  4.846   1.00 53.86  ? 117  ASP A O     1 
ATOM   926  C  CB    . ASP A 1 117 ? 6.500   31.188  6.887   1.00 54.18  ? 117  ASP A CB    1 
ATOM   927  C  CG    . ASP A 1 117 ? 5.832   31.787  5.655   1.00 54.08  ? 117  ASP A CG    1 
ATOM   928  O  OD1   . ASP A 1 117 ? 5.326   32.924  5.755   1.00 55.06  ? 117  ASP A OD1   1 
ATOM   929  O  OD2   . ASP A 1 117 ? 5.794   31.137  4.592   1.00 54.45  ? 117  ASP A OD2   1 
ATOM   930  N  N     . TYR A 1 118 ? 5.838   28.271  6.854   1.00 53.32  ? 118  TYR A N     1 
ATOM   931  C  CA    . TYR A 1 118 ? 5.100   27.085  6.503   1.00 53.32  ? 118  TYR A CA    1 
ATOM   932  C  C     . TYR A 1 118 ? 4.177   27.292  5.309   1.00 53.20  ? 118  TYR A C     1 
ATOM   933  O  O     . TYR A 1 118 ? 3.832   26.352  4.608   1.00 53.90  ? 118  TYR A O     1 
ATOM   934  C  CB    . TYR A 1 118 ? 4.356   26.553  7.728   1.00 53.22  ? 118  TYR A CB    1 
ATOM   935  C  CG    . TYR A 1 118 ? 5.273   25.781  8.643   1.00 53.12  ? 118  TYR A CG    1 
ATOM   936  C  CD1   . TYR A 1 118 ? 5.946   24.658  8.184   1.00 53.98  ? 118  TYR A CD1   1 
ATOM   937  C  CD2   . TYR A 1 118 ? 5.490   26.183  9.952   1.00 53.83  ? 118  TYR A CD2   1 
ATOM   938  C  CE1   . TYR A 1 118 ? 6.795   23.945  9.006   1.00 54.66  ? 118  TYR A CE1   1 
ATOM   939  C  CE2   . TYR A 1 118 ? 6.350   25.483  10.784  1.00 54.22  ? 118  TYR A CE2   1 
ATOM   940  C  CZ    . TYR A 1 118 ? 6.993   24.366  10.305  1.00 55.09  ? 118  TYR A CZ    1 
ATOM   941  O  OH    . TYR A 1 118 ? 7.836   23.664  11.126  1.00 56.89  ? 118  TYR A OH    1 
ATOM   942  N  N     . ARG A 1 119 ? 3.816   28.534  5.055   1.00 53.06  ? 119  ARG A N     1 
ATOM   943  C  CA    . ARG A 1 119 ? 2.886   28.855  3.997   1.00 52.84  ? 119  ARG A CA    1 
ATOM   944  C  C     . ARG A 1 119 ? 3.589   28.818  2.648   1.00 52.77  ? 119  ARG A C     1 
ATOM   945  O  O     . ARG A 1 119 ? 3.045   28.329  1.655   1.00 52.91  ? 119  ARG A O     1 
ATOM   946  C  CB    . ARG A 1 119 ? 2.315   30.233  4.269   1.00 53.00  ? 119  ARG A CB    1 
ATOM   947  C  CG    . ARG A 1 119 ? 1.205   30.640  3.355   1.00 53.55  ? 119  ARG A CG    1 
ATOM   948  C  CD    . ARG A 1 119 ? 0.875   32.089  3.568   1.00 53.86  ? 119  ARG A CD    1 
ATOM   949  N  NE    . ARG A 1 119 ? 2.050   32.961  3.480   1.00 54.19  ? 119  ARG A NE    1 
ATOM   950  C  CZ    . ARG A 1 119 ? 2.669   33.280  2.347   1.00 53.15  ? 119  ARG A CZ    1 
ATOM   951  N  NH1   . ARG A 1 119 ? 2.244   32.780  1.193   1.00 52.52  ? 119  ARG A NH1   1 
ATOM   952  N  NH2   . ARG A 1 119 ? 3.714   34.095  2.369   1.00 52.73  ? 119  ARG A NH2   1 
ATOM   953  N  N     . GLU A 1 120 ? 4.809   29.340  2.624   1.00 52.44  ? 120  GLU A N     1 
ATOM   954  C  CA    . GLU A 1 120 ? 5.632   29.273  1.437   1.00 52.12  ? 120  GLU A CA    1 
ATOM   955  C  C     . GLU A 1 120 ? 6.061   27.839  1.191   1.00 51.61  ? 120  GLU A C     1 
ATOM   956  O  O     . GLU A 1 120 ? 6.098   27.392  0.048   1.00 51.33  ? 120  GLU A O     1 
ATOM   957  C  CB    . GLU A 1 120 ? 6.846   30.184  1.569   1.00 52.14  ? 120  GLU A CB    1 
ATOM   958  C  CG    . GLU A 1 120 ? 6.546   31.618  1.202   1.00 52.57  ? 120  GLU A CG    1 
ATOM   959  C  CD    . GLU A 1 120 ? 7.687   32.539  1.521   1.00 53.39  ? 120  GLU A CD    1 
ATOM   960  O  OE1   . GLU A 1 120 ? 8.739   32.040  1.970   1.00 53.89  ? 120  GLU A OE1   1 
ATOM   961  O  OE2   . GLU A 1 120 ? 7.536   33.764  1.323   1.00 54.95  ? 120  GLU A OE2   1 
ATOM   962  N  N     . ALA A 1 121 ? 6.388   27.141  2.278   1.00 51.14  ? 121  ALA A N     1 
ATOM   963  C  CA    . ALA A 1 121 ? 6.686   25.718  2.252   1.00 50.85  ? 121  ALA A CA    1 
ATOM   964  C  C     . ALA A 1 121 ? 5.544   24.963  1.594   1.00 50.57  ? 121  ALA A C     1 
ATOM   965  O  O     . ALA A 1 121 ? 5.742   24.206  0.658   1.00 50.42  ? 121  ALA A O     1 
ATOM   966  C  CB    . ALA A 1 121 ? 6.901   25.203  3.664   1.00 50.94  ? 121  ALA A CB    1 
ATOM   967  N  N     . TYR A 1 122 ? 4.342   25.170  2.103   1.00 50.36  ? 122  TYR A N     1 
ATOM   968  C  CA    . TYR A 1 122 ? 3.167   24.620  1.479   1.00 50.53  ? 122  TYR A CA    1 
ATOM   969  C  C     . TYR A 1 122 ? 3.108   24.977  -0.008  1.00 50.83  ? 122  TYR A C     1 
ATOM   970  O  O     . TYR A 1 122 ? 2.914   24.127  -0.852  1.00 51.76  ? 122  TYR A O     1 
ATOM   971  C  CB    . TYR A 1 122 ? 1.910   25.107  2.194   1.00 50.35  ? 122  TYR A CB    1 
ATOM   972  C  CG    . TYR A 1 122 ? 0.663   24.535  1.590   1.00 50.23  ? 122  TYR A CG    1 
ATOM   973  C  CD1   . TYR A 1 122 ? 0.171   23.308  2.011   1.00 49.46  ? 122  TYR A CD1   1 
ATOM   974  C  CD2   . TYR A 1 122 ? -0.018  25.214  0.581   1.00 49.76  ? 122  TYR A CD2   1 
ATOM   975  C  CE1   . TYR A 1 122 ? -0.959  22.776  1.450   1.00 50.61  ? 122  TYR A CE1   1 
ATOM   976  C  CE2   . TYR A 1 122 ? -1.148  24.687  0.008   1.00 50.24  ? 122  TYR A CE2   1 
ATOM   977  C  CZ    . TYR A 1 122 ? -1.614  23.466  0.446   1.00 50.92  ? 122  TYR A CZ    1 
ATOM   978  O  OH    . TYR A 1 122 ? -2.749  22.925  -0.112  1.00 52.95  ? 122  TYR A OH    1 
ATOM   979  N  N     . ASN A 1 123 ? 3.261   26.243  -0.338  1.00 51.70  ? 123  ASN A N     1 
ATOM   980  C  CA    . ASN A 1 123 ? 3.229   26.640  -1.732  1.00 51.90  ? 123  ASN A CA    1 
ATOM   981  C  C     . ASN A 1 123 ? 4.301   25.945  -2.560  1.00 52.28  ? 123  ASN A C     1 
ATOM   982  O  O     . ASN A 1 123 ? 4.052   25.565  -3.698  1.00 52.44  ? 123  ASN A O     1 
ATOM   983  C  CB    . ASN A 1 123 ? 3.350   28.150  -1.853  1.00 51.66  ? 123  ASN A CB    1 
ATOM   984  C  CG    . ASN A 1 123 ? 2.095   28.861  -1.418  1.00 50.98  ? 123  ASN A CG    1 
ATOM   985  O  OD1   . ASN A 1 123 ? 1.027   28.254  -1.294  1.00 48.48  ? 123  ASN A OD1   1 
ATOM   986  N  ND2   . ASN A 1 123 ? 2.215   30.160  -1.181  1.00 50.18  ? 123  ASN A ND2   1 
ATOM   987  N  N     . LEU A 1 124 ? 5.487   25.786  -1.978  1.00 52.57  ? 124  LEU A N     1 
ATOM   988  C  CA    . LEU A 1 124 ? 6.577   25.071  -2.618  1.00 52.91  ? 124  LEU A CA    1 
ATOM   989  C  C     . LEU A 1 124 ? 6.178   23.614  -2.763  1.00 53.07  ? 124  LEU A C     1 
ATOM   990  O  O     . LEU A 1 124 ? 6.443   22.975  -3.778  1.00 53.39  ? 124  LEU A O     1 
ATOM   991  C  CB    . LEU A 1 124 ? 7.841   25.173  -1.770  1.00 53.04  ? 124  LEU A CB    1 
ATOM   992  C  CG    . LEU A 1 124 ? 9.146   24.787  -2.459  1.00 54.09  ? 124  LEU A CG    1 
ATOM   993  C  CD1   . LEU A 1 124 ? 9.521   25.851  -3.475  1.00 55.69  ? 124  LEU A CD1   1 
ATOM   994  C  CD2   . LEU A 1 124 ? 10.266  24.605  -1.444  1.00 53.57  ? 124  LEU A CD2   1 
ATOM   995  N  N     . GLY A 1 125 ? 5.535   23.089  -1.731  1.00 53.10  ? 125  GLY A N     1 
ATOM   996  C  CA    . GLY A 1 125 ? 5.029   21.736  -1.770  1.00 53.28  ? 125  GLY A CA    1 
ATOM   997  C  C     . GLY A 1 125 ? 4.129   21.524  -2.967  1.00 53.42  ? 125  GLY A C     1 
ATOM   998  O  O     . GLY A 1 125 ? 4.233   20.510  -3.637  1.00 53.34  ? 125  GLY A O     1 
ATOM   999  N  N     . LEU A 1 126 ? 3.241   22.481  -3.228  1.00 53.81  ? 126  LEU A N     1 
ATOM   1000 C  CA    . LEU A 1 126 ? 2.304   22.395  -4.349  1.00 54.29  ? 126  LEU A CA    1 
ATOM   1001 C  C     . LEU A 1 126 ? 3.041   22.458  -5.663  1.00 54.66  ? 126  LEU A C     1 
ATOM   1002 O  O     . LEU A 1 126 ? 2.697   21.772  -6.639  1.00 54.91  ? 126  LEU A O     1 
ATOM   1003 C  CB    . LEU A 1 126 ? 1.328   23.564  -4.308  1.00 53.99  ? 126  LEU A CB    1 
ATOM   1004 C  CG    . LEU A 1 126 ? 0.368   23.566  -3.129  1.00 53.88  ? 126  LEU A CG    1 
ATOM   1005 C  CD1   . LEU A 1 126 ? -0.601  24.730  -3.256  1.00 51.61  ? 126  LEU A CD1   1 
ATOM   1006 C  CD2   . LEU A 1 126 ? -0.361  22.227  -3.054  1.00 52.42  ? 126  LEU A CD2   1 
ATOM   1007 N  N     . GLU A 1 127 ? 4.046   23.319  -5.669  1.00 54.88  ? 127  GLU A N     1 
ATOM   1008 C  CA    . GLU A 1 127 ? 4.884   23.565  -6.808  1.00 55.14  ? 127  GLU A CA    1 
ATOM   1009 C  C     . GLU A 1 127 ? 5.642   22.293  -7.111  1.00 54.73  ? 127  GLU A C     1 
ATOM   1010 O  O     . GLU A 1 127 ? 5.665   21.818  -8.247  1.00 55.25  ? 127  GLU A O     1 
ATOM   1011 C  CB    . GLU A 1 127 ? 5.844   24.679  -6.428  1.00 55.69  ? 127  GLU A CB    1 
ATOM   1012 C  CG    . GLU A 1 127 ? 6.643   25.283  -7.550  1.00 57.13  ? 127  GLU A CG    1 
ATOM   1013 C  CD    . GLU A 1 127 ? 7.192   26.618  -7.144  1.00 58.31  ? 127  GLU A CD    1 
ATOM   1014 O  OE1   . GLU A 1 127 ? 6.498   27.335  -6.385  1.00 59.28  ? 127  GLU A OE1   1 
ATOM   1015 O  OE2   . GLU A 1 127 ? 8.311   26.952  -7.572  1.00 60.16  ? 127  GLU A OE2   1 
ATOM   1016 N  N     . ILE A 1 128 ? 6.246   21.730  -6.075  1.00 54.06  ? 128  ILE A N     1 
ATOM   1017 C  CA    . ILE A 1 128 ? 6.950   20.471  -6.190  1.00 53.13  ? 128  ILE A CA    1 
ATOM   1018 C  C     . ILE A 1 128 ? 6.035   19.357  -6.684  1.00 53.40  ? 128  ILE A C     1 
ATOM   1019 O  O     . ILE A 1 128 ? 6.430   18.527  -7.506  1.00 53.98  ? 128  ILE A O     1 
ATOM   1020 C  CB    . ILE A 1 128 ? 7.525   20.069  -4.838  1.00 53.05  ? 128  ILE A CB    1 
ATOM   1021 C  CG1   . ILE A 1 128 ? 8.768   20.890  -4.537  1.00 51.02  ? 128  ILE A CG1   1 
ATOM   1022 C  CG2   . ILE A 1 128 ? 7.759   18.539  -4.771  1.00 51.82  ? 128  ILE A CG2   1 
ATOM   1023 C  CD1   . ILE A 1 128 ? 9.456   20.497  -3.250  1.00 50.65  ? 128  ILE A CD1   1 
ATOM   1024 N  N     . LYS A 1 129 ? 4.820   19.318  -6.160  1.00 52.85  ? 129  LYS A N     1 
ATOM   1025 C  CA    . LYS A 1 129 ? 3.862   18.316  -6.581  1.00 53.11  ? 129  LYS A CA    1 
ATOM   1026 C  C     . LYS A 1 129 ? 3.549   18.476  -8.056  1.00 53.59  ? 129  LYS A C     1 
ATOM   1027 O  O     . LYS A 1 129 ? 3.578   17.518  -8.806  1.00 54.49  ? 129  LYS A O     1 
ATOM   1028 C  CB    . LYS A 1 129 ? 2.592   18.376  -5.722  1.00 52.28  ? 129  LYS A CB    1 
ATOM   1029 C  CG    . LYS A 1 129 ? 2.790   17.716  -4.375  1.00 51.29  ? 129  LYS A CG    1 
ATOM   1030 C  CD    . LYS A 1 129 ? 1.675   18.041  -3.380  1.00 49.54  ? 129  LYS A CD    1 
ATOM   1031 C  CE    . LYS A 1 129 ? 0.324   17.546  -3.836  1.00 45.64  ? 129  LYS A CE    1 
ATOM   1032 N  NZ    . LYS A 1 129 ? 0.310   16.059  -3.963  1.00 43.46  ? 129  LYS A NZ    1 
ATOM   1033 N  N     . ASN A 1 130 ? 3.272   19.699  -8.471  1.00 54.43  ? 130  ASN A N     1 
ATOM   1034 C  CA    . ASN A 1 130 ? 2.960   19.977  -9.867  1.00 54.91  ? 130  ASN A CA    1 
ATOM   1035 C  C     . ASN A 1 130 ? 4.100   19.662  -10.814 1.00 54.60  ? 130  ASN A C     1 
ATOM   1036 O  O     . ASN A 1 130 ? 3.855   19.140  -11.890 1.00 54.60  ? 130  ASN A O     1 
ATOM   1037 C  CB    . ASN A 1 130 ? 2.518   21.431  -10.049 1.00 55.01  ? 130  ASN A CB    1 
ATOM   1038 C  CG    . ASN A 1 130 ? 1.256   21.747  -9.290  1.00 56.90  ? 130  ASN A CG    1 
ATOM   1039 O  OD1   . ASN A 1 130 ? 0.227   21.092  -9.466  1.00 59.54  ? 130  ASN A OD1   1 
ATOM   1040 N  ND2   . ASN A 1 130 ? 1.323   22.757  -8.433  1.00 59.06  ? 130  ASN A ND2   1 
ATOM   1041 N  N     . LYS A 1 131 ? 5.332   19.982  -10.419 1.00 54.46  ? 131  LYS A N     1 
ATOM   1042 C  CA    . LYS A 1 131 ? 6.484   19.781  -11.296 1.00 54.73  ? 131  LYS A CA    1 
ATOM   1043 C  C     . LYS A 1 131 ? 6.650   18.306  -11.588 1.00 54.76  ? 131  LYS A C     1 
ATOM   1044 O  O     . LYS A 1 131 ? 6.875   17.905  -12.725 1.00 55.09  ? 131  LYS A O     1 
ATOM   1045 C  CB    . LYS A 1 131 ? 7.770   20.317  -10.665 1.00 54.85  ? 131  LYS A CB    1 
ATOM   1046 C  CG    . LYS A 1 131 ? 8.928   20.535  -11.655 1.00 55.68  ? 131  LYS A CG    1 
ATOM   1047 C  CD    . LYS A 1 131 ? 8.679   21.768  -12.545 1.00 57.37  ? 131  LYS A CD    1 
ATOM   1048 C  CE    . LYS A 1 131 ? 9.972   22.306  -13.126 1.00 58.79  ? 131  LYS A CE    1 
ATOM   1049 N  NZ    . LYS A 1 131 ? 9.735   23.233  -14.283 1.00 59.95  ? 131  LYS A NZ    1 
ATOM   1050 N  N     . ILE A 1 132 ? 6.536   17.501  -10.542 1.00 54.74  ? 132  ILE A N     1 
ATOM   1051 C  CA    . ILE A 1 132 ? 6.670   16.067  -10.659 1.00 54.38  ? 132  ILE A CA    1 
ATOM   1052 C  C     . ILE A 1 132 ? 5.510   15.516  -11.474 1.00 55.26  ? 132  ILE A C     1 
ATOM   1053 O  O     . ILE A 1 132 ? 5.675   14.570  -12.251 1.00 55.78  ? 132  ILE A O     1 
ATOM   1054 C  CB    . ILE A 1 132 ? 6.732   15.410  -9.269  1.00 54.02  ? 132  ILE A CB    1 
ATOM   1055 C  CG1   . ILE A 1 132 ? 7.915   15.971  -8.473  1.00 52.07  ? 132  ILE A CG1   1 
ATOM   1056 C  CG2   . ILE A 1 132 ? 6.822   13.901  -9.392  1.00 52.74  ? 132  ILE A CG2   1 
ATOM   1057 C  CD1   . ILE A 1 132 ? 7.982   15.466  -7.069  1.00 49.57  ? 132  ILE A CD1   1 
ATOM   1058 N  N     . LEU A 1 133 ? 4.333   16.104  -11.306 1.00 55.45  ? 133  LEU A N     1 
ATOM   1059 C  CA    . LEU A 1 133 ? 3.190   15.667  -12.078 1.00 55.88  ? 133  LEU A CA    1 
ATOM   1060 C  C     . LEU A 1 133 ? 3.371   16.080  -13.527 1.00 56.29  ? 133  LEU A C     1 
ATOM   1061 O  O     . LEU A 1 133 ? 3.046   15.325  -14.427 1.00 57.23  ? 133  LEU A O     1 
ATOM   1062 C  CB    . LEU A 1 133 ? 1.891   16.233  -11.507 1.00 56.01  ? 133  LEU A CB    1 
ATOM   1063 C  CG    . LEU A 1 133 ? 0.588   15.570  -11.958 1.00 55.09  ? 133  LEU A CG    1 
ATOM   1064 C  CD1   . LEU A 1 133 ? 0.591   14.099  -11.634 1.00 54.31  ? 133  LEU A CD1   1 
ATOM   1065 C  CD2   . LEU A 1 133 ? -0.580  16.242  -11.293 1.00 54.20  ? 133  LEU A CD2   1 
ATOM   1066 N  N     . GLU A 1 134 ? 3.901   17.275  -13.757 1.00 56.50  ? 134  GLU A N     1 
ATOM   1067 C  CA    . GLU A 1 134 ? 4.186   17.731  -15.105 1.00 56.61  ? 134  GLU A CA    1 
ATOM   1068 C  C     . GLU A 1 134 ? 5.228   16.825  -15.755 1.00 56.26  ? 134  GLU A C     1 
ATOM   1069 O  O     . GLU A 1 134 ? 5.043   16.331  -16.857 1.00 55.93  ? 134  GLU A O     1 
ATOM   1070 C  CB    . GLU A 1 134 ? 4.750   19.158  -15.082 1.00 57.18  ? 134  GLU A CB    1 
ATOM   1071 C  CG    . GLU A 1 134 ? 3.927   20.199  -14.317 1.00 59.45  ? 134  GLU A CG    1 
ATOM   1072 C  CD    . GLU A 1 134 ? 4.668   21.542  -14.167 1.00 61.99  ? 134  GLU A CD    1 
ATOM   1073 O  OE1   . GLU A 1 134 ? 5.765   21.696  -14.773 1.00 62.33  ? 134  GLU A OE1   1 
ATOM   1074 O  OE2   . GLU A 1 134 ? 4.153   22.433  -13.441 1.00 61.55  ? 134  GLU A OE2   1 
ATOM   1075 N  N     . LYS A 1 135 ? 6.331   16.621  -15.046 1.00 55.98  ? 135  LYS A N     1 
ATOM   1076 C  CA    . LYS A 1 135 ? 7.523   16.043  -15.621 1.00 55.90  ? 135  LYS A CA    1 
ATOM   1077 C  C     . LYS A 1 135 ? 7.450   14.532  -15.705 1.00 55.96  ? 135  LYS A C     1 
ATOM   1078 O  O     . LYS A 1 135 ? 7.938   13.938  -16.668 1.00 55.78  ? 135  LYS A O     1 
ATOM   1079 C  CB    . LYS A 1 135 ? 8.748   16.466  -14.809 1.00 55.98  ? 135  LYS A CB    1 
ATOM   1080 C  CG    . LYS A 1 135 ? 9.039   17.964  -14.869 1.00 56.67  ? 135  LYS A CG    1 
ATOM   1081 C  CD    . LYS A 1 135 ? 9.542   18.359  -16.244 1.00 56.81  ? 135  LYS A CD    1 
ATOM   1082 C  CE    . LYS A 1 135 ? 9.592   19.856  -16.431 1.00 56.80  ? 135  LYS A CE    1 
ATOM   1083 N  NZ    . LYS A 1 135 ? 9.853   20.170  -17.878 1.00 57.44  ? 135  LYS A NZ    1 
ATOM   1084 N  N     . GLU A 1 136 ? 6.832   13.921  -14.695 1.00 55.81  ? 136  GLU A N     1 
ATOM   1085 C  CA    . GLU A 1 136 ? 6.801   12.470  -14.571 1.00 55.52  ? 136  GLU A CA    1 
ATOM   1086 C  C     . GLU A 1 136 ? 5.400   11.909  -14.421 1.00 55.23  ? 136  GLU A C     1 
ATOM   1087 O  O     . GLU A 1 136 ? 5.238   10.708  -14.332 1.00 55.38  ? 136  GLU A O     1 
ATOM   1088 C  CB    . GLU A 1 136 ? 7.675   12.019  -13.392 1.00 55.41  ? 136  GLU A CB    1 
ATOM   1089 C  CG    . GLU A 1 136 ? 9.161   12.376  -13.547 1.00 56.00  ? 136  GLU A CG    1 
ATOM   1090 C  CD    . GLU A 1 136 ? 9.804   11.749  -14.789 1.00 58.59  ? 136  GLU A CD    1 
ATOM   1091 O  OE1   . GLU A 1 136 ? 9.441   10.605  -15.147 1.00 59.37  ? 136  GLU A OE1   1 
ATOM   1092 O  OE2   . GLU A 1 136 ? 10.685  12.393  -15.411 1.00 59.64  ? 136  GLU A OE2   1 
ATOM   1093 N  N     . LYS A 1 137 ? 4.387   12.771  -14.400 1.00 55.25  ? 137  LYS A N     1 
ATOM   1094 C  CA    . LYS A 1 137 ? 2.994   12.326  -14.214 1.00 55.18  ? 137  LYS A CA    1 
ATOM   1095 C  C     . LYS A 1 137 ? 2.852   11.428  -12.985 1.00 54.58  ? 137  LYS A C     1 
ATOM   1096 O  O     . LYS A 1 137 ? 2.051   10.496  -12.951 1.00 55.13  ? 137  LYS A O     1 
ATOM   1097 C  CB    . LYS A 1 137 ? 2.446   11.640  -15.472 1.00 55.62  ? 137  LYS A CB    1 
ATOM   1098 C  CG    . LYS A 1 137 ? 2.110   12.605  -16.602 1.00 57.79  ? 137  LYS A CG    1 
ATOM   1099 C  CD    . LYS A 1 137 ? 1.015   13.603  -16.153 1.00 62.72  ? 137  LYS A CD    1 
ATOM   1100 C  CE    . LYS A 1 137 ? 0.913   14.805  -17.085 1.00 65.23  ? 137  LYS A CE    1 
ATOM   1101 N  NZ    . LYS A 1 137 ? 2.186   15.598  -17.116 1.00 66.53  ? 137  LYS A NZ    1 
ATOM   1102 N  N     . ILE A 1 138 ? 3.646   11.731  -11.972 1.00 53.55  ? 138  ILE A N     1 
ATOM   1103 C  CA    . ILE A 1 138 ? 3.636   11.008  -10.730 1.00 52.39  ? 138  ILE A CA    1 
ATOM   1104 C  C     . ILE A 1 138 ? 3.045   11.933  -9.685  1.00 51.80  ? 138  ILE A C     1 
ATOM   1105 O  O     . ILE A 1 138 ? 3.495   13.062  -9.526  1.00 51.62  ? 138  ILE A O     1 
ATOM   1106 C  CB    . ILE A 1 138 ? 5.067   10.643  -10.334 1.00 52.01  ? 138  ILE A CB    1 
ATOM   1107 C  CG1   . ILE A 1 138 ? 5.621   9.573   -11.276 1.00 52.20  ? 138  ILE A CG1   1 
ATOM   1108 C  CG2   . ILE A 1 138 ? 5.149   10.236  -8.877  1.00 52.42  ? 138  ILE A CG2   1 
ATOM   1109 C  CD1   . ILE A 1 138 ? 4.956   8.214   -11.191 1.00 50.53  ? 138  ILE A CD1   1 
ATOM   1110 N  N     . THR A 1 139 ? 2.013   11.470  -8.990  1.00 50.92  ? 139  THR A N     1 
ATOM   1111 C  CA    . THR A 1 139 ? 1.521   12.207  -7.847  1.00 50.21  ? 139  THR A CA    1 
ATOM   1112 C  C     . THR A 1 139 ? 2.321   11.782  -6.632  1.00 49.67  ? 139  THR A C     1 
ATOM   1113 O  O     . THR A 1 139 ? 2.817   10.662  -6.525  1.00 49.38  ? 139  THR A O     1 
ATOM   1114 C  CB    . THR A 1 139 ? 0.041   11.974  -7.596  1.00 50.04  ? 139  THR A CB    1 
ATOM   1115 O  OG1   . THR A 1 139 ? -0.113  10.732  -6.919  1.00 52.54  ? 139  THR A OG1   1 
ATOM   1116 C  CG2   . THR A 1 139 ? -0.693  11.925  -8.892  1.00 49.21  ? 139  THR A CG2   1 
ATOM   1117 N  N     . VAL A 1 140 ? 2.500   12.715  -5.727  1.00 49.20  ? 140  VAL A N     1 
ATOM   1118 C  CA    . VAL A 1 140 ? 3.327   12.446  -4.591  1.00 48.39  ? 140  VAL A CA    1 
ATOM   1119 C  C     . VAL A 1 140 ? 2.604   13.101  -3.437  1.00 48.46  ? 140  VAL A C     1 
ATOM   1120 O  O     . VAL A 1 140 ? 1.732   13.922  -3.633  1.00 47.75  ? 140  VAL A O     1 
ATOM   1121 C  CB    . VAL A 1 140 ? 4.730   13.053  -4.767  1.00 48.11  ? 140  VAL A CB    1 
ATOM   1122 C  CG1   . VAL A 1 140 ? 5.377   12.557  -6.054  1.00 45.42  ? 140  VAL A CG1   1 
ATOM   1123 C  CG2   . VAL A 1 140 ? 4.651   14.564  -4.750  1.00 47.48  ? 140  VAL A CG2   1 
ATOM   1124 N  N     . THR A 1 141 ? 2.940   12.681  -2.234  1.00 48.99  ? 141  THR A N     1 
ATOM   1125 C  CA    . THR A 1 141 ? 2.445   13.314  -1.050  1.00 49.01  ? 141  THR A CA    1 
ATOM   1126 C  C     . THR A 1 141 ? 3.569   14.104  -0.424  1.00 49.28  ? 141  THR A C     1 
ATOM   1127 O  O     . THR A 1 141 ? 4.706   13.668  -0.356  1.00 49.77  ? 141  THR A O     1 
ATOM   1128 C  CB    . THR A 1 141 ? 1.882   12.274  -0.110  1.00 48.95  ? 141  THR A CB    1 
ATOM   1129 O  OG1   . THR A 1 141 ? 0.689   11.747  -0.698  1.00 49.15  ? 141  THR A OG1   1 
ATOM   1130 C  CG2   . THR A 1 141 ? 1.540   12.878  1.243   1.00 49.00  ? 141  THR A CG2   1 
ATOM   1131 N  N     . VAL A 1 142 ? 3.241   15.307  0.001   1.00 50.02  ? 142  VAL A N     1 
ATOM   1132 C  CA    . VAL A 1 142 ? 4.214   16.185  0.574   1.00 49.35  ? 142  VAL A CA    1 
ATOM   1133 C  C     . VAL A 1 142 ? 3.857   16.389  2.033   1.00 49.62  ? 142  VAL A C     1 
ATOM   1134 O  O     . VAL A 1 142 ? 2.690   16.584  2.376   1.00 49.28  ? 142  VAL A O     1 
ATOM   1135 C  CB    . VAL A 1 142 ? 4.244   17.504  -0.177  1.00 49.06  ? 142  VAL A CB    1 
ATOM   1136 C  CG1   . VAL A 1 142 ? 4.983   18.557  0.630   1.00 48.94  ? 142  VAL A CG1   1 
ATOM   1137 C  CG2   . VAL A 1 142 ? 4.905   17.300  -1.514  1.00 47.31  ? 142  VAL A CG2   1 
ATOM   1138 N  N     . GLY A 1 143 ? 4.872   16.309  2.887   1.00 49.45  ? 143  GLY A N     1 
ATOM   1139 C  CA    . GLY A 1 143 ? 4.709   16.501  4.310   1.00 48.80  ? 143  GLY A CA    1 
ATOM   1140 C  C     . GLY A 1 143 ? 5.708   17.553  4.716   1.00 49.40  ? 143  GLY A C     1 
ATOM   1141 O  O     . GLY A 1 143 ? 6.917   17.392  4.510   1.00 48.88  ? 143  GLY A O     1 
ATOM   1142 N  N     . ILE A 1 144 ? 5.201   18.650  5.267   1.00 49.28  ? 144  ILE A N     1 
ATOM   1143 C  CA    . ILE A 1 144 ? 6.042   19.741  5.679   1.00 49.15  ? 144  ILE A CA    1 
ATOM   1144 C  C     . ILE A 1 144 ? 5.970   19.884  7.185   1.00 49.47  ? 144  ILE A C     1 
ATOM   1145 O  O     . ILE A 1 144 ? 4.886   19.993  7.763   1.00 49.37  ? 144  ILE A O     1 
ATOM   1146 C  CB    . ILE A 1 144 ? 5.594   21.067  5.040   1.00 49.35  ? 144  ILE A CB    1 
ATOM   1147 C  CG1   . ILE A 1 144 ? 5.878   21.060  3.534   1.00 49.23  ? 144  ILE A CG1   1 
ATOM   1148 C  CG2   . ILE A 1 144 ? 6.291   22.222  5.696   1.00 47.90  ? 144  ILE A CG2   1 
ATOM   1149 C  CD1   . ILE A 1 144 ? 4.705   21.556  2.702   1.00 46.82  ? 144  ILE A CD1   1 
ATOM   1150 N  N     . SER A 1 145 ? 7.132   19.881  7.825   1.00 49.25  ? 145  SER A N     1 
ATOM   1151 C  CA    . SER A 1 145 ? 7.183   20.215  9.224   1.00 49.14  ? 145  SER A CA    1 
ATOM   1152 C  C     . SER A 1 145 ? 8.552   20.775  9.593   1.00 49.83  ? 145  SER A C     1 
ATOM   1153 O  O     . SER A 1 145 ? 9.358   21.098  8.714   1.00 50.08  ? 145  SER A O     1 
ATOM   1154 C  CB    . SER A 1 145 ? 6.817   19.013  10.076  1.00 48.82  ? 145  SER A CB    1 
ATOM   1155 O  OG    . SER A 1 145 ? 6.271   19.435  11.309  1.00 48.41  ? 145  SER A OG    1 
ATOM   1156 N  N     . LYS A 1 146 ? 8.795   20.913  10.891  1.00 50.27  ? 146  LYS A N     1 
ATOM   1157 C  CA    . LYS A 1 146 ? 10.034  21.477  11.391  1.00 51.03  ? 146  LYS A CA    1 
ATOM   1158 C  C     . LYS A 1 146 ? 11.153  20.446  11.399  1.00 51.32  ? 146  LYS A C     1 
ATOM   1159 O  O     . LYS A 1 146 ? 12.315  20.775  11.569  1.00 51.26  ? 146  LYS A O     1 
ATOM   1160 C  CB    . LYS A 1 146 ? 9.816   22.034  12.801  1.00 51.34  ? 146  LYS A CB    1 
ATOM   1161 C  CG    . LYS A 1 146 ? 9.317   20.991  13.779  1.00 51.76  ? 146  LYS A CG    1 
ATOM   1162 C  CD    . LYS A 1 146 ? 8.752   21.648  15.009  1.00 52.80  ? 146  LYS A CD    1 
ATOM   1163 C  CE    . LYS A 1 146 ? 9.795   22.519  15.680  1.00 53.58  ? 146  LYS A CE    1 
ATOM   1164 N  NZ    . LYS A 1 146 ? 9.188   23.260  16.809  1.00 53.58  ? 146  LYS A NZ    1 
ATOM   1165 N  N     . ASN A 1 147 ? 10.807  19.183  11.210  1.00 52.17  ? 147  ASN A N     1 
ATOM   1166 C  CA    . ASN A 1 147 ? 11.830  18.167  11.119  1.00 52.21  ? 147  ASN A CA    1 
ATOM   1167 C  C     . ASN A 1 147 ? 11.376  17.026  10.257  1.00 52.66  ? 147  ASN A C     1 
ATOM   1168 O  O     . ASN A 1 147 ? 10.225  16.987  9.820   1.00 53.28  ? 147  ASN A O     1 
ATOM   1169 C  CB    . ASN A 1 147 ? 12.264  17.669  12.505  1.00 52.56  ? 147  ASN A CB    1 
ATOM   1170 C  CG    . ASN A 1 147 ? 11.120  17.078  13.307  1.00 51.93  ? 147  ASN A CG    1 
ATOM   1171 O  OD1   . ASN A 1 147 ? 10.151  16.574  12.751  1.00 51.42  ? 147  ASN A OD1   1 
ATOM   1172 N  ND2   . ASN A 1 147 ? 11.238  17.135  14.627  1.00 51.79  ? 147  ASN A ND2   1 
ATOM   1173 N  N     . LYS A 1 148 ? 12.297  16.101  10.027  1.00 52.58  ? 148  LYS A N     1 
ATOM   1174 C  CA    . LYS A 1 148 ? 12.089  14.978  9.149   1.00 52.36  ? 148  LYS A CA    1 
ATOM   1175 C  C     . LYS A 1 148 ? 10.947  14.122  9.642   1.00 52.01  ? 148  LYS A C     1 
ATOM   1176 O  O     . LYS A 1 148 ? 10.035  13.791  8.886   1.00 51.73  ? 148  LYS A O     1 
ATOM   1177 C  CB    . LYS A 1 148 ? 13.378  14.159  9.069   1.00 52.36  ? 148  LYS A CB    1 
ATOM   1178 C  CG    . LYS A 1 148 ? 14.499  14.887  8.370   1.00 53.04  ? 148  LYS A CG    1 
ATOM   1179 C  CD    . LYS A 1 148 ? 15.518  13.931  7.807   1.00 56.93  ? 148  LYS A CD    1 
ATOM   1180 C  CE    . LYS A 1 148 ? 16.156  13.085  8.900   1.00 60.24  ? 148  LYS A CE    1 
ATOM   1181 N  NZ    . LYS A 1 148 ? 17.378  12.342  8.416   1.00 60.77  ? 148  LYS A NZ    1 
ATOM   1182 N  N     . VAL A 1 149 ? 11.002  13.777  10.922  1.00 52.05  ? 149  VAL A N     1 
ATOM   1183 C  CA    . VAL A 1 149 ? 10.010  12.902  11.530  1.00 52.13  ? 149  VAL A CA    1 
ATOM   1184 C  C     . VAL A 1 149 ? 8.589   13.417  11.338  1.00 52.47  ? 149  VAL A C     1 
ATOM   1185 O  O     . VAL A 1 149 ? 7.690   12.660  10.975  1.00 53.13  ? 149  VAL A O     1 
ATOM   1186 C  CB    . VAL A 1 149 ? 10.254  12.744  13.023  1.00 51.83  ? 149  VAL A CB    1 
ATOM   1187 C  CG1   . VAL A 1 149 ? 9.158   11.906  13.636  1.00 51.42  ? 149  VAL A CG1   1 
ATOM   1188 C  CG2   . VAL A 1 149 ? 11.611  12.117  13.264  1.00 51.27  ? 149  VAL A CG2   1 
ATOM   1189 N  N     . PHE A 1 150 ? 8.386   14.705  11.570  1.00 52.03  ? 150  PHE A N     1 
ATOM   1190 C  CA    . PHE A 1 150 ? 7.047   15.261  11.473  1.00 52.07  ? 150  PHE A CA    1 
ATOM   1191 C  C     . PHE A 1 150 ? 6.602   15.563  10.052  1.00 52.03  ? 150  PHE A C     1 
ATOM   1192 O  O     . PHE A 1 150 ? 5.408   15.611  9.765   1.00 51.82  ? 150  PHE A O     1 
ATOM   1193 C  CB    . PHE A 1 150 ? 6.882   16.451  12.416  1.00 51.39  ? 150  PHE A CB    1 
ATOM   1194 C  CG    . PHE A 1 150 ? 6.598   16.028  13.811  1.00 51.14  ? 150  PHE A CG    1 
ATOM   1195 C  CD1   . PHE A 1 150 ? 5.308   15.704  14.191  1.00 49.27  ? 150  PHE A CD1   1 
ATOM   1196 C  CD2   . PHE A 1 150 ? 7.626   15.859  14.722  1.00 50.97  ? 150  PHE A CD2   1 
ATOM   1197 C  CE1   . PHE A 1 150 ? 5.043   15.280  15.461  1.00 50.66  ? 150  PHE A CE1   1 
ATOM   1198 C  CE2   . PHE A 1 150 ? 7.363   15.428  16.005  1.00 51.14  ? 150  PHE A CE2   1 
ATOM   1199 C  CZ    . PHE A 1 150 ? 6.071   15.140  16.375  1.00 50.70  ? 150  PHE A CZ    1 
ATOM   1200 N  N     . ALA A 1 151 ? 7.582   15.762  9.180   1.00 52.08  ? 151  ALA A N     1 
ATOM   1201 C  CA    . ALA A 1 151 ? 7.345   15.894  7.762   1.00 52.01  ? 151  ALA A CA    1 
ATOM   1202 C  C     . ALA A 1 151 ? 6.895   14.543  7.243   1.00 52.42  ? 151  ALA A C     1 
ATOM   1203 O  O     . ALA A 1 151 ? 5.961   14.462  6.466   1.00 53.00  ? 151  ALA A O     1 
ATOM   1204 C  CB    . ALA A 1 151 ? 8.606   16.350  7.062   1.00 51.37  ? 151  ALA A CB    1 
ATOM   1205 N  N     . LYS A 1 152 ? 7.551   13.470  7.677   1.00 52.55  ? 152  LYS A N     1 
ATOM   1206 C  CA    . LYS A 1 152 ? 7.084   12.142  7.340   1.00 52.31  ? 152  LYS A CA    1 
ATOM   1207 C  C     . LYS A 1 152 ? 5.692   11.865  7.892   1.00 51.99  ? 152  LYS A C     1 
ATOM   1208 O  O     . LYS A 1 152 ? 4.868   11.240  7.234   1.00 52.20  ? 152  LYS A O     1 
ATOM   1209 C  CB    . LYS A 1 152 ? 8.051   11.087  7.857   1.00 52.83  ? 152  LYS A CB    1 
ATOM   1210 C  CG    . LYS A 1 152 ? 7.658   9.678   7.479   1.00 54.92  ? 152  LYS A CG    1 
ATOM   1211 C  CD    . LYS A 1 152 ? 8.835   8.739   7.525   1.00 60.92  ? 152  LYS A CD    1 
ATOM   1212 C  CE    . LYS A 1 152 ? 8.395   7.322   7.189   1.00 64.97  ? 152  LYS A CE    1 
ATOM   1213 N  NZ    . LYS A 1 152 ? 9.213   6.258   7.909   1.00 68.60  ? 152  LYS A NZ    1 
ATOM   1214 N  N     . ILE A 1 153 ? 5.446   12.295  9.121   1.00 51.60  ? 153  ILE A N     1 
ATOM   1215 C  CA    . ILE A 1 153 ? 4.150   12.123  9.733   1.00 51.38  ? 153  ILE A CA    1 
ATOM   1216 C  C     . ILE A 1 153 ? 3.112   12.947  8.995   1.00 51.79  ? 153  ILE A C     1 
ATOM   1217 O  O     . ILE A 1 153 ? 2.020   12.470  8.739   1.00 52.32  ? 153  ILE A O     1 
ATOM   1218 C  CB    . ILE A 1 153 ? 4.171   12.489  11.223  1.00 51.32  ? 153  ILE A CB    1 
ATOM   1219 C  CG1   . ILE A 1 153 ? 5.044   11.504  11.986  1.00 51.25  ? 153  ILE A CG1   1 
ATOM   1220 C  CG2   . ILE A 1 153 ? 2.767   12.501  11.787  1.00 50.38  ? 153  ILE A CG2   1 
ATOM   1221 C  CD1   . ILE A 1 153 ? 5.300   11.916  13.400  1.00 53.67  ? 153  ILE A CD1   1 
ATOM   1222 N  N     . ALA A 1 154 ? 3.466   14.176  8.635   1.00 52.52  ? 154  ALA A N     1 
ATOM   1223 C  CA    . ALA A 1 154 ? 2.603   15.018  7.818   1.00 52.99  ? 154  ALA A CA    1 
ATOM   1224 C  C     . ALA A 1 154 ? 2.200   14.281  6.565   1.00 53.33  ? 154  ALA A C     1 
ATOM   1225 O  O     . ALA A 1 154 ? 1.021   14.156  6.289   1.00 53.53  ? 154  ALA A O     1 
ATOM   1226 C  CB    . ALA A 1 154 ? 3.277   16.338  7.476   1.00 52.55  ? 154  ALA A CB    1 
ATOM   1227 N  N     . ALA A 1 155 ? 3.186   13.775  5.829   1.00 54.08  ? 155  ALA A N     1 
ATOM   1228 C  CA    . ALA A 1 155 ? 2.950   12.993  4.613   1.00 54.96  ? 155  ALA A CA    1 
ATOM   1229 C  C     . ALA A 1 155 ? 2.084   11.758  4.831   1.00 55.59  ? 155  ALA A C     1 
ATOM   1230 O  O     . ALA A 1 155 ? 1.164   11.500  4.074   1.00 56.22  ? 155  ALA A O     1 
ATOM   1231 C  CB    . ALA A 1 155 ? 4.277   12.608  3.948   1.00 54.10  ? 155  ALA A CB    1 
ATOM   1232 N  N     . ASP A 1 156 ? 2.374   10.978  5.857   1.00 57.08  ? 156  ASP A N     1 
ATOM   1233 C  CA    . ASP A 1 156 ? 1.560   9.801   6.139   1.00 58.32  ? 156  ASP A CA    1 
ATOM   1234 C  C     . ASP A 1 156 ? 0.110   10.166  6.352   1.00 58.18  ? 156  ASP A C     1 
ATOM   1235 O  O     . ASP A 1 156 ? -0.780  9.412   5.991   1.00 58.43  ? 156  ASP A O     1 
ATOM   1236 C  CB    . ASP A 1 156 ? 2.061   9.091   7.380   1.00 59.12  ? 156  ASP A CB    1 
ATOM   1237 C  CG    . ASP A 1 156 ? 3.431   8.524   7.197   1.00 62.05  ? 156  ASP A CG    1 
ATOM   1238 O  OD1   . ASP A 1 156 ? 3.829   8.278   6.028   1.00 64.45  ? 156  ASP A OD1   1 
ATOM   1239 O  OD2   . ASP A 1 156 ? 4.108   8.325   8.229   1.00 66.23  ? 156  ASP A OD2   1 
ATOM   1240 N  N     . MET A 1 157 ? -0.116  11.326  6.949   1.00 58.04  ? 157  MET A N     1 
ATOM   1241 C  CA    . MET A 1 157 ? -1.458  11.811  7.191   1.00 58.29  ? 157  MET A CA    1 
ATOM   1242 C  C     . MET A 1 157 ? -2.170  12.336  5.954   1.00 57.77  ? 157  MET A C     1 
ATOM   1243 O  O     . MET A 1 157 ? -3.371  12.544  5.987   1.00 58.02  ? 157  MET A O     1 
ATOM   1244 C  CB    . MET A 1 157 ? -1.420  12.936  8.214   1.00 58.61  ? 157  MET A CB    1 
ATOM   1245 C  CG    . MET A 1 157 ? -1.107  12.490  9.605   1.00 59.28  ? 157  MET A CG    1 
ATOM   1246 S  SD    . MET A 1 157 ? -0.928  13.958  10.611  1.00 63.03  ? 157  MET A SD    1 
ATOM   1247 C  CE    . MET A 1 157 ? -0.859  13.239  12.254  1.00 61.81  ? 157  MET A CE    1 
ATOM   1248 N  N     . ALA A 1 158 ? -1.432  12.555  4.875   1.00 57.28  ? 158  ALA A N     1 
ATOM   1249 C  CA    . ALA A 1 158 ? -1.968  13.222  3.699   1.00 56.81  ? 158  ALA A CA    1 
ATOM   1250 C  C     . ALA A 1 158 ? -1.994  12.288  2.486   1.00 56.98  ? 158  ALA A C     1 
ATOM   1251 O  O     . ALA A 1 158 ? -2.572  12.617  1.449   1.00 57.26  ? 158  ALA A O     1 
ATOM   1252 C  CB    . ALA A 1 158 ? -1.149  14.432  3.401   1.00 56.22  ? 158  ALA A CB    1 
ATOM   1253 N  N     . LYS A 1 159 ? -1.349  11.135  2.623   1.00 56.78  ? 159  LYS A N     1 
ATOM   1254 C  CA    . LYS A 1 159 ? -1.299  10.129  1.567   1.00 57.10  ? 159  LYS A CA    1 
ATOM   1255 C  C     . LYS A 1 159 ? -2.712  9.715   1.205   1.00 56.80  ? 159  LYS A C     1 
ATOM   1256 O  O     . LYS A 1 159 ? -3.522  9.499   2.096   1.00 56.45  ? 159  LYS A O     1 
ATOM   1257 C  CB    . LYS A 1 159 ? -0.565  8.877   2.062   1.00 56.58  ? 159  LYS A CB    1 
ATOM   1258 C  CG    . LYS A 1 159 ? 0.934   8.941   1.929   1.00 58.90  ? 159  LYS A CG    1 
ATOM   1259 C  CD    . LYS A 1 159 ? 1.603   7.601   2.280   1.00 56.91  ? 159  LYS A CD    1 
ATOM   1260 C  CE    . LYS A 1 159 ? 3.107   7.804   2.461   1.00 59.64  ? 159  LYS A CE    1 
ATOM   1261 N  NZ    . LYS A 1 159 ? 3.897   6.505   2.396   1.00 60.15  ? 159  LYS A NZ    1 
ATOM   1262 N  N     . PRO A 1 160 ? -3.000  9.556   -0.101  1.00 57.03  ? 160  PRO A N     1 
ATOM   1263 C  CA    . PRO A 1 160 ? -2.119  9.753   -1.242  1.00 56.90  ? 160  PRO A CA    1 
ATOM   1264 C  C     . PRO A 1 160 ? -2.323  11.098  -1.924  1.00 56.77  ? 160  PRO A C     1 
ATOM   1265 O  O     . PRO A 1 160 ? -3.335  11.744  -1.706  1.00 56.67  ? 160  PRO A O     1 
ATOM   1266 C  CB    . PRO A 1 160 ? -2.577  8.646   -2.187  1.00 57.37  ? 160  PRO A CB    1 
ATOM   1267 C  CG    . PRO A 1 160 ? -4.058  8.531   -1.925  1.00 56.67  ? 160  PRO A CG    1 
ATOM   1268 C  CD    . PRO A 1 160 ? -4.322  9.066   -0.536  1.00 57.17  ? 160  PRO A CD    1 
ATOM   1269 N  N     . ASN A 1 161 ? -1.367  11.518  -2.747  1.00 56.57  ? 161  ASN A N     1 
ATOM   1270 C  CA    . ASN A 1 161 ? -1.535  12.748  -3.519  1.00 56.53  ? 161  ASN A CA    1 
ATOM   1271 C  C     . ASN A 1 161 ? -1.945  13.909  -2.612  1.00 56.31  ? 161  ASN A C     1 
ATOM   1272 O  O     . ASN A 1 161 ? -2.751  14.770  -2.987  1.00 56.88  ? 161  ASN A O     1 
ATOM   1273 C  CB    . ASN A 1 161 ? -2.586  12.542  -4.618  1.00 56.44  ? 161  ASN A CB    1 
ATOM   1274 C  CG    . ASN A 1 161 ? -2.702  13.732  -5.558  1.00 57.31  ? 161  ASN A CG    1 
ATOM   1275 O  OD1   . ASN A 1 161 ? -1.777  14.538  -5.698  1.00 59.16  ? 161  ASN A OD1   1 
ATOM   1276 N  ND2   . ASN A 1 161 ? -3.847  13.846  -6.210  1.00 57.11  ? 161  ASN A ND2   1 
ATOM   1277 N  N     . GLY A 1 162 ? -1.395  13.939  -1.408  1.00 55.21  ? 162  GLY A N     1 
ATOM   1278 C  CA    . GLY A 1 162 ? -1.761  14.994  -0.487  1.00 53.72  ? 162  GLY A CA    1 
ATOM   1279 C  C     . GLY A 1 162 ? -0.607  15.930  -0.269  1.00 52.80  ? 162  GLY A C     1 
ATOM   1280 O  O     . GLY A 1 162 ? 0.452   15.782  -0.862  1.00 53.29  ? 162  GLY A O     1 
ATOM   1281 N  N     . ILE A 1 163 ? -0.826  16.906  0.586   1.00 52.14  ? 163  ILE A N     1 
ATOM   1282 C  CA    . ILE A 1 163 ? 0.205   17.830  0.995   1.00 51.31  ? 163  ILE A CA    1 
ATOM   1283 C  C     . ILE A 1 163 ? -0.282  18.299  2.331   1.00 51.30  ? 163  ILE A C     1 
ATOM   1284 O  O     . ILE A 1 163 ? -1.446  18.616  2.483   1.00 51.85  ? 163  ILE A O     1 
ATOM   1285 C  CB    . ILE A 1 163 ? 0.368   19.017  0.028   1.00 50.97  ? 163  ILE A CB    1 
ATOM   1286 C  CG1   . ILE A 1 163 ? 1.288   20.067  0.654   1.00 49.83  ? 163  ILE A CG1   1 
ATOM   1287 C  CG2   . ILE A 1 163 ? -1.000  19.616  -0.359  1.00 50.42  ? 163  ILE A CG2   1 
ATOM   1288 C  CD1   . ILE A 1 163 ? 1.840   21.050  -0.314  1.00 49.22  ? 163  ILE A CD1   1 
ATOM   1289 N  N     . LYS A 1 164 ? 0.586   18.304  3.322   1.00 51.57  ? 164  LYS A N     1 
ATOM   1290 C  CA    . LYS A 1 164 ? 0.141   18.589  4.670   1.00 51.80  ? 164  LYS A CA    1 
ATOM   1291 C  C     . LYS A 1 164 ? 1.265   19.270  5.398   1.00 51.86  ? 164  LYS A C     1 
ATOM   1292 O  O     . LYS A 1 164 ? 2.383   18.785  5.415   1.00 51.80  ? 164  LYS A O     1 
ATOM   1293 C  CB    . LYS A 1 164 ? -0.260  17.295  5.386   1.00 51.65  ? 164  LYS A CB    1 
ATOM   1294 C  CG    . LYS A 1 164 ? -0.444  17.412  6.879   1.00 52.58  ? 164  LYS A CG    1 
ATOM   1295 C  CD    . LYS A 1 164 ? -1.857  17.155  7.272   1.00 55.13  ? 164  LYS A CD    1 
ATOM   1296 C  CE    . LYS A 1 164 ? -2.003  17.192  8.771   1.00 58.54  ? 164  LYS A CE    1 
ATOM   1297 N  NZ    . LYS A 1 164 ? -1.913  18.583  9.347   1.00 60.08  ? 164  LYS A NZ    1 
ATOM   1298 N  N     . VAL A 1 165 ? 0.964   20.419  5.980   1.00 52.41  ? 165  VAL A N     1 
ATOM   1299 C  CA    . VAL A 1 165 ? 1.905   21.088  6.836   1.00 52.58  ? 165  VAL A CA    1 
ATOM   1300 C  C     . VAL A 1 165 ? 1.568   20.710  8.270   1.00 53.40  ? 165  VAL A C     1 
ATOM   1301 O  O     . VAL A 1 165 ? 0.417   20.798  8.683   1.00 53.46  ? 165  VAL A O     1 
ATOM   1302 C  CB    . VAL A 1 165 ? 1.809   22.626  6.677   1.00 52.41  ? 165  VAL A CB    1 
ATOM   1303 C  CG1   . VAL A 1 165 ? 2.507   23.328  7.834   1.00 51.40  ? 165  VAL A CG1   1 
ATOM   1304 C  CG2   . VAL A 1 165 ? 2.383   23.059  5.340   1.00 51.08  ? 165  VAL A CG2   1 
ATOM   1305 N  N     . ILE A 1 166 ? 2.568   20.266  9.021   1.00 53.96  ? 166  ILE A N     1 
ATOM   1306 C  CA    . ILE A 1 166 ? 2.443   20.188  10.467  1.00 54.21  ? 166  ILE A CA    1 
ATOM   1307 C  C     . ILE A 1 166 ? 3.265   21.334  11.028  1.00 54.91  ? 166  ILE A C     1 
ATOM   1308 O  O     . ILE A 1 166 ? 4.485   21.237  11.145  1.00 54.93  ? 166  ILE A O     1 
ATOM   1309 C  CB    . ILE A 1 166 ? 2.945   18.836  11.009  1.00 54.26  ? 166  ILE A CB    1 
ATOM   1310 C  CG1   . ILE A 1 166 ? 2.034   17.707  10.533  1.00 54.29  ? 166  ILE A CG1   1 
ATOM   1311 C  CG2   . ILE A 1 166 ? 2.985   18.830  12.520  1.00 54.07  ? 166  ILE A CG2   1 
ATOM   1312 C  CD1   . ILE A 1 166 ? 2.437   16.375  11.068  1.00 56.03  ? 166  ILE A CD1   1 
ATOM   1313 N  N     . ASP A 1 167 ? 2.601   22.438  11.350  1.00 56.18  ? 167  ASP A N     1 
ATOM   1314 C  CA    . ASP A 1 167 ? 3.311   23.611  11.842  1.00 57.01  ? 167  ASP A CA    1 
ATOM   1315 C  C     . ASP A 1 167 ? 3.730   23.370  13.282  1.00 57.41  ? 167  ASP A C     1 
ATOM   1316 O  O     . ASP A 1 167 ? 3.346   22.361  13.874  1.00 57.21  ? 167  ASP A O     1 
ATOM   1317 C  CB    . ASP A 1 167 ? 2.485   24.893  11.669  1.00 57.28  ? 167  ASP A CB    1 
ATOM   1318 C  CG    . ASP A 1 167 ? 1.200   24.901  12.501  1.00 58.29  ? 167  ASP A CG    1 
ATOM   1319 O  OD1   . ASP A 1 167 ? 1.123   24.187  13.520  1.00 60.85  ? 167  ASP A OD1   1 
ATOM   1320 O  OD2   . ASP A 1 167 ? 0.262   25.646  12.145  1.00 58.70  ? 167  ASP A OD2   1 
ATOM   1321 N  N     . ASP A 1 168 ? 4.533   24.282  13.825  1.00 58.19  ? 168  ASP A N     1 
ATOM   1322 C  CA    . ASP A 1 168 ? 5.081   24.159  15.177  1.00 58.95  ? 168  ASP A CA    1 
ATOM   1323 C  C     . ASP A 1 168 ? 4.020   23.857  16.229  1.00 59.23  ? 168  ASP A C     1 
ATOM   1324 O  O     . ASP A 1 168 ? 4.281   23.166  17.216  1.00 59.25  ? 168  ASP A O     1 
ATOM   1325 C  CB    . ASP A 1 168 ? 5.831   25.436  15.559  1.00 58.97  ? 168  ASP A CB    1 
ATOM   1326 C  CG    . ASP A 1 168 ? 7.213   25.520  14.927  1.00 60.16  ? 168  ASP A CG    1 
ATOM   1327 O  OD1   . ASP A 1 168 ? 7.459   24.857  13.891  1.00 61.27  ? 168  ASP A OD1   1 
ATOM   1328 O  OD2   . ASP A 1 168 ? 8.061   26.254  15.474  1.00 61.19  ? 168  ASP A OD2   1 
ATOM   1329 N  N     . GLU A 1 169 ? 2.822   24.381  16.010  1.00 59.77  ? 169  GLU A N     1 
ATOM   1330 C  CA    . GLU A 1 169 ? 1.728   24.180  16.941  1.00 60.40  ? 169  GLU A CA    1 
ATOM   1331 C  C     . GLU A 1 169 ? 1.142   22.779  16.855  1.00 60.51  ? 169  GLU A C     1 
ATOM   1332 O  O     . GLU A 1 169 ? 0.887   22.161  17.883  1.00 60.48  ? 169  GLU A O     1 
ATOM   1333 C  CB    . GLU A 1 169 ? 0.639   25.229  16.724  1.00 60.71  ? 169  GLU A CB    1 
ATOM   1334 C  CG    . GLU A 1 169 ? 1.049   26.646  17.123  1.00 62.07  ? 169  GLU A CG    1 
ATOM   1335 C  CD    . GLU A 1 169 ? 1.050   26.868  18.628  1.00 64.15  ? 169  GLU A CD    1 
ATOM   1336 O  OE1   . GLU A 1 169 ? 1.170   25.879  19.388  1.00 63.98  ? 169  GLU A OE1   1 
ATOM   1337 O  OE2   . GLU A 1 169 ? 0.929   28.045  19.056  1.00 65.89  ? 169  GLU A OE2   1 
ATOM   1338 N  N     . GLU A 1 170 ? 0.929   22.276  15.639  1.00 60.67  ? 170  GLU A N     1 
ATOM   1339 C  CA    . GLU A 1 170 ? 0.403   20.920  15.479  1.00 61.03  ? 170  GLU A CA    1 
ATOM   1340 C  C     . GLU A 1 170 ? 1.445   19.912  15.932  1.00 60.56  ? 170  GLU A C     1 
ATOM   1341 O  O     . GLU A 1 170 ? 1.099   18.867  16.471  1.00 60.39  ? 170  GLU A O     1 
ATOM   1342 C  CB    . GLU A 1 170 ? -0.052  20.623  14.040  1.00 61.32  ? 170  GLU A CB    1 
ATOM   1343 C  CG    . GLU A 1 170 ? -1.169  19.561  13.954  1.00 63.24  ? 170  GLU A CG    1 
ATOM   1344 C  CD    . GLU A 1 170 ? -1.434  19.080  12.526  1.00 67.37  ? 170  GLU A CD    1 
ATOM   1345 O  OE1   . GLU A 1 170 ? -1.441  19.929  11.600  1.00 69.71  ? 170  GLU A OE1   1 
ATOM   1346 O  OE2   . GLU A 1 170 ? -1.638  17.855  12.317  1.00 68.41  ? 170  GLU A OE2   1 
ATOM   1347 N  N     . VAL A 1 171 ? 2.717   20.231  15.710  1.00 60.29  ? 171  VAL A N     1 
ATOM   1348 C  CA    . VAL A 1 171 ? 3.806   19.416  16.232  1.00 60.06  ? 171  VAL A CA    1 
ATOM   1349 C  C     . VAL A 1 171 ? 3.601   19.219  17.728  1.00 60.53  ? 171  VAL A C     1 
ATOM   1350 O  O     . VAL A 1 171 ? 3.648   18.099  18.224  1.00 60.44  ? 171  VAL A O     1 
ATOM   1351 C  CB    . VAL A 1 171 ? 5.175   20.075  16.012  1.00 59.85  ? 171  VAL A CB    1 
ATOM   1352 C  CG1   . VAL A 1 171 ? 6.207   19.466  16.943  1.00 59.17  ? 171  VAL A CG1   1 
ATOM   1353 C  CG2   . VAL A 1 171 ? 5.606   19.952  14.560  1.00 59.54  ? 171  VAL A CG2   1 
ATOM   1354 N  N     . LYS A 1 172 ? 3.365   20.316  18.446  1.00 60.96  ? 172  LYS A N     1 
ATOM   1355 C  CA    . LYS A 1 172 ? 3.149   20.239  19.883  1.00 61.29  ? 172  LYS A CA    1 
ATOM   1356 C  C     . LYS A 1 172 ? 1.851   19.507  20.214  1.00 60.90  ? 172  LYS A C     1 
ATOM   1357 O  O     . LYS A 1 172 ? 1.796   18.777  21.199  1.00 60.96  ? 172  LYS A O     1 
ATOM   1358 C  CB    . LYS A 1 172 ? 3.175   21.630  20.520  1.00 61.84  ? 172  LYS A CB    1 
ATOM   1359 C  CG    . LYS A 1 172 ? 4.575   22.235  20.612  1.00 63.62  ? 172  LYS A CG    1 
ATOM   1360 C  CD    . LYS A 1 172 ? 5.446   21.483  21.618  1.00 65.82  ? 172  LYS A CD    1 
ATOM   1361 C  CE    . LYS A 1 172 ? 6.642   22.328  22.059  1.00 66.98  ? 172  LYS A CE    1 
ATOM   1362 N  NZ    . LYS A 1 172 ? 7.000   22.075  23.485  1.00 66.82  ? 172  LYS A NZ    1 
ATOM   1363 N  N     . ARG A 1 173 ? 0.819   19.688  19.391  1.00 60.31  ? 173  ARG A N     1 
ATOM   1364 C  CA    . ARG A 1 173 ? -0.425  18.942  19.568  1.00 60.15  ? 173  ARG A CA    1 
ATOM   1365 C  C     . ARG A 1 173 ? -0.205  17.447  19.373  1.00 59.56  ? 173  ARG A C     1 
ATOM   1366 O  O     . ARG A 1 173 ? -0.731  16.628  20.122  1.00 59.35  ? 173  ARG A O     1 
ATOM   1367 C  CB    . ARG A 1 173 ? -1.516  19.422  18.601  1.00 60.48  ? 173  ARG A CB    1 
ATOM   1368 C  CG    . ARG A 1 173 ? -2.773  18.537  18.627  1.00 61.53  ? 173  ARG A CG    1 
ATOM   1369 C  CD    . ARG A 1 173 ? -3.919  19.066  17.759  1.00 62.83  ? 173  ARG A CD    1 
ATOM   1370 N  NE    . ARG A 1 173 ? -3.791  18.681  16.356  1.00 64.68  ? 173  ARG A NE    1 
ATOM   1371 C  CZ    . ARG A 1 173 ? -3.951  17.441  15.892  1.00 66.31  ? 173  ARG A CZ    1 
ATOM   1372 N  NH1   . ARG A 1 173 ? -4.240  16.445  16.717  1.00 67.03  ? 173  ARG A NH1   1 
ATOM   1373 N  NH2   . ARG A 1 173 ? -3.808  17.188  14.595  1.00 66.60  ? 173  ARG A NH2   1 
ATOM   1374 N  N     . LEU A 1 174 ? 0.573   17.099  18.353  1.00 59.26  ? 174  LEU A N     1 
ATOM   1375 C  CA    . LEU A 1 174 ? 0.786   15.707  17.996  1.00 58.76  ? 174  LEU A CA    1 
ATOM   1376 C  C     . LEU A 1 174 ? 1.675   14.988  19.003  1.00 58.52  ? 174  LEU A C     1 
ATOM   1377 O  O     . LEU A 1 174 ? 1.479   13.808  19.277  1.00 58.27  ? 174  LEU A O     1 
ATOM   1378 C  CB    . LEU A 1 174 ? 1.319   15.591  16.567  1.00 58.91  ? 174  LEU A CB    1 
ATOM   1379 C  CG    . LEU A 1 174 ? 0.278   16.049  15.538  1.00 58.51  ? 174  LEU A CG    1 
ATOM   1380 C  CD1   . LEU A 1 174 ? 0.830   16.019  14.122  1.00 56.72  ? 174  LEU A CD1   1 
ATOM   1381 C  CD2   . LEU A 1 174 ? -0.973  15.196  15.665  1.00 58.11  ? 174  LEU A CD2   1 
ATOM   1382 N  N     . ILE A 1 175 ? 2.636   15.706  19.570  1.00 58.48  ? 175  ILE A N     1 
ATOM   1383 C  CA    . ILE A 1 175 ? 3.422   15.166  20.672  1.00 58.84  ? 175  ILE A CA    1 
ATOM   1384 C  C     . ILE A 1 175 ? 2.494   14.702  21.801  1.00 59.16  ? 175  ILE A C     1 
ATOM   1385 O  O     . ILE A 1 175 ? 2.786   13.727  22.495  1.00 58.96  ? 175  ILE A O     1 
ATOM   1386 C  CB    . ILE A 1 175 ? 4.430   16.204  21.205  1.00 58.75  ? 175  ILE A CB    1 
ATOM   1387 C  CG1   . ILE A 1 175 ? 5.588   16.373  20.220  1.00 58.71  ? 175  ILE A CG1   1 
ATOM   1388 C  CG2   . ILE A 1 175 ? 4.959   15.797  22.566  1.00 58.31  ? 175  ILE A CG2   1 
ATOM   1389 C  CD1   . ILE A 1 175 ? 6.429   17.609  20.488  1.00 58.85  ? 175  ILE A CD1   1 
ATOM   1390 N  N     . ARG A 1 176 ? 1.361   15.391  21.950  1.00 59.73  ? 176  ARG A N     1 
ATOM   1391 C  CA    . ARG A 1 176 ? 0.386   15.099  23.002  1.00 60.05  ? 176  ARG A CA    1 
ATOM   1392 C  C     . ARG A 1 176 ? -0.744  14.171  22.553  1.00 60.36  ? 176  ARG A C     1 
ATOM   1393 O  O     . ARG A 1 176 ? -1.286  13.418  23.365  1.00 60.23  ? 176  ARG A O     1 
ATOM   1394 C  CB    . ARG A 1 176 ? -0.226  16.397  23.534  1.00 60.16  ? 176  ARG A CB    1 
ATOM   1395 C  CG    . ARG A 1 176 ? 0.774   17.421  24.037  1.00 60.41  ? 176  ARG A CG    1 
ATOM   1396 C  CD    . ARG A 1 176 ? 0.071   18.658  24.588  1.00 61.06  ? 176  ARG A CD    1 
ATOM   1397 N  NE    . ARG A 1 176 ? -0.554  19.477  23.547  1.00 61.38  ? 176  ARG A NE    1 
ATOM   1398 C  CZ    . ARG A 1 176 ? -1.858  19.476  23.264  1.00 61.83  ? 176  ARG A CZ    1 
ATOM   1399 N  NH1   . ARG A 1 176 ? -2.694  18.691  23.936  1.00 61.59  ? 176  ARG A NH1   1 
ATOM   1400 N  NH2   . ARG A 1 176 ? -2.331  20.263  22.305  1.00 61.75  ? 176  ARG A NH2   1 
ATOM   1401 N  N     . GLU A 1 177 ? -1.105  14.230  21.273  1.00 60.70  ? 177  GLU A N     1 
ATOM   1402 C  CA    . GLU A 1 177 ? -2.304  13.537  20.790  1.00 61.24  ? 177  GLU A CA    1 
ATOM   1403 C  C     . GLU A 1 177 ? -2.047  12.382  19.828  1.00 61.59  ? 177  GLU A C     1 
ATOM   1404 O  O     . GLU A 1 177 ? -2.877  11.482  19.711  1.00 61.64  ? 177  GLU A O     1 
ATOM   1405 C  CB    . GLU A 1 177 ? -3.280  14.530  20.144  1.00 61.56  ? 177  GLU A CB    1 
ATOM   1406 C  CG    . GLU A 1 177 ? -4.237  15.220  21.133  1.00 61.88  ? 177  GLU A CG    1 
ATOM   1407 C  CD    . GLU A 1 177 ? -5.256  16.101  20.429  1.00 63.11  ? 177  GLU A CD    1 
ATOM   1408 O  OE1   . GLU A 1 177 ? -5.153  16.273  19.192  1.00 63.82  ? 177  GLU A OE1   1 
ATOM   1409 O  OE2   . GLU A 1 177 ? -6.160  16.633  21.107  1.00 63.81  ? 177  GLU A OE2   1 
ATOM   1410 N  N     . LEU A 1 178 ? -0.911  12.407  19.134  1.00 61.79  ? 178  LEU A N     1 
ATOM   1411 C  CA    . LEU A 1 178 ? -0.614  11.368  18.161  1.00 62.06  ? 178  LEU A CA    1 
ATOM   1412 C  C     . LEU A 1 178 ? -0.212  10.063  18.833  1.00 62.38  ? 178  LEU A C     1 
ATOM   1413 O  O     . LEU A 1 178 ? 0.685   10.031  19.684  1.00 62.44  ? 178  LEU A O     1 
ATOM   1414 C  CB    . LEU A 1 178 ? 0.487   11.801  17.189  1.00 62.09  ? 178  LEU A CB    1 
ATOM   1415 C  CG    . LEU A 1 178 ? 0.727   10.804  16.052  1.00 62.28  ? 178  LEU A CG    1 
ATOM   1416 C  CD1   . LEU A 1 178 ? -0.507  10.757  15.140  1.00 62.03  ? 178  LEU A CD1   1 
ATOM   1417 C  CD2   . LEU A 1 178 ? 1.995   11.098  15.258  1.00 60.45  ? 178  LEU A CD2   1 
ATOM   1418 N  N     . ASP A 1 179 ? -0.881  8.986   18.438  1.00 62.54  ? 179  ASP A N     1 
ATOM   1419 C  CA    . ASP A 1 179 ? -0.510  7.661   18.886  1.00 62.62  ? 179  ASP A CA    1 
ATOM   1420 C  C     . ASP A 1 179 ? 0.968   7.473   18.572  1.00 61.95  ? 179  ASP A C     1 
ATOM   1421 O  O     . ASP A 1 179 ? 1.400   7.658   17.439  1.00 61.97  ? 179  ASP A O     1 
ATOM   1422 C  CB    . ASP A 1 179 ? -1.360  6.607   18.174  1.00 63.18  ? 179  ASP A CB    1 
ATOM   1423 C  CG    . ASP A 1 179 ? -1.026  5.185   18.607  1.00 65.19  ? 179  ASP A CG    1 
ATOM   1424 O  OD1   . ASP A 1 179 ? 0.108   4.927   19.078  1.00 66.41  ? 179  ASP A OD1   1 
ATOM   1425 O  OD2   . ASP A 1 179 ? -1.912  4.316   18.469  1.00 68.39  ? 179  ASP A OD2   1 
ATOM   1426 N  N     . ILE A 1 180 ? 1.744   7.118   19.585  1.00 61.23  ? 180  ILE A N     1 
ATOM   1427 C  CA    . ILE A 1 180 ? 3.186   7.032   19.427  1.00 60.42  ? 180  ILE A CA    1 
ATOM   1428 C  C     . ILE A 1 180 ? 3.558   5.933   18.429  1.00 60.12  ? 180  ILE A C     1 
ATOM   1429 O  O     . ILE A 1 180 ? 4.626   5.958   17.817  1.00 59.31  ? 180  ILE A O     1 
ATOM   1430 C  CB    . ILE A 1 180 ? 3.874   6.829   20.777  1.00 60.16  ? 180  ILE A CB    1 
ATOM   1431 C  CG1   . ILE A 1 180 ? 5.342   7.259   20.691  1.00 60.24  ? 180  ILE A CG1   1 
ATOM   1432 C  CG2   . ILE A 1 180 ? 3.688   5.407   21.249  1.00 59.77  ? 180  ILE A CG2   1 
ATOM   1433 C  CD1   . ILE A 1 180 ? 6.024   7.375   22.037  1.00 60.48  ? 180  ILE A CD1   1 
ATOM   1434 N  N     . ALA A 1 181 ? 2.654   4.977   18.255  1.00 59.99  ? 181  ALA A N     1 
ATOM   1435 C  CA    . ALA A 1 181 ? 2.799   3.993   17.187  1.00 59.52  ? 181  ALA A CA    1 
ATOM   1436 C  C     . ALA A 1 181 ? 2.874   4.669   15.829  1.00 59.14  ? 181  ALA A C     1 
ATOM   1437 O  O     . ALA A 1 181 ? 3.435   4.123   14.911  1.00 59.63  ? 181  ALA A O     1 
ATOM   1438 C  CB    . ALA A 1 181 ? 1.647   3.000   17.211  1.00 59.44  ? 181  ALA A CB    1 
ATOM   1439 N  N     . ASP A 1 182 ? 2.319   5.862   15.686  1.00 58.77  ? 182  ASP A N     1 
ATOM   1440 C  CA    . ASP A 1 182 ? 2.304   6.497   14.376  1.00 58.62  ? 182  ASP A CA    1 
ATOM   1441 C  C     . ASP A 1 182 ? 3.603   7.226   14.092  1.00 58.10  ? 182  ASP A C     1 
ATOM   1442 O  O     . ASP A 1 182 ? 3.790   7.799   13.022  1.00 57.72  ? 182  ASP A O     1 
ATOM   1443 C  CB    . ASP A 1 182 ? 1.110   7.438   14.253  1.00 58.73  ? 182  ASP A CB    1 
ATOM   1444 C  CG    . ASP A 1 182 ? -0.192  6.714   14.370  1.00 59.58  ? 182  ASP A CG    1 
ATOM   1445 O  OD1   . ASP A 1 182 ? -0.176  5.479   14.215  1.00 61.08  ? 182  ASP A OD1   1 
ATOM   1446 O  OD2   . ASP A 1 182 ? -1.232  7.364   14.621  1.00 61.94  ? 182  ASP A OD2   1 
ATOM   1447 N  N     . VAL A 1 183 ? 4.488   7.211   15.076  1.00 58.13  ? 183  VAL A N     1 
ATOM   1448 C  CA    . VAL A 1 183 ? 5.790   7.830   14.958  1.00 57.68  ? 183  VAL A CA    1 
ATOM   1449 C  C     . VAL A 1 183 ? 6.674   6.890   14.168  1.00 58.06  ? 183  VAL A C     1 
ATOM   1450 O  O     . VAL A 1 183 ? 6.756   5.699   14.485  1.00 58.37  ? 183  VAL A O     1 
ATOM   1451 C  CB    . VAL A 1 183 ? 6.398   8.101   16.349  1.00 57.68  ? 183  VAL A CB    1 
ATOM   1452 C  CG1   . VAL A 1 183 ? 7.808   8.651   16.228  1.00 56.90  ? 183  VAL A CG1   1 
ATOM   1453 C  CG2   . VAL A 1 183 ? 5.503   9.050   17.143  1.00 56.58  ? 183  VAL A CG2   1 
ATOM   1454 N  N     . PRO A 1 184 ? 7.308   7.416   13.105  1.00 58.04  ? 184  PRO A N     1 
ATOM   1455 C  CA    . PRO A 1 184 ? 8.262   6.701   12.281  1.00 57.55  ? 184  PRO A CA    1 
ATOM   1456 C  C     . PRO A 1 184 ? 9.323   6.074   13.141  1.00 57.41  ? 184  PRO A C     1 
ATOM   1457 O  O     . PRO A 1 184 ? 9.905   6.749   13.982  1.00 57.42  ? 184  PRO A O     1 
ATOM   1458 C  CB    . PRO A 1 184 ? 8.896   7.811   11.448  1.00 57.62  ? 184  PRO A CB    1 
ATOM   1459 C  CG    . PRO A 1 184 ? 7.857   8.853   11.363  1.00 57.54  ? 184  PRO A CG    1 
ATOM   1460 C  CD    . PRO A 1 184 ? 7.105   8.802   12.644  1.00 57.92  ? 184  PRO A CD    1 
ATOM   1461 N  N     . GLY A 1 185 ? 9.592   4.794   12.923  1.00 57.61  ? 185  GLY A N     1 
ATOM   1462 C  CA    . GLY A 1 185 ? 10.592  4.101   13.715  1.00 57.72  ? 185  GLY A CA    1 
ATOM   1463 C  C     . GLY A 1 185 ? 9.929   3.310   14.816  1.00 57.89  ? 185  GLY A C     1 
ATOM   1464 O  O     . GLY A 1 185 ? 10.560  2.488   15.472  1.00 58.22  ? 185  GLY A O     1 
ATOM   1465 N  N     . ILE A 1 186 ? 8.643   3.547   15.013  1.00 57.89  ? 186  ILE A N     1 
ATOM   1466 C  CA    . ILE A 1 186 ? 7.903   2.779   15.990  1.00 58.16  ? 186  ILE A CA    1 
ATOM   1467 C  C     . ILE A 1 186 ? 7.026   1.784   15.261  1.00 58.27  ? 186  ILE A C     1 
ATOM   1468 O  O     . ILE A 1 186 ? 5.957   2.134   14.776  1.00 58.65  ? 186  ILE A O     1 
ATOM   1469 C  CB    . ILE A 1 186 ? 7.044   3.676   16.917  1.00 57.86  ? 186  ILE A CB    1 
ATOM   1470 C  CG1   . ILE A 1 186 ? 7.896   4.781   17.547  1.00 57.82  ? 186  ILE A CG1   1 
ATOM   1471 C  CG2   . ILE A 1 186 ? 6.424   2.855   18.003  1.00 57.69  ? 186  ILE A CG2   1 
ATOM   1472 C  CD1   . ILE A 1 186 ? 9.232   4.300   18.089  1.00 58.35  ? 186  ILE A CD1   1 
ATOM   1473 N  N     . GLY A 1 187 ? 7.502   0.548   15.166  1.00 58.47  ? 187  GLY A N     1 
ATOM   1474 C  CA    . GLY A 1 187 ? 6.731   -0.519  14.560  1.00 59.32  ? 187  GLY A CA    1 
ATOM   1475 C  C     . GLY A 1 187 ? 5.847   -1.196  15.591  1.00 60.32  ? 187  GLY A C     1 
ATOM   1476 O  O     . GLY A 1 187 ? 5.619   -0.675  16.682  1.00 60.09  ? 187  GLY A O     1 
ATOM   1477 N  N     . ASN A 1 188 ? 5.353   -2.376  15.250  1.00 61.14  ? 188  ASN A N     1 
ATOM   1478 C  CA    . ASN A 1 188 ? 4.472   -3.109  16.142  1.00 61.58  ? 188  ASN A CA    1 
ATOM   1479 C  C     . ASN A 1 188 ? 5.176   -3.528  17.417  1.00 61.27  ? 188  ASN A C     1 
ATOM   1480 O  O     . ASN A 1 188 ? 4.591   -3.448  18.498  1.00 61.45  ? 188  ASN A O     1 
ATOM   1481 C  CB    . ASN A 1 188 ? 3.881   -4.314  15.414  1.00 62.09  ? 188  ASN A CB    1 
ATOM   1482 C  CG    . ASN A 1 188 ? 3.368   -3.944  14.033  1.00 64.62  ? 188  ASN A CG    1 
ATOM   1483 O  OD1   . ASN A 1 188 ? 4.014   -4.236  13.010  1.00 69.29  ? 188  ASN A OD1   1 
ATOM   1484 N  ND2   . ASN A 1 188 ? 2.239   -3.239  13.995  1.00 64.17  ? 188  ASN A ND2   1 
ATOM   1485 N  N     . ILE A 1 189 ? 6.433   -3.951  17.299  1.00 60.51  ? 189  ILE A N     1 
ATOM   1486 C  CA    . ILE A 1 189 ? 7.176   -4.408  18.472  1.00 59.89  ? 189  ILE A CA    1 
ATOM   1487 C  C     . ILE A 1 189 ? 7.355   -3.284  19.482  1.00 59.61  ? 189  ILE A C     1 
ATOM   1488 O  O     . ILE A 1 189 ? 7.041   -3.443  20.657  1.00 59.73  ? 189  ILE A O     1 
ATOM   1489 C  CB    . ILE A 1 189 ? 8.554   -4.999  18.113  1.00 59.76  ? 189  ILE A CB    1 
ATOM   1490 C  CG1   . ILE A 1 189 ? 8.408   -6.101  17.065  1.00 59.74  ? 189  ILE A CG1   1 
ATOM   1491 C  CG2   . ILE A 1 189 ? 9.249   -5.534  19.358  1.00 58.85  ? 189  ILE A CG2   1 
ATOM   1492 C  CD1   . ILE A 1 189 ? 7.305   -7.078  17.367  1.00 60.38  ? 189  ILE A CD1   1 
ATOM   1493 N  N     . THR A 1 190 ? 7.861   -2.150  19.012  1.00 59.32  ? 190  THR A N     1 
ATOM   1494 C  CA    . THR A 1 190 ? 8.082   -0.992  19.864  1.00 59.07  ? 190  THR A CA    1 
ATOM   1495 C  C     . THR A 1 190 ? 6.771   -0.414  20.377  1.00 59.07  ? 190  THR A C     1 
ATOM   1496 O  O     . THR A 1 190 ? 6.679   -0.020  21.533  1.00 58.94  ? 190  THR A O     1 
ATOM   1497 C  CB    . THR A 1 190 ? 8.855   0.108   19.128  1.00 58.95  ? 190  THR A CB    1 
ATOM   1498 O  OG1   . THR A 1 190 ? 10.112  -0.414  18.680  1.00 58.84  ? 190  THR A OG1   1 
ATOM   1499 C  CG2   . THR A 1 190 ? 9.102   1.290   20.049  1.00 58.81  ? 190  THR A CG2   1 
ATOM   1500 N  N     . ALA A 1 191 ? 5.760   -0.364  19.518  1.00 59.13  ? 191  ALA A N     1 
ATOM   1501 C  CA    . ALA A 1 191 ? 4.461   0.144   19.927  1.00 59.64  ? 191  ALA A CA    1 
ATOM   1502 C  C     . ALA A 1 191 ? 3.935   -0.685  21.093  1.00 59.79  ? 191  ALA A C     1 
ATOM   1503 O  O     . ALA A 1 191 ? 3.466   -0.143  22.086  1.00 59.49  ? 191  ALA A O     1 
ATOM   1504 C  CB    . ALA A 1 191 ? 3.465   0.133   18.757  1.00 59.35  ? 191  ALA A CB    1 
ATOM   1505 N  N     . GLU A 1 192 ? 4.049   -2.003  20.972  1.00 60.21  ? 192  GLU A N     1 
ATOM   1506 C  CA    . GLU A 1 192 ? 3.483   -2.914  21.953  1.00 60.70  ? 192  GLU A CA    1 
ATOM   1507 C  C     . GLU A 1 192 ? 4.342   -3.036  23.209  1.00 60.72  ? 192  GLU A C     1 
ATOM   1508 O  O     . GLU A 1 192 ? 3.933   -3.651  24.192  1.00 61.10  ? 192  GLU A O     1 
ATOM   1509 C  CB    . GLU A 1 192 ? 3.208   -4.285  21.322  1.00 60.90  ? 192  GLU A CB    1 
ATOM   1510 C  CG    . GLU A 1 192 ? 2.036   -4.281  20.321  1.00 62.36  ? 192  GLU A CG    1 
ATOM   1511 C  CD    . GLU A 1 192 ? 0.722   -3.728  20.919  1.00 65.15  ? 192  GLU A CD    1 
ATOM   1512 O  OE1   . GLU A 1 192 ? 0.365   -4.104  22.065  1.00 63.81  ? 192  GLU A OE1   1 
ATOM   1513 O  OE2   . GLU A 1 192 ? 0.046   -2.919  20.234  1.00 65.83  ? 192  GLU A OE2   1 
ATOM   1514 N  N     . LYS A 1 193 ? 5.526   -2.434  23.173  1.00 60.69  ? 193  LYS A N     1 
ATOM   1515 C  CA    . LYS A 1 193 ? 6.377   -2.328  24.346  1.00 60.60  ? 193  LYS A CA    1 
ATOM   1516 C  C     . LYS A 1 193 ? 6.096   -1.003  25.031  1.00 60.31  ? 193  LYS A C     1 
ATOM   1517 O  O     . LYS A 1 193 ? 6.178   -0.892  26.252  1.00 60.47  ? 193  LYS A O     1 
ATOM   1518 C  CB    . LYS A 1 193 ? 7.853   -2.403  23.953  1.00 60.96  ? 193  LYS A CB    1 
ATOM   1519 C  CG    . LYS A 1 193 ? 8.334   -3.777  23.505  1.00 61.60  ? 193  LYS A CG    1 
ATOM   1520 C  CD    . LYS A 1 193 ? 9.679   -3.661  22.790  1.00 63.53  ? 193  LYS A CD    1 
ATOM   1521 C  CE    . LYS A 1 193 ? 10.433  -5.001  22.770  1.00 64.98  ? 193  LYS A CE    1 
ATOM   1522 N  NZ    . LYS A 1 193 ? 11.758  -4.908  22.075  1.00 64.33  ? 193  LYS A NZ    1 
ATOM   1523 N  N     . LEU A 1 194 ? 5.768   0.004   24.233  1.00 60.06  ? 194  LEU A N     1 
ATOM   1524 C  CA    . LEU A 1 194 ? 5.379   1.303   24.763  1.00 59.94  ? 194  LEU A CA    1 
ATOM   1525 C  C     . LEU A 1 194 ? 3.999   1.253   25.435  1.00 59.98  ? 194  LEU A C     1 
ATOM   1526 O  O     . LEU A 1 194 ? 3.770   1.937   26.434  1.00 59.95  ? 194  LEU A O     1 
ATOM   1527 C  CB    . LEU A 1 194 ? 5.405   2.368   23.666  1.00 59.65  ? 194  LEU A CB    1 
ATOM   1528 C  CG    . LEU A 1 194 ? 6.779   2.710   23.092  1.00 59.52  ? 194  LEU A CG    1 
ATOM   1529 C  CD1   . LEU A 1 194 ? 6.641   3.546   21.806  1.00 59.10  ? 194  LEU A CD1   1 
ATOM   1530 C  CD2   . LEU A 1 194 ? 7.652   3.413   24.125  1.00 58.18  ? 194  LEU A CD2   1 
ATOM   1531 N  N     . LYS A 1 195 ? 3.087   0.452   24.884  1.00 59.98  ? 195  LYS A N     1 
ATOM   1532 C  CA    . LYS A 1 195 ? 1.803   0.215   25.531  1.00 60.03  ? 195  LYS A CA    1 
ATOM   1533 C  C     . LYS A 1 195 ? 2.048   -0.320  26.927  1.00 59.63  ? 195  LYS A C     1 
ATOM   1534 O  O     . LYS A 1 195 ? 1.613   0.288   27.899  1.00 59.53  ? 195  LYS A O     1 
ATOM   1535 C  CB    . LYS A 1 195 ? 0.942   -0.771  24.744  1.00 60.29  ? 195  LYS A CB    1 
ATOM   1536 C  CG    . LYS A 1 195 ? 0.438   -0.232  23.413  1.00 61.89  ? 195  LYS A CG    1 
ATOM   1537 C  CD    . LYS A 1 195 ? -0.885  -0.885  23.017  1.00 63.93  ? 195  LYS A CD    1 
ATOM   1538 C  CE    . LYS A 1 195 ? -1.997  -0.501  23.985  1.00 65.14  ? 195  LYS A CE    1 
ATOM   1539 N  NZ    . LYS A 1 195 ? -3.366  -0.713  23.415  1.00 66.30  ? 195  LYS A NZ    1 
ATOM   1540 N  N     . LYS A 1 196 ? 2.758   -1.448  27.015  1.00 59.28  ? 196  LYS A N     1 
ATOM   1541 C  CA    . LYS A 1 196 ? 3.146   -2.045  28.299  1.00 58.70  ? 196  LYS A CA    1 
ATOM   1542 C  C     . LYS A 1 196 ? 3.559   -0.975  29.296  1.00 58.34  ? 196  LYS A C     1 
ATOM   1543 O  O     . LYS A 1 196 ? 3.086   -0.965  30.433  1.00 58.62  ? 196  LYS A O     1 
ATOM   1544 C  CB    . LYS A 1 196 ? 4.312   -3.014  28.123  1.00 58.84  ? 196  LYS A CB    1 
ATOM   1545 C  CG    . LYS A 1 196 ? 3.945   -4.474  27.963  1.00 59.26  ? 196  LYS A CG    1 
ATOM   1546 C  CD    . LYS A 1 196 ? 5.225   -5.313  27.907  1.00 60.64  ? 196  LYS A CD    1 
ATOM   1547 C  CE    . LYS A 1 196 ? 5.002   -6.749  28.364  1.00 61.06  ? 196  LYS A CE    1 
ATOM   1548 N  NZ    . LYS A 1 196 ? 4.566   -6.825  29.798  1.00 61.91  ? 196  LYS A NZ    1 
ATOM   1549 N  N     . LEU A 1 197 ? 4.446   -0.082  28.865  1.00 57.77  ? 197  LEU A N     1 
ATOM   1550 C  CA    . LEU A 1 197 ? 4.920   1.011   29.705  1.00 57.39  ? 197  LEU A CA    1 
ATOM   1551 C  C     . LEU A 1 197 ? 3.861   2.081   29.943  1.00 57.23  ? 197  LEU A C     1 
ATOM   1552 O  O     . LEU A 1 197 ? 4.086   3.020   30.702  1.00 57.07  ? 197  LEU A O     1 
ATOM   1553 C  CB    . LEU A 1 197 ? 6.150   1.670   29.085  1.00 57.28  ? 197  LEU A CB    1 
ATOM   1554 C  CG    . LEU A 1 197 ? 7.451   0.876   29.070  1.00 57.36  ? 197  LEU A CG    1 
ATOM   1555 C  CD1   . LEU A 1 197 ? 8.584   1.733   28.516  1.00 57.04  ? 197  LEU A CD1   1 
ATOM   1556 C  CD2   . LEU A 1 197 ? 7.777   0.382   30.459  1.00 56.57  ? 197  LEU A CD2   1 
ATOM   1557 N  N     . GLY A 1 198 ? 2.714   1.952   29.285  1.00 57.22  ? 198  GLY A N     1 
ATOM   1558 C  CA    . GLY A 1 198 ? 1.673   2.974   29.373  1.00 57.19  ? 198  GLY A CA    1 
ATOM   1559 C  C     . GLY A 1 198 ? 2.022   4.220   28.580  1.00 57.12  ? 198  GLY A C     1 
ATOM   1560 O  O     . GLY A 1 198 ? 1.451   5.287   28.802  1.00 56.99  ? 198  GLY A O     1 
ATOM   1561 N  N     . ILE A 1 199 ? 2.972   4.079   27.659  1.00 57.02  ? 199  ILE A N     1 
ATOM   1562 C  CA    . ILE A 1 199 ? 3.375   5.173   26.783  1.00 57.13  ? 199  ILE A CA    1 
ATOM   1563 C  C     . ILE A 1 199 ? 2.621   5.085   25.458  1.00 57.07  ? 199  ILE A C     1 
ATOM   1564 O  O     . ILE A 1 199 ? 2.909   4.231   24.623  1.00 57.04  ? 199  ILE A O     1 
ATOM   1565 C  CB    . ILE A 1 199 ? 4.894   5.145   26.513  1.00 57.12  ? 199  ILE A CB    1 
ATOM   1566 C  CG1   . ILE A 1 199 ? 5.668   5.324   27.820  1.00 56.76  ? 199  ILE A CG1   1 
ATOM   1567 C  CG2   . ILE A 1 199 ? 5.279   6.223   25.514  1.00 57.12  ? 199  ILE A CG2   1 
ATOM   1568 C  CD1   . ILE A 1 199 ? 7.155   5.228   27.647  1.00 56.16  ? 199  ILE A CD1   1 
ATOM   1569 N  N     . ASN A 1 200 ? 1.645   5.967   25.280  1.00 57.14  ? 200  ASN A N     1 
ATOM   1570 C  CA    . ASN A 1 200 ? 0.776   5.924   24.111  1.00 57.18  ? 200  ASN A CA    1 
ATOM   1571 C  C     . ASN A 1 200 ? 1.031   7.109   23.203  1.00 56.88  ? 200  ASN A C     1 
ATOM   1572 O  O     . ASN A 1 200 ? 0.586   7.135   22.060  1.00 57.10  ? 200  ASN A O     1 
ATOM   1573 C  CB    . ASN A 1 200 ? -0.685  5.962   24.552  1.00 57.40  ? 200  ASN A CB    1 
ATOM   1574 C  CG    . ASN A 1 200 ? -0.942  5.106   25.759  1.00 58.02  ? 200  ASN A CG    1 
ATOM   1575 O  OD1   . ASN A 1 200 ? -0.920  3.882   25.669  1.00 59.80  ? 200  ASN A OD1   1 
ATOM   1576 N  ND2   . ASN A 1 200 ? -1.184  5.741   26.905  1.00 58.03  ? 200  ASN A ND2   1 
ATOM   1577 N  N     . LYS A 1 201 ? 1.735   8.094   23.735  1.00 56.63  ? 201  LYS A N     1 
ATOM   1578 C  CA    . LYS A 1 201 ? 1.912   9.368   23.072  1.00 56.59  ? 201  LYS A CA    1 
ATOM   1579 C  C     . LYS A 1 201 ? 3.353   9.790   23.274  1.00 56.45  ? 201  LYS A C     1 
ATOM   1580 O  O     . LYS A 1 201 ? 3.987   9.388   24.242  1.00 56.37  ? 201  LYS A O     1 
ATOM   1581 C  CB    . LYS A 1 201 ? 0.980   10.421  23.690  1.00 56.99  ? 201  LYS A CB    1 
ATOM   1582 C  CG    . LYS A 1 201 ? -0.515  10.054  23.687  1.00 57.08  ? 201  LYS A CG    1 
ATOM   1583 C  CD    . LYS A 1 201 ? -1.080  10.155  22.277  1.00 58.10  ? 201  LYS A CD    1 
ATOM   1584 C  CE    . LYS A 1 201 ? -2.302  9.279   22.078  1.00 57.45  ? 201  LYS A CE    1 
ATOM   1585 N  NZ    . LYS A 1 201 ? -3.447  9.829   22.796  1.00 57.75  ? 201  LYS A NZ    1 
ATOM   1586 N  N     . LEU A 1 202 ? 3.875   10.596  22.360  1.00 56.32  ? 202  LEU A N     1 
ATOM   1587 C  CA    . LEU A 1 202 ? 5.237   11.078  22.499  1.00 56.10  ? 202  LEU A CA    1 
ATOM   1588 C  C     . LEU A 1 202 ? 5.433   11.734  23.850  1.00 56.44  ? 202  LEU A C     1 
ATOM   1589 O  O     . LEU A 1 202 ? 6.488   11.597  24.471  1.00 56.61  ? 202  LEU A O     1 
ATOM   1590 C  CB    . LEU A 1 202 ? 5.563   12.081  21.403  1.00 55.88  ? 202  LEU A CB    1 
ATOM   1591 C  CG    . LEU A 1 202 ? 5.939   11.485  20.059  1.00 54.46  ? 202  LEU A CG    1 
ATOM   1592 C  CD1   . LEU A 1 202 ? 6.049   12.597  19.040  1.00 52.54  ? 202  LEU A CD1   1 
ATOM   1593 C  CD2   . LEU A 1 202 ? 7.244   10.738  20.215  1.00 53.90  ? 202  LEU A CD2   1 
ATOM   1594 N  N     . VAL A 1 203 ? 4.405   12.442  24.306  1.00 56.68  ? 203  VAL A N     1 
ATOM   1595 C  CA    . VAL A 1 203 ? 4.498   13.209  25.535  1.00 56.79  ? 203  VAL A CA    1 
ATOM   1596 C  C     . VAL A 1 203 ? 4.763   12.302  26.733  1.00 56.95  ? 203  VAL A C     1 
ATOM   1597 O  O     . VAL A 1 203 ? 5.470   12.687  27.661  1.00 57.24  ? 203  VAL A O     1 
ATOM   1598 C  CB    . VAL A 1 203 ? 3.247   14.102  25.750  1.00 56.90  ? 203  VAL A CB    1 
ATOM   1599 C  CG1   . VAL A 1 203 ? 1.995   13.264  25.994  1.00 56.75  ? 203  VAL A CG1   1 
ATOM   1600 C  CG2   . VAL A 1 203 ? 3.482   15.087  26.887  1.00 56.95  ? 203  VAL A CG2   1 
ATOM   1601 N  N     . ASP A 1 204 ? 4.230   11.082  26.679  1.00 57.06  ? 204  ASP A N     1 
ATOM   1602 C  CA    . ASP A 1 204 ? 4.401   10.095  27.747  1.00 57.13  ? 204  ASP A CA    1 
ATOM   1603 C  C     . ASP A 1 204 ? 5.837   9.635   27.937  1.00 57.16  ? 204  ASP A C     1 
ATOM   1604 O  O     . ASP A 1 204 ? 6.148   8.970   28.915  1.00 57.62  ? 204  ASP A O     1 
ATOM   1605 C  CB    . ASP A 1 204 ? 3.536   8.866   27.481  1.00 57.03  ? 204  ASP A CB    1 
ATOM   1606 C  CG    . ASP A 1 204 ? 2.074   9.201   27.351  1.00 57.46  ? 204  ASP A CG    1 
ATOM   1607 O  OD1   . ASP A 1 204 ? 1.568   10.009  28.170  1.00 58.39  ? 204  ASP A OD1   1 
ATOM   1608 O  OD2   . ASP A 1 204 ? 1.429   8.648   26.436  1.00 56.77  ? 204  ASP A OD2   1 
ATOM   1609 N  N     . THR A 1 205 ? 6.709   9.964   26.998  1.00 57.23  ? 205  THR A N     1 
ATOM   1610 C  CA    . THR A 1 205 ? 8.092   9.530   27.090  1.00 57.37  ? 205  THR A CA    1 
ATOM   1611 C  C     . THR A 1 205 ? 8.872   10.483  27.973  1.00 57.69  ? 205  THR A C     1 
ATOM   1612 O  O     . THR A 1 205 ? 9.993   10.191  28.391  1.00 57.71  ? 205  THR A O     1 
ATOM   1613 C  CB    . THR A 1 205 ? 8.756   9.455   25.710  1.00 57.36  ? 205  THR A CB    1 
ATOM   1614 O  OG1   . THR A 1 205 ? 8.797   10.766  25.130  1.00 57.10  ? 205  THR A OG1   1 
ATOM   1615 C  CG2   . THR A 1 205 ? 7.970   8.516   24.805  1.00 56.79  ? 205  THR A CG2   1 
ATOM   1616 N  N     . LEU A 1 206 ? 8.266   11.630  28.252  1.00 58.06  ? 206  LEU A N     1 
ATOM   1617 C  CA    . LEU A 1 206 ? 8.850   12.590  29.170  1.00 58.31  ? 206  LEU A CA    1 
ATOM   1618 C  C     . LEU A 1 206 ? 8.436   12.261  30.595  1.00 58.74  ? 206  LEU A C     1 
ATOM   1619 O  O     . LEU A 1 206 ? 9.120   12.636  31.543  1.00 59.13  ? 206  LEU A O     1 
ATOM   1620 C  CB    . LEU A 1 206 ? 8.423   14.010  28.800  1.00 58.10  ? 206  LEU A CB    1 
ATOM   1621 C  CG    . LEU A 1 206 ? 8.679   14.401  27.347  1.00 57.21  ? 206  LEU A CG    1 
ATOM   1622 C  CD1   . LEU A 1 206 ? 8.222   15.822  27.082  1.00 57.02  ? 206  LEU A CD1   1 
ATOM   1623 C  CD2   . LEU A 1 206 ? 10.148  14.240  27.011  1.00 56.69  ? 206  LEU A CD2   1 
ATOM   1624 N  N     . SER A 1 207 ? 7.319   11.549  30.740  1.00 59.19  ? 207  SER A N     1 
ATOM   1625 C  CA    . SER A 1 207 ? 6.788   11.200  32.063  1.00 59.53  ? 207  SER A CA    1 
ATOM   1626 C  C     . SER A 1 207 ? 7.417   9.905   32.567  1.00 59.64  ? 207  SER A C     1 
ATOM   1627 O  O     . SER A 1 207 ? 6.972   9.328   33.557  1.00 59.76  ? 207  SER A O     1 
ATOM   1628 C  CB    . SER A 1 207 ? 5.262   11.052  32.026  1.00 59.46  ? 207  SER A CB    1 
ATOM   1629 O  OG    . SER A 1 207 ? 4.670   11.902  31.052  1.00 60.13  ? 207  SER A OG    1 
ATOM   1630 N  N     . ILE A 1 208 ? 8.457   9.453   31.878  1.00 59.82  ? 208  ILE A N     1 
ATOM   1631 C  CA    . ILE A 1 208 ? 9.151   8.231   32.263  1.00 60.13  ? 208  ILE A CA    1 
ATOM   1632 C  C     . ILE A 1 208 ? 10.658  8.454   32.329  1.00 60.54  ? 208  ILE A C     1 
ATOM   1633 O  O     . ILE A 1 208 ? 11.222  9.164   31.494  1.00 60.84  ? 208  ILE A O     1 
ATOM   1634 C  CB    . ILE A 1 208 ? 8.842   7.070   31.287  1.00 59.94  ? 208  ILE A CB    1 
ATOM   1635 C  CG1   . ILE A 1 208 ? 9.444   5.761   31.803  1.00 59.56  ? 208  ILE A CG1   1 
ATOM   1636 C  CG2   . ILE A 1 208 ? 9.345   7.391   29.887  1.00 59.82  ? 208  ILE A CG2   1 
ATOM   1637 C  CD1   . ILE A 1 208 ? 8.946   4.533   31.083  1.00 59.04  ? 208  ILE A CD1   1 
ATOM   1638 N  N     . GLU A 1 209 ? 11.303  7.850   33.327  1.00 60.91  ? 209  GLU A N     1 
ATOM   1639 C  CA    . GLU A 1 209 ? 12.757  7.909   33.447  1.00 61.16  ? 209  GLU A CA    1 
ATOM   1640 C  C     . GLU A 1 209 ? 13.400  7.314   32.204  1.00 61.42  ? 209  GLU A C     1 
ATOM   1641 O  O     . GLU A 1 209 ? 12.849  6.405   31.577  1.00 61.43  ? 209  GLU A O     1 
ATOM   1642 C  CB    . GLU A 1 209 ? 13.239  7.137   34.676  1.00 61.30  ? 209  GLU A CB    1 
ATOM   1643 C  CG    . GLU A 1 209 ? 12.489  7.419   35.958  1.00 60.90  ? 209  GLU A CG    1 
ATOM   1644 C  CD    . GLU A 1 209 ? 12.719  6.328   36.982  1.00 61.37  ? 209  GLU A CD    1 
ATOM   1645 O  OE1   . GLU A 1 209 ? 13.309  5.290   36.602  1.00 61.08  ? 209  GLU A OE1   1 
ATOM   1646 O  OE2   . GLU A 1 209 ? 12.320  6.504   38.160  1.00 61.12  ? 209  GLU A OE2   1 
ATOM   1647 N  N     . PHE A 1 210 ? 14.571  7.822   31.847  1.00 61.65  ? 210  PHE A N     1 
ATOM   1648 C  CA    . PHE A 1 210 ? 15.234  7.358   30.643  1.00 61.71  ? 210  PHE A CA    1 
ATOM   1649 C  C     . PHE A 1 210 ? 15.482  5.849   30.653  1.00 61.79  ? 210  PHE A C     1 
ATOM   1650 O  O     . PHE A 1 210 ? 15.047  5.144   29.742  1.00 62.00  ? 210  PHE A O     1 
ATOM   1651 C  CB    . PHE A 1 210 ? 16.539  8.115   30.396  1.00 61.69  ? 210  PHE A CB    1 
ATOM   1652 C  CG    . PHE A 1 210 ? 17.245  7.686   29.146  1.00 62.16  ? 210  PHE A CG    1 
ATOM   1653 C  CD1   . PHE A 1 210 ? 16.628  7.823   27.910  1.00 62.27  ? 210  PHE A CD1   1 
ATOM   1654 C  CD2   . PHE A 1 210 ? 18.510  7.125   29.204  1.00 62.37  ? 210  PHE A CD2   1 
ATOM   1655 C  CE1   . PHE A 1 210 ? 17.260  7.425   26.752  1.00 62.21  ? 210  PHE A CE1   1 
ATOM   1656 C  CE2   . PHE A 1 210 ? 19.151  6.725   28.056  1.00 62.59  ? 210  PHE A CE2   1 
ATOM   1657 C  CZ    . PHE A 1 210 ? 18.518  6.872   26.818  1.00 62.85  ? 210  PHE A CZ    1 
ATOM   1658 N  N     . ASP A 1 211 ? 16.165  5.360   31.684  1.00 61.84  ? 211  ASP A N     1 
ATOM   1659 C  CA    . ASP A 1 211 ? 16.594  3.959   31.749  1.00 61.92  ? 211  ASP A CA    1 
ATOM   1660 C  C     . ASP A 1 211 ? 15.444  2.953   31.685  1.00 61.93  ? 211  ASP A C     1 
ATOM   1661 O  O     . ASP A 1 211 ? 15.592  1.862   31.130  1.00 61.86  ? 211  ASP A O     1 
ATOM   1662 C  CB    . ASP A 1 211 ? 17.412  3.719   33.015  1.00 61.92  ? 211  ASP A CB    1 
ATOM   1663 C  CG    . ASP A 1 211 ? 18.131  4.967   33.483  1.00 62.29  ? 211  ASP A CG    1 
ATOM   1664 O  OD1   . ASP A 1 211 ? 19.379  5.000   33.390  1.00 62.67  ? 211  ASP A OD1   1 
ATOM   1665 O  OD2   . ASP A 1 211 ? 17.445  5.920   33.928  1.00 61.61  ? 211  ASP A OD2   1 
ATOM   1666 N  N     . LYS A 1 212 ? 14.305  3.319   32.264  1.00 62.00  ? 212  LYS A N     1 
ATOM   1667 C  CA    . LYS A 1 212 ? 13.127  2.458   32.252  1.00 61.94  ? 212  LYS A CA    1 
ATOM   1668 C  C     . LYS A 1 212 ? 12.533  2.405   30.849  1.00 61.71  ? 212  LYS A C     1 
ATOM   1669 O  O     . LYS A 1 212 ? 12.055  1.360   30.405  1.00 61.76  ? 212  LYS A O     1 
ATOM   1670 C  CB    . LYS A 1 212 ? 12.090  2.951   33.269  1.00 62.09  ? 212  LYS A CB    1 
ATOM   1671 C  CG    . LYS A 1 212 ? 11.006  1.933   33.604  1.00 62.47  ? 212  LYS A CG    1 
ATOM   1672 C  CD    . LYS A 1 212 ? 10.209  2.339   34.837  1.00 62.90  ? 212  LYS A CD    1 
ATOM   1673 C  CE    . LYS A 1 212 ? 10.839  1.817   36.130  1.00 63.81  ? 212  LYS A CE    1 
ATOM   1674 N  NZ    . LYS A 1 212 ? 12.185  2.395   36.422  1.00 64.06  ? 212  LYS A NZ    1 
ATOM   1675 N  N     . LEU A 1 213 ? 12.578  3.540   30.154  1.00 61.44  ? 213  LEU A N     1 
ATOM   1676 C  CA    . LEU A 1 213 ? 12.170  3.620   28.752  1.00 61.04  ? 213  LEU A CA    1 
ATOM   1677 C  C     . LEU A 1 213 ? 13.206  2.937   27.865  1.00 60.83  ? 213  LEU A C     1 
ATOM   1678 O  O     . LEU A 1 213 ? 12.869  2.068   27.062  1.00 60.76  ? 213  LEU A O     1 
ATOM   1679 C  CB    . LEU A 1 213 ? 11.983  5.081   28.332  1.00 60.96  ? 213  LEU A CB    1 
ATOM   1680 C  CG    . LEU A 1 213 ? 11.623  5.341   26.868  1.00 61.07  ? 213  LEU A CG    1 
ATOM   1681 C  CD1   . LEU A 1 213 ? 10.412  4.517   26.460  1.00 60.53  ? 213  LEU A CD1   1 
ATOM   1682 C  CD2   . LEU A 1 213 ? 11.379  6.826   26.620  1.00 61.08  ? 213  LEU A CD2   1 
ATOM   1683 N  N     . LYS A 1 214 ? 14.463  3.346   28.021  1.00 60.75  ? 214  LYS A N     1 
ATOM   1684 C  CA    . LYS A 1 214 ? 15.618  2.688   27.396  1.00 60.67  ? 214  LYS A CA    1 
ATOM   1685 C  C     . LYS A 1 214 ? 15.576  1.180   27.585  1.00 60.57  ? 214  LYS A C     1 
ATOM   1686 O  O     . LYS A 1 214 ? 15.696  0.425   26.632  1.00 60.77  ? 214  LYS A O     1 
ATOM   1687 C  CB    . LYS A 1 214 ? 16.912  3.247   27.999  1.00 60.72  ? 214  LYS A CB    1 
ATOM   1688 C  CG    . LYS A 1 214 ? 18.173  2.437   27.756  1.00 60.59  ? 214  LYS A CG    1 
ATOM   1689 C  CD    . LYS A 1 214 ? 19.350  3.115   28.456  1.00 61.25  ? 214  LYS A CD    1 
ATOM   1690 C  CE    . LYS A 1 214 ? 20.714  2.607   27.970  1.00 61.90  ? 214  LYS A CE    1 
ATOM   1691 N  NZ    . LYS A 1 214 ? 21.238  1.425   28.728  1.00 60.16  ? 214  LYS A NZ    1 
ATOM   1692 N  N     . GLY A 1 215 ? 15.392  0.748   28.826  1.00 60.65  ? 215  GLY A N     1 
ATOM   1693 C  CA    . GLY A 1 215 ? 15.352  -0.671  29.153  1.00 60.61  ? 215  GLY A CA    1 
ATOM   1694 C  C     . GLY A 1 215 ? 14.217  -1.445  28.510  1.00 60.48  ? 215  GLY A C     1 
ATOM   1695 O  O     . GLY A 1 215 ? 14.052  -2.637  28.768  1.00 60.77  ? 215  GLY A O     1 
ATOM   1696 N  N     . MET A 1 216 ? 13.434  -0.777  27.672  1.00 60.16  ? 216  MET A N     1 
ATOM   1697 C  CA    . MET A 1 216 ? 12.314  -1.426  27.009  1.00 59.92  ? 216  MET A CA    1 
ATOM   1698 C  C     . MET A 1 216 ? 12.487  -1.364  25.503  1.00 59.44  ? 216  MET A C     1 
ATOM   1699 O  O     . MET A 1 216 ? 12.385  -2.375  24.808  1.00 59.46  ? 216  MET A O     1 
ATOM   1700 C  CB    . MET A 1 216 ? 11.003  -0.744  27.403  1.00 60.28  ? 216  MET A CB    1 
ATOM   1701 C  CG    . MET A 1 216 ? 9.762   -1.612  27.232  1.00 61.43  ? 216  MET A CG    1 
ATOM   1702 S  SD    . MET A 1 216 ? 9.823   -3.145  28.197  1.00 64.84  ? 216  MET A SD    1 
ATOM   1703 C  CE    . MET A 1 216 ? 10.344  -2.558  29.812  1.00 64.02  ? 216  MET A CE    1 
ATOM   1704 N  N     . ILE A 1 217 ? 12.765  -0.164  25.008  1.00 58.78  ? 217  ILE A N     1 
ATOM   1705 C  CA    . ILE A 1 217 ? 12.786  0.087   23.580  1.00 57.94  ? 217  ILE A CA    1 
ATOM   1706 C  C     . ILE A 1 217 ? 14.197  0.384   23.077  1.00 57.81  ? 217  ILE A C     1 
ATOM   1707 O  O     . ILE A 1 217 ? 14.412  0.567   21.876  1.00 57.62  ? 217  ILE A O     1 
ATOM   1708 C  CB    . ILE A 1 217 ? 11.843  1.232   23.221  1.00 57.58  ? 217  ILE A CB    1 
ATOM   1709 C  CG1   . ILE A 1 217 ? 12.351  2.542   23.819  1.00 57.03  ? 217  ILE A CG1   1 
ATOM   1710 C  CG2   . ILE A 1 217 ? 10.436  0.921   23.709  1.00 57.85  ? 217  ILE A CG2   1 
ATOM   1711 C  CD1   . ILE A 1 217 ? 11.589  3.749   23.341  1.00 56.05  ? 217  ILE A CD1   1 
ATOM   1712 N  N     . GLY A 1 218 ? 15.154  0.430   24.004  1.00 57.40  ? 218  GLY A N     1 
ATOM   1713 C  CA    . GLY A 1 218 ? 16.551  0.649   23.651  1.00 56.71  ? 218  GLY A CA    1 
ATOM   1714 C  C     . GLY A 1 218 ? 16.973  2.093   23.814  1.00 56.29  ? 218  GLY A C     1 
ATOM   1715 O  O     . GLY A 1 218 ? 16.140  2.995   23.836  1.00 56.13  ? 218  GLY A O     1 
ATOM   1716 N  N     . GLU A 1 219 ? 18.276  2.312   23.915  1.00 56.02  ? 219  GLU A N     1 
ATOM   1717 C  CA    . GLU A 1 219 ? 18.804  3.645   24.160  1.00 56.08  ? 219  GLU A CA    1 
ATOM   1718 C  C     . GLU A 1 219 ? 18.494  4.608   23.029  1.00 55.73  ? 219  GLU A C     1 
ATOM   1719 O  O     . GLU A 1 219 ? 18.070  5.737   23.273  1.00 55.65  ? 219  GLU A O     1 
ATOM   1720 C  CB    . GLU A 1 219 ? 20.315  3.593   24.385  1.00 56.25  ? 219  GLU A CB    1 
ATOM   1721 C  CG    . GLU A 1 219 ? 20.853  4.814   25.097  1.00 57.64  ? 219  GLU A CG    1 
ATOM   1722 C  CD    . GLU A 1 219 ? 22.361  4.851   25.132  1.00 59.47  ? 219  GLU A CD    1 
ATOM   1723 O  OE1   . GLU A 1 219 ? 22.968  4.889   24.041  1.00 59.66  ? 219  GLU A OE1   1 
ATOM   1724 O  OE2   . GLU A 1 219 ? 22.936  4.850   26.249  1.00 60.22  ? 219  GLU A OE2   1 
ATOM   1725 N  N     . ALA A 1 220 ? 18.713  4.152   21.796  1.00 55.58  ? 220  ALA A N     1 
ATOM   1726 C  CA    . ALA A 1 220 ? 18.555  4.986   20.609  1.00 55.25  ? 220  ALA A CA    1 
ATOM   1727 C  C     . ALA A 1 220 ? 17.118  5.417   20.407  1.00 55.23  ? 220  ALA A C     1 
ATOM   1728 O  O     . ALA A 1 220 ? 16.853  6.575   20.107  1.00 55.11  ? 220  ALA A O     1 
ATOM   1729 C  CB    . ALA A 1 220 ? 19.053  4.261   19.388  1.00 55.01  ? 220  ALA A CB    1 
ATOM   1730 N  N     . LYS A 1 221 ? 16.197  4.477   20.569  1.00 55.53  ? 221  LYS A N     1 
ATOM   1731 C  CA    . LYS A 1 221 ? 14.781  4.732   20.330  1.00 56.23  ? 221  LYS A CA    1 
ATOM   1732 C  C     . LYS A 1 221 ? 14.217  5.618   21.428  1.00 55.93  ? 221  LYS A C     1 
ATOM   1733 O  O     . LYS A 1 221 ? 13.494  6.573   21.161  1.00 56.20  ? 221  LYS A O     1 
ATOM   1734 C  CB    . LYS A 1 221 ? 14.020  3.416   20.305  1.00 56.67  ? 221  LYS A CB    1 
ATOM   1735 C  CG    . LYS A 1 221 ? 13.061  3.274   19.155  1.00 59.24  ? 221  LYS A CG    1 
ATOM   1736 C  CD    . LYS A 1 221 ? 12.672  1.807   19.009  1.00 63.42  ? 221  LYS A CD    1 
ATOM   1737 C  CE    . LYS A 1 221 ? 12.331  1.457   17.570  1.00 65.65  ? 221  LYS A CE    1 
ATOM   1738 N  NZ    . LYS A 1 221 ? 13.485  1.669   16.648  1.00 67.34  ? 221  LYS A NZ    1 
ATOM   1739 N  N     . ALA A 1 222 ? 14.543  5.279   22.669  1.00 55.62  ? 222  ALA A N     1 
ATOM   1740 C  CA    . ALA A 1 222 ? 14.221  6.114   23.803  1.00 55.30  ? 222  ALA A CA    1 
ATOM   1741 C  C     . ALA A 1 222 ? 14.653  7.552   23.550  1.00 55.21  ? 222  ALA A C     1 
ATOM   1742 O  O     . ALA A 1 222 ? 13.840  8.465   23.639  1.00 54.96  ? 222  ALA A O     1 
ATOM   1743 C  CB    . ALA A 1 222 ? 14.884  5.571   25.057  1.00 55.26  ? 222  ALA A CB    1 
ATOM   1744 N  N     . LYS A 1 223 ? 15.932  7.755   23.243  1.00 55.39  ? 223  LYS A N     1 
ATOM   1745 C  CA    . LYS A 1 223 ? 16.435  9.104   22.995  1.00 55.96  ? 223  LYS A CA    1 
ATOM   1746 C  C     . LYS A 1 223 ? 15.623  9.770   21.885  1.00 55.93  ? 223  LYS A C     1 
ATOM   1747 O  O     . LYS A 1 223 ? 15.105  10.872  22.053  1.00 56.37  ? 223  LYS A O     1 
ATOM   1748 C  CB    . LYS A 1 223 ? 17.920  9.083   22.632  1.00 56.01  ? 223  LYS A CB    1 
ATOM   1749 C  CG    . LYS A 1 223 ? 18.874  8.919   23.808  1.00 57.01  ? 223  LYS A CG    1 
ATOM   1750 C  CD    . LYS A 1 223 ? 20.316  8.844   23.316  1.00 58.16  ? 223  LYS A CD    1 
ATOM   1751 C  CE    . LYS A 1 223 ? 21.276  8.316   24.376  1.00 59.47  ? 223  LYS A CE    1 
ATOM   1752 N  NZ    . LYS A 1 223 ? 21.548  9.295   25.474  1.00 60.78  ? 223  LYS A NZ    1 
ATOM   1753 N  N     . TYR A 1 224 ? 15.525  9.082   20.756  1.00 55.88  ? 224  TYR A N     1 
ATOM   1754 C  CA    . TYR A 1 224 ? 14.683  9.478   19.633  1.00 56.02  ? 224  TYR A CA    1 
ATOM   1755 C  C     . TYR A 1 224 ? 13.330  10.014  20.074  1.00 56.23  ? 224  TYR A C     1 
ATOM   1756 O  O     . TYR A 1 224 ? 12.999  11.177  19.820  1.00 56.34  ? 224  TYR A O     1 
ATOM   1757 C  CB    . TYR A 1 224 ? 14.485  8.264   18.727  1.00 56.08  ? 224  TYR A CB    1 
ATOM   1758 C  CG    . TYR A 1 224 ? 13.561  8.458   17.545  1.00 55.65  ? 224  TYR A CG    1 
ATOM   1759 C  CD1   . TYR A 1 224 ? 13.855  9.380   16.560  1.00 54.86  ? 224  TYR A CD1   1 
ATOM   1760 C  CD2   . TYR A 1 224 ? 12.416  7.680   17.402  1.00 54.79  ? 224  TYR A CD2   1 
ATOM   1761 C  CE1   . TYR A 1 224 ? 13.031  9.542   15.474  1.00 55.40  ? 224  TYR A CE1   1 
ATOM   1762 C  CE2   . TYR A 1 224 ? 11.576  7.839   16.320  1.00 55.67  ? 224  TYR A CE2   1 
ATOM   1763 C  CZ    . TYR A 1 224 ? 11.890  8.771   15.349  1.00 55.97  ? 224  TYR A CZ    1 
ATOM   1764 O  OH    . TYR A 1 224 ? 11.074  8.938   14.246  1.00 54.67  ? 224  TYR A OH    1 
ATOM   1765 N  N     . LEU A 1 225 ? 12.558  9.155   20.734  1.00 56.32  ? 225  LEU A N     1 
ATOM   1766 C  CA    . LEU A 1 225 ? 11.225  9.502   21.214  1.00 56.44  ? 225  LEU A CA    1 
ATOM   1767 C  C     . LEU A 1 225 ? 11.237  10.723  22.114  1.00 56.36  ? 225  LEU A C     1 
ATOM   1768 O  O     . LEU A 1 225 ? 10.473  11.662  21.905  1.00 56.24  ? 225  LEU A O     1 
ATOM   1769 C  CB    . LEU A 1 225 ? 10.598  8.318   21.954  1.00 56.47  ? 225  LEU A CB    1 
ATOM   1770 C  CG    . LEU A 1 225 ? 10.351  7.061   21.113  1.00 56.21  ? 225  LEU A CG    1 
ATOM   1771 C  CD1   . LEU A 1 225 ? 9.502   6.092   21.915  1.00 56.68  ? 225  LEU A CD1   1 
ATOM   1772 C  CD2   . LEU A 1 225 ? 9.662   7.418   19.812  1.00 54.01  ? 225  LEU A CD2   1 
ATOM   1773 N  N     . ILE A 1 226 ? 12.112  10.704  23.113  1.00 56.58  ? 226  ILE A N     1 
ATOM   1774 C  CA    . ILE A 1 226 ? 12.215  11.802  24.066  1.00 56.67  ? 226  ILE A CA    1 
ATOM   1775 C  C     . ILE A 1 226 ? 12.565  13.099  23.351  1.00 56.89  ? 226  ILE A C     1 
ATOM   1776 O  O     . ILE A 1 226 ? 11.978  14.144  23.615  1.00 56.80  ? 226  ILE A O     1 
ATOM   1777 C  CB    . ILE A 1 226 ? 13.246  11.493  25.166  1.00 56.63  ? 226  ILE A CB    1 
ATOM   1778 C  CG1   . ILE A 1 226 ? 12.807  10.259  25.960  1.00 56.75  ? 226  ILE A CG1   1 
ATOM   1779 C  CG2   . ILE A 1 226 ? 13.407  12.679  26.110  1.00 56.69  ? 226  ILE A CG2   1 
ATOM   1780 C  CD1   . ILE A 1 226 ? 13.787  9.832   27.046  1.00 56.72  ? 226  ILE A CD1   1 
ATOM   1781 N  N     . SER A 1 227 ? 13.510  13.018  22.422  1.00 57.43  ? 227  SER A N     1 
ATOM   1782 C  CA    . SER A 1 227 ? 13.888  14.171  21.615  1.00 57.75  ? 227  SER A CA    1 
ATOM   1783 C  C     . SER A 1 227 ? 12.727  14.679  20.758  1.00 57.74  ? 227  SER A C     1 
ATOM   1784 O  O     . SER A 1 227 ? 12.587  15.884  20.537  1.00 57.92  ? 227  SER A O     1 
ATOM   1785 C  CB    . SER A 1 227 ? 15.084  13.835  20.733  1.00 57.55  ? 227  SER A CB    1 
ATOM   1786 O  OG    . SER A 1 227 ? 15.056  14.614  19.551  1.00 58.45  ? 227  SER A OG    1 
ATOM   1787 N  N     . LEU A 1 228 ? 11.897  13.761  20.279  1.00 57.91  ? 228  LEU A N     1 
ATOM   1788 C  CA    . LEU A 1 228 ? 10.713  14.140  19.518  1.00 58.09  ? 228  LEU A CA    1 
ATOM   1789 C  C     . LEU A 1 228 ? 9.713   14.824  20.426  1.00 58.27  ? 228  LEU A C     1 
ATOM   1790 O  O     . LEU A 1 228 ? 9.189   15.886  20.090  1.00 58.42  ? 228  LEU A O     1 
ATOM   1791 C  CB    . LEU A 1 228 ? 10.068  12.923  18.861  1.00 58.03  ? 228  LEU A CB    1 
ATOM   1792 C  CG    . LEU A 1 228 ? 10.695  12.453  17.548  1.00 58.26  ? 228  LEU A CG    1 
ATOM   1793 C  CD1   . LEU A 1 228 ? 10.140  11.096  17.174  1.00 57.58  ? 228  LEU A CD1   1 
ATOM   1794 C  CD2   . LEU A 1 228 ? 10.443  13.463  16.440  1.00 57.51  ? 228  LEU A CD2   1 
ATOM   1795 N  N     . ALA A 1 229 ? 9.464   14.205  21.578  1.00 58.35  ? 229  ALA A N     1 
ATOM   1796 C  CA    . ALA A 1 229 ? 8.524   14.715  22.564  1.00 58.39  ? 229  ALA A CA    1 
ATOM   1797 C  C     . ALA A 1 229 ? 8.947   16.087  23.070  1.00 58.74  ? 229  ALA A C     1 
ATOM   1798 O  O     . ALA A 1 229 ? 8.111   16.922  23.396  1.00 58.48  ? 229  ALA A O     1 
ATOM   1799 C  CB    . ALA A 1 229 ? 8.404   13.746  23.710  1.00 58.20  ? 229  ALA A CB    1 
ATOM   1800 N  N     . ARG A 1 230 ? 10.254  16.318  23.112  1.00 59.39  ? 230  ARG A N     1 
ATOM   1801 C  CA    . ARG A 1 230 ? 10.798  17.589  23.563  1.00 60.16  ? 230  ARG A CA    1 
ATOM   1802 C  C     . ARG A 1 230 ? 10.769  18.673  22.488  1.00 60.97  ? 230  ARG A C     1 
ATOM   1803 O  O     . ARG A 1 230 ? 11.178  19.804  22.736  1.00 60.96  ? 230  ARG A O     1 
ATOM   1804 C  CB    . ARG A 1 230 ? 12.225  17.386  24.058  1.00 59.90  ? 230  ARG A CB    1 
ATOM   1805 C  CG    . ARG A 1 230 ? 12.290  16.639  25.367  1.00 60.04  ? 230  ARG A CG    1 
ATOM   1806 C  CD    . ARG A 1 230 ? 13.709  16.470  25.863  1.00 59.76  ? 230  ARG A CD    1 
ATOM   1807 N  NE    . ARG A 1 230 ? 13.751  16.621  27.309  1.00 61.10  ? 230  ARG A NE    1 
ATOM   1808 C  CZ    . ARG A 1 230 ? 14.640  16.037  28.101  1.00 61.30  ? 230  ARG A CZ    1 
ATOM   1809 N  NH1   . ARG A 1 230 ? 15.574  15.239  27.588  1.00 60.50  ? 230  ARG A NH1   1 
ATOM   1810 N  NH2   . ARG A 1 230 ? 14.588  16.251  29.410  1.00 60.31  ? 230  ARG A NH2   1 
ATOM   1811 N  N     . ASP A 1 231 ? 10.278  18.323  21.301  1.00 62.16  ? 231  ASP A N     1 
ATOM   1812 C  CA    . ASP A 1 231 ? 10.318  19.214  20.141  1.00 63.21  ? 231  ASP A CA    1 
ATOM   1813 C  C     . ASP A 1 231 ? 11.748  19.714  19.931  1.00 64.00  ? 231  ASP A C     1 
ATOM   1814 O  O     . ASP A 1 231 ? 11.974  20.853  19.505  1.00 64.07  ? 231  ASP A O     1 
ATOM   1815 C  CB    . ASP A 1 231 ? 9.337   20.384  20.299  1.00 63.16  ? 231  ASP A CB    1 
ATOM   1816 C  CG    . ASP A 1 231 ? 8.871   20.953  18.957  1.00 63.49  ? 231  ASP A CG    1 
ATOM   1817 O  OD1   . ASP A 1 231 ? 9.441   20.569  17.914  1.00 64.24  ? 231  ASP A OD1   1 
ATOM   1818 O  OD2   . ASP A 1 231 ? 7.930   21.784  18.941  1.00 63.96  ? 231  ASP A OD2   1 
ATOM   1819 N  N     . GLU A 1 232 ? 12.708  18.846  20.245  1.00 64.76  ? 232  GLU A N     1 
ATOM   1820 C  CA    . GLU A 1 232 ? 14.119  19.154  20.085  1.00 65.59  ? 232  GLU A CA    1 
ATOM   1821 C  C     . GLU A 1 232 ? 14.685  18.470  18.852  1.00 66.27  ? 232  GLU A C     1 
ATOM   1822 O  O     . GLU A 1 232 ? 15.719  18.891  18.322  1.00 66.65  ? 232  GLU A O     1 
ATOM   1823 C  CB    . GLU A 1 232 ? 14.900  18.685  21.303  1.00 65.48  ? 232  GLU A CB    1 
ATOM   1824 C  CG    . GLU A 1 232 ? 14.686  19.532  22.542  1.00 66.76  ? 232  GLU A CG    1 
ATOM   1825 C  CD    . GLU A 1 232 ? 15.447  18.999  23.737  1.00 67.44  ? 232  GLU A CD    1 
ATOM   1826 O  OE1   . GLU A 1 232 ? 15.930  17.845  23.672  1.00 67.43  ? 232  GLU A OE1   1 
ATOM   1827 O  OE2   . GLU A 1 232 ? 15.561  19.734  24.738  1.00 68.27  ? 232  GLU A OE2   1 
ATOM   1828 N  N     . TYR A 1 233 ? 14.020  17.403  18.410  1.00 66.68  ? 233  TYR A N     1 
ATOM   1829 C  CA    . TYR A 1 233 ? 14.523  16.608  17.308  1.00 66.99  ? 233  TYR A CA    1 
ATOM   1830 C  C     . TYR A 1 233 ? 14.856  17.540  16.165  1.00 67.49  ? 233  TYR A C     1 
ATOM   1831 O  O     . TYR A 1 233 ? 14.013  18.326  15.717  1.00 67.73  ? 233  TYR A O     1 
ATOM   1832 C  CB    . TYR A 1 233 ? 13.500  15.565  16.868  1.00 66.96  ? 233  TYR A CB    1 
ATOM   1833 C  CG    . TYR A 1 233 ? 13.962  14.694  15.719  1.00 66.49  ? 233  TYR A CG    1 
ATOM   1834 C  CD1   . TYR A 1 233 ? 14.407  13.391  15.935  1.00 65.89  ? 233  TYR A CD1   1 
ATOM   1835 C  CD2   . TYR A 1 233 ? 13.951  15.175  14.414  1.00 66.56  ? 233  TYR A CD2   1 
ATOM   1836 C  CE1   . TYR A 1 233 ? 14.825  12.592  14.876  1.00 65.80  ? 233  TYR A CE1   1 
ATOM   1837 C  CE2   . TYR A 1 233 ? 14.373  14.389  13.349  1.00 65.86  ? 233  TYR A CE2   1 
ATOM   1838 C  CZ    . TYR A 1 233 ? 14.802  13.101  13.583  1.00 66.19  ? 233  TYR A CZ    1 
ATOM   1839 O  OH    . TYR A 1 233 ? 15.213  12.332  12.512  1.00 66.76  ? 233  TYR A OH    1 
ATOM   1840 N  N     . ASN A 1 234 ? 16.098  17.457  15.709  1.00 67.76  ? 234  ASN A N     1 
ATOM   1841 C  CA    . ASN A 1 234 ? 16.603  18.380  14.718  1.00 68.18  ? 234  ASN A CA    1 
ATOM   1842 C  C     . ASN A 1 234 ? 17.629  17.685  13.840  1.00 68.30  ? 234  ASN A C     1 
ATOM   1843 O  O     . ASN A 1 234 ? 18.619  18.302  13.434  1.00 68.65  ? 234  ASN A O     1 
ATOM   1844 C  CB    . ASN A 1 234 ? 17.248  19.584  15.417  1.00 68.34  ? 234  ASN A CB    1 
ATOM   1845 C  CG    . ASN A 1 234 ? 16.954  20.905  14.718  1.00 68.58  ? 234  ASN A CG    1 
ATOM   1846 O  OD1   . ASN A 1 234 ? 16.194  20.957  13.749  1.00 68.39  ? 234  ASN A OD1   1 
ATOM   1847 N  ND2   . ASN A 1 234 ? 17.552  21.985  15.221  1.00 68.89  ? 234  ASN A ND2   1 
ATOM   1848 N  N     . GLU A 1 235 ? 17.409  16.399  13.567  1.00 68.18  ? 235  GLU A N     1 
ATOM   1849 C  CA    . GLU A 1 235 ? 18.305  15.650  12.692  1.00 68.09  ? 235  GLU A CA    1 
ATOM   1850 C  C     . GLU A 1 235 ? 18.348  16.301  11.326  1.00 67.79  ? 235  GLU A C     1 
ATOM   1851 O  O     . GLU A 1 235 ? 17.312  16.548  10.714  1.00 67.76  ? 235  GLU A O     1 
ATOM   1852 C  CB    . GLU A 1 235 ? 17.885  14.189  12.576  1.00 68.17  ? 235  GLU A CB    1 
ATOM   1853 C  CG    . GLU A 1 235 ? 18.148  13.397  13.832  1.00 69.26  ? 235  GLU A CG    1 
ATOM   1854 C  CD    . GLU A 1 235 ? 19.609  13.450  14.243  1.00 70.59  ? 235  GLU A CD    1 
ATOM   1855 O  OE1   . GLU A 1 235 ? 20.469  13.144  13.387  1.00 70.40  ? 235  GLU A OE1   1 
ATOM   1856 O  OE2   . GLU A 1 235 ? 19.890  13.799  15.414  1.00 70.32  ? 235  GLU A OE2   1 
ATOM   1857 N  N     . PRO A 1 236 ? 19.554  16.603  10.847  1.00 67.72  ? 236  PRO A N     1 
ATOM   1858 C  CA    . PRO A 1 236 ? 19.619  17.364  9.620   1.00 67.58  ? 236  PRO A CA    1 
ATOM   1859 C  C     . PRO A 1 236 ? 19.321  16.503  8.401   1.00 67.47  ? 236  PRO A C     1 
ATOM   1860 O  O     . PRO A 1 236 ? 19.469  15.282  8.433   1.00 67.39  ? 236  PRO A O     1 
ATOM   1861 C  CB    . PRO A 1 236 ? 21.066  17.869  9.599   1.00 67.55  ? 236  PRO A CB    1 
ATOM   1862 C  CG    . PRO A 1 236 ? 21.831  16.835  10.347  1.00 67.77  ? 236  PRO A CG    1 
ATOM   1863 C  CD    . PRO A 1 236 ? 20.888  16.279  11.387  1.00 67.89  ? 236  PRO A CD    1 
ATOM   1864 N  N     . ILE A 1 237 ? 18.863  17.159  7.350   1.00 67.48  ? 237  ILE A N     1 
ATOM   1865 C  CA    . ILE A 1 237 ? 18.695  16.544  6.066   1.00 67.68  ? 237  ILE A CA    1 
ATOM   1866 C  C     . ILE A 1 237 ? 20.101  16.326  5.543   1.00 68.08  ? 237  ILE A C     1 
ATOM   1867 O  O     . ILE A 1 237 ? 20.752  17.256  5.082   1.00 68.20  ? 237  ILE A O     1 
ATOM   1868 C  CB    . ILE A 1 237 ? 17.896  17.464  5.120   1.00 67.36  ? 237  ILE A CB    1 
ATOM   1869 C  CG1   . ILE A 1 237 ? 16.400  17.349  5.406   1.00 67.26  ? 237  ILE A CG1   1 
ATOM   1870 C  CG2   . ILE A 1 237 ? 18.130  17.100  3.681   1.00 67.98  ? 237  ILE A CG2   1 
ATOM   1871 C  CD1   . ILE A 1 237 ? 16.024  17.625  6.836   1.00 66.63  ? 237  ILE A CD1   1 
ATOM   1872 N  N     . ARG A 1 238 ? 20.588  15.097  5.650   1.00 68.49  ? 238  ARG A N     1 
ATOM   1873 C  CA    . ARG A 1 238 ? 21.903  14.781  5.124   1.00 68.71  ? 238  ARG A CA    1 
ATOM   1874 C  C     . ARG A 1 238 ? 21.808  13.854  3.937   1.00 68.42  ? 238  ARG A C     1 
ATOM   1875 O  O     . ARG A 1 238 ? 21.005  12.927  3.923   1.00 67.87  ? 238  ARG A O     1 
ATOM   1876 C  CB    . ARG A 1 238 ? 22.815  14.193  6.202   1.00 69.04  ? 238  ARG A CB    1 
ATOM   1877 C  CG    . ARG A 1 238 ? 22.140  13.219  7.163   1.00 70.42  ? 238  ARG A CG    1 
ATOM   1878 C  CD    . ARG A 1 238 ? 23.098  12.815  8.294   1.00 72.68  ? 238  ARG A CD    1 
ATOM   1879 N  NE    . ARG A 1 238 ? 23.670  13.959  9.010   1.00 74.13  ? 238  ARG A NE    1 
ATOM   1880 C  CZ    . ARG A 1 238 ? 24.873  14.490  8.764   1.00 75.47  ? 238  ARG A CZ    1 
ATOM   1881 N  NH1   . ARG A 1 238 ? 25.304  15.527  9.479   1.00 74.90  ? 238  ARG A NH1   1 
ATOM   1882 N  NH2   . ARG A 1 238 ? 25.651  13.990  7.805   1.00 75.85  ? 238  ARG A NH2   1 
ATOM   1883 N  N     . THR A 1 239 ? 22.631  14.135  2.933   1.00 68.52  ? 239  THR A N     1 
ATOM   1884 C  CA    . THR A 1 239 ? 22.771  13.261  1.785   1.00 68.90  ? 239  THR A CA    1 
ATOM   1885 C  C     . THR A 1 239 ? 23.120  11.856  2.256   1.00 68.84  ? 239  THR A C     1 
ATOM   1886 O  O     . THR A 1 239 ? 24.068  11.648  3.016   1.00 68.47  ? 239  THR A O     1 
ATOM   1887 C  CB    . THR A 1 239 ? 23.845  13.796  0.813   1.00 69.18  ? 239  THR A CB    1 
ATOM   1888 O  OG1   . THR A 1 239 ? 23.355  14.995  0.193   1.00 69.76  ? 239  THR A OG1   1 
ATOM   1889 C  CG2   . THR A 1 239 ? 24.184  12.757  -0.266  1.00 68.82  ? 239  THR A CG2   1 
ATOM   1890 N  N     . ARG A 1 240 ? 22.330  10.890  1.814   1.00 69.02  ? 240  ARG A N     1 
ATOM   1891 C  CA    . ARG A 1 240 ? 22.515  9.532   2.279   1.00 69.09  ? 240  ARG A CA    1 
ATOM   1892 C  C     . ARG A 1 240 ? 23.613  8.800   1.521   1.00 68.23  ? 240  ARG A C     1 
ATOM   1893 O  O     . ARG A 1 240 ? 23.865  9.044   0.337   1.00 68.16  ? 240  ARG A O     1 
ATOM   1894 C  CB    . ARG A 1 240 ? 21.195  8.756   2.272   1.00 69.92  ? 240  ARG A CB    1 
ATOM   1895 C  CG    . ARG A 1 240 ? 20.198  9.259   3.318   1.00 71.37  ? 240  ARG A CG    1 
ATOM   1896 C  CD    . ARG A 1 240 ? 19.173  8.184   3.684   1.00 75.41  ? 240  ARG A CD    1 
ATOM   1897 N  NE    . ARG A 1 240 ? 18.057  8.706   4.473   1.00 77.48  ? 240  ARG A NE    1 
ATOM   1898 C  CZ    . ARG A 1 240 ? 17.254  7.948   5.220   1.00 81.23  ? 240  ARG A CZ    1 
ATOM   1899 N  NH1   . ARG A 1 240 ? 17.456  6.631   5.281   1.00 82.54  ? 240  ARG A NH1   1 
ATOM   1900 N  NH2   . ARG A 1 240 ? 16.248  8.499   5.906   1.00 80.96  ? 240  ARG A NH2   1 
ATOM   1901 N  N     . VAL A 1 241 ? 24.294  7.927   2.250   1.00 67.15  ? 241  VAL A N     1 
ATOM   1902 C  CA    . VAL A 1 241 ? 25.377  7.150   1.717   1.00 65.67  ? 241  VAL A CA    1 
ATOM   1903 C  C     . VAL A 1 241 ? 24.929  5.732   1.959   1.00 65.20  ? 241  VAL A C     1 
ATOM   1904 O  O     . VAL A 1 241 ? 24.710  5.331   3.096   1.00 65.09  ? 241  VAL A O     1 
ATOM   1905 C  CB    . VAL A 1 241 ? 26.707  7.455   2.461   1.00 65.93  ? 241  VAL A CB    1 
ATOM   1906 C  CG1   . VAL A 1 241 ? 27.883  6.793   1.777   1.00 64.54  ? 241  VAL A CG1   1 
ATOM   1907 C  CG2   . VAL A 1 241 ? 26.934  8.960   2.537   1.00 65.51  ? 241  VAL A CG2   1 
ATOM   1908 N  N     . ARG A 1 242 ? 24.716  4.995   0.879   1.00 64.72  ? 242  ARG A N     1 
ATOM   1909 C  CA    . ARG A 1 242 ? 24.362  3.604   0.976   1.00 64.24  ? 242  ARG A CA    1 
ATOM   1910 C  C     . ARG A 1 242 ? 25.421  2.972   1.872   1.00 63.57  ? 242  ARG A C     1 
ATOM   1911 O  O     . ARG A 1 242 ? 26.622  3.144   1.648   1.00 63.55  ? 242  ARG A O     1 
ATOM   1912 C  CB    . ARG A 1 242 ? 24.345  2.974   -0.419  1.00 64.47  ? 242  ARG A CB    1 
ATOM   1913 C  CG    . ARG A 1 242 ? 23.433  1.772   -0.548  1.00 67.43  ? 242  ARG A CG    1 
ATOM   1914 C  CD    . ARG A 1 242 ? 21.938  2.125   -0.397  1.00 71.59  ? 242  ARG A CD    1 
ATOM   1915 N  NE    . ARG A 1 242 ? 21.449  2.987   -1.481  1.00 74.84  ? 242  ARG A NE    1 
ATOM   1916 C  CZ    . ARG A 1 242 ? 20.268  2.851   -2.093  1.00 76.31  ? 242  ARG A CZ    1 
ATOM   1917 N  NH1   . ARG A 1 242 ? 19.425  1.869   -1.753  1.00 75.85  ? 242  ARG A NH1   1 
ATOM   1918 N  NH2   . ARG A 1 242 ? 19.933  3.693   -3.070  1.00 76.25  ? 242  ARG A NH2   1 
ATOM   1919 N  N     . LYS A 1 243 ? 24.984  2.289   2.922   1.00 62.69  ? 243  LYS A N     1 
ATOM   1920 C  CA    . LYS A 1 243 ? 25.918  1.676   3.849   1.00 61.80  ? 243  LYS A CA    1 
ATOM   1921 C  C     . LYS A 1 243 ? 26.147  0.220   3.501   1.00 61.17  ? 243  LYS A C     1 
ATOM   1922 O  O     . LYS A 1 243 ? 27.183  -0.358  3.812   1.00 61.44  ? 243  LYS A O     1 
ATOM   1923 C  CB    . LYS A 1 243 ? 25.412  1.812   5.274   1.00 61.89  ? 243  LYS A CB    1 
ATOM   1924 C  CG    . LYS A 1 243 ? 25.903  3.060   5.937   1.00 62.96  ? 243  LYS A CG    1 
ATOM   1925 C  CD    . LYS A 1 243 ? 24.867  3.615   6.865   1.00 65.26  ? 243  LYS A CD    1 
ATOM   1926 C  CE    . LYS A 1 243 ? 25.385  4.876   7.528   1.00 67.64  ? 243  LYS A CE    1 
ATOM   1927 N  NZ    . LYS A 1 243 ? 26.140  5.717   6.538   1.00 69.38  ? 243  LYS A NZ    1 
ATOM   1928 N  N     . SER A 1 244 ? 25.175  -0.355  2.819   1.00 60.67  ? 244  SER A N     1 
ATOM   1929 C  CA    . SER A 1 244 ? 25.209  -1.745  2.450   1.00 60.04  ? 244  SER A CA    1 
ATOM   1930 C  C     . SER A 1 244 ? 24.470  -1.931  1.141   1.00 59.43  ? 244  SER A C     1 
ATOM   1931 O  O     . SER A 1 244 ? 23.485  -1.256  0.862   1.00 59.13  ? 244  SER A O     1 
ATOM   1932 C  CB    . SER A 1 244 ? 24.556  -2.594  3.530   1.00 59.73  ? 244  SER A CB    1 
ATOM   1933 O  OG    . SER A 1 244 ? 23.180  -2.307  3.576   1.00 60.99  ? 244  SER A OG    1 
ATOM   1934 N  N     . ILE A 1 245 ? 24.986  -2.848  0.342   1.00 59.26  ? 245  ILE A N     1 
ATOM   1935 C  CA    . ILE A 1 245 ? 24.390  -3.254  -0.906  1.00 59.35  ? 245  ILE A CA    1 
ATOM   1936 C  C     . ILE A 1 245 ? 24.309  -4.753  -0.797  1.00 58.30  ? 245  ILE A C     1 
ATOM   1937 O  O     . ILE A 1 245 ? 25.262  -5.402  -0.411  1.00 58.75  ? 245  ILE A O     1 
ATOM   1938 C  CB    . ILE A 1 245 ? 25.299  -2.966  -2.111  1.00 59.72  ? 245  ILE A CB    1 
ATOM   1939 C  CG1   . ILE A 1 245 ? 25.705  -1.491  -2.157  1.00 61.28  ? 245  ILE A CG1   1 
ATOM   1940 C  CG2   . ILE A 1 245 ? 24.600  -3.375  -3.396  1.00 60.26  ? 245  ILE A CG2   1 
ATOM   1941 C  CD1   . ILE A 1 245 ? 24.972  -0.696  -3.187  1.00 63.69  ? 245  ILE A CD1   1 
ATOM   1942 N  N     . GLY A 1 246 ? 23.165  -5.306  -1.122  1.00 57.59  ? 246  GLY A N     1 
ATOM   1943 C  CA    . GLY A 1 246 ? 23.017  -6.733  -1.080  1.00 56.42  ? 246  GLY A CA    1 
ATOM   1944 C  C     . GLY A 1 246 ? 21.962  -7.176  -2.062  1.00 56.06  ? 246  GLY A C     1 
ATOM   1945 O  O     . GLY A 1 246 ? 21.226  -6.366  -2.643  1.00 54.61  ? 246  GLY A O     1 
ATOM   1946 N  N     . ARG A 1 247 ? 21.913  -8.480  -2.246  1.00 55.69  ? 247  ARG A N     1 
ATOM   1947 C  CA    . ARG A 1 247 ? 21.022  -9.066  -3.186  1.00 56.40  ? 247  ARG A CA    1 
ATOM   1948 C  C     . ARG A 1 247 ? 20.664  -10.408 -2.582  1.00 55.98  ? 247  ARG A C     1 
ATOM   1949 O  O     . ARG A 1 247 ? 21.520  -11.117 -2.083  1.00 56.40  ? 247  ARG A O     1 
ATOM   1950 C  CB    . ARG A 1 247 ? 21.727  -9.198  -4.532  1.00 56.72  ? 247  ARG A CB    1 
ATOM   1951 C  CG    . ARG A 1 247 ? 21.014  -10.055 -5.550  1.00 59.81  ? 247  ARG A CG    1 
ATOM   1952 C  CD    . ARG A 1 247 ? 19.759  -9.399  -6.063  1.00 63.61  ? 247  ARG A CD    1 
ATOM   1953 N  NE    . ARG A 1 247 ? 19.002  -10.342 -6.874  1.00 67.46  ? 247  ARG A NE    1 
ATOM   1954 C  CZ    . ARG A 1 247 ? 17.686  -10.300 -7.025  1.00 69.03  ? 247  ARG A CZ    1 
ATOM   1955 N  NH1   . ARG A 1 247 ? 16.987  -9.350  -6.425  1.00 69.16  ? 247  ARG A NH1   1 
ATOM   1956 N  NH2   . ARG A 1 247 ? 17.073  -11.208 -7.770  1.00 69.53  ? 247  ARG A NH2   1 
ATOM   1957 N  N     . ILE A 1 248 ? 19.386  -10.725 -2.559  1.00 55.54  ? 248  ILE A N     1 
ATOM   1958 C  CA    . ILE A 1 248 ? 18.959  -11.982 -2.014  1.00 55.85  ? 248  ILE A CA    1 
ATOM   1959 C  C     . ILE A 1 248 ? 17.915  -12.537 -2.948  1.00 56.08  ? 248  ILE A C     1 
ATOM   1960 O  O     . ILE A 1 248 ? 17.081  -11.797 -3.478  1.00 56.26  ? 248  ILE A O     1 
ATOM   1961 C  CB    . ILE A 1 248 ? 18.395  -11.863 -0.577  1.00 55.83  ? 248  ILE A CB    1 
ATOM   1962 C  CG1   . ILE A 1 248 ? 17.888  -13.220 -0.097  1.00 55.25  ? 248  ILE A CG1   1 
ATOM   1963 C  CG2   . ILE A 1 248 ? 17.264  -10.880 -0.527  1.00 57.00  ? 248  ILE A CG2   1 
ATOM   1964 C  CD1   . ILE A 1 248 ? 17.500  -13.230 1.342   1.00 55.84  ? 248  ILE A CD1   1 
ATOM   1965 N  N     . VAL A 1 249 ? 17.985  -13.840 -3.168  1.00 55.86  ? 249  VAL A N     1 
ATOM   1966 C  CA    . VAL A 1 249 ? 17.073  -14.493 -4.077  1.00 56.12  ? 249  VAL A CA    1 
ATOM   1967 C  C     . VAL A 1 249 ? 16.349  -15.661 -3.419  1.00 55.97  ? 249  VAL A C     1 
ATOM   1968 O  O     . VAL A 1 249 ? 16.879  -16.336 -2.534  1.00 55.32  ? 249  VAL A O     1 
ATOM   1969 C  CB    . VAL A 1 249 ? 17.818  -14.989 -5.338  1.00 56.31  ? 249  VAL A CB    1 
ATOM   1970 C  CG1   . VAL A 1 249 ? 18.472  -13.818 -6.041  1.00 57.87  ? 249  VAL A CG1   1 
ATOM   1971 C  CG2   . VAL A 1 249 ? 18.864  -16.009 -4.972  1.00 55.59  ? 249  VAL A CG2   1 
ATOM   1972 N  N     . THR A 1 250 ? 15.119  -15.894 -3.851  1.00 56.38  ? 250  THR A N     1 
ATOM   1973 C  CA    . THR A 1 250 ? 14.468  -17.101 -3.454  1.00 56.83  ? 250  THR A CA    1 
ATOM   1974 C  C     . THR A 1 250 ? 14.993  -18.189 -4.369  1.00 57.31  ? 250  THR A C     1 
ATOM   1975 O  O     . THR A 1 250 ? 15.255  -17.960 -5.551  1.00 57.10  ? 250  THR A O     1 
ATOM   1976 C  CB    . THR A 1 250 ? 12.954  -16.978 -3.531  1.00 56.91  ? 250  THR A CB    1 
ATOM   1977 O  OG1   . THR A 1 250 ? 12.528  -15.989 -2.589  1.00 57.40  ? 250  THR A OG1   1 
ATOM   1978 C  CG2   . THR A 1 250 ? 12.296  -18.302 -3.172  1.00 55.95  ? 250  THR A CG2   1 
ATOM   1979 N  N     . MET A 1 251 ? 15.196  -19.368 -3.811  1.00 58.00  ? 251  MET A N     1 
ATOM   1980 C  CA    . MET A 1 251 ? 15.497  -20.506 -4.641  1.00 59.25  ? 251  MET A CA    1 
ATOM   1981 C  C     . MET A 1 251 ? 14.220  -21.187 -5.130  1.00 60.04  ? 251  MET A C     1 
ATOM   1982 O  O     . MET A 1 251 ? 13.172  -21.145 -4.466  1.00 60.01  ? 251  MET A O     1 
ATOM   1983 C  CB    . MET A 1 251 ? 16.427  -21.454 -3.908  1.00 59.39  ? 251  MET A CB    1 
ATOM   1984 C  CG    . MET A 1 251 ? 17.751  -20.773 -3.559  1.00 60.11  ? 251  MET A CG    1 
ATOM   1985 S  SD    . MET A 1 251 ? 18.866  -21.915 -2.753  1.00 63.46  ? 251  MET A SD    1 
ATOM   1986 C  CE    . MET A 1 251 ? 18.068  -22.056 -1.165  1.00 61.87  ? 251  MET A CE    1 
ATOM   1987 N  N     . LYS A 1 252 ? 14.325  -21.778 -6.321  1.00 60.93  ? 252  LYS A N     1 
ATOM   1988 C  CA    . LYS A 1 252 ? 13.243  -22.491 -6.991  1.00 61.53  ? 252  LYS A CA    1 
ATOM   1989 C  C     . LYS A 1 252 ? 12.612  -23.468 -6.012  1.00 61.56  ? 252  LYS A C     1 
ATOM   1990 O  O     . LYS A 1 252 ? 11.413  -23.772 -6.082  1.00 61.32  ? 252  LYS A O     1 
ATOM   1991 C  CB    . LYS A 1 252 ? 13.828  -23.260 -8.178  1.00 61.92  ? 252  LYS A CB    1 
ATOM   1992 C  CG    . LYS A 1 252 ? 13.123  -23.050 -9.502  1.00 63.94  ? 252  LYS A CG    1 
ATOM   1993 C  CD    . LYS A 1 252 ? 13.124  -21.580 -9.912  1.00 68.14  ? 252  LYS A CD    1 
ATOM   1994 C  CE    . LYS A 1 252 ? 12.962  -21.416 -11.428 1.00 70.49  ? 252  LYS A CE    1 
ATOM   1995 N  NZ    . LYS A 1 252 ? 11.947  -22.360 -12.020 1.00 71.68  ? 252  LYS A NZ    1 
ATOM   1996 N  N     . ARG A 1 253 ? 13.443  -23.958 -5.099  1.00 61.48  ? 253  ARG A N     1 
ATOM   1997 C  CA    . ARG A 1 253 ? 12.997  -24.851 -4.053  1.00 61.99  ? 253  ARG A CA    1 
ATOM   1998 C  C     . ARG A 1 253 ? 14.042  -24.852 -2.949  1.00 61.74  ? 253  ARG A C     1 
ATOM   1999 O  O     . ARG A 1 253 ? 15.192  -24.508 -3.187  1.00 61.50  ? 253  ARG A O     1 
ATOM   2000 C  CB    . ARG A 1 253 ? 12.794  -26.264 -4.607  1.00 62.41  ? 253  ARG A CB    1 
ATOM   2001 C  CG    . ARG A 1 253 ? 14.007  -26.847 -5.298  1.00 63.08  ? 253  ARG A CG    1 
ATOM   2002 C  CD    . ARG A 1 253 ? 13.592  -27.976 -6.204  1.00 64.80  ? 253  ARG A CD    1 
ATOM   2003 N  NE    . ARG A 1 253 ? 14.601  -29.027 -6.241  1.00 66.52  ? 253  ARG A NE    1 
ATOM   2004 C  CZ    . ARG A 1 253 ? 14.375  -30.260 -6.690  1.00 67.54  ? 253  ARG A CZ    1 
ATOM   2005 N  NH1   . ARG A 1 253 ? 13.170  -30.596 -7.144  1.00 67.27  ? 253  ARG A NH1   1 
ATOM   2006 N  NH2   . ARG A 1 253 ? 15.351  -31.158 -6.686  1.00 67.37  ? 253  ARG A NH2   1 
ATOM   2007 N  N     . ASN A 1 254 ? 13.640  -25.233 -1.742  1.00 61.73  ? 254  ASN A N     1 
ATOM   2008 C  CA    . ASN A 1 254 ? 14.547  -25.174 -0.609  1.00 61.92  ? 254  ASN A CA    1 
ATOM   2009 C  C     . ASN A 1 254 ? 15.650  -26.182 -0.764  1.00 62.45  ? 254  ASN A C     1 
ATOM   2010 O  O     . ASN A 1 254 ? 15.449  -27.249 -1.345  1.00 62.58  ? 254  ASN A O     1 
ATOM   2011 C  CB    . ASN A 1 254 ? 13.813  -25.426 0.702   1.00 61.77  ? 254  ASN A CB    1 
ATOM   2012 C  CG    . ASN A 1 254 ? 12.588  -24.559 0.856   1.00 61.00  ? 254  ASN A CG    1 
ATOM   2013 O  OD1   . ASN A 1 254 ? 12.630  -23.351 0.631   1.00 58.57  ? 254  ASN A OD1   1 
ATOM   2014 N  ND2   . ASN A 1 254 ? 11.482  -25.176 1.233   1.00 61.07  ? 254  ASN A ND2   1 
ATOM   2015 N  N     . SER A 1 255 ? 16.820  -25.848 -0.238  1.00 62.83  ? 255  SER A N     1 
ATOM   2016 C  CA    . SER A 1 255 ? 17.944  -26.744 -0.336  1.00 63.26  ? 255  SER A CA    1 
ATOM   2017 C  C     . SER A 1 255 ? 18.878  -26.610 0.861   1.00 63.52  ? 255  SER A C     1 
ATOM   2018 O  O     . SER A 1 255 ? 19.037  -25.529 1.417   1.00 63.62  ? 255  SER A O     1 
ATOM   2019 C  CB    . SER A 1 255 ? 18.704  -26.489 -1.640  1.00 63.32  ? 255  SER A CB    1 
ATOM   2020 O  OG    . SER A 1 255 ? 19.640  -27.530 -1.891  1.00 64.09  ? 255  SER A OG    1 
ATOM   2021 N  N     . ARG A 1 256 ? 19.479  -27.726 1.258   1.00 63.58  ? 256  ARG A N     1 
ATOM   2022 C  CA    . ARG A 1 256 ? 20.583  -27.705 2.198   1.00 63.86  ? 256  ARG A CA    1 
ATOM   2023 C  C     . ARG A 1 256 ? 21.837  -28.086 1.432   1.00 64.05  ? 256  ARG A C     1 
ATOM   2024 O  O     . ARG A 1 256 ? 22.886  -28.342 2.023   1.00 63.85  ? 256  ARG A O     1 
ATOM   2025 C  CB    . ARG A 1 256 ? 20.355  -28.692 3.339   1.00 63.85  ? 256  ARG A CB    1 
ATOM   2026 C  CG    . ARG A 1 256 ? 19.408  -28.195 4.407   1.00 64.54  ? 256  ARG A CG    1 
ATOM   2027 C  CD    . ARG A 1 256 ? 19.556  -28.967 5.712   1.00 64.37  ? 256  ARG A CD    1 
ATOM   2028 N  NE    . ARG A 1 256 ? 20.948  -29.028 6.154   1.00 65.23  ? 256  ARG A NE    1 
ATOM   2029 C  CZ    . ARG A 1 256 ? 21.620  -28.018 6.699   1.00 65.05  ? 256  ARG A CZ    1 
ATOM   2030 N  NH1   . ARG A 1 256 ? 21.042  -26.842 6.882   1.00 65.57  ? 256  ARG A NH1   1 
ATOM   2031 N  NH2   . ARG A 1 256 ? 22.881  -28.188 7.062   1.00 65.17  ? 256  ARG A NH2   1 
ATOM   2032 N  N     . ASN A 1 257 ? 21.714  -28.121 0.107   1.00 64.35  ? 257  ASN A N     1 
ATOM   2033 C  CA    . ASN A 1 257 ? 22.805  -28.567 -0.747  1.00 64.60  ? 257  ASN A CA    1 
ATOM   2034 C  C     . ASN A 1 257 ? 23.552  -27.426 -1.404  1.00 64.52  ? 257  ASN A C     1 
ATOM   2035 O  O     . ASN A 1 257 ? 23.067  -26.819 -2.355  1.00 64.26  ? 257  ASN A O     1 
ATOM   2036 C  CB    . ASN A 1 257 ? 22.325  -29.552 -1.818  1.00 64.82  ? 257  ASN A CB    1 
ATOM   2037 C  CG    . ASN A 1 257 ? 23.466  -30.060 -2.695  1.00 65.22  ? 257  ASN A CG    1 
ATOM   2038 O  OD1   . ASN A 1 257 ? 24.383  -30.735 -2.219  1.00 64.71  ? 257  ASN A OD1   1 
ATOM   2039 N  ND2   . ASN A 1 257 ? 23.414  -29.730 -3.984  1.00 65.97  ? 257  ASN A ND2   1 
ATOM   2040 N  N     . LEU A 1 258 ? 24.755  -27.182 -0.891  1.00 64.63  ? 258  LEU A N     1 
ATOM   2041 C  CA    . LEU A 1 258 ? 25.656  -26.149 -1.368  1.00 64.77  ? 258  LEU A CA    1 
ATOM   2042 C  C     . LEU A 1 258 ? 25.667  -25.986 -2.885  1.00 64.98  ? 258  LEU A C     1 
ATOM   2043 O  O     . LEU A 1 258 ? 25.596  -24.874 -3.394  1.00 65.17  ? 258  LEU A O     1 
ATOM   2044 C  CB    . LEU A 1 258 ? 27.066  -26.459 -0.877  1.00 64.84  ? 258  LEU A CB    1 
ATOM   2045 C  CG    . LEU A 1 258 ? 28.104  -25.347 -0.985  1.00 65.00  ? 258  LEU A CG    1 
ATOM   2046 C  CD1   . LEU A 1 258 ? 27.995  -24.412 0.211   1.00 64.51  ? 258  LEU A CD1   1 
ATOM   2047 C  CD2   . LEU A 1 258 ? 29.496  -25.941 -1.078  1.00 63.63  ? 258  LEU A CD2   1 
ATOM   2048 N  N     . GLU A 1 259 ? 25.748  -27.097 -3.605  1.00 65.39  ? 259  GLU A N     1 
ATOM   2049 C  CA    . GLU A 1 259 ? 25.918  -27.062 -5.058  1.00 65.69  ? 259  GLU A CA    1 
ATOM   2050 C  C     . GLU A 1 259 ? 24.672  -26.535 -5.763  1.00 65.51  ? 259  GLU A C     1 
ATOM   2051 O  O     . GLU A 1 259 ? 24.755  -25.930 -6.831  1.00 65.51  ? 259  GLU A O     1 
ATOM   2052 C  CB    . GLU A 1 259 ? 26.281  -28.455 -5.586  1.00 65.91  ? 259  GLU A CB    1 
ATOM   2053 C  CG    . GLU A 1 259 ? 26.993  -29.363 -4.573  1.00 66.92  ? 259  GLU A CG    1 
ATOM   2054 C  CD    . GLU A 1 259 ? 28.229  -28.723 -3.931  1.00 68.66  ? 259  GLU A CD    1 
ATOM   2055 O  OE1   . GLU A 1 259 ? 28.755  -27.720 -4.474  1.00 69.00  ? 259  GLU A OE1   1 
ATOM   2056 O  OE2   . GLU A 1 259 ? 28.673  -29.232 -2.875  1.00 68.86  ? 259  GLU A OE2   1 
ATOM   2057 N  N     . GLU A 1 260 ? 23.520  -26.779 -5.148  1.00 65.42  ? 260  GLU A N     1 
ATOM   2058 C  CA    . GLU A 1 260 ? 22.233  -26.322 -5.661  1.00 65.25  ? 260  GLU A CA    1 
ATOM   2059 C  C     . GLU A 1 260 ? 22.012  -24.862 -5.280  1.00 64.89  ? 260  GLU A C     1 
ATOM   2060 O  O     . GLU A 1 260 ? 21.408  -24.092 -6.028  1.00 64.98  ? 260  GLU A O     1 
ATOM   2061 C  CB    . GLU A 1 260 ? 21.110  -27.202 -5.090  1.00 65.39  ? 260  GLU A CB    1 
ATOM   2062 C  CG    . GLU A 1 260 ? 19.725  -26.921 -5.652  1.00 65.99  ? 260  GLU A CG    1 
ATOM   2063 C  CD    . GLU A 1 260 ? 18.650  -27.827 -5.068  1.00 66.71  ? 260  GLU A CD    1 
ATOM   2064 O  OE1   . GLU A 1 260 ? 18.994  -28.852 -4.437  1.00 67.02  ? 260  GLU A OE1   1 
ATOM   2065 O  OE2   . GLU A 1 260 ? 17.454  -27.512 -5.243  1.00 67.54  ? 260  GLU A OE2   1 
ATOM   2066 N  N     . ILE A 1 261 ? 22.523  -24.494 -4.110  1.00 64.58  ? 261  ILE A N     1 
ATOM   2067 C  CA    . ILE A 1 261 ? 22.416  -23.142 -3.578  1.00 64.15  ? 261  ILE A CA    1 
ATOM   2068 C  C     . ILE A 1 261 ? 23.388  -22.150 -4.221  1.00 64.26  ? 261  ILE A C     1 
ATOM   2069 O  O     . ILE A 1 261 ? 23.033  -20.992 -4.453  1.00 64.58  ? 261  ILE A O     1 
ATOM   2070 C  CB    . ILE A 1 261 ? 22.665  -23.132 -2.057  1.00 64.13  ? 261  ILE A CB    1 
ATOM   2071 C  CG1   . ILE A 1 261 ? 21.748  -24.132 -1.358  1.00 63.62  ? 261  ILE A CG1   1 
ATOM   2072 C  CG2   . ILE A 1 261 ? 22.471  -21.731 -1.491  1.00 63.36  ? 261  ILE A CG2   1 
ATOM   2073 C  CD1   . ILE A 1 261 ? 21.801  -24.054 0.145   1.00 63.46  ? 261  ILE A CD1   1 
ATOM   2074 N  N     . LYS A 1 262 ? 24.613  -22.593 -4.493  1.00 63.89  ? 262  LYS A N     1 
ATOM   2075 C  CA    . LYS A 1 262 ? 25.668  -21.695 -4.979  1.00 63.80  ? 262  LYS A CA    1 
ATOM   2076 C  C     . LYS A 1 262 ? 25.267  -20.792 -6.148  1.00 63.56  ? 262  LYS A C     1 
ATOM   2077 O  O     . LYS A 1 262 ? 25.513  -19.594 -6.104  1.00 63.49  ? 262  LYS A O     1 
ATOM   2078 C  CB    . LYS A 1 262 ? 26.918  -22.483 -5.358  1.00 64.12  ? 262  LYS A CB    1 
ATOM   2079 C  CG    . LYS A 1 262 ? 27.756  -22.957 -4.188  1.00 64.69  ? 262  LYS A CG    1 
ATOM   2080 C  CD    . LYS A 1 262 ? 28.568  -24.171 -4.596  1.00 65.98  ? 262  LYS A CD    1 
ATOM   2081 C  CE    . LYS A 1 262 ? 29.115  -24.027 -6.011  1.00 67.05  ? 262  LYS A CE    1 
ATOM   2082 N  NZ    . LYS A 1 262 ? 30.184  -25.037 -6.303  1.00 67.01  ? 262  LYS A NZ    1 
ATOM   2083 N  N     . PRO A 1 263 ? 24.672  -21.365 -7.212  1.00 63.30  ? 263  PRO A N     1 
ATOM   2084 C  CA    . PRO A 1 263 ? 24.297  -20.534 -8.361  1.00 62.97  ? 263  PRO A CA    1 
ATOM   2085 C  C     . PRO A 1 263 ? 23.523  -19.298 -7.940  1.00 62.83  ? 263  PRO A C     1 
ATOM   2086 O  O     . PRO A 1 263 ? 23.752  -18.203 -8.469  1.00 63.03  ? 263  PRO A O     1 
ATOM   2087 C  CB    . PRO A 1 263 ? 23.399  -21.457 -9.178  1.00 63.01  ? 263  PRO A CB    1 
ATOM   2088 C  CG    . PRO A 1 263 ? 23.890  -22.824 -8.854  1.00 63.10  ? 263  PRO A CG    1 
ATOM   2089 C  CD    . PRO A 1 263 ? 24.329  -22.783 -7.420  1.00 63.01  ? 263  PRO A CD    1 
ATOM   2090 N  N     . TYR A 1 264 ? 22.610  -19.474 -6.992  1.00 62.39  ? 264  TYR A N     1 
ATOM   2091 C  CA    . TYR A 1 264 ? 21.805  -18.366 -6.482  1.00 61.97  ? 264  TYR A CA    1 
ATOM   2092 C  C     . TYR A 1 264 ? 22.685  -17.368 -5.760  1.00 61.41  ? 264  TYR A C     1 
ATOM   2093 O  O     . TYR A 1 264 ? 22.615  -16.167 -6.007  1.00 60.88  ? 264  TYR A O     1 
ATOM   2094 C  CB    . TYR A 1 264 ? 20.736  -18.892 -5.530  1.00 62.03  ? 264  TYR A CB    1 
ATOM   2095 C  CG    . TYR A 1 264 ? 19.715  -19.749 -6.220  1.00 62.50  ? 264  TYR A CG    1 
ATOM   2096 C  CD1   . TYR A 1 264 ? 18.660  -19.175 -6.913  1.00 62.97  ? 264  TYR A CD1   1 
ATOM   2097 C  CD2   . TYR A 1 264 ? 19.813  -21.130 -6.196  1.00 63.20  ? 264  TYR A CD2   1 
ATOM   2098 C  CE1   . TYR A 1 264 ? 17.721  -19.952 -7.558  1.00 63.44  ? 264  TYR A CE1   1 
ATOM   2099 C  CE2   . TYR A 1 264 ? 18.879  -21.915 -6.834  1.00 63.79  ? 264  TYR A CE2   1 
ATOM   2100 C  CZ    . TYR A 1 264 ? 17.834  -21.318 -7.511  1.00 63.98  ? 264  TYR A CZ    1 
ATOM   2101 O  OH    . TYR A 1 264 ? 16.905  -22.097 -8.148  1.00 65.64  ? 264  TYR A OH    1 
ATOM   2102 N  N     . LEU A 1 265 ? 23.526  -17.888 -4.873  1.00 61.06  ? 265  LEU A N     1 
ATOM   2103 C  CA    . LEU A 1 265 ? 24.445  -17.069 -4.117  1.00 60.82  ? 265  LEU A CA    1 
ATOM   2104 C  C     . LEU A 1 265 ? 25.369  -16.281 -5.029  1.00 60.94  ? 265  LEU A C     1 
ATOM   2105 O  O     . LEU A 1 265 ? 25.587  -15.098 -4.813  1.00 61.22  ? 265  LEU A O     1 
ATOM   2106 C  CB    . LEU A 1 265 ? 25.256  -17.940 -3.167  1.00 60.75  ? 265  LEU A CB    1 
ATOM   2107 C  CG    . LEU A 1 265 ? 26.374  -17.256 -2.384  1.00 60.10  ? 265  LEU A CG    1 
ATOM   2108 C  CD1   . LEU A 1 265 ? 25.790  -16.270 -1.371  1.00 58.32  ? 265  LEU A CD1   1 
ATOM   2109 C  CD2   . LEU A 1 265 ? 27.236  -18.307 -1.702  1.00 58.07  ? 265  LEU A CD2   1 
ATOM   2110 N  N     . PHE A 1 266 ? 25.911  -16.926 -6.051  1.00 61.32  ? 266  PHE A N     1 
ATOM   2111 C  CA    . PHE A 1 266 ? 26.877  -16.263 -6.927  1.00 62.03  ? 266  PHE A CA    1 
ATOM   2112 C  C     . PHE A 1 266 ? 26.205  -15.214 -7.780  1.00 62.41  ? 266  PHE A C     1 
ATOM   2113 O  O     . PHE A 1 266 ? 26.804  -14.194 -8.125  1.00 63.00  ? 266  PHE A O     1 
ATOM   2114 C  CB    . PHE A 1 266 ? 27.594  -17.266 -7.822  1.00 61.64  ? 266  PHE A CB    1 
ATOM   2115 C  CG    . PHE A 1 266 ? 28.391  -18.272 -7.071  1.00 61.84  ? 266  PHE A CG    1 
ATOM   2116 C  CD1   . PHE A 1 266 ? 28.810  -18.013 -5.775  1.00 61.71  ? 266  PHE A CD1   1 
ATOM   2117 C  CD2   . PHE A 1 266 ? 28.751  -19.480 -7.668  1.00 62.69  ? 266  PHE A CD2   1 
ATOM   2118 C  CE1   . PHE A 1 266 ? 29.565  -18.949 -5.080  1.00 61.85  ? 266  PHE A CE1   1 
ATOM   2119 C  CE2   . PHE A 1 266 ? 29.499  -20.417 -6.981  1.00 61.67  ? 266  PHE A CE2   1 
ATOM   2120 C  CZ    . PHE A 1 266 ? 29.909  -20.151 -5.689  1.00 62.22  ? 266  PHE A CZ    1 
ATOM   2121 N  N     . ARG A 1 267 ? 24.955  -15.474 -8.123  1.00 62.90  ? 267  ARG A N     1 
ATOM   2122 C  CA    . ARG A 1 267 ? 24.149  -14.512 -8.842  1.00 63.53  ? 267  ARG A CA    1 
ATOM   2123 C  C     . ARG A 1 267 ? 23.943  -13.295 -7.945  1.00 63.43  ? 267  ARG A C     1 
ATOM   2124 O  O     . ARG A 1 267 ? 24.030  -12.145 -8.396  1.00 63.97  ? 267  ARG A O     1 
ATOM   2125 C  CB    . ARG A 1 267 ? 22.807  -15.150 -9.175  1.00 63.95  ? 267  ARG A CB    1 
ATOM   2126 C  CG    . ARG A 1 267 ? 22.204  -14.733 -10.505 1.00 66.66  ? 267  ARG A CG    1 
ATOM   2127 C  CD    . ARG A 1 267 ? 20.969  -15.598 -10.805 1.00 69.15  ? 267  ARG A CD    1 
ATOM   2128 N  NE    . ARG A 1 267 ? 21.313  -17.025 -10.854 1.00 71.11  ? 267  ARG A NE    1 
ATOM   2129 C  CZ    . ARG A 1 267 ? 20.528  -18.000 -10.397 1.00 71.72  ? 267  ARG A CZ    1 
ATOM   2130 N  NH1   . ARG A 1 267 ? 19.352  -17.704 -9.845  1.00 72.48  ? 267  ARG A NH1   1 
ATOM   2131 N  NH2   . ARG A 1 267 ? 20.918  -19.265 -10.477 1.00 70.47  ? 267  ARG A NH2   1 
ATOM   2132 N  N     . ALA A 1 268 ? 23.663  -13.557 -6.671  1.00 62.88  ? 268  ALA A N     1 
ATOM   2133 C  CA    . ALA A 1 268 ? 23.475  -12.506 -5.692  1.00 62.38  ? 268  ALA A CA    1 
ATOM   2134 C  C     . ALA A 1 268 ? 24.774  -11.726 -5.522  1.00 62.54  ? 268  ALA A C     1 
ATOM   2135 O  O     . ALA A 1 268 ? 24.765  -10.497 -5.379  1.00 62.06  ? 268  ALA A O     1 
ATOM   2136 C  CB    . ALA A 1 268 ? 23.010  -13.098 -4.367  1.00 62.33  ? 268  ALA A CB    1 
ATOM   2137 N  N     . ILE A 1 269 ? 25.898  -12.436 -5.553  1.00 62.63  ? 269  ILE A N     1 
ATOM   2138 C  CA    . ILE A 1 269 ? 27.192  -11.769 -5.511  1.00 63.13  ? 269  ILE A CA    1 
ATOM   2139 C  C     . ILE A 1 269 ? 27.410  -10.947 -6.768  1.00 63.98  ? 269  ILE A C     1 
ATOM   2140 O  O     . ILE A 1 269 ? 27.750  -9.765  -6.694  1.00 63.90  ? 269  ILE A O     1 
ATOM   2141 C  CB    . ILE A 1 269 ? 28.358  -12.752 -5.336  1.00 62.83  ? 269  ILE A CB    1 
ATOM   2142 C  CG1   . ILE A 1 269 ? 28.279  -13.400 -3.962  1.00 61.82  ? 269  ILE A CG1   1 
ATOM   2143 C  CG2   . ILE A 1 269 ? 29.683  -12.021 -5.484  1.00 61.54  ? 269  ILE A CG2   1 
ATOM   2144 C  CD1   . ILE A 1 269 ? 28.773  -14.786 -3.938  1.00 62.70  ? 269  ILE A CD1   1 
ATOM   2145 N  N     . GLU A 1 270 ? 27.187  -11.569 -7.919  1.00 65.04  ? 270  GLU A N     1 
ATOM   2146 C  CA    . GLU A 1 270 ? 27.395  -10.888 -9.188  1.00 66.37  ? 270  GLU A CA    1 
ATOM   2147 C  C     . GLU A 1 270 ? 26.584  -9.615  -9.237  1.00 66.37  ? 270  GLU A C     1 
ATOM   2148 O  O     . GLU A 1 270 ? 27.090  -8.560  -9.622  1.00 66.50  ? 270  GLU A O     1 
ATOM   2149 C  CB    . GLU A 1 270 ? 27.040  -11.790 -10.376 1.00 66.56  ? 270  GLU A CB    1 
ATOM   2150 C  CG    . GLU A 1 270 ? 28.196  -12.612 -10.882 1.00 69.06  ? 270  GLU A CG    1 
ATOM   2151 C  CD    . GLU A 1 270 ? 29.372  -11.752 -11.343 1.00 73.53  ? 270  GLU A CD    1 
ATOM   2152 O  OE1   . GLU A 1 270 ? 29.274  -11.116 -12.418 1.00 76.05  ? 270  GLU A OE1   1 
ATOM   2153 O  OE2   . GLU A 1 270 ? 30.406  -11.722 -10.639 1.00 74.31  ? 270  GLU A OE2   1 
ATOM   2154 N  N     . GLU A 1 271 ? 25.324  -9.723  -8.836  1.00 66.67  ? 271  GLU A N     1 
ATOM   2155 C  CA    . GLU A 1 271 ? 24.426  -8.591  -8.854  1.00 67.04  ? 271  GLU A CA    1 
ATOM   2156 C  C     . GLU A 1 271 ? 24.781  -7.591  -7.761  1.00 66.90  ? 271  GLU A C     1 
ATOM   2157 O  O     . GLU A 1 271 ? 24.865  -6.398  -8.030  1.00 66.94  ? 271  GLU A O     1 
ATOM   2158 C  CB    . GLU A 1 271 ? 22.962  -9.056  -8.795  1.00 67.49  ? 271  GLU A CB    1 
ATOM   2159 C  CG    . GLU A 1 271 ? 22.497  -9.739  -10.109 1.00 69.64  ? 271  GLU A CG    1 
ATOM   2160 C  CD    . GLU A 1 271 ? 21.234  -10.613 -9.963  1.00 72.39  ? 271  GLU A CD    1 
ATOM   2161 O  OE1   . GLU A 1 271 ? 20.396  -10.322 -9.073  1.00 73.77  ? 271  GLU A OE1   1 
ATOM   2162 O  OE2   . GLU A 1 271 ? 21.084  -11.597 -10.739 1.00 72.26  ? 271  GLU A OE2   1 
ATOM   2163 N  N     . SER A 1 272 ? 25.020  -8.059  -6.539  1.00 67.16  ? 272  SER A N     1 
ATOM   2164 C  CA    . SER A 1 272 ? 25.465  -7.147  -5.473  1.00 67.39  ? 272  SER A CA    1 
ATOM   2165 C  C     . SER A 1 272 ? 26.710  -6.403  -5.907  1.00 67.35  ? 272  SER A C     1 
ATOM   2166 O  O     . SER A 1 272 ? 26.818  -5.191  -5.749  1.00 67.26  ? 272  SER A O     1 
ATOM   2167 C  CB    . SER A 1 272 ? 25.820  -7.888  -4.188  1.00 66.97  ? 272  SER A CB    1 
ATOM   2168 O  OG    . SER A 1 272 ? 24.791  -8.746  -3.811  1.00 67.49  ? 272  SER A OG    1 
ATOM   2169 N  N     . TYR A 1 273 ? 27.663  -7.147  -6.437  1.00 67.50  ? 273  TYR A N     1 
ATOM   2170 C  CA    . TYR A 1 273 ? 28.938  -6.558  -6.749  1.00 68.49  ? 273  TYR A CA    1 
ATOM   2171 C  C     . TYR A 1 273 ? 28.805  -5.546  -7.883  1.00 69.16  ? 273  TYR A C     1 
ATOM   2172 O  O     . TYR A 1 273 ? 29.456  -4.494  -7.891  1.00 68.91  ? 273  TYR A O     1 
ATOM   2173 C  CB    . TYR A 1 273 ? 29.938  -7.641  -7.104  1.00 68.27  ? 273  TYR A CB    1 
ATOM   2174 C  CG    . TYR A 1 273 ? 31.296  -7.337  -6.565  1.00 68.85  ? 273  TYR A CG    1 
ATOM   2175 C  CD1   . TYR A 1 273 ? 31.735  -7.904  -5.374  1.00 68.95  ? 273  TYR A CD1   1 
ATOM   2176 C  CD2   . TYR A 1 273 ? 32.135  -6.457  -7.225  1.00 69.72  ? 273  TYR A CD2   1 
ATOM   2177 C  CE1   . TYR A 1 273 ? 32.984  -7.616  -4.867  1.00 69.25  ? 273  TYR A CE1   1 
ATOM   2178 C  CE2   . TYR A 1 273 ? 33.383  -6.168  -6.731  1.00 70.79  ? 273  TYR A CE2   1 
ATOM   2179 C  CZ    . TYR A 1 273 ? 33.805  -6.747  -5.550  1.00 70.79  ? 273  TYR A CZ    1 
ATOM   2180 O  OH    . TYR A 1 273 ? 35.066  -6.430  -5.066  1.00 73.66  ? 273  TYR A OH    1 
ATOM   2181 N  N     . TYR A 1 274 ? 27.962  -5.886  -8.851  1.00 70.32  ? 274  TYR A N     1 
ATOM   2182 C  CA    . TYR A 1 274 ? 27.644  -4.982  -9.934  1.00 71.53  ? 274  TYR A CA    1 
ATOM   2183 C  C     . TYR A 1 274 ? 27.028  -3.701  -9.378  1.00 71.40  ? 274  TYR A C     1 
ATOM   2184 O  O     . TYR A 1 274 ? 27.393  -2.597  -9.777  1.00 71.91  ? 274  TYR A O     1 
ATOM   2185 C  CB    . TYR A 1 274 ? 26.683  -5.651  -10.920 1.00 72.25  ? 274  TYR A CB    1 
ATOM   2186 C  CG    . TYR A 1 274 ? 26.028  -4.666  -11.858 1.00 74.70  ? 274  TYR A CG    1 
ATOM   2187 C  CD1   . TYR A 1 274 ? 26.697  -4.204  -12.991 1.00 76.42  ? 274  TYR A CD1   1 
ATOM   2188 C  CD2   . TYR A 1 274 ? 24.757  -4.176  -11.596 1.00 76.06  ? 274  TYR A CD2   1 
ATOM   2189 C  CE1   . TYR A 1 274 ? 26.104  -3.289  -13.845 1.00 77.94  ? 274  TYR A CE1   1 
ATOM   2190 C  CE2   . TYR A 1 274 ? 24.158  -3.262  -12.438 1.00 78.18  ? 274  TYR A CE2   1 
ATOM   2191 C  CZ    . TYR A 1 274 ? 24.832  -2.822  -13.565 1.00 78.46  ? 274  TYR A CZ    1 
ATOM   2192 O  OH    . TYR A 1 274 ? 24.221  -1.913  -14.410 1.00 79.71  ? 274  TYR A OH    1 
ATOM   2193 N  N     . LYS A 1 275 ? 26.107  -3.852  -8.435  1.00 71.28  ? 275  LYS A N     1 
ATOM   2194 C  CA    . LYS A 1 275 ? 25.410  -2.712  -7.856  1.00 71.18  ? 275  LYS A CA    1 
ATOM   2195 C  C     . LYS A 1 275 ? 26.245  -1.934  -6.832  1.00 70.81  ? 275  LYS A C     1 
ATOM   2196 O  O     . LYS A 1 275 ? 25.845  -0.856  -6.407  1.00 71.40  ? 275  LYS A O     1 
ATOM   2197 C  CB    . LYS A 1 275 ? 24.056  -3.159  -7.296  1.00 71.45  ? 275  LYS A CB    1 
ATOM   2198 C  CG    . LYS A 1 275 ? 23.194  -3.847  -8.386  1.00 73.54  ? 275  LYS A CG    1 
ATOM   2199 C  CD    . LYS A 1 275 ? 21.838  -4.414  -7.896  1.00 77.06  ? 275  LYS A CD    1 
ATOM   2200 C  CE    . LYS A 1 275 ? 21.213  -5.364  -8.963  1.00 77.21  ? 275  LYS A CE    1 
ATOM   2201 N  NZ    . LYS A 1 275 ? 19.942  -6.041  -8.513  1.00 77.22  ? 275  LYS A NZ    1 
ATOM   2202 N  N     . LEU A 1 276 ? 27.401  -2.473  -6.450  1.00 70.06  ? 276  LEU A N     1 
ATOM   2203 C  CA    . LEU A 1 276 ? 28.367  -1.749  -5.621  1.00 69.56  ? 276  LEU A CA    1 
ATOM   2204 C  C     . LEU A 1 276 ? 28.951  -0.578  -6.392  1.00 69.81  ? 276  LEU A C     1 
ATOM   2205 O  O     . LEU A 1 276 ? 29.162  0.512   -5.851  1.00 69.90  ? 276  LEU A O     1 
ATOM   2206 C  CB    . LEU A 1 276 ? 29.513  -2.668  -5.206  1.00 69.02  ? 276  LEU A CB    1 
ATOM   2207 C  CG    . LEU A 1 276 ? 29.257  -3.618  -4.044  1.00 67.70  ? 276  LEU A CG    1 
ATOM   2208 C  CD1   . LEU A 1 276 ? 30.321  -4.698  -4.014  1.00 66.29  ? 276  LEU A CD1   1 
ATOM   2209 C  CD2   . LEU A 1 276 ? 29.221  -2.829  -2.747  1.00 65.70  ? 276  LEU A CD2   1 
ATOM   2210 N  N     . ASP A 1 277 ? 29.226  -0.827  -7.663  1.00 69.91  ? 277  ASP A N     1 
ATOM   2211 C  CA    . ASP A 1 277 ? 29.727  0.194   -8.561  1.00 70.07  ? 277  ASP A CA    1 
ATOM   2212 C  C     . ASP A 1 277 ? 30.813  1.031   -7.923  1.00 69.59  ? 277  ASP A C     1 
ATOM   2213 O  O     . ASP A 1 277 ? 30.531  2.088   -7.345  1.00 70.15  ? 277  ASP A O     1 
ATOM   2214 C  CB    . ASP A 1 277 ? 28.598  1.123   -8.996  1.00 70.48  ? 277  ASP A CB    1 
ATOM   2215 C  CG    . ASP A 1 277 ? 28.998  1.996   -10.165 1.00 72.27  ? 277  ASP A CG    1 
ATOM   2216 O  OD1   . ASP A 1 277 ? 28.366  3.059   -10.370 1.00 74.63  ? 277  ASP A OD1   1 
ATOM   2217 O  OD2   . ASP A 1 277 ? 29.955  1.612   -10.877 1.00 73.87  ? 277  ASP A OD2   1 
ATOM   2218 N  N     . LYS A 1 278 ? 32.056  0.584   -8.027  1.00 68.14  ? 278  LYS A N     1 
ATOM   2219 C  CA    . LYS A 1 278 ? 33.150  1.422   -7.567  1.00 67.06  ? 278  LYS A CA    1 
ATOM   2220 C  C     . LYS A 1 278 ? 33.393  1.270   -6.071  1.00 65.64  ? 278  LYS A C     1 
ATOM   2221 O  O     . LYS A 1 278 ? 34.540  1.322   -5.630  1.00 65.96  ? 278  LYS A O     1 
ATOM   2222 C  CB    . LYS A 1 278 ? 32.858  2.892   -7.882  1.00 67.33  ? 278  LYS A CB    1 
ATOM   2223 C  CG    . LYS A 1 278 ? 32.701  3.210   -9.365  1.00 68.99  ? 278  LYS A CG    1 
ATOM   2224 C  CD    . LYS A 1 278 ? 34.042  3.235   -10.078 1.00 70.95  ? 278  LYS A CD    1 
ATOM   2225 C  CE    . LYS A 1 278 ? 33.936  3.982   -11.406 1.00 72.58  ? 278  LYS A CE    1 
ATOM   2226 N  NZ    . LYS A 1 278 ? 35.273  4.300   -11.991 1.00 73.23  ? 278  LYS A NZ    1 
ATOM   2227 N  N     . ARG A 1 279 ? 32.316  1.103   -5.299  1.00 63.56  ? 279  ARG A N     1 
ATOM   2228 C  CA    . ARG A 1 279 ? 32.396  0.939   -3.849  1.00 61.23  ? 279  ARG A CA    1 
ATOM   2229 C  C     . ARG A 1 279 ? 33.054  -0.382  -3.505  1.00 59.59  ? 279  ARG A C     1 
ATOM   2230 O  O     . ARG A 1 279 ? 32.670  -1.419  -4.034  1.00 59.23  ? 279  ARG A O     1 
ATOM   2231 C  CB    . ARG A 1 279 ? 30.998  0.937   -3.238  1.00 61.49  ? 279  ARG A CB    1 
ATOM   2232 C  CG    . ARG A 1 279 ? 30.427  2.284   -2.872  1.00 61.91  ? 279  ARG A CG    1 
ATOM   2233 C  CD    . ARG A 1 279 ? 28.977  2.095   -2.499  1.00 63.81  ? 279  ARG A CD    1 
ATOM   2234 N  NE    . ARG A 1 279 ? 28.227  1.747   -3.692  1.00 65.86  ? 279  ARG A NE    1 
ATOM   2235 C  CZ    . ARG A 1 279 ? 27.189  2.438   -4.142  1.00 66.44  ? 279  ARG A CZ    1 
ATOM   2236 N  NH1   . ARG A 1 279 ? 26.759  3.501   -3.467  1.00 65.38  ? 279  ARG A NH1   1 
ATOM   2237 N  NH2   . ARG A 1 279 ? 26.578  2.052   -5.257  1.00 66.45  ? 279  ARG A NH2   1 
ATOM   2238 N  N     . ILE A 1 280 ? 34.049  -0.345  -2.622  1.00 57.81  ? 280  ILE A N     1 
ATOM   2239 C  CA    . ILE A 1 280 ? 34.711  -1.563  -2.170  1.00 55.78  ? 280  ILE A CA    1 
ATOM   2240 C  C     . ILE A 1 280 ? 34.209  -1.890  -0.775  1.00 54.11  ? 280  ILE A C     1 
ATOM   2241 O  O     . ILE A 1 280 ? 34.398  -1.101  0.150   1.00 53.55  ? 280  ILE A O     1 
ATOM   2242 C  CB    . ILE A 1 280 ? 36.242  -1.409  -2.062  1.00 55.92  ? 280  ILE A CB    1 
ATOM   2243 C  CG1   . ILE A 1 280 ? 36.815  -0.465  -3.131  1.00 56.44  ? 280  ILE A CG1   1 
ATOM   2244 C  CG2   . ILE A 1 280 ? 36.912  -2.787  -2.056  1.00 56.11  ? 280  ILE A CG2   1 
ATOM   2245 C  CD1   . ILE A 1 280 ? 36.735  -0.971  -4.543  1.00 56.28  ? 280  ILE A CD1   1 
ATOM   2246 N  N     . PRO A 1 281 ? 33.589  -3.066  -0.607  1.00 52.70  ? 281  PRO A N     1 
ATOM   2247 C  CA    . PRO A 1 281 ? 33.138  -3.481  0.718   1.00 51.49  ? 281  PRO A CA    1 
ATOM   2248 C  C     . PRO A 1 281 ? 34.250  -4.149  1.528   1.00 50.37  ? 281  PRO A C     1 
ATOM   2249 O  O     . PRO A 1 281 ? 35.077  -4.870  0.979   1.00 49.63  ? 281  PRO A O     1 
ATOM   2250 C  CB    . PRO A 1 281 ? 32.049  -4.500  0.398   1.00 51.03  ? 281  PRO A CB    1 
ATOM   2251 C  CG    . PRO A 1 281 ? 32.507  -5.126  -0.878  1.00 51.45  ? 281  PRO A CG    1 
ATOM   2252 C  CD    . PRO A 1 281 ? 33.287  -4.080  -1.635  1.00 52.44  ? 281  PRO A CD    1 
ATOM   2253 N  N     . LYS A 1 282 ? 34.256  -3.919  2.830   1.00 50.06  ? 282  LYS A N     1 
ATOM   2254 C  CA    . LYS A 1 282 ? 35.148  -4.658  3.717   1.00 50.60  ? 282  LYS A CA    1 
ATOM   2255 C  C     . LYS A 1 282 ? 34.397  -5.787  4.388   1.00 50.17  ? 282  LYS A C     1 
ATOM   2256 O  O     . LYS A 1 282 ? 34.999  -6.700  4.943   1.00 49.90  ? 282  LYS A O     1 
ATOM   2257 C  CB    . LYS A 1 282 ? 35.752  -3.749  4.781   1.00 50.81  ? 282  LYS A CB    1 
ATOM   2258 C  CG    . LYS A 1 282 ? 36.843  -2.828  4.277   1.00 52.51  ? 282  LYS A CG    1 
ATOM   2259 C  CD    . LYS A 1 282 ? 36.809  -1.526  5.062   1.00 56.57  ? 282  LYS A CD    1 
ATOM   2260 C  CE    . LYS A 1 282 ? 38.149  -0.806  4.987   1.00 58.85  ? 282  LYS A CE    1 
ATOM   2261 N  NZ    . LYS A 1 282 ? 38.148  0.482   5.779   1.00 60.23  ? 282  LYS A NZ    1 
ATOM   2262 N  N     . ALA A 1 283 ? 33.072  -5.718  4.339   1.00 49.91  ? 283  ALA A N     1 
ATOM   2263 C  CA    . ALA A 1 283 ? 32.266  -6.717  5.003   1.00 49.85  ? 283  ALA A CA    1 
ATOM   2264 C  C     . ALA A 1 283 ? 31.393  -7.429  3.997   1.00 50.15  ? 283  ALA A C     1 
ATOM   2265 O  O     . ALA A 1 283 ? 30.886  -6.828  3.051   1.00 50.33  ? 283  ALA A O     1 
ATOM   2266 C  CB    . ALA A 1 283 ? 31.439  -6.096  6.103   1.00 49.00  ? 283  ALA A CB    1 
ATOM   2267 N  N     . ILE A 1 284 ? 31.253  -8.729  4.192   1.00 50.25  ? 284  ILE A N     1 
ATOM   2268 C  CA    . ILE A 1 284 ? 30.362  -9.514  3.376   1.00 50.24  ? 284  ILE A CA    1 
ATOM   2269 C  C     . ILE A 1 284 ? 29.590  -10.392 4.323   1.00 50.50  ? 284  ILE A C     1 
ATOM   2270 O  O     . ILE A 1 284 ? 30.151  -10.950 5.263   1.00 50.41  ? 284  ILE A O     1 
ATOM   2271 C  CB    . ILE A 1 284 ? 31.110  -10.399 2.370   1.00 50.51  ? 284  ILE A CB    1 
ATOM   2272 C  CG1   . ILE A 1 284 ? 30.116  -11.217 1.548   1.00 49.84  ? 284  ILE A CG1   1 
ATOM   2273 C  CG2   . ILE A 1 284 ? 32.123  -11.302 3.081   1.00 50.13  ? 284  ILE A CG2   1 
ATOM   2274 C  CD1   . ILE A 1 284 ? 30.753  -12.135 0.558   1.00 51.31  ? 284  ILE A CD1   1 
ATOM   2275 N  N     . HIS A 1 285 ? 28.294  -10.484 4.084   1.00 50.70  ? 285  HIS A N     1 
ATOM   2276 C  CA    . HIS A 1 285 ? 27.449  -11.339 4.861   1.00 51.28  ? 285  HIS A CA    1 
ATOM   2277 C  C     . HIS A 1 285 ? 26.705  -12.197 3.896   1.00 51.51  ? 285  HIS A C     1 
ATOM   2278 O  O     . HIS A 1 285 ? 26.168  -11.706 2.917   1.00 51.97  ? 285  HIS A O     1 
ATOM   2279 C  CB    . HIS A 1 285 ? 26.498  -10.511 5.728   1.00 50.76  ? 285  HIS A CB    1 
ATOM   2280 C  CG    . HIS A 1 285 ? 27.201  -9.815  6.854   1.00 52.19  ? 285  HIS A CG    1 
ATOM   2281 N  ND1   . HIS A 1 285 ? 27.264  -10.337 8.131   1.00 51.90  ? 285  HIS A ND1   1 
ATOM   2282 C  CD2   . HIS A 1 285 ? 27.930  -8.675  6.879   1.00 51.37  ? 285  HIS A CD2   1 
ATOM   2283 C  CE1   . HIS A 1 285 ? 27.979  -9.533  8.897   1.00 51.70  ? 285  HIS A CE1   1 
ATOM   2284 N  NE2   . HIS A 1 285 ? 28.402  -8.522  8.160   1.00 51.96  ? 285  HIS A NE2   1 
ATOM   2285 N  N     . VAL A 1 286 ? 26.707  -13.496 4.131   1.00 52.01  ? 286  VAL A N     1 
ATOM   2286 C  CA    . VAL A 1 286 ? 25.763  -14.314 3.416   1.00 52.21  ? 286  VAL A CA    1 
ATOM   2287 C  C     . VAL A 1 286 ? 24.539  -14.394 4.302   1.00 52.67  ? 286  VAL A C     1 
ATOM   2288 O  O     . VAL A 1 286 ? 24.630  -14.734 5.478   1.00 52.81  ? 286  VAL A O     1 
ATOM   2289 C  CB    . VAL A 1 286 ? 26.309  -15.686 3.035   1.00 52.18  ? 286  VAL A CB    1 
ATOM   2290 C  CG1   . VAL A 1 286 ? 25.178  -16.571 2.495   1.00 52.18  ? 286  VAL A CG1   1 
ATOM   2291 C  CG2   . VAL A 1 286 ? 27.389  -15.534 1.994   1.00 51.39  ? 286  VAL A CG2   1 
ATOM   2292 N  N     . VAL A 1 287 ? 23.408  -14.010 3.729   1.00 53.10  ? 287  VAL A N     1 
ATOM   2293 C  CA    . VAL A 1 287 ? 22.141  -14.034 4.412   1.00 53.33  ? 287  VAL A CA    1 
ATOM   2294 C  C     . VAL A 1 287 ? 21.357  -15.201 3.825   1.00 54.12  ? 287  VAL A C     1 
ATOM   2295 O  O     . VAL A 1 287 ? 21.211  -15.316 2.601   1.00 54.03  ? 287  VAL A O     1 
ATOM   2296 C  CB    . VAL A 1 287 ? 21.362  -12.734 4.170   1.00 53.15  ? 287  VAL A CB    1 
ATOM   2297 C  CG1   . VAL A 1 287 ? 20.105  -12.725 4.985   1.00 52.82  ? 287  VAL A CG1   1 
ATOM   2298 C  CG2   . VAL A 1 287 ? 22.234  -11.500 4.471   1.00 52.68  ? 287  VAL A CG2   1 
ATOM   2299 N  N     . ALA A 1 288 ? 20.878  -16.082 4.696   1.00 54.79  ? 288  ALA A N     1 
ATOM   2300 C  CA    . ALA A 1 288 ? 20.016  -17.164 4.268   1.00 55.53  ? 288  ALA A CA    1 
ATOM   2301 C  C     . ALA A 1 288 ? 18.687  -17.014 4.970   1.00 56.14  ? 288  ALA A C     1 
ATOM   2302 O  O     . ALA A 1 288 ? 18.639  -16.826 6.183   1.00 56.25  ? 288  ALA A O     1 
ATOM   2303 C  CB    . ALA A 1 288 ? 20.638  -18.521 4.589   1.00 55.30  ? 288  ALA A CB    1 
ATOM   2304 N  N     . VAL A 1 289 ? 17.609  -17.050 4.199   1.00 56.93  ? 289  VAL A N     1 
ATOM   2305 C  CA    . VAL A 1 289 ? 16.298  -17.222 4.783   1.00 57.67  ? 289  VAL A CA    1 
ATOM   2306 C  C     . VAL A 1 289 ? 16.047  -18.715 4.730   1.00 58.56  ? 289  VAL A C     1 
ATOM   2307 O  O     . VAL A 1 289 ? 16.260  -19.357 3.698   1.00 58.88  ? 289  VAL A O     1 
ATOM   2308 C  CB    . VAL A 1 289 ? 15.202  -16.447 4.041   1.00 57.55  ? 289  VAL A CB    1 
ATOM   2309 C  CG1   . VAL A 1 289 ? 13.861  -16.693 4.699   1.00 57.07  ? 289  VAL A CG1   1 
ATOM   2310 C  CG2   . VAL A 1 289 ? 15.525  -14.959 4.045   1.00 57.00  ? 289  VAL A CG2   1 
ATOM   2311 N  N     . THR A 1 290 ? 15.641  -19.269 5.864   1.00 59.27  ? 290  THR A N     1 
ATOM   2312 C  CA    . THR A 1 290 ? 15.436  -20.696 5.989   1.00 59.81  ? 290  THR A CA    1 
ATOM   2313 C  C     . THR A 1 290 ? 14.033  -21.084 5.546   1.00 60.48  ? 290  THR A C     1 
ATOM   2314 O  O     . THR A 1 290 ? 13.254  -20.246 5.083   1.00 60.34  ? 290  THR A O     1 
ATOM   2315 C  CB    . THR A 1 290 ? 15.666  -21.142 7.436   1.00 59.61  ? 290  THR A CB    1 
ATOM   2316 O  OG1   . THR A 1 290 ? 14.895  -20.309 8.308   1.00 59.75  ? 290  THR A OG1   1 
ATOM   2317 C  CG2   . THR A 1 290 ? 17.120  -20.974 7.792   1.00 59.55  ? 290  THR A CG2   1 
ATOM   2318 N  N     . GLU A 1 291 ? 13.719  -22.369 5.680   1.00 61.32  ? 291  GLU A N     1 
ATOM   2319 C  CA    . GLU A 1 291 ? 12.407  -22.867 5.313   1.00 61.99  ? 291  GLU A CA    1 
ATOM   2320 C  C     . GLU A 1 291 ? 11.291  -22.115 6.012   1.00 62.26  ? 291  GLU A C     1 
ATOM   2321 O  O     . GLU A 1 291 ? 10.278  -21.791 5.400   1.00 61.89  ? 291  GLU A O     1 
ATOM   2322 C  CB    . GLU A 1 291 ? 12.289  -24.325 5.693   1.00 62.15  ? 291  GLU A CB    1 
ATOM   2323 C  CG    . GLU A 1 291 ? 12.938  -25.255 4.736   1.00 63.19  ? 291  GLU A CG    1 
ATOM   2324 C  CD    . GLU A 1 291 ? 12.330  -26.624 4.828   1.00 63.83  ? 291  GLU A CD    1 
ATOM   2325 O  OE1   . GLU A 1 291 ? 13.074  -27.592 5.087   1.00 65.60  ? 291  GLU A OE1   1 
ATOM   2326 O  OE2   . GLU A 1 291 ? 11.099  -26.725 4.656   1.00 63.61  ? 291  GLU A OE2   1 
ATOM   2327 N  N     . ASP A 1 292 ? 11.479  -21.874 7.305   1.00 62.89  ? 292  ASP A N     1 
ATOM   2328 C  CA    . ASP A 1 292 ? 10.440  -21.305 8.148   1.00 63.76  ? 292  ASP A CA    1 
ATOM   2329 C  C     . ASP A 1 292 ? 10.575  -19.794 8.146   1.00 64.06  ? 292  ASP A C     1 
ATOM   2330 O  O     . ASP A 1 292 ? 10.039  -19.093 9.014   1.00 64.30  ? 292  ASP A O     1 
ATOM   2331 C  CB    . ASP A 1 292 ? 10.564  -21.859 9.565   1.00 64.16  ? 292  ASP A CB    1 
ATOM   2332 C  CG    . ASP A 1 292 ? 11.939  -21.637 10.147  1.00 64.62  ? 292  ASP A CG    1 
ATOM   2333 O  OD1   . ASP A 1 292 ? 12.337  -22.387 11.061  1.00 64.20  ? 292  ASP A OD1   1 
ATOM   2334 O  OD2   . ASP A 1 292 ? 12.619  -20.703 9.680   1.00 65.69  ? 292  ASP A OD2   1 
ATOM   2335 N  N     . LEU A 1 293 ? 11.321  -19.310 7.157   1.00 64.19  ? 293  LEU A N     1 
ATOM   2336 C  CA    . LEU A 1 293 ? 11.483  -17.897 6.917   1.00 63.73  ? 293  LEU A CA    1 
ATOM   2337 C  C     . LEU A 1 293 ? 12.237  -17.165 8.026   1.00 63.56  ? 293  LEU A C     1 
ATOM   2338 O  O     . LEU A 1 293 ? 12.227  -15.932 8.080   1.00 63.83  ? 293  LEU A O     1 
ATOM   2339 C  CB    . LEU A 1 293 ? 10.125  -17.260 6.651   1.00 64.32  ? 293  LEU A CB    1 
ATOM   2340 C  CG    . LEU A 1 293 ? 9.487   -17.574 5.297   1.00 64.58  ? 293  LEU A CG    1 
ATOM   2341 C  CD1   . LEU A 1 293 ? 8.082   -17.017 5.301   1.00 64.52  ? 293  LEU A CD1   1 
ATOM   2342 C  CD2   . LEU A 1 293 ? 10.290  -16.945 4.164   1.00 64.59  ? 293  LEU A CD2   1 
ATOM   2343 N  N     . ASP A 1 294 ? 12.897  -17.913 8.905   1.00 63.19  ? 294  ASP A N     1 
ATOM   2344 C  CA    . ASP A 1 294 ? 13.895  -17.303 9.775   1.00 62.96  ? 294  ASP A CA    1 
ATOM   2345 C  C     . ASP A 1 294 ? 15.030  -16.793 8.891   1.00 62.29  ? 294  ASP A C     1 
ATOM   2346 O  O     . ASP A 1 294 ? 15.401  -17.421 7.896   1.00 62.20  ? 294  ASP A O     1 
ATOM   2347 C  CB    . ASP A 1 294 ? 14.438  -18.292 10.810  1.00 63.29  ? 294  ASP A CB    1 
ATOM   2348 C  CG    . ASP A 1 294 ? 15.040  -17.597 12.036  1.00 64.61  ? 294  ASP A CG    1 
ATOM   2349 O  OD1   . ASP A 1 294 ? 14.568  -16.493 12.393  1.00 66.41  ? 294  ASP A OD1   1 
ATOM   2350 O  OD2   . ASP A 1 294 ? 15.981  -18.154 12.654  1.00 65.84  ? 294  ASP A OD2   1 
ATOM   2351 N  N     . ILE A 1 295 ? 15.557  -15.632 9.234   1.00 61.50  ? 295  ILE A N     1 
ATOM   2352 C  CA    . ILE A 1 295 ? 16.672  -15.093 8.504   1.00 60.30  ? 295  ILE A CA    1 
ATOM   2353 C  C     . ILE A 1 295 ? 17.927  -15.372 9.302   1.00 60.05  ? 295  ILE A C     1 
ATOM   2354 O  O     . ILE A 1 295 ? 18.025  -15.008 10.474  1.00 60.28  ? 295  ILE A O     1 
ATOM   2355 C  CB    . ILE A 1 295 ? 16.508  -13.602 8.247   1.00 60.30  ? 295  ILE A CB    1 
ATOM   2356 C  CG1   . ILE A 1 295 ? 15.180  -13.352 7.525   1.00 59.75  ? 295  ILE A CG1   1 
ATOM   2357 C  CG2   . ILE A 1 295 ? 17.709  -13.068 7.448   1.00 59.45  ? 295  ILE A CG2   1 
ATOM   2358 C  CD1   . ILE A 1 295 ? 15.028  -11.952 6.993   1.00 61.51  ? 295  ILE A CD1   1 
ATOM   2359 N  N     . VAL A 1 296 ? 18.866  -16.048 8.652   1.00 59.18  ? 296  VAL A N     1 
ATOM   2360 C  CA    . VAL A 1 296 ? 20.133  -16.452 9.249   1.00 58.85  ? 296  VAL A CA    1 
ATOM   2361 C  C     . VAL A 1 296 ? 21.239  -15.811 8.420   1.00 58.33  ? 296  VAL A C     1 
ATOM   2362 O  O     . VAL A 1 296 ? 21.130  -15.720 7.195   1.00 58.68  ? 296  VAL A O     1 
ATOM   2363 C  CB    . VAL A 1 296 ? 20.282  -17.990 9.220   1.00 58.43  ? 296  VAL A CB    1 
ATOM   2364 C  CG1   . VAL A 1 296 ? 21.636  -18.413 9.722   1.00 59.60  ? 296  VAL A CG1   1 
ATOM   2365 C  CG2   . VAL A 1 296 ? 19.193  -18.639 10.057  1.00 58.41  ? 296  VAL A CG2   1 
ATOM   2366 N  N     . SER A 1 297 ? 22.291  -15.340 9.071   1.00 57.32  ? 297  SER A N     1 
ATOM   2367 C  CA    . SER A 1 297 ? 23.374  -14.736 8.322   1.00 56.48  ? 297  SER A CA    1 
ATOM   2368 C  C     . SER A 1 297 ? 24.708  -15.034 8.960   1.00 55.59  ? 297  SER A C     1 
ATOM   2369 O  O     . SER A 1 297 ? 24.837  -15.069 10.183  1.00 55.63  ? 297  SER A O     1 
ATOM   2370 C  CB    . SER A 1 297 ? 23.181  -13.225 8.194   1.00 56.69  ? 297  SER A CB    1 
ATOM   2371 O  OG    . SER A 1 297 ? 23.993  -12.526 9.113   1.00 57.35  ? 297  SER A OG    1 
ATOM   2372 N  N     . ARG A 1 298 ? 25.696  -15.266 8.111   1.00 54.34  ? 298  ARG A N     1 
ATOM   2373 C  CA    . ARG A 1 298 ? 27.064  -15.414 8.548   1.00 53.15  ? 298  ARG A CA    1 
ATOM   2374 C  C     . ARG A 1 298 ? 27.853  -14.382 7.791   1.00 52.44  ? 298  ARG A C     1 
ATOM   2375 O  O     . ARG A 1 298 ? 27.760  -14.303 6.579   1.00 52.63  ? 298  ARG A O     1 
ATOM   2376 C  CB    . ARG A 1 298 ? 27.577  -16.815 8.232   1.00 53.03  ? 298  ARG A CB    1 
ATOM   2377 C  CG    . ARG A 1 298 ? 26.960  -17.881 9.102   1.00 52.70  ? 298  ARG A CG    1 
ATOM   2378 C  CD    . ARG A 1 298 ? 27.203  -17.558 10.555  1.00 52.62  ? 298  ARG A CD    1 
ATOM   2379 N  NE    . ARG A 1 298 ? 26.586  -18.513 11.464  1.00 53.11  ? 298  ARG A NE    1 
ATOM   2380 C  CZ    . ARG A 1 298 ? 25.315  -18.466 11.834  1.00 53.78  ? 298  ARG A CZ    1 
ATOM   2381 N  NH1   . ARG A 1 298 ? 24.516  -17.529 11.353  1.00 55.33  ? 298  ARG A NH1   1 
ATOM   2382 N  NH2   . ARG A 1 298 ? 24.834  -19.365 12.669  1.00 55.40  ? 298  ARG A NH2   1 
ATOM   2383 N  N     . GLY A 1 299 ? 28.612  -13.566 8.497   1.00 51.84  ? 299  GLY A N     1 
ATOM   2384 C  CA    . GLY A 1 299 ? 29.371  -12.541 7.825   1.00 51.38  ? 299  GLY A CA    1 
ATOM   2385 C  C     . GLY A 1 299 ? 30.832  -12.490 8.191   1.00 51.24  ? 299  GLY A C     1 
ATOM   2386 O  O     . GLY A 1 299 ? 31.284  -13.147 9.133   1.00 51.35  ? 299  GLY A O     1 
ATOM   2387 N  N     . ARG A 1 300 ? 31.574  -11.700 7.430   1.00 50.95  ? 300  ARG A N     1 
ATOM   2388 C  CA    . ARG A 1 300 ? 32.976  -11.480 7.716   1.00 51.22  ? 300  ARG A CA    1 
ATOM   2389 C  C     . ARG A 1 300 ? 33.364  -10.075 7.301   1.00 50.89  ? 300  ARG A C     1 
ATOM   2390 O  O     . ARG A 1 300 ? 32.937  -9.588  6.264   1.00 51.94  ? 300  ARG A O     1 
ATOM   2391 C  CB    . ARG A 1 300 ? 33.868  -12.512 7.020   1.00 50.93  ? 300  ARG A CB    1 
ATOM   2392 C  CG    . ARG A 1 300 ? 35.282  -12.497 7.580   1.00 52.06  ? 300  ARG A CG    1 
ATOM   2393 C  CD    . ARG A 1 300 ? 36.249  -13.406 6.843   1.00 52.52  ? 300  ARG A CD    1 
ATOM   2394 N  NE    . ARG A 1 300 ? 37.602  -12.870 6.962   1.00 54.78  ? 300  ARG A NE    1 
ATOM   2395 C  CZ    . ARG A 1 300 ? 38.711  -13.477 6.545   1.00 54.84  ? 300  ARG A CZ    1 
ATOM   2396 N  NH1   . ARG A 1 300 ? 38.655  -14.674 5.971   1.00 54.89  ? 300  ARG A NH1   1 
ATOM   2397 N  NH2   . ARG A 1 300 ? 39.881  -12.872 6.703   1.00 54.53  ? 300  ARG A NH2   1 
ATOM   2398 N  N     . THR A 1 301 ? 34.140  -9.414  8.142   1.00 50.39  ? 301  THR A N     1 
ATOM   2399 C  CA    . THR A 1 301 ? 34.681  -8.117  7.822   1.00 49.57  ? 301  THR A CA    1 
ATOM   2400 C  C     . THR A 1 301 ? 36.177  -8.288  7.695   1.00 49.52  ? 301  THR A C     1 
ATOM   2401 O  O     . THR A 1 301 ? 36.850  -8.570  8.670   1.00 49.42  ? 301  THR A O     1 
ATOM   2402 C  CB    . THR A 1 301 ? 34.377  -7.101  8.917   1.00 49.34  ? 301  THR A CB    1 
ATOM   2403 O  OG1   . THR A 1 301 ? 32.959  -6.860  8.945   1.00 50.14  ? 301  THR A OG1   1 
ATOM   2404 C  CG2   . THR A 1 301 ? 35.125  -5.794  8.674   1.00 47.22  ? 301  THR A CG2   1 
ATOM   2405 N  N     . PHE A 1 302 ? 36.682  -8.152  6.475   1.00 49.51  ? 302  PHE A N     1 
ATOM   2406 C  CA    . PHE A 1 302 ? 38.109  -8.182  6.233   1.00 49.58  ? 302  PHE A CA    1 
ATOM   2407 C  C     . PHE A 1 302 ? 38.675  -6.837  6.625   1.00 49.71  ? 302  PHE A C     1 
ATOM   2408 O  O     . PHE A 1 302 ? 37.943  -5.847  6.675   1.00 49.50  ? 302  PHE A O     1 
ATOM   2409 C  CB    . PHE A 1 302 ? 38.385  -8.441  4.759   1.00 49.13  ? 302  PHE A CB    1 
ATOM   2410 C  CG    . PHE A 1 302 ? 37.905  -9.763  4.290   1.00 49.06  ? 302  PHE A CG    1 
ATOM   2411 C  CD1   . PHE A 1 302 ? 36.553  -10.017 4.168   1.00 48.54  ? 302  PHE A CD1   1 
ATOM   2412 C  CD2   . PHE A 1 302 ? 38.803  -10.761 3.953   1.00 50.01  ? 302  PHE A CD2   1 
ATOM   2413 C  CE1   . PHE A 1 302 ? 36.104  -11.239 3.731   1.00 48.77  ? 302  PHE A CE1   1 
ATOM   2414 C  CE2   . PHE A 1 302 ? 38.351  -11.998 3.512   1.00 49.61  ? 302  PHE A CE2   1 
ATOM   2415 C  CZ    . PHE A 1 302 ? 36.996  -12.233 3.406   1.00 48.53  ? 302  PHE A CZ    1 
ATOM   2416 N  N     . PRO A 1 303 ? 39.980  -6.784  6.908   1.00 50.16  ? 303  PRO A N     1 
ATOM   2417 C  CA    . PRO A 1 303 ? 40.486  -5.438  7.113   1.00 50.65  ? 303  PRO A CA    1 
ATOM   2418 C  C     . PRO A 1 303 ? 40.142  -4.705  5.834   1.00 51.00  ? 303  PRO A C     1 
ATOM   2419 O  O     . PRO A 1 303 ? 39.123  -4.013  5.762   1.00 52.60  ? 303  PRO A O     1 
ATOM   2420 C  CB    . PRO A 1 303 ? 42.003  -5.636  7.235   1.00 50.05  ? 303  PRO A CB    1 
ATOM   2421 C  CG    . PRO A 1 303 ? 42.198  -7.058  7.551   1.00 49.52  ? 303  PRO A CG    1 
ATOM   2422 C  CD    . PRO A 1 303 ? 41.029  -7.815  7.014   1.00 50.13  ? 303  PRO A CD    1 
ATOM   2423 N  N     A HIS A 1 304 ? 40.959  -4.895  4.812   0.50 51.13  ? 304  HIS A N     1 
ATOM   2424 N  N     B HIS A 1 304 ? 40.979  -4.916  4.823   0.50 50.97  ? 304  HIS A N     1 
ATOM   2425 C  CA    A HIS A 1 304 ? 40.773  -4.228  3.537   0.50 51.03  ? 304  HIS A CA    1 
ATOM   2426 C  CA    B HIS A 1 304 ? 40.829  -4.384  3.472   0.50 50.73  ? 304  HIS A CA    1 
ATOM   2427 C  C     A HIS A 1 304 ? 39.534  -4.698  2.773   0.50 51.10  ? 304  HIS A C     1 
ATOM   2428 C  C     B HIS A 1 304 ? 39.487  -4.667  2.800   0.50 50.92  ? 304  HIS A C     1 
ATOM   2429 O  O     A HIS A 1 304 ? 38.810  -5.595  3.210   0.50 51.08  ? 304  HIS A O     1 
ATOM   2430 O  O     B HIS A 1 304 ? 38.654  -5.419  3.312   0.50 50.93  ? 304  HIS A O     1 
ATOM   2431 C  CB    A HIS A 1 304 ? 42.034  -4.402  2.698   0.50 50.87  ? 304  HIS A CB    1 
ATOM   2432 C  CB    B HIS A 1 304 ? 41.923  -4.986  2.590   0.50 50.36  ? 304  HIS A CB    1 
ATOM   2433 C  CG    A HIS A 1 304 ? 43.295  -4.180  3.474   0.50 51.13  ? 304  HIS A CG    1 
ATOM   2434 C  CG    B HIS A 1 304 ? 41.863  -6.481  2.496   0.50 49.91  ? 304  HIS A CG    1 
ATOM   2435 N  ND1   A HIS A 1 304 ? 43.801  -2.923  3.728   0.50 51.19  ? 304  HIS A ND1   1 
ATOM   2436 N  ND1   B HIS A 1 304 ? 42.738  -7.307  3.168   0.50 50.05  ? 304  HIS A ND1   1 
ATOM   2437 C  CD2   A HIS A 1 304 ? 44.140  -5.053  4.073   0.50 50.59  ? 304  HIS A CD2   1 
ATOM   2438 C  CD2   B HIS A 1 304 ? 41.026  -7.299  1.814   0.50 49.67  ? 304  HIS A CD2   1 
ATOM   2439 C  CE1   A HIS A 1 304 ? 44.911  -3.032  4.434   0.50 50.43  ? 304  HIS A CE1   1 
ATOM   2440 C  CE1   B HIS A 1 304 ? 42.445  -8.568  2.901   0.50 49.27  ? 304  HIS A CE1   1 
ATOM   2441 N  NE2   A HIS A 1 304 ? 45.139  -4.314  4.657   0.50 50.31  ? 304  HIS A NE2   1 
ATOM   2442 N  NE2   B HIS A 1 304 ? 41.410  -8.590  2.081   0.50 49.45  ? 304  HIS A NE2   1 
ATOM   2443 N  N     . GLY A 1 305 ? 39.303  -4.079  1.621   1.00 51.16  ? 305  GLY A N     1 
ATOM   2444 C  CA    . GLY A 1 305 ? 38.113  -4.325  0.825   1.00 51.22  ? 305  GLY A CA    1 
ATOM   2445 C  C     . GLY A 1 305 ? 38.048  -5.714  0.235   1.00 51.28  ? 305  GLY A C     1 
ATOM   2446 O  O     . GLY A 1 305 ? 39.058  -6.375  0.082   1.00 50.95  ? 305  GLY A O     1 
ATOM   2447 N  N     . ILE A 1 306 ? 36.838  -6.147  -0.105  1.00 51.73  ? 306  ILE A N     1 
ATOM   2448 C  CA    . ILE A 1 306 ? 36.622  -7.485  -0.626  1.00 51.93  ? 306  ILE A CA    1 
ATOM   2449 C  C     . ILE A 1 306 ? 36.497  -7.408  -2.132  1.00 52.13  ? 306  ILE A C     1 
ATOM   2450 O  O     . ILE A 1 306 ? 35.744  -6.593  -2.655  1.00 51.99  ? 306  ILE A O     1 
ATOM   2451 C  CB    . ILE A 1 306 ? 35.338  -8.094  -0.047  1.00 52.22  ? 306  ILE A CB    1 
ATOM   2452 C  CG1   . ILE A 1 306 ? 35.410  -8.125  1.478   1.00 52.04  ? 306  ILE A CG1   1 
ATOM   2453 C  CG2   . ILE A 1 306 ? 35.093  -9.478  -0.616  1.00 52.23  ? 306  ILE A CG2   1 
ATOM   2454 C  CD1   . ILE A 1 306 ? 34.081  -8.368  2.122   1.00 53.60  ? 306  ILE A CD1   1 
ATOM   2455 N  N     . SER A 1 307 ? 37.252  -8.247  -2.828  1.00 52.86  ? 307  SER A N     1 
ATOM   2456 C  CA    . SER A 1 307 ? 37.176  -8.314  -4.275  1.00 53.39  ? 307  SER A CA    1 
ATOM   2457 C  C     . SER A 1 307 ? 36.066  -9.292  -4.637  1.00 53.98  ? 307  SER A C     1 
ATOM   2458 O  O     . SER A 1 307 ? 35.626  -10.071 -3.797  1.00 53.87  ? 307  SER A O     1 
ATOM   2459 C  CB    . SER A 1 307 ? 38.518  -8.749  -4.870  1.00 53.19  ? 307  SER A CB    1 
ATOM   2460 O  OG    . SER A 1 307 ? 38.829  -10.083 -4.520  1.00 52.31  ? 307  SER A OG    1 
ATOM   2461 N  N     . LYS A 1 308 ? 35.601  -9.241  -5.877  1.00 54.82  ? 308  LYS A N     1 
ATOM   2462 C  CA    . LYS A 1 308 ? 34.534  -10.130 -6.298  1.00 55.81  ? 308  LYS A CA    1 
ATOM   2463 C  C     . LYS A 1 308 ? 34.963  -11.571 -6.120  1.00 56.12  ? 308  LYS A C     1 
ATOM   2464 O  O     . LYS A 1 308 ? 34.171  -12.410 -5.694  1.00 56.26  ? 308  LYS A O     1 
ATOM   2465 C  CB    . LYS A 1 308 ? 34.143  -9.877  -7.752  1.00 56.33  ? 308  LYS A CB    1 
ATOM   2466 C  CG    . LYS A 1 308 ? 32.813  -10.509 -8.135  1.00 56.98  ? 308  LYS A CG    1 
ATOM   2467 C  CD    . LYS A 1 308 ? 32.053  -9.600  -9.073  1.00 59.11  ? 308  LYS A CD    1 
ATOM   2468 C  CE    . LYS A 1 308 ? 32.757  -9.492  -10.413 1.00 60.93  ? 308  LYS A CE    1 
ATOM   2469 N  NZ    . LYS A 1 308 ? 32.399  -10.661 -11.256 1.00 62.67  ? 308  LYS A NZ    1 
ATOM   2470 N  N     . GLU A 1 309 ? 36.223  -11.846 -6.448  1.00 56.71  ? 309  GLU A N     1 
ATOM   2471 C  CA    . GLU A 1 309 ? 36.813  -13.158 -6.218  1.00 57.15  ? 309  GLU A CA    1 
ATOM   2472 C  C     . GLU A 1 309 ? 36.758  -13.555 -4.749  1.00 57.01  ? 309  GLU A C     1 
ATOM   2473 O  O     . GLU A 1 309 ? 36.294  -14.638 -4.423  1.00 57.14  ? 309  GLU A O     1 
ATOM   2474 C  CB    . GLU A 1 309 ? 38.250  -13.214 -6.739  1.00 57.31  ? 309  GLU A CB    1 
ATOM   2475 C  CG    . GLU A 1 309 ? 38.425  -14.040 -8.015  1.00 59.51  ? 309  GLU A CG    1 
ATOM   2476 C  CD    . GLU A 1 309 ? 37.988  -13.296 -9.277  1.00 62.70  ? 309  GLU A CD    1 
ATOM   2477 O  OE1   . GLU A 1 309 ? 36.974  -12.557 -9.216  1.00 62.86  ? 309  GLU A OE1   1 
ATOM   2478 O  OE2   . GLU A 1 309 ? 38.663  -13.449 -10.329 1.00 63.21  ? 309  GLU A OE2   1 
ATOM   2479 N  N     . THR A 1 310 ? 37.230  -12.686 -3.864  1.00 57.24  ? 310  THR A N     1 
ATOM   2480 C  CA    . THR A 1 310 ? 37.148  -12.964 -2.437  1.00 57.87  ? 310  THR A CA    1 
ATOM   2481 C  C     . THR A 1 310 ? 35.685  -13.066 -1.975  1.00 58.33  ? 310  THR A C     1 
ATOM   2482 O  O     . THR A 1 310 ? 35.364  -13.826 -1.067  1.00 58.33  ? 310  THR A O     1 
ATOM   2483 C  CB    . THR A 1 310 ? 37.888  -11.903 -1.602  1.00 57.93  ? 310  THR A CB    1 
ATOM   2484 O  OG1   . THR A 1 310 ? 39.240  -11.777 -2.062  1.00 58.31  ? 310  THR A OG1   1 
ATOM   2485 C  CG2   . THR A 1 310 ? 37.904  -12.301 -0.137  1.00 58.05  ? 310  THR A CG2   1 
ATOM   2486 N  N     . ALA A 1 311 ? 34.797  -12.309 -2.610  1.00 58.83  ? 311  ALA A N     1 
ATOM   2487 C  CA    . ALA A 1 311 ? 33.374  -12.411 -2.311  1.00 59.47  ? 311  ALA A CA    1 
ATOM   2488 C  C     . ALA A 1 311 ? 32.855  -13.803 -2.670  1.00 60.01  ? 311  ALA A C     1 
ATOM   2489 O  O     . ALA A 1 311 ? 32.157  -14.441 -1.884  1.00 60.48  ? 311  ALA A O     1 
ATOM   2490 C  CB    . ALA A 1 311 ? 32.595  -11.339 -3.051  1.00 59.30  ? 311  ALA A CB    1 
ATOM   2491 N  N     . TYR A 1 312 ? 33.196  -14.276 -3.861  1.00 60.31  ? 312  TYR A N     1 
ATOM   2492 C  CA    . TYR A 1 312 ? 32.796  -15.616 -4.265  1.00 60.60  ? 312  TYR A CA    1 
ATOM   2493 C  C     . TYR A 1 312 ? 33.252  -16.662 -3.254  1.00 60.19  ? 312  TYR A C     1 
ATOM   2494 O  O     . TYR A 1 312 ? 32.445  -17.449 -2.770  1.00 60.50  ? 312  TYR A O     1 
ATOM   2495 C  CB    . TYR A 1 312 ? 33.323  -15.940 -5.659  1.00 60.77  ? 312  TYR A CB    1 
ATOM   2496 C  CG    . TYR A 1 312 ? 32.424  -15.440 -6.765  1.00 62.75  ? 312  TYR A CG    1 
ATOM   2497 C  CD1   . TYR A 1 312 ? 31.229  -16.083 -7.049  1.00 64.78  ? 312  TYR A CD1   1 
ATOM   2498 C  CD2   . TYR A 1 312 ? 32.767  -14.328 -7.528  1.00 64.17  ? 312  TYR A CD2   1 
ATOM   2499 C  CE1   . TYR A 1 312 ? 30.396  -15.634 -8.061  1.00 66.03  ? 312  TYR A CE1   1 
ATOM   2500 C  CE2   . TYR A 1 312 ? 31.944  -13.871 -8.543  1.00 64.73  ? 312  TYR A CE2   1 
ATOM   2501 C  CZ    . TYR A 1 312 ? 30.762  -14.532 -8.805  1.00 65.77  ? 312  TYR A CZ    1 
ATOM   2502 O  OH    . TYR A 1 312 ? 29.931  -14.105 -9.809  1.00 66.14  ? 312  TYR A OH    1 
ATOM   2503 N  N     . SER A 1 313 ? 34.540  -16.645 -2.923  1.00 59.93  ? 313  SER A N     1 
ATOM   2504 C  CA    . SER A 1 313 ? 35.136  -17.601 -1.993  1.00 59.49  ? 313  SER A CA    1 
ATOM   2505 C  C     . SER A 1 313 ? 34.615  -17.462 -0.575  1.00 59.04  ? 313  SER A C     1 
ATOM   2506 O  O     . SER A 1 313 ? 34.250  -18.452 0.045   1.00 58.95  ? 313  SER A O     1 
ATOM   2507 C  CB    . SER A 1 313 ? 36.654  -17.442 -1.977  1.00 59.59  ? 313  SER A CB    1 
ATOM   2508 O  OG    . SER A 1 313 ? 37.136  -17.312 -3.300  1.00 60.71  ? 313  SER A OG    1 
ATOM   2509 N  N     . GLU A 1 314 ? 34.599  -16.241 -0.051  1.00 58.77  ? 314  GLU A N     1 
ATOM   2510 C  CA    . GLU A 1 314 ? 34.134  -16.032 1.315   1.00 58.85  ? 314  GLU A CA    1 
ATOM   2511 C  C     . GLU A 1 314 ? 32.652  -16.346 1.473   1.00 58.52  ? 314  GLU A C     1 
ATOM   2512 O  O     . GLU A 1 314 ? 32.234  -16.862 2.503   1.00 58.33  ? 314  GLU A O     1 
ATOM   2513 C  CB    . GLU A 1 314 ? 34.409  -14.605 1.796   1.00 59.18  ? 314  GLU A CB    1 
ATOM   2514 C  CG    . GLU A 1 314 ? 34.205  -14.427 3.309   1.00 59.90  ? 314  GLU A CG    1 
ATOM   2515 C  CD    . GLU A 1 314 ? 35.166  -15.291 4.133   1.00 60.73  ? 314  GLU A CD    1 
ATOM   2516 O  OE1   . GLU A 1 314 ? 34.787  -15.734 5.238   1.00 61.27  ? 314  GLU A OE1   1 
ATOM   2517 O  OE2   . GLU A 1 314 ? 36.303  -15.529 3.672   1.00 60.20  ? 314  GLU A OE2   1 
ATOM   2518 N  N     . SER A 1 315 ? 31.865  -16.038 0.450   1.00 58.28  ? 315  SER A N     1 
ATOM   2519 C  CA    . SER A 1 315 ? 30.433  -16.245 0.524   1.00 58.76  ? 315  SER A CA    1 
ATOM   2520 C  C     . SER A 1 315 ? 30.151  -17.723 0.651   1.00 58.39  ? 315  SER A C     1 
ATOM   2521 O  O     . SER A 1 315 ? 29.363  -18.147 1.491   1.00 58.58  ? 315  SER A O     1 
ATOM   2522 C  CB    . SER A 1 315 ? 29.733  -15.682 -0.713  1.00 59.18  ? 315  SER A CB    1 
ATOM   2523 O  OG    . SER A 1 315 ? 30.000  -16.492 -1.849  1.00 60.70  ? 315  SER A OG    1 
ATOM   2524 N  N     . VAL A 1 316 ? 30.815  -18.510 -0.181  1.00 58.39  ? 316  VAL A N     1 
ATOM   2525 C  CA    . VAL A 1 316 ? 30.713  -19.969 -0.102  1.00 58.14  ? 316  VAL A CA    1 
ATOM   2526 C  C     . VAL A 1 316 ? 31.102  -20.517 1.268   1.00 57.70  ? 316  VAL A C     1 
ATOM   2527 O  O     . VAL A 1 316 ? 30.438  -21.408 1.795   1.00 57.86  ? 316  VAL A O     1 
ATOM   2528 C  CB    . VAL A 1 316 ? 31.535  -20.644 -1.195  1.00 58.10  ? 316  VAL A CB    1 
ATOM   2529 C  CG1   . VAL A 1 316 ? 31.740  -22.113 -0.878  1.00 58.58  ? 316  VAL A CG1   1 
ATOM   2530 C  CG2   . VAL A 1 316 ? 30.831  -20.478 -2.523  1.00 57.99  ? 316  VAL A CG2   1 
ATOM   2531 N  N     . LYS A 1 317 ? 32.165  -19.980 1.850   1.00 57.20  ? 317  LYS A N     1 
ATOM   2532 C  CA    . LYS A 1 317 ? 32.541  -20.365 3.204   1.00 56.86  ? 317  LYS A CA    1 
ATOM   2533 C  C     . LYS A 1 317 ? 31.439  -19.992 4.183   1.00 56.56  ? 317  LYS A C     1 
ATOM   2534 O  O     . LYS A 1 317 ? 31.086  -20.778 5.054   1.00 56.53  ? 317  LYS A O     1 
ATOM   2535 C  CB    . LYS A 1 317 ? 33.837  -19.683 3.633   1.00 56.77  ? 317  LYS A CB    1 
ATOM   2536 C  CG    . LYS A 1 317 ? 35.072  -20.132 2.905   1.00 56.66  ? 317  LYS A CG    1 
ATOM   2537 C  CD    . LYS A 1 317 ? 36.264  -19.332 3.400   1.00 58.01  ? 317  LYS A CD    1 
ATOM   2538 C  CE    . LYS A 1 317 ? 37.549  -19.747 2.712   1.00 59.77  ? 317  LYS A CE    1 
ATOM   2539 N  NZ    . LYS A 1 317 ? 38.616  -18.756 2.982   1.00 60.31  ? 317  LYS A NZ    1 
ATOM   2540 N  N     . LEU A 1 318 ? 30.909  -18.778 4.048   1.00 56.16  ? 318  LEU A N     1 
ATOM   2541 C  CA    . LEU A 1 318 ? 29.896  -18.297 4.968   1.00 55.63  ? 318  LEU A CA    1 
ATOM   2542 C  C     . LEU A 1 318 ? 28.627  -19.114 4.797   1.00 55.67  ? 318  LEU A C     1 
ATOM   2543 O  O     . LEU A 1 318 ? 27.959  -19.449 5.768   1.00 55.12  ? 318  LEU A O     1 
ATOM   2544 C  CB    . LEU A 1 318 ? 29.617  -16.815 4.733   1.00 55.62  ? 318  LEU A CB    1 
ATOM   2545 C  CG    . LEU A 1 318 ? 30.815  -15.877 4.899   1.00 55.03  ? 318  LEU A CG    1 
ATOM   2546 C  CD1   . LEU A 1 318 ? 30.491  -14.478 4.354   1.00 51.54  ? 318  LEU A CD1   1 
ATOM   2547 C  CD2   . LEU A 1 318 ? 31.301  -15.835 6.355   1.00 52.92  ? 318  LEU A CD2   1 
ATOM   2548 N  N     . LEU A 1 319 ? 28.310  -19.437 3.548   1.00 56.11  ? 319  LEU A N     1 
ATOM   2549 C  CA    . LEU A 1 319 ? 27.196  -20.322 3.243   1.00 56.49  ? 319  LEU A CA    1 
ATOM   2550 C  C     . LEU A 1 319 ? 27.472  -21.702 3.817   1.00 57.17  ? 319  LEU A C     1 
ATOM   2551 O  O     . LEU A 1 319 ? 26.572  -22.333 4.370   1.00 57.69  ? 319  LEU A O     1 
ATOM   2552 C  CB    . LEU A 1 319 ? 26.980  -20.417 1.734   1.00 56.15  ? 319  LEU A CB    1 
ATOM   2553 C  CG    . LEU A 1 319 ? 25.981  -21.476 1.280   1.00 54.98  ? 319  LEU A CG    1 
ATOM   2554 C  CD1   . LEU A 1 319 ? 24.592  -21.170 1.836   1.00 53.91  ? 319  LEU A CD1   1 
ATOM   2555 C  CD2   . LEU A 1 319 ? 25.966  -21.590 -0.239  1.00 53.46  ? 319  LEU A CD2   1 
ATOM   2556 N  N     . GLN A 1 320 ? 28.714  -22.170 3.675   1.00 57.74  ? 320  GLN A N     1 
ATOM   2557 C  CA    . GLN A 1 320 ? 29.149  -23.414 4.307   1.00 58.12  ? 320  GLN A CA    1 
ATOM   2558 C  C     . GLN A 1 320 ? 28.830  -23.362 5.795   1.00 58.26  ? 320  GLN A C     1 
ATOM   2559 O  O     . GLN A 1 320 ? 28.264  -24.304 6.348   1.00 58.47  ? 320  GLN A O     1 
ATOM   2560 C  CB    . GLN A 1 320 ? 30.658  -23.640 4.131   1.00 58.40  ? 320  GLN A CB    1 
ATOM   2561 C  CG    . GLN A 1 320 ? 31.144  -23.881 2.698   1.00 59.36  ? 320  GLN A CG    1 
ATOM   2562 C  CD    . GLN A 1 320 ? 32.676  -24.033 2.595   1.00 60.12  ? 320  GLN A CD    1 
ATOM   2563 O  OE1   . GLN A 1 320 ? 33.352  -24.435 3.552   1.00 59.29  ? 320  GLN A OE1   1 
ATOM   2564 N  NE2   . GLN A 1 320 ? 33.219  -23.719 1.421   1.00 60.19  ? 320  GLN A NE2   1 
ATOM   2565 N  N     . LYS A 1 321 ? 29.198  -22.253 6.431   1.00 58.49  ? 321  LYS A N     1 
ATOM   2566 C  CA    . LYS A 1 321 ? 29.053  -22.079 7.876   1.00 58.92  ? 321  LYS A CA    1 
ATOM   2567 C  C     . LYS A 1 321 ? 27.592  -21.967 8.304   1.00 58.98  ? 321  LYS A C     1 
ATOM   2568 O  O     . LYS A 1 321 ? 27.238  -22.322 9.423   1.00 59.15  ? 321  LYS A O     1 
ATOM   2569 C  CB    . LYS A 1 321 ? 29.845  -20.851 8.335   1.00 59.12  ? 321  LYS A CB    1 
ATOM   2570 C  CG    . LYS A 1 321 ? 29.768  -20.552 9.823   1.00 59.99  ? 321  LYS A CG    1 
ATOM   2571 C  CD    . LYS A 1 321 ? 30.588  -19.314 10.189  1.00 61.96  ? 321  LYS A CD    1 
ATOM   2572 C  CE    . LYS A 1 321 ? 30.688  -19.139 11.710  1.00 63.01  ? 321  LYS A CE    1 
ATOM   2573 N  NZ    . LYS A 1 321 ? 31.242  -17.808 12.120  1.00 63.44  ? 321  LYS A NZ    1 
ATOM   2574 N  N     . ILE A 1 322 ? 26.749  -21.463 7.412   1.00 59.37  ? 322  ILE A N     1 
ATOM   2575 C  CA    . ILE A 1 322 ? 25.318  -21.370 7.674   1.00 59.56  ? 322  ILE A CA    1 
ATOM   2576 C  C     . ILE A 1 322 ? 24.738  -22.774 7.647   1.00 60.15  ? 322  ILE A C     1 
ATOM   2577 O  O     . ILE A 1 322 ? 24.034  -23.190 8.566   1.00 60.51  ? 322  ILE A O     1 
ATOM   2578 C  CB    . ILE A 1 322 ? 24.591  -20.557 6.585   1.00 59.32  ? 322  ILE A CB    1 
ATOM   2579 C  CG1   . ILE A 1 322 ? 24.822  -19.059 6.771   1.00 58.55  ? 322  ILE A CG1   1 
ATOM   2580 C  CG2   . ILE A 1 322 ? 23.088  -20.865 6.595   1.00 58.98  ? 322  ILE A CG2   1 
ATOM   2581 C  CD1   . ILE A 1 322 ? 24.192  -18.221 5.680   1.00 56.51  ? 322  ILE A CD1   1 
ATOM   2582 N  N     . LEU A 1 323 ? 25.046  -23.490 6.569   1.00 60.32  ? 323  LEU A N     1 
ATOM   2583 C  CA    . LEU A 1 323 ? 24.561  -24.830 6.348   1.00 60.61  ? 323  LEU A CA    1 
ATOM   2584 C  C     . LEU A 1 323 ? 25.003  -25.715 7.506   1.00 61.25  ? 323  LEU A C     1 
ATOM   2585 O  O     . LEU A 1 323 ? 24.313  -26.657 7.882   1.00 61.43  ? 323  LEU A O     1 
ATOM   2586 C  CB    . LEU A 1 323 ? 25.128  -25.356 5.025   1.00 60.37  ? 323  LEU A CB    1 
ATOM   2587 C  CG    . LEU A 1 323 ? 24.230  -25.509 3.789   1.00 59.76  ? 323  LEU A CG    1 
ATOM   2588 C  CD1   . LEU A 1 323 ? 23.073  -24.544 3.771   1.00 58.59  ? 323  LEU A CD1   1 
ATOM   2589 C  CD2   . LEU A 1 323 ? 25.036  -25.411 2.500   1.00 59.19  ? 323  LEU A CD2   1 
ATOM   2590 N  N     . GLU A 1 324 ? 26.157  -25.381 8.076   1.00 61.87  ? 324  GLU A N     1 
ATOM   2591 C  CA    . GLU A 1 324 ? 26.765  -26.145 9.156   1.00 62.24  ? 324  GLU A CA    1 
ATOM   2592 C  C     . GLU A 1 324 ? 26.193  -25.842 10.542  1.00 62.55  ? 324  GLU A C     1 
ATOM   2593 O  O     . GLU A 1 324 ? 25.977  -26.751 11.338  1.00 62.65  ? 324  GLU A O     1 
ATOM   2594 C  CB    . GLU A 1 324 ? 28.272  -25.903 9.161   1.00 62.24  ? 324  GLU A CB    1 
ATOM   2595 C  CG    . GLU A 1 324 ? 29.009  -26.614 8.042   1.00 63.14  ? 324  GLU A CG    1 
ATOM   2596 C  CD    . GLU A 1 324 ? 30.517  -26.557 8.205   1.00 63.64  ? 324  GLU A CD    1 
ATOM   2597 O  OE1   . GLU A 1 324 ? 31.192  -27.519 7.786   1.00 63.70  ? 324  GLU A OE1   1 
ATOM   2598 O  OE2   . GLU A 1 324 ? 31.027  -25.554 8.750   1.00 64.41  ? 324  GLU A OE2   1 
ATOM   2599 N  N     . GLU A 1 325 ? 25.953  -24.568 10.834  1.00 63.12  ? 325  GLU A N     1 
ATOM   2600 C  CA    . GLU A 1 325 ? 25.523  -24.164 12.174  1.00 63.59  ? 325  GLU A CA    1 
ATOM   2601 C  C     . GLU A 1 325 ? 24.005  -24.026 12.297  1.00 63.77  ? 325  GLU A C     1 
ATOM   2602 O  O     . GLU A 1 325 ? 23.492  -23.597 13.331  1.00 63.83  ? 325  GLU A O     1 
ATOM   2603 C  CB    . GLU A 1 325 ? 26.216  -22.861 12.585  1.00 63.75  ? 325  GLU A CB    1 
ATOM   2604 C  CG    . GLU A 1 325 ? 27.738  -22.958 12.599  1.00 64.07  ? 325  GLU A CG    1 
ATOM   2605 C  CD    . GLU A 1 325 ? 28.418  -21.629 12.901  1.00 65.02  ? 325  GLU A CD    1 
ATOM   2606 O  OE1   . GLU A 1 325 ? 27.767  -20.567 12.743  1.00 64.78  ? 325  GLU A OE1   1 
ATOM   2607 O  OE2   . GLU A 1 325 ? 29.608  -21.653 13.294  1.00 64.30  ? 325  GLU A OE2   1 
ATOM   2608 N  N     . ASP A 1 326 ? 23.296  -24.390 11.236  1.00 64.04  ? 326  ASP A N     1 
ATOM   2609 C  CA    . ASP A 1 326 ? 21.840  -24.344 11.226  1.00 64.45  ? 326  ASP A CA    1 
ATOM   2610 C  C     . ASP A 1 326 ? 21.331  -25.515 10.404  1.00 64.63  ? 326  ASP A C     1 
ATOM   2611 O  O     . ASP A 1 326 ? 21.739  -25.710 9.259   1.00 64.63  ? 326  ASP A O     1 
ATOM   2612 C  CB    . ASP A 1 326 ? 21.331  -23.021 10.649  1.00 64.57  ? 326  ASP A CB    1 
ATOM   2613 C  CG    . ASP A 1 326 ? 19.852  -22.776 10.956  1.00 65.40  ? 326  ASP A CG    1 
ATOM   2614 O  OD1   . ASP A 1 326 ? 19.018  -23.639 10.595  1.00 66.08  ? 326  ASP A OD1   1 
ATOM   2615 O  OD2   . ASP A 1 326 ? 19.526  -21.723 11.556  1.00 64.31  ? 326  ASP A OD2   1 
ATOM   2616 N  N     . GLU A 1 327 ? 20.443  -26.303 10.999  1.00 64.82  ? 327  GLU A N     1 
ATOM   2617 C  CA    . GLU A 1 327 ? 20.020  -27.557 10.394  1.00 64.89  ? 327  GLU A CA    1 
ATOM   2618 C  C     . GLU A 1 327 ? 18.980  -27.354 9.293   1.00 64.33  ? 327  GLU A C     1 
ATOM   2619 O  O     . GLU A 1 327 ? 18.728  -28.258 8.494   1.00 64.60  ? 327  GLU A O     1 
ATOM   2620 C  CB    . GLU A 1 327 ? 19.501  -28.520 11.470  1.00 65.18  ? 327  GLU A CB    1 
ATOM   2621 C  CG    . GLU A 1 327 ? 18.518  -27.888 12.465  1.00 66.68  ? 327  GLU A CG    1 
ATOM   2622 C  CD    . GLU A 1 327 ? 17.066  -27.928 11.992  1.00 68.55  ? 327  GLU A CD    1 
ATOM   2623 O  OE1   . GLU A 1 327 ? 16.711  -28.846 11.220  1.00 69.59  ? 327  GLU A OE1   1 
ATOM   2624 O  OE2   . GLU A 1 327 ? 16.275  -27.047 12.405  1.00 69.10  ? 327  GLU A OE2   1 
ATOM   2625 N  N     . ARG A 1 328 ? 18.395  -26.164 9.240   1.00 63.48  ? 328  ARG A N     1 
ATOM   2626 C  CA    . ARG A 1 328 ? 17.274  -25.904 8.337   1.00 62.70  ? 328  ARG A CA    1 
ATOM   2627 C  C     . ARG A 1 328 ? 17.642  -25.861 6.856   1.00 61.99  ? 328  ARG A C     1 
ATOM   2628 O  O     . ARG A 1 328 ? 18.785  -25.588 6.486   1.00 62.12  ? 328  ARG A O     1 
ATOM   2629 C  CB    . ARG A 1 328 ? 16.554  -24.621 8.744   1.00 62.64  ? 328  ARG A CB    1 
ATOM   2630 C  CG    . ARG A 1 328 ? 15.767  -24.756 10.034  1.00 63.11  ? 328  ARG A CG    1 
ATOM   2631 C  CD    . ARG A 1 328 ? 15.304  -23.407 10.554  1.00 64.38  ? 328  ARG A CD    1 
ATOM   2632 N  NE    . ARG A 1 328 ? 16.396  -22.629 11.134  1.00 65.19  ? 328  ARG A NE    1 
ATOM   2633 C  CZ    . ARG A 1 328 ? 16.223  -21.498 11.812  1.00 65.76  ? 328  ARG A CZ    1 
ATOM   2634 N  NH1   . ARG A 1 328 ? 15.003  -21.016 11.996  1.00 65.83  ? 328  ARG A NH1   1 
ATOM   2635 N  NH2   . ARG A 1 328 ? 17.267  -20.851 12.308  1.00 66.31  ? 328  ARG A NH2   1 
ATOM   2636 N  N     . LYS A 1 329 ? 16.663  -26.145 6.006   1.00 61.07  ? 329  LYS A N     1 
ATOM   2637 C  CA    . LYS A 1 329 ? 16.837  -25.926 4.582   1.00 60.28  ? 329  LYS A CA    1 
ATOM   2638 C  C     . LYS A 1 329 ? 16.800  -24.427 4.306   1.00 59.51  ? 329  LYS A C     1 
ATOM   2639 O  O     . LYS A 1 329 ? 16.194  -23.651 5.044   1.00 59.56  ? 329  LYS A O     1 
ATOM   2640 C  CB    . LYS A 1 329 ? 15.759  -26.642 3.767   1.00 60.45  ? 329  LYS A CB    1 
ATOM   2641 C  CG    . LYS A 1 329 ? 15.900  -28.154 3.731   1.00 61.19  ? 329  LYS A CG    1 
ATOM   2642 C  CD    . LYS A 1 329 ? 15.021  -28.771 2.662   1.00 61.93  ? 329  LYS A CD    1 
ATOM   2643 C  CE    . LYS A 1 329 ? 15.219  -30.273 2.605   1.00 63.06  ? 329  LYS A CE    1 
ATOM   2644 N  NZ    . LYS A 1 329 ? 14.434  -30.897 1.501   1.00 63.66  ? 329  LYS A NZ    1 
ATOM   2645 N  N     . ILE A 1 330 ? 17.460  -24.025 3.235   1.00 58.38  ? 330  ILE A N     1 
ATOM   2646 C  CA    . ILE A 1 330 ? 17.564  -22.634 2.899   1.00 57.08  ? 330  ILE A CA    1 
ATOM   2647 C  C     . ILE A 1 330 ? 16.603  -22.376 1.765   1.00 56.60  ? 330  ILE A C     1 
ATOM   2648 O  O     . ILE A 1 330 ? 16.542  -23.140 0.806   1.00 56.59  ? 330  ILE A O     1 
ATOM   2649 C  CB    . ILE A 1 330 ? 19.004  -22.273 2.522   1.00 56.99  ? 330  ILE A CB    1 
ATOM   2650 C  CG1   . ILE A 1 330 ? 19.863  -22.283 3.790   1.00 56.99  ? 330  ILE A CG1   1 
ATOM   2651 C  CG2   . ILE A 1 330 ? 19.065  -20.920 1.827   1.00 56.62  ? 330  ILE A CG2   1 
ATOM   2652 C  CD1   . ILE A 1 330 ? 21.346  -22.174 3.544   1.00 56.09  ? 330  ILE A CD1   1 
ATOM   2653 N  N     . ARG A 1 331 ? 15.837  -21.303 1.893   1.00 55.51  ? 331  ARG A N     1 
ATOM   2654 C  CA    . ARG A 1 331 ? 14.802  -20.994 0.940   1.00 54.91  ? 331  ARG A CA    1 
ATOM   2655 C  C     . ARG A 1 331 ? 15.228  -19.797 0.114   1.00 54.60  ? 331  ARG A C     1 
ATOM   2656 O  O     . ARG A 1 331 ? 14.998  -19.741 -1.094  1.00 55.01  ? 331  ARG A O     1 
ATOM   2657 C  CB    . ARG A 1 331 ? 13.503  -20.721 1.696   1.00 54.78  ? 331  ARG A CB    1 
ATOM   2658 C  CG    . ARG A 1 331 ? 12.437  -19.990 0.937   1.00 54.04  ? 331  ARG A CG    1 
ATOM   2659 C  CD    . ARG A 1 331 ? 11.392  -19.532 1.931   1.00 54.23  ? 331  ARG A CD    1 
ATOM   2660 N  NE    . ARG A 1 331 ? 10.360  -18.704 1.322   1.00 55.86  ? 331  ARG A NE    1 
ATOM   2661 C  CZ    . ARG A 1 331 ? 9.178   -19.169 0.939   1.00 55.14  ? 331  ARG A CZ    1 
ATOM   2662 N  NH1   . ARG A 1 331 ? 8.899   -20.457 1.100   1.00 54.01  ? 331  ARG A NH1   1 
ATOM   2663 N  NH2   . ARG A 1 331 ? 8.288   -18.353 0.393   1.00 53.58  ? 331  ARG A NH2   1 
ATOM   2664 N  N     . ARG A 1 332 ? 15.861  -18.835 0.767   1.00 53.87  ? 332  ARG A N     1 
ATOM   2665 C  CA    . ARG A 1 332 ? 16.409  -17.699 0.058   1.00 53.14  ? 332  ARG A CA    1 
ATOM   2666 C  C     . ARG A 1 332 ? 17.847  -17.555 0.482   1.00 52.91  ? 332  ARG A C     1 
ATOM   2667 O  O     . ARG A 1 332 ? 18.205  -17.792 1.642   1.00 52.87  ? 332  ARG A O     1 
ATOM   2668 C  CB    . ARG A 1 332 ? 15.609  -16.425 0.348   1.00 53.48  ? 332  ARG A CB    1 
ATOM   2669 C  CG    . ARG A 1 332 ? 14.100  -16.677 0.398   1.00 53.19  ? 332  ARG A CG    1 
ATOM   2670 C  CD    . ARG A 1 332 ? 13.323  -15.424 0.642   1.00 55.46  ? 332  ARG A CD    1 
ATOM   2671 N  NE    . ARG A 1 332 ? 13.721  -14.357 -0.273  1.00 55.71  ? 332  ARG A NE    1 
ATOM   2672 C  CZ    . ARG A 1 332 ? 14.027  -13.122 0.108   1.00 54.65  ? 332  ARG A CZ    1 
ATOM   2673 N  NH1   . ARG A 1 332 ? 14.393  -12.218 -0.798  1.00 53.91  ? 332  ARG A NH1   1 
ATOM   2674 N  NH2   . ARG A 1 332 ? 13.954  -12.793 1.391   1.00 54.01  ? 332  ARG A NH2   1 
ATOM   2675 N  N     . ILE A 1 333 ? 18.690  -17.220 -0.474  1.00 52.19  ? 333  ILE A N     1 
ATOM   2676 C  CA    . ILE A 1 333 ? 20.074  -17.061 -0.169  1.00 52.13  ? 333  ILE A CA    1 
ATOM   2677 C  C     . ILE A 1 333 ? 20.455  -15.717 -0.720  1.00 52.30  ? 333  ILE A C     1 
ATOM   2678 O  O     . ILE A 1 333 ? 20.022  -15.329 -1.801  1.00 53.04  ? 333  ILE A O     1 
ATOM   2679 C  CB    . ILE A 1 333 ? 20.942  -18.188 -0.775  1.00 51.94  ? 333  ILE A CB    1 
ATOM   2680 C  CG1   . ILE A 1 333 ? 22.359  -18.110 -0.226  1.00 50.73  ? 333  ILE A CG1   1 
ATOM   2681 C  CG2   . ILE A 1 333 ? 20.941  -18.119 -2.288  1.00 52.13  ? 333  ILE A CG2   1 
ATOM   2682 C  CD1   . ILE A 1 333 ? 22.425  -18.223 1.261   1.00 50.20  ? 333  ILE A CD1   1 
ATOM   2683 N  N     . GLY A 1 334 ? 21.227  -14.974 0.046   1.00 51.71  ? 334  GLY A N     1 
ATOM   2684 C  CA    . GLY A 1 334 ? 21.637  -13.702 -0.430  1.00 51.62  ? 334  GLY A CA    1 
ATOM   2685 C  C     . GLY A 1 334 ? 22.990  -13.350 0.106   1.00 51.69  ? 334  GLY A C     1 
ATOM   2686 O  O     . GLY A 1 334 ? 23.587  -14.099 0.868   1.00 50.91  ? 334  GLY A O     1 
ATOM   2687 N  N     . VAL A 1 335 ? 23.451  -12.184 -0.313  1.00 51.70  ? 335  VAL A N     1 
ATOM   2688 C  CA    . VAL A 1 335 ? 24.705  -11.660 0.122   1.00 52.35  ? 335  VAL A CA    1 
ATOM   2689 C  C     . VAL A 1 335 ? 24.490  -10.184 0.389   1.00 52.35  ? 335  VAL A C     1 
ATOM   2690 O  O     . VAL A 1 335 ? 23.588  -9.544  -0.155  1.00 52.81  ? 335  VAL A O     1 
ATOM   2691 C  CB    . VAL A 1 335 ? 25.789  -11.868 -0.938  1.00 52.44  ? 335  VAL A CB    1 
ATOM   2692 C  CG1   . VAL A 1 335 ? 25.562  -10.921 -2.101  1.00 52.39  ? 335  VAL A CG1   1 
ATOM   2693 C  CG2   . VAL A 1 335 ? 27.155  -11.648 -0.332  1.00 53.02  ? 335  VAL A CG2   1 
ATOM   2694 N  N     . ARG A 1 336 ? 25.291  -9.650  1.283   1.00 51.96  ? 336  ARG A N     1 
ATOM   2695 C  CA    . ARG A 1 336 ? 25.176  -8.259  1.612   1.00 51.37  ? 336  ARG A CA    1 
ATOM   2696 C  C     . ARG A 1 336 ? 26.577  -7.782  1.864   1.00 50.78  ? 336  ARG A C     1 
ATOM   2697 O  O     . ARG A 1 336 ? 27.327  -8.375  2.637   1.00 49.06  ? 336  ARG A O     1 
ATOM   2698 C  CB    . ARG A 1 336 ? 24.312  -8.065  2.845   1.00 51.23  ? 336  ARG A CB    1 
ATOM   2699 C  CG    . ARG A 1 336 ? 24.284  -6.648  3.363   1.00 52.68  ? 336  ARG A CG    1 
ATOM   2700 C  CD    . ARG A 1 336 ? 22.934  -6.371  3.988   1.00 57.86  ? 336  ARG A CD    1 
ATOM   2701 N  NE    . ARG A 1 336 ? 21.900  -6.400  2.960   1.00 63.16  ? 336  ARG A NE    1 
ATOM   2702 C  CZ    . ARG A 1 336 ? 21.381  -5.313  2.382   1.00 67.27  ? 336  ARG A CZ    1 
ATOM   2703 N  NH1   . ARG A 1 336 ? 21.769  -4.092  2.764   1.00 66.56  ? 336  ARG A NH1   1 
ATOM   2704 N  NH2   . ARG A 1 336 ? 20.455  -5.441  1.426   1.00 68.56  ? 336  ARG A NH2   1 
ATOM   2705 N  N     . PHE A 1 337 ? 26.918  -6.708  1.177   1.00 51.21  ? 337  PHE A N     1 
ATOM   2706 C  CA    . PHE A 1 337 ? 28.213  -6.099  1.325   1.00 51.33  ? 337  PHE A CA    1 
ATOM   2707 C  C     . PHE A 1 337 ? 28.008  -4.830  2.071   1.00 51.33  ? 337  PHE A C     1 
ATOM   2708 O  O     . PHE A 1 337 ? 26.933  -4.247  2.012   1.00 50.88  ? 337  PHE A O     1 
ATOM   2709 C  CB    . PHE A 1 337 ? 28.803  -5.826  -0.043  1.00 51.31  ? 337  PHE A CB    1 
ATOM   2710 C  CG    . PHE A 1 337 ? 29.089  -7.059  -0.791  1.00 52.44  ? 337  PHE A CG    1 
ATOM   2711 C  CD1   . PHE A 1 337 ? 30.207  -7.811  -0.487  1.00 52.69  ? 337  PHE A CD1   1 
ATOM   2712 C  CD2   . PHE A 1 337 ? 28.217  -7.508  -1.758  1.00 53.80  ? 337  PHE A CD2   1 
ATOM   2713 C  CE1   . PHE A 1 337 ? 30.470  -8.962  -1.158  1.00 53.83  ? 337  PHE A CE1   1 
ATOM   2714 C  CE2   . PHE A 1 337 ? 28.472  -8.668  -2.435  1.00 54.19  ? 337  PHE A CE2   1 
ATOM   2715 C  CZ    . PHE A 1 337 ? 29.588  -9.399  -2.141  1.00 55.55  ? 337  PHE A CZ    1 
ATOM   2716 N  N     . SER A 1 338 ? 29.048  -4.407  2.778   1.00 51.74  ? 338  SER A N     1 
ATOM   2717 C  CA    . SER A 1 338 ? 28.960  -3.232  3.610   1.00 51.77  ? 338  SER A CA    1 
ATOM   2718 C  C     . SER A 1 338 ? 30.356  -2.828  3.989   1.00 51.74  ? 338  SER A C     1 
ATOM   2719 O  O     . SER A 1 338 ? 31.313  -3.460  3.570   1.00 51.65  ? 338  SER A O     1 
ATOM   2720 C  CB    . SER A 1 338 ? 28.142  -3.537  4.859   1.00 51.77  ? 338  SER A CB    1 
ATOM   2721 O  OG    . SER A 1 338 ? 28.629  -4.697  5.509   1.00 52.25  ? 338  SER A OG    1 
ATOM   2722 N  N     . LYS A 1 339 ? 30.458  -1.770  4.788   1.00 52.36  ? 339  LYS A N     1 
ATOM   2723 C  CA    . LYS A 1 339 ? 31.738  -1.230  5.231   1.00 52.93  ? 339  LYS A CA    1 
ATOM   2724 C  C     . LYS A 1 339 ? 32.548  -0.886  4.018   1.00 53.05  ? 339  LYS A C     1 
ATOM   2725 O  O     . LYS A 1 339 ? 33.615  -1.437  3.789   1.00 52.73  ? 339  LYS A O     1 
ATOM   2726 C  CB    . LYS A 1 339 ? 32.490  -2.195  6.144   1.00 52.59  ? 339  LYS A CB    1 
ATOM   2727 C  CG    . LYS A 1 339 ? 31.671  -2.625  7.332   1.00 54.20  ? 339  LYS A CG    1 
ATOM   2728 C  CD    . LYS A 1 339 ? 32.516  -3.308  8.382   1.00 57.53  ? 339  LYS A CD    1 
ATOM   2729 C  CE    . LYS A 1 339 ? 31.635  -3.936  9.451   1.00 58.61  ? 339  LYS A CE    1 
ATOM   2730 N  NZ    . LYS A 1 339 ? 32.463  -4.335  10.620  1.00 61.24  ? 339  LYS A NZ    1 
ATOM   2731 N  N     . PHE A 1 340 ? 31.997  0.035   3.238   1.00 53.62  ? 340  PHE A N     1 
ATOM   2732 C  CA    . PHE A 1 340 ? 32.608  0.463   2.003   1.00 54.05  ? 340  PHE A CA    1 
ATOM   2733 C  C     . PHE A 1 340 ? 33.758  1.352   2.344   1.00 54.59  ? 340  PHE A C     1 
ATOM   2734 O  O     . PHE A 1 340 ? 33.672  2.154   3.266   1.00 55.10  ? 340  PHE A O     1 
ATOM   2735 C  CB    . PHE A 1 340 ? 31.600  1.225   1.148   1.00 53.68  ? 340  PHE A CB    1 
ATOM   2736 C  CG    . PHE A 1 340 ? 30.370  0.440   0.839   1.00 52.70  ? 340  PHE A CG    1 
ATOM   2737 C  CD1   . PHE A 1 340 ? 30.467  -0.863  0.424   1.00 51.46  ? 340  PHE A CD1   1 
ATOM   2738 C  CD2   . PHE A 1 340 ? 29.112  1.008   0.960   1.00 52.20  ? 340  PHE A CD2   1 
ATOM   2739 C  CE1   . PHE A 1 340 ? 29.326  -1.598  0.137   1.00 53.75  ? 340  PHE A CE1   1 
ATOM   2740 C  CE2   . PHE A 1 340 ? 27.979  0.277   0.663   1.00 52.83  ? 340  PHE A CE2   1 
ATOM   2741 C  CZ    . PHE A 1 340 ? 28.083  -1.027  0.253   1.00 51.07  ? 340  PHE A CZ    1 
ATOM   2742 N  N     . ILE A 1 341 ? 34.842  1.207   1.602   1.00 55.45  ? 341  ILE A N     1 
ATOM   2743 C  CA    . ILE A 1 341 ? 36.026  2.009   1.840   1.00 55.91  ? 341  ILE A CA    1 
ATOM   2744 C  C     . ILE A 1 341 ? 35.757  3.483   1.526   1.00 56.40  ? 341  ILE A C     1 
ATOM   2745 O  O     . ILE A 1 341 ? 35.122  3.787   0.523   1.00 56.53  ? 341  ILE A O     1 
ATOM   2746 C  CB    . ILE A 1 341 ? 37.182  1.476   1.015   1.00 55.87  ? 341  ILE A CB    1 
ATOM   2747 C  CG1   . ILE A 1 341 ? 37.413  0.006   1.382   1.00 56.01  ? 341  ILE A CG1   1 
ATOM   2748 C  CG2   . ILE A 1 341 ? 38.437  2.324   1.228   1.00 56.21  ? 341  ILE A CG2   1 
ATOM   2749 C  CD1   . ILE A 1 341 ? 38.589  -0.622  0.711   1.00 56.17  ? 341  ILE A CD1   1 
ATOM   2750 O  OXT   . ILE A 1 341 ? 36.142  4.410   2.262   1.00 57.11  ? 341  ILE A OXT   1 
ATOM   2751 O  "O5'" . DG  B 2 1   ? 30.960  -0.728  34.255  1.00 85.81  ? 802  DG  D "O5'" 1 
ATOM   2752 C  "C5'" . DG  B 2 1   ? 31.321  -1.196  32.959  1.00 85.87  ? 802  DG  D "C5'" 1 
ATOM   2753 C  "C4'" . DG  B 2 1   ? 32.730  -0.756  32.602  1.00 85.80  ? 802  DG  D "C4'" 1 
ATOM   2754 O  "O4'" . DG  B 2 1   ? 33.652  -1.856  32.800  1.00 85.67  ? 802  DG  D "O4'" 1 
ATOM   2755 C  "C3'" . DG  B 2 1   ? 32.934  -0.367  31.147  1.00 85.71  ? 802  DG  D "C3'" 1 
ATOM   2756 O  "O3'" . DG  B 2 1   ? 32.590  0.998   30.943  1.00 85.59  ? 802  DG  D "O3'" 1 
ATOM   2757 C  "C2'" . DG  B 2 1   ? 34.434  -0.571  30.961  1.00 85.72  ? 802  DG  D "C2'" 1 
ATOM   2758 C  "C1'" . DG  B 2 1   ? 34.786  -1.661  31.973  1.00 85.60  ? 802  DG  D "C1'" 1 
ATOM   2759 N  N9    . DG  B 2 1   ? 35.173  -2.935  31.362  1.00 85.34  ? 802  DG  D N9    1 
ATOM   2760 C  C8    . DG  B 2 1   ? 34.806  -4.190  31.785  1.00 85.13  ? 802  DG  D C8    1 
ATOM   2761 N  N7    . DG  B 2 1   ? 35.299  -5.149  31.051  1.00 85.07  ? 802  DG  D N7    1 
ATOM   2762 C  C5    . DG  B 2 1   ? 36.048  -4.494  30.081  1.00 84.94  ? 802  DG  D C5    1 
ATOM   2763 C  C6    . DG  B 2 1   ? 36.816  -5.018  29.011  1.00 84.61  ? 802  DG  D C6    1 
ATOM   2764 O  O6    . DG  B 2 1   ? 36.989  -6.206  28.705  1.00 84.31  ? 802  DG  D O6    1 
ATOM   2765 N  N1    . DG  B 2 1   ? 37.420  -4.010  28.258  1.00 84.51  ? 802  DG  D N1    1 
ATOM   2766 C  C2    . DG  B 2 1   ? 37.294  -2.663  28.507  1.00 84.59  ? 802  DG  D C2    1 
ATOM   2767 N  N2    . DG  B 2 1   ? 37.948  -1.836  27.676  1.00 84.42  ? 802  DG  D N2    1 
ATOM   2768 N  N3    . DG  B 2 1   ? 36.579  -2.161  29.508  1.00 84.87  ? 802  DG  D N3    1 
ATOM   2769 C  C4    . DG  B 2 1   ? 35.982  -3.128  30.255  1.00 85.14  ? 802  DG  D C4    1 
ATOM   2770 P  P     . DT  B 2 2   ? 31.615  1.418   29.743  1.00 85.54  ? 803  DT  D P     1 
ATOM   2771 O  OP1   . DT  B 2 2   ? 30.755  2.514   30.246  1.00 85.56  ? 803  DT  D OP1   1 
ATOM   2772 O  OP2   . DT  B 2 2   ? 30.981  0.184   29.223  1.00 85.61  ? 803  DT  D OP2   1 
ATOM   2773 O  "O5'" . DT  B 2 2   ? 32.602  1.987   28.606  1.00 84.57  ? 803  DT  D "O5'" 1 
ATOM   2774 C  "C5'" . DT  B 2 2   ? 34.031  1.991   28.762  1.00 83.05  ? 803  DT  D "C5'" 1 
ATOM   2775 C  "C4'" . DT  B 2 2   ? 34.746  1.420   27.542  1.00 81.91  ? 803  DT  D "C4'" 1 
ATOM   2776 O  "O4'" . DT  B 2 2   ? 35.044  0.011   27.739  1.00 81.68  ? 803  DT  D "O4'" 1 
ATOM   2777 C  "C3'" . DT  B 2 2   ? 33.971  1.488   26.225  1.00 81.05  ? 803  DT  D "C3'" 1 
ATOM   2778 O  "O3'" . DT  B 2 2   ? 34.856  1.721   25.139  1.00 79.60  ? 803  DT  D "O3'" 1 
ATOM   2779 C  "C2'" . DT  B 2 2   ? 33.379  0.091   26.114  1.00 81.18  ? 803  DT  D "C2'" 1 
ATOM   2780 C  "C1'" . DT  B 2 2   ? 34.587  -0.698  26.599  1.00 81.51  ? 803  DT  D "C1'" 1 
ATOM   2781 N  N1    . DT  B 2 2   ? 34.287  -2.118  26.944  1.00 81.29  ? 803  DT  D N1    1 
ATOM   2782 C  C2    . DT  B 2 2   ? 34.835  -3.116  26.169  1.00 80.96  ? 803  DT  D C2    1 
ATOM   2783 O  O2    . DT  B 2 2   ? 35.560  -2.898  25.213  1.00 80.76  ? 803  DT  D O2    1 
ATOM   2784 N  N3    . DT  B 2 2   ? 34.501  -4.386  26.565  1.00 80.85  ? 803  DT  D N3    1 
ATOM   2785 C  C4    . DT  B 2 2   ? 33.692  -4.747  27.630  1.00 81.03  ? 803  DT  D C4    1 
ATOM   2786 O  O4    . DT  B 2 2   ? 33.455  -5.919  27.903  1.00 81.02  ? 803  DT  D O4    1 
ATOM   2787 C  C5    . DT  B 2 2   ? 33.151  -3.652  28.398  1.00 81.15  ? 803  DT  D C5    1 
ATOM   2788 C  C7    . DT  B 2 2   ? 32.258  -3.915  29.576  1.00 80.98  ? 803  DT  D C7    1 
ATOM   2789 C  C6    . DT  B 2 2   ? 33.469  -2.406  28.021  1.00 81.27  ? 803  DT  D C6    1 
ATOM   2790 P  P     . DT  B 2 3   ? 34.536  2.916   24.131  1.00 78.97  ? 804  DT  D P     1 
ATOM   2791 O  OP1   . DT  B 2 3   ? 35.004  4.154   24.797  1.00 78.78  ? 804  DT  D OP1   1 
ATOM   2792 O  OP2   . DT  B 2 3   ? 33.123  2.775   23.701  1.00 78.49  ? 804  DT  D OP2   1 
ATOM   2793 O  "O5'" . DT  B 2 3   ? 35.463  2.619   22.858  1.00 77.76  ? 804  DT  D "O5'" 1 
ATOM   2794 C  "C5'" . DT  B 2 3   ? 34.879  2.335   21.583  1.00 75.67  ? 804  DT  D "C5'" 1 
ATOM   2795 C  "C4'" . DT  B 2 3   ? 35.561  1.134   20.952  1.00 74.05  ? 804  DT  D "C4'" 1 
ATOM   2796 O  "O4'" . DT  B 2 3   ? 35.372  -0.015  21.811  1.00 73.07  ? 804  DT  D "O4'" 1 
ATOM   2797 C  "C3'" . DT  B 2 3   ? 35.025  0.720   19.589  1.00 73.81  ? 804  DT  D "C3'" 1 
ATOM   2798 O  "O3'" . DT  B 2 3   ? 36.087  0.558   18.661  1.00 74.04  ? 804  DT  D "O3'" 1 
ATOM   2799 C  "C2'" . DT  B 2 3   ? 34.336  -0.615  19.855  1.00 73.26  ? 804  DT  D "C2'" 1 
ATOM   2800 C  "C1'" . DT  B 2 3   ? 35.164  -1.150  21.010  1.00 71.77  ? 804  DT  D "C1'" 1 
ATOM   2801 N  N1    . DT  B 2 3   ? 34.491  -2.201  21.833  1.00 70.74  ? 804  DT  D N1    1 
ATOM   2802 C  C2    . DT  B 2 3   ? 34.990  -3.489  21.805  1.00 70.33  ? 804  DT  D C2    1 
ATOM   2803 O  O2    . DT  B 2 3   ? 35.956  -3.819  21.136  1.00 70.17  ? 804  DT  D O2    1 
ATOM   2804 N  N3    . DT  B 2 3   ? 34.312  -4.386  22.596  1.00 69.78  ? 804  DT  D N3    1 
ATOM   2805 C  C4    . DT  B 2 3   ? 33.209  -4.128  23.390  1.00 69.74  ? 804  DT  D C4    1 
ATOM   2806 O  O4    . DT  B 2 3   ? 32.668  -4.999  24.061  1.00 69.33  ? 804  DT  D O4    1 
ATOM   2807 C  C5    . DT  B 2 3   ? 32.737  -2.766  23.375  1.00 69.94  ? 804  DT  D C5    1 
ATOM   2808 C  C7    . DT  B 2 3   ? 31.545  -2.389  24.206  1.00 69.87  ? 804  DT  D C7    1 
ATOM   2809 C  C6    . DT  B 2 3   ? 33.391  -1.878  22.609  1.00 70.26  ? 804  DT  D C6    1 
ATOM   2810 P  P     . DG  B 2 4   ? 35.874  1.034   17.140  1.00 74.76  ? 805  DG  D P     1 
ATOM   2811 O  OP1   . DG  B 2 4   ? 37.127  1.739   16.768  1.00 74.94  ? 805  DG  D OP1   1 
ATOM   2812 O  OP2   . DG  B 2 4   ? 34.556  1.709   17.032  1.00 73.83  ? 805  DG  D OP2   1 
ATOM   2813 O  "O5'" . DG  B 2 4   ? 35.766  -0.319  16.287  1.00 73.05  ? 805  DG  D "O5'" 1 
ATOM   2814 C  "C5'" . DG  B 2 4   ? 36.494  -1.487  16.679  1.00 70.38  ? 805  DG  D "C5'" 1 
ATOM   2815 C  "C4'" . DG  B 2 4   ? 35.684  -2.727  16.352  1.00 67.70  ? 805  DG  D "C4'" 1 
ATOM   2816 O  "O4'" . DG  B 2 4   ? 35.054  -3.220  17.567  1.00 66.84  ? 805  DG  D "O4'" 1 
ATOM   2817 C  "C3'" . DG  B 2 4   ? 34.548  -2.483  15.357  1.00 65.91  ? 805  DG  D "C3'" 1 
ATOM   2818 O  "O3'" . DG  B 2 4   ? 34.342  -3.635  14.549  1.00 64.37  ? 805  DG  D "O3'" 1 
ATOM   2819 C  "C2'" . DG  B 2 4   ? 33.356  -2.283  16.282  1.00 65.88  ? 805  DG  D "C2'" 1 
ATOM   2820 C  "C1'" . DG  B 2 4   ? 33.691  -3.414  17.243  1.00 66.37  ? 805  DG  D "C1'" 1 
ATOM   2821 N  N9    . DG  B 2 4   ? 32.828  -3.530  18.417  1.00 65.72  ? 805  DG  D N9    1 
ATOM   2822 C  C8    . DG  B 2 4   ? 32.055  -2.562  19.012  1.00 65.52  ? 805  DG  D C8    1 
ATOM   2823 N  N7    . DG  B 2 4   ? 31.385  -3.005  20.040  1.00 65.38  ? 805  DG  D N7    1 
ATOM   2824 C  C5    . DG  B 2 4   ? 31.728  -4.351  20.121  1.00 64.95  ? 805  DG  D C5    1 
ATOM   2825 C  C6    . DG  B 2 4   ? 31.316  -5.357  21.030  1.00 64.58  ? 805  DG  D C6    1 
ATOM   2826 O  O6    . DG  B 2 4   ? 30.533  -5.250  21.985  1.00 64.74  ? 805  DG  D O6    1 
ATOM   2827 N  N1    . DG  B 2 4   ? 31.907  -6.590  20.749  1.00 63.71  ? 805  DG  D N1    1 
ATOM   2828 C  C2    . DG  B 2 4   ? 32.787  -6.825  19.717  1.00 63.70  ? 805  DG  D C2    1 
ATOM   2829 N  N2    . DG  B 2 4   ? 33.259  -8.077  19.597  1.00 62.89  ? 805  DG  D N2    1 
ATOM   2830 N  N3    . DG  B 2 4   ? 33.183  -5.890  18.867  1.00 64.24  ? 805  DG  D N3    1 
ATOM   2831 C  C4    . DG  B 2 4   ? 32.613  -4.687  19.126  1.00 65.02  ? 805  DG  D C4    1 
ATOM   2832 P  P     . DG  B 2 5   ? 34.737  -3.619  12.996  1.00 63.20  ? 806  DG  D P     1 
ATOM   2833 O  OP1   . DG  B 2 5   ? 36.175  -3.248  12.950  1.00 62.52  ? 806  DG  D OP1   1 
ATOM   2834 O  OP2   . DG  B 2 5   ? 33.703  -2.861  12.247  1.00 62.25  ? 806  DG  D OP2   1 
ATOM   2835 O  "O5'" . DG  B 2 5   ? 34.604  -5.143  12.547  1.00 59.64  ? 806  DG  D "O5'" 1 
ATOM   2836 C  "C5'" . DG  B 2 5   ? 35.433  -6.097  13.171  1.00 54.26  ? 806  DG  D "C5'" 1 
ATOM   2837 C  "C4'" . DG  B 2 5   ? 34.574  -7.252  13.634  1.00 49.83  ? 806  DG  D "C4'" 1 
ATOM   2838 O  "O4'" . DG  B 2 5   ? 33.854  -6.902  14.839  1.00 48.33  ? 806  DG  D "O4'" 1 
ATOM   2839 C  "C3'" . DG  B 2 5   ? 33.508  -7.692  12.640  1.00 47.58  ? 806  DG  D "C3'" 1 
ATOM   2840 O  "O3'" . DG  B 2 5   ? 33.493  -9.082  12.691  1.00 45.07  ? 806  DG  D "O3'" 1 
ATOM   2841 C  "C2'" . DG  B 2 5   ? 32.213  -7.151  13.231  1.00 47.08  ? 806  DG  D "C2'" 1 
ATOM   2842 C  "C1'" . DG  B 2 5   ? 32.533  -7.381  14.697  1.00 46.86  ? 806  DG  D "C1'" 1 
ATOM   2843 N  N9    . DG  B 2 5   ? 31.708  -6.615  15.610  1.00 46.34  ? 806  DG  D N9    1 
ATOM   2844 C  C8    . DG  B 2 5   ? 31.505  -5.257  15.573  1.00 46.05  ? 806  DG  D C8    1 
ATOM   2845 N  N7    . DG  B 2 5   ? 30.716  -4.837  16.517  1.00 46.37  ? 806  DG  D N7    1 
ATOM   2846 C  C5    . DG  B 2 5   ? 30.383  -5.986  17.227  1.00 46.06  ? 806  DG  D C5    1 
ATOM   2847 C  C6    . DG  B 2 5   ? 29.557  -6.148  18.367  1.00 45.66  ? 806  DG  D C6    1 
ATOM   2848 O  O6    . DG  B 2 5   ? 28.942  -5.272  18.993  1.00 45.87  ? 806  DG  D O6    1 
ATOM   2849 N  N1    . DG  B 2 5   ? 29.482  -7.484  18.770  1.00 44.42  ? 806  DG  D N1    1 
ATOM   2850 C  C2    . DG  B 2 5   ? 30.124  -8.532  18.156  1.00 43.37  ? 806  DG  D C2    1 
ATOM   2851 N  N2    . DG  B 2 5   ? 29.923  -9.739  18.696  1.00 41.81  ? 806  DG  D N2    1 
ATOM   2852 N  N3    . DG  B 2 5   ? 30.907  -8.394  17.094  1.00 44.31  ? 806  DG  D N3    1 
ATOM   2853 C  C4    . DG  B 2 5   ? 30.989  -7.097  16.684  1.00 45.80  ? 806  DG  D C4    1 
ATOM   2854 P  P     . DA  B 2 6   ? 33.052  -9.937  11.430  1.00 44.00  ? 807  DA  D P     1 
ATOM   2855 O  OP1   . DA  B 2 6   ? 34.255  -10.730 11.065  1.00 42.31  ? 807  DA  D OP1   1 
ATOM   2856 O  OP2   . DA  B 2 6   ? 32.330  -9.086  10.455  1.00 41.87  ? 807  DA  D OP2   1 
ATOM   2857 O  "O5'" . DA  B 2 6   ? 31.944  -10.896 12.055  1.00 43.10  ? 807  DA  D "O5'" 1 
ATOM   2858 C  "C5'" . DA  B 2 6   ? 32.269  -11.696 13.171  1.00 41.56  ? 807  DA  D "C5'" 1 
ATOM   2859 C  "C4'" . DA  B 2 6   ? 30.998  -12.267 13.763  1.00 40.80  ? 807  DA  D "C4'" 1 
ATOM   2860 O  "O4'" . DA  B 2 6   ? 30.384  -11.253 14.581  1.00 39.60  ? 807  DA  D "O4'" 1 
ATOM   2861 C  "C3'" . DA  B 2 6   ? 29.925  -12.688 12.769  1.00 40.81  ? 807  DA  D "C3'" 1 
ATOM   2862 O  "O3'" . DA  B 2 6   ? 29.294  -13.818 13.288  1.00 41.81  ? 807  DA  D "O3'" 1 
ATOM   2863 C  "C2'" . DA  B 2 6   ? 28.958  -11.513 12.786  1.00 40.99  ? 807  DA  D "C2'" 1 
ATOM   2864 C  "C1'" . DA  B 2 6   ? 29.023  -11.166 14.260  1.00 40.01  ? 807  DA  D "C1'" 1 
ATOM   2865 N  N9    . DA  B 2 6   ? 28.666  -9.799  14.575  1.00 40.47  ? 807  DA  D N9    1 
ATOM   2866 C  C8    . DA  B 2 6   ? 29.067  -8.678  13.908  1.00 40.07  ? 807  DA  D C8    1 
ATOM   2867 N  N7    . DA  B 2 6   ? 28.604  -7.572  14.436  1.00 40.87  ? 807  DA  D N7    1 
ATOM   2868 C  C5    . DA  B 2 6   ? 27.852  -8.002  15.516  1.00 41.26  ? 807  DA  D C5    1 
ATOM   2869 C  C6    . DA  B 2 6   ? 27.096  -7.314  16.485  1.00 41.58  ? 807  DA  D C6    1 
ATOM   2870 N  N6    . DA  B 2 6   ? 26.975  -5.984  16.505  1.00 41.95  ? 807  DA  D N6    1 
ATOM   2871 N  N1    . DA  B 2 6   ? 26.476  -8.049  17.434  1.00 41.66  ? 807  DA  D N1    1 
ATOM   2872 C  C2    . DA  B 2 6   ? 26.598  -9.381  17.415  1.00 40.80  ? 807  DA  D C2    1 
ATOM   2873 N  N3    . DA  B 2 6   ? 27.278  -10.136 16.556  1.00 41.28  ? 807  DA  D N3    1 
ATOM   2874 C  C4    . DA  B 2 6   ? 27.883  -9.378  15.622  1.00 41.04  ? 807  DA  D C4    1 
ATOM   2875 P  P     . DT  B 2 7   ? 28.525  -14.840 12.335  1.00 43.39  ? 808  DT  D P     1 
ATOM   2876 O  OP1   . DT  B 2 7   ? 28.942  -16.194 12.771  1.00 44.80  ? 808  DT  D OP1   1 
ATOM   2877 O  OP2   . DT  B 2 7   ? 28.686  -14.420 10.931  1.00 44.53  ? 808  DT  D OP2   1 
ATOM   2878 O  "O5'" . DT  B 2 7   ? 27.001  -14.608 12.732  1.00 43.30  ? 808  DT  D "O5'" 1 
ATOM   2879 C  "C5'" . DT  B 2 7   ? 26.702  -14.643 14.108  1.00 43.90  ? 808  DT  D "C5'" 1 
ATOM   2880 C  "C4'" . DT  B 2 7   ? 25.420  -13.895 14.365  1.00 44.13  ? 808  DT  D "C4'" 1 
ATOM   2881 O  "O4'" . DT  B 2 7   ? 25.683  -12.482 14.457  1.00 43.92  ? 808  DT  D "O4'" 1 
ATOM   2882 C  "C3'" . DT  B 2 7   ? 24.346  -14.061 13.293  1.00 44.05  ? 808  DT  D "C3'" 1 
ATOM   2883 O  "O3'" . DT  B 2 7   ? 23.324  -14.829 13.890  1.00 45.54  ? 808  DT  D "O3'" 1 
ATOM   2884 C  "C2'" . DT  B 2 7   ? 23.916  -12.628 12.991  1.00 44.33  ? 808  DT  D "C2'" 1 
ATOM   2885 C  "C1'" . DT  B 2 7   ? 24.436  -11.889 14.215  1.00 43.82  ? 808  DT  D "C1'" 1 
ATOM   2886 N  N1    . DT  B 2 7   ? 24.651  -10.442 14.027  1.00 43.93  ? 808  DT  D N1    1 
ATOM   2887 C  C2    . DT  B 2 7   ? 24.160  -9.591  14.989  1.00 44.02  ? 808  DT  D C2    1 
ATOM   2888 O  O2    . DT  B 2 7   ? 23.565  -9.974  15.976  1.00 44.66  ? 808  DT  D O2    1 
ATOM   2889 N  N3    . DT  B 2 7   ? 24.397  -8.267  14.755  1.00 43.15  ? 808  DT  D N3    1 
ATOM   2890 C  C4    . DT  B 2 7   ? 25.068  -7.734  13.684  1.00 42.09  ? 808  DT  D C4    1 
ATOM   2891 O  O4    . DT  B 2 7   ? 25.229  -6.530  13.586  1.00 42.71  ? 808  DT  D O4    1 
ATOM   2892 C  C5    . DT  B 2 7   ? 25.560  -8.678  12.712  1.00 42.00  ? 808  DT  D C5    1 
ATOM   2893 C  C7    . DT  B 2 7   ? 26.305  -8.203  11.506  1.00 40.76  ? 808  DT  D C7    1 
ATOM   2894 C  C6    . DT  B 2 7   ? 25.331  -9.977  12.924  1.00 42.70  ? 808  DT  D C6    1 
ATOM   2895 P  P     . DG  B 2 8   ? 21.920  -15.149 13.204  1.00 47.80  ? 809  DG  D P     1 
ATOM   2896 O  OP1   . DG  B 2 8   ? 21.457  -16.482 13.638  1.00 49.08  ? 809  DG  D OP1   1 
ATOM   2897 O  OP2   . DG  B 2 8   ? 21.996  -14.865 11.754  1.00 48.04  ? 809  DG  D OP2   1 
ATOM   2898 O  "O5'" . DG  B 2 8   ? 20.993  -14.081 13.946  1.00 47.40  ? 809  DG  D "O5'" 1 
ATOM   2899 C  "C5'" . DG  B 2 8   ? 21.200  -13.817 15.325  1.00 46.85  ? 809  DG  D "C5'" 1 
ATOM   2900 C  "C4'" . DG  B 2 8   ? 20.161  -12.825 15.797  1.00 47.62  ? 809  DG  D "C4'" 1 
ATOM   2901 O  "O4'" . DG  B 2 8   ? 20.635  -11.463 15.620  1.00 47.50  ? 809  DG  D "O4'" 1 
ATOM   2902 C  "C3'" . DG  B 2 8   ? 18.842  -12.889 15.027  1.00 48.77  ? 809  DG  D "C3'" 1 
ATOM   2903 O  "O3'" . DG  B 2 8   ? 17.828  -12.623 15.976  1.00 50.47  ? 809  DG  D "O3'" 1 
ATOM   2904 C  "C2'" . DG  B 2 8   ? 18.965  -11.791 13.972  1.00 45.89  ? 809  DG  D "C2'" 1 
ATOM   2905 C  "C1'" . DG  B 2 8   ? 19.752  -10.758 14.766  1.00 44.90  ? 809  DG  D "C1'" 1 
ATOM   2906 N  N9    . DG  B 2 8   ? 20.510  -9.824  13.941  1.00 43.41  ? 809  DG  D N9    1 
ATOM   2907 C  C8    . DG  B 2 8   ? 21.224  -10.075 12.788  1.00 42.77  ? 809  DG  D C8    1 
ATOM   2908 N  N7    . DG  B 2 8   ? 21.769  -9.005  12.274  1.00 40.91  ? 809  DG  D N7    1 
ATOM   2909 C  C5    . DG  B 2 8   ? 21.402  -7.990  13.146  1.00 40.94  ? 809  DG  D C5    1 
ATOM   2910 C  C6    . DG  B 2 8   ? 21.695  -6.614  13.120  1.00 40.92  ? 809  DG  D C6    1 
ATOM   2911 O  O6    . DG  B 2 8   ? 22.371  -5.990  12.296  1.00 41.33  ? 809  DG  D O6    1 
ATOM   2912 N  N1    . DG  B 2 8   ? 21.113  -5.946  14.198  1.00 41.80  ? 809  DG  D N1    1 
ATOM   2913 C  C2    . DG  B 2 8   ? 20.338  -6.529  15.172  1.00 40.88  ? 809  DG  D C2    1 
ATOM   2914 N  N2    . DG  B 2 8   ? 19.853  -5.726  16.127  1.00 40.05  ? 809  DG  D N2    1 
ATOM   2915 N  N3    . DG  B 2 8   ? 20.056  -7.816  15.201  1.00 40.69  ? 809  DG  D N3    1 
ATOM   2916 C  C4    . DG  B 2 8   ? 20.622  -8.477  14.169  1.00 41.58  ? 809  DG  D C4    1 
ATOM   2917 P  P     . DG  B 2 9   ? 16.278  -12.690 15.628  1.00 51.49  ? 810  DG  D P     1 
ATOM   2918 O  OP1   . DG  B 2 9   ? 15.670  -13.542 16.679  1.00 52.80  ? 810  DG  D OP1   1 
ATOM   2919 O  OP2   . DG  B 2 9   ? 16.032  -13.000 14.202  1.00 51.76  ? 810  DG  D OP2   1 
ATOM   2920 O  "O5'" . DG  B 2 9   ? 15.916  -11.163 15.905  1.00 51.88  ? 810  DG  D "O5'" 1 
ATOM   2921 C  "C5'" . DG  B 2 9   ? 16.446  -10.585 17.112  1.00 51.12  ? 810  DG  D "C5'" 1 
ATOM   2922 C  "C4'" . DG  B 2 9   ? 15.845  -9.219  17.391  1.00 50.68  ? 810  DG  D "C4'" 1 
ATOM   2923 O  "O4'" . DG  B 2 9   ? 16.589  -8.198  16.673  1.00 50.50  ? 810  DG  D "O4'" 1 
ATOM   2924 C  "C3'" . DG  B 2 9   ? 14.411  -9.036  16.930  1.00 49.99  ? 810  DG  D "C3'" 1 
ATOM   2925 O  "O3'" . DG  B 2 9   ? 13.853  -8.017  17.735  1.00 50.59  ? 810  DG  D "O3'" 1 
ATOM   2926 C  "C2'" . DG  B 2 9   ? 14.608  -8.575  15.486  1.00 48.99  ? 810  DG  D "C2'" 1 
ATOM   2927 C  "C1'" . DG  B 2 9   ? 15.787  -7.626  15.656  1.00 47.63  ? 810  DG  D "C1'" 1 
ATOM   2928 N  N9    . DG  B 2 9   ? 16.613  -7.444  14.460  1.00 45.84  ? 810  DG  D N9    1 
ATOM   2929 C  C8    . DG  B 2 9   ? 17.042  -8.417  13.593  1.00 44.82  ? 810  DG  D C8    1 
ATOM   2930 N  N7    . DG  B 2 9   ? 17.765  -7.960  12.609  1.00 44.70  ? 810  DG  D N7    1 
ATOM   2931 C  C5    . DG  B 2 9   ? 17.818  -6.592  12.840  1.00 44.53  ? 810  DG  D C5    1 
ATOM   2932 C  C6    . DG  B 2 9   ? 18.468  -5.573  12.106  1.00 44.23  ? 810  DG  D C6    1 
ATOM   2933 O  O6    . DG  B 2 9   ? 19.145  -5.696  11.082  1.00 44.90  ? 810  DG  D O6    1 
ATOM   2934 N  N1    . DG  B 2 9   ? 18.281  -4.317  12.671  1.00 43.86  ? 810  DG  D N1    1 
ATOM   2935 C  C2    . DG  B 2 9   ? 17.560  -4.088  13.814  1.00 44.24  ? 810  DG  D C2    1 
ATOM   2936 N  N2    . DG  B 2 9   ? 17.498  -2.816  14.218  1.00 44.08  ? 810  DG  D N2    1 
ATOM   2937 N  N3    . DG  B 2 9   ? 16.949  -5.032  14.519  1.00 44.03  ? 810  DG  D N3    1 
ATOM   2938 C  C4    . DG  B 2 9   ? 17.119  -6.258  13.975  1.00 44.49  ? 810  DG  D C4    1 
ATOM   2939 P  P     . DT  B 2 10  ? 12.284  -7.714  17.740  1.00 50.89  ? 811  DT  D P     1 
ATOM   2940 O  OP1   . DT  B 2 10  ? 11.919  -7.578  19.169  1.00 50.48  ? 811  DT  D OP1   1 
ATOM   2941 O  OP2   . DT  B 2 10  ? 11.593  -8.688  16.867  1.00 50.84  ? 811  DT  D OP2   1 
ATOM   2942 O  "O5'" . DT  B 2 10  ? 12.156  -6.302  17.007  1.00 48.75  ? 811  DT  D "O5'" 1 
ATOM   2943 C  "C5'" . DT  B 2 10  ? 13.059  -5.252  17.278  1.00 46.82  ? 811  DT  D "C5'" 1 
ATOM   2944 C  "C4'" . DT  B 2 10  ? 12.834  -4.156  16.257  1.00 45.65  ? 811  DT  D "C4'" 1 
ATOM   2945 O  "O4'" . DT  B 2 10  ? 13.724  -4.339  15.128  1.00 44.74  ? 811  DT  D "O4'" 1 
ATOM   2946 C  "C3'" . DT  B 2 10  ? 11.432  -4.135  15.674  1.00 44.74  ? 811  DT  D "C3'" 1 
ATOM   2947 O  "O3'" . DT  B 2 10  ? 10.865  -2.907  16.077  1.00 44.71  ? 811  DT  D "O3'" 1 
ATOM   2948 C  "C2'" . DT  B 2 10  ? 11.614  -4.266  14.154  1.00 44.13  ? 811  DT  D "C2'" 1 
ATOM   2949 C  "C1'" . DT  B 2 10  ? 13.074  -3.878  13.975  1.00 44.41  ? 811  DT  D "C1'" 1 
ATOM   2950 N  N1    . DT  B 2 10  ? 13.840  -4.487  12.850  1.00 44.16  ? 811  DT  D N1    1 
ATOM   2951 C  C2    . DT  B 2 10  ? 14.689  -3.673  12.138  1.00 43.27  ? 811  DT  D C2    1 
ATOM   2952 O  O2    . DT  B 2 10  ? 14.816  -2.488  12.359  1.00 42.59  ? 811  DT  D O2    1 
ATOM   2953 N  N3    . DT  B 2 10  ? 15.374  -4.291  11.136  1.00 44.50  ? 811  DT  D N3    1 
ATOM   2954 C  C4    . DT  B 2 10  ? 15.299  -5.622  10.785  1.00 45.33  ? 811  DT  D C4    1 
ATOM   2955 O  O4    . DT  B 2 10  ? 15.965  -6.087  9.867   1.00 45.91  ? 811  DT  D O4    1 
ATOM   2956 C  C5    . DT  B 2 10  ? 14.400  -6.423  11.585  1.00 45.39  ? 811  DT  D C5    1 
ATOM   2957 C  C7    . DT  B 2 10  ? 14.239  -7.889  11.306  1.00 44.98  ? 811  DT  D C7    1 
ATOM   2958 C  C6    . DT  B 2 10  ? 13.722  -5.825  12.573  1.00 44.29  ? 811  DT  D C6    1 
ATOM   2959 P  P     . DA  B 2 11  ? 9.455   -2.417  15.521  1.00 43.30  ? 812  DA  D P     1 
ATOM   2960 O  OP1   . DA  B 2 11  ? 8.927   -1.493  16.538  1.00 44.71  ? 812  DA  D OP1   1 
ATOM   2961 O  OP2   . DA  B 2 11  ? 8.660   -3.551  15.021  1.00 43.29  ? 812  DA  D OP2   1 
ATOM   2962 O  "O5'" . DA  B 2 11  ? 9.886   -1.575  14.246  1.00 43.55  ? 812  DA  D "O5'" 1 
ATOM   2963 C  "C5'" . DA  B 2 11  ? 10.814  -0.536  14.424  1.00 42.40  ? 812  DA  D "C5'" 1 
ATOM   2964 C  "C4'" . DA  B 2 11  ? 10.999  0.143   13.092  1.00 41.60  ? 812  DA  D "C4'" 1 
ATOM   2965 O  "O4'" . DA  B 2 11  ? 11.928  -0.646  12.310  1.00 41.79  ? 812  DA  D "O4'" 1 
ATOM   2966 C  "C3'" . DA  B 2 11  ? 9.717   0.237   12.278  1.00 40.65  ? 812  DA  D "C3'" 1 
ATOM   2967 O  "O3'" . DA  B 2 11  ? 9.483   1.572   11.880  1.00 41.14  ? 812  DA  D "O3'" 1 
ATOM   2968 C  "C2'" . DA  B 2 11  ? 9.971   -0.666  11.072  1.00 40.67  ? 812  DA  D "C2'" 1 
ATOM   2969 C  "C1'" . DA  B 2 11  ? 11.479  -0.666  10.973  1.00 39.00  ? 812  DA  D "C1'" 1 
ATOM   2970 N  N9    . DA  B 2 11  ? 11.973  -1.869  10.326  1.00 39.07  ? 812  DA  D N9    1 
ATOM   2971 C  C8    . DA  B 2 11  ? 11.586  -3.150  10.594  1.00 38.85  ? 812  DA  D C8    1 
ATOM   2972 N  N7    . DA  B 2 11  ? 12.187  -4.049  9.866   1.00 38.58  ? 812  DA  D N7    1 
ATOM   2973 C  C5    . DA  B 2 11  ? 13.034  -3.296  9.065   1.00 37.75  ? 812  DA  D C5    1 
ATOM   2974 C  C6    . DA  B 2 11  ? 13.952  -3.663  8.074   1.00 37.40  ? 812  DA  D C6    1 
ATOM   2975 N  N6    . DA  B 2 11  ? 14.132  -4.936  7.740   1.00 36.77  ? 812  DA  D N6    1 
ATOM   2976 N  N1    . DA  B 2 11  ? 14.646  -2.682  7.452   1.00 37.09  ? 812  DA  D N1    1 
ATOM   2977 C  C2    . DA  B 2 11  ? 14.445  -1.412  7.819   1.00 35.80  ? 812  DA  D C2    1 
ATOM   2978 N  N3    . DA  B 2 11  ? 13.614  -0.944  8.744   1.00 37.44  ? 812  DA  D N3    1 
ATOM   2979 C  C4    . DA  B 2 11  ? 12.930  -1.950  9.333   1.00 38.45  ? 812  DA  D C4    1 
ATOM   2980 P  P     . DG  B 2 12  ? 8.095   1.893   11.146  1.00 42.34  ? 813  DG  D P     1 
ATOM   2981 O  OP1   . DG  B 2 12  ? 7.569   3.179   11.633  1.00 39.58  ? 813  DG  D OP1   1 
ATOM   2982 O  OP2   . DG  B 2 12  ? 7.284   0.660   11.225  1.00 44.41  ? 813  DG  D OP2   1 
ATOM   2983 O  "O5'" . DG  B 2 12  ? 8.525   2.087   9.631   1.00 43.19  ? 813  DG  D "O5'" 1 
ATOM   2984 C  "C5'" . DG  B 2 12  ? 9.601   2.941   9.360   1.00 44.58  ? 813  DG  D "C5'" 1 
ATOM   2985 C  "C4'" . DG  B 2 12  ? 10.026  2.609   7.965   1.00 46.93  ? 813  DG  D "C4'" 1 
ATOM   2986 O  "O4'" . DG  B 2 12  ? 10.772  1.389   8.046   1.00 47.72  ? 813  DG  D "O4'" 1 
ATOM   2987 C  "C3'" . DG  B 2 12  ? 8.865   2.268   7.053   1.00 49.71  ? 813  DG  D "C3'" 1 
ATOM   2988 O  "O3'" . DG  B 2 12  ? 8.341   3.537   6.611   1.00 55.53  ? 813  DG  D "O3'" 1 
ATOM   2989 C  "C2'" . DG  B 2 12  ? 9.557   1.399   6.024   1.00 49.16  ? 813  DG  D "C2'" 1 
ATOM   2990 C  "C1'" . DG  B 2 12  ? 10.804  0.872   6.750   1.00 46.82  ? 813  DG  D "C1'" 1 
ATOM   2991 N  N9    . DG  B 2 12  ? 10.793  -0.582  6.725   1.00 43.90  ? 813  DG  D N9    1 
ATOM   2992 C  C8    . DG  B 2 12  ? 10.035  -1.498  7.421   1.00 43.47  ? 813  DG  D C8    1 
ATOM   2993 N  N7    . DG  B 2 12  ? 10.294  -2.737  7.066   1.00 42.97  ? 813  DG  D N7    1 
ATOM   2994 C  C5    . DG  B 2 12  ? 11.249  -2.609  6.061   1.00 41.16  ? 813  DG  D C5    1 
ATOM   2995 C  C6    . DG  B 2 12  ? 11.921  -3.567  5.285   1.00 41.98  ? 813  DG  D C6    1 
ATOM   2996 O  O6    . DG  B 2 12  ? 11.805  -4.796  5.313   1.00 45.48  ? 813  DG  D O6    1 
ATOM   2997 N  N1    . DG  B 2 12  ? 12.818  -2.984  4.393   1.00 41.25  ? 813  DG  D N1    1 
ATOM   2998 C  C2    . DG  B 2 12  ? 13.054  -1.643  4.271   1.00 40.23  ? 813  DG  D C2    1 
ATOM   2999 N  N2    . DG  B 2 12  ? 13.950  -1.255  3.366   1.00 41.40  ? 813  DG  D N2    1 
ATOM   3000 N  N3    . DG  B 2 12  ? 12.446  -0.730  5.002   1.00 42.34  ? 813  DG  D N3    1 
ATOM   3001 C  C4    . DG  B 2 12  ? 11.564  -1.294  5.858   1.00 42.51  ? 813  DG  D C4    1 
HETATM 3002 P  P     A 2DA B 2 13  ? 7.766   3.750   5.156   0.80 54.29  ? 814  2DA D P     1 
HETATM 3003 P  P     B 2DA B 2 13  ? 8.207   4.184   5.115   0.20 54.73  ? 814  2DA D P     1 
HETATM 3004 O  OP1   A 2DA B 2 13  ? 7.580   5.205   4.981   0.80 57.24  ? 814  2DA D OP1   1 
HETATM 3005 O  OP1   B 2DA B 2 13  ? 9.069   5.396   5.280   0.20 55.19  ? 814  2DA D OP1   1 
HETATM 3006 O  OP2   A 2DA B 2 13  ? 6.572   2.862   5.180   0.80 55.19  ? 814  2DA D OP2   1 
HETATM 3007 O  OP2   B 2DA B 2 13  ? 6.833   4.412   4.564   0.20 56.70  ? 814  2DA D OP2   1 
HETATM 3008 O  "O5'" A 2DA B 2 13  ? 8.816   3.224   4.042   0.80 57.03  ? 814  2DA D "O5'" 1 
HETATM 3009 O  "O5'" B 2DA B 2 13  ? 9.030   3.216   4.146   0.20 55.14  ? 814  2DA D "O5'" 1 
HETATM 3010 C  "C5'" A 2DA B 2 13  ? 10.045  3.947   3.761   0.80 57.76  ? 814  2DA D "C5'" 1 
HETATM 3011 C  "C5'" B 2DA B 2 13  ? 10.403  3.577   4.002   0.20 54.45  ? 814  2DA D "C5'" 1 
HETATM 3012 C  "C4'" A 2DA B 2 13  ? 10.627  3.501   2.424   0.80 58.09  ? 814  2DA D "C4'" 1 
HETATM 3013 C  "C4'" B 2DA B 2 13  ? 10.891  3.446   2.574   0.20 53.85  ? 814  2DA D "C4'" 1 
HETATM 3014 O  "O4'" A 2DA B 2 13  ? 11.455  2.314   2.559   0.80 59.99  ? 814  2DA D "O4'" 1 
HETATM 3015 O  "O4'" B 2DA B 2 13  ? 11.753  2.284   2.483   0.20 53.69  ? 814  2DA D "O4'" 1 
HETATM 3016 C  "C3'" A 2DA B 2 13  ? 9.624   3.135   1.344   0.80 57.49  ? 814  2DA D "C3'" 1 
HETATM 3017 C  "C3'" B 2DA B 2 13  ? 9.799   3.274   1.516   0.20 53.37  ? 814  2DA D "C3'" 1 
HETATM 3018 C  "C2'" A 2DA B 2 13  ? 10.460  2.290   0.387   0.80 58.08  ? 814  2DA D "C2'" 1 
HETATM 3019 C  "C2'" B 2DA B 2 13  ? 10.391  2.266   0.536   0.20 53.00  ? 814  2DA D "C2'" 1 
HETATM 3020 C  "C1'" A 2DA B 2 13  ? 11.460  1.604   1.323   0.80 60.04  ? 814  2DA D "C1'" 1 
HETATM 3021 C  "C1'" B 2DA B 2 13  ? 11.338  1.453   1.416   0.20 52.99  ? 814  2DA D "C1'" 1 
HETATM 3022 N  N9    A 2DA B 2 13  ? 11.152  0.183   1.518   0.80 60.46  ? 814  2DA D N9    1 
HETATM 3023 N  N9    B 2DA B 2 13  ? 10.758  0.229   1.967   0.20 51.89  ? 814  2DA D N9    1 
HETATM 3024 C  C8    A 2DA B 2 13  ? 11.715  -0.864  0.834   0.80 61.32  ? 814  2DA D C8    1 
HETATM 3025 C  C8    B 2DA B 2 13  ? 9.982   0.096   3.084   0.20 51.24  ? 814  2DA D C8    1 
HETATM 3026 N  N7    A 2DA B 2 13  ? 11.253  -2.045  1.185   0.80 61.48  ? 814  2DA D N7    1 
HETATM 3027 N  N7    B 2DA B 2 13  ? 9.614   -1.136  3.333   0.20 50.74  ? 814  2DA D N7    1 
HETATM 3028 C  C5    A 2DA B 2 13  ? 10.314  -1.747  2.160   0.80 60.70  ? 814  2DA D C5    1 
HETATM 3029 C  C5    B 2DA B 2 13  ? 10.189  -1.860  2.306   0.20 50.83  ? 814  2DA D C5    1 
HETATM 3030 C  C6    A 2DA B 2 13  ? 9.477   -2.580  2.917   0.80 61.31  ? 814  2DA D C6    1 
HETATM 3031 C  C6    B 2DA B 2 13  ? 10.179  -3.232  1.996   0.20 50.18  ? 814  2DA D C6    1 
HETATM 3032 N  N6    A 2DA B 2 13  ? 9.496   -3.913  2.775   0.80 60.05  ? 814  2DA D N6    1 
HETATM 3033 N  N6    B 2DA B 2 13  ? 9.533   -4.145  2.729   0.20 49.90  ? 814  2DA D N6    1 
HETATM 3034 N  N1    A 2DA B 2 13  ? 8.637   -2.000  3.805   0.80 61.77  ? 814  2DA D N1    1 
HETATM 3035 N  N1    B 2DA B 2 13  ? 10.852  -3.632  0.900   0.20 49.99  ? 814  2DA D N1    1 
HETATM 3036 C  C2    A 2DA B 2 13  ? 8.677   -0.664  3.895   0.80 63.09  ? 814  2DA D C2    1 
HETATM 3037 C  C2    B 2DA B 2 13  ? 11.497  -2.717  0.164   0.20 50.06  ? 814  2DA D C2    1 
HETATM 3038 N  N3    A 2DA B 2 13  ? 9.429   0.225   3.235   0.80 61.38  ? 814  2DA D N3    1 
HETATM 3039 N  N3    B 2DA B 2 13  ? 11.582  -1.402  0.353   0.20 50.69  ? 814  2DA D N3    1 
HETATM 3040 C  C4    A 2DA B 2 13  ? 10.234  -0.388  2.373   0.80 60.01  ? 814  2DA D C4    1 
HETATM 3041 C  C4    B 2DA B 2 13  ? 10.900  -1.037  1.454   0.20 51.33  ? 814  2DA D C4    1 
ATOM   3042 O  "O5'" . DC  C 3 1   ? 9.417   -26.984 -4.169  1.00 76.79  ? 901  DC  E "O5'" 1 
ATOM   3043 C  "C5'" . DC  C 3 1   ? 9.200   -25.749 -4.844  1.00 75.35  ? 901  DC  E "C5'" 1 
ATOM   3044 C  "C4'" . DC  C 3 1   ? 7.717   -25.436 -4.914  1.00 74.87  ? 901  DC  E "C4'" 1 
ATOM   3045 O  "O4'" . DC  C 3 1   ? 7.034   -26.274 -5.871  1.00 74.85  ? 901  DC  E "O4'" 1 
ATOM   3046 C  "C3'" . DC  C 3 1   ? 6.935   -25.688 -3.637  1.00 74.72  ? 901  DC  E "C3'" 1 
ATOM   3047 O  "O3'" . DC  C 3 1   ? 7.026   -24.516 -2.852  1.00 73.97  ? 901  DC  E "O3'" 1 
ATOM   3048 C  "C2'" . DC  C 3 1   ? 5.510   -25.968 -4.132  1.00 74.45  ? 901  DC  E "C2'" 1 
ATOM   3049 C  "C1'" . DC  C 3 1   ? 5.662   -26.034 -5.650  1.00 74.74  ? 901  DC  E "C1'" 1 
ATOM   3050 N  N1    . DC  C 3 1   ? 4.835   -27.099 -6.313  1.00 74.82  ? 901  DC  E N1    1 
ATOM   3051 C  C2    . DC  C 3 1   ? 3.545   -26.782 -6.763  1.00 74.31  ? 901  DC  E C2    1 
ATOM   3052 O  O2    . DC  C 3 1   ? 3.074   -25.650 -6.604  1.00 74.45  ? 901  DC  E O2    1 
ATOM   3053 N  N3    . DC  C 3 1   ? 2.819   -27.739 -7.373  1.00 75.17  ? 901  DC  E N3    1 
ATOM   3054 C  C4    . DC  C 3 1   ? 3.309   -28.968 -7.535  1.00 75.90  ? 901  DC  E C4    1 
ATOM   3055 N  N4    . DC  C 3 1   ? 2.504   -29.861 -8.132  1.00 76.80  ? 901  DC  E N4    1 
ATOM   3056 C  C5    . DC  C 3 1   ? 4.622   -29.320 -7.085  1.00 74.98  ? 901  DC  E C5    1 
ATOM   3057 C  C6    . DC  C 3 1   ? 5.342   -28.359 -6.488  1.00 74.78  ? 901  DC  E C6    1 
ATOM   3058 P  P     . DT  C 3 2   ? 6.404   -24.416 -1.380  1.00 74.58  ? 902  DT  E P     1 
ATOM   3059 O  OP1   . DT  C 3 2   ? 6.921   -23.121 -0.865  1.00 74.85  ? 902  DT  E OP1   1 
ATOM   3060 O  OP2   . DT  C 3 2   ? 6.615   -25.683 -0.644  1.00 74.21  ? 902  DT  E OP2   1 
ATOM   3061 O  "O5'" . DT  C 3 2   ? 4.824   -24.333 -1.608  1.00 71.81  ? 902  DT  E "O5'" 1 
ATOM   3062 C  "C5'" . DT  C 3 2   ? 4.153   -23.094 -1.624  1.00 69.72  ? 902  DT  E "C5'" 1 
ATOM   3063 C  "C4'" . DT  C 3 2   ? 2.689   -23.430 -1.683  1.00 68.46  ? 902  DT  E "C4'" 1 
ATOM   3064 O  "O4'" . DT  C 3 2   ? 2.531   -24.387 -2.749  1.00 67.91  ? 902  DT  E "O4'" 1 
ATOM   3065 C  "C3'" . DT  C 3 2   ? 2.239   -24.159 -0.429  1.00 67.05  ? 902  DT  E "C3'" 1 
ATOM   3066 O  "O3'" . DT  C 3 2   ? 1.712   -23.270 0.591   1.00 65.04  ? 902  DT  E "O3'" 1 
ATOM   3067 C  "C2'" . DT  C 3 2   ? 1.269   -25.230 -0.937  1.00 66.89  ? 902  DT  E "C2'" 1 
ATOM   3068 C  "C1'" . DT  C 3 2   ? 1.408   -25.190 -2.457  1.00 66.50  ? 902  DT  E "C1'" 1 
ATOM   3069 N  N1    . DT  C 3 2   ? 1.592   -26.504 -3.142  1.00 65.03  ? 902  DT  E N1    1 
ATOM   3070 C  C2    . DT  C 3 2   ? 0.685   -26.878 -4.112  1.00 64.56  ? 902  DT  E C2    1 
ATOM   3071 O  O2    . DT  C 3 2   ? -0.266  -26.207 -4.441  1.00 65.59  ? 902  DT  E O2    1 
ATOM   3072 N  N3    . DT  C 3 2   ? 0.932   -28.077 -4.712  1.00 64.34  ? 902  DT  E N3    1 
ATOM   3073 C  C4    . DT  C 3 2   ? 1.975   -28.929 -4.435  1.00 64.50  ? 902  DT  E C4    1 
ATOM   3074 O  O4    . DT  C 3 2   ? 2.095   -29.987 -5.035  1.00 65.77  ? 902  DT  E O4    1 
ATOM   3075 C  C5    . DT  C 3 2   ? 2.902   -28.490 -3.414  1.00 64.42  ? 902  DT  E C5    1 
ATOM   3076 C  C7    . DT  C 3 2   ? 4.077   -29.349 -3.042  1.00 64.24  ? 902  DT  E C7    1 
ATOM   3077 C  C6    . DT  C 3 2   ? 2.669   -27.309 -2.823  1.00 64.91  ? 902  DT  E C6    1 
ATOM   3078 P  P     . DA  C 3 3   ? 0.622   -22.135 0.323   1.00 63.73  ? 903  DA  E P     1 
ATOM   3079 O  OP1   . DA  C 3 3   ? -0.070  -21.812 1.580   1.00 63.35  ? 903  DA  E OP1   1 
ATOM   3080 O  OP2   . DA  C 3 3   ? -0.182  -22.495 -0.849  1.00 65.53  ? 903  DA  E OP2   1 
ATOM   3081 O  "O5'" . DA  C 3 3   ? 1.520   -20.898 -0.129  1.00 65.24  ? 903  DA  E "O5'" 1 
ATOM   3082 C  "C5'" . DA  C 3 3   ? 0.885   -19.816 -0.802  1.00 63.88  ? 903  DA  E "C5'" 1 
ATOM   3083 C  "C4'" . DA  C 3 3   ? 1.723   -18.566 -0.669  1.00 62.65  ? 903  DA  E "C4'" 1 
ATOM   3084 O  "O4'" . DA  C 3 3   ? 1.377   -17.863 0.548   1.00 61.69  ? 903  DA  E "O4'" 1 
ATOM   3085 C  "C3'" . DA  C 3 3   ? 3.209   -18.847 -0.611  1.00 61.19  ? 903  DA  E "C3'" 1 
ATOM   3086 O  "O3'" . DA  C 3 3   ? 3.834   -17.877 -1.389  1.00 61.15  ? 903  DA  E "O3'" 1 
ATOM   3087 C  "C2'" . DA  C 3 3   ? 3.575   -18.697 0.859   1.00 61.66  ? 903  DA  E "C2'" 1 
ATOM   3088 C  "C1'" . DA  C 3 3   ? 2.495   -17.771 1.399   1.00 61.35  ? 903  DA  E "C1'" 1 
ATOM   3089 N  N9    . DA  C 3 3   ? 1.998   -18.168 2.700   1.00 60.72  ? 903  DA  E N9    1 
ATOM   3090 C  C8    . DA  C 3 3   ? 1.847   -19.433 3.176   1.00 60.13  ? 903  DA  E C8    1 
ATOM   3091 N  N7    . DA  C 3 3   ? 1.371   -19.479 4.393   1.00 60.81  ? 903  DA  E N7    1 
ATOM   3092 C  C5    . DA  C 3 3   ? 1.190   -18.150 4.733   1.00 61.88  ? 903  DA  E C5    1 
ATOM   3093 C  C6    . DA  C 3 3   ? 0.701   -17.516 5.899   1.00 62.18  ? 903  DA  E C6    1 
ATOM   3094 N  N6    . DA  C 3 3   ? 0.282   -18.173 6.992   1.00 61.00  ? 903  DA  E N6    1 
ATOM   3095 N  N1    . DA  C 3 3   ? 0.670   -16.163 5.889   1.00 62.97  ? 903  DA  E N1    1 
ATOM   3096 C  C2    . DA  C 3 3   ? 1.086   -15.492 4.803   1.00 62.18  ? 903  DA  E C2    1 
ATOM   3097 N  N3    . DA  C 3 3   ? 1.557   -15.978 3.657   1.00 61.38  ? 903  DA  E N3    1 
ATOM   3098 C  C4    . DA  C 3 3   ? 1.581   -17.324 3.693   1.00 61.62  ? 903  DA  E C4    1 
ATOM   3099 P  P     . DA  C 3 4   ? 5.412   -17.687 -1.330  1.00 59.21  ? 904  DA  E P     1 
ATOM   3100 O  OP1   . DA  C 3 4   ? 5.786   -17.024 -2.594  1.00 60.29  ? 904  DA  E OP1   1 
ATOM   3101 O  OP2   . DA  C 3 4   ? 6.029   -18.975 -0.962  1.00 59.88  ? 904  DA  E OP2   1 
ATOM   3102 O  "O5'" . DA  C 3 4   ? 5.635   -16.685 -0.114  1.00 59.11  ? 904  DA  E "O5'" 1 
ATOM   3103 C  "C5'" . DA  C 3 4   ? 5.244   -15.324 -0.236  1.00 59.59  ? 904  DA  E "C5'" 1 
ATOM   3104 C  "C4'" . DA  C 3 4   ? 5.556   -14.617 1.061   1.00 59.78  ? 904  DA  E "C4'" 1 
ATOM   3105 O  "O4'" . DA  C 3 4   ? 4.735   -15.134 2.120   1.00 60.31  ? 904  DA  E "O4'" 1 
ATOM   3106 C  "C3'" . DA  C 3 4   ? 6.945   -14.904 1.559   1.00 60.19  ? 904  DA  E "C3'" 1 
ATOM   3107 O  "O3'" . DA  C 3 4   ? 7.784   -14.030 0.865   1.00 61.27  ? 904  DA  E "O3'" 1 
ATOM   3108 C  "C2'" . DA  C 3 4   ? 6.839   -14.568 3.036   1.00 60.55  ? 904  DA  E "C2'" 1 
ATOM   3109 C  "C1'" . DA  C 3 4   ? 5.407   -14.988 3.352   1.00 61.72  ? 904  DA  E "C1'" 1 
ATOM   3110 N  N9    . DA  C 3 4   ? 5.264   -16.249 4.072   1.00 63.94  ? 904  DA  E N9    1 
ATOM   3111 C  C8    . DA  C 3 4   ? 5.710   -17.489 3.691   1.00 64.24  ? 904  DA  E C8    1 
ATOM   3112 N  N7    . DA  C 3 4   ? 5.432   -18.439 4.552   1.00 65.35  ? 904  DA  E N7    1 
ATOM   3113 C  C5    . DA  C 3 4   ? 4.749   -17.781 5.563   1.00 66.47  ? 904  DA  E C5    1 
ATOM   3114 C  C6    . DA  C 3 4   ? 4.173   -18.228 6.771   1.00 68.37  ? 904  DA  E C6    1 
ATOM   3115 N  N6    . DA  C 3 4   ? 4.202   -19.508 7.164   1.00 70.05  ? 904  DA  E N6    1 
ATOM   3116 N  N1    . DA  C 3 4   ? 3.554   -17.311 7.559   1.00 69.23  ? 904  DA  E N1    1 
ATOM   3117 C  C2    . DA  C 3 4   ? 3.533   -16.031 7.148   1.00 68.88  ? 904  DA  E C2    1 
ATOM   3118 N  N3    . DA  C 3 4   ? 4.048   -15.493 6.036   1.00 66.96  ? 904  DA  E N3    1 
ATOM   3119 C  C4    . DA  C 3 4   ? 4.639   -16.430 5.282   1.00 65.56  ? 904  DA  E C4    1 
ATOM   3120 P  P     . DC  C 3 5   ? 9.363   -14.225 0.910   1.00 60.34  ? 905  DC  E P     1 
ATOM   3121 O  OP1   . DC  C 3 5   ? 9.662   -15.674 1.021   1.00 62.77  ? 905  DC  E OP1   1 
ATOM   3122 O  OP2   . DC  C 3 5   ? 9.920   -13.299 1.920   1.00 61.12  ? 905  DC  E OP2   1 
ATOM   3123 O  "O5'" . DC  C 3 5   ? 9.743   -13.721 -0.553  1.00 59.50  ? 905  DC  E "O5'" 1 
ATOM   3124 C  "C5'" . DC  C 3 5   ? 8.785   -13.667 -1.575  1.00 58.52  ? 905  DC  E "C5'" 1 
ATOM   3125 C  "C4'" . DC  C 3 5   ? 9.387   -12.936 -2.754  1.00 57.77  ? 905  DC  E "C4'" 1 
ATOM   3126 O  "O4'" . DC  C 3 5   ? 8.789   -11.618 -2.879  1.00 59.01  ? 905  DC  E "O4'" 1 
ATOM   3127 C  "C3'" . DC  C 3 5   ? 10.885  -12.674 -2.608  1.00 56.81  ? 905  DC  E "C3'" 1 
ATOM   3128 O  "O3'" . DC  C 3 5   ? 11.458  -12.472 -3.873  1.00 54.26  ? 905  DC  E "O3'" 1 
ATOM   3129 C  "C2'" . DC  C 3 5   ? 10.933  -11.372 -1.815  1.00 57.33  ? 905  DC  E "C2'" 1 
ATOM   3130 C  "C1'" . DC  C 3 5   ? 9.683   -10.655 -2.345  1.00 58.07  ? 905  DC  E "C1'" 1 
ATOM   3131 N  N1    . DC  C 3 5   ? 9.022   -9.865  -1.267  1.00 57.51  ? 905  DC  E N1    1 
ATOM   3132 C  C2    . DC  C 3 5   ? 8.907   -8.500  -1.465  1.00 56.53  ? 905  DC  E C2    1 
ATOM   3133 O  O2    . DC  C 3 5   ? 9.332   -8.031  -2.525  1.00 56.99  ? 905  DC  E O2    1 
ATOM   3134 N  N3    . DC  C 3 5   ? 8.324   -7.742  -0.505  1.00 57.01  ? 905  DC  E N3    1 
ATOM   3135 C  C4    . DC  C 3 5   ? 7.889   -8.297  0.620   1.00 56.50  ? 905  DC  E C4    1 
ATOM   3136 N  N4    . DC  C 3 5   ? 7.339   -7.478  1.516   1.00 55.68  ? 905  DC  E N4    1 
ATOM   3137 C  C5    . DC  C 3 5   ? 8.015   -9.700  0.856   1.00 56.37  ? 905  DC  E C5    1 
ATOM   3138 C  C6    . DC  C 3 5   ? 8.588   -10.444 -0.101  1.00 56.77  ? 905  DC  E C6    1 
HETATM 3139 P  P     A 8OG C 3 6   ? 13.024  -12.649 -4.001  0.80 50.99  ? 906  8OG E P     1 
HETATM 3140 P  P     B 8OG C 3 6   ? 13.033  -12.667 -4.070  0.20 54.78  ? 906  8OG E P     1 
HETATM 3141 O  OP1   A 8OG C 3 6   ? 13.366  -12.925 -5.445  0.80 54.35  ? 906  8OG E OP1   1 
HETATM 3142 O  OP1   B 8OG C 3 6   ? 13.271  -13.027 -5.517  0.20 55.48  ? 906  8OG E OP1   1 
HETATM 3143 O  OP2   A 8OG C 3 6   ? 13.393  -13.577 -2.884  0.80 49.86  ? 906  8OG E OP2   1 
HETATM 3144 O  OP2   B 8OG C 3 6   ? 13.514  -13.579 -2.968  0.20 54.57  ? 906  8OG E OP2   1 
HETATM 3145 O  "O5'" A 8OG C 3 6   ? 13.680  -11.203 -3.709  0.80 52.31  ? 906  8OG E "O5'" 1 
HETATM 3146 O  "O5'" B 8OG C 3 6   ? 13.685  -11.216 -3.803  0.20 55.31  ? 906  8OG E "O5'" 1 
HETATM 3147 C  "C5'" A 8OG C 3 6   ? 13.586  -10.105 -4.631  0.80 53.04  ? 906  8OG E "C5'" 1 
HETATM 3148 C  "C5'" B 8OG C 3 6   ? 13.705  -10.148 -4.755  0.20 56.06  ? 906  8OG E "C5'" 1 
HETATM 3149 C  "C4'" A 8OG C 3 6   ? 13.888  -8.881  -3.806  0.80 53.92  ? 906  8OG E "C4'" 1 
HETATM 3150 C  "C4'" B 8OG C 3 6   ? 13.868  -8.902  -3.924  0.20 56.52  ? 906  8OG E "C4'" 1 
HETATM 3151 O  "O4'" A 8OG C 3 6   ? 12.879  -8.274  -2.987  0.80 54.12  ? 906  8OG E "O4'" 1 
HETATM 3152 O  "O4'" B 8OG C 3 6   ? 12.742  -8.285  -3.267  0.20 57.19  ? 906  8OG E "O4'" 1 
HETATM 3153 C  "C3'" A 8OG C 3 6   ? 15.086  -8.563  -3.382  0.80 54.21  ? 906  8OG E "C3'" 1 
HETATM 3154 C  "C3'" B 8OG C 3 6   ? 15.010  -8.527  -3.397  0.20 56.22  ? 906  8OG E "C3'" 1 
HETATM 3155 O  "O3'" A 8OG C 3 6   ? 15.737  -7.774  -4.036  0.80 54.73  ? 906  8OG E "O3'" 1 
HETATM 3156 O  "O3'" B 8OG C 3 6   ? 15.721  -7.758  -4.029  0.20 55.50  ? 906  8OG E "O3'" 1 
HETATM 3157 C  "C2'" A 8OG C 3 6   ? 15.065  -8.478  -1.879  0.80 55.32  ? 906  8OG E "C2'" 1 
HETATM 3158 C  "C2'" B 8OG C 3 6   ? 14.806  -8.354  -1.915  0.20 57.17  ? 906  8OG E "C2'" 1 
HETATM 3159 C  "C1'" A 8OG C 3 6   ? 13.580  -8.284  -1.726  0.80 55.66  ? 906  8OG E "C1'" 1 
HETATM 3160 C  "C1'" B 8OG C 3 6   ? 13.322  -8.072  -1.956  0.20 57.84  ? 906  8OG E "C1'" 1 
HETATM 3161 N  N9    A 8OG C 3 6   ? 12.904  -8.190  -0.561  0.80 58.88  ? 906  8OG E N9    1 
HETATM 3162 N  N9    B 8OG C 3 6   ? 12.595  -7.530  -0.942  0.20 59.18  ? 906  8OG E N9    1 
HETATM 3163 C  C8    A 8OG C 3 6   ? 12.682  -9.158  0.334   0.80 60.80  ? 906  8OG E C8    1 
HETATM 3164 C  C8    B 8OG C 3 6   ? 12.118  -6.295  -1.004  0.20 59.20  ? 906  8OG E C8    1 
HETATM 3165 N  N7    A 8OG C 3 6   ? 11.937  -8.743  1.372   0.80 59.58  ? 906  8OG E N7    1 
HETATM 3166 N  N7    B 8OG C 3 6   ? 11.422  -5.951  0.087   0.20 59.57  ? 906  8OG E N7    1 
HETATM 3167 C  C5    A 8OG C 3 6   ? 11.658  -7.456  1.081   0.80 59.08  ? 906  8OG E C5    1 
HETATM 3168 C  C5    B 8OG C 3 6   ? 11.455  -7.049  0.878   0.20 60.19  ? 906  8OG E C5    1 
HETATM 3169 C  C6    A 8OG C 3 6   ? 10.914  -6.387  1.748   0.80 59.05  ? 906  8OG E C6    1 
HETATM 3170 C  C6    B 8OG C 3 6   ? 10.908  -7.385  2.211   0.20 60.47  ? 906  8OG E C6    1 
HETATM 3171 O  O6    A 8OG C 3 6   ? 10.354  -6.623  2.844   0.80 59.24  ? 906  8OG E O6    1 
HETATM 3172 O  O6    B 8OG C 3 6   ? 10.240  -6.557  2.865   0.20 60.70  ? 906  8OG E O6    1 
HETATM 3173 N  N1    A 8OG C 3 6   ? 10.866  -5.187  1.134   0.80 59.54  ? 906  8OG E N1    1 
HETATM 3174 N  N1    B 8OG C 3 6   ? 11.147  -8.606  2.701   0.20 61.01  ? 906  8OG E N1    1 
HETATM 3175 C  C2    A 8OG C 3 6   ? 11.468  -4.934  -0.047  0.80 59.73  ? 906  8OG E C2    1 
HETATM 3176 C  C2    B 8OG C 3 6   ? 11.861  -9.528  2.032   0.20 60.91  ? 906  8OG E C2    1 
HETATM 3177 N  N2    A 8OG C 3 6   ? 11.357  -3.682  -0.575  0.80 61.68  ? 906  8OG E N2    1 
HETATM 3178 N  N2    B 8OG C 3 6   ? 12.039  -10.735 2.625   0.20 60.71  ? 906  8OG E N2    1 
HETATM 3179 N  N3    A 8OG C 3 6   ? 12.166  -5.857  -0.723  0.80 58.36  ? 906  8OG E N3    1 
HETATM 3180 N  N3    B 8OG C 3 6   ? 12.395  -9.300  0.813   0.20 60.78  ? 906  8OG E N3    1 
HETATM 3181 C  C4    A 8OG C 3 6   ? 12.286  -7.083  -0.215  0.80 59.52  ? 906  8OG E C4    1 
HETATM 3182 C  C4    B 8OG C 3 6   ? 12.232  -8.120  0.198   0.20 60.15  ? 906  8OG E C4    1 
HETATM 3183 O  O8    A 8OG C 3 6   ? 13.158  -10.359 0.247   0.80 62.75  ? 906  8OG E O8    1 
HETATM 3184 O  O8    B 8OG C 3 6   ? 12.316  -5.503  -2.000  0.20 58.78  ? 906  8OG E O8    1 
ATOM   3185 P  P     . DC  C 3 7   ? 17.299  -7.572  -3.812  1.00 51.91  ? 907  DC  E P     1 
ATOM   3186 O  OP1   . DC  C 3 7   ? 17.877  -7.127  -5.085  1.00 55.17  ? 907  DC  E OP1   1 
ATOM   3187 O  OP2   . DC  C 3 7   ? 17.839  -8.693  -3.017  1.00 56.76  ? 907  DC  E OP2   1 
ATOM   3188 O  "O5'" . DC  C 3 7   ? 17.390  -6.310  -2.855  1.00 57.05  ? 907  DC  E "O5'" 1 
ATOM   3189 C  "C5'" . DC  C 3 7   ? 16.859  -5.077  -3.314  1.00 57.26  ? 907  DC  E "C5'" 1 
ATOM   3190 C  "C4'" . DC  C 3 7   ? 16.683  -4.251  -2.076  1.00 56.62  ? 907  DC  E "C4'" 1 
ATOM   3191 O  "O4'" . DC  C 3 7   ? 15.712  -4.914  -1.243  1.00 56.34  ? 907  DC  E "O4'" 1 
ATOM   3192 C  "C3'" . DC  C 3 7   ? 17.920  -4.282  -1.206  1.00 56.77  ? 907  DC  E "C3'" 1 
ATOM   3193 O  "O3'" . DC  C 3 7   ? 18.617  -3.113  -1.455  1.00 57.94  ? 907  DC  E "O3'" 1 
ATOM   3194 C  "C2'" . DC  C 3 7   ? 17.366  -4.275  0.211   1.00 57.01  ? 907  DC  E "C2'" 1 
ATOM   3195 C  "C1'" . DC  C 3 7   ? 15.859  -4.250  -0.029  1.00 55.41  ? 907  DC  E "C1'" 1 
ATOM   3196 N  N1    . DC  C 3 7   ? 15.144  -4.928  1.066   1.00 52.98  ? 907  DC  E N1    1 
ATOM   3197 C  C2    . DC  C 3 7   ? 14.372  -4.128  1.898   1.00 51.16  ? 907  DC  E C2    1 
ATOM   3198 O  O2    . DC  C 3 7   ? 14.285  -2.919  1.638   1.00 50.22  ? 907  DC  E O2    1 
ATOM   3199 N  N3    . DC  C 3 7   ? 13.737  -4.699  2.942   1.00 51.92  ? 907  DC  E N3    1 
ATOM   3200 C  C4    . DC  C 3 7   ? 13.881  -6.000  3.171   1.00 52.88  ? 907  DC  E C4    1 
ATOM   3201 N  N4    . DC  C 3 7   ? 13.231  -6.505  4.222   1.00 52.82  ? 907  DC  E N4    1 
ATOM   3202 C  C5    . DC  C 3 7   ? 14.698  -6.835  2.344   1.00 52.56  ? 907  DC  E C5    1 
ATOM   3203 C  C6    . DC  C 3 7   ? 15.312  -6.257  1.307   1.00 52.95  ? 907  DC  E C6    1 
ATOM   3204 P  P     . DT  C 3 8   ? 20.138  -2.941  -1.039  1.00 56.51  ? 908  DT  E P     1 
ATOM   3205 O  OP1   . DT  C 3 8   ? 20.771  -2.230  -2.165  1.00 55.50  ? 908  DT  E OP1   1 
ATOM   3206 O  OP2   . DT  C 3 8   ? 20.671  -4.200  -0.502  1.00 56.90  ? 908  DT  E OP2   1 
ATOM   3207 O  "O5'" . DT  C 3 8   ? 19.969  -1.977  0.209   1.00 53.54  ? 908  DT  E "O5'" 1 
ATOM   3208 C  "C5'" . DT  C 3 8   ? 19.234  -0.827  0.034   1.00 49.74  ? 908  DT  E "C5'" 1 
ATOM   3209 C  "C4'" . DT  C 3 8   ? 19.062  -0.191  1.377   1.00 47.98  ? 908  DT  E "C4'" 1 
ATOM   3210 O  "O4'" . DT  C 3 8   ? 18.058  -0.921  2.097   1.00 47.38  ? 908  DT  E "O4'" 1 
ATOM   3211 C  "C3'" . DT  C 3 8   ? 20.306  -0.198  2.254   1.00 47.71  ? 908  DT  E "C3'" 1 
ATOM   3212 O  "O3'" . DT  C 3 8   ? 20.469  1.144   2.564   1.00 47.44  ? 908  DT  E "O3'" 1 
ATOM   3213 C  "C2'" . DT  C 3 8   ? 19.905  -1.000  3.481   1.00 47.09  ? 908  DT  E "C2'" 1 
ATOM   3214 C  "C1'" . DT  C 3 8   ? 18.391  -0.858  3.442   1.00 46.72  ? 908  DT  E "C1'" 1 
ATOM   3215 N  N1    . DT  C 3 8   ? 17.728  -2.012  4.018   1.00 46.98  ? 908  DT  E N1    1 
ATOM   3216 C  C2    . DT  C 3 8   ? 16.750  -1.802  4.962   1.00 45.21  ? 908  DT  E C2    1 
ATOM   3217 O  O2    . DT  C 3 8   ? 16.419  -0.708  5.339   1.00 43.83  ? 908  DT  E O2    1 
ATOM   3218 N  N3    . DT  C 3 8   ? 16.195  -2.941  5.456   1.00 45.76  ? 908  DT  E N3    1 
ATOM   3219 C  C4    . DT  C 3 8   ? 16.511  -4.225  5.085   1.00 45.77  ? 908  DT  E C4    1 
ATOM   3220 O  O4    . DT  C 3 8   ? 15.946  -5.171  5.592   1.00 46.70  ? 908  DT  E O4    1 
ATOM   3221 C  C5    . DT  C 3 8   ? 17.531  -4.373  4.077   1.00 46.20  ? 908  DT  E C5    1 
ATOM   3222 C  C7    . DT  C 3 8   ? 17.951  -5.733  3.613   1.00 46.93  ? 908  DT  E C7    1 
ATOM   3223 C  C6    . DT  C 3 8   ? 18.101  -3.269  3.595   1.00 45.74  ? 908  DT  E C6    1 
ATOM   3224 P  P     . DA  C 3 9   ? 21.594  1.742   3.493   1.00 48.89  ? 909  DA  E P     1 
ATOM   3225 O  OP1   . DA  C 3 9   ? 22.006  2.951   2.765   1.00 51.39  ? 909  DA  E OP1   1 
ATOM   3226 O  OP2   . DA  C 3 9   ? 22.538  0.716   4.017   1.00 47.93  ? 909  DA  E OP2   1 
ATOM   3227 O  "O5'" . DA  C 3 9   ? 20.774  2.249   4.752   1.00 47.93  ? 909  DA  E "O5'" 1 
ATOM   3228 C  "C5'" . DA  C 3 9   ? 19.507  2.837   4.676   1.00 44.43  ? 909  DA  E "C5'" 1 
ATOM   3229 C  "C4'" . DA  C 3 9   ? 19.197  3.059   6.135   1.00 44.25  ? 909  DA  E "C4'" 1 
ATOM   3230 O  "O4'" . DA  C 3 9   ? 18.513  1.901   6.651   1.00 43.64  ? 909  DA  E "O4'" 1 
ATOM   3231 C  "C3'" . DA  C 3 9   ? 20.452  3.176   6.986   1.00 44.62  ? 909  DA  E "C3'" 1 
ATOM   3232 O  "O3'" . DA  C 3 9   ? 20.152  4.087   7.991   1.00 45.30  ? 909  DA  E "O3'" 1 
ATOM   3233 C  "C2'" . DA  C 3 9   ? 20.650  1.775   7.548   1.00 43.11  ? 909  DA  E "C2'" 1 
ATOM   3234 C  "C1'" . DA  C 3 9   ? 19.203  1.382   7.759   1.00 42.43  ? 909  DA  E "C1'" 1 
ATOM   3235 N  N9    . DA  C 3 9   ? 19.026  -0.060  7.760   1.00 41.97  ? 909  DA  E N9    1 
ATOM   3236 C  C8    . DA  C 3 9   ? 19.672  -0.961  6.965   1.00 41.14  ? 909  DA  E C8    1 
ATOM   3237 N  N7    . DA  C 3 9   ? 19.321  -2.201  7.189   1.00 42.14  ? 909  DA  E N7    1 
ATOM   3238 C  C5    . DA  C 3 9   ? 18.373  -2.111  8.205   1.00 40.96  ? 909  DA  E C5    1 
ATOM   3239 C  C6    . DA  C 3 9   ? 17.617  -3.071  8.905   1.00 39.31  ? 909  DA  E C6    1 
ATOM   3240 N  N6    . DA  C 3 9   ? 17.685  -4.380  8.693   1.00 38.43  ? 909  DA  E N6    1 
ATOM   3241 N  N1    . DA  C 3 9   ? 16.772  -2.629  9.847   1.00 39.45  ? 909  DA  E N1    1 
ATOM   3242 C  C2    . DA  C 3 9   ? 16.703  -1.321  10.087  1.00 39.83  ? 909  DA  E C2    1 
ATOM   3243 N  N3    . DA  C 3 9   ? 17.354  -0.322  9.498   1.00 40.96  ? 909  DA  E N3    1 
ATOM   3244 C  C4    . DA  C 3 9   ? 18.178  -0.789  8.557   1.00 41.15  ? 909  DA  E C4    1 
ATOM   3245 P  P     . DC  C 3 10  ? 21.281  4.795   8.870   1.00 47.72  ? 910  DC  E P     1 
ATOM   3246 O  OP1   . DC  C 3 10  ? 20.983  6.254   8.825   1.00 48.98  ? 910  DC  E OP1   1 
ATOM   3247 O  OP2   . DC  C 3 10  ? 22.627  4.260   8.573   1.00 45.69  ? 910  DC  E OP2   1 
ATOM   3248 O  "O5'" . DC  C 3 10  ? 20.902  4.260   10.327  1.00 45.29  ? 910  DC  E "O5'" 1 
ATOM   3249 C  "C5'" . DC  C 3 10  ? 19.546  4.367   10.712  1.00 43.93  ? 910  DC  E "C5'" 1 
ATOM   3250 C  "C4'" . DC  C 3 10  ? 19.349  3.440   11.879  1.00 43.30  ? 910  DC  E "C4'" 1 
ATOM   3251 O  "O4'" . DC  C 3 10  ? 19.255  2.077   11.414  1.00 43.06  ? 910  DC  E "O4'" 1 
ATOM   3252 C  "C3'" . DC  C 3 10  ? 20.545  3.472   12.803  1.00 43.62  ? 910  DC  E "C3'" 1 
ATOM   3253 O  "O3'" . DC  C 3 10  ? 20.013  3.808   14.032  1.00 46.98  ? 910  DC  E "O3'" 1 
ATOM   3254 C  "C2'" . DC  C 3 10  ? 21.088  2.049   12.768  1.00 41.81  ? 910  DC  E "C2'" 1 
ATOM   3255 C  "C1'" . DC  C 3 10  ? 19.854  1.266   12.376  1.00 40.90  ? 910  DC  E "C1'" 1 
ATOM   3256 N  N1    . DC  C 3 10  ? 20.150  -0.034  11.742  1.00 40.37  ? 910  DC  E N1    1 
ATOM   3257 C  C2    . DC  C 3 10  ? 19.390  -1.137  12.118  1.00 41.12  ? 910  DC  E C2    1 
ATOM   3258 O  O2    . DC  C 3 10  ? 18.490  -0.971  12.956  1.00 42.46  ? 910  DC  E O2    1 
ATOM   3259 N  N3    . DC  C 3 10  ? 19.656  -2.340  11.552  1.00 40.33  ? 910  DC  E N3    1 
ATOM   3260 C  C4    . DC  C 3 10  ? 20.623  -2.449  10.643  1.00 39.12  ? 910  DC  E C4    1 
ATOM   3261 N  N4    . DC  C 3 10  ? 20.844  -3.656  10.113  1.00 39.05  ? 910  DC  E N4    1 
ATOM   3262 C  C5    . DC  C 3 10  ? 21.416  -1.328  10.249  1.00 39.14  ? 910  DC  E C5    1 
ATOM   3263 C  C6    . DC  C 3 10  ? 21.146  -0.150  10.820  1.00 39.54  ? 910  DC  E C6    1 
ATOM   3264 P  P     . DC  C 3 11  ? 20.947  4.128   15.272  1.00 50.05  ? 911  DC  E P     1 
ATOM   3265 O  OP1   . DC  C 3 11  ? 20.443  5.401   15.842  1.00 50.39  ? 911  DC  E OP1   1 
ATOM   3266 O  OP2   . DC  C 3 11  ? 22.370  3.920   14.889  1.00 49.71  ? 911  DC  E OP2   1 
ATOM   3267 O  "O5'" . DC  C 3 11  ? 20.524  2.955   16.269  1.00 48.79  ? 911  DC  E "O5'" 1 
ATOM   3268 C  "C5'" . DC  C 3 11  ? 19.221  2.424   16.138  1.00 47.62  ? 911  DC  E "C5'" 1 
ATOM   3269 C  "C4'" . DC  C 3 11  ? 19.160  1.137   16.920  1.00 47.06  ? 911  DC  E "C4'" 1 
ATOM   3270 O  "O4'" . DC  C 3 11  ? 19.438  0.024   16.043  1.00 46.33  ? 911  DC  E "O4'" 1 
ATOM   3271 C  "C3'" . DC  C 3 11  ? 20.199  1.070   18.026  1.00 46.91  ? 911  DC  E "C3'" 1 
ATOM   3272 O  "O3'" . DC  C 3 11  ? 19.625  0.348   19.071  1.00 46.72  ? 911  DC  E "O3'" 1 
ATOM   3273 C  "C2'" . DC  C 3 11  ? 21.334  0.270   17.393  1.00 47.12  ? 911  DC  E "C2'" 1 
ATOM   3274 C  "C1'" . DC  C 3 11  ? 20.513  -0.710  16.568  1.00 46.42  ? 911  DC  E "C1'" 1 
ATOM   3275 N  N1    . DC  C 3 11  ? 21.265  -1.343  15.460  1.00 46.28  ? 911  DC  E N1    1 
ATOM   3276 C  C2    . DC  C 3 11  ? 21.032  -2.697  15.230  1.00 46.21  ? 911  DC  E C2    1 
ATOM   3277 O  O2    . DC  C 3 11  ? 20.210  -3.280  15.949  1.00 46.54  ? 911  DC  E O2    1 
ATOM   3278 N  N3    . DC  C 3 11  ? 21.705  -3.318  14.230  1.00 45.75  ? 911  DC  E N3    1 
ATOM   3279 C  C4    . DC  C 3 11  ? 22.580  -2.635  13.492  1.00 44.69  ? 911  DC  E C4    1 
ATOM   3280 N  N4    . DC  C 3 11  ? 23.214  -3.311  12.526  1.00 44.06  ? 911  DC  E N4    1 
ATOM   3281 C  C5    . DC  C 3 11  ? 22.836  -1.248  13.719  1.00 43.97  ? 911  DC  E C5    1 
ATOM   3282 C  C6    . DC  C 3 11  ? 22.165  -0.644  14.705  1.00 45.03  ? 911  DC  E C6    1 
ATOM   3283 P  P     . DA  C 3 12  ? 20.028  0.606   20.589  1.00 45.97  ? 912  DA  E P     1 
ATOM   3284 O  OP1   . DA  C 3 12  ? 18.998  1.521   21.129  1.00 47.18  ? 912  DA  E OP1   1 
ATOM   3285 O  OP2   . DA  C 3 12  ? 21.465  0.941   20.681  1.00 45.79  ? 912  DA  E OP2   1 
ATOM   3286 O  "O5'" . DA  C 3 12  ? 19.780  -0.840  21.216  1.00 45.64  ? 912  DA  E "O5'" 1 
ATOM   3287 C  "C5'" . DA  C 3 12  ? 18.735  -1.609  20.644  1.00 47.02  ? 912  DA  E "C5'" 1 
ATOM   3288 C  "C4'" . DA  C 3 12  ? 18.836  -3.052  21.072  1.00 47.75  ? 912  DA  E "C4'" 1 
ATOM   3289 O  "O4'" . DA  C 3 12  ? 19.420  -3.846  20.011  1.00 47.22  ? 912  DA  E "O4'" 1 
ATOM   3290 C  "C3'" . DA  C 3 12  ? 19.706  -3.245  22.299  1.00 48.62  ? 912  DA  E "C3'" 1 
ATOM   3291 O  "O3'" . DA  C 3 12  ? 18.994  -4.117  23.181  1.00 50.60  ? 912  DA  E "O3'" 1 
ATOM   3292 C  "C2'" . DA  C 3 12  ? 21.040  -3.753  21.740  1.00 46.92  ? 912  DA  E "C2'" 1 
ATOM   3293 C  "C1'" . DA  C 3 12  ? 20.656  -4.397  20.414  1.00 46.16  ? 912  DA  E "C1'" 1 
ATOM   3294 N  N9    . DA  C 3 12  ? 21.596  -4.152  19.321  1.00 45.21  ? 912  DA  E N9    1 
ATOM   3295 C  C8    . DA  C 3 12  ? 22.110  -2.945  18.940  1.00 45.06  ? 912  DA  E C8    1 
ATOM   3296 N  N7    . DA  C 3 12  ? 22.925  -3.014  17.916  1.00 44.33  ? 912  DA  E N7    1 
ATOM   3297 C  C5    . DA  C 3 12  ? 22.943  -4.358  17.601  1.00 43.58  ? 912  DA  E C5    1 
ATOM   3298 C  C6    . DA  C 3 12  ? 23.620  -5.072  16.599  1.00 43.30  ? 912  DA  E C6    1 
ATOM   3299 N  N6    . DA  C 3 12  ? 24.432  -4.480  15.718  1.00 43.27  ? 912  DA  E N6    1 
ATOM   3300 N  N1    . DA  C 3 12  ? 23.423  -6.403  16.543  1.00 43.02  ? 912  DA  E N1    1 
ATOM   3301 C  C2    . DA  C 3 12  ? 22.607  -6.966  17.440  1.00 43.57  ? 912  DA  E C2    1 
ATOM   3302 N  N3    . DA  C 3 12  ? 21.913  -6.396  18.428  1.00 43.31  ? 912  DA  E N3    1 
ATOM   3303 C  C4    . DA  C 3 12  ? 22.131  -5.076  18.454  1.00 43.72  ? 912  DA  E C4    1 
ATOM   3304 P  P     . DT  C 3 13  ? 19.695  -5.184  24.144  1.00 53.03  ? 913  DT  E P     1 
ATOM   3305 O  OP1   . DT  C 3 13  ? 18.709  -5.538  25.192  1.00 52.60  ? 913  DT  E OP1   1 
ATOM   3306 O  OP2   . DT  C 3 13  ? 21.055  -4.722  24.532  1.00 51.75  ? 913  DT  E OP2   1 
ATOM   3307 O  "O5'" . DT  C 3 13  ? 19.811  -6.411  23.112  1.00 54.10  ? 913  DT  E "O5'" 1 
ATOM   3308 C  "C5'" . DT  C 3 13  ? 19.973  -7.748  23.562  1.00 55.60  ? 913  DT  E "C5'" 1 
ATOM   3309 C  "C4'" . DT  C 3 13  ? 21.368  -8.236  23.232  1.00 56.58  ? 913  DT  E "C4'" 1 
ATOM   3310 O  "O4'" . DT  C 3 13  ? 21.892  -7.545  22.067  1.00 56.51  ? 913  DT  E "O4'" 1 
ATOM   3311 C  "C3'" . DT  C 3 13  ? 22.404  -7.943  24.303  1.00 57.00  ? 913  DT  E "C3'" 1 
ATOM   3312 O  "O3'" . DT  C 3 13  ? 22.303  -8.899  25.387  1.00 59.65  ? 913  DT  E "O3'" 1 
ATOM   3313 C  "C2'" . DT  C 3 13  ? 23.714  -7.962  23.515  1.00 56.36  ? 913  DT  E "C2'" 1 
ATOM   3314 C  "C1'" . DT  C 3 13  ? 23.269  -7.864  22.050  1.00 55.68  ? 913  DT  E "C1'" 1 
ATOM   3315 N  N1    . DT  C 3 13  ? 24.067  -6.919  21.184  1.00 54.36  ? 913  DT  E N1    1 
ATOM   3316 C  C2    . DT  C 3 13  ? 24.628  -7.428  20.028  1.00 53.79  ? 913  DT  E C2    1 
ATOM   3317 O  O2    . DT  C 3 13  ? 24.497  -8.591  19.683  1.00 53.38  ? 913  DT  E O2    1 
ATOM   3318 N  N3    . DT  C 3 13  ? 25.352  -6.527  19.284  1.00 52.73  ? 913  DT  E N3    1 
ATOM   3319 C  C4    . DT  C 3 13  ? 25.573  -5.194  19.576  1.00 52.81  ? 913  DT  E C4    1 
ATOM   3320 O  O4    . DT  C 3 13  ? 26.243  -4.471  18.840  1.00 52.01  ? 913  DT  E O4    1 
ATOM   3321 C  C5    . DT  C 3 13  ? 24.962  -4.725  20.803  1.00 52.90  ? 913  DT  E C5    1 
ATOM   3322 C  C7    . DT  C 3 13  ? 25.125  -3.295  21.224  1.00 53.05  ? 913  DT  E C7    1 
ATOM   3323 C  C6    . DT  C 3 13  ? 24.251  -5.596  21.539  1.00 53.39  ? 913  DT  E C6    1 
ATOM   3324 P  P     . DC  C 3 14  ? 23.157  -10.247 25.588  1.00 60.75  ? 914  DC  E P     1 
ATOM   3325 O  OP1   . DC  C 3 14  ? 22.371  -11.100 26.499  1.00 60.95  ? 914  DC  E OP1   1 
ATOM   3326 O  OP2   . DC  C 3 14  ? 24.550  -9.890  25.961  1.00 60.21  ? 914  DC  E OP2   1 
ATOM   3327 O  "O5'" . DC  C 3 14  ? 23.131  -10.950 24.144  1.00 61.34  ? 914  DC  E "O5'" 1 
ATOM   3328 C  "C5'" . DC  C 3 14  ? 23.383  -12.355 24.019  1.00 61.21  ? 914  DC  E "C5'" 1 
ATOM   3329 C  "C4'" . DC  C 3 14  ? 24.781  -12.626 23.475  1.00 61.11  ? 914  DC  E "C4'" 1 
ATOM   3330 O  "O4'" . DC  C 3 14  ? 25.159  -11.551 22.580  1.00 60.19  ? 914  DC  E "O4'" 1 
ATOM   3331 C  "C3'" . DC  C 3 14  ? 25.887  -12.719 24.526  1.00 61.17  ? 914  DC  E "C3'" 1 
ATOM   3332 O  "O3'" . DC  C 3 14  ? 26.212  -14.101 24.768  1.00 63.52  ? 914  DC  E "O3'" 1 
ATOM   3333 C  "C2'" . DC  C 3 14  ? 27.054  -11.916 23.952  1.00 59.80  ? 914  DC  E "C2'" 1 
ATOM   3334 C  "C1'" . DC  C 3 14  ? 26.561  -11.410 22.600  1.00 59.13  ? 914  DC  E "C1'" 1 
ATOM   3335 N  N1    . DC  C 3 14  ? 26.904  -9.978  22.350  1.00 57.29  ? 914  DC  E N1    1 
ATOM   3336 C  C2    . DC  C 3 14  ? 27.608  -9.626  21.192  1.00 55.65  ? 914  DC  E C2    1 
ATOM   3337 O  O2    . DC  C 3 14  ? 27.934  -10.518 20.394  1.00 54.11  ? 914  DC  E O2    1 
ATOM   3338 N  N3    . DC  C 3 14  ? 27.915  -8.317  20.990  1.00 54.71  ? 914  DC  E N3    1 
ATOM   3339 C  C4    . DC  C 3 14  ? 27.547  -7.390  21.874  1.00 54.58  ? 914  DC  E C4    1 
ATOM   3340 N  N4    . DC  C 3 14  ? 27.873  -6.117  21.637  1.00 53.76  ? 914  DC  E N4    1 
ATOM   3341 C  C5    . DC  C 3 14  ? 26.836  -7.734  23.060  1.00 55.88  ? 914  DC  E C5    1 
ATOM   3342 C  C6    . DC  C 3 14  ? 26.541  -9.025  23.257  1.00 56.73  ? 914  DC  E C6    1 
ATOM   3343 P  P     . DC  C 3 15  ? 27.704  -14.716 24.815  1.00 64.67  ? 915  DC  E P     1 
ATOM   3344 O  OP1   . DC  C 3 15  ? 27.573  -16.136 25.205  1.00 64.58  ? 915  DC  E OP1   1 
ATOM   3345 O  OP2   . DC  C 3 15  ? 28.610  -13.833 25.596  1.00 63.53  ? 915  DC  E OP2   1 
ATOM   3346 O  "O5'" . DC  C 3 15  ? 28.101  -14.663 23.263  1.00 65.12  ? 915  DC  E "O5'" 1 
ATOM   3347 C  "C5'" . DC  C 3 15  ? 29.219  -15.393 22.783  1.00 65.45  ? 915  DC  E "C5'" 1 
ATOM   3348 C  "C4'" . DC  C 3 15  ? 30.458  -14.518 22.765  1.00 65.90  ? 915  DC  E "C4'" 1 
ATOM   3349 O  "O4'" . DC  C 3 15  ? 30.120  -13.142 22.441  1.00 65.69  ? 915  DC  E "O4'" 1 
ATOM   3350 C  "C3'" . DC  C 3 15  ? 31.185  -14.448 24.103  1.00 66.34  ? 915  DC  E "C3'" 1 
ATOM   3351 O  "O3'" . DC  C 3 15  ? 32.195  -15.480 24.191  1.00 68.08  ? 915  DC  E "O3'" 1 
ATOM   3352 C  "C2'" . DC  C 3 15  ? 31.737  -13.024 24.153  1.00 65.63  ? 915  DC  E "C2'" 1 
ATOM   3353 C  "C1'" . DC  C 3 15  ? 31.216  -12.363 22.874  1.00 65.23  ? 915  DC  E "C1'" 1 
ATOM   3354 N  N1    . DC  C 3 15  ? 30.835  -10.935 23.105  1.00 63.94  ? 915  DC  E N1    1 
ATOM   3355 C  C2    . DC  C 3 15  ? 31.279  -9.939  22.228  1.00 63.15  ? 915  DC  E C2    1 
ATOM   3356 O  O2    . DC  C 3 15  ? 31.967  -10.261 21.251  1.00 62.08  ? 915  DC  E O2    1 
ATOM   3357 N  N3    . DC  C 3 15  ? 30.930  -8.649  22.477  1.00 62.98  ? 915  DC  E N3    1 
ATOM   3358 C  C4    . DC  C 3 15  ? 30.185  -8.345  23.548  1.00 63.16  ? 915  DC  E C4    1 
ATOM   3359 N  N4    . DC  C 3 15  ? 29.866  -7.065  23.761  1.00 62.54  ? 915  DC  E N4    1 
ATOM   3360 C  C5    . DC  C 3 15  ? 29.732  -9.346  24.455  1.00 63.45  ? 915  DC  E C5    1 
ATOM   3361 C  C6    . DC  C 3 15  ? 30.084  -10.610 24.199  1.00 63.98  ? 915  DC  E C6    1 
ATOM   3362 P  P     . DA  C 3 16  ? 33.756  -15.226 23.917  1.00 68.96  ? 916  DA  E P     1 
ATOM   3363 O  OP1   . DA  C 3 16  ? 34.391  -16.533 23.653  1.00 69.26  ? 916  DA  E OP1   1 
ATOM   3364 O  OP2   . DA  C 3 16  ? 34.282  -14.349 24.989  1.00 69.07  ? 916  DA  E OP2   1 
ATOM   3365 O  "O5'" . DA  C 3 16  ? 33.774  -14.416 22.544  1.00 69.53  ? 916  DA  E "O5'" 1 
ATOM   3366 C  "C5'" . DA  C 3 16  ? 34.405  -14.999 21.416  1.00 70.21  ? 916  DA  E "C5'" 1 
ATOM   3367 C  "C4'" . DA  C 3 16  ? 35.619  -14.193 20.996  1.00 70.40  ? 916  DA  E "C4'" 1 
ATOM   3368 O  "O4'" . DA  C 3 16  ? 35.324  -12.771 21.046  1.00 70.00  ? 916  DA  E "O4'" 1 
ATOM   3369 C  "C3'" . DA  C 3 16  ? 36.869  -14.383 21.843  1.00 70.83  ? 916  DA  E "C3'" 1 
ATOM   3370 O  "O3'" . DA  C 3 16  ? 37.955  -14.238 20.941  1.00 72.01  ? 916  DA  E "O3'" 1 
ATOM   3371 C  "C2'" . DA  C 3 16  ? 36.753  -13.247 22.859  1.00 70.01  ? 916  DA  E "C2'" 1 
ATOM   3372 C  "C1'" . DA  C 3 16  ? 36.145  -12.133 22.009  1.00 69.66  ? 916  DA  E "C1'" 1 
ATOM   3373 N  N9    . DA  C 3 16  ? 35.328  -11.161 22.741  1.00 68.69  ? 916  DA  E N9    1 
ATOM   3374 C  C8    . DA  C 3 16  ? 34.523  -11.396 23.823  1.00 68.26  ? 916  DA  E C8    1 
ATOM   3375 N  N7    . DA  C 3 16  ? 33.903  -10.328 24.269  1.00 67.66  ? 916  DA  E N7    1 
ATOM   3376 C  C5    . DA  C 3 16  ? 34.329  -9.320  23.419  1.00 67.27  ? 916  DA  E C5    1 
ATOM   3377 C  C6    . DA  C 3 16  ? 34.038  -7.942  23.357  1.00 66.62  ? 916  DA  E C6    1 
ATOM   3378 N  N6    . DA  C 3 16  ? 33.212  -7.329  24.208  1.00 66.47  ? 916  DA  E N6    1 
ATOM   3379 N  N1    . DA  C 3 16  ? 34.635  -7.214  22.392  1.00 66.07  ? 916  DA  E N1    1 
ATOM   3380 C  C2    . DA  C 3 16  ? 35.467  -7.829  21.545  1.00 66.47  ? 916  DA  E C2    1 
ATOM   3381 N  N3    . DA  C 3 16  ? 35.814  -9.114  21.497  1.00 66.96  ? 916  DA  E N3    1 
ATOM   3382 C  C4    . DA  C 3 16  ? 35.205  -9.814  22.470  1.00 67.71  ? 916  DA  E C4    1 
ATOM   3383 P  P     . DA  C 3 17  ? 39.472  -14.015 21.388  1.00 73.77  ? 917  DA  E P     1 
ATOM   3384 O  OP1   . DA  C 3 17  ? 40.206  -15.271 21.118  1.00 74.23  ? 917  DA  E OP1   1 
ATOM   3385 O  OP2   . DA  C 3 17  ? 39.532  -13.433 22.752  1.00 73.85  ? 917  DA  E OP2   1 
ATOM   3386 O  "O5'" . DA  C 3 17  ? 39.933  -12.899 20.335  1.00 73.25  ? 917  DA  E "O5'" 1 
ATOM   3387 C  "C5'" . DA  C 3 17  ? 39.039  -11.848 19.992  1.00 73.24  ? 917  DA  E "C5'" 1 
ATOM   3388 C  "C4'" . DA  C 3 17  ? 39.611  -10.478 20.320  1.00 73.23  ? 917  DA  E "C4'" 1 
ATOM   3389 O  "O4'" . DA  C 3 17  ? 38.685  -9.747  21.163  1.00 72.72  ? 917  DA  E "O4'" 1 
ATOM   3390 C  "C3'" . DA  C 3 17  ? 40.953  -10.467 21.050  1.00 73.49  ? 917  DA  E "C3'" 1 
ATOM   3391 O  "O3'" . DA  C 3 17  ? 41.840  -9.590  20.344  1.00 74.00  ? 917  DA  E "O3'" 1 
ATOM   3392 C  "C2'" . DA  C 3 17  ? 40.597  -9.982  22.459  1.00 73.04  ? 917  DA  E "C2'" 1 
ATOM   3393 C  "C1'" . DA  C 3 17  ? 39.407  -9.076  22.171  1.00 72.53  ? 917  DA  E "C1'" 1 
ATOM   3394 N  N9    . DA  C 3 17  ? 38.501  -8.852  23.295  1.00 71.97  ? 917  DA  E N9    1 
ATOM   3395 C  C8    . DA  C 3 17  ? 38.008  -9.792  24.159  1.00 71.66  ? 917  DA  E C8    1 
ATOM   3396 N  N7    . DA  C 3 17  ? 37.203  -9.302  25.070  1.00 71.35  ? 917  DA  E N7    1 
ATOM   3397 C  C5    . DA  C 3 17  ? 37.162  -7.947  24.783  1.00 71.33  ? 917  DA  E C5    1 
ATOM   3398 C  C6    . DA  C 3 17  ? 36.483  -6.869  25.385  1.00 71.04  ? 917  DA  E C6    1 
ATOM   3399 N  N6    . DA  C 3 17  ? 35.685  -7.015  26.446  1.00 70.83  ? 917  DA  E N6    1 
ATOM   3400 N  N1    . DA  C 3 17  ? 36.658  -5.638  24.858  1.00 70.99  ? 917  DA  E N1    1 
ATOM   3401 C  C2    . DA  C 3 17  ? 37.457  -5.500  23.794  1.00 71.39  ? 917  DA  E C2    1 
ATOM   3402 N  N3    . DA  C 3 17  ? 38.145  -6.438  23.142  1.00 71.78  ? 917  DA  E N3    1 
ATOM   3403 C  C4    . DA  C 3 17  ? 37.956  -7.650  23.692  1.00 71.66  ? 917  DA  E C4    1 
ATOM   3404 P  P     . DC  C 3 18  ? 42.990  -8.761  21.089  1.00 74.86  ? 918  DC  E P     1 
ATOM   3405 O  OP1   . DC  C 3 18  ? 43.904  -8.229  20.052  1.00 75.02  ? 918  DC  E OP1   1 
ATOM   3406 O  OP2   . DC  C 3 18  ? 43.543  -9.587  22.191  1.00 74.48  ? 918  DC  E OP2   1 
ATOM   3407 O  "O5'" . DC  C 3 18  ? 42.160  -7.547  21.727  1.00 74.38  ? 918  DC  E "O5'" 1 
ATOM   3408 C  "C5'" . DC  C 3 18  ? 41.712  -6.446  20.937  1.00 73.13  ? 918  DC  E "C5'" 1 
ATOM   3409 C  "C4'" . DC  C 3 18  ? 41.876  -5.153  21.721  1.00 72.44  ? 918  DC  E "C4'" 1 
ATOM   3410 O  "O4'" . DC  C 3 18  ? 40.947  -5.125  22.837  1.00 72.05  ? 918  DC  E "O4'" 1 
ATOM   3411 C  "C3'" . DC  C 3 18  ? 43.262  -4.938  22.324  1.00 71.89  ? 918  DC  E "C3'" 1 
ATOM   3412 O  "O3'" . DC  C 3 18  ? 43.643  -3.575  22.186  1.00 71.47  ? 918  DC  E "O3'" 1 
ATOM   3413 C  "C2'" . DC  C 3 18  ? 43.089  -5.328  23.791  1.00 71.63  ? 918  DC  E "C2'" 1 
ATOM   3414 C  "C1'" . DC  C 3 18  ? 41.636  -4.956  24.064  1.00 71.28  ? 918  DC  E "C1'" 1 
ATOM   3415 N  N1    . DC  C 3 18  ? 40.964  -5.815  25.094  1.00 70.66  ? 918  DC  E N1    1 
ATOM   3416 C  C2    . DC  C 3 18  ? 40.040  -5.254  25.990  1.00 70.19  ? 918  DC  E C2    1 
ATOM   3417 O  O2    . DC  C 3 18  ? 39.791  -4.043  25.935  1.00 70.15  ? 918  DC  E O2    1 
ATOM   3418 N  N3    . DC  C 3 18  ? 39.443  -6.058  26.905  1.00 69.69  ? 918  DC  E N3    1 
ATOM   3419 C  C4    . DC  C 3 18  ? 39.733  -7.360  26.943  1.00 69.67  ? 918  DC  E C4    1 
ATOM   3420 N  N4    . DC  C 3 18  ? 39.118  -8.110  27.862  1.00 69.42  ? 918  DC  E N4    1 
ATOM   3421 C  C5    . DC  C 3 18  ? 40.667  -7.953  26.043  1.00 69.96  ? 918  DC  E C5    1 
ATOM   3422 C  C6    . DC  C 3 18  ? 41.250  -7.152  25.145  1.00 70.41  ? 918  DC  E C6    1 
ATOM   3423 N  N     . GLY D 1 1   ? -7.771  73.110  58.663  1.00 56.21  ? 1001 GLY B N     1 
ATOM   3424 C  CA    . GLY D 1 1   ? -7.288  72.409  57.433  1.00 56.21  ? 1001 GLY B CA    1 
ATOM   3425 C  C     . GLY D 1 1   ? -8.404  72.119  56.448  1.00 56.22  ? 1001 GLY B C     1 
ATOM   3426 O  O     . GLY D 1 1   ? -9.408  71.497  56.803  1.00 56.24  ? 1001 GLY B O     1 
ATOM   3427 N  N     . ILE D 1 2   ? -8.237  72.576  55.209  1.00 56.15  ? 1002 ILE B N     1 
ATOM   3428 C  CA    . ILE D 1 2   ? -9.239  72.346  54.172  1.00 56.17  ? 1002 ILE B CA    1 
ATOM   3429 C  C     . ILE D 1 2   ? -8.624  71.769  52.898  1.00 56.18  ? 1002 ILE B C     1 
ATOM   3430 O  O     . ILE D 1 2   ? -7.626  72.278  52.388  1.00 56.18  ? 1002 ILE B O     1 
ATOM   3431 C  CB    . ILE D 1 2   ? -10.006 73.636  53.813  1.00 56.22  ? 1002 ILE B CB    1 
ATOM   3432 C  CG1   . ILE D 1 2   ? -10.866 74.098  54.986  1.00 56.21  ? 1002 ILE B CG1   1 
ATOM   3433 C  CG2   . ILE D 1 2   ? -10.883 73.412  52.583  1.00 56.39  ? 1002 ILE B CG2   1 
ATOM   3434 C  CD1   . ILE D 1 2   ? -11.674 75.343  54.688  1.00 56.70  ? 1002 ILE B CD1   1 
ATOM   3435 N  N     . VAL D 1 3   ? -9.228  70.705  52.383  1.00 56.07  ? 1003 VAL B N     1 
ATOM   3436 C  CA    . VAL D 1 3   ? -8.761  70.112  51.146  1.00 55.96  ? 1003 VAL B CA    1 
ATOM   3437 C  C     . VAL D 1 3   ? -9.804  70.276  50.050  1.00 55.78  ? 1003 VAL B C     1 
ATOM   3438 O  O     . VAL D 1 3   ? -10.936 69.808  50.177  1.00 55.83  ? 1003 VAL B O     1 
ATOM   3439 C  CB    . VAL D 1 3   ? -8.409  68.623  51.321  1.00 56.10  ? 1003 VAL B CB    1 
ATOM   3440 C  CG1   . VAL D 1 3   ? -7.947  68.037  50.006  1.00 55.91  ? 1003 VAL B CG1   1 
ATOM   3441 C  CG2   . VAL D 1 3   ? -7.333  68.456  52.391  1.00 56.28  ? 1003 VAL B CG2   1 
ATOM   3442 N  N     . LEU D 1 4   ? -9.411  70.959  48.981  1.00 55.42  ? 1004 LEU B N     1 
ATOM   3443 C  CA    . LEU D 1 4   ? -10.271 71.142  47.825  1.00 55.19  ? 1004 LEU B CA    1 
ATOM   3444 C  C     . LEU D 1 4   ? -9.849  70.184  46.713  1.00 54.96  ? 1004 LEU B C     1 
ATOM   3445 O  O     . LEU D 1 4   ? -8.807  70.355  46.085  1.00 54.85  ? 1004 LEU B O     1 
ATOM   3446 C  CB    . LEU D 1 4   ? -10.226 72.596  47.348  1.00 55.28  ? 1004 LEU B CB    1 
ATOM   3447 C  CG    . LEU D 1 4   ? -11.132 72.974  46.172  1.00 55.47  ? 1004 LEU B CG    1 
ATOM   3448 C  CD1   . LEU D 1 4   ? -11.804 74.320  46.418  1.00 55.55  ? 1004 LEU B CD1   1 
ATOM   3449 C  CD2   . LEU D 1 4   ? -10.363 72.980  44.864  1.00 54.79  ? 1004 LEU B CD2   1 
ATOM   3450 N  N     . PHE D 1 5   ? -10.662 69.161  46.493  1.00 54.52  ? 1005 PHE B N     1 
ATOM   3451 C  CA    . PHE D 1 5   ? -10.351 68.146  45.520  1.00 54.08  ? 1005 PHE B CA    1 
ATOM   3452 C  C     . PHE D 1 5   ? -11.199 68.339  44.278  1.00 54.36  ? 1005 PHE B C     1 
ATOM   3453 O  O     . PHE D 1 5   ? -12.418 68.474  44.365  1.00 54.36  ? 1005 PHE B O     1 
ATOM   3454 C  CB    . PHE D 1 5   ? -10.580 66.764  46.117  1.00 53.88  ? 1005 PHE B CB    1 
ATOM   3455 C  CG    . PHE D 1 5   ? -10.743 65.683  45.097  1.00 52.11  ? 1005 PHE B CG    1 
ATOM   3456 C  CD1   . PHE D 1 5   ? -9.642  65.060  44.552  1.00 51.69  ? 1005 PHE B CD1   1 
ATOM   3457 C  CD2   . PHE D 1 5   ? -12.003 65.283  44.692  1.00 51.30  ? 1005 PHE B CD2   1 
ATOM   3458 C  CE1   . PHE D 1 5   ? -9.789  64.061  43.620  1.00 50.84  ? 1005 PHE B CE1   1 
ATOM   3459 C  CE2   . PHE D 1 5   ? -12.157 64.283  43.759  1.00 51.21  ? 1005 PHE B CE2   1 
ATOM   3460 C  CZ    . PHE D 1 5   ? -11.049 63.673  43.223  1.00 50.54  ? 1005 PHE B CZ    1 
ATOM   3461 N  N     . VAL D 1 6   ? -10.538 68.357  43.126  1.00 54.57  ? 1006 VAL B N     1 
ATOM   3462 C  CA    . VAL D 1 6   ? -11.202 68.590  41.854  1.00 54.87  ? 1006 VAL B CA    1 
ATOM   3463 C  C     . VAL D 1 6   ? -11.211 67.330  40.997  1.00 55.09  ? 1006 VAL B C     1 
ATOM   3464 O  O     . VAL D 1 6   ? -10.171 66.734  40.718  1.00 55.13  ? 1006 VAL B O     1 
ATOM   3465 C  CB    . VAL D 1 6   ? -10.528 69.721  41.073  1.00 54.84  ? 1006 VAL B CB    1 
ATOM   3466 C  CG1   . VAL D 1 6   ? -11.316 70.021  39.820  1.00 54.78  ? 1006 VAL B CG1   1 
ATOM   3467 C  CG2   . VAL D 1 6   ? -10.409 70.970  41.947  1.00 54.84  ? 1006 VAL B CG2   1 
ATOM   3468 N  N     . ASP D 1 7   ? -12.401 66.925  40.586  1.00 55.43  ? 1007 ASP B N     1 
ATOM   3469 C  CA    . ASP D 1 7   ? -12.548 65.726  39.787  1.00 55.93  ? 1007 ASP B CA    1 
ATOM   3470 C  C     . ASP D 1 7   ? -13.233 66.096  38.487  1.00 55.45  ? 1007 ASP B C     1 
ATOM   3471 O  O     . ASP D 1 7   ? -14.378 66.540  38.492  1.00 55.57  ? 1007 ASP B O     1 
ATOM   3472 C  CB    . ASP D 1 7   ? -13.379 64.688  40.551  1.00 56.53  ? 1007 ASP B CB    1 
ATOM   3473 C  CG    . ASP D 1 7   ? -13.207 63.290  40.007  1.00 58.01  ? 1007 ASP B CG    1 
ATOM   3474 O  OD1   . ASP D 1 7   ? -12.762 63.160  38.854  1.00 59.27  ? 1007 ASP B OD1   1 
ATOM   3475 O  OD2   . ASP D 1 7   ? -13.510 62.315  40.722  1.00 65.14  ? 1007 ASP B OD2   1 
ATOM   3476 N  N     . PHE D 1 8   ? -12.537 65.921  37.373  1.00 55.03  ? 1008 PHE B N     1 
ATOM   3477 C  CA    . PHE D 1 8   ? -13.117 66.255  36.069  1.00 54.80  ? 1008 PHE B CA    1 
ATOM   3478 C  C     . PHE D 1 8   ? -14.232 65.278  35.731  1.00 54.41  ? 1008 PHE B C     1 
ATOM   3479 O  O     . PHE D 1 8   ? -14.074 64.076  35.884  1.00 54.96  ? 1008 PHE B O     1 
ATOM   3480 C  CB    . PHE D 1 8   ? -12.057 66.255  34.958  1.00 54.67  ? 1008 PHE B CB    1 
ATOM   3481 C  CG    . PHE D 1 8   ? -10.792 66.984  35.312  1.00 54.60  ? 1008 PHE B CG    1 
ATOM   3482 C  CD1   . PHE D 1 8   ? -10.748 67.867  36.374  1.00 55.78  ? 1008 PHE B CD1   1 
ATOM   3483 C  CD2   . PHE D 1 8   ? -9.651  66.818  34.550  1.00 55.85  ? 1008 PHE B CD2   1 
ATOM   3484 C  CE1   . PHE D 1 8   ? -9.582  68.546  36.691  1.00 55.58  ? 1008 PHE B CE1   1 
ATOM   3485 C  CE2   . PHE D 1 8   ? -8.486  67.500  34.858  1.00 55.40  ? 1008 PHE B CE2   1 
ATOM   3486 C  CZ    . PHE D 1 8   ? -8.452  68.358  35.932  1.00 54.56  ? 1008 PHE B CZ    1 
ATOM   3487 N  N     . ASP D 1 9   ? -15.362 65.797  35.274  1.00 54.34  ? 1009 ASP B N     1 
ATOM   3488 C  CA    . ASP D 1 9   ? -16.529 64.955  35.018  1.00 54.28  ? 1009 ASP B CA    1 
ATOM   3489 C  C     . ASP D 1 9   ? -16.369 64.128  33.765  1.00 53.81  ? 1009 ASP B C     1 
ATOM   3490 O  O     . ASP D 1 9   ? -15.922 64.637  32.738  1.00 53.88  ? 1009 ASP B O     1 
ATOM   3491 C  CB    . ASP D 1 9   ? -17.799 65.796  34.927  1.00 54.30  ? 1009 ASP B CB    1 
ATOM   3492 C  CG    . ASP D 1 9   ? -18.089 66.519  36.204  1.00 55.48  ? 1009 ASP B CG    1 
ATOM   3493 O  OD1   . ASP D 1 9   ? -17.770 65.956  37.276  1.00 56.95  ? 1009 ASP B OD1   1 
ATOM   3494 O  OD2   . ASP D 1 9   ? -18.621 67.650  36.136  1.00 57.00  ? 1009 ASP B OD2   1 
ATOM   3495 N  N     . TYR D 1 10  ? -16.759 62.859  33.852  1.00 53.51  ? 1010 TYR B N     1 
ATOM   3496 C  CA    . TYR D 1 10  ? -16.661 61.928  32.727  1.00 53.38  ? 1010 TYR B CA    1 
ATOM   3497 C  C     . TYR D 1 10  ? -15.590 62.402  31.755  1.00 52.91  ? 1010 TYR B C     1 
ATOM   3498 O  O     . TYR D 1 10  ? -15.818 62.561  30.555  1.00 52.75  ? 1010 TYR B O     1 
ATOM   3499 C  CB    . TYR D 1 10  ? -18.022 61.726  32.054  1.00 53.64  ? 1010 TYR B CB    1 
ATOM   3500 C  CG    . TYR D 1 10  ? -18.639 62.974  31.475  1.00 55.18  ? 1010 TYR B CG    1 
ATOM   3501 C  CD1   . TYR D 1 10  ? -18.709 63.155  30.097  1.00 56.16  ? 1010 TYR B CD1   1 
ATOM   3502 C  CD2   . TYR D 1 10  ? -19.174 63.965  32.298  1.00 56.19  ? 1010 TYR B CD2   1 
ATOM   3503 C  CE1   . TYR D 1 10  ? -19.272 64.288  29.555  1.00 56.68  ? 1010 TYR B CE1   1 
ATOM   3504 C  CE2   . TYR D 1 10  ? -19.741 65.112  31.761  1.00 56.49  ? 1010 TYR B CE2   1 
ATOM   3505 C  CZ    . TYR D 1 10  ? -19.788 65.264  30.387  1.00 57.13  ? 1010 TYR B CZ    1 
ATOM   3506 O  OH    . TYR D 1 10  ? -20.342 66.394  29.828  1.00 58.12  ? 1010 TYR B OH    1 
ATOM   3507 N  N     . PHE D 1 11  ? -14.400 62.604  32.305  1.00 52.34  ? 1011 PHE B N     1 
ATOM   3508 C  CA    . PHE D 1 11  ? -13.377 63.391  31.647  1.00 52.35  ? 1011 PHE B CA    1 
ATOM   3509 C  C     . PHE D 1 11  ? -13.166 63.081  30.164  1.00 52.61  ? 1011 PHE B C     1 
ATOM   3510 O  O     . PHE D 1 11  ? -13.378 63.944  29.315  1.00 52.77  ? 1011 PHE B O     1 
ATOM   3511 C  CB    . PHE D 1 11  ? -12.064 63.285  32.407  1.00 52.17  ? 1011 PHE B CB    1 
ATOM   3512 C  CG    . PHE D 1 11  ? -10.980 64.129  31.835  1.00 50.79  ? 1011 PHE B CG    1 
ATOM   3513 C  CD1   . PHE D 1 11  ? -11.221 65.451  31.511  1.00 51.10  ? 1011 PHE B CD1   1 
ATOM   3514 C  CD2   . PHE D 1 11  ? -9.722  63.614  31.636  1.00 49.73  ? 1011 PHE B CD2   1 
ATOM   3515 C  CE1   . PHE D 1 11  ? -10.226 66.231  30.995  1.00 50.30  ? 1011 PHE B CE1   1 
ATOM   3516 C  CE2   . PHE D 1 11  ? -8.731  64.389  31.117  1.00 49.09  ? 1011 PHE B CE2   1 
ATOM   3517 C  CZ    . PHE D 1 11  ? -8.980  65.697  30.797  1.00 49.72  ? 1011 PHE B CZ    1 
ATOM   3518 N  N     . TYR D 1 12  ? -12.741 61.854  29.865  1.00 52.65  ? 1012 TYR B N     1 
ATOM   3519 C  CA    . TYR D 1 12  ? -12.448 61.445  28.492  1.00 52.69  ? 1012 TYR B CA    1 
ATOM   3520 C  C     . TYR D 1 12  ? -13.607 61.729  27.562  1.00 52.67  ? 1012 TYR B C     1 
ATOM   3521 O  O     . TYR D 1 12  ? -13.442 62.389  26.539  1.00 52.89  ? 1012 TYR B O     1 
ATOM   3522 C  CB    . TYR D 1 12  ? -12.160 59.955  28.448  1.00 52.74  ? 1012 TYR B CB    1 
ATOM   3523 C  CG    . TYR D 1 12  ? -10.886 59.552  29.118  1.00 53.20  ? 1012 TYR B CG    1 
ATOM   3524 C  CD1   . TYR D 1 12  ? -10.190 60.436  29.941  1.00 52.89  ? 1012 TYR B CD1   1 
ATOM   3525 C  CD2   . TYR D 1 12  ? -10.386 58.272  28.955  1.00 54.84  ? 1012 TYR B CD2   1 
ATOM   3526 C  CE1   . TYR D 1 12  ? -9.022  60.058  30.556  1.00 52.41  ? 1012 TYR B CE1   1 
ATOM   3527 C  CE2   . TYR D 1 12  ? -9.213  57.884  29.573  1.00 54.61  ? 1012 TYR B CE2   1 
ATOM   3528 C  CZ    . TYR D 1 12  ? -8.540  58.779  30.367  1.00 52.91  ? 1012 TYR B CZ    1 
ATOM   3529 O  OH    . TYR D 1 12  ? -7.379  58.371  30.969  1.00 53.32  ? 1012 TYR B OH    1 
ATOM   3530 N  N     . ALA D 1 13  ? -14.777 61.212  27.930  1.00 52.63  ? 1013 ALA B N     1 
ATOM   3531 C  CA    . ALA D 1 13  ? -16.004 61.415  27.176  1.00 52.73  ? 1013 ALA B CA    1 
ATOM   3532 C  C     . ALA D 1 13  ? -16.312 62.898  27.026  1.00 52.89  ? 1013 ALA B C     1 
ATOM   3533 O  O     . ALA D 1 13  ? -16.721 63.356  25.952  1.00 52.87  ? 1013 ALA B O     1 
ATOM   3534 C  CB    . ALA D 1 13  ? -17.164 60.702  27.849  1.00 52.39  ? 1013 ALA B CB    1 
ATOM   3535 N  N     . GLN D 1 14  ? -16.111 63.658  28.095  1.00 52.92  ? 1014 GLN B N     1 
ATOM   3536 C  CA    . GLN D 1 14  ? -16.384 65.078  28.005  1.00 53.02  ? 1014 GLN B CA    1 
ATOM   3537 C  C     . GLN D 1 14  ? -15.414 65.816  27.098  1.00 52.89  ? 1014 GLN B C     1 
ATOM   3538 O  O     . GLN D 1 14  ? -15.820 66.720  26.392  1.00 53.06  ? 1014 GLN B O     1 
ATOM   3539 C  CB    . GLN D 1 14  ? -16.444 65.757  29.367  1.00 53.02  ? 1014 GLN B CB    1 
ATOM   3540 C  CG    . GLN D 1 14  ? -17.122 67.117  29.246  1.00 53.65  ? 1014 GLN B CG    1 
ATOM   3541 C  CD    . GLN D 1 14  ? -17.080 67.923  30.506  1.00 54.03  ? 1014 GLN B CD    1 
ATOM   3542 O  OE1   . GLN D 1 14  ? -16.611 67.454  31.541  1.00 55.21  ? 1014 GLN B OE1   1 
ATOM   3543 N  NE2   . GLN D 1 14  ? -17.573 69.153  30.431  1.00 54.73  ? 1014 GLN B NE2   1 
ATOM   3544 N  N     . VAL D 1 15  ? -14.139 65.453  27.125  1.00 52.97  ? 1015 VAL B N     1 
ATOM   3545 C  CA    . VAL D 1 15  ? -13.187 66.075  26.222  1.00 53.21  ? 1015 VAL B CA    1 
ATOM   3546 C  C     . VAL D 1 15  ? -13.576 65.764  24.773  1.00 53.85  ? 1015 VAL B C     1 
ATOM   3547 O  O     . VAL D 1 15  ? -13.532 66.637  23.910  1.00 54.13  ? 1015 VAL B O     1 
ATOM   3548 C  CB    . VAL D 1 15  ? -11.752 65.597  26.490  1.00 53.29  ? 1015 VAL B CB    1 
ATOM   3549 C  CG1   . VAL D 1 15  ? -10.810 66.108  25.392  1.00 52.60  ? 1015 VAL B CG1   1 
ATOM   3550 C  CG2   . VAL D 1 15  ? -11.299 66.037  27.859  1.00 52.26  ? 1015 VAL B CG2   1 
ATOM   3551 N  N     . GLU D 1 16  ? -13.969 64.520  24.515  1.00 54.21  ? 1016 GLU B N     1 
ATOM   3552 C  CA    . GLU D 1 16  ? -14.491 64.149  23.213  1.00 54.94  ? 1016 GLU B CA    1 
ATOM   3553 C  C     . GLU D 1 16  ? -15.672 65.009  22.818  1.00 55.26  ? 1016 GLU B C     1 
ATOM   3554 O  O     . GLU D 1 16  ? -15.820 65.360  21.651  1.00 55.64  ? 1016 GLU B O     1 
ATOM   3555 C  CB    . GLU D 1 16  ? -14.893 62.673  23.189  1.00 54.98  ? 1016 GLU B CB    1 
ATOM   3556 C  CG    . GLU D 1 16  ? -13.733 61.745  23.394  1.00 55.44  ? 1016 GLU B CG    1 
ATOM   3557 C  CD    . GLU D 1 16  ? -12.698 61.876  22.304  1.00 56.90  ? 1016 GLU B CD    1 
ATOM   3558 O  OE1   . GLU D 1 16  ? -12.932 62.647  21.348  1.00 57.02  ? 1016 GLU B OE1   1 
ATOM   3559 O  OE2   . GLU D 1 16  ? -11.654 61.197  22.396  1.00 57.58  ? 1016 GLU B OE2   1 
ATOM   3560 N  N     . GLU D 1 17  ? -16.514 65.341  23.793  1.00 55.92  ? 1017 GLU B N     1 
ATOM   3561 C  CA    . GLU D 1 17  ? -17.670 66.204  23.562  1.00 56.36  ? 1017 GLU B CA    1 
ATOM   3562 C  C     . GLU D 1 17  ? -17.253 67.634  23.268  1.00 56.46  ? 1017 GLU B C     1 
ATOM   3563 O  O     . GLU D 1 17  ? -17.894 68.323  22.475  1.00 57.00  ? 1017 GLU B O     1 
ATOM   3564 C  CB    . GLU D 1 17  ? -18.612 66.178  24.764  1.00 56.56  ? 1017 GLU B CB    1 
ATOM   3565 C  CG    . GLU D 1 17  ? -19.484 64.949  24.824  1.00 57.77  ? 1017 GLU B CG    1 
ATOM   3566 C  CD    . GLU D 1 17  ? -20.417 64.939  26.033  1.00 59.79  ? 1017 GLU B CD    1 
ATOM   3567 O  OE1   . GLU D 1 17  ? -20.177 65.692  27.007  1.00 59.72  ? 1017 GLU B OE1   1 
ATOM   3568 O  OE2   . GLU D 1 17  ? -21.397 64.169  26.000  1.00 60.66  ? 1017 GLU B OE2   1 
ATOM   3569 N  N     . VAL D 1 18  ? -16.184 68.076  23.919  1.00 56.36  ? 1018 VAL B N     1 
ATOM   3570 C  CA    . VAL D 1 18  ? -15.650 69.416  23.724  1.00 56.43  ? 1018 VAL B CA    1 
ATOM   3571 C  C     . VAL D 1 18  ? -14.999 69.489  22.345  1.00 56.82  ? 1018 VAL B C     1 
ATOM   3572 O  O     . VAL D 1 18  ? -15.134 70.483  21.625  1.00 56.98  ? 1018 VAL B O     1 
ATOM   3573 C  CB    . VAL D 1 18  ? -14.592 69.746  24.808  1.00 56.59  ? 1018 VAL B CB    1 
ATOM   3574 C  CG1   . VAL D 1 18  ? -13.722 70.932  24.397  1.00 56.21  ? 1018 VAL B CG1   1 
ATOM   3575 C  CG2   . VAL D 1 18  ? -15.252 69.977  26.157  1.00 55.97  ? 1018 VAL B CG2   1 
ATOM   3576 N  N     . LEU D 1 19  ? -14.304 68.413  21.982  1.00 56.75  ? 1019 LEU B N     1 
ATOM   3577 C  CA    . LEU D 1 19  ? -13.583 68.333  20.720  1.00 56.64  ? 1019 LEU B CA    1 
ATOM   3578 C  C     . LEU D 1 19  ? -14.515 68.068  19.541  1.00 56.93  ? 1019 LEU B C     1 
ATOM   3579 O  O     . LEU D 1 19  ? -14.098 68.128  18.385  1.00 57.20  ? 1019 LEU B O     1 
ATOM   3580 C  CB    . LEU D 1 19  ? -12.497 67.259  20.811  1.00 56.28  ? 1019 LEU B CB    1 
ATOM   3581 C  CG    . LEU D 1 19  ? -11.091 67.741  21.191  1.00 55.94  ? 1019 LEU B CG    1 
ATOM   3582 C  CD1   . LEU D 1 19  ? -11.084 69.131  21.797  1.00 55.80  ? 1019 LEU B CD1   1 
ATOM   3583 C  CD2   . LEU D 1 19  ? -10.377 66.762  22.088  1.00 54.54  ? 1019 LEU B CD2   1 
ATOM   3584 N  N     . ASN D 1 20  ? -15.775 67.775  19.848  1.00 57.31  ? 1020 ASN B N     1 
ATOM   3585 C  CA    . ASN D 1 20  ? -16.800 67.529  18.846  1.00 57.69  ? 1020 ASN B CA    1 
ATOM   3586 C  C     . ASN D 1 20  ? -18.171 67.732  19.471  1.00 58.08  ? 1020 ASN B C     1 
ATOM   3587 O  O     . ASN D 1 20  ? -18.803 66.770  19.904  1.00 58.28  ? 1020 ASN B O     1 
ATOM   3588 C  CB    . ASN D 1 20  ? -16.694 66.101  18.318  1.00 57.63  ? 1020 ASN B CB    1 
ATOM   3589 C  CG    . ASN D 1 20  ? -17.429 65.908  17.010  1.00 58.28  ? 1020 ASN B CG    1 
ATOM   3590 O  OD1   . ASN D 1 20  ? -18.396 65.163  16.942  1.00 58.33  ? 1020 ASN B OD1   1 
ATOM   3591 N  ND2   . ASN D 1 20  ? -16.964 66.582  15.955  1.00 59.97  ? 1020 ASN B ND2   1 
ATOM   3592 N  N     . PRO D 1 21  ? -18.625 68.994  19.550  1.00 58.33  ? 1021 PRO B N     1 
ATOM   3593 C  CA    . PRO D 1 21  ? -19.909 69.340  20.158  1.00 58.43  ? 1021 PRO B CA    1 
ATOM   3594 C  C     . PRO D 1 21  ? -21.119 68.711  19.465  1.00 58.54  ? 1021 PRO B C     1 
ATOM   3595 O  O     . PRO D 1 21  ? -22.208 68.711  20.026  1.00 58.29  ? 1021 PRO B O     1 
ATOM   3596 C  CB    . PRO D 1 21  ? -19.949 70.867  20.042  1.00 58.41  ? 1021 PRO B CB    1 
ATOM   3597 C  CG    . PRO D 1 21  ? -18.519 71.267  19.925  1.00 58.38  ? 1021 PRO B CG    1 
ATOM   3598 C  CD    . PRO D 1 21  ? -17.914 70.195  19.080  1.00 58.47  ? 1021 PRO B CD    1 
ATOM   3599 N  N     . SER D 1 22  ? -20.931 68.177  18.262  1.00 59.10  ? 1022 SER B N     1 
ATOM   3600 C  CA    . SER D 1 22  ? -21.980 67.395  17.606  1.00 59.58  ? 1022 SER B CA    1 
ATOM   3601 C  C     . SER D 1 22  ? -22.321 66.180  18.477  1.00 59.78  ? 1022 SER B C     1 
ATOM   3602 O  O     . SER D 1 22  ? -23.434 65.661  18.434  1.00 60.17  ? 1022 SER B O     1 
ATOM   3603 C  CB    . SER D 1 22  ? -21.539 66.951  16.209  1.00 59.69  ? 1022 SER B CB    1 
ATOM   3604 O  OG    . SER D 1 22  ? -20.981 65.649  16.234  1.00 60.30  ? 1022 SER B OG    1 
ATOM   3605 N  N     . LEU D 1 23  ? -21.348 65.749  19.273  1.00 59.71  ? 1023 LEU B N     1 
ATOM   3606 C  CA    . LEU D 1 23  ? -21.537 64.707  20.280  1.00 59.85  ? 1023 LEU B CA    1 
ATOM   3607 C  C     . LEU D 1 23  ? -22.457 65.118  21.429  1.00 60.08  ? 1023 LEU B C     1 
ATOM   3608 O  O     . LEU D 1 23  ? -22.901 64.271  22.215  1.00 60.25  ? 1023 LEU B O     1 
ATOM   3609 C  CB    . LEU D 1 23  ? -20.184 64.328  20.881  1.00 59.49  ? 1023 LEU B CB    1 
ATOM   3610 C  CG    . LEU D 1 23  ? -19.485 63.071  20.369  1.00 59.06  ? 1023 LEU B CG    1 
ATOM   3611 C  CD1   . LEU D 1 23  ? -19.809 62.760  18.915  1.00 58.28  ? 1023 LEU B CD1   1 
ATOM   3612 C  CD2   . LEU D 1 23  ? -17.993 63.195  20.603  1.00 57.68  ? 1023 LEU B CD2   1 
ATOM   3613 N  N     . LYS D 1 24  ? -22.725 66.414  21.545  1.00 60.19  ? 1024 LYS B N     1 
ATOM   3614 C  CA    . LYS D 1 24  ? -23.412 66.925  22.724  1.00 60.28  ? 1024 LYS B CA    1 
ATOM   3615 C  C     . LYS D 1 24  ? -24.856 66.440  22.802  1.00 59.85  ? 1024 LYS B C     1 
ATOM   3616 O  O     . LYS D 1 24  ? -25.630 66.596  21.852  1.00 59.68  ? 1024 LYS B O     1 
ATOM   3617 C  CB    . LYS D 1 24  ? -23.363 68.456  22.760  1.00 60.60  ? 1024 LYS B CB    1 
ATOM   3618 C  CG    . LYS D 1 24  ? -23.394 69.035  24.167  1.00 61.52  ? 1024 LYS B CG    1 
ATOM   3619 C  CD    . LYS D 1 24  ? -22.144 68.646  24.960  1.00 62.34  ? 1024 LYS B CD    1 
ATOM   3620 C  CE    . LYS D 1 24  ? -22.189 69.211  26.383  1.00 63.26  ? 1024 LYS B CE    1 
ATOM   3621 N  NZ    . LYS D 1 24  ? -23.352 68.704  27.173  1.00 62.96  ? 1024 LYS B NZ    1 
ATOM   3622 N  N     . GLY D 1 25  ? -25.201 65.832  23.933  1.00 59.28  ? 1025 GLY B N     1 
ATOM   3623 C  CA    . GLY D 1 25  ? -26.575 65.421  24.196  1.00 58.76  ? 1025 GLY B CA    1 
ATOM   3624 C  C     . GLY D 1 25  ? -26.824 63.931  24.070  1.00 58.20  ? 1025 GLY B C     1 
ATOM   3625 O  O     . GLY D 1 25  ? -27.826 63.418  24.568  1.00 58.54  ? 1025 GLY B O     1 
ATOM   3626 N  N     . LYS D 1 26  ? -25.917 63.235  23.400  1.00 57.49  ? 1026 LYS B N     1 
ATOM   3627 C  CA    . LYS D 1 26  ? -26.076 61.802  23.183  1.00 56.61  ? 1026 LYS B CA    1 
ATOM   3628 C  C     . LYS D 1 26  ? -25.015 60.977  23.906  1.00 55.46  ? 1026 LYS B C     1 
ATOM   3629 O  O     . LYS D 1 26  ? -24.026 61.522  24.392  1.00 55.38  ? 1026 LYS B O     1 
ATOM   3630 C  CB    . LYS D 1 26  ? -26.080 61.476  21.686  1.00 56.78  ? 1026 LYS B CB    1 
ATOM   3631 C  CG    . LYS D 1 26  ? -25.108 62.277  20.841  1.00 57.33  ? 1026 LYS B CG    1 
ATOM   3632 C  CD    . LYS D 1 26  ? -25.420 62.050  19.353  1.00 58.21  ? 1026 LYS B CD    1 
ATOM   3633 C  CE    . LYS D 1 26  ? -24.838 63.151  18.486  1.00 58.81  ? 1026 LYS B CE    1 
ATOM   3634 N  NZ    . LYS D 1 26  ? -24.514 62.688  17.103  1.00 58.45  ? 1026 LYS B NZ    1 
ATOM   3635 N  N     . PRO D 1 27  ? -25.220 59.654  23.967  1.00 54.22  ? 1027 PRO B N     1 
ATOM   3636 C  CA    . PRO D 1 27  ? -24.279 58.775  24.642  1.00 53.18  ? 1027 PRO B CA    1 
ATOM   3637 C  C     . PRO D 1 27  ? -22.928 58.733  23.928  1.00 52.27  ? 1027 PRO B C     1 
ATOM   3638 O  O     . PRO D 1 27  ? -22.837 58.389  22.747  1.00 52.24  ? 1027 PRO B O     1 
ATOM   3639 C  CB    . PRO D 1 27  ? -24.955 57.399  24.572  1.00 53.10  ? 1027 PRO B CB    1 
ATOM   3640 C  CG    . PRO D 1 27  ? -26.347 57.640  24.122  1.00 53.53  ? 1027 PRO B CG    1 
ATOM   3641 C  CD    . PRO D 1 27  ? -26.344 58.914  23.369  1.00 54.04  ? 1027 PRO B CD    1 
ATOM   3642 N  N     . VAL D 1 28  ? -21.893 59.099  24.657  1.00 51.20  ? 1028 VAL B N     1 
ATOM   3643 C  CA    . VAL D 1 28  ? -20.546 59.005  24.178  1.00 50.24  ? 1028 VAL B CA    1 
ATOM   3644 C  C     . VAL D 1 28  ? -19.870 57.979  25.052  1.00 49.92  ? 1028 VAL B C     1 
ATOM   3645 O  O     . VAL D 1 28  ? -19.954 58.037  26.273  1.00 49.33  ? 1028 VAL B O     1 
ATOM   3646 C  CB    . VAL D 1 28  ? -19.807 60.346  24.305  1.00 50.12  ? 1028 VAL B CB    1 
ATOM   3647 C  CG1   . VAL D 1 28  ? -18.329 60.168  23.963  1.00 50.13  ? 1028 VAL B CG1   1 
ATOM   3648 C  CG2   . VAL D 1 28  ? -20.468 61.387  23.425  1.00 49.12  ? 1028 VAL B CG2   1 
ATOM   3649 N  N     . VAL D 1 29  ? -19.219 57.020  24.416  1.00 49.53  ? 1029 VAL B N     1 
ATOM   3650 C  CA    . VAL D 1 29  ? -18.523 55.987  25.136  1.00 49.47  ? 1029 VAL B CA    1 
ATOM   3651 C  C     . VAL D 1 29  ? -17.073 55.964  24.670  1.00 50.02  ? 1029 VAL B C     1 
ATOM   3652 O  O     . VAL D 1 29  ? -16.784 55.608  23.524  1.00 49.87  ? 1029 VAL B O     1 
ATOM   3653 C  CB    . VAL D 1 29  ? -19.196 54.624  24.903  1.00 49.21  ? 1029 VAL B CB    1 
ATOM   3654 C  CG1   . VAL D 1 29  ? -18.524 53.551  25.729  1.00 48.71  ? 1029 VAL B CG1   1 
ATOM   3655 C  CG2   . VAL D 1 29  ? -20.664 54.708  25.230  1.00 48.43  ? 1029 VAL B CG2   1 
ATOM   3656 N  N     . VAL D 1 30  ? -16.162 56.386  25.539  1.00 50.61  ? 1030 VAL B N     1 
ATOM   3657 C  CA    . VAL D 1 30  ? -14.749 56.334  25.202  1.00 51.66  ? 1030 VAL B CA    1 
ATOM   3658 C  C     . VAL D 1 30  ? -14.215 54.948  25.543  1.00 52.88  ? 1030 VAL B C     1 
ATOM   3659 O  O     . VAL D 1 30  ? -14.337 54.476  26.679  1.00 52.58  ? 1030 VAL B O     1 
ATOM   3660 C  CB    . VAL D 1 30  ? -13.943 57.423  25.894  1.00 51.66  ? 1030 VAL B CB    1 
ATOM   3661 C  CG1   . VAL D 1 30  ? -12.464 57.241  25.607  1.00 51.03  ? 1030 VAL B CG1   1 
ATOM   3662 C  CG2   . VAL D 1 30  ? -14.410 58.785  25.412  1.00 51.38  ? 1030 VAL B CG2   1 
ATOM   3663 N  N     . CYS D 1 31  ? -13.671 54.289  24.527  1.00 54.30  ? 1031 CYS B N     1 
ATOM   3664 C  CA    . CYS D 1 31  ? -13.338 52.878  24.607  1.00 56.14  ? 1031 CYS B CA    1 
ATOM   3665 C  C     . CYS D 1 31  ? -11.855 52.616  24.494  1.00 57.15  ? 1031 CYS B C     1 
ATOM   3666 O  O     . CYS D 1 31  ? -11.127 53.320  23.796  1.00 57.14  ? 1031 CYS B O     1 
ATOM   3667 C  CB    . CYS D 1 31  ? -14.044 52.094  23.502  1.00 56.00  ? 1031 CYS B CB    1 
ATOM   3668 S  SG    . CYS D 1 31  ? -15.839 52.179  23.549  1.00 56.95  ? 1031 CYS B SG    1 
ATOM   3669 N  N     . VAL D 1 32  ? -11.422 51.591  25.212  1.00 58.80  ? 1032 VAL B N     1 
ATOM   3670 C  CA    . VAL D 1 32  ? -10.124 50.998  24.994  1.00 59.97  ? 1032 VAL B CA    1 
ATOM   3671 C  C     . VAL D 1 32  ? -10.391 49.780  24.158  1.00 61.17  ? 1032 VAL B C     1 
ATOM   3672 O  O     . VAL D 1 32  ? -10.928 48.792  24.644  1.00 60.96  ? 1032 VAL B O     1 
ATOM   3673 C  CB    . VAL D 1 32  ? -9.485  50.548  26.305  1.00 59.91  ? 1032 VAL B CB    1 
ATOM   3674 C  CG1   . VAL D 1 32  ? -8.018  50.212  26.082  1.00 59.31  ? 1032 VAL B CG1   1 
ATOM   3675 C  CG2   . VAL D 1 32  ? -9.662  51.624  27.356  1.00 59.22  ? 1032 VAL B CG2   1 
ATOM   3676 N  N     . PHE D 1 33  ? -10.052 49.874  22.882  1.00 63.20  ? 1033 PHE B N     1 
ATOM   3677 C  CA    . PHE D 1 33  ? -10.159 48.751  21.989  1.00 65.28  ? 1033 PHE B CA    1 
ATOM   3678 C  C     . PHE D 1 33  ? -8.883  47.946  22.133  1.00 66.51  ? 1033 PHE B C     1 
ATOM   3679 O  O     . PHE D 1 33  ? -7.800  48.458  21.889  1.00 66.79  ? 1033 PHE B O     1 
ATOM   3680 C  CB    . PHE D 1 33  ? -10.361 49.239  20.560  1.00 65.41  ? 1033 PHE B CB    1 
ATOM   3681 C  CG    . PHE D 1 33  ? -11.613 50.052  20.372  1.00 66.07  ? 1033 PHE B CG    1 
ATOM   3682 C  CD1   . PHE D 1 33  ? -12.848 49.429  20.238  1.00 66.87  ? 1033 PHE B CD1   1 
ATOM   3683 C  CD2   . PHE D 1 33  ? -11.558 51.435  20.328  1.00 65.81  ? 1033 PHE B CD2   1 
ATOM   3684 C  CE1   . PHE D 1 33  ? -14.008 50.173  20.060  1.00 66.63  ? 1033 PHE B CE1   1 
ATOM   3685 C  CE2   . PHE D 1 33  ? -12.706 52.183  20.145  1.00 65.89  ? 1033 PHE B CE2   1 
ATOM   3686 C  CZ    . PHE D 1 33  ? -13.934 51.554  20.014  1.00 66.92  ? 1033 PHE B CZ    1 
ATOM   3687 N  N     . SER D 1 34  ? -9.016  46.691  22.554  1.00 68.48  ? 1034 SER B N     1 
ATOM   3688 C  CA    . SER D 1 34  ? -7.856  45.878  22.945  1.00 70.22  ? 1034 SER B CA    1 
ATOM   3689 C  C     . SER D 1 34  ? -7.002  45.453  21.745  1.00 71.31  ? 1034 SER B C     1 
ATOM   3690 O  O     . SER D 1 34  ? -5.763  45.412  21.831  1.00 71.78  ? 1034 SER B O     1 
ATOM   3691 C  CB    . SER D 1 34  ? -8.306  44.647  23.730  1.00 69.97  ? 1034 SER B CB    1 
ATOM   3692 O  OG    . SER D 1 34  ? -8.930  43.714  22.870  1.00 70.73  ? 1034 SER B OG    1 
ATOM   3693 N  N     . GLY D 1 35  ? -7.666  45.140  20.632  1.00 72.17  ? 1035 GLY B N     1 
ATOM   3694 C  CA    . GLY D 1 35  ? -6.967  44.774  19.403  1.00 73.23  ? 1035 GLY B CA    1 
ATOM   3695 C  C     . GLY D 1 35  ? -7.230  43.345  18.964  1.00 73.88  ? 1035 GLY B C     1 
ATOM   3696 O  O     . GLY D 1 35  ? -6.879  42.959  17.841  1.00 74.02  ? 1035 GLY B O     1 
ATOM   3697 N  N     . ARG D 1 36  ? -7.837  42.560  19.856  1.00 74.18  ? 1036 ARG B N     1 
ATOM   3698 C  CA    . ARG D 1 36  ? -8.256  41.193  19.541  1.00 74.73  ? 1036 ARG B CA    1 
ATOM   3699 C  C     . ARG D 1 36  ? -9.382  41.172  18.511  1.00 74.78  ? 1036 ARG B C     1 
ATOM   3700 O  O     . ARG D 1 36  ? -9.189  41.545  17.351  1.00 74.97  ? 1036 ARG B O     1 
ATOM   3701 C  CB    . ARG D 1 36  ? -8.699  40.457  20.809  1.00 74.86  ? 1036 ARG B CB    1 
ATOM   3702 C  CG    . ARG D 1 36  ? -7.608  39.628  21.467  1.00 75.22  ? 1036 ARG B CG    1 
ATOM   3703 C  CD    . ARG D 1 36  ? -7.286  38.392  20.642  1.00 75.60  ? 1036 ARG B CD    1 
ATOM   3704 N  NE    . ARG D 1 36  ? -6.240  37.583  21.259  1.00 76.09  ? 1036 ARG B NE    1 
ATOM   3705 C  CZ    . ARG D 1 36  ? -6.463  36.610  22.134  1.00 76.38  ? 1036 ARG B CZ    1 
ATOM   3706 N  NH1   . ARG D 1 36  ? -7.703  36.313  22.498  1.00 76.98  ? 1036 ARG B NH1   1 
ATOM   3707 N  NH2   . ARG D 1 36  ? -5.446  35.930  22.646  1.00 76.73  ? 1036 ARG B NH2   1 
ATOM   3708 N  N     . PHE D 1 37  ? -10.559 40.730  18.938  1.00 74.85  ? 1037 PHE B N     1 
ATOM   3709 C  CA    . PHE D 1 37  ? -11.721 40.698  18.054  1.00 74.95  ? 1037 PHE B CA    1 
ATOM   3710 C  C     . PHE D 1 37  ? -12.313 42.095  17.833  1.00 74.67  ? 1037 PHE B C     1 
ATOM   3711 O  O     . PHE D 1 37  ? -12.017 43.033  18.577  1.00 74.49  ? 1037 PHE B O     1 
ATOM   3712 C  CB    . PHE D 1 37  ? -12.782 39.696  18.556  1.00 75.12  ? 1037 PHE B CB    1 
ATOM   3713 C  CG    . PHE D 1 37  ? -13.174 39.868  20.013  1.00 76.13  ? 1037 PHE B CG    1 
ATOM   3714 C  CD1   . PHE D 1 37  ? -14.455 40.295  20.356  1.00 76.63  ? 1037 PHE B CD1   1 
ATOM   3715 C  CD2   . PHE D 1 37  ? -12.273 39.573  21.039  1.00 76.96  ? 1037 PHE B CD2   1 
ATOM   3716 C  CE1   . PHE D 1 37  ? -14.830 40.443  21.695  1.00 76.88  ? 1037 PHE B CE1   1 
ATOM   3717 C  CE2   . PHE D 1 37  ? -12.636 39.721  22.380  1.00 77.08  ? 1037 PHE B CE2   1 
ATOM   3718 C  CZ    . PHE D 1 37  ? -13.918 40.156  22.708  1.00 76.99  ? 1037 PHE B CZ    1 
ATOM   3719 N  N     . GLU D 1 38  ? -13.116 42.234  16.781  1.00 74.40  ? 1038 GLU B N     1 
ATOM   3720 C  CA    . GLU D 1 38  ? -13.838 43.476  16.512  1.00 74.01  ? 1038 GLU B CA    1 
ATOM   3721 C  C     . GLU D 1 38  ? -14.685 43.844  17.730  1.00 73.49  ? 1038 GLU B C     1 
ATOM   3722 O  O     . GLU D 1 38  ? -15.412 42.997  18.266  1.00 73.60  ? 1038 GLU B O     1 
ATOM   3723 C  CB    . GLU D 1 38  ? -14.717 43.301  15.267  1.00 74.24  ? 1038 GLU B CB    1 
ATOM   3724 C  CG    . GLU D 1 38  ? -15.953 44.198  15.178  1.00 74.69  ? 1038 GLU B CG    1 
ATOM   3725 C  CD    . GLU D 1 38  ? -16.949 43.702  14.131  1.00 75.82  ? 1038 GLU B CD    1 
ATOM   3726 O  OE1   . GLU D 1 38  ? -18.155 44.017  14.252  1.00 76.53  ? 1038 GLU B OE1   1 
ATOM   3727 O  OE2   . GLU D 1 38  ? -16.528 42.986  13.188  1.00 75.50  ? 1038 GLU B OE2   1 
ATOM   3728 N  N     . ASP D 1 39  ? -14.577 45.097  18.169  1.00 72.56  ? 1039 ASP B N     1 
ATOM   3729 C  CA    . ASP D 1 39  ? -15.299 45.579  19.351  1.00 71.60  ? 1039 ASP B CA    1 
ATOM   3730 C  C     . ASP D 1 39  ? -14.726 44.988  20.626  1.00 70.85  ? 1039 ASP B C     1 
ATOM   3731 O  O     . ASP D 1 39  ? -15.405 44.935  21.655  1.00 71.27  ? 1039 ASP B O     1 
ATOM   3732 C  CB    . ASP D 1 39  ? -16.796 45.247  19.272  1.00 71.63  ? 1039 ASP B CB    1 
ATOM   3733 C  CG    . ASP D 1 39  ? -17.588 46.286  18.507  1.00 71.79  ? 1039 ASP B CG    1 
ATOM   3734 O  OD1   . ASP D 1 39  ? -17.144 47.454  18.460  1.00 71.98  ? 1039 ASP B OD1   1 
ATOM   3735 O  OD2   . ASP D 1 39  ? -18.659 45.936  17.961  1.00 71.94  ? 1039 ASP B OD2   1 
ATOM   3736 N  N     . SER D 1 40  ? -13.483 44.529  20.563  1.00 69.52  ? 1040 SER B N     1 
ATOM   3737 C  CA    . SER D 1 40  ? -12.853 43.957  21.743  1.00 68.20  ? 1040 SER B CA    1 
ATOM   3738 C  C     . SER D 1 40  ? -12.246 45.055  22.590  1.00 67.22  ? 1040 SER B C     1 
ATOM   3739 O  O     . SER D 1 40  ? -11.371 45.810  22.134  1.00 66.97  ? 1040 SER B O     1 
ATOM   3740 C  CB    . SER D 1 40  ? -11.763 42.963  21.359  1.00 68.35  ? 1040 SER B CB    1 
ATOM   3741 O  OG    . SER D 1 40  ? -10.708 43.624  20.681  1.00 68.58  ? 1040 SER B OG    1 
ATOM   3742 N  N     . GLY D 1 41  ? -12.714 45.131  23.829  1.00 65.70  ? 1041 GLY B N     1 
ATOM   3743 C  CA    . GLY D 1 41  ? -12.128 46.018  24.801  1.00 64.00  ? 1041 GLY B CA    1 
ATOM   3744 C  C     . GLY D 1 41  ? -13.086 46.346  25.921  1.00 62.91  ? 1041 GLY B C     1 
ATOM   3745 O  O     . GLY D 1 41  ? -14.058 45.640  26.162  1.00 62.83  ? 1041 GLY B O     1 
ATOM   3746 N  N     . ALA D 1 42  ? -12.795 47.428  26.619  1.00 61.64  ? 1042 ALA B N     1 
ATOM   3747 C  CA    . ALA D 1 42  ? -13.653 47.869  27.676  1.00 60.24  ? 1042 ALA B CA    1 
ATOM   3748 C  C     . ALA D 1 42  ? -13.995 49.333  27.459  1.00 59.08  ? 1042 ALA B C     1 
ATOM   3749 O  O     . ALA D 1 42  ? -13.272 50.067  26.796  1.00 58.94  ? 1042 ALA B O     1 
ATOM   3750 C  CB    . ALA D 1 42  ? -12.963 47.678  29.001  1.00 60.43  ? 1042 ALA B CB    1 
ATOM   3751 N  N     . VAL D 1 43  ? -15.117 49.748  28.017  1.00 57.74  ? 1043 VAL B N     1 
ATOM   3752 C  CA    . VAL D 1 43  ? -15.411 51.156  28.128  1.00 56.23  ? 1043 VAL B CA    1 
ATOM   3753 C  C     . VAL D 1 43  ? -14.459 51.775  29.143  1.00 55.57  ? 1043 VAL B C     1 
ATOM   3754 O  O     . VAL D 1 43  ? -14.336 51.302  30.266  1.00 55.55  ? 1043 VAL B O     1 
ATOM   3755 C  CB    . VAL D 1 43  ? -16.862 51.366  28.553  1.00 55.75  ? 1043 VAL B CB    1 
ATOM   3756 C  CG1   . VAL D 1 43  ? -17.115 52.820  28.862  1.00 54.96  ? 1043 VAL B CG1   1 
ATOM   3757 C  CG2   . VAL D 1 43  ? -17.790 50.850  27.459  1.00 55.53  ? 1043 VAL B CG2   1 
ATOM   3758 N  N     . ALA D 1 44  ? -13.763 52.822  28.730  1.00 55.07  ? 1044 ALA B N     1 
ATOM   3759 C  CA    . ALA D 1 44  ? -12.867 53.542  29.618  1.00 54.56  ? 1044 ALA B CA    1 
ATOM   3760 C  C     . ALA D 1 44  ? -13.706 54.519  30.426  1.00 54.63  ? 1044 ALA B C     1 
ATOM   3761 O  O     . ALA D 1 44  ? -13.557 54.648  31.632  1.00 55.06  ? 1044 ALA B O     1 
ATOM   3762 C  CB    . ALA D 1 44  ? -11.824 54.272  28.811  1.00 53.81  ? 1044 ALA B CB    1 
ATOM   3763 N  N     . THR D 1 45  ? -14.595 55.213  29.738  1.00 54.92  ? 1045 THR B N     1 
ATOM   3764 C  CA    . THR D 1 45  ? -15.558 56.069  30.385  1.00 55.24  ? 1045 THR B CA    1 
ATOM   3765 C  C     . THR D 1 45  ? -16.679 56.410  29.429  1.00 55.09  ? 1045 THR B C     1 
ATOM   3766 O  O     . THR D 1 45  ? -16.518 56.386  28.211  1.00 55.60  ? 1045 THR B O     1 
ATOM   3767 C  CB    . THR D 1 45  ? -14.929 57.375  30.885  1.00 55.63  ? 1045 THR B CB    1 
ATOM   3768 O  OG1   . THR D 1 45  ? -15.841 58.016  31.788  1.00 56.22  ? 1045 THR B OG1   1 
ATOM   3769 C  CG2   . THR D 1 45  ? -14.628 58.310  29.727  1.00 55.33  ? 1045 THR B CG2   1 
ATOM   3770 N  N     . ALA D 1 46  ? -17.828 56.732  29.989  1.00 54.94  ? 1046 ALA B N     1 
ATOM   3771 C  CA    . ALA D 1 46  ? -18.953 57.131  29.179  1.00 54.40  ? 1046 ALA B CA    1 
ATOM   3772 C  C     . ALA D 1 46  ? -19.523 58.424  29.707  1.00 54.07  ? 1046 ALA B C     1 
ATOM   3773 O  O     . ALA D 1 46  ? -19.311 58.796  30.862  1.00 53.43  ? 1046 ALA B O     1 
ATOM   3774 C  CB    . ALA D 1 46  ? -20.010 56.052  29.175  1.00 54.27  ? 1046 ALA B CB    1 
ATOM   3775 N  N     . ASN D 1 47  ? -20.188 59.126  28.804  1.00 54.23  ? 1047 ASN B N     1 
ATOM   3776 C  CA    . ASN D 1 47  ? -21.141 60.166  29.116  1.00 54.45  ? 1047 ASN B CA    1 
ATOM   3777 C  C     . ASN D 1 47  ? -22.000 59.803  30.292  1.00 54.58  ? 1047 ASN B C     1 
ATOM   3778 O  O     . ASN D 1 47  ? -22.148 58.633  30.607  1.00 54.83  ? 1047 ASN B O     1 
ATOM   3779 C  CB    . ASN D 1 47  ? -22.101 60.253  27.939  1.00 54.71  ? 1047 ASN B CB    1 
ATOM   3780 C  CG    . ASN D 1 47  ? -21.896 61.456  27.142  1.00 53.98  ? 1047 ASN B CG    1 
ATOM   3781 O  OD1   . ASN D 1 47  ? -21.374 62.457  27.650  1.00 58.17  ? 1047 ASN B OD1   1 
ATOM   3782 N  ND2   . ASN D 1 47  ? -22.321 61.401  25.890  1.00 56.41  ? 1047 ASN B ND2   1 
ATOM   3783 N  N     . TYR D 1 48  ? -22.616 60.796  30.918  1.00 55.12  ? 1048 TYR B N     1 
ATOM   3784 C  CA    . TYR D 1 48  ? -23.705 60.494  31.836  1.00 55.64  ? 1048 TYR B CA    1 
ATOM   3785 C  C     . TYR D 1 48  ? -24.934 60.116  31.015  1.00 55.70  ? 1048 TYR B C     1 
ATOM   3786 O  O     . TYR D 1 48  ? -25.777 59.343  31.461  1.00 55.98  ? 1048 TYR B O     1 
ATOM   3787 C  CB    . TYR D 1 48  ? -23.965 61.654  32.797  1.00 55.91  ? 1048 TYR B CB    1 
ATOM   3788 C  CG    . TYR D 1 48  ? -22.970 61.665  33.944  1.00 57.37  ? 1048 TYR B CG    1 
ATOM   3789 C  CD1   . TYR D 1 48  ? -21.681 62.162  33.768  1.00 58.53  ? 1048 TYR B CD1   1 
ATOM   3790 C  CD2   . TYR D 1 48  ? -23.311 61.147  35.195  1.00 58.39  ? 1048 TYR B CD2   1 
ATOM   3791 C  CE1   . TYR D 1 48  ? -20.758 62.160  34.807  1.00 59.26  ? 1048 TYR B CE1   1 
ATOM   3792 C  CE2   . TYR D 1 48  ? -22.398 61.138  36.239  1.00 59.85  ? 1048 TYR B CE2   1 
ATOM   3793 C  CZ    . TYR D 1 48  ? -21.120 61.650  36.041  1.00 59.60  ? 1048 TYR B CZ    1 
ATOM   3794 O  OH    . TYR D 1 48  ? -20.215 61.649  37.082  1.00 59.15  ? 1048 TYR B OH    1 
ATOM   3795 N  N     . GLU D 1 49  ? -25.004 60.637  29.793  1.00 55.66  ? 1049 GLU B N     1 
ATOM   3796 C  CA    . GLU D 1 49  ? -25.986 60.179  28.816  1.00 55.94  ? 1049 GLU B CA    1 
ATOM   3797 C  C     . GLU D 1 49  ? -25.909 58.663  28.659  1.00 55.45  ? 1049 GLU B C     1 
ATOM   3798 O  O     . GLU D 1 49  ? -26.930 57.989  28.525  1.00 55.92  ? 1049 GLU B O     1 
ATOM   3799 C  CB    . GLU D 1 49  ? -25.744 60.834  27.450  1.00 56.10  ? 1049 GLU B CB    1 
ATOM   3800 C  CG    . GLU D 1 49  ? -26.043 62.327  27.377  1.00 58.19  ? 1049 GLU B CG    1 
ATOM   3801 C  CD    . GLU D 1 49  ? -25.271 63.152  28.410  1.00 60.65  ? 1049 GLU B CD    1 
ATOM   3802 O  OE1   . GLU D 1 49  ? -24.034 62.966  28.538  1.00 59.77  ? 1049 GLU B OE1   1 
ATOM   3803 O  OE2   . GLU D 1 49  ? -25.915 63.995  29.087  1.00 61.35  ? 1049 GLU B OE2   1 
ATOM   3804 N  N     . ALA D 1 50  ? -24.691 58.135  28.670  1.00 54.71  ? 1050 ALA B N     1 
ATOM   3805 C  CA    . ALA D 1 50  ? -24.471 56.714  28.465  1.00 54.00  ? 1050 ALA B CA    1 
ATOM   3806 C  C     . ALA D 1 50  ? -24.527 55.955  29.780  1.00 53.56  ? 1050 ALA B C     1 
ATOM   3807 O  O     . ALA D 1 50  ? -25.054 54.851  29.833  1.00 53.33  ? 1050 ALA B O     1 
ATOM   3808 C  CB    . ALA D 1 50  ? -23.133 56.478  27.774  1.00 53.72  ? 1050 ALA B CB    1 
ATOM   3809 N  N     . ARG D 1 51  ? -23.963 56.548  30.831  1.00 53.34  ? 1051 ARG B N     1 
ATOM   3810 C  CA    . ARG D 1 51  ? -23.955 55.934  32.153  1.00 53.19  ? 1051 ARG B CA    1 
ATOM   3811 C  C     . ARG D 1 51  ? -25.346 55.639  32.628  1.00 52.54  ? 1051 ARG B C     1 
ATOM   3812 O  O     . ARG D 1 51  ? -25.588 54.575  33.181  1.00 52.70  ? 1051 ARG B O     1 
ATOM   3813 C  CB    . ARG D 1 51  ? -23.280 56.831  33.179  1.00 53.47  ? 1051 ARG B CB    1 
ATOM   3814 C  CG    . ARG D 1 51  ? -21.821 56.565  33.293  1.00 54.17  ? 1051 ARG B CG    1 
ATOM   3815 C  CD    . ARG D 1 51  ? -21.194 57.587  34.151  1.00 54.85  ? 1051 ARG B CD    1 
ATOM   3816 N  NE    . ARG D 1 51  ? -19.967 58.033  33.525  1.00 55.63  ? 1051 ARG B NE    1 
ATOM   3817 C  CZ    . ARG D 1 51  ? -18.914 58.450  34.201  1.00 55.65  ? 1051 ARG B CZ    1 
ATOM   3818 N  NH1   . ARG D 1 51  ? -18.954 58.455  35.524  1.00 55.14  ? 1051 ARG B NH1   1 
ATOM   3819 N  NH2   . ARG D 1 51  ? -17.824 58.837  33.554  1.00 55.55  ? 1051 ARG B NH2   1 
ATOM   3820 N  N     . LYS D 1 52  ? -26.241 56.603  32.428  1.00 51.89  ? 1052 LYS B N     1 
ATOM   3821 C  CA    . LYS D 1 52  ? -27.664 56.434  32.690  1.00 51.43  ? 1052 LYS B CA    1 
ATOM   3822 C  C     . LYS D 1 52  ? -28.125 55.026  32.382  1.00 50.63  ? 1052 LYS B C     1 
ATOM   3823 O  O     . LYS D 1 52  ? -28.940 54.465  33.097  1.00 50.70  ? 1052 LYS B O     1 
ATOM   3824 C  CB    . LYS D 1 52  ? -28.481 57.385  31.818  1.00 51.57  ? 1052 LYS B CB    1 
ATOM   3825 C  CG    . LYS D 1 52  ? -28.856 58.686  32.466  1.00 52.74  ? 1052 LYS B CG    1 
ATOM   3826 C  CD    . LYS D 1 52  ? -29.858 59.428  31.591  1.00 54.42  ? 1052 LYS B CD    1 
ATOM   3827 C  CE    . LYS D 1 52  ? -29.462 59.357  30.121  1.00 55.52  ? 1052 LYS B CE    1 
ATOM   3828 N  NZ    . LYS D 1 52  ? -30.384 60.142  29.247  1.00 55.91  ? 1052 LYS B NZ    1 
ATOM   3829 N  N     . PHE D 1 53  ? -27.613 54.460  31.302  1.00 49.80  ? 1053 PHE B N     1 
ATOM   3830 C  CA    . PHE D 1 53  ? -28.107 53.174  30.858  1.00 49.52  ? 1053 PHE B CA    1 
ATOM   3831 C  C     . PHE D 1 53  ? -27.193 52.005  31.209  1.00 49.42  ? 1053 PHE B C     1 
ATOM   3832 O  O     . PHE D 1 53  ? -27.341 50.915  30.671  1.00 49.16  ? 1053 PHE B O     1 
ATOM   3833 C  CB    . PHE D 1 53  ? -28.422 53.229  29.366  1.00 49.69  ? 1053 PHE B CB    1 
ATOM   3834 C  CG    . PHE D 1 53  ? -29.412 54.296  29.007  1.00 49.14  ? 1053 PHE B CG    1 
ATOM   3835 C  CD1   . PHE D 1 53  ? -30.741 54.175  29.378  1.00 49.35  ? 1053 PHE B CD1   1 
ATOM   3836 C  CD2   . PHE D 1 53  ? -29.014 55.426  28.319  1.00 49.23  ? 1053 PHE B CD2   1 
ATOM   3837 C  CE1   . PHE D 1 53  ? -31.664 55.156  29.053  1.00 49.58  ? 1053 PHE B CE1   1 
ATOM   3838 C  CE2   . PHE D 1 53  ? -29.930 56.413  27.989  1.00 49.63  ? 1053 PHE B CE2   1 
ATOM   3839 C  CZ    . PHE D 1 53  ? -31.254 56.278  28.354  1.00 49.61  ? 1053 PHE B CZ    1 
ATOM   3840 N  N     . GLY D 1 54  ? -26.268 52.233  32.137  1.00 49.45  ? 1054 GLY B N     1 
ATOM   3841 C  CA    . GLY D 1 54  ? -25.375 51.182  32.602  1.00 49.64  ? 1054 GLY B CA    1 
ATOM   3842 C  C     . GLY D 1 54  ? -24.095 51.106  31.802  1.00 49.90  ? 1054 GLY B C     1 
ATOM   3843 O  O     . GLY D 1 54  ? -23.261 50.238  32.025  1.00 49.75  ? 1054 GLY B O     1 
ATOM   3844 N  N     . VAL D 1 55  ? -23.934 52.005  30.846  1.00 50.43  ? 1055 VAL B N     1 
ATOM   3845 C  CA    . VAL D 1 55  ? -22.671 52.058  30.137  1.00 51.28  ? 1055 VAL B CA    1 
ATOM   3846 C  C     . VAL D 1 55  ? -21.707 52.838  31.007  1.00 51.78  ? 1055 VAL B C     1 
ATOM   3847 O  O     . VAL D 1 55  ? -21.808 54.052  31.131  1.00 51.90  ? 1055 VAL B O     1 
ATOM   3848 C  CB    . VAL D 1 55  ? -22.808 52.667  28.742  1.00 51.27  ? 1055 VAL B CB    1 
ATOM   3849 C  CG1   . VAL D 1 55  ? -21.449 52.727  28.064  1.00 51.29  ? 1055 VAL B CG1   1 
ATOM   3850 C  CG2   . VAL D 1 55  ? -23.787 51.832  27.919  1.00 50.77  ? 1055 VAL B CG2   1 
ATOM   3851 N  N     . LYS D 1 56  ? -20.810 52.106  31.656  1.00 52.56  ? 1056 LYS B N     1 
ATOM   3852 C  CA    . LYS D 1 56  ? -19.870 52.688  32.588  1.00 53.38  ? 1056 LYS B CA    1 
ATOM   3853 C  C     . LYS D 1 56  ? -18.485 52.163  32.285  1.00 53.58  ? 1056 LYS B C     1 
ATOM   3854 O  O     . LYS D 1 56  ? -18.328 51.190  31.542  1.00 53.52  ? 1056 LYS B O     1 
ATOM   3855 C  CB    . LYS D 1 56  ? -20.263 52.349  34.030  1.00 53.67  ? 1056 LYS B CB    1 
ATOM   3856 C  CG    . LYS D 1 56  ? -20.298 50.845  34.346  1.00 54.65  ? 1056 LYS B CG    1 
ATOM   3857 C  CD    . LYS D 1 56  ? -21.089 50.580  35.627  1.00 55.99  ? 1056 LYS B CD    1 
ATOM   3858 C  CE    . LYS D 1 56  ? -21.106 49.086  35.969  1.00 57.33  ? 1056 LYS B CE    1 
ATOM   3859 N  NZ    . LYS D 1 56  ? -21.524 48.818  37.391  1.00 57.04  ? 1056 LYS B NZ    1 
ATOM   3860 N  N     . ALA D 1 57  ? -17.485 52.833  32.850  1.00 53.86  ? 1057 ALA B N     1 
ATOM   3861 C  CA    . ALA D 1 57  ? -16.096 52.410  32.753  1.00 54.04  ? 1057 ALA B CA    1 
ATOM   3862 C  C     . ALA D 1 57  ? -15.944 50.939  33.103  1.00 54.27  ? 1057 ALA B C     1 
ATOM   3863 O  O     . ALA D 1 57  ? -16.350 50.504  34.173  1.00 54.60  ? 1057 ALA B O     1 
ATOM   3864 C  CB    . ALA D 1 57  ? -15.245 53.250  33.683  1.00 53.84  ? 1057 ALA B CB    1 
ATOM   3865 N  N     . GLY D 1 58  ? -15.359 50.166  32.208  1.00 54.76  ? 1058 GLY B N     1 
ATOM   3866 C  CA    . GLY D 1 58  ? -14.973 48.819  32.569  1.00 55.71  ? 1058 GLY B CA    1 
ATOM   3867 C  C     . GLY D 1 58  ? -15.768 47.747  31.876  1.00 56.46  ? 1058 GLY B C     1 
ATOM   3868 O  O     . GLY D 1 58  ? -15.250 46.660  31.608  1.00 56.85  ? 1058 GLY B O     1 
ATOM   3869 N  N     . ILE D 1 59  ? -17.026 48.030  31.566  1.00 56.74  ? 1059 ILE B N     1 
ATOM   3870 C  CA    . ILE D 1 59  ? -17.801 47.013  30.897  1.00 57.16  ? 1059 ILE B CA    1 
ATOM   3871 C  C     . ILE D 1 59  ? -17.251 46.784  29.492  1.00 57.26  ? 1059 ILE B C     1 
ATOM   3872 O  O     . ILE D 1 59  ? -16.694 47.700  28.878  1.00 57.33  ? 1059 ILE B O     1 
ATOM   3873 C  CB    . ILE D 1 59  ? -19.318 47.300  30.918  1.00 57.34  ? 1059 ILE B CB    1 
ATOM   3874 C  CG1   . ILE D 1 59  ? -19.694 48.405  29.945  1.00 57.45  ? 1059 ILE B CG1   1 
ATOM   3875 C  CG2   . ILE D 1 59  ? -19.769 47.644  32.335  1.00 57.31  ? 1059 ILE B CG2   1 
ATOM   3876 C  CD1   . ILE D 1 59  ? -21.158 48.418  29.659  1.00 58.09  ? 1059 ILE B CD1   1 
ATOM   3877 N  N     . PRO D 1 60  ? -17.339 45.541  29.009  1.00 57.35  ? 1060 PRO B N     1 
ATOM   3878 C  CA    . PRO D 1 60  ? -16.946 45.256  27.636  1.00 57.50  ? 1060 PRO B CA    1 
ATOM   3879 C  C     . PRO D 1 60  ? -17.648 46.191  26.666  1.00 57.69  ? 1060 PRO B C     1 
ATOM   3880 O  O     . PRO D 1 60  ? -18.802 46.546  26.873  1.00 57.67  ? 1060 PRO B O     1 
ATOM   3881 C  CB    . PRO D 1 60  ? -17.444 43.828  27.415  1.00 57.25  ? 1060 PRO B CB    1 
ATOM   3882 C  CG    . PRO D 1 60  ? -17.479 43.222  28.766  1.00 57.62  ? 1060 PRO B CG    1 
ATOM   3883 C  CD    . PRO D 1 60  ? -17.791 44.337  29.729  1.00 57.48  ? 1060 PRO B CD    1 
ATOM   3884 N  N     . ILE D 1 61  ? -16.947 46.588  25.613  1.00 58.17  ? 1061 ILE B N     1 
ATOM   3885 C  CA    . ILE D 1 61  ? -17.551 47.371  24.554  1.00 58.53  ? 1061 ILE B CA    1 
ATOM   3886 C  C     . ILE D 1 61  ? -18.750 46.620  23.987  1.00 59.01  ? 1061 ILE B C     1 
ATOM   3887 O  O     . ILE D 1 61  ? -19.784 47.223  23.678  1.00 59.72  ? 1061 ILE B O     1 
ATOM   3888 C  CB    . ILE D 1 61  ? -16.532 47.665  23.461  1.00 58.63  ? 1061 ILE B CB    1 
ATOM   3889 C  CG1   . ILE D 1 61  ? -15.358 48.439  24.065  1.00 58.36  ? 1061 ILE B CG1   1 
ATOM   3890 C  CG2   . ILE D 1 61  ? -17.180 48.413  22.298  1.00 58.73  ? 1061 ILE B CG2   1 
ATOM   3891 C  CD1   . ILE D 1 61  ? -14.155 48.512  23.179  1.00 59.12  ? 1061 ILE B CD1   1 
ATOM   3892 N  N     . VAL D 1 62  ? -18.626 45.301  23.871  1.00 59.11  ? 1062 VAL B N     1 
ATOM   3893 C  CA    . VAL D 1 62  ? -19.733 44.492  23.375  1.00 59.11  ? 1062 VAL B CA    1 
ATOM   3894 C  C     . VAL D 1 62  ? -20.961 44.627  24.277  1.00 59.09  ? 1062 VAL B C     1 
ATOM   3895 O  O     . VAL D 1 62  ? -22.079 44.793  23.783  1.00 59.23  ? 1062 VAL B O     1 
ATOM   3896 C  CB    . VAL D 1 62  ? -19.356 42.996  23.207  1.00 59.19  ? 1062 VAL B CB    1 
ATOM   3897 C  CG1   . VAL D 1 62  ? -18.074 42.859  22.410  1.00 59.82  ? 1062 VAL B CG1   1 
ATOM   3898 C  CG2   . VAL D 1 62  ? -19.235 42.298  24.562  1.00 58.99  ? 1062 VAL B CG2   1 
ATOM   3899 N  N     . GLU D 1 63  ? -20.756 44.542  25.591  1.00 58.97  ? 1063 GLU B N     1 
ATOM   3900 C  CA    . GLU D 1 63  ? -21.843 44.747  26.544  1.00 59.10  ? 1063 GLU B CA    1 
ATOM   3901 C  C     . GLU D 1 63  ? -22.483 46.116  26.349  1.00 58.53  ? 1063 GLU B C     1 
ATOM   3902 O  O     . GLU D 1 63  ? -23.695 46.230  26.162  1.00 58.65  ? 1063 GLU B O     1 
ATOM   3903 C  CB    . GLU D 1 63  ? -21.362 44.581  27.989  1.00 59.29  ? 1063 GLU B CB    1 
ATOM   3904 C  CG    . GLU D 1 63  ? -21.629 43.194  28.581  1.00 62.09  ? 1063 GLU B CG    1 
ATOM   3905 C  CD    . GLU D 1 63  ? -21.806 43.213  30.103  1.00 65.61  ? 1063 GLU B CD    1 
ATOM   3906 O  OE1   . GLU D 1 63  ? -20.901 43.718  30.813  1.00 65.67  ? 1063 GLU B OE1   1 
ATOM   3907 O  OE2   . GLU D 1 63  ? -22.857 42.713  30.590  1.00 67.41  ? 1063 GLU B OE2   1 
ATOM   3908 N  N     . ALA D 1 64  ? -21.650 47.148  26.381  1.00 58.18  ? 1064 ALA B N     1 
ATOM   3909 C  CA    . ALA D 1 64  ? -22.087 48.521  26.183  1.00 57.45  ? 1064 ALA B CA    1 
ATOM   3910 C  C     . ALA D 1 64  ? -22.958 48.616  24.940  1.00 57.01  ? 1064 ALA B C     1 
ATOM   3911 O  O     . ALA D 1 64  ? -23.991 49.284  24.940  1.00 56.73  ? 1064 ALA B O     1 
ATOM   3912 C  CB    . ALA D 1 64  ? -20.876 49.440  26.062  1.00 57.25  ? 1064 ALA B CB    1 
ATOM   3913 N  N     . LYS D 1 65  ? -22.531 47.933  23.883  1.00 56.86  ? 1065 LYS B N     1 
ATOM   3914 C  CA    . LYS D 1 65  ? -23.227 47.980  22.597  1.00 56.44  ? 1065 LYS B CA    1 
ATOM   3915 C  C     . LYS D 1 65  ? -24.564 47.257  22.600  1.00 55.90  ? 1065 LYS B C     1 
ATOM   3916 O  O     . LYS D 1 65  ? -25.393 47.513  21.740  1.00 56.38  ? 1065 LYS B O     1 
ATOM   3917 C  CB    . LYS D 1 65  ? -22.329 47.462  21.470  1.00 56.53  ? 1065 LYS B CB    1 
ATOM   3918 C  CG    . LYS D 1 65  ? -21.433 48.523  20.866  1.00 56.67  ? 1065 LYS B CG    1 
ATOM   3919 C  CD    . LYS D 1 65  ? -20.523 47.922  19.812  1.00 58.75  ? 1065 LYS B CD    1 
ATOM   3920 C  CE    . LYS D 1 65  ? -19.567 48.959  19.232  1.00 59.34  ? 1065 LYS B CE    1 
ATOM   3921 N  NZ    . LYS D 1 65  ? -20.191 49.760  18.138  1.00 61.34  ? 1065 LYS B NZ    1 
ATOM   3922 N  N     . LYS D 1 66  ? -24.772 46.351  23.555  1.00 55.43  ? 1066 LYS B N     1 
ATOM   3923 C  CA    . LYS D 1 66  ? -26.070 45.687  23.715  1.00 55.04  ? 1066 LYS B CA    1 
ATOM   3924 C  C     . LYS D 1 66  ? -27.075 46.641  24.349  1.00 54.39  ? 1066 LYS B C     1 
ATOM   3925 O  O     . LYS D 1 66  ? -28.286 46.476  24.217  1.00 54.59  ? 1066 LYS B O     1 
ATOM   3926 C  CB    . LYS D 1 66  ? -25.949 44.452  24.614  1.00 55.17  ? 1066 LYS B CB    1 
ATOM   3927 C  CG    . LYS D 1 66  ? -25.235 43.259  24.011  1.00 56.06  ? 1066 LYS B CG    1 
ATOM   3928 C  CD    . LYS D 1 66  ? -25.043 42.172  25.070  1.00 56.93  ? 1066 LYS B CD    1 
ATOM   3929 C  CE    . LYS D 1 66  ? -24.175 41.030  24.553  1.00 57.88  ? 1066 LYS B CE    1 
ATOM   3930 N  NZ    . LYS D 1 66  ? -23.135 40.624  25.558  1.00 59.12  ? 1066 LYS B NZ    1 
ATOM   3931 N  N     . ILE D 1 67  ? -26.548 47.622  25.067  1.00 53.95  ? 1067 ILE B N     1 
ATOM   3932 C  CA    . ILE D 1 67  ? -27.344 48.562  25.837  1.00 53.21  ? 1067 ILE B CA    1 
ATOM   3933 C  C     . ILE D 1 67  ? -27.571 49.807  25.004  1.00 52.69  ? 1067 ILE B C     1 
ATOM   3934 O  O     . ILE D 1 67  ? -28.692 50.299  24.877  1.00 52.36  ? 1067 ILE B O     1 
ATOM   3935 C  CB    . ILE D 1 67  ? -26.593 48.978  27.106  1.00 53.18  ? 1067 ILE B CB    1 
ATOM   3936 C  CG1   . ILE D 1 67  ? -26.347 47.769  28.011  1.00 53.13  ? 1067 ILE B CG1   1 
ATOM   3937 C  CG2   . ILE D 1 67  ? -27.341 50.089  27.834  1.00 53.11  ? 1067 ILE B CG2   1 
ATOM   3938 C  CD1   . ILE D 1 67  ? -25.466 48.088  29.216  1.00 53.12  ? 1067 ILE B CD1   1 
ATOM   3939 N  N     . LEU D 1 68  ? -26.481 50.311  24.443  1.00 52.25  ? 1068 LEU B N     1 
ATOM   3940 C  CA    . LEU D 1 68  ? -26.530 51.456  23.553  1.00 51.70  ? 1068 LEU B CA    1 
ATOM   3941 C  C     . LEU D 1 68  ? -25.884 51.123  22.215  1.00 51.60  ? 1068 LEU B C     1 
ATOM   3942 O  O     . LEU D 1 68  ? -24.741 51.510  21.955  1.00 51.40  ? 1068 LEU B O     1 
ATOM   3943 C  CB    . LEU D 1 68  ? -25.825 52.645  24.187  1.00 51.28  ? 1068 LEU B CB    1 
ATOM   3944 C  CG    . LEU D 1 68  ? -26.393 53.121  25.514  1.00 50.64  ? 1068 LEU B CG    1 
ATOM   3945 C  CD1   . LEU D 1 68  ? -25.578 54.302  26.002  1.00 49.45  ? 1068 LEU B CD1   1 
ATOM   3946 C  CD2   . LEU D 1 68  ? -27.874 53.484  25.390  1.00 49.63  ? 1068 LEU B CD2   1 
ATOM   3947 N  N     . PRO D 1 69  ? -26.610 50.387  21.361  1.00 51.75  ? 1069 PRO B N     1 
ATOM   3948 C  CA    . PRO D 1 69  ? -26.104 50.097  20.020  1.00 51.87  ? 1069 PRO B CA    1 
ATOM   3949 C  C     . PRO D 1 69  ? -25.697 51.367  19.280  1.00 51.89  ? 1069 PRO B C     1 
ATOM   3950 O  O     . PRO D 1 69  ? -24.770 51.340  18.473  1.00 51.93  ? 1069 PRO B O     1 
ATOM   3951 C  CB    . PRO D 1 69  ? -27.302 49.444  19.322  1.00 51.83  ? 1069 PRO B CB    1 
ATOM   3952 C  CG    . PRO D 1 69  ? -28.477 49.663  20.231  1.00 52.02  ? 1069 PRO B CG    1 
ATOM   3953 C  CD    . PRO D 1 69  ? -27.920 49.769  21.601  1.00 51.60  ? 1069 PRO B CD    1 
ATOM   3954 N  N     . ASN D 1 70  ? -26.368 52.471  19.598  1.00 51.98  ? 1070 ASN B N     1 
ATOM   3955 C  CA    . ASN D 1 70  ? -26.215 53.725  18.866  1.00 51.76  ? 1070 ASN B CA    1 
ATOM   3956 C  C     . ASN D 1 70  ? -25.471 54.807  19.612  1.00 51.58  ? 1070 ASN B C     1 
ATOM   3957 O  O     . ASN D 1 70  ? -25.437 55.943  19.162  1.00 51.90  ? 1070 ASN B O     1 
ATOM   3958 C  CB    . ASN D 1 70  ? -27.590 54.252  18.468  1.00 51.89  ? 1070 ASN B CB    1 
ATOM   3959 C  CG    . ASN D 1 70  ? -28.352 53.260  17.645  1.00 51.84  ? 1070 ASN B CG    1 
ATOM   3960 O  OD1   . ASN D 1 70  ? -27.760 52.546  16.837  1.00 52.17  ? 1070 ASN B OD1   1 
ATOM   3961 N  ND2   . ASN D 1 70  ? -29.664 53.186  17.850  1.00 52.21  ? 1070 ASN B ND2   1 
ATOM   3962 N  N     . ALA D 1 71  ? -24.893 54.475  20.759  1.00 51.34  ? 1071 ALA B N     1 
ATOM   3963 C  CA    . ALA D 1 71  ? -23.994 55.411  21.402  1.00 51.15  ? 1071 ALA B CA    1 
ATOM   3964 C  C     . ALA D 1 71  ? -22.841 55.609  20.446  1.00 50.96  ? 1071 ALA B C     1 
ATOM   3965 O  O     . ALA D 1 71  ? -22.575 54.751  19.604  1.00 51.10  ? 1071 ALA B O     1 
ATOM   3966 C  CB    . ALA D 1 71  ? -23.484 54.867  22.724  1.00 51.21  ? 1071 ALA B CB    1 
ATOM   3967 N  N     . VAL D 1 72  ? -22.177 56.749  20.567  1.00 50.66  ? 1072 VAL B N     1 
ATOM   3968 C  CA    . VAL D 1 72  ? -20.942 57.000  19.863  1.00 50.13  ? 1072 VAL B CA    1 
ATOM   3969 C  C     . VAL D 1 72  ? -19.792 56.361  20.625  1.00 50.24  ? 1072 VAL B C     1 
ATOM   3970 O  O     . VAL D 1 72  ? -19.518 56.730  21.755  1.00 50.10  ? 1072 VAL B O     1 
ATOM   3971 C  CB    . VAL D 1 72  ? -20.692 58.503  19.746  1.00 50.26  ? 1072 VAL B CB    1 
ATOM   3972 C  CG1   . VAL D 1 72  ? -19.307 58.785  19.138  1.00 49.80  ? 1072 VAL B CG1   1 
ATOM   3973 C  CG2   . VAL D 1 72  ? -21.796 59.139  18.926  1.00 49.48  ? 1072 VAL B CG2   1 
ATOM   3974 N  N     . TYR D 1 73  ? -19.117 55.407  19.989  1.00 50.68  ? 1073 TYR B N     1 
ATOM   3975 C  CA    . TYR D 1 73  ? -18.003 54.699  20.602  1.00 50.60  ? 1073 TYR B CA    1 
ATOM   3976 C  C     . TYR D 1 73  ? -16.690 55.214  20.071  1.00 50.82  ? 1073 TYR B C     1 
ATOM   3977 O  O     . TYR D 1 73  ? -16.374 55.039  18.907  1.00 50.79  ? 1073 TYR B O     1 
ATOM   3978 C  CB    . TYR D 1 73  ? -18.137 53.191  20.370  1.00 50.28  ? 1073 TYR B CB    1 
ATOM   3979 C  CG    . TYR D 1 73  ? -19.293 52.630  21.145  1.00 49.87  ? 1073 TYR B CG    1 
ATOM   3980 C  CD1   . TYR D 1 73  ? -19.113 52.078  22.415  1.00 49.88  ? 1073 TYR B CD1   1 
ATOM   3981 C  CD2   . TYR D 1 73  ? -20.573 52.689  20.633  1.00 48.35  ? 1073 TYR B CD2   1 
ATOM   3982 C  CE1   . TYR D 1 73  ? -20.188 51.580  23.131  1.00 49.30  ? 1073 TYR B CE1   1 
ATOM   3983 C  CE2   . TYR D 1 73  ? -21.639 52.206  21.333  1.00 49.32  ? 1073 TYR B CE2   1 
ATOM   3984 C  CZ    . TYR D 1 73  ? -21.452 51.652  22.580  1.00 49.07  ? 1073 TYR B CZ    1 
ATOM   3985 O  OH    . TYR D 1 73  ? -22.543 51.177  23.256  1.00 47.97  ? 1073 TYR B OH    1 
ATOM   3986 N  N     . LEU D 1 74  ? -15.928 55.857  20.945  1.00 51.46  ? 1074 LEU B N     1 
ATOM   3987 C  CA    . LEU D 1 74  ? -14.720 56.547  20.551  1.00 51.78  ? 1074 LEU B CA    1 
ATOM   3988 C  C     . LEU D 1 74  ? -13.492 55.849  21.080  1.00 52.51  ? 1074 LEU B C     1 
ATOM   3989 O  O     . LEU D 1 74  ? -13.482 55.394  22.215  1.00 51.90  ? 1074 LEU B O     1 
ATOM   3990 C  CB    . LEU D 1 74  ? -14.750 57.981  21.074  1.00 51.46  ? 1074 LEU B CB    1 
ATOM   3991 C  CG    . LEU D 1 74  ? -15.806 58.812  20.366  1.00 51.67  ? 1074 LEU B CG    1 
ATOM   3992 C  CD1   . LEU D 1 74  ? -15.971 60.123  21.058  1.00 52.75  ? 1074 LEU B CD1   1 
ATOM   3993 C  CD2   . LEU D 1 74  ? -15.417 59.013  18.900  1.00 51.21  ? 1074 LEU B CD2   1 
ATOM   3994 N  N     . PRO D 1 75  ? -12.440 55.778  20.256  1.00 53.33  ? 1075 PRO B N     1 
ATOM   3995 C  CA    . PRO D 1 75  ? -11.184 55.296  20.784  1.00 54.48  ? 1075 PRO B CA    1 
ATOM   3996 C  C     . PRO D 1 75  ? -10.660 56.298  21.780  1.00 55.56  ? 1075 PRO B C     1 
ATOM   3997 O  O     . PRO D 1 75  ? -10.837 57.504  21.605  1.00 55.83  ? 1075 PRO B O     1 
ATOM   3998 C  CB    . PRO D 1 75  ? -10.268 55.250  19.562  1.00 54.09  ? 1075 PRO B CB    1 
ATOM   3999 C  CG    . PRO D 1 75  ? -10.843 56.247  18.637  1.00 54.30  ? 1075 PRO B CG    1 
ATOM   4000 C  CD    . PRO D 1 75  ? -12.337 56.149  18.838  1.00 53.70  ? 1075 PRO B CD    1 
ATOM   4001 N  N     . MET D 1 76  ? -10.038 55.786  22.827  1.00 56.51  ? 1076 MET B N     1 
ATOM   4002 C  CA    . MET D 1 76  ? -9.414  56.613  23.812  1.00 58.10  ? 1076 MET B CA    1 
ATOM   4003 C  C     . MET D 1 76  ? -8.188  57.346  23.270  1.00 58.66  ? 1076 MET B C     1 
ATOM   4004 O  O     . MET D 1 76  ? -7.180  56.733  22.933  1.00 59.38  ? 1076 MET B O     1 
ATOM   4005 C  CB    . MET D 1 76  ? -8.997  55.735  24.974  1.00 58.67  ? 1076 MET B CB    1 
ATOM   4006 C  CG    . MET D 1 76  ? -9.018  56.429  26.284  1.00 59.71  ? 1076 MET B CG    1 
ATOM   4007 S  SD    . MET D 1 76  ? -8.181  55.345  27.411  1.00 65.35  ? 1076 MET B SD    1 
ATOM   4008 C  CE    . MET D 1 76  ? -6.609  55.141  26.560  1.00 66.53  ? 1076 MET B CE    1 
ATOM   4009 N  N     . ARG D 1 77  ? -8.275  58.665  23.206  1.00 58.87  ? 1077 ARG B N     1 
ATOM   4010 C  CA    . ARG D 1 77  ? -7.139  59.485  22.848  1.00 58.91  ? 1077 ARG B CA    1 
ATOM   4011 C  C     . ARG D 1 77  ? -6.494  60.061  24.098  1.00 59.24  ? 1077 ARG B C     1 
ATOM   4012 O  O     . ARG D 1 77  ? -6.627  61.252  24.364  1.00 58.88  ? 1077 ARG B O     1 
ATOM   4013 C  CB    . ARG D 1 77  ? -7.603  60.629  21.958  1.00 58.88  ? 1077 ARG B CB    1 
ATOM   4014 C  CG    . ARG D 1 77  ? -8.374  60.191  20.735  1.00 58.23  ? 1077 ARG B CG    1 
ATOM   4015 C  CD    . ARG D 1 77  ? -8.624  61.379  19.844  1.00 57.67  ? 1077 ARG B CD    1 
ATOM   4016 N  NE    . ARG D 1 77  ? -9.767  62.167  20.292  1.00 57.52  ? 1077 ARG B NE    1 
ATOM   4017 C  CZ    . ARG D 1 77  ? -10.161 63.289  19.699  1.00 58.06  ? 1077 ARG B CZ    1 
ATOM   4018 N  NH1   . ARG D 1 77  ? -9.491  63.754  18.655  1.00 58.24  ? 1077 ARG B NH1   1 
ATOM   4019 N  NH2   . ARG D 1 77  ? -11.214 63.951  20.149  1.00 59.32  ? 1077 ARG B NH2   1 
ATOM   4020 N  N     . LYS D 1 78  ? -5.800  59.218  24.861  1.00 60.05  ? 1078 LYS B N     1 
ATOM   4021 C  CA    . LYS D 1 78  ? -5.244  59.609  26.169  1.00 60.98  ? 1078 LYS B CA    1 
ATOM   4022 C  C     . LYS D 1 78  ? -4.421  60.883  26.097  1.00 61.03  ? 1078 LYS B C     1 
ATOM   4023 O  O     . LYS D 1 78  ? -4.569  61.770  26.917  1.00 61.40  ? 1078 LYS B O     1 
ATOM   4024 C  CB    . LYS D 1 78  ? -4.403  58.475  26.754  1.00 61.56  ? 1078 LYS B CB    1 
ATOM   4025 C  CG    . LYS D 1 78  ? -4.330  58.468  28.285  1.00 63.36  ? 1078 LYS B CG    1 
ATOM   4026 C  CD    . LYS D 1 78  ? -4.162  57.041  28.820  1.00 66.77  ? 1078 LYS B CD    1 
ATOM   4027 C  CE    . LYS D 1 78  ? -4.058  57.011  30.354  1.00 68.59  ? 1078 LYS B CE    1 
ATOM   4028 N  NZ    . LYS D 1 78  ? -3.038  57.977  30.875  1.00 68.87  ? 1078 LYS B NZ    1 
ATOM   4029 N  N     . GLU D 1 79  ? -3.571  60.963  25.087  1.00 61.50  ? 1079 GLU B N     1 
ATOM   4030 C  CA    . GLU D 1 79  ? -2.739  62.127  24.808  1.00 61.57  ? 1079 GLU B CA    1 
ATOM   4031 C  C     . GLU D 1 79  ? -3.525  63.436  24.720  1.00 60.77  ? 1079 GLU B C     1 
ATOM   4032 O  O     . GLU D 1 79  ? -3.071  64.482  25.187  1.00 60.86  ? 1079 GLU B O     1 
ATOM   4033 C  CB    . GLU D 1 79  ? -2.013  61.887  23.485  1.00 62.02  ? 1079 GLU B CB    1 
ATOM   4034 C  CG    . GLU D 1 79  ? -1.576  60.429  23.268  1.00 64.80  ? 1079 GLU B CG    1 
ATOM   4035 C  CD    . GLU D 1 79  ? -2.694  59.492  22.744  1.00 68.07  ? 1079 GLU B CD    1 
ATOM   4036 O  OE1   . GLU D 1 79  ? -3.641  59.954  22.043  1.00 68.54  ? 1079 GLU B OE1   1 
ATOM   4037 O  OE2   . GLU D 1 79  ? -2.599  58.271  23.029  1.00 68.51  ? 1079 GLU B OE2   1 
ATOM   4038 N  N     . VAL D 1 80  ? -4.686  63.381  24.078  1.00 59.94  ? 1080 VAL B N     1 
ATOM   4039 C  CA    . VAL D 1 80  ? -5.565  64.536  23.985  1.00 59.04  ? 1080 VAL B CA    1 
ATOM   4040 C  C     . VAL D 1 80  ? -6.135  64.908  25.360  1.00 58.59  ? 1080 VAL B C     1 
ATOM   4041 O  O     . VAL D 1 80  ? -6.194  66.085  25.723  1.00 58.67  ? 1080 VAL B O     1 
ATOM   4042 C  CB    . VAL D 1 80  ? -6.724  64.254  23.032  1.00 58.96  ? 1080 VAL B CB    1 
ATOM   4043 C  CG1   . VAL D 1 80  ? -7.601  65.469  22.889  1.00 59.26  ? 1080 VAL B CG1   1 
ATOM   4044 C  CG2   . VAL D 1 80  ? -6.197  63.820  21.694  1.00 58.48  ? 1080 VAL B CG2   1 
ATOM   4045 N  N     . TYR D 1 81  ? -6.543  63.897  26.120  1.00 57.77  ? 1081 TYR B N     1 
ATOM   4046 C  CA    . TYR D 1 81  ? -7.159  64.123  27.414  1.00 57.03  ? 1081 TYR B CA    1 
ATOM   4047 C  C     . TYR D 1 81  ? -6.074  64.576  28.352  1.00 58.15  ? 1081 TYR B C     1 
ATOM   4048 O  O     . TYR D 1 81  ? -6.307  65.392  29.238  1.00 58.22  ? 1081 TYR B O     1 
ATOM   4049 C  CB    . TYR D 1 81  ? -7.798  62.846  27.958  1.00 56.17  ? 1081 TYR B CB    1 
ATOM   4050 C  CG    . TYR D 1 81  ? -8.600  62.071  26.954  1.00 51.38  ? 1081 TYR B CG    1 
ATOM   4051 C  CD1   . TYR D 1 81  ? -9.357  62.711  26.000  1.00 49.23  ? 1081 TYR B CD1   1 
ATOM   4052 C  CD2   . TYR D 1 81  ? -8.613  60.698  26.981  1.00 50.01  ? 1081 TYR B CD2   1 
ATOM   4053 C  CE1   . TYR D 1 81  ? -10.089 61.998  25.073  1.00 48.54  ? 1081 TYR B CE1   1 
ATOM   4054 C  CE2   . TYR D 1 81  ? -9.343  59.973  26.071  1.00 48.82  ? 1081 TYR B CE2   1 
ATOM   4055 C  CZ    . TYR D 1 81  ? -10.080 60.626  25.121  1.00 48.14  ? 1081 TYR B CZ    1 
ATOM   4056 O  OH    . TYR D 1 81  ? -10.797 59.902  24.217  1.00 47.72  ? 1081 TYR B OH    1 
ATOM   4057 N  N     . GLN D 1 82  ? -4.880  64.032  28.144  1.00 59.16  ? 1082 GLN B N     1 
ATOM   4058 C  CA    . GLN D 1 82  ? -3.708  64.411  28.907  1.00 60.26  ? 1082 GLN B CA    1 
ATOM   4059 C  C     . GLN D 1 82  ? -3.327  65.859  28.607  1.00 60.78  ? 1082 GLN B C     1 
ATOM   4060 O  O     . GLN D 1 82  ? -2.948  66.609  29.503  1.00 61.00  ? 1082 GLN B O     1 
ATOM   4061 C  CB    . GLN D 1 82  ? -2.550  63.457  28.612  1.00 60.33  ? 1082 GLN B CB    1 
ATOM   4062 C  CG    . GLN D 1 82  ? -1.329  63.664  29.495  1.00 62.71  ? 1082 GLN B CG    1 
ATOM   4063 C  CD    . GLN D 1 82  ? -1.646  63.532  30.983  1.00 64.49  ? 1082 GLN B CD    1 
ATOM   4064 O  OE1   . GLN D 1 82  ? -2.091  62.477  31.448  1.00 67.84  ? 1082 GLN B OE1   1 
ATOM   4065 N  NE2   . GLN D 1 82  ? -1.421  64.602  31.731  1.00 62.96  ? 1082 GLN B NE2   1 
ATOM   4066 N  N     . GLN D 1 83  ? -3.442  66.262  27.351  1.00 61.62  ? 1083 GLN B N     1 
ATOM   4067 C  CA    . GLN D 1 83  ? -3.211  67.663  27.005  1.00 62.42  ? 1083 GLN B CA    1 
ATOM   4068 C  C     . GLN D 1 83  ? -4.176  68.523  27.802  1.00 62.50  ? 1083 GLN B C     1 
ATOM   4069 O  O     . GLN D 1 83  ? -3.765  69.446  28.497  1.00 63.14  ? 1083 GLN B O     1 
ATOM   4070 C  CB    . GLN D 1 83  ? -3.363  67.906  25.490  1.00 62.46  ? 1083 GLN B CB    1 
ATOM   4071 C  CG    . GLN D 1 83  ? -2.067  67.718  24.692  1.00 63.54  ? 1083 GLN B CG    1 
ATOM   4072 C  CD    . GLN D 1 83  ? -2.251  67.830  23.164  1.00 65.05  ? 1083 GLN B CD    1 
ATOM   4073 O  OE1   . GLN D 1 83  ? -3.283  67.435  22.604  1.00 64.32  ? 1083 GLN B OE1   1 
ATOM   4074 N  NE2   . GLN D 1 83  ? -1.227  68.352  22.486  1.00 65.94  ? 1083 GLN B NE2   1 
ATOM   4075 N  N     . VAL D 1 84  ? -5.461  68.197  27.720  1.00 62.86  ? 1084 VAL B N     1 
ATOM   4076 C  CA    . VAL D 1 84  ? -6.503  68.950  28.415  1.00 62.98  ? 1084 VAL B CA    1 
ATOM   4077 C  C     . VAL D 1 84  ? -6.286  68.948  29.929  1.00 63.13  ? 1084 VAL B C     1 
ATOM   4078 O  O     . VAL D 1 84  ? -6.460  69.962  30.588  1.00 63.20  ? 1084 VAL B O     1 
ATOM   4079 C  CB    . VAL D 1 84  ? -7.912  68.394  28.079  1.00 63.05  ? 1084 VAL B CB    1 
ATOM   4080 C  CG1   . VAL D 1 84  ? -9.003  69.181  28.815  1.00 62.87  ? 1084 VAL B CG1   1 
ATOM   4081 C  CG2   . VAL D 1 84  ? -8.145  68.434  26.582  1.00 62.57  ? 1084 VAL B CG2   1 
ATOM   4082 N  N     . SER D 1 85  ? -5.901  67.793  30.460  1.00 63.56  ? 1085 SER B N     1 
ATOM   4083 C  CA    . SER D 1 85  ? -5.643  67.603  31.881  1.00 63.79  ? 1085 SER B CA    1 
ATOM   4084 C  C     . SER D 1 85  ? -4.475  68.444  32.387  1.00 64.14  ? 1085 SER B C     1 
ATOM   4085 O  O     . SER D 1 85  ? -4.569  69.080  33.438  1.00 64.31  ? 1085 SER B O     1 
ATOM   4086 C  CB    . SER D 1 85  ? -5.363  66.125  32.157  1.00 63.71  ? 1085 SER B CB    1 
ATOM   4087 O  OG    . SER D 1 85  ? -4.624  65.956  33.356  1.00 64.03  ? 1085 SER B OG    1 
ATOM   4088 N  N     . SER D 1 86  ? -3.368  68.429  31.649  1.00 64.33  ? 1086 SER B N     1 
ATOM   4089 C  CA    . SER D 1 86  ? -2.191  69.204  32.017  1.00 64.46  ? 1086 SER B CA    1 
ATOM   4090 C  C     . SER D 1 86  ? -2.518  70.688  32.083  1.00 64.50  ? 1086 SER B C     1 
ATOM   4091 O  O     . SER D 1 86  ? -2.042  71.399  32.966  1.00 64.54  ? 1086 SER B O     1 
ATOM   4092 C  CB    . SER D 1 86  ? -1.053  68.955  31.025  1.00 64.46  ? 1086 SER B CB    1 
ATOM   4093 O  OG    . SER D 1 86  ? -0.489  67.669  31.220  1.00 65.12  ? 1086 SER B OG    1 
ATOM   4094 N  N     . ARG D 1 87  ? -3.341  71.149  31.149  1.00 64.65  ? 1087 ARG B N     1 
ATOM   4095 C  CA    . ARG D 1 87  ? -3.709  72.557  31.091  1.00 64.68  ? 1087 ARG B CA    1 
ATOM   4096 C  C     . ARG D 1 87  ? -4.629  72.958  32.235  1.00 64.91  ? 1087 ARG B C     1 
ATOM   4097 O  O     . ARG D 1 87  ? -4.660  74.124  32.639  1.00 65.01  ? 1087 ARG B O     1 
ATOM   4098 C  CB    . ARG D 1 87  ? -4.361  72.887  29.754  1.00 64.67  ? 1087 ARG B CB    1 
ATOM   4099 C  CG    . ARG D 1 87  ? -3.405  72.835  28.583  1.00 64.22  ? 1087 ARG B CG    1 
ATOM   4100 C  CD    . ARG D 1 87  ? -3.967  73.601  27.410  1.00 63.72  ? 1087 ARG B CD    1 
ATOM   4101 N  NE    . ARG D 1 87  ? -5.282  73.111  27.006  1.00 63.90  ? 1087 ARG B NE    1 
ATOM   4102 C  CZ    . ARG D 1 87  ? -5.481  72.139  26.117  1.00 63.80  ? 1087 ARG B CZ    1 
ATOM   4103 N  NH1   . ARG D 1 87  ? -4.447  71.541  25.540  1.00 63.18  ? 1087 ARG B NH1   1 
ATOM   4104 N  NH2   . ARG D 1 87  ? -6.718  71.764  25.808  1.00 64.06  ? 1087 ARG B NH2   1 
ATOM   4105 N  N     . ILE D 1 88  ? -5.376  71.992  32.757  1.00 65.09  ? 1088 ILE B N     1 
ATOM   4106 C  CA    . ILE D 1 88  ? -6.225  72.244  33.913  1.00 65.31  ? 1088 ILE B CA    1 
ATOM   4107 C  C     . ILE D 1 88  ? -5.449  72.065  35.215  1.00 65.64  ? 1088 ILE B C     1 
ATOM   4108 O  O     . ILE D 1 88  ? -5.674  72.790  36.175  1.00 65.64  ? 1088 ILE B O     1 
ATOM   4109 C  CB    . ILE D 1 88  ? -7.462  71.342  33.933  1.00 65.13  ? 1088 ILE B CB    1 
ATOM   4110 C  CG1   . ILE D 1 88  ? -8.253  71.490  32.636  1.00 64.79  ? 1088 ILE B CG1   1 
ATOM   4111 C  CG2   . ILE D 1 88  ? -8.342  71.690  35.125  1.00 65.05  ? 1088 ILE B CG2   1 
ATOM   4112 C  CD1   . ILE D 1 88  ? -9.289  70.396  32.432  1.00 64.49  ? 1088 ILE B CD1   1 
ATOM   4113 N  N     . MET D 1 89  ? -4.535  71.101  35.242  1.00 66.23  ? 1089 MET B N     1 
ATOM   4114 C  CA    . MET D 1 89  ? -3.691  70.892  36.411  1.00 66.81  ? 1089 MET B CA    1 
ATOM   4115 C  C     . MET D 1 89  ? -2.755  72.076  36.609  1.00 67.33  ? 1089 MET B C     1 
ATOM   4116 O  O     . MET D 1 89  ? -2.059  72.171  37.623  1.00 67.63  ? 1089 MET B O     1 
ATOM   4117 C  CB    . MET D 1 89  ? -2.885  69.601  36.287  1.00 66.88  ? 1089 MET B CB    1 
ATOM   4118 C  CG    . MET D 1 89  ? -3.730  68.334  36.242  1.00 67.31  ? 1089 MET B CG    1 
ATOM   4119 S  SD    . MET D 1 89  ? -5.054  68.287  37.469  1.00 67.69  ? 1089 MET B SD    1 
ATOM   4120 C  CE    . MET D 1 89  ? -5.561  66.578  37.343  1.00 66.31  ? 1089 MET B CE    1 
ATOM   4121 N  N     . ASN D 1 90  ? -2.744  72.978  35.633  1.00 67.66  ? 1090 ASN B N     1 
ATOM   4122 C  CA    . ASN D 1 90  ? -1.985  74.212  35.743  1.00 67.95  ? 1090 ASN B CA    1 
ATOM   4123 C  C     . ASN D 1 90  ? -2.873  75.383  36.127  1.00 68.09  ? 1090 ASN B C     1 
ATOM   4124 O  O     . ASN D 1 90  ? -2.429  76.307  36.809  1.00 68.14  ? 1090 ASN B O     1 
ATOM   4125 C  CB    . ASN D 1 90  ? -1.242  74.502  34.441  1.00 68.18  ? 1090 ASN B CB    1 
ATOM   4126 C  CG    . ASN D 1 90  ? 0.016   73.678  34.303  1.00 68.52  ? 1090 ASN B CG    1 
ATOM   4127 O  OD1   . ASN D 1 90  ? 0.700   73.397  35.294  1.00 69.49  ? 1090 ASN B OD1   1 
ATOM   4128 N  ND2   . ASN D 1 90  ? 0.333   73.285  33.076  1.00 68.00  ? 1090 ASN B ND2   1 
ATOM   4129 N  N     . LEU D 1 91  ? -4.128  75.342  35.689  1.00 68.21  ? 1091 LEU B N     1 
ATOM   4130 C  CA    . LEU D 1 91  ? -5.105  76.330  36.124  1.00 68.58  ? 1091 LEU B CA    1 
ATOM   4131 C  C     . LEU D 1 91  ? -5.408  76.115  37.603  1.00 68.78  ? 1091 LEU B C     1 
ATOM   4132 O  O     . LEU D 1 91  ? -5.804  77.044  38.311  1.00 68.95  ? 1091 LEU B O     1 
ATOM   4133 C  CB    . LEU D 1 91  ? -6.390  76.244  35.298  1.00 68.51  ? 1091 LEU B CB    1 
ATOM   4134 C  CG    . LEU D 1 91  ? -6.307  76.683  33.833  1.00 69.12  ? 1091 LEU B CG    1 
ATOM   4135 C  CD1   . LEU D 1 91  ? -7.635  76.460  33.110  1.00 69.56  ? 1091 LEU B CD1   1 
ATOM   4136 C  CD2   . LEU D 1 91  ? -5.866  78.138  33.715  1.00 69.04  ? 1091 LEU B CD2   1 
ATOM   4137 N  N     . LEU D 1 92  ? -5.208  74.882  38.062  1.00 68.94  ? 1092 LEU B N     1 
ATOM   4138 C  CA    . LEU D 1 92  ? -5.442  74.525  39.456  1.00 69.06  ? 1092 LEU B CA    1 
ATOM   4139 C  C     . LEU D 1 92  ? -4.284  74.914  40.382  1.00 69.27  ? 1092 LEU B C     1 
ATOM   4140 O  O     . LEU D 1 92  ? -4.470  75.037  41.591  1.00 69.27  ? 1092 LEU B O     1 
ATOM   4141 C  CB    . LEU D 1 92  ? -5.752  73.032  39.585  1.00 68.93  ? 1092 LEU B CB    1 
ATOM   4142 C  CG    . LEU D 1 92  ? -7.096  72.577  39.021  1.00 68.60  ? 1092 LEU B CG    1 
ATOM   4143 C  CD1   . LEU D 1 92  ? -7.488  71.271  39.651  1.00 68.42  ? 1092 LEU B CD1   1 
ATOM   4144 C  CD2   . LEU D 1 92  ? -8.174  73.619  39.255  1.00 68.32  ? 1092 LEU B CD2   1 
ATOM   4145 N  N     . ARG D 1 93  ? -3.095  75.104  39.817  1.00 69.50  ? 1093 ARG B N     1 
ATOM   4146 C  CA    . ARG D 1 93  ? -1.962  75.595  40.594  1.00 69.72  ? 1093 ARG B CA    1 
ATOM   4147 C  C     . ARG D 1 93  ? -2.115  77.090  40.855  1.00 69.82  ? 1093 ARG B C     1 
ATOM   4148 O  O     . ARG D 1 93  ? -1.727  77.586  41.911  1.00 69.87  ? 1093 ARG B O     1 
ATOM   4149 C  CB    . ARG D 1 93  ? -0.639  75.317  39.878  1.00 69.70  ? 1093 ARG B CB    1 
ATOM   4150 C  CG    . ARG D 1 93  ? -0.353  73.851  39.648  1.00 69.77  ? 1093 ARG B CG    1 
ATOM   4151 C  CD    . ARG D 1 93  ? 1.036   73.646  39.078  1.00 70.27  ? 1093 ARG B CD    1 
ATOM   4152 N  NE    . ARG D 1 93  ? 1.047   72.644  38.010  1.00 71.11  ? 1093 ARG B NE    1 
ATOM   4153 C  CZ    . ARG D 1 93  ? 1.182   71.335  38.203  1.00 71.29  ? 1093 ARG B CZ    1 
ATOM   4154 N  NH1   . ARG D 1 93  ? 1.318   70.849  39.433  1.00 71.30  ? 1093 ARG B NH1   1 
ATOM   4155 N  NH2   . ARG D 1 93  ? 1.183   70.509  37.164  1.00 70.63  ? 1093 ARG B NH2   1 
ATOM   4156 N  N     . GLU D 1 94  ? -2.696  77.796  39.887  1.00 70.06  ? 1094 GLU B N     1 
ATOM   4157 C  CA    . GLU D 1 94  ? -2.919  79.235  39.989  1.00 70.23  ? 1094 GLU B CA    1 
ATOM   4158 C  C     . GLU D 1 94  ? -3.637  79.590  41.283  1.00 70.32  ? 1094 GLU B C     1 
ATOM   4159 O  O     . GLU D 1 94  ? -3.446  80.677  41.831  1.00 70.29  ? 1094 GLU B O     1 
ATOM   4160 C  CB    . GLU D 1 94  ? -3.735  79.750  38.799  1.00 70.20  ? 1094 GLU B CB    1 
ATOM   4161 C  CG    . GLU D 1 94  ? -3.208  79.344  37.432  1.00 70.75  ? 1094 GLU B CG    1 
ATOM   4162 C  CD    . GLU D 1 94  ? -1.751  79.713  37.216  1.00 71.29  ? 1094 GLU B CD    1 
ATOM   4163 O  OE1   . GLU D 1 94  ? -1.253  80.631  37.898  1.00 71.78  ? 1094 GLU B OE1   1 
ATOM   4164 O  OE2   . GLU D 1 94  ? -1.102  79.085  36.354  1.00 71.78  ? 1094 GLU B OE2   1 
ATOM   4165 N  N     . TYR D 1 95  ? -4.464  78.668  41.764  1.00 70.42  ? 1095 TYR B N     1 
ATOM   4166 C  CA    . TYR D 1 95  ? -5.229  78.895  42.984  1.00 70.53  ? 1095 TYR B CA    1 
ATOM   4167 C  C     . TYR D 1 95  ? -4.451  78.495  44.233  1.00 70.52  ? 1095 TYR B C     1 
ATOM   4168 O  O     . TYR D 1 95  ? -4.329  79.286  45.174  1.00 70.64  ? 1095 TYR B O     1 
ATOM   4169 C  CB    . TYR D 1 95  ? -6.578  78.183  42.915  1.00 70.60  ? 1095 TYR B CB    1 
ATOM   4170 C  CG    . TYR D 1 95  ? -7.482  78.748  41.846  1.00 70.77  ? 1095 TYR B CG    1 
ATOM   4171 C  CD1   . TYR D 1 95  ? -8.279  79.855  42.101  1.00 71.03  ? 1095 TYR B CD1   1 
ATOM   4172 C  CD2   . TYR D 1 95  ? -7.529  78.185  40.578  1.00 71.20  ? 1095 TYR B CD2   1 
ATOM   4173 C  CE1   . TYR D 1 95  ? -9.105  80.381  41.127  1.00 71.34  ? 1095 TYR B CE1   1 
ATOM   4174 C  CE2   . TYR D 1 95  ? -8.352  78.704  39.597  1.00 71.50  ? 1095 TYR B CE2   1 
ATOM   4175 C  CZ    . TYR D 1 95  ? -9.139  79.803  39.878  1.00 71.41  ? 1095 TYR B CZ    1 
ATOM   4176 O  OH    . TYR D 1 95  ? -9.963  80.327  38.910  1.00 71.68  ? 1095 TYR B OH    1 
ATOM   4177 N  N     . SER D 1 96  ? -3.920  77.277  44.241  1.00 70.37  ? 1096 SER B N     1 
ATOM   4178 C  CA    . SER D 1 96  ? -3.063  76.846  45.339  1.00 70.34  ? 1096 SER B CA    1 
ATOM   4179 C  C     . SER D 1 96  ? -1.760  76.241  44.834  1.00 70.37  ? 1096 SER B C     1 
ATOM   4180 O  O     . SER D 1 96  ? -1.754  75.450  43.888  1.00 70.23  ? 1096 SER B O     1 
ATOM   4181 C  CB    . SER D 1 96  ? -3.789  75.862  46.258  1.00 70.37  ? 1096 SER B CB    1 
ATOM   4182 O  OG    . SER D 1 96  ? -2.959  75.480  47.342  1.00 70.14  ? 1096 SER B OG    1 
ATOM   4183 N  N     . GLU D 1 97  ? -0.660  76.625  45.476  1.00 70.42  ? 1097 GLU B N     1 
ATOM   4184 C  CA    . GLU D 1 97  ? 0.666   76.130  45.117  1.00 70.42  ? 1097 GLU B CA    1 
ATOM   4185 C  C     . GLU D 1 97  ? 0.816   74.663  45.500  1.00 70.41  ? 1097 GLU B C     1 
ATOM   4186 O  O     . GLU D 1 97  ? 1.358   73.865  44.731  1.00 70.48  ? 1097 GLU B O     1 
ATOM   4187 C  CB    . GLU D 1 97  ? 1.754   76.955  45.807  1.00 70.43  ? 1097 GLU B CB    1 
ATOM   4188 C  CG    . GLU D 1 97  ? 1.632   78.459  45.608  1.00 70.41  ? 1097 GLU B CG    1 
ATOM   4189 C  CD    . GLU D 1 97  ? 2.974   79.159  45.700  1.00 70.44  ? 1097 GLU B CD    1 
ATOM   4190 O  OE1   . GLU D 1 97  ? 2.997   80.390  45.921  1.00 70.15  ? 1097 GLU B OE1   1 
ATOM   4191 O  OE2   . GLU D 1 97  ? 4.008   78.473  45.549  1.00 70.31  ? 1097 GLU B OE2   1 
ATOM   4192 N  N     . LYS D 1 98  ? 0.327   74.317  46.691  1.00 70.29  ? 1098 LYS B N     1 
ATOM   4193 C  CA    . LYS D 1 98  ? 0.387   72.942  47.191  1.00 70.08  ? 1098 LYS B CA    1 
ATOM   4194 C  C     . LYS D 1 98  ? -0.695  72.056  46.565  1.00 69.87  ? 1098 LYS B C     1 
ATOM   4195 O  O     . LYS D 1 98  ? -1.744  71.811  47.162  1.00 69.79  ? 1098 LYS B O     1 
ATOM   4196 C  CB    . LYS D 1 98  ? 0.288   72.924  48.718  1.00 70.04  ? 1098 LYS B CB    1 
ATOM   4197 C  CG    . LYS D 1 98  ? 1.448   73.620  49.419  1.00 70.24  ? 1098 LYS B CG    1 
ATOM   4198 C  CD    . LYS D 1 98  ? 1.499   73.259  50.900  1.00 70.23  ? 1098 LYS B CD    1 
ATOM   4199 C  CE    . LYS D 1 98  ? 2.707   73.875  51.585  1.00 70.02  ? 1098 LYS B CE    1 
ATOM   4200 N  NZ    . LYS D 1 98  ? 2.883   73.357  52.972  1.00 69.99  ? 1098 LYS B NZ    1 
ATOM   4201 N  N     . ILE D 1 99  ? -0.431  71.577  45.354  1.00 69.55  ? 1099 ILE B N     1 
ATOM   4202 C  CA    . ILE D 1 99  ? -1.405  70.771  44.638  1.00 69.37  ? 1099 ILE B CA    1 
ATOM   4203 C  C     . ILE D 1 99  ? -0.948  69.317  44.529  1.00 69.18  ? 1099 ILE B C     1 
ATOM   4204 O  O     . ILE D 1 99  ? 0.229   69.036  44.300  1.00 69.30  ? 1099 ILE B O     1 
ATOM   4205 C  CB    . ILE D 1 99  ? -1.693  71.340  43.226  1.00 69.46  ? 1099 ILE B CB    1 
ATOM   4206 C  CG1   . ILE D 1 99  ? -3.077  70.901  42.742  1.00 69.27  ? 1099 ILE B CG1   1 
ATOM   4207 C  CG2   . ILE D 1 99  ? -0.608  70.922  42.232  1.00 69.36  ? 1099 ILE B CG2   1 
ATOM   4208 C  CD1   . ILE D 1 99  ? -3.341  71.208  41.283  1.00 69.45  ? 1099 ILE B CD1   1 
ATOM   4209 N  N     . GLU D 1 100 ? -1.883  68.395  44.716  1.00 68.79  ? 1100 GLU B N     1 
ATOM   4210 C  CA    . GLU D 1 100 ? -1.604  66.983  44.509  1.00 68.43  ? 1100 GLU B CA    1 
ATOM   4211 C  C     . GLU D 1 100 ? -2.377  66.509  43.302  1.00 67.97  ? 1100 GLU B C     1 
ATOM   4212 O  O     . GLU D 1 100 ? -3.605  66.442  43.336  1.00 67.72  ? 1100 GLU B O     1 
ATOM   4213 C  CB    . GLU D 1 100 ? -2.007  66.160  45.734  1.00 68.64  ? 1100 GLU B CB    1 
ATOM   4214 C  CG    . GLU D 1 100 ? -1.964  64.655  45.518  1.00 69.21  ? 1100 GLU B CG    1 
ATOM   4215 C  CD    . GLU D 1 100 ? -2.009  63.873  46.818  1.00 70.64  ? 1100 GLU B CD    1 
ATOM   4216 O  OE1   . GLU D 1 100 ? -2.436  64.441  47.848  1.00 71.21  ? 1100 GLU B OE1   1 
ATOM   4217 O  OE2   . GLU D 1 100 ? -1.609  62.688  46.811  1.00 71.01  ? 1100 GLU B OE2   1 
ATOM   4218 N  N     . ILE D 1 101 ? -1.654  66.205  42.231  1.00 67.63  ? 1101 ILE B N     1 
ATOM   4219 C  CA    . ILE D 1 101 ? -2.249  65.600  41.051  1.00 67.06  ? 1101 ILE B CA    1 
ATOM   4220 C  C     . ILE D 1 101 ? -2.378  64.106  41.325  1.00 66.87  ? 1101 ILE B C     1 
ATOM   4221 O  O     . ILE D 1 101 ? -1.375  63.390  41.413  1.00 67.04  ? 1101 ILE B O     1 
ATOM   4222 C  CB    . ILE D 1 101 ? -1.383  65.839  39.798  1.00 67.25  ? 1101 ILE B CB    1 
ATOM   4223 C  CG1   . ILE D 1 101 ? -1.009  67.319  39.688  1.00 66.90  ? 1101 ILE B CG1   1 
ATOM   4224 C  CG2   . ILE D 1 101 ? -2.099  65.369  38.536  1.00 66.94  ? 1101 ILE B CG2   1 
ATOM   4225 C  CD1   . ILE D 1 101 ? -2.197  68.245  39.731  1.00 66.75  ? 1101 ILE B CD1   1 
ATOM   4226 N  N     . ALA D 1 102 ? -3.617  63.648  41.483  1.00 66.27  ? 1102 ALA B N     1 
ATOM   4227 C  CA    . ALA D 1 102 ? -3.893  62.266  41.853  1.00 65.49  ? 1102 ALA B CA    1 
ATOM   4228 C  C     . ALA D 1 102 ? -3.975  61.363  40.631  1.00 64.88  ? 1102 ALA B C     1 
ATOM   4229 O  O     . ALA D 1 102 ? -3.681  60.168  40.697  1.00 64.68  ? 1102 ALA B O     1 
ATOM   4230 C  CB    . ALA D 1 102 ? -5.184  62.195  42.641  1.00 65.67  ? 1102 ALA B CB    1 
ATOM   4231 N  N     . SER D 1 103 ? -4.388  61.948  39.517  1.00 64.39  ? 1103 SER B N     1 
ATOM   4232 C  CA    . SER D 1 103 ? -4.598  61.203  38.289  1.00 63.74  ? 1103 SER B CA    1 
ATOM   4233 C  C     . SER D 1 103 ? -4.810  62.178  37.149  1.00 63.58  ? 1103 SER B C     1 
ATOM   4234 O  O     . SER D 1 103 ? -4.637  63.381  37.304  1.00 63.35  ? 1103 SER B O     1 
ATOM   4235 C  CB    . SER D 1 103 ? -5.834  60.310  38.422  1.00 63.75  ? 1103 SER B CB    1 
ATOM   4236 O  OG    . SER D 1 103 ? -7.020  61.082  38.348  1.00 62.65  ? 1103 SER B OG    1 
ATOM   4237 N  N     . ILE D 1 104 ? -5.211  61.650  36.004  1.00 63.79  ? 1104 ILE B N     1 
ATOM   4238 C  CA    . ILE D 1 104 ? -5.413  62.462  34.815  1.00 63.96  ? 1104 ILE B CA    1 
ATOM   4239 C  C     . ILE D 1 104 ? -6.484  63.528  35.028  1.00 64.05  ? 1104 ILE B C     1 
ATOM   4240 O  O     . ILE D 1 104 ? -6.464  64.579  34.396  1.00 64.00  ? 1104 ILE B O     1 
ATOM   4241 C  CB    . ILE D 1 104 ? -5.783  61.576  33.608  1.00 63.84  ? 1104 ILE B CB    1 
ATOM   4242 C  CG1   . ILE D 1 104 ? -5.596  62.339  32.294  1.00 63.66  ? 1104 ILE B CG1   1 
ATOM   4243 C  CG2   . ILE D 1 104 ? -7.197  61.010  33.762  1.00 64.20  ? 1104 ILE B CG2   1 
ATOM   4244 C  CD1   . ILE D 1 104 ? -5.598  61.445  31.088  1.00 63.67  ? 1104 ILE B CD1   1 
ATOM   4245 N  N     . ASP D 1 105 ? -7.408  63.268  35.943  1.00 64.39  ? 1105 ASP B N     1 
ATOM   4246 C  CA    . ASP D 1 105 ? -8.572  64.124  36.072  1.00 64.43  ? 1105 ASP B CA    1 
ATOM   4247 C  C     . ASP D 1 105 ? -8.891  64.470  37.519  1.00 64.71  ? 1105 ASP B C     1 
ATOM   4248 O  O     . ASP D 1 105 ? -9.985  64.933  37.825  1.00 65.00  ? 1105 ASP B O     1 
ATOM   4249 C  CB    . ASP D 1 105 ? -9.777  63.460  35.404  1.00 64.15  ? 1105 ASP B CB    1 
ATOM   4250 C  CG    . ASP D 1 105 ? -10.394 62.381  36.263  1.00 63.46  ? 1105 ASP B CG    1 
ATOM   4251 O  OD1   . ASP D 1 105 ? -9.664  61.732  37.040  1.00 63.32  ? 1105 ASP B OD1   1 
ATOM   4252 O  OD2   . ASP D 1 105 ? -11.616 62.180  36.158  1.00 59.90  ? 1105 ASP B OD2   1 
ATOM   4253 N  N     . GLU D 1 106 ? -7.936  64.247  38.411  1.00 65.21  ? 1106 GLU B N     1 
ATOM   4254 C  CA    . GLU D 1 106 ? -8.128  64.593  39.816  1.00 65.68  ? 1106 GLU B CA    1 
ATOM   4255 C  C     . GLU D 1 106 ? -6.949  65.346  40.382  1.00 65.78  ? 1106 GLU B C     1 
ATOM   4256 O  O     . GLU D 1 106 ? -5.801  64.916  40.258  1.00 65.87  ? 1106 GLU B O     1 
ATOM   4257 C  CB    . GLU D 1 106 ? -8.308  63.348  40.663  1.00 65.74  ? 1106 GLU B CB    1 
ATOM   4258 C  CG    . GLU D 1 106 ? -9.502  62.514  40.343  1.00 66.73  ? 1106 GLU B CG    1 
ATOM   4259 C  CD    . GLU D 1 106 ? -9.414  61.208  41.066  1.00 68.67  ? 1106 GLU B CD    1 
ATOM   4260 O  OE1   . GLU D 1 106 ? -8.321  60.598  41.019  1.00 69.43  ? 1106 GLU B OE1   1 
ATOM   4261 O  OE2   . GLU D 1 106 ? -10.412 60.810  41.706  1.00 69.24  ? 1106 GLU B OE2   1 
ATOM   4262 N  N     . ALA D 1 107 ? -7.244  66.467  41.021  1.00 65.87  ? 1107 ALA B N     1 
ATOM   4263 C  CA    . ALA D 1 107 ? -6.240  67.197  41.760  1.00 65.96  ? 1107 ALA B CA    1 
ATOM   4264 C  C     . ALA D 1 107 ? -6.768  67.460  43.152  1.00 66.08  ? 1107 ALA B C     1 
ATOM   4265 O  O     . ALA D 1 107 ? -7.953  67.733  43.335  1.00 65.79  ? 1107 ALA B O     1 
ATOM   4266 C  CB    . ALA D 1 107 ? -5.904  68.500  41.070  1.00 65.87  ? 1107 ALA B CB    1 
ATOM   4267 N  N     . TYR D 1 108 ? -5.880  67.345  44.131  1.00 66.39  ? 1108 TYR B N     1 
ATOM   4268 C  CA    . TYR D 1 108 ? -6.159  67.813  45.471  1.00 66.76  ? 1108 TYR B CA    1 
ATOM   4269 C  C     . TYR D 1 108 ? -5.455  69.143  45.664  1.00 66.81  ? 1108 TYR B C     1 
ATOM   4270 O  O     . TYR D 1 108 ? -4.257  69.258  45.413  1.00 66.72  ? 1108 TYR B O     1 
ATOM   4271 C  CB    . TYR D 1 108 ? -5.657  66.811  46.500  1.00 66.97  ? 1108 TYR B CB    1 
ATOM   4272 C  CG    . TYR D 1 108 ? -6.409  65.508  46.486  1.00 67.64  ? 1108 TYR B CG    1 
ATOM   4273 C  CD1   . TYR D 1 108 ? -7.619  65.382  47.153  1.00 68.48  ? 1108 TYR B CD1   1 
ATOM   4274 C  CD2   . TYR D 1 108 ? -5.912  64.405  45.810  1.00 68.69  ? 1108 TYR B CD2   1 
ATOM   4275 C  CE1   . TYR D 1 108 ? -8.317  64.190  47.144  1.00 69.19  ? 1108 TYR B CE1   1 
ATOM   4276 C  CE2   . TYR D 1 108 ? -6.604  63.207  45.795  1.00 69.67  ? 1108 TYR B CE2   1 
ATOM   4277 C  CZ    . TYR D 1 108 ? -7.805  63.106  46.469  1.00 69.59  ? 1108 TYR B CZ    1 
ATOM   4278 O  OH    . TYR D 1 108 ? -8.505  61.922  46.464  1.00 70.47  ? 1108 TYR B OH    1 
ATOM   4279 N  N     . LEU D 1 109 ? -6.207  70.151  46.090  1.00 67.00  ? 1109 LEU B N     1 
ATOM   4280 C  CA    . LEU D 1 109 ? -5.619  71.435  46.437  1.00 67.10  ? 1109 LEU B CA    1 
ATOM   4281 C  C     . LEU D 1 109 ? -5.638  71.601  47.938  1.00 67.20  ? 1109 LEU B C     1 
ATOM   4282 O  O     . LEU D 1 109 ? -6.688  71.495  48.573  1.00 67.25  ? 1109 LEU B O     1 
ATOM   4283 C  CB    . LEU D 1 109 ? -6.375  72.598  45.787  1.00 67.07  ? 1109 LEU B CB    1 
ATOM   4284 C  CG    . LEU D 1 109 ? -6.023  72.946  44.341  1.00 66.97  ? 1109 LEU B CG    1 
ATOM   4285 C  CD1   . LEU D 1 109 ? -6.543  71.877  43.396  1.00 66.79  ? 1109 LEU B CD1   1 
ATOM   4286 C  CD2   . LEU D 1 109 ? -6.589  74.309  43.975  1.00 66.62  ? 1109 LEU B CD2   1 
ATOM   4287 N  N     . ASP D 1 110 ? -4.467  71.850  48.505  1.00 67.33  ? 1110 ASP B N     1 
ATOM   4288 C  CA    . ASP D 1 110 ? -4.373  72.188  49.906  1.00 67.26  ? 1110 ASP B CA    1 
ATOM   4289 C  C     . ASP D 1 110 ? -4.869  73.618  50.071  1.00 67.29  ? 1110 ASP B C     1 
ATOM   4290 O  O     . ASP D 1 110 ? -4.275  74.558  49.542  1.00 67.23  ? 1110 ASP B O     1 
ATOM   4291 C  CB    . ASP D 1 110 ? -2.926  72.062  50.392  1.00 67.27  ? 1110 ASP B CB    1 
ATOM   4292 C  CG    . ASP D 1 110 ? -2.825  71.857  51.900  1.00 67.51  ? 1110 ASP B CG    1 
ATOM   4293 O  OD1   . ASP D 1 110 ? -3.874  71.830  52.582  1.00 67.45  ? 1110 ASP B OD1   1 
ATOM   4294 O  OD2   . ASP D 1 110 ? -1.690  71.718  52.403  1.00 67.48  ? 1110 ASP B OD2   1 
ATOM   4295 N  N     . ILE D 1 111 ? -5.985  73.770  50.771  1.00 67.36  ? 1111 ILE B N     1 
ATOM   4296 C  CA    . ILE D 1 111 ? -6.433  75.083  51.200  1.00 67.48  ? 1111 ILE B CA    1 
ATOM   4297 C  C     . ILE D 1 111 ? -6.131  75.272  52.682  1.00 67.61  ? 1111 ILE B C     1 
ATOM   4298 O  O     . ILE D 1 111 ? -6.951  74.940  53.537  1.00 67.63  ? 1111 ILE B O     1 
ATOM   4299 C  CB    . ILE D 1 111 ? -7.942  75.274  50.991  1.00 67.44  ? 1111 ILE B CB    1 
ATOM   4300 C  CG1   . ILE D 1 111 ? -8.284  75.306  49.503  1.00 66.45  ? 1111 ILE B CG1   1 
ATOM   4301 C  CG2   . ILE D 1 111 ? -8.419  76.554  51.708  1.00 67.49  ? 1111 ILE B CG2   1 
ATOM   4302 C  CD1   . ILE D 1 111 ? -9.734  75.613  49.247  1.00 65.38  ? 1111 ILE B CD1   1 
ATOM   4303 N  N     . SER D 1 112 ? -4.945  75.786  52.983  1.00 67.94  ? 1112 SER B N     1 
ATOM   4304 C  CA    . SER D 1 112 ? -4.598  76.145  54.360  1.00 68.32  ? 1112 SER B CA    1 
ATOM   4305 C  C     . SER D 1 112 ? -4.215  77.618  54.415  1.00 68.46  ? 1112 SER B C     1 
ATOM   4306 O  O     . SER D 1 112 ? -4.413  78.288  55.428  1.00 68.48  ? 1112 SER B O     1 
ATOM   4307 C  CB    . SER D 1 112 ? -3.458  75.269  54.887  1.00 68.34  ? 1112 SER B CB    1 
ATOM   4308 O  OG    . SER D 1 112 ? -2.404  75.177  53.942  1.00 68.27  ? 1112 SER B OG    1 
ATOM   4309 N  N     . ASP D 1 113 ? -3.667  78.107  53.307  1.00 68.73  ? 1113 ASP B N     1 
ATOM   4310 C  CA    . ASP D 1 113 ? -3.321  79.514  53.161  1.00 68.93  ? 1113 ASP B CA    1 
ATOM   4311 C  C     . ASP D 1 113 ? -4.288  80.200  52.200  1.00 69.05  ? 1113 ASP B C     1 
ATOM   4312 O  O     . ASP D 1 113 ? -3.918  81.150  51.508  1.00 69.17  ? 1113 ASP B O     1 
ATOM   4313 C  CB    . ASP D 1 113 ? -1.882  79.662  52.653  1.00 68.90  ? 1113 ASP B CB    1 
ATOM   4314 C  CG    . ASP D 1 113 ? -0.848  79.415  53.738  1.00 68.89  ? 1113 ASP B CG    1 
ATOM   4315 O  OD1   . ASP D 1 113 ? -0.675  80.296  54.615  1.00 69.20  ? 1113 ASP B OD1   1 
ATOM   4316 O  OD2   . ASP D 1 113 ? -0.200  78.346  53.706  1.00 68.24  ? 1113 ASP B OD2   1 
ATOM   4317 N  N     . LYS D 1 114 ? -5.526  79.713  52.156  1.00 69.10  ? 1114 LYS B N     1 
ATOM   4318 C  CA    . LYS D 1 114 ? -6.537  80.277  51.265  1.00 69.19  ? 1114 LYS B CA    1 
ATOM   4319 C  C     . LYS D 1 114 ? -7.828  80.598  52.020  1.00 69.24  ? 1114 LYS B C     1 
ATOM   4320 O  O     . LYS D 1 114 ? -8.885  80.033  51.740  1.00 69.25  ? 1114 LYS B O     1 
ATOM   4321 C  CB    . LYS D 1 114 ? -6.815  79.331  50.094  1.00 69.18  ? 1114 LYS B CB    1 
ATOM   4322 C  CG    . LYS D 1 114 ? -5.571  78.656  49.523  1.00 69.21  ? 1114 LYS B CG    1 
ATOM   4323 C  CD    . LYS D 1 114 ? -4.646  79.636  48.807  1.00 69.09  ? 1114 LYS B CD    1 
ATOM   4324 C  CE    . LYS D 1 114 ? -3.317  78.968  48.476  1.00 69.06  ? 1114 LYS B CE    1 
ATOM   4325 N  NZ    . LYS D 1 114 ? -2.512  79.722  47.476  1.00 68.89  ? 1114 LYS B NZ    1 
ATOM   4326 N  N     . VAL D 1 115 ? -7.708  81.512  52.980  1.00 69.43  ? 1115 VAL B N     1 
ATOM   4327 C  CA    . VAL D 1 115 ? -8.821  82.012  53.802  1.00 69.50  ? 1115 VAL B CA    1 
ATOM   4328 C  C     . VAL D 1 115 ? -9.746  80.930  54.379  1.00 69.53  ? 1115 VAL B C     1 
ATOM   4329 O  O     . VAL D 1 115 ? -10.551 80.329  53.666  1.00 69.46  ? 1115 VAL B O     1 
ATOM   4330 C  CB    . VAL D 1 115 ? -9.643  83.105  53.072  1.00 69.54  ? 1115 VAL B CB    1 
ATOM   4331 C  CG1   . VAL D 1 115 ? -10.565 83.818  54.057  1.00 69.53  ? 1115 VAL B CG1   1 
ATOM   4332 C  CG2   . VAL D 1 115 ? -8.715  84.111  52.395  1.00 69.28  ? 1115 VAL B CG2   1 
ATOM   4333 N  N     . ARG D 1 116 ? -9.626  80.716  55.687  1.00 69.57  ? 1116 ARG B N     1 
ATOM   4334 C  CA    . ARG D 1 116 ? -10.347 79.659  56.398  1.00 69.52  ? 1116 ARG B CA    1 
ATOM   4335 C  C     . ARG D 1 116 ? -11.867 79.807  56.335  1.00 69.33  ? 1116 ARG B C     1 
ATOM   4336 O  O     . ARG D 1 116 ? -12.412 80.856  56.691  1.00 69.21  ? 1116 ARG B O     1 
ATOM   4337 C  CB    . ARG D 1 116 ? -9.920  79.621  57.871  1.00 69.64  ? 1116 ARG B CB    1 
ATOM   4338 C  CG    . ARG D 1 116 ? -8.500  80.099  58.154  1.00 69.93  ? 1116 ARG B CG    1 
ATOM   4339 C  CD    . ARG D 1 116 ? -8.462  81.573  58.544  1.00 70.22  ? 1116 ARG B CD    1 
ATOM   4340 N  NE    . ARG D 1 116 ? -8.678  82.458  57.401  1.00 70.55  ? 1116 ARG B NE    1 
ATOM   4341 C  CZ    . ARG D 1 116 ? -8.583  83.784  57.453  1.00 70.65  ? 1116 ARG B CZ    1 
ATOM   4342 N  NH1   . ARG D 1 116 ? -8.275  84.386  58.594  1.00 70.53  ? 1116 ARG B NH1   1 
ATOM   4343 N  NH2   . ARG D 1 116 ? -8.794  84.510  56.362  1.00 70.62  ? 1116 ARG B NH2   1 
ATOM   4344 N  N     . ASP D 1 117 ? -12.537 78.744  55.894  1.00 69.04  ? 1117 ASP B N     1 
ATOM   4345 C  CA    . ASP D 1 117 ? -13.999 78.668  55.906  1.00 68.79  ? 1117 ASP B CA    1 
ATOM   4346 C  C     . ASP D 1 117 ? -14.514 77.703  54.841  1.00 68.59  ? 1117 ASP B C     1 
ATOM   4347 O  O     . ASP D 1 117 ? -14.032 77.695  53.705  1.00 68.59  ? 1117 ASP B O     1 
ATOM   4348 C  CB    . ASP D 1 117 ? -14.630 80.051  55.715  1.00 68.81  ? 1117 ASP B CB    1 
ATOM   4349 C  CG    . ASP D 1 117 ? -16.082 80.100  56.158  1.00 68.80  ? 1117 ASP B CG    1 
ATOM   4350 O  OD1   . ASP D 1 117 ? -16.797 79.087  55.995  1.00 68.40  ? 1117 ASP B OD1   1 
ATOM   4351 O  OD2   . ASP D 1 117 ? -16.510 81.159  56.670  1.00 68.98  ? 1117 ASP B OD2   1 
ATOM   4352 N  N     . TYR D 1 118 ? -15.500 76.893  55.218  1.00 68.30  ? 1118 TYR B N     1 
ATOM   4353 C  CA    . TYR D 1 118 ? -16.122 75.944  54.294  1.00 67.90  ? 1118 TYR B CA    1 
ATOM   4354 C  C     . TYR D 1 118 ? -17.080 76.642  53.326  1.00 67.61  ? 1118 TYR B C     1 
ATOM   4355 O  O     . TYR D 1 118 ? -17.805 75.988  52.577  1.00 67.65  ? 1118 TYR B O     1 
ATOM   4356 C  CB    . TYR D 1 118 ? -16.866 74.842  55.059  1.00 67.91  ? 1118 TYR B CB    1 
ATOM   4357 C  CG    . TYR D 1 118 ? -16.012 73.658  55.475  1.00 67.77  ? 1118 TYR B CG    1 
ATOM   4358 C  CD1   . TYR D 1 118 ? -16.417 72.815  56.504  1.00 67.51  ? 1118 TYR B CD1   1 
ATOM   4359 C  CD2   . TYR D 1 118 ? -14.805 73.382  54.839  1.00 67.94  ? 1118 TYR B CD2   1 
ATOM   4360 C  CE1   . TYR D 1 118 ? -15.648 71.727  56.888  1.00 67.44  ? 1118 TYR B CE1   1 
ATOM   4361 C  CE2   . TYR D 1 118 ? -14.027 72.296  55.218  1.00 67.87  ? 1118 TYR B CE2   1 
ATOM   4362 C  CZ    . TYR D 1 118 ? -14.454 71.474  56.244  1.00 67.76  ? 1118 TYR B CZ    1 
ATOM   4363 O  OH    . TYR D 1 118 ? -13.688 70.395  56.625  1.00 67.50  ? 1118 TYR B OH    1 
ATOM   4364 N  N     . ARG D 1 119 ? -17.081 77.970  53.358  1.00 67.16  ? 1119 ARG B N     1 
ATOM   4365 C  CA    . ARG D 1 119 ? -17.901 78.774  52.461  1.00 66.73  ? 1119 ARG B CA    1 
ATOM   4366 C  C     . ARG D 1 119 ? -16.982 79.632  51.597  1.00 66.49  ? 1119 ARG B C     1 
ATOM   4367 O  O     . ARG D 1 119 ? -17.355 80.067  50.506  1.00 66.44  ? 1119 ARG B O     1 
ATOM   4368 C  CB    . ARG D 1 119 ? -18.854 79.648  53.273  1.00 66.78  ? 1119 ARG B CB    1 
ATOM   4369 C  CG    . ARG D 1 119 ? -19.883 80.421  52.468  1.00 66.50  ? 1119 ARG B CG    1 
ATOM   4370 C  CD    . ARG D 1 119 ? -20.739 81.252  53.413  1.00 66.09  ? 1119 ARG B CD    1 
ATOM   4371 N  NE    . ARG D 1 119 ? -21.515 82.275  52.720  1.00 65.70  ? 1119 ARG B NE    1 
ATOM   4372 C  CZ    . ARG D 1 119 ? -22.211 83.226  53.334  1.00 65.24  ? 1119 ARG B CZ    1 
ATOM   4373 N  NH1   . ARG D 1 119 ? -22.228 83.293  54.659  1.00 65.04  ? 1119 ARG B NH1   1 
ATOM   4374 N  NH2   . ARG D 1 119 ? -22.889 84.114  52.621  1.00 65.09  ? 1119 ARG B NH2   1 
ATOM   4375 N  N     . GLU D 1 120 ? -15.771 79.861  52.099  1.00 66.13  ? 1120 GLU B N     1 
ATOM   4376 C  CA    . GLU D 1 120 ? -14.729 80.549  51.349  1.00 65.74  ? 1120 GLU B CA    1 
ATOM   4377 C  C     . GLU D 1 120 ? -14.202 79.635  50.254  1.00 65.43  ? 1120 GLU B C     1 
ATOM   4378 O  O     . GLU D 1 120 ? -13.975 80.067  49.123  1.00 65.49  ? 1120 GLU B O     1 
ATOM   4379 C  CB    . GLU D 1 120 ? -13.581 80.949  52.278  1.00 65.74  ? 1120 GLU B CB    1 
ATOM   4380 C  CG    . GLU D 1 120 ? -13.853 82.178  53.121  1.00 65.79  ? 1120 GLU B CG    1 
ATOM   4381 C  CD    . GLU D 1 120 ? -13.465 83.464  52.418  1.00 65.87  ? 1120 GLU B CD    1 
ATOM   4382 O  OE1   . GLU D 1 120 ? -12.870 83.380  51.320  1.00 65.20  ? 1120 GLU B OE1   1 
ATOM   4383 O  OE2   . GLU D 1 120 ? -13.744 84.554  52.972  1.00 65.06  ? 1120 GLU B OE2   1 
ATOM   4384 N  N     . ALA D 1 121 ? -14.009 78.365  50.604  1.00 65.05  ? 1121 ALA B N     1 
ATOM   4385 C  CA    . ALA D 1 121 ? -13.527 77.362  49.662  1.00 64.45  ? 1121 ALA B CA    1 
ATOM   4386 C  C     . ALA D 1 121 ? -14.589 77.026  48.627  1.00 64.17  ? 1121 ALA B C     1 
ATOM   4387 O  O     . ALA D 1 121 ? -14.268 76.679  47.488  1.00 64.34  ? 1121 ALA B O     1 
ATOM   4388 C  CB    . ALA D 1 121 ? -13.096 76.107  50.399  1.00 64.45  ? 1121 ALA B CB    1 
ATOM   4389 N  N     . TYR D 1 122 ? -15.854 77.121  49.025  1.00 63.59  ? 1122 TYR B N     1 
ATOM   4390 C  CA    . TYR D 1 122 ? -16.959 76.839  48.116  1.00 63.21  ? 1122 TYR B CA    1 
ATOM   4391 C  C     . TYR D 1 122 ? -17.000 77.848  46.970  1.00 63.24  ? 1122 TYR B C     1 
ATOM   4392 O  O     . TYR D 1 122 ? -17.195 77.475  45.812  1.00 63.37  ? 1122 TYR B O     1 
ATOM   4393 C  CB    . TYR D 1 122 ? -18.283 76.830  48.874  1.00 62.98  ? 1122 TYR B CB    1 
ATOM   4394 C  CG    . TYR D 1 122 ? -19.489 76.460  48.041  1.00 62.24  ? 1122 TYR B CG    1 
ATOM   4395 C  CD1   . TYR D 1 122 ? -19.933 75.148  47.973  1.00 61.66  ? 1122 TYR B CD1   1 
ATOM   4396 C  CD2   . TYR D 1 122 ? -20.196 77.428  47.340  1.00 61.83  ? 1122 TYR B CD2   1 
ATOM   4397 C  CE1   . TYR D 1 122 ? -21.041 74.808  47.228  1.00 61.51  ? 1122 TYR B CE1   1 
ATOM   4398 C  CE2   . TYR D 1 122 ? -21.305 77.099  46.591  1.00 61.66  ? 1122 TYR B CE2   1 
ATOM   4399 C  CZ    . TYR D 1 122 ? -21.723 75.788  46.538  1.00 61.79  ? 1122 TYR B CZ    1 
ATOM   4400 O  OH    . TYR D 1 122 ? -22.829 75.457  45.789  1.00 62.36  ? 1122 TYR B OH    1 
ATOM   4401 N  N     . ASN D 1 123 ? -16.806 79.124  47.295  1.00 63.14  ? 1123 ASN B N     1 
ATOM   4402 C  CA    . ASN D 1 123 ? -16.759 80.173  46.280  1.00 63.01  ? 1123 ASN B CA    1 
ATOM   4403 C  C     . ASN D 1 123 ? -15.512 80.073  45.404  1.00 62.96  ? 1123 ASN B C     1 
ATOM   4404 O  O     . ASN D 1 123 ? -15.526 80.481  44.243  1.00 62.96  ? 1123 ASN B O     1 
ATOM   4405 C  CB    . ASN D 1 123 ? -16.844 81.556  46.927  1.00 63.03  ? 1123 ASN B CB    1 
ATOM   4406 C  CG    . ASN D 1 123 ? -18.238 81.880  47.436  1.00 62.96  ? 1123 ASN B CG    1 
ATOM   4407 O  OD1   . ASN D 1 123 ? -19.117 81.017  47.473  1.00 62.68  ? 1123 ASN B OD1   1 
ATOM   4408 N  ND2   . ASN D 1 123 ? -18.445 83.131  47.831  1.00 62.66  ? 1123 ASN B ND2   1 
ATOM   4409 N  N     . LEU D 1 124 ? -14.435 79.536  45.972  1.00 62.86  ? 1124 LEU B N     1 
ATOM   4410 C  CA    . LEU D 1 124 ? -13.203 79.299  45.229  1.00 62.76  ? 1124 LEU B CA    1 
ATOM   4411 C  C     . LEU D 1 124 ? -13.423 78.180  44.210  1.00 62.81  ? 1124 LEU B C     1 
ATOM   4412 O  O     . LEU D 1 124 ? -12.996 78.274  43.057  1.00 62.54  ? 1124 LEU B O     1 
ATOM   4413 C  CB    . LEU D 1 124 ? -12.069 78.929  46.191  1.00 62.68  ? 1124 LEU B CB    1 
ATOM   4414 C  CG    . LEU D 1 124 ? -10.672 78.716  45.605  1.00 62.58  ? 1124 LEU B CG    1 
ATOM   4415 C  CD1   . LEU D 1 124 ? -10.051 80.040  45.200  1.00 62.55  ? 1124 LEU B CD1   1 
ATOM   4416 C  CD2   . LEU D 1 124 ? -9.780  78.004  46.602  1.00 62.27  ? 1124 LEU B CD2   1 
ATOM   4417 N  N     . GLY D 1 125 ? -14.105 77.125  44.649  1.00 62.88  ? 1125 GLY B N     1 
ATOM   4418 C  CA    . GLY D 1 125 ? -14.446 76.008  43.781  1.00 62.82  ? 1125 GLY B CA    1 
ATOM   4419 C  C     . GLY D 1 125 ? -15.407 76.413  42.683  1.00 62.86  ? 1125 GLY B C     1 
ATOM   4420 O  O     . GLY D 1 125 ? -15.259 75.990  41.537  1.00 62.96  ? 1125 GLY B O     1 
ATOM   4421 N  N     . LEU D 1 126 ? -16.403 77.222  43.032  1.00 62.89  ? 1126 LEU B N     1 
ATOM   4422 C  CA    . LEU D 1 126 ? -17.322 77.765  42.040  1.00 62.93  ? 1126 LEU B CA    1 
ATOM   4423 C  C     . LEU D 1 126 ? -16.528 78.575  41.026  1.00 63.04  ? 1126 LEU B C     1 
ATOM   4424 O  O     . LEU D 1 126 ? -16.756 78.490  39.817  1.00 62.94  ? 1126 LEU B O     1 
ATOM   4425 C  CB    . LEU D 1 126 ? -18.380 78.655  42.700  1.00 62.90  ? 1126 LEU B CB    1 
ATOM   4426 C  CG    . LEU D 1 126 ? -19.652 78.006  43.252  1.00 62.70  ? 1126 LEU B CG    1 
ATOM   4427 C  CD1   . LEU D 1 126 ? -20.689 79.075  43.577  1.00 62.30  ? 1126 LEU B CD1   1 
ATOM   4428 C  CD2   . LEU D 1 126 ? -20.221 77.000  42.264  1.00 62.55  ? 1126 LEU B CD2   1 
ATOM   4429 N  N     . GLU D 1 127 ? -15.589 79.360  41.541  1.00 63.18  ? 1127 GLU B N     1 
ATOM   4430 C  CA    . GLU D 1 127 ? -14.696 80.154  40.717  1.00 63.32  ? 1127 GLU B CA    1 
ATOM   4431 C  C     . GLU D 1 127 ? -13.858 79.241  39.842  1.00 63.28  ? 1127 GLU B C     1 
ATOM   4432 O  O     . GLU D 1 127 ? -13.683 79.502  38.652  1.00 63.46  ? 1127 GLU B O     1 
ATOM   4433 C  CB    . GLU D 1 127 ? -13.799 81.004  41.611  1.00 63.43  ? 1127 GLU B CB    1 
ATOM   4434 C  CG    . GLU D 1 127 ? -12.694 81.755  40.899  1.00 63.68  ? 1127 GLU B CG    1 
ATOM   4435 C  CD    . GLU D 1 127 ? -12.012 82.739  41.823  1.00 63.62  ? 1127 GLU B CD    1 
ATOM   4436 O  OE1   . GLU D 1 127 ? -12.666 83.186  42.789  1.00 63.54  ? 1127 GLU B OE1   1 
ATOM   4437 O  OE2   . GLU D 1 127 ? -10.828 83.063  41.592  1.00 63.87  ? 1127 GLU B OE2   1 
ATOM   4438 N  N     . ILE D 1 128 ? -13.352 78.165  40.442  1.00 63.20  ? 1128 ILE B N     1 
ATOM   4439 C  CA    . ILE D 1 128 ? -12.562 77.161  39.728  1.00 62.96  ? 1128 ILE B CA    1 
ATOM   4440 C  C     . ILE D 1 128 ? -13.357 76.474  38.619  1.00 62.89  ? 1128 ILE B C     1 
ATOM   4441 O  O     . ILE D 1 128 ? -12.933 76.466  37.469  1.00 62.89  ? 1128 ILE B O     1 
ATOM   4442 C  CB    . ILE D 1 128 ? -11.987 76.104  40.693  1.00 62.96  ? 1128 ILE B CB    1 
ATOM   4443 C  CG1   . ILE D 1 128 ? -10.789 76.679  41.448  1.00 62.84  ? 1128 ILE B CG1   1 
ATOM   4444 C  CG2   . ILE D 1 128 ? -11.576 74.851  39.939  1.00 62.62  ? 1128 ILE B CG2   1 
ATOM   4445 C  CD1   . ILE D 1 128 ? -10.134 75.688  42.384  1.00 63.15  ? 1128 ILE B CD1   1 
ATOM   4446 N  N     . LYS D 1 129 ? -14.505 75.901  38.967  1.00 62.84  ? 1129 LYS B N     1 
ATOM   4447 C  CA    . LYS D 1 129 ? -15.376 75.273  37.976  1.00 62.78  ? 1129 LYS B CA    1 
ATOM   4448 C  C     . LYS D 1 129 ? -15.573 76.195  36.784  1.00 62.76  ? 1129 LYS B C     1 
ATOM   4449 O  O     . LYS D 1 129 ? -15.240 75.842  35.654  1.00 62.98  ? 1129 LYS B O     1 
ATOM   4450 C  CB    . LYS D 1 129 ? -16.733 74.916  38.586  1.00 62.74  ? 1129 LYS B CB    1 
ATOM   4451 C  CG    . LYS D 1 129 ? -16.717 73.688  39.483  1.00 62.73  ? 1129 LYS B CG    1 
ATOM   4452 C  CD    . LYS D 1 129 ? -17.989 73.591  40.310  1.00 62.88  ? 1129 LYS B CD    1 
ATOM   4453 C  CE    . LYS D 1 129 ? -19.230 73.487  39.433  1.00 63.23  ? 1129 LYS B CE    1 
ATOM   4454 N  NZ    . LYS D 1 129 ? -19.432 72.111  38.904  1.00 63.26  ? 1129 LYS B NZ    1 
ATOM   4455 N  N     . ASN D 1 130 ? -16.109 77.380  37.049  1.00 62.89  ? 1130 ASN B N     1 
ATOM   4456 C  CA    . ASN D 1 130 ? -16.342 78.386  36.014  1.00 62.86  ? 1130 ASN B CA    1 
ATOM   4457 C  C     . ASN D 1 130 ? -15.079 78.751  35.245  1.00 62.75  ? 1130 ASN B C     1 
ATOM   4458 O  O     . ASN D 1 130 ? -15.135 78.997  34.041  1.00 62.63  ? 1130 ASN B O     1 
ATOM   4459 C  CB    . ASN D 1 130 ? -16.977 79.636  36.620  1.00 62.84  ? 1130 ASN B CB    1 
ATOM   4460 C  CG    . ASN D 1 130 ? -18.298 79.340  37.298  1.00 63.27  ? 1130 ASN B CG    1 
ATOM   4461 O  OD1   . ASN D 1 130 ? -18.853 78.250  37.147  1.00 63.78  ? 1130 ASN B OD1   1 
ATOM   4462 N  ND2   . ASN D 1 130 ? -18.807 80.305  38.054  1.00 63.73  ? 1130 ASN B ND2   1 
ATOM   4463 N  N     . LYS D 1 131 ? -13.945 78.789  35.940  1.00 62.69  ? 1131 LYS B N     1 
ATOM   4464 C  CA    . LYS D 1 131 ? -12.668 79.036  35.286  1.00 62.75  ? 1131 LYS B CA    1 
ATOM   4465 C  C     . LYS D 1 131 ? -12.394 77.943  34.264  1.00 62.80  ? 1131 LYS B C     1 
ATOM   4466 O  O     . LYS D 1 131 ? -12.152 78.222  33.089  1.00 63.07  ? 1131 LYS B O     1 
ATOM   4467 C  CB    . LYS D 1 131 ? -11.533 79.093  36.311  1.00 62.75  ? 1131 LYS B CB    1 
ATOM   4468 C  CG    . LYS D 1 131 ? -10.134 79.165  35.700  1.00 62.67  ? 1131 LYS B CG    1 
ATOM   4469 C  CD    . LYS D 1 131 ? -9.951  80.424  34.867  1.00 62.89  ? 1131 LYS B CD    1 
ATOM   4470 C  CE    . LYS D 1 131 ? -10.140 81.684  35.707  1.00 63.53  ? 1131 LYS B CE    1 
ATOM   4471 N  NZ    . LYS D 1 131 ? -10.199 82.909  34.858  1.00 63.51  ? 1131 LYS B NZ    1 
ATOM   4472 N  N     . ILE D 1 132 ? -12.444 76.696  34.718  1.00 62.68  ? 1132 ILE B N     1 
ATOM   4473 C  CA    . ILE D 1 132 ? -12.191 75.562  33.849  1.00 62.53  ? 1132 ILE B CA    1 
ATOM   4474 C  C     . ILE D 1 132 ? -13.253 75.454  32.766  1.00 62.73  ? 1132 ILE B C     1 
ATOM   4475 O  O     . ILE D 1 132 ? -12.947 75.092  31.631  1.00 63.10  ? 1132 ILE B O     1 
ATOM   4476 C  CB    . ILE D 1 132 ? -12.116 74.246  34.641  1.00 62.45  ? 1132 ILE B CB    1 
ATOM   4477 C  CG1   . ILE D 1 132 ? -11.012 74.328  35.697  1.00 61.71  ? 1132 ILE B CG1   1 
ATOM   4478 C  CG2   . ILE D 1 132 ? -11.864 73.081  33.703  1.00 62.12  ? 1132 ILE B CG2   1 
ATOM   4479 C  CD1   . ILE D 1 132 ? -11.127 73.290  36.783  1.00 60.51  ? 1132 ILE B CD1   1 
ATOM   4480 N  N     . LEU D 1 133 ? -14.496 75.772  33.106  1.00 62.76  ? 1133 LEU B N     1 
ATOM   4481 C  CA    . LEU D 1 133 ? -15.566 75.724  32.119  1.00 63.05  ? 1133 LEU B CA    1 
ATOM   4482 C  C     . LEU D 1 133 ? -15.375 76.788  31.041  1.00 63.37  ? 1133 LEU B C     1 
ATOM   4483 O  O     . LEU D 1 133 ? -15.703 76.571  29.873  1.00 63.65  ? 1133 LEU B O     1 
ATOM   4484 C  CB    . LEU D 1 133 ? -16.939 75.863  32.782  1.00 62.96  ? 1133 LEU B CB    1 
ATOM   4485 C  CG    . LEU D 1 133 ? -18.144 75.776  31.837  1.00 62.94  ? 1133 LEU B CG    1 
ATOM   4486 C  CD1   . LEU D 1 133 ? -18.109 74.480  31.038  1.00 62.65  ? 1133 LEU B CD1   1 
ATOM   4487 C  CD2   . LEU D 1 133 ? -19.462 75.913  32.592  1.00 62.50  ? 1133 LEU B CD2   1 
ATOM   4488 N  N     . GLU D 1 134 ? -14.836 77.938  31.430  1.00 63.67  ? 1134 GLU B N     1 
ATOM   4489 C  CA    . GLU D 1 134 ? -14.597 79.019  30.479  1.00 63.88  ? 1134 GLU B CA    1 
ATOM   4490 C  C     . GLU D 1 134 ? -13.362 78.734  29.635  1.00 63.87  ? 1134 GLU B C     1 
ATOM   4491 O  O     . GLU D 1 134 ? -13.351 78.992  28.429  1.00 63.96  ? 1134 GLU B O     1 
ATOM   4492 C  CB    . GLU D 1 134 ? -14.443 80.367  31.200  1.00 63.89  ? 1134 GLU B CB    1 
ATOM   4493 C  CG    . GLU D 1 134 ? -15.715 80.863  31.880  1.00 64.31  ? 1134 GLU B CG    1 
ATOM   4494 C  CD    . GLU D 1 134 ? -15.465 82.031  32.832  1.00 64.82  ? 1134 GLU B CD    1 
ATOM   4495 O  OE1   . GLU D 1 134 ? -14.510 82.804  32.598  1.00 65.12  ? 1134 GLU B OE1   1 
ATOM   4496 O  OE2   . GLU D 1 134 ? -16.226 82.177  33.814  1.00 64.46  ? 1134 GLU B OE2   1 
ATOM   4497 N  N     . LYS D 1 135 ? -12.327 78.192  30.270  1.00 63.78  ? 1135 LYS B N     1 
ATOM   4498 C  CA    . LYS D 1 135 ? -11.038 78.022  29.610  1.00 63.74  ? 1135 LYS B CA    1 
ATOM   4499 C  C     . LYS D 1 135 ? -10.935 76.708  28.845  1.00 63.69  ? 1135 LYS B C     1 
ATOM   4500 O  O     . LYS D 1 135 ? -10.440 76.678  27.718  1.00 63.64  ? 1135 LYS B O     1 
ATOM   4501 C  CB    . LYS D 1 135 ? -9.888  78.173  30.613  1.00 63.75  ? 1135 LYS B CB    1 
ATOM   4502 C  CG    . LYS D 1 135 ? -9.840  79.548  31.272  1.00 63.80  ? 1135 LYS B CG    1 
ATOM   4503 C  CD    . LYS D 1 135 ? -9.649  80.652  30.234  1.00 64.43  ? 1135 LYS B CD    1 
ATOM   4504 C  CE    . LYS D 1 135 ? -10.453 81.910  30.563  1.00 64.02  ? 1135 LYS B CE    1 
ATOM   4505 N  NZ    . LYS D 1 135 ? -10.050 82.538  31.846  1.00 63.89  ? 1135 LYS B NZ    1 
ATOM   4506 N  N     . GLU D 1 136 ? -11.414 75.624  29.448  1.00 63.69  ? 1136 GLU B N     1 
ATOM   4507 C  CA    . GLU D 1 136 ? -11.306 74.314  28.818  1.00 63.46  ? 1136 GLU B CA    1 
ATOM   4508 C  C     . GLU D 1 136 ? -12.647 73.678  28.487  1.00 63.32  ? 1136 GLU B C     1 
ATOM   4509 O  O     . GLU D 1 136 ? -12.684 72.523  28.090  1.00 63.61  ? 1136 GLU B O     1 
ATOM   4510 C  CB    . GLU D 1 136 ? -10.484 73.360  29.683  1.00 63.33  ? 1136 GLU B CB    1 
ATOM   4511 C  CG    . GLU D 1 136 ? -9.078  73.844  29.977  1.00 63.81  ? 1136 GLU B CG    1 
ATOM   4512 C  CD    . GLU D 1 136 ? -8.136  73.725  28.791  1.00 64.40  ? 1136 GLU B CD    1 
ATOM   4513 O  OE1   . GLU D 1 136 ? -8.433  72.965  27.841  1.00 66.00  ? 1136 GLU B OE1   1 
ATOM   4514 O  OE2   . GLU D 1 136 ? -7.079  74.385  28.816  1.00 64.26  ? 1136 GLU B OE2   1 
ATOM   4515 N  N     . LYS D 1 137 ? -13.743 74.415  28.652  1.00 63.23  ? 1137 LYS B N     1 
ATOM   4516 C  CA    . LYS D 1 137 ? -15.067 73.900  28.292  1.00 62.85  ? 1137 LYS B CA    1 
ATOM   4517 C  C     . LYS D 1 137 ? -15.399 72.644  29.090  1.00 62.46  ? 1137 LYS B C     1 
ATOM   4518 O  O     . LYS D 1 137 ? -16.336 71.909  28.768  1.00 62.39  ? 1137 LYS B O     1 
ATOM   4519 C  CB    . LYS D 1 137 ? -15.123 73.601  26.790  1.00 63.19  ? 1137 LYS B CB    1 
ATOM   4520 C  CG    . LYS D 1 137 ? -15.420 74.806  25.896  1.00 63.71  ? 1137 LYS B CG    1 
ATOM   4521 C  CD    . LYS D 1 137 ? -16.877 74.791  25.432  1.00 65.06  ? 1137 LYS B CD    1 
ATOM   4522 C  CE    . LYS D 1 137 ? -17.119 75.744  24.258  1.00 65.87  ? 1137 LYS B CE    1 
ATOM   4523 N  NZ    . LYS D 1 137 ? -17.455 77.130  24.703  1.00 66.23  ? 1137 LYS B NZ    1 
ATOM   4524 N  N     . ILE D 1 138 ? -14.616 72.401  30.133  1.00 62.00  ? 1138 ILE B N     1 
ATOM   4525 C  CA    . ILE D 1 138 ? -14.740 71.186  30.924  1.00 61.64  ? 1138 ILE B CA    1 
ATOM   4526 C  C     . ILE D 1 138 ? -15.447 71.454  32.249  1.00 61.53  ? 1138 ILE B C     1 
ATOM   4527 O  O     . ILE D 1 138 ? -14.960 72.225  33.076  1.00 61.71  ? 1138 ILE B O     1 
ATOM   4528 C  CB    . ILE D 1 138 ? -13.354 70.575  31.231  1.00 61.59  ? 1138 ILE B CB    1 
ATOM   4529 C  CG1   . ILE D 1 138 ? -12.627 70.184  29.936  1.00 61.16  ? 1138 ILE B CG1   1 
ATOM   4530 C  CG2   . ILE D 1 138 ? -13.493 69.380  32.158  1.00 61.25  ? 1138 ILE B CG2   1 
ATOM   4531 C  CD1   . ILE D 1 138 ? -13.346 69.139  29.119  1.00 60.35  ? 1138 ILE B CD1   1 
ATOM   4532 N  N     . THR D 1 139 ? -16.595 70.817  32.454  1.00 61.13  ? 1139 THR B N     1 
ATOM   4533 C  CA    . THR D 1 139 ? -17.246 70.861  33.754  1.00 60.65  ? 1139 THR B CA    1 
ATOM   4534 C  C     . THR D 1 139 ? -16.535 69.883  34.699  1.00 60.34  ? 1139 THR B C     1 
ATOM   4535 O  O     . THR D 1 139 ? -16.084 68.820  34.260  1.00 60.48  ? 1139 THR B O     1 
ATOM   4536 C  CB    . THR D 1 139 ? -18.739 70.496  33.657  1.00 60.58  ? 1139 THR B CB    1 
ATOM   4537 O  OG1   . THR D 1 139 ? -18.880 69.091  33.444  1.00 60.26  ? 1139 THR B OG1   1 
ATOM   4538 C  CG2   . THR D 1 139 ? -19.408 71.243  32.513  1.00 61.03  ? 1139 THR B CG2   1 
ATOM   4539 N  N     . VAL D 1 140 ? -16.436 70.251  35.979  1.00 60.08  ? 1140 VAL B N     1 
ATOM   4540 C  CA    . VAL D 1 140 ? -15.782 69.432  37.019  1.00 59.63  ? 1140 VAL B CA    1 
ATOM   4541 C  C     . VAL D 1 140 ? -16.594 69.452  38.313  1.00 59.50  ? 1140 VAL B C     1 
ATOM   4542 O  O     . VAL D 1 140 ? -17.499 70.272  38.469  1.00 59.83  ? 1140 VAL B O     1 
ATOM   4543 C  CB    . VAL D 1 140 ? -14.335 69.918  37.323  1.00 59.56  ? 1140 VAL B CB    1 
ATOM   4544 C  CG1   . VAL D 1 140 ? -13.514 69.989  36.033  1.00 59.27  ? 1140 VAL B CG1   1 
ATOM   4545 C  CG2   . VAL D 1 140 ? -14.352 71.274  38.011  1.00 59.36  ? 1140 VAL B CG2   1 
ATOM   4546 N  N     . THR D 1 141 ? -16.274 68.546  39.229  1.00 59.21  ? 1141 THR B N     1 
ATOM   4547 C  CA    . THR D 1 141 ? -16.927 68.520  40.526  1.00 59.23  ? 1141 THR B CA    1 
ATOM   4548 C  C     . THR D 1 141 ? -15.919 68.823  41.611  1.00 59.03  ? 1141 THR B C     1 
ATOM   4549 O  O     . THR D 1 141 ? -14.820 68.262  41.617  1.00 58.90  ? 1141 THR B O     1 
ATOM   4550 C  CB    . THR D 1 141 ? -17.589 67.171  40.777  1.00 59.15  ? 1141 THR B CB    1 
ATOM   4551 O  OG1   . THR D 1 141 ? -18.970 67.267  40.382  1.00 60.16  ? 1141 THR B OG1   1 
ATOM   4552 C  CG2   . THR D 1 141 ? -17.512 66.801  42.237  1.00 59.54  ? 1141 THR B CG2   1 
ATOM   4553 N  N     . VAL D 1 142 ? -16.281 69.733  42.514  1.00 58.90  ? 1142 VAL B N     1 
ATOM   4554 C  CA    . VAL D 1 142 ? -15.376 70.107  43.569  1.00 58.74  ? 1142 VAL B CA    1 
ATOM   4555 C  C     . VAL D 1 142 ? -15.874 69.481  44.835  1.00 58.79  ? 1142 VAL B C     1 
ATOM   4556 O  O     . VAL D 1 142 ? -17.030 69.642  45.231  1.00 59.37  ? 1142 VAL B O     1 
ATOM   4557 C  CB    . VAL D 1 142 ? -15.262 71.629  43.714  1.00 58.81  ? 1142 VAL B CB    1 
ATOM   4558 C  CG1   . VAL D 1 142 ? -14.396 71.969  44.918  1.00 59.11  ? 1142 VAL B CG1   1 
ATOM   4559 C  CG2   . VAL D 1 142 ? -14.676 72.229  42.445  1.00 58.70  ? 1142 VAL B CG2   1 
ATOM   4560 N  N     . GLY D 1 143 ? -14.995 68.646  45.423  1.00 58.75  ? 1143 GLY B N     1 
ATOM   4561 C  CA    . GLY D 1 143 ? -15.258 68.047  46.703  1.00 58.73  ? 1143 GLY B CA    1 
ATOM   4562 C  C     . GLY D 1 143 ? -14.386 68.774  47.691  1.00 58.64  ? 1143 GLY B C     1 
ATOM   4563 O  O     . GLY D 1 143 ? -13.173 68.859  47.503  1.00 58.82  ? 1143 GLY B O     1 
ATOM   4564 N  N     . ILE D 1 144 ? -14.997 69.310  48.741  1.00 58.60  ? 1144 ILE B N     1 
ATOM   4565 C  CA    . ILE D 1 144 ? -14.249 70.073  49.728  1.00 58.34  ? 1144 ILE B CA    1 
ATOM   4566 C  C     . ILE D 1 144 ? -14.547 69.598  51.139  1.00 58.33  ? 1144 ILE B C     1 
ATOM   4567 O  O     . ILE D 1 144 ? -15.702 69.568  51.562  1.00 58.55  ? 1144 ILE B O     1 
ATOM   4568 C  CB    . ILE D 1 144 ? -14.564 71.579  49.634  1.00 58.28  ? 1144 ILE B CB    1 
ATOM   4569 C  CG1   . ILE D 1 144 ? -14.754 72.000  48.175  1.00 58.13  ? 1144 ILE B CG1   1 
ATOM   4570 C  CG2   . ILE D 1 144 ? -13.465 72.395  50.309  1.00 58.35  ? 1144 ILE B CG2   1 
ATOM   4571 C  CD1   . ILE D 1 144 ? -15.357 73.371  47.995  1.00 57.47  ? 1144 ILE B CD1   1 
ATOM   4572 N  N     . SER D 1 145 ? -13.498 69.235  51.869  1.00 58.16  ? 1145 SER B N     1 
ATOM   4573 C  CA    . SER D 1 145 ? -13.645 68.860  53.265  1.00 57.84  ? 1145 SER B CA    1 
ATOM   4574 C  C     . SER D 1 145 ? -12.290 68.863  53.960  1.00 57.78  ? 1145 SER B C     1 
ATOM   4575 O  O     . SER D 1 145 ? -11.300 69.326  53.395  1.00 57.71  ? 1145 SER B O     1 
ATOM   4576 C  CB    . SER D 1 145 ? -14.319 67.494  53.391  1.00 57.97  ? 1145 SER B CB    1 
ATOM   4577 O  OG    . SER D 1 145 ? -15.244 67.484  54.466  1.00 57.92  ? 1145 SER B OG    1 
ATOM   4578 N  N     . LYS D 1 146 ? -12.253 68.341  55.183  1.00 57.74  ? 1146 LYS B N     1 
ATOM   4579 C  CA    . LYS D 1 146 ? -11.086 68.478  56.054  1.00 57.67  ? 1146 LYS B CA    1 
ATOM   4580 C  C     . LYS D 1 146 ? -9.880  67.663  55.599  1.00 57.66  ? 1146 LYS B C     1 
ATOM   4581 O  O     . LYS D 1 146 ? -8.739  67.995  55.922  1.00 57.64  ? 1146 LYS B O     1 
ATOM   4582 C  CB    . LYS D 1 146 ? -11.452 68.127  57.499  1.00 57.62  ? 1146 LYS B CB    1 
ATOM   4583 C  CG    . LYS D 1 146 ? -11.742 66.656  57.741  1.00 57.37  ? 1146 LYS B CG    1 
ATOM   4584 C  CD    . LYS D 1 146 ? -11.918 66.387  59.223  1.00 57.45  ? 1146 LYS B CD    1 
ATOM   4585 C  CE    . LYS D 1 146 ? -10.819 67.059  60.033  1.00 57.00  ? 1146 LYS B CE    1 
ATOM   4586 N  NZ    . LYS D 1 146 ? -11.003 66.841  61.482  1.00 56.46  ? 1146 LYS B NZ    1 
ATOM   4587 N  N     . ASN D 1 147 ? -10.133 66.597  54.850  1.00 57.77  ? 1147 ASN B N     1 
ATOM   4588 C  CA    . ASN D 1 147 ? -9.056  65.769  54.323  1.00 57.74  ? 1147 ASN B CA    1 
ATOM   4589 C  C     . ASN D 1 147 ? -9.287  65.394  52.865  1.00 57.72  ? 1147 ASN B C     1 
ATOM   4590 O  O     . ASN D 1 147 ? -10.365 65.625  52.314  1.00 57.75  ? 1147 ASN B O     1 
ATOM   4591 C  CB    . ASN D 1 147 ? -8.879  64.508  55.172  1.00 57.71  ? 1147 ASN B CB    1 
ATOM   4592 C  CG    . ASN D 1 147 ? -10.176 63.751  55.367  1.00 57.70  ? 1147 ASN B CG    1 
ATOM   4593 O  OD1   . ASN D 1 147 ? -10.978 63.619  54.442  1.00 57.55  ? 1147 ASN B OD1   1 
ATOM   4594 N  ND2   . ASN D 1 147 ? -10.392 63.254  56.580  1.00 57.95  ? 1147 ASN B ND2   1 
ATOM   4595 N  N     . LYS D 1 148 ? -8.265  64.809  52.253  1.00 57.56  ? 1148 LYS B N     1 
ATOM   4596 C  CA    . LYS D 1 148 ? -8.330  64.387  50.864  1.00 57.29  ? 1148 LYS B CA    1 
ATOM   4597 C  C     . LYS D 1 148 ? -9.450  63.385  50.627  1.00 57.27  ? 1148 LYS B C     1 
ATOM   4598 O  O     . LYS D 1 148 ? -10.122 63.422  49.589  1.00 57.39  ? 1148 LYS B O     1 
ATOM   4599 C  CB    . LYS D 1 148 ? -6.993  63.783  50.438  1.00 57.16  ? 1148 LYS B CB    1 
ATOM   4600 C  CG    . LYS D 1 148 ? -5.837  64.765  50.490  1.00 57.49  ? 1148 LYS B CG    1 
ATOM   4601 C  CD    . LYS D 1 148 ? -4.553  64.146  49.988  1.00 58.43  ? 1148 LYS B CD    1 
ATOM   4602 C  CE    . LYS D 1 148 ? -4.212  62.866  50.730  1.00 58.83  ? 1148 LYS B CE    1 
ATOM   4603 N  NZ    . LYS D 1 148 ? -3.109  62.151  50.024  1.00 60.37  ? 1148 LYS B NZ    1 
ATOM   4604 N  N     . VAL D 1 149 ? -9.646  62.488  51.587  1.00 56.96  ? 1149 VAL B N     1 
ATOM   4605 C  CA    . VAL D 1 149 ? -10.626 61.423  51.437  1.00 56.83  ? 1149 VAL B CA    1 
ATOM   4606 C  C     . VAL D 1 149 ? -12.043 61.967  51.362  1.00 56.99  ? 1149 VAL B C     1 
ATOM   4607 O  O     . VAL D 1 149 ? -12.807 61.608  50.464  1.00 56.93  ? 1149 VAL B O     1 
ATOM   4608 C  CB    . VAL D 1 149 ? -10.519 60.397  52.563  1.00 56.77  ? 1149 VAL B CB    1 
ATOM   4609 C  CG1   . VAL D 1 149 ? -11.729 59.482  52.562  1.00 56.30  ? 1149 VAL B CG1   1 
ATOM   4610 C  CG2   . VAL D 1 149 ? -9.241  59.599  52.399  1.00 56.83  ? 1149 VAL B CG2   1 
ATOM   4611 N  N     . PHE D 1 150 ? -12.391 62.843  52.297  1.00 57.09  ? 1150 PHE B N     1 
ATOM   4612 C  CA    . PHE D 1 150 ? -13.720 63.432  52.297  1.00 57.25  ? 1150 PHE B CA    1 
ATOM   4613 C  C     . PHE D 1 150 ? -13.818 64.539  51.261  1.00 57.29  ? 1150 PHE B C     1 
ATOM   4614 O  O     . PHE D 1 150 ? -14.908 64.879  50.801  1.00 57.30  ? 1150 PHE B O     1 
ATOM   4615 C  CB    . PHE D 1 150 ? -14.101 63.911  53.695  1.00 57.35  ? 1150 PHE B CB    1 
ATOM   4616 C  CG    . PHE D 1 150 ? -14.302 62.788  54.666  1.00 57.83  ? 1150 PHE B CG    1 
ATOM   4617 C  CD1   . PHE D 1 150 ? -15.450 62.012  54.615  1.00 58.18  ? 1150 PHE B CD1   1 
ATOM   4618 C  CD2   . PHE D 1 150 ? -13.332 62.483  55.608  1.00 58.81  ? 1150 PHE B CD2   1 
ATOM   4619 C  CE1   . PHE D 1 150 ? -15.641 60.963  55.497  1.00 59.08  ? 1150 PHE B CE1   1 
ATOM   4620 C  CE2   . PHE D 1 150 ? -13.512 61.435  56.502  1.00 59.76  ? 1150 PHE B CE2   1 
ATOM   4621 C  CZ    . PHE D 1 150 ? -14.669 60.673  56.446  1.00 59.82  ? 1150 PHE B CZ    1 
ATOM   4622 N  N     . ALA D 1 151 ? -12.668 65.085  50.882  1.00 57.32  ? 1151 ALA B N     1 
ATOM   4623 C  CA    . ALA D 1 151 ? -12.607 65.968  49.734  1.00 57.42  ? 1151 ALA B CA    1 
ATOM   4624 C  C     . ALA D 1 151 ? -13.062 65.182  48.511  1.00 57.40  ? 1151 ALA B C     1 
ATOM   4625 O  O     . ALA D 1 151 ? -13.848 65.680  47.710  1.00 57.18  ? 1151 ALA B O     1 
ATOM   4626 C  CB    . ALA D 1 151 ? -11.202 66.500  49.539  1.00 57.47  ? 1151 ALA B CB    1 
ATOM   4627 N  N     . LYS D 1 152 ? -12.579 63.946  48.388  1.00 57.63  ? 1152 LYS B N     1 
ATOM   4628 C  CA    . LYS D 1 152 ? -12.987 63.072  47.292  1.00 58.01  ? 1152 LYS B CA    1 
ATOM   4629 C  C     . LYS D 1 152 ? -14.442 62.631  47.402  1.00 58.10  ? 1152 LYS B C     1 
ATOM   4630 O  O     . LYS D 1 152 ? -15.153 62.561  46.401  1.00 58.24  ? 1152 LYS B O     1 
ATOM   4631 C  CB    . LYS D 1 152 ? -12.083 61.842  47.172  1.00 58.14  ? 1152 LYS B CB    1 
ATOM   4632 C  CG    . LYS D 1 152 ? -12.534 60.898  46.051  1.00 58.71  ? 1152 LYS B CG    1 
ATOM   4633 C  CD    . LYS D 1 152 ? -11.541 59.779  45.754  1.00 59.43  ? 1152 LYS B CD    1 
ATOM   4634 C  CE    . LYS D 1 152 ? -10.570 60.160  44.660  1.00 60.53  ? 1152 LYS B CE    1 
ATOM   4635 N  NZ    . LYS D 1 152 ? -9.758  58.995  44.176  1.00 60.99  ? 1152 LYS B NZ    1 
ATOM   4636 N  N     . ILE D 1 153 ? -14.888 62.324  48.613  1.00 58.30  ? 1153 ILE B N     1 
ATOM   4637 C  CA    . ILE D 1 153 ? -16.245 61.828  48.788  1.00 58.41  ? 1153 ILE B CA    1 
ATOM   4638 C  C     . ILE D 1 153 ? -17.254 62.936  48.496  1.00 58.64  ? 1153 ILE B C     1 
ATOM   4639 O  O     . ILE D 1 153 ? -18.304 62.692  47.900  1.00 58.53  ? 1153 ILE B O     1 
ATOM   4640 C  CB    . ILE D 1 153 ? -16.453 61.230  50.181  1.00 58.48  ? 1153 ILE B CB    1 
ATOM   4641 C  CG1   . ILE D 1 153 ? -15.370 60.188  50.459  1.00 58.10  ? 1153 ILE B CG1   1 
ATOM   4642 C  CG2   . ILE D 1 153 ? -17.837 60.601  50.291  1.00 58.86  ? 1153 ILE B CG2   1 
ATOM   4643 C  CD1   . ILE D 1 153 ? -15.431 59.587  51.841  1.00 57.51  ? 1153 ILE B CD1   1 
ATOM   4644 N  N     . ALA D 1 154 ? -16.918 64.159  48.894  1.00 58.90  ? 1154 ALA B N     1 
ATOM   4645 C  CA    . ALA D 1 154 ? -17.735 65.311  48.555  1.00 59.30  ? 1154 ALA B CA    1 
ATOM   4646 C  C     . ALA D 1 154 ? -17.946 65.373  47.046  1.00 59.70  ? 1154 ALA B C     1 
ATOM   4647 O  O     . ALA D 1 154 ? -19.066 65.565  46.572  1.00 59.61  ? 1154 ALA B O     1 
ATOM   4648 C  CB    . ALA D 1 154 ? -17.091 66.586  49.061  1.00 59.22  ? 1154 ALA B CB    1 
ATOM   4649 N  N     . ALA D 1 155 ? -16.859 65.194  46.300  1.00 60.44  ? 1155 ALA B N     1 
ATOM   4650 C  CA    . ALA D 1 155 ? -16.910 65.152  44.842  1.00 61.00  ? 1155 ALA B CA    1 
ATOM   4651 C  C     . ALA D 1 155 ? -17.706 63.947  44.355  1.00 61.66  ? 1155 ALA B C     1 
ATOM   4652 O  O     . ALA D 1 155 ? -18.544 64.065  43.462  1.00 61.59  ? 1155 ALA B O     1 
ATOM   4653 C  CB    . ALA D 1 155 ? -15.513 65.129  44.269  1.00 60.77  ? 1155 ALA B CB    1 
ATOM   4654 N  N     . ASP D 1 156 ? -17.444 62.789  44.956  1.00 62.66  ? 1156 ASP B N     1 
ATOM   4655 C  CA    . ASP D 1 156 ? -18.161 61.564  44.621  1.00 63.74  ? 1156 ASP B CA    1 
ATOM   4656 C  C     . ASP D 1 156 ? -19.685 61.751  44.668  1.00 64.38  ? 1156 ASP B C     1 
ATOM   4657 O  O     . ASP D 1 156 ? -20.412 61.175  43.860  1.00 64.67  ? 1156 ASP B O     1 
ATOM   4658 C  CB    . ASP D 1 156 ? -17.741 60.427  45.558  1.00 63.82  ? 1156 ASP B CB    1 
ATOM   4659 C  CG    . ASP D 1 156 ? -16.315 59.951  45.316  1.00 64.96  ? 1156 ASP B CG    1 
ATOM   4660 O  OD1   . ASP D 1 156 ? -15.717 60.309  44.271  1.00 66.97  ? 1156 ASP B OD1   1 
ATOM   4661 O  OD2   . ASP D 1 156 ? -15.789 59.203  46.170  1.00 65.62  ? 1156 ASP B OD2   1 
ATOM   4662 N  N     . MET D 1 157 ? -20.165 62.563  45.605  1.00 65.14  ? 1157 MET B N     1 
ATOM   4663 C  CA    . MET D 1 157 ? -21.607 62.745  45.800  1.00 65.77  ? 1157 MET B CA    1 
ATOM   4664 C  C     . MET D 1 157 ? -22.240 63.830  44.922  1.00 66.33  ? 1157 MET B C     1 
ATOM   4665 O  O     . MET D 1 157 ? -23.417 63.737  44.569  1.00 66.26  ? 1157 MET B O     1 
ATOM   4666 C  CB    . MET D 1 157 ? -21.902 63.036  47.265  1.00 65.54  ? 1157 MET B CB    1 
ATOM   4667 C  CG    . MET D 1 157 ? -21.348 61.996  48.211  1.00 65.35  ? 1157 MET B CG    1 
ATOM   4668 S  SD    . MET D 1 157 ? -21.584 62.500  49.915  1.00 64.42  ? 1157 MET B SD    1 
ATOM   4669 C  CE    . MET D 1 157 ? -23.369 62.657  49.934  1.00 64.62  ? 1157 MET B CE    1 
ATOM   4670 N  N     . ALA D 1 158 ? -21.463 64.855  44.580  1.00 67.07  ? 1158 ALA B N     1 
ATOM   4671 C  CA    . ALA D 1 158 ? -21.961 65.962  43.762  1.00 67.79  ? 1158 ALA B CA    1 
ATOM   4672 C  C     . ALA D 1 158 ? -21.574 65.795  42.302  1.00 68.33  ? 1158 ALA B C     1 
ATOM   4673 O  O     . ALA D 1 158 ? -21.634 66.750  41.530  1.00 68.55  ? 1158 ALA B O     1 
ATOM   4674 C  CB    . ALA D 1 158 ? -21.426 67.282  44.285  1.00 67.70  ? 1158 ALA B CB    1 
ATOM   4675 N  N     . LYS D 1 159 ? -21.206 64.573  41.927  1.00 68.97  ? 1159 LYS B N     1 
ATOM   4676 C  CA    . LYS D 1 159 ? -20.465 64.314  40.693  1.00 69.44  ? 1159 LYS B CA    1 
ATOM   4677 C  C     . LYS D 1 159 ? -20.853 65.098  39.432  1.00 69.83  ? 1159 LYS B C     1 
ATOM   4678 O  O     . LYS D 1 159 ? -20.104 65.978  38.993  1.00 70.24  ? 1159 LYS B O     1 
ATOM   4679 C  CB    . LYS D 1 159 ? -20.363 62.816  40.404  1.00 69.60  ? 1159 LYS B CB    1 
ATOM   4680 C  CG    . LYS D 1 159 ? -19.165 62.192  41.078  1.00 69.86  ? 1159 LYS B CG    1 
ATOM   4681 C  CD    . LYS D 1 159 ? -18.514 61.129  40.225  1.00 69.94  ? 1159 LYS B CD    1 
ATOM   4682 C  CE    . LYS D 1 159 ? -17.053 60.987  40.607  1.00 69.64  ? 1159 LYS B CE    1 
ATOM   4683 N  NZ    . LYS D 1 159 ? -16.349 62.295  40.495  1.00 69.36  ? 1159 LYS B NZ    1 
ATOM   4684 N  N     . PRO D 1 160 ? -22.003 64.774  38.824  1.00 69.93  ? 1160 PRO B N     1 
ATOM   4685 C  CA    . PRO D 1 160 ? -22.192 65.380  37.503  1.00 69.60  ? 1160 PRO B CA    1 
ATOM   4686 C  C     . PRO D 1 160 ? -22.280 66.898  37.634  1.00 69.46  ? 1160 PRO B C     1 
ATOM   4687 O  O     . PRO D 1 160 ? -23.313 67.424  38.063  1.00 69.43  ? 1160 PRO B O     1 
ATOM   4688 C  CB    . PRO D 1 160 ? -23.522 64.790  37.020  1.00 69.69  ? 1160 PRO B CB    1 
ATOM   4689 C  CG    . PRO D 1 160 ? -23.814 63.629  37.943  1.00 70.15  ? 1160 PRO B CG    1 
ATOM   4690 C  CD    . PRO D 1 160 ? -23.145 63.944  39.243  1.00 69.89  ? 1160 PRO B CD    1 
ATOM   4691 N  N     . ASN D 1 161 ? -21.188 67.583  37.294  1.00 69.08  ? 1161 ASN B N     1 
ATOM   4692 C  CA    . ASN D 1 161 ? -21.112 69.041  37.373  1.00 68.64  ? 1161 ASN B CA    1 
ATOM   4693 C  C     . ASN D 1 161 ? -21.639 69.586  38.697  1.00 68.31  ? 1161 ASN B C     1 
ATOM   4694 O  O     . ASN D 1 161 ? -22.689 70.225  38.747  1.00 68.47  ? 1161 ASN B O     1 
ATOM   4695 C  CB    . ASN D 1 161 ? -21.857 69.680  36.197  1.00 68.72  ? 1161 ASN B CB    1 
ATOM   4696 C  CG    . ASN D 1 161 ? -21.669 71.185  36.132  1.00 68.97  ? 1161 ASN B CG    1 
ATOM   4697 O  OD1   . ASN D 1 161 ? -20.892 71.763  36.894  1.00 69.29  ? 1161 ASN B OD1   1 
ATOM   4698 N  ND2   . ASN D 1 161 ? -22.382 71.828  35.217  1.00 69.38  ? 1161 ASN B ND2   1 
ATOM   4699 N  N     . GLY D 1 162 ? -20.906 69.339  39.775  1.00 67.78  ? 1162 GLY B N     1 
ATOM   4700 C  CA    . GLY D 1 162 ? -21.381 69.735  41.087  1.00 66.87  ? 1162 GLY B CA    1 
ATOM   4701 C  C     . GLY D 1 162 ? -20.313 70.296  41.994  1.00 66.42  ? 1162 GLY B C     1 
ATOM   4702 O  O     . GLY D 1 162 ? -19.123 70.211  41.702  1.00 66.22  ? 1162 GLY B O     1 
ATOM   4703 N  N     . ILE D 1 163 ? -20.753 70.883  43.102  1.00 66.07  ? 1163 ILE B N     1 
ATOM   4704 C  CA    . ILE D 1 163 ? -19.834 71.402  44.099  1.00 65.58  ? 1163 ILE B CA    1 
ATOM   4705 C  C     . ILE D 1 163 ? -20.359 71.119  45.494  1.00 65.42  ? 1163 ILE B C     1 
ATOM   4706 O  O     . ILE D 1 163 ? -21.415 71.607  45.889  1.00 65.71  ? 1163 ILE B O     1 
ATOM   4707 C  CB    . ILE D 1 163 ? -19.550 72.909  43.899  1.00 65.49  ? 1163 ILE B CB    1 
ATOM   4708 C  CG1   . ILE D 1 163 ? -18.623 73.425  45.001  1.00 64.63  ? 1163 ILE B CG1   1 
ATOM   4709 C  CG2   . ILE D 1 163 ? -20.849 73.703  43.807  1.00 65.40  ? 1163 ILE B CG2   1 
ATOM   4710 C  CD1   . ILE D 1 163 ? -17.844 74.647  44.605  1.00 63.54  ? 1163 ILE B CD1   1 
ATOM   4711 N  N     . LYS D 1 164 ? -19.614 70.309  46.233  1.00 65.17  ? 1164 LYS B N     1 
ATOM   4712 C  CA    . LYS D 1 164 ? -20.062 69.850  47.536  1.00 65.00  ? 1164 LYS B CA    1 
ATOM   4713 C  C     . LYS D 1 164 ? -19.036 70.150  48.613  1.00 64.81  ? 1164 LYS B C     1 
ATOM   4714 O  O     . LYS D 1 164 ? -17.869 69.762  48.507  1.00 64.61  ? 1164 LYS B O     1 
ATOM   4715 C  CB    . LYS D 1 164 ? -20.354 68.345  47.494  1.00 65.09  ? 1164 LYS B CB    1 
ATOM   4716 C  CG    . LYS D 1 164 ? -20.744 67.717  48.825  1.00 64.97  ? 1164 LYS B CG    1 
ATOM   4717 C  CD    . LYS D 1 164 ? -22.231 67.861  49.106  1.00 65.85  ? 1164 LYS B CD    1 
ATOM   4718 C  CE    . LYS D 1 164 ? -22.577 67.318  50.494  1.00 66.62  ? 1164 LYS B CE    1 
ATOM   4719 N  NZ    . LYS D 1 164 ? -23.974 67.622  50.920  1.00 66.55  ? 1164 LYS B NZ    1 
ATOM   4720 N  N     . VAL D 1 165 ? -19.483 70.866  49.639  1.00 64.69  ? 1165 VAL B N     1 
ATOM   4721 C  CA    . VAL D 1 165 ? -18.739 70.966  50.882  1.00 64.53  ? 1165 VAL B CA    1 
ATOM   4722 C  C     . VAL D 1 165 ? -19.357 69.969  51.844  1.00 64.47  ? 1165 VAL B C     1 
ATOM   4723 O  O     . VAL D 1 165 ? -20.555 70.032  52.121  1.00 64.62  ? 1165 VAL B O     1 
ATOM   4724 C  CB    . VAL D 1 165 ? -18.828 72.367  51.522  1.00 64.43  ? 1165 VAL B CB    1 
ATOM   4725 C  CG1   . VAL D 1 165 ? -17.908 72.446  52.723  1.00 64.26  ? 1165 VAL B CG1   1 
ATOM   4726 C  CG2   . VAL D 1 165 ? -18.469 73.446  50.521  1.00 64.41  ? 1165 VAL B CG2   1 
ATOM   4727 N  N     . ILE D 1 166 ? -18.552 69.033  52.330  1.00 64.39  ? 1166 ILE B N     1 
ATOM   4728 C  CA    . ILE D 1 166 ? -18.990 68.166  53.411  1.00 64.47  ? 1166 ILE B CA    1 
ATOM   4729 C  C     . ILE D 1 166 ? -18.509 68.785  54.714  1.00 64.49  ? 1166 ILE B C     1 
ATOM   4730 O  O     . ILE D 1 166 ? -17.368 68.564  55.128  1.00 64.52  ? 1166 ILE B O     1 
ATOM   4731 C  CB    . ILE D 1 166 ? -18.447 66.737  53.263  1.00 64.51  ? 1166 ILE B CB    1 
ATOM   4732 C  CG1   . ILE D 1 166 ? -19.100 66.048  52.067  1.00 64.66  ? 1166 ILE B CG1   1 
ATOM   4733 C  CG2   . ILE D 1 166 ? -18.711 65.928  54.521  1.00 64.33  ? 1166 ILE B CG2   1 
ATOM   4734 C  CD1   . ILE D 1 166 ? -18.672 64.616  51.886  1.00 65.10  ? 1166 ILE B CD1   1 
ATOM   4735 N  N     . ASP D 1 167 ? -19.373 69.579  55.346  1.00 64.43  ? 1167 ASP B N     1 
ATOM   4736 C  CA    . ASP D 1 167 ? -18.993 70.279  56.568  1.00 64.41  ? 1167 ASP B CA    1 
ATOM   4737 C  C     . ASP D 1 167 ? -18.673 69.293  57.686  1.00 64.44  ? 1167 ASP B C     1 
ATOM   4738 O  O     . ASP D 1 167 ? -18.931 68.095  57.557  1.00 64.32  ? 1167 ASP B O     1 
ATOM   4739 C  CB    . ASP D 1 167 ? -20.052 71.315  56.991  1.00 64.45  ? 1167 ASP B CB    1 
ATOM   4740 C  CG    . ASP D 1 167 ? -21.350 70.683  57.492  1.00 64.38  ? 1167 ASP B CG    1 
ATOM   4741 O  OD1   . ASP D 1 167 ? -21.314 69.569  58.052  1.00 64.26  ? 1167 ASP B OD1   1 
ATOM   4742 O  OD2   . ASP D 1 167 ? -22.414 71.322  57.341  1.00 64.13  ? 1167 ASP B OD2   1 
ATOM   4743 N  N     . ASP D 1 168 ? -18.105 69.796  58.777  1.00 64.47  ? 1168 ASP B N     1 
ATOM   4744 C  CA    . ASP D 1 168 ? -17.655 68.935  59.865  1.00 64.52  ? 1168 ASP B CA    1 
ATOM   4745 C  C     . ASP D 1 168 ? -18.805 68.153  60.498  1.00 64.65  ? 1168 ASP B C     1 
ATOM   4746 O  O     . ASP D 1 168 ? -18.618 67.024  60.955  1.00 64.52  ? 1168 ASP B O     1 
ATOM   4747 C  CB    . ASP D 1 168 ? -16.888 69.754  60.905  1.00 64.44  ? 1168 ASP B CB    1 
ATOM   4748 C  CG    . ASP D 1 168 ? -15.665 70.433  60.315  1.00 64.25  ? 1168 ASP B CG    1 
ATOM   4749 O  OD1   . ASP D 1 168 ? -15.034 69.832  59.415  1.00 64.17  ? 1168 ASP B OD1   1 
ATOM   4750 O  OD2   . ASP D 1 168 ? -15.337 71.562  60.739  1.00 63.19  ? 1168 ASP B OD2   1 
ATOM   4751 N  N     . GLU D 1 169 ? -19.993 68.754  60.505  1.00 64.91  ? 1169 GLU B N     1 
ATOM   4752 C  CA    . GLU D 1 169 ? -21.206 68.076  60.960  1.00 65.20  ? 1169 GLU B CA    1 
ATOM   4753 C  C     . GLU D 1 169 ? -21.566 66.917  60.025  1.00 65.32  ? 1169 GLU B C     1 
ATOM   4754 O  O     . GLU D 1 169 ? -22.124 65.907  60.460  1.00 65.44  ? 1169 GLU B O     1 
ATOM   4755 C  CB    . GLU D 1 169 ? -22.372 69.067  61.049  1.00 65.15  ? 1169 GLU B CB    1 
ATOM   4756 C  CG    . GLU D 1 169 ? -22.549 69.724  62.409  1.00 65.39  ? 1169 GLU B CG    1 
ATOM   4757 C  CD    . GLU D 1 169 ? -23.516 68.960  63.298  1.00 66.06  ? 1169 GLU B CD    1 
ATOM   4758 O  OE1   . GLU D 1 169 ? -23.826 69.439  64.416  1.00 66.36  ? 1169 GLU B OE1   1 
ATOM   4759 O  OE2   . GLU D 1 169 ? -23.973 67.878  62.870  1.00 66.28  ? 1169 GLU B OE2   1 
ATOM   4760 N  N     . GLU D 1 170 ? -21.243 67.072  58.742  1.00 65.39  ? 1170 GLU B N     1 
ATOM   4761 C  CA    . GLU D 1 170 ? -21.515 66.042  57.741  1.00 65.50  ? 1170 GLU B CA    1 
ATOM   4762 C  C     . GLU D 1 170 ? -20.382 65.022  57.626  1.00 65.45  ? 1170 GLU B C     1 
ATOM   4763 O  O     . GLU D 1 170 ? -20.579 63.929  57.090  1.00 65.39  ? 1170 GLU B O     1 
ATOM   4764 C  CB    . GLU D 1 170 ? -21.786 66.670  56.371  1.00 65.61  ? 1170 GLU B CB    1 
ATOM   4765 C  CG    . GLU D 1 170 ? -23.099 67.433  56.277  1.00 66.05  ? 1170 GLU B CG    1 
ATOM   4766 C  CD    . GLU D 1 170 ? -23.334 68.031  54.899  1.00 66.47  ? 1170 GLU B CD    1 
ATOM   4767 O  OE1   . GLU D 1 170 ? -22.659 67.611  53.932  1.00 66.20  ? 1170 GLU B OE1   1 
ATOM   4768 O  OE2   . GLU D 1 170 ? -24.202 68.924  54.788  1.00 66.58  ? 1170 GLU B OE2   1 
ATOM   4769 N  N     . VAL D 1 171 ? -19.195 65.380  58.110  1.00 65.40  ? 1171 VAL B N     1 
ATOM   4770 C  CA    . VAL D 1 171 ? -18.084 64.433  58.150  1.00 65.50  ? 1171 VAL B CA    1 
ATOM   4771 C  C     . VAL D 1 171 ? -18.404 63.306  59.124  1.00 65.77  ? 1171 VAL B C     1 
ATOM   4772 O  O     . VAL D 1 171 ? -18.054 62.151  58.882  1.00 65.70  ? 1171 VAL B O     1 
ATOM   4773 C  CB    . VAL D 1 171 ? -16.754 65.102  58.550  1.00 65.41  ? 1171 VAL B CB    1 
ATOM   4774 C  CG1   . VAL D 1 171 ? -15.667 64.054  58.727  1.00 65.24  ? 1171 VAL B CG1   1 
ATOM   4775 C  CG2   . VAL D 1 171 ? -16.333 66.120  57.502  1.00 65.56  ? 1171 VAL B CG2   1 
ATOM   4776 N  N     . LYS D 1 172 ? -19.078 63.657  60.219  1.00 66.18  ? 1172 LYS B N     1 
ATOM   4777 C  CA    . LYS D 1 172 ? -19.526 62.690  61.210  1.00 66.47  ? 1172 LYS B CA    1 
ATOM   4778 C  C     . LYS D 1 172 ? -20.724 61.917  60.663  1.00 66.62  ? 1172 LYS B C     1 
ATOM   4779 O  O     . LYS D 1 172 ? -20.748 60.676  60.690  1.00 66.49  ? 1172 LYS B O     1 
ATOM   4780 C  CB    . LYS D 1 172 ? -19.905 63.400  62.514  1.00 66.67  ? 1172 LYS B CB    1 
ATOM   4781 C  CG    . LYS D 1 172 ? -18.897 64.444  62.989  1.00 67.02  ? 1172 LYS B CG    1 
ATOM   4782 C  CD    . LYS D 1 172 ? -17.794 63.835  63.841  1.00 67.42  ? 1172 LYS B CD    1 
ATOM   4783 C  CE    . LYS D 1 172 ? -16.943 64.921  64.483  1.00 67.60  ? 1172 LYS B CE    1 
ATOM   4784 N  NZ    . LYS D 1 172 ? -16.224 64.431  65.695  1.00 68.10  ? 1172 LYS B NZ    1 
ATOM   4785 N  N     . ARG D 1 173 ? -21.712 62.661  60.159  1.00 67.01  ? 1173 ARG B N     1 
ATOM   4786 C  CA    . ARG D 1 173 ? -22.905 62.074  59.547  1.00 67.63  ? 1173 ARG B CA    1 
ATOM   4787 C  C     . ARG D 1 173 ? -22.527 60.990  58.542  1.00 67.91  ? 1173 ARG B C     1 
ATOM   4788 O  O     . ARG D 1 173 ? -23.157 59.934  58.493  1.00 68.09  ? 1173 ARG B O     1 
ATOM   4789 C  CB    . ARG D 1 173 ? -23.759 63.148  58.852  1.00 67.69  ? 1173 ARG B CB    1 
ATOM   4790 C  CG    . ARG D 1 173 ? -24.630 62.598  57.704  1.00 68.45  ? 1173 ARG B CG    1 
ATOM   4791 C  CD    . ARG D 1 173 ? -25.187 63.688  56.778  1.00 69.09  ? 1173 ARG B CD    1 
ATOM   4792 N  NE    . ARG D 1 173 ? -24.199 64.218  55.835  1.00 69.67  ? 1173 ARG B NE    1 
ATOM   4793 C  CZ    . ARG D 1 173 ? -24.086 63.845  54.559  1.00 70.49  ? 1173 ARG B CZ    1 
ATOM   4794 N  NH1   . ARG D 1 173 ? -24.894 62.920  54.054  1.00 70.87  ? 1173 ARG B NH1   1 
ATOM   4795 N  NH2   . ARG D 1 173 ? -23.159 64.394  53.781  1.00 70.18  ? 1173 ARG B NH2   1 
ATOM   4796 N  N     . LEU D 1 174 ? -21.497 61.258  57.742  1.00 68.21  ? 1174 LEU B N     1 
ATOM   4797 C  CA    . LEU D 1 174 ? -21.034 60.306  56.738  1.00 68.36  ? 1174 LEU B CA    1 
ATOM   4798 C  C     . LEU D 1 174 ? -20.405 59.056  57.346  1.00 68.46  ? 1174 LEU B C     1 
ATOM   4799 O  O     . LEU D 1 174 ? -20.776 57.939  56.991  1.00 68.56  ? 1174 LEU B O     1 
ATOM   4800 C  CB    . LEU D 1 174 ? -20.067 60.970  55.758  1.00 68.43  ? 1174 LEU B CB    1 
ATOM   4801 C  CG    . LEU D 1 174 ? -20.733 61.794  54.659  1.00 68.39  ? 1174 LEU B CG    1 
ATOM   4802 C  CD1   . LEU D 1 174 ? -19.779 61.949  53.493  1.00 68.59  ? 1174 LEU B CD1   1 
ATOM   4803 C  CD2   . LEU D 1 174 ? -22.025 61.126  54.207  1.00 68.26  ? 1174 LEU B CD2   1 
ATOM   4804 N  N     . ILE D 1 175 ? -19.456 59.240  58.259  1.00 68.58  ? 1175 ILE B N     1 
ATOM   4805 C  CA    . ILE D 1 175 ? -18.865 58.109  58.978  1.00 68.73  ? 1175 ILE B CA    1 
ATOM   4806 C  C     . ILE D 1 175 ? -19.946 57.123  59.453  1.00 68.90  ? 1175 ILE B C     1 
ATOM   4807 O  O     . ILE D 1 175 ? -19.679 55.933  59.633  1.00 68.95  ? 1175 ILE B O     1 
ATOM   4808 C  CB    . ILE D 1 175 ? -18.011 58.578  60.178  1.00 68.71  ? 1175 ILE B CB    1 
ATOM   4809 C  CG1   . ILE D 1 175 ? -16.802 59.379  59.690  1.00 68.52  ? 1175 ILE B CG1   1 
ATOM   4810 C  CG2   . ILE D 1 175 ? -17.545 57.394  61.001  1.00 68.46  ? 1175 ILE B CG2   1 
ATOM   4811 C  CD1   . ILE D 1 175 ? -16.090 60.132  60.792  1.00 68.89  ? 1175 ILE B CD1   1 
ATOM   4812 N  N     . ARG D 1 176 ? -21.163 57.627  59.644  1.00 69.00  ? 1176 ARG B N     1 
ATOM   4813 C  CA    . ARG D 1 176 ? -22.310 56.784  59.969  1.00 69.12  ? 1176 ARG B CA    1 
ATOM   4814 C  C     . ARG D 1 176 ? -23.136 56.412  58.738  1.00 69.23  ? 1176 ARG B C     1 
ATOM   4815 O  O     . ARG D 1 176 ? -23.452 55.242  58.528  1.00 69.38  ? 1176 ARG B O     1 
ATOM   4816 C  CB    . ARG D 1 176 ? -23.202 57.468  61.002  1.00 69.18  ? 1176 ARG B CB    1 
ATOM   4817 C  CG    . ARG D 1 176 ? -23.053 56.913  62.400  1.00 69.34  ? 1176 ARG B CG    1 
ATOM   4818 C  CD    . ARG D 1 176 ? -23.813 57.752  63.401  1.00 69.59  ? 1176 ARG B CD    1 
ATOM   4819 N  NE    . ARG D 1 176 ? -23.020 58.879  63.888  1.00 70.02  ? 1176 ARG B NE    1 
ATOM   4820 C  CZ    . ARG D 1 176 ? -23.212 60.143  63.527  1.00 70.17  ? 1176 ARG B CZ    1 
ATOM   4821 N  NH1   . ARG D 1 176 ? -24.178 60.453  62.671  1.00 69.93  ? 1176 ARG B NH1   1 
ATOM   4822 N  NH2   . ARG D 1 176 ? -22.438 61.098  64.027  1.00 70.37  ? 1176 ARG B NH2   1 
ATOM   4823 N  N     . GLU D 1 177 ? -23.489 57.407  57.928  1.00 69.24  ? 1177 GLU B N     1 
ATOM   4824 C  CA    . GLU D 1 177 ? -24.311 57.166  56.740  1.00 69.17  ? 1177 GLU B CA    1 
ATOM   4825 C  C     . GLU D 1 177 ? -23.531 56.526  55.595  1.00 68.93  ? 1177 GLU B C     1 
ATOM   4826 O  O     . GLU D 1 177 ? -24.015 55.594  54.953  1.00 68.90  ? 1177 GLU B O     1 
ATOM   4827 C  CB    . GLU D 1 177 ? -24.980 58.457  56.255  1.00 69.28  ? 1177 GLU B CB    1 
ATOM   4828 C  CG    . GLU D 1 177 ? -26.175 58.907  57.099  1.00 69.29  ? 1177 GLU B CG    1 
ATOM   4829 C  CD    . GLU D 1 177 ? -26.938 60.062  56.464  1.00 69.34  ? 1177 GLU B CD    1 
ATOM   4830 O  OE1   . GLU D 1 177 ? -26.926 60.182  55.217  1.00 69.31  ? 1177 GLU B OE1   1 
ATOM   4831 O  OE2   . GLU D 1 177 ? -27.551 60.850  57.211  1.00 69.36  ? 1177 GLU B OE2   1 
ATOM   4832 N  N     . LEU D 1 178 ? -22.327 57.028  55.344  1.00 68.72  ? 1178 LEU B N     1 
ATOM   4833 C  CA    . LEU D 1 178 ? -21.551 56.598  54.182  1.00 68.52  ? 1178 LEU B CA    1 
ATOM   4834 C  C     . LEU D 1 178 ? -21.165 55.121  54.205  1.00 68.38  ? 1178 LEU B C     1 
ATOM   4835 O  O     . LEU D 1 178 ? -20.589 54.616  55.175  1.00 68.13  ? 1178 LEU B O     1 
ATOM   4836 C  CB    . LEU D 1 178 ? -20.304 57.465  53.992  1.00 68.48  ? 1178 LEU B CB    1 
ATOM   4837 C  CG    . LEU D 1 178 ? -19.579 57.241  52.661  1.00 68.28  ? 1178 LEU B CG    1 
ATOM   4838 C  CD1   . LEU D 1 178 ? -20.330 57.893  51.505  1.00 67.81  ? 1178 LEU B CD1   1 
ATOM   4839 C  CD2   . LEU D 1 178 ? -18.157 57.750  52.739  1.00 68.30  ? 1178 LEU B CD2   1 
ATOM   4840 N  N     . ASP D 1 179 ? -21.496 54.448  53.109  1.00 68.27  ? 1179 ASP B N     1 
ATOM   4841 C  CA    . ASP D 1 179 ? -21.166 53.049  52.903  1.00 68.29  ? 1179 ASP B CA    1 
ATOM   4842 C  C     . ASP D 1 179 ? -19.648 52.851  52.860  1.00 68.01  ? 1179 ASP B C     1 
ATOM   4843 O  O     . ASP D 1 179 ? -18.925 53.666  52.282  1.00 67.95  ? 1179 ASP B O     1 
ATOM   4844 C  CB    . ASP D 1 179 ? -21.794 52.582  51.591  1.00 68.48  ? 1179 ASP B CB    1 
ATOM   4845 C  CG    . ASP D 1 179 ? -21.917 51.079  51.506  1.00 69.34  ? 1179 ASP B CG    1 
ATOM   4846 O  OD1   . ASP D 1 179 ? -20.890 50.382  51.685  1.00 69.60  ? 1179 ASP B OD1   1 
ATOM   4847 O  OD2   . ASP D 1 179 ? -23.047 50.600  51.253  1.00 70.41  ? 1179 ASP B OD2   1 
ATOM   4848 N  N     . ILE D 1 180 ? -19.170 51.766  53.464  1.00 67.54  ? 1180 ILE B N     1 
ATOM   4849 C  CA    . ILE D 1 180 ? -17.731 51.500  53.527  1.00 67.02  ? 1180 ILE B CA    1 
ATOM   4850 C  C     . ILE D 1 180 ? -17.113 51.312  52.136  1.00 66.51  ? 1180 ILE B C     1 
ATOM   4851 O  O     . ILE D 1 180 ? -15.976 51.720  51.889  1.00 66.51  ? 1180 ILE B O     1 
ATOM   4852 C  CB    . ILE D 1 180 ? -17.407 50.283  54.429  1.00 67.07  ? 1180 ILE B CB    1 
ATOM   4853 C  CG1   . ILE D 1 180 ? -15.933 50.289  54.835  1.00 67.25  ? 1180 ILE B CG1   1 
ATOM   4854 C  CG2   . ILE D 1 180 ? -17.773 48.978  53.747  1.00 67.07  ? 1180 ILE B CG2   1 
ATOM   4855 C  CD1   . ILE D 1 180 ? -15.655 51.024  56.121  1.00 67.25  ? 1180 ILE B CD1   1 
ATOM   4856 N  N     . ALA D 1 181 ? -17.868 50.709  51.224  1.00 65.88  ? 1181 ALA B N     1 
ATOM   4857 C  CA    . ALA D 1 181 ? -17.380 50.499  49.867  1.00 65.16  ? 1181 ALA B CA    1 
ATOM   4858 C  C     . ALA D 1 181 ? -17.163 51.832  49.166  1.00 64.67  ? 1181 ALA B C     1 
ATOM   4859 O  O     . ALA D 1 181 ? -16.375 51.925  48.235  1.00 64.88  ? 1181 ALA B O     1 
ATOM   4860 C  CB    . ALA D 1 181 ? -18.343 49.635  49.085  1.00 65.24  ? 1181 ALA B CB    1 
ATOM   4861 N  N     . ASP D 1 182 ? -17.854 52.864  49.633  1.00 64.22  ? 1182 ASP B N     1 
ATOM   4862 C  CA    . ASP D 1 182 ? -17.735 54.199  49.054  1.00 63.84  ? 1182 ASP B CA    1 
ATOM   4863 C  C     . ASP D 1 182 ? -16.520 54.970  49.558  1.00 63.37  ? 1182 ASP B C     1 
ATOM   4864 O  O     . ASP D 1 182 ? -16.238 56.068  49.071  1.00 63.31  ? 1182 ASP B O     1 
ATOM   4865 C  CB    . ASP D 1 182 ? -19.010 55.014  49.302  1.00 64.13  ? 1182 ASP B CB    1 
ATOM   4866 C  CG    . ASP D 1 182 ? -20.147 54.604  48.386  1.00 64.79  ? 1182 ASP B CG    1 
ATOM   4867 O  OD1   . ASP D 1 182 ? -19.867 53.974  47.339  1.00 65.13  ? 1182 ASP B OD1   1 
ATOM   4868 O  OD2   . ASP D 1 182 ? -21.314 54.913  48.710  1.00 65.50  ? 1182 ASP B OD2   1 
ATOM   4869 N  N     . VAL D 1 183 ? -15.809 54.413  50.536  1.00 62.66  ? 1183 VAL B N     1 
ATOM   4870 C  CA    . VAL D 1 183 ? -14.551 55.010  50.975  1.00 62.01  ? 1183 VAL B CA    1 
ATOM   4871 C  C     . VAL D 1 183 ? -13.449 54.770  49.940  1.00 61.77  ? 1183 VAL B C     1 
ATOM   4872 O  O     . VAL D 1 183 ? -13.209 53.631  49.526  1.00 61.60  ? 1183 VAL B O     1 
ATOM   4873 C  CB    . VAL D 1 183 ? -14.104 54.481  52.346  1.00 61.94  ? 1183 VAL B CB    1 
ATOM   4874 C  CG1   . VAL D 1 183 ? -12.616 54.694  52.538  1.00 61.64  ? 1183 VAL B CG1   1 
ATOM   4875 C  CG2   . VAL D 1 183 ? -14.889 55.164  53.456  1.00 61.98  ? 1183 VAL B CG2   1 
ATOM   4876 N  N     . PRO D 1 184 ? -12.794 55.853  49.496  1.00 61.35  ? 1184 PRO B N     1 
ATOM   4877 C  CA    . PRO D 1 184 ? -11.694 55.748  48.551  1.00 61.19  ? 1184 PRO B CA    1 
ATOM   4878 C  C     . PRO D 1 184 ? -10.623 54.792  49.063  1.00 61.05  ? 1184 PRO B C     1 
ATOM   4879 O  O     . PRO D 1 184 ? -10.139 54.954  50.173  1.00 61.19  ? 1184 PRO B O     1 
ATOM   4880 C  CB    . PRO D 1 184 ? -11.141 57.175  48.492  1.00 61.28  ? 1184 PRO B CB    1 
ATOM   4881 C  CG    . PRO D 1 184 ? -12.264 58.047  48.924  1.00 61.02  ? 1184 PRO B CG    1 
ATOM   4882 C  CD    . PRO D 1 184 ? -13.091 57.247  49.869  1.00 61.19  ? 1184 PRO B CD    1 
ATOM   4883 N  N     . GLY D 1 185 ? -10.254 53.804  48.257  1.00 61.03  ? 1185 GLY B N     1 
ATOM   4884 C  CA    . GLY D 1 185 ? -9.271  52.817  48.673  1.00 60.73  ? 1185 GLY B CA    1 
ATOM   4885 C  C     . GLY D 1 185 ? -9.950  51.524  49.068  1.00 60.74  ? 1185 GLY B C     1 
ATOM   4886 O  O     . GLY D 1 185 ? -9.302  50.491  49.223  1.00 60.46  ? 1185 GLY B O     1 
ATOM   4887 N  N     . ILE D 1 186 ? -11.267 51.585  49.238  1.00 60.87  ? 1186 ILE B N     1 
ATOM   4888 C  CA    . ILE D 1 186 ? -12.052 50.388  49.505  1.00 61.02  ? 1186 ILE B CA    1 
ATOM   4889 C  C     . ILE D 1 186 ? -12.726 49.904  48.233  1.00 61.22  ? 1186 ILE B C     1 
ATOM   4890 O  O     . ILE D 1 186 ? -13.655 50.542  47.725  1.00 61.19  ? 1186 ILE B O     1 
ATOM   4891 C  CB    . ILE D 1 186 ? -13.122 50.625  50.586  1.00 61.07  ? 1186 ILE B CB    1 
ATOM   4892 C  CG1   . ILE D 1 186 ? -12.473 51.112  51.887  1.00 61.09  ? 1186 ILE B CG1   1 
ATOM   4893 C  CG2   . ILE D 1 186 ? -13.930 49.357  50.816  1.00 60.82  ? 1186 ILE B CG2   1 
ATOM   4894 C  CD1   . ILE D 1 186 ? -11.206 50.362  52.272  1.00 60.83  ? 1186 ILE B CD1   1 
ATOM   4895 N  N     . GLY D 1 187 ? -12.246 48.777  47.718  1.00 61.42  ? 1187 GLY B N     1 
ATOM   4896 C  CA    . GLY D 1 187 ? -12.802 48.181  46.513  1.00 62.00  ? 1187 GLY B CA    1 
ATOM   4897 C  C     . GLY D 1 187 ? -13.658 46.979  46.848  1.00 62.59  ? 1187 GLY B C     1 
ATOM   4898 O  O     . GLY D 1 187 ? -13.907 46.692  48.019  1.00 62.77  ? 1187 GLY B O     1 
ATOM   4899 N  N     . ASN D 1 188 ? -14.095 46.266  45.816  1.00 63.05  ? 1188 ASN B N     1 
ATOM   4900 C  CA    . ASN D 1 188 ? -15.034 45.161  45.974  1.00 63.59  ? 1188 ASN B CA    1 
ATOM   4901 C  C     . ASN D 1 188 ? -14.478 43.999  46.797  1.00 63.83  ? 1188 ASN B C     1 
ATOM   4902 O  O     . ASN D 1 188 ? -15.232 43.234  47.403  1.00 63.89  ? 1188 ASN B O     1 
ATOM   4903 C  CB    . ASN D 1 188 ? -15.488 44.660  44.600  1.00 63.74  ? 1188 ASN B CB    1 
ATOM   4904 C  CG    . ASN D 1 188 ? -15.845 45.798  43.651  1.00 64.43  ? 1188 ASN B CG    1 
ATOM   4905 O  OD1   . ASN D 1 188 ? -14.966 46.516  43.160  1.00 65.54  ? 1188 ASN B OD1   1 
ATOM   4906 N  ND2   . ASN D 1 188 ? -17.139 45.965  43.387  1.00 63.77  ? 1188 ASN B ND2   1 
ATOM   4907 N  N     . ILE D 1 189 ? -13.158 43.862  46.809  1.00 64.05  ? 1189 ILE B N     1 
ATOM   4908 C  CA    . ILE D 1 189 ? -12.526 42.786  47.557  1.00 64.23  ? 1189 ILE B CA    1 
ATOM   4909 C  C     . ILE D 1 189 ? -12.493 43.117  49.046  1.00 64.25  ? 1189 ILE B C     1 
ATOM   4910 O  O     . ILE D 1 189 ? -12.888 42.300  49.882  1.00 64.29  ? 1189 ILE B O     1 
ATOM   4911 C  CB    . ILE D 1 189 ? -11.101 42.495  47.046  1.00 64.32  ? 1189 ILE B CB    1 
ATOM   4912 C  CG1   . ILE D 1 189 ? -11.126 42.189  45.542  1.00 64.78  ? 1189 ILE B CG1   1 
ATOM   4913 C  CG2   . ILE D 1 189 ? -10.480 41.347  47.829  1.00 64.26  ? 1189 ILE B CG2   1 
ATOM   4914 C  CD1   . ILE D 1 189 ? -12.129 41.096  45.145  1.00 65.96  ? 1189 ILE B CD1   1 
ATOM   4915 N  N     . THR D 1 190 ? -12.029 44.322  49.368  1.00 64.29  ? 1190 THR B N     1 
ATOM   4916 C  CA    . THR D 1 190 ? -11.967 44.779  50.753  1.00 64.32  ? 1190 THR B CA    1 
ATOM   4917 C  C     . THR D 1 190 ? -13.366 44.969  51.326  1.00 64.40  ? 1190 THR B C     1 
ATOM   4918 O  O     . THR D 1 190 ? -13.636 44.560  52.452  1.00 64.38  ? 1190 THR B O     1 
ATOM   4919 C  CB    . THR D 1 190 ? -11.171 46.094  50.894  1.00 64.27  ? 1190 THR B CB    1 
ATOM   4920 O  OG1   . THR D 1 190 ? -9.836  45.901  50.404  1.00 64.04  ? 1190 THR B OG1   1 
ATOM   4921 C  CG2   . THR D 1 190 ? -11.117 46.535  52.349  1.00 63.79  ? 1190 THR B CG2   1 
ATOM   4922 N  N     . ALA D 1 191 ? -14.249 45.579  50.541  1.00 64.63  ? 1191 ALA B N     1 
ATOM   4923 C  CA    . ALA D 1 191 ? -15.639 45.777  50.945  1.00 64.96  ? 1191 ALA B CA    1 
ATOM   4924 C  C     . ALA D 1 191 ? -16.307 44.446  51.265  1.00 65.29  ? 1191 ALA B C     1 
ATOM   4925 O  O     . ALA D 1 191 ? -17.028 44.326  52.255  1.00 65.22  ? 1191 ALA B O     1 
ATOM   4926 C  CB    . ALA D 1 191 ? -16.413 46.517  49.862  1.00 64.91  ? 1191 ALA B CB    1 
ATOM   4927 N  N     . GLU D 1 192 ? -16.058 43.445  50.428  1.00 65.78  ? 1192 GLU B N     1 
ATOM   4928 C  CA    . GLU D 1 192 ? -16.581 42.106  50.680  1.00 66.29  ? 1192 GLU B CA    1 
ATOM   4929 C  C     . GLU D 1 192 ? -15.951 41.440  51.902  1.00 66.23  ? 1192 GLU B C     1 
ATOM   4930 O  O     . GLU D 1 192 ? -16.605 40.656  52.579  1.00 66.50  ? 1192 GLU B O     1 
ATOM   4931 C  CB    . GLU D 1 192 ? -16.444 41.217  49.440  1.00 66.49  ? 1192 GLU B CB    1 
ATOM   4932 C  CG    . GLU D 1 192 ? -17.730 41.095  48.634  1.00 67.44  ? 1192 GLU B CG    1 
ATOM   4933 C  CD    . GLU D 1 192 ? -18.772 40.237  49.338  1.00 68.88  ? 1192 GLU B CD    1 
ATOM   4934 O  OE1   . GLU D 1 192 ? -19.983 40.441  49.093  1.00 69.51  ? 1192 GLU B OE1   1 
ATOM   4935 O  OE2   . GLU D 1 192 ? -18.380 39.358  50.139  1.00 69.47  ? 1192 GLU B OE2   1 
ATOM   4936 N  N     . LYS D 1 193 ? -14.689 41.751  52.183  1.00 66.31  ? 1193 LYS B N     1 
ATOM   4937 C  CA    . LYS D 1 193 ? -14.025 41.236  53.378  1.00 66.50  ? 1193 LYS B CA    1 
ATOM   4938 C  C     . LYS D 1 193 ? -14.613 41.883  54.633  1.00 66.58  ? 1193 LYS B C     1 
ATOM   4939 O  O     . LYS D 1 193 ? -14.638 41.277  55.708  1.00 66.59  ? 1193 LYS B O     1 
ATOM   4940 C  CB    . LYS D 1 193 ? -12.520 41.512  53.329  1.00 66.60  ? 1193 LYS B CB    1 
ATOM   4941 C  CG    . LYS D 1 193 ? -11.716 40.652  52.361  1.00 66.85  ? 1193 LYS B CG    1 
ATOM   4942 C  CD    . LYS D 1 193 ? -10.306 41.214  52.215  1.00 67.28  ? 1193 LYS B CD    1 
ATOM   4943 C  CE    . LYS D 1 193 ? -9.432  40.360  51.313  1.00 67.61  ? 1193 LYS B CE    1 
ATOM   4944 N  NZ    . LYS D 1 193 ? -8.374  41.185  50.648  1.00 68.35  ? 1193 LYS B NZ    1 
ATOM   4945 N  N     . LEU D 1 194 ? -15.078 43.120  54.486  1.00 66.55  ? 1194 LEU B N     1 
ATOM   4946 C  CA    . LEU D 1 194 ? -15.625 43.875  55.605  1.00 66.59  ? 1194 LEU B CA    1 
ATOM   4947 C  C     . LEU D 1 194 ? -17.052 43.447  55.914  1.00 66.80  ? 1194 LEU B C     1 
ATOM   4948 O  O     . LEU D 1 194 ? -17.469 43.447  57.075  1.00 67.08  ? 1194 LEU B O     1 
ATOM   4949 C  CB    . LEU D 1 194 ? -15.576 45.375  55.318  1.00 66.43  ? 1194 LEU B CB    1 
ATOM   4950 C  CG    . LEU D 1 194 ? -14.181 45.972  55.130  1.00 66.11  ? 1194 LEU B CG    1 
ATOM   4951 C  CD1   . LEU D 1 194 ? -14.265 47.360  54.513  1.00 65.52  ? 1194 LEU B CD1   1 
ATOM   4952 C  CD2   . LEU D 1 194 ? -13.418 46.004  56.441  1.00 65.12  ? 1194 LEU B CD2   1 
ATOM   4953 N  N     . LYS D 1 195 ? -17.795 43.075  54.877  1.00 66.90  ? 1195 LYS B N     1 
ATOM   4954 C  CA    . LYS D 1 195 ? -19.159 42.592  55.054  1.00 67.24  ? 1195 LYS B CA    1 
ATOM   4955 C  C     . LYS D 1 195 ? -19.202 41.212  55.720  1.00 67.44  ? 1195 LYS B C     1 
ATOM   4956 O  O     . LYS D 1 195 ? -20.149 40.901  56.441  1.00 67.48  ? 1195 LYS B O     1 
ATOM   4957 C  CB    . LYS D 1 195 ? -19.917 42.604  53.728  1.00 67.17  ? 1195 LYS B CB    1 
ATOM   4958 C  CG    . LYS D 1 195 ? -20.145 44.011  53.210  1.00 67.40  ? 1195 LYS B CG    1 
ATOM   4959 C  CD    . LYS D 1 195 ? -20.695 44.024  51.797  1.00 68.39  ? 1195 LYS B CD    1 
ATOM   4960 C  CE    . LYS D 1 195 ? -22.209 43.881  51.779  1.00 68.47  ? 1195 LYS B CE    1 
ATOM   4961 N  NZ    . LYS D 1 195 ? -22.774 44.478  50.531  1.00 68.36  ? 1195 LYS B NZ    1 
ATOM   4962 N  N     . LYS D 1 196 ? -18.171 40.399  55.491  1.00 67.60  ? 1196 LYS B N     1 
ATOM   4963 C  CA    . LYS D 1 196 ? -18.028 39.134  56.210  1.00 67.72  ? 1196 LYS B CA    1 
ATOM   4964 C  C     . LYS D 1 196 ? -17.778 39.434  57.684  1.00 67.55  ? 1196 LYS B C     1 
ATOM   4965 O  O     . LYS D 1 196 ? -18.174 38.663  58.564  1.00 67.55  ? 1196 LYS B O     1 
ATOM   4966 C  CB    . LYS D 1 196 ? -16.860 38.307  55.664  1.00 67.90  ? 1196 LYS B CB    1 
ATOM   4967 C  CG    . LYS D 1 196 ? -16.657 38.386  54.165  1.00 68.71  ? 1196 LYS B CG    1 
ATOM   4968 C  CD    . LYS D 1 196 ? -17.333 37.247  53.417  1.00 70.07  ? 1196 LYS B CD    1 
ATOM   4969 C  CE    . LYS D 1 196 ? -16.800 37.181  51.980  1.00 70.87  ? 1196 LYS B CE    1 
ATOM   4970 N  NZ    . LYS D 1 196 ? -17.384 36.065  51.182  1.00 71.44  ? 1196 LYS B NZ    1 
ATOM   4971 N  N     . LEU D 1 197 ? -17.111 40.557  57.944  1.00 67.26  ? 1197 LEU B N     1 
ATOM   4972 C  CA    . LEU D 1 197 ? -16.818 40.984  59.308  1.00 67.10  ? 1197 LEU B CA    1 
ATOM   4973 C  C     . LEU D 1 197 ? -18.026 41.672  59.936  1.00 66.97  ? 1197 LEU B C     1 
ATOM   4974 O  O     . LEU D 1 197 ? -18.096 41.838  61.153  1.00 67.00  ? 1197 LEU B O     1 
ATOM   4975 C  CB    . LEU D 1 197 ? -15.604 41.917  59.337  1.00 67.07  ? 1197 LEU B CB    1 
ATOM   4976 C  CG    . LEU D 1 197 ? -14.229 41.262  59.166  1.00 67.13  ? 1197 LEU B CG    1 
ATOM   4977 C  CD1   . LEU D 1 197 ? -13.115 42.308  59.113  1.00 66.48  ? 1197 LEU B CD1   1 
ATOM   4978 C  CD2   . LEU D 1 197 ? -13.976 40.244  60.279  1.00 66.93  ? 1197 LEU B CD2   1 
ATOM   4979 N  N     . GLY D 1 198 ? -18.980 42.061  59.096  1.00 66.81  ? 1198 GLY B N     1 
ATOM   4980 C  CA    . GLY D 1 198 ? -20.168 42.767  59.556  1.00 66.27  ? 1198 GLY B CA    1 
ATOM   4981 C  C     . GLY D 1 198 ? -20.043 44.256  59.303  1.00 65.99  ? 1198 GLY B C     1 
ATOM   4982 O  O     . GLY D 1 198 ? -21.037 44.983  59.330  1.00 66.09  ? 1198 GLY B O     1 
ATOM   4983 N  N     . ILE D 1 199 ? -18.816 44.710  59.050  1.00 65.48  ? 1199 ILE B N     1 
ATOM   4984 C  CA    . ILE D 1 199 ? -18.553 46.123  58.800  1.00 65.01  ? 1199 ILE B CA    1 
ATOM   4985 C  C     . ILE D 1 199 ? -19.212 46.596  57.510  1.00 64.75  ? 1199 ILE B C     1 
ATOM   4986 O  O     . ILE D 1 199 ? -18.861 46.154  56.413  1.00 64.84  ? 1199 ILE B O     1 
ATOM   4987 C  CB    . ILE D 1 199 ? -17.048 46.424  58.721  1.00 64.99  ? 1199 ILE B CB    1 
ATOM   4988 C  CG1   . ILE D 1 199 ? -16.350 46.023  60.016  1.00 64.89  ? 1199 ILE B CG1   1 
ATOM   4989 C  CG2   . ILE D 1 199 ? -16.814 47.900  58.427  1.00 64.94  ? 1199 ILE B CG2   1 
ATOM   4990 C  CD1   . ILE D 1 199 ? -14.846 46.167  59.952  1.00 64.74  ? 1199 ILE B CD1   1 
ATOM   4991 N  N     . ASN D 1 200 ? -20.169 47.503  57.649  1.00 64.36  ? 1200 ASN B N     1 
ATOM   4992 C  CA    . ASN D 1 200 ? -20.871 48.042  56.499  1.00 64.09  ? 1200 ASN B CA    1 
ATOM   4993 C  C     . ASN D 1 200 ? -20.721 49.553  56.409  1.00 63.76  ? 1200 ASN B C     1 
ATOM   4994 O  O     . ASN D 1 200 ? -20.974 50.159  55.368  1.00 63.78  ? 1200 ASN B O     1 
ATOM   4995 C  CB    . ASN D 1 200 ? -22.343 47.624  56.533  1.00 64.11  ? 1200 ASN B CB    1 
ATOM   4996 C  CG    . ASN D 1 200 ? -22.578 46.287  55.851  1.00 64.28  ? 1200 ASN B CG    1 
ATOM   4997 O  OD1   . ASN D 1 200 ? -22.365 46.152  54.642  1.00 65.04  ? 1200 ASN B OD1   1 
ATOM   4998 N  ND2   . ASN D 1 200 ? -23.007 45.294  56.618  1.00 63.87  ? 1200 ASN B ND2   1 
ATOM   4999 N  N     . LYS D 1 201 ? -20.286 50.150  57.512  1.00 63.36  ? 1201 LYS B N     1 
ATOM   5000 C  CA    . LYS D 1 201 ? -20.118 51.590  57.598  1.00 62.89  ? 1201 LYS B CA    1 
ATOM   5001 C  C     . LYS D 1 201 ? -18.710 51.897  58.070  1.00 62.61  ? 1201 LYS B C     1 
ATOM   5002 O  O     . LYS D 1 201 ? -18.039 51.038  58.641  1.00 62.44  ? 1201 LYS B O     1 
ATOM   5003 C  CB    . LYS D 1 201 ? -21.142 52.188  58.575  1.00 62.91  ? 1201 LYS B CB    1 
ATOM   5004 C  CG    . LYS D 1 201 ? -22.593 52.007  58.150  1.00 62.53  ? 1201 LYS B CG    1 
ATOM   5005 C  CD    . LYS D 1 201 ? -22.842 52.629  56.784  1.00 62.16  ? 1201 LYS B CD    1 
ATOM   5006 C  CE    . LYS D 1 201 ? -24.249 52.359  56.283  1.00 61.99  ? 1201 LYS B CE    1 
ATOM   5007 N  NZ    . LYS D 1 201 ? -24.386 52.743  54.846  1.00 61.71  ? 1201 LYS B NZ    1 
ATOM   5008 N  N     . LEU D 1 202 ? -18.257 53.120  57.821  1.00 62.47  ? 1202 LEU B N     1 
ATOM   5009 C  CA    . LEU D 1 202 ? -16.965 53.561  58.333  1.00 62.37  ? 1202 LEU B CA    1 
ATOM   5010 C  C     . LEU D 1 202 ? -16.904 53.385  59.843  1.00 62.45  ? 1202 LEU B C     1 
ATOM   5011 O  O     . LEU D 1 202 ? -15.948 52.827  60.382  1.00 62.53  ? 1202 LEU B O     1 
ATOM   5012 C  CB    . LEU D 1 202 ? -16.718 55.028  57.985  1.00 62.21  ? 1202 LEU B CB    1 
ATOM   5013 C  CG    . LEU D 1 202 ? -15.540 55.325  57.067  1.00 61.58  ? 1202 LEU B CG    1 
ATOM   5014 C  CD1   . LEU D 1 202 ? -15.265 56.815  57.060  1.00 60.91  ? 1202 LEU B CD1   1 
ATOM   5015 C  CD2   . LEU D 1 202 ? -14.313 54.557  57.520  1.00 61.32  ? 1202 LEU B CD2   1 
ATOM   5016 N  N     . VAL D 1 203 ? -17.939 53.868  60.516  1.00 62.46  ? 1203 VAL B N     1 
ATOM   5017 C  CA    . VAL D 1 203 ? -18.010 53.818  61.972  1.00 62.62  ? 1203 VAL B CA    1 
ATOM   5018 C  C     . VAL D 1 203 ? -17.916 52.389  62.516  1.00 62.66  ? 1203 VAL B C     1 
ATOM   5019 O  O     . VAL D 1 203 ? -17.340 52.162  63.579  1.00 62.63  ? 1203 VAL B O     1 
ATOM   5020 C  CB    . VAL D 1 203 ? -19.287 54.523  62.487  1.00 62.50  ? 1203 VAL B CB    1 
ATOM   5021 C  CG1   . VAL D 1 203 ? -20.539 53.745  62.093  1.00 62.50  ? 1203 VAL B CG1   1 
ATOM   5022 C  CG2   . VAL D 1 203 ? -19.213 54.729  63.980  1.00 62.72  ? 1203 VAL B CG2   1 
ATOM   5023 N  N     . ASP D 1 204 ? -18.459 51.428  61.770  1.00 62.85  ? 1204 ASP B N     1 
ATOM   5024 C  CA    . ASP D 1 204 ? -18.432 50.020  62.167  1.00 62.95  ? 1204 ASP B CA    1 
ATOM   5025 C  C     . ASP D 1 204 ? -17.009 49.485  62.352  1.00 63.03  ? 1204 ASP B C     1 
ATOM   5026 O  O     . ASP D 1 204 ? -16.816 48.383  62.861  1.00 63.06  ? 1204 ASP B O     1 
ATOM   5027 C  CB    . ASP D 1 204 ? -19.182 49.156  61.146  1.00 62.93  ? 1204 ASP B CB    1 
ATOM   5028 C  CG    . ASP D 1 204 ? -20.652 49.528  61.019  1.00 63.11  ? 1204 ASP B CG    1 
ATOM   5029 O  OD1   . ASP D 1 204 ? -21.154 50.312  61.852  1.00 63.36  ? 1204 ASP B OD1   1 
ATOM   5030 O  OD2   . ASP D 1 204 ? -21.308 49.028  60.080  1.00 63.20  ? 1204 ASP B OD2   1 
ATOM   5031 N  N     . THR D 1 205 ? -16.015 50.261  61.934  1.00 63.19  ? 1205 THR B N     1 
ATOM   5032 C  CA    . THR D 1 205 ? -14.623 49.856  62.097  1.00 63.37  ? 1205 THR B CA    1 
ATOM   5033 C  C     . THR D 1 205 ? -14.194 50.040  63.545  1.00 63.70  ? 1205 THR B C     1 
ATOM   5034 O  O     . THR D 1 205 ? -13.330 49.317  64.044  1.00 63.72  ? 1205 THR B O     1 
ATOM   5035 C  CB    . THR D 1 205 ? -13.675 50.649  61.165  1.00 63.24  ? 1205 THR B CB    1 
ATOM   5036 O  OG1   . THR D 1 205 ? -13.825 52.054  61.399  1.00 62.63  ? 1205 THR B OG1   1 
ATOM   5037 C  CG2   . THR D 1 205 ? -13.983 50.347  59.700  1.00 63.18  ? 1205 THR B CG2   1 
ATOM   5038 N  N     . LEU D 1 206 ? -14.813 51.009  64.211  1.00 64.14  ? 1206 LEU B N     1 
ATOM   5039 C  CA    . LEU D 1 206 ? -14.519 51.315  65.608  1.00 64.78  ? 1206 LEU B CA    1 
ATOM   5040 C  C     . LEU D 1 206 ? -14.965 50.195  66.547  1.00 65.19  ? 1206 LEU B C     1 
ATOM   5041 O  O     . LEU D 1 206 ? -14.375 49.994  67.607  1.00 65.16  ? 1206 LEU B O     1 
ATOM   5042 C  CB    . LEU D 1 206 ? -15.196 52.627  66.013  1.00 64.75  ? 1206 LEU B CB    1 
ATOM   5043 C  CG    . LEU D 1 206 ? -14.987 53.818  65.073  1.00 64.40  ? 1206 LEU B CG    1 
ATOM   5044 C  CD1   . LEU D 1 206 ? -15.836 55.003  65.514  1.00 64.48  ? 1206 LEU B CD1   1 
ATOM   5045 C  CD2   . LEU D 1 206 ? -13.521 54.197  65.006  1.00 63.53  ? 1206 LEU B CD2   1 
ATOM   5046 N  N     . SER D 1 207 ? -16.007 49.470  66.148  1.00 65.83  ? 1207 SER B N     1 
ATOM   5047 C  CA    . SER D 1 207 ? -16.561 48.387  66.958  1.00 66.51  ? 1207 SER B CA    1 
ATOM   5048 C  C     . SER D 1 207 ? -15.858 47.051  66.696  1.00 67.01  ? 1207 SER B C     1 
ATOM   5049 O  O     . SER D 1 207 ? -16.428 45.983  66.921  1.00 67.05  ? 1207 SER B O     1 
ATOM   5050 C  CB    . SER D 1 207 ? -18.064 48.246  66.699  1.00 66.43  ? 1207 SER B CB    1 
ATOM   5051 O  OG    . SER D 1 207 ? -18.692 49.527  66.598  1.00 66.49  ? 1207 SER B OG    1 
ATOM   5052 N  N     . ILE D 1 208 ? -14.616 47.118  66.227  1.00 67.73  ? 1208 ILE B N     1 
ATOM   5053 C  CA    . ILE D 1 208 ? -13.857 45.920  65.872  1.00 68.39  ? 1208 ILE B CA    1 
ATOM   5054 C  C     . ILE D 1 208 ? -12.368 46.085  66.191  1.00 68.81  ? 1208 ILE B C     1 
ATOM   5055 O  O     . ILE D 1 208 ? -11.776 47.127  65.903  1.00 68.87  ? 1208 ILE B O     1 
ATOM   5056 C  CB    . ILE D 1 208 ? -14.083 45.536  64.382  1.00 68.37  ? 1208 ILE B CB    1 
ATOM   5057 C  CG1   . ILE D 1 208 ? -15.252 44.550  64.270  1.00 68.53  ? 1208 ILE B CG1   1 
ATOM   5058 C  CG2   . ILE D 1 208 ? -12.818 44.959  63.749  1.00 68.38  ? 1208 ILE B CG2   1 
ATOM   5059 C  CD1   . ILE D 1 208 ? -15.465 43.990  62.885  1.00 68.68  ? 1208 ILE B CD1   1 
ATOM   5060 N  N     . GLU D 1 209 ? -11.779 45.060  66.804  1.00 69.32  ? 1209 GLU B N     1 
ATOM   5061 C  CA    . GLU D 1 209 ? -10.363 45.084  67.168  1.00 69.85  ? 1209 GLU B CA    1 
ATOM   5062 C  C     . GLU D 1 209 ? -9.457  45.116  65.939  1.00 70.20  ? 1209 GLU B C     1 
ATOM   5063 O  O     . GLU D 1 209 ? -9.762  44.510  64.913  1.00 70.27  ? 1209 GLU B O     1 
ATOM   5064 C  CB    . GLU D 1 209 ? -10.012 43.888  68.055  1.00 69.90  ? 1209 GLU B CB    1 
ATOM   5065 C  CG    . GLU D 1 209 ? -10.604 43.960  69.454  1.00 70.17  ? 1209 GLU B CG    1 
ATOM   5066 C  CD    . GLU D 1 209 ? -10.456 42.656  70.217  1.00 70.86  ? 1209 GLU B CD    1 
ATOM   5067 O  OE1   . GLU D 1 209 ? -10.649 42.653  71.455  1.00 70.85  ? 1209 GLU B OE1   1 
ATOM   5068 O  OE2   . GLU D 1 209 ? -10.146 41.630  69.575  1.00 71.14  ? 1209 GLU B OE2   1 
ATOM   5069 N  N     . PHE D 1 210 ? -8.335  45.820  66.064  1.00 70.58  ? 1210 PHE B N     1 
ATOM   5070 C  CA    . PHE D 1 210 ? -7.425  46.074  64.947  1.00 70.98  ? 1210 PHE B CA    1 
ATOM   5071 C  C     . PHE D 1 210 ? -6.869  44.816  64.271  1.00 71.19  ? 1210 PHE B C     1 
ATOM   5072 O  O     . PHE D 1 210 ? -6.647  44.803  63.059  1.00 71.15  ? 1210 PHE B O     1 
ATOM   5073 C  CB    . PHE D 1 210 ? -6.273  46.970  65.411  1.00 71.04  ? 1210 PHE B CB    1 
ATOM   5074 C  CG    . PHE D 1 210 ? -5.186  47.141  64.391  1.00 71.11  ? 1210 PHE B CG    1 
ATOM   5075 C  CD1   . PHE D 1 210 ? -5.247  48.165  63.460  1.00 71.15  ? 1210 PHE B CD1   1 
ATOM   5076 C  CD2   . PHE D 1 210 ? -4.096  46.280  64.370  1.00 71.42  ? 1210 PHE B CD2   1 
ATOM   5077 C  CE1   . PHE D 1 210 ? -4.245  48.328  62.525  1.00 71.34  ? 1210 PHE B CE1   1 
ATOM   5078 C  CE2   . PHE D 1 210 ? -3.090  46.434  63.435  1.00 71.44  ? 1210 PHE B CE2   1 
ATOM   5079 C  CZ    . PHE D 1 210 ? -3.166  47.459  62.510  1.00 71.61  ? 1210 PHE B CZ    1 
ATOM   5080 N  N     . ASP D 1 211 ? -6.635  43.773  65.061  1.00 71.41  ? 1211 ASP B N     1 
ATOM   5081 C  CA    . ASP D 1 211 ? -6.074  42.524  64.556  1.00 71.66  ? 1211 ASP B CA    1 
ATOM   5082 C  C     . ASP D 1 211 ? -7.094  41.774  63.712  1.00 71.71  ? 1211 ASP B C     1 
ATOM   5083 O  O     . ASP D 1 211 ? -6.747  41.134  62.719  1.00 71.54  ? 1211 ASP B O     1 
ATOM   5084 C  CB    . ASP D 1 211 ? -5.629  41.650  65.725  1.00 71.76  ? 1211 ASP B CB    1 
ATOM   5085 C  CG    . ASP D 1 211 ? -4.793  42.413  66.729  1.00 72.22  ? 1211 ASP B CG    1 
ATOM   5086 O  OD1   . ASP D 1 211 ? -3.912  43.189  66.295  1.00 72.74  ? 1211 ASP B OD1   1 
ATOM   5087 O  OD2   . ASP D 1 211 ? -5.018  42.239  67.948  1.00 72.34  ? 1211 ASP B OD2   1 
ATOM   5088 N  N     . LYS D 1 212 ? -8.352  41.855  64.136  1.00 71.91  ? 1212 LYS B N     1 
ATOM   5089 C  CA    . LYS D 1 212 ? -9.473  41.274  63.413  1.00 72.13  ? 1212 LYS B CA    1 
ATOM   5090 C  C     . LYS D 1 212 ? -9.540  41.900  62.022  1.00 72.24  ? 1212 LYS B C     1 
ATOM   5091 O  O     . LYS D 1 212 ? -9.895  41.240  61.043  1.00 72.42  ? 1212 LYS B O     1 
ATOM   5092 C  CB    . LYS D 1 212 ? -10.764 41.559  64.181  1.00 72.14  ? 1212 LYS B CB    1 
ATOM   5093 C  CG    . LYS D 1 212 ? -11.940 40.649  63.864  1.00 72.39  ? 1212 LYS B CG    1 
ATOM   5094 C  CD    . LYS D 1 212 ? -13.231 41.253  64.413  1.00 72.46  ? 1212 LYS B CD    1 
ATOM   5095 C  CE    . LYS D 1 212 ? -14.379 40.257  64.433  1.00 72.46  ? 1212 LYS B CE    1 
ATOM   5096 N  NZ    . LYS D 1 212 ? -14.378 39.437  65.676  1.00 72.61  ? 1212 LYS B NZ    1 
ATOM   5097 N  N     . LEU D 1 213 ? -9.173  43.177  61.949  1.00 72.26  ? 1213 LEU B N     1 
ATOM   5098 C  CA    . LEU D 1 213 ? -9.248  43.958  60.719  1.00 72.17  ? 1213 LEU B CA    1 
ATOM   5099 C  C     . LEU D 1 213 ? -7.958  43.866  59.908  1.00 72.19  ? 1213 LEU B C     1 
ATOM   5100 O  O     . LEU D 1 213 ? -7.991  43.756  58.681  1.00 72.15  ? 1213 LEU B O     1 
ATOM   5101 C  CB    . LEU D 1 213 ? -9.542  45.423  61.054  1.00 72.22  ? 1213 LEU B CB    1 
ATOM   5102 C  CG    . LEU D 1 213 ? -10.021 46.339  59.928  1.00 72.30  ? 1213 LEU B CG    1 
ATOM   5103 C  CD1   . LEU D 1 213 ? -11.378 45.885  59.435  1.00 72.32  ? 1213 LEU B CD1   1 
ATOM   5104 C  CD2   . LEU D 1 213 ? -10.080 47.784  60.404  1.00 72.22  ? 1213 LEU B CD2   1 
ATOM   5105 N  N     . LYS D 1 214 ? -6.824  43.927  60.602  1.00 72.18  ? 1214 LYS B N     1 
ATOM   5106 C  CA    . LYS D 1 214 ? -5.515  43.788  59.974  1.00 72.16  ? 1214 LYS B CA    1 
ATOM   5107 C  C     . LYS D 1 214 ? -5.380  42.412  59.330  1.00 72.08  ? 1214 LYS B C     1 
ATOM   5108 O  O     . LYS D 1 214 ? -4.852  42.283  58.226  1.00 72.08  ? 1214 LYS B O     1 
ATOM   5109 C  CB    . LYS D 1 214 ? -4.406  43.988  61.011  1.00 72.31  ? 1214 LYS B CB    1 
ATOM   5110 C  CG    . LYS D 1 214 ? -2.981  43.841  60.475  1.00 72.60  ? 1214 LYS B CG    1 
ATOM   5111 C  CD    . LYS D 1 214 ? -2.004  43.558  61.618  1.00 73.00  ? 1214 LYS B CD    1 
ATOM   5112 C  CE    . LYS D 1 214 ? -0.552  43.705  61.176  1.00 72.98  ? 1214 LYS B CE    1 
ATOM   5113 N  NZ    . LYS D 1 214 ? -0.182  42.744  60.100  1.00 72.76  ? 1214 LYS B NZ    1 
ATOM   5114 N  N     . GLY D 1 215 ? -5.865  41.387  60.027  1.00 71.99  ? 1215 GLY B N     1 
ATOM   5115 C  CA    . GLY D 1 215 ? -5.793  40.013  59.535  1.00 71.85  ? 1215 GLY B CA    1 
ATOM   5116 C  C     . GLY D 1 215 ? -6.502  39.844  58.205  1.00 71.72  ? 1215 GLY B C     1 
ATOM   5117 O  O     . GLY D 1 215 ? -6.159  38.966  57.408  1.00 71.80  ? 1215 GLY B O     1 
ATOM   5118 N  N     . MET D 1 216 ? -7.479  40.711  57.960  1.00 71.46  ? 1216 MET B N     1 
ATOM   5119 C  CA    . MET D 1 216 ? -8.333  40.613  56.787  1.00 71.04  ? 1216 MET B CA    1 
ATOM   5120 C  C     . MET D 1 216 ? -7.867  41.528  55.658  1.00 70.75  ? 1216 MET B C     1 
ATOM   5121 O  O     . MET D 1 216 ? -7.614  41.081  54.537  1.00 70.84  ? 1216 MET B O     1 
ATOM   5122 C  CB    . MET D 1 216 ? -9.770  40.969  57.172  1.00 71.07  ? 1216 MET B CB    1 
ATOM   5123 C  CG    . MET D 1 216 ? -10.809 40.071  56.549  1.00 71.27  ? 1216 MET B CG    1 
ATOM   5124 S  SD    . MET D 1 216 ? -10.429 38.343  56.882  1.00 72.40  ? 1216 MET B SD    1 
ATOM   5125 C  CE    . MET D 1 216 ? -10.675 38.248  58.662  1.00 72.05  ? 1216 MET B CE    1 
ATOM   5126 N  N     . ILE D 1 217 ? -7.756  42.815  55.963  1.00 70.18  ? 1217 ILE B N     1 
ATOM   5127 C  CA    . ILE D 1 217 ? -7.526  43.817  54.934  1.00 69.46  ? 1217 ILE B CA    1 
ATOM   5128 C  C     . ILE D 1 217 ? -6.110  44.402  54.970  1.00 69.32  ? 1217 ILE B C     1 
ATOM   5129 O  O     . ILE D 1 217 ? -5.769  45.275  54.167  1.00 69.23  ? 1217 ILE B O     1 
ATOM   5130 C  CB    . ILE D 1 217 ? -8.587  44.936  55.011  1.00 69.35  ? 1217 ILE B CB    1 
ATOM   5131 C  CG1   . ILE D 1 217 ? -8.300  45.885  56.171  1.00 68.79  ? 1217 ILE B CG1   1 
ATOM   5132 C  CG2   . ILE D 1 217 ? -9.981  44.335  55.155  1.00 69.25  ? 1217 ILE B CG2   1 
ATOM   5133 C  CD1   . ILE D 1 217 ? -9.271  47.032  56.257  1.00 68.00  ? 1217 ILE B CD1   1 
ATOM   5134 N  N     . GLY D 1 218 ? -5.285  43.912  55.892  1.00 69.00  ? 1218 GLY B N     1 
ATOM   5135 C  CA    . GLY D 1 218 ? -3.907  44.384  56.004  1.00 68.71  ? 1218 GLY B CA    1 
ATOM   5136 C  C     . GLY D 1 218 ? -3.800  45.590  56.914  1.00 68.46  ? 1218 GLY B C     1 
ATOM   5137 O  O     . GLY D 1 218 ? -4.808  46.073  57.427  1.00 68.33  ? 1218 GLY B O     1 
ATOM   5138 N  N     . GLU D 1 219 ? -2.580  46.089  57.099  1.00 68.25  ? 1219 GLU B N     1 
ATOM   5139 C  CA    . GLU D 1 219 ? -2.326  47.147  58.076  1.00 68.16  ? 1219 GLU B CA    1 
ATOM   5140 C  C     . GLU D 1 219 ? -2.653  48.550  57.563  1.00 68.00  ? 1219 GLU B C     1 
ATOM   5141 O  O     . GLU D 1 219 ? -3.312  49.324  58.251  1.00 68.03  ? 1219 GLU B O     1 
ATOM   5142 C  CB    . GLU D 1 219 ? -0.879  47.080  58.586  1.00 68.22  ? 1219 GLU B CB    1 
ATOM   5143 C  CG    . GLU D 1 219 ? -0.737  47.402  60.075  1.00 68.28  ? 1219 GLU B CG    1 
ATOM   5144 C  CD    . GLU D 1 219 ? 0.648   47.087  60.634  1.00 68.49  ? 1219 GLU B CD    1 
ATOM   5145 O  OE1   . GLU D 1 219 ? 1.642   47.211  59.885  1.00 68.50  ? 1219 GLU B OE1   1 
ATOM   5146 O  OE2   . GLU D 1 219 ? 0.744   46.723  61.830  1.00 68.53  ? 1219 GLU B OE2   1 
ATOM   5147 N  N     . ALA D 1 220 ? -2.191  48.883  56.363  1.00 67.92  ? 1220 ALA B N     1 
ATOM   5148 C  CA    . ALA D 1 220 ? -2.431  50.215  55.818  1.00 67.77  ? 1220 ALA B CA    1 
ATOM   5149 C  C     . ALA D 1 220 ? -3.929  50.502  55.707  1.00 67.70  ? 1220 ALA B C     1 
ATOM   5150 O  O     . ALA D 1 220 ? -4.399  51.553  56.149  1.00 67.87  ? 1220 ALA B O     1 
ATOM   5151 C  CB    . ALA D 1 220 ? -1.751  50.379  54.475  1.00 67.92  ? 1220 ALA B CB    1 
ATOM   5152 N  N     . LYS D 1 221 ? -4.675  49.562  55.132  1.00 67.22  ? 1221 LYS B N     1 
ATOM   5153 C  CA    . LYS D 1 221 ? -6.125  49.706  55.020  1.00 66.79  ? 1221 LYS B CA    1 
ATOM   5154 C  C     . LYS D 1 221 ? -6.815  49.733  56.386  1.00 66.34  ? 1221 LYS B C     1 
ATOM   5155 O  O     . LYS D 1 221 ? -7.831  50.405  56.555  1.00 66.14  ? 1221 LYS B O     1 
ATOM   5156 C  CB    . LYS D 1 221 ? -6.713  48.601  54.143  1.00 66.67  ? 1221 LYS B CB    1 
ATOM   5157 C  CG    . LYS D 1 221 ? -6.743  48.944  52.668  1.00 67.56  ? 1221 LYS B CG    1 
ATOM   5158 C  CD    . LYS D 1 221 ? -6.947  47.704  51.815  1.00 68.29  ? 1221 LYS B CD    1 
ATOM   5159 C  CE    . LYS D 1 221 ? -7.176  48.074  50.371  1.00 68.64  ? 1221 LYS B CE    1 
ATOM   5160 N  NZ    . LYS D 1 221 ? -6.104  48.958  49.832  1.00 69.87  ? 1221 LYS B NZ    1 
ATOM   5161 N  N     . ALA D 1 222 ? -6.262  49.002  57.351  1.00 65.96  ? 1222 ALA B N     1 
ATOM   5162 C  CA    . ALA D 1 222 ? -6.787  49.006  58.720  1.00 65.63  ? 1222 ALA B CA    1 
ATOM   5163 C  C     . ALA D 1 222 ? -6.617  50.371  59.386  1.00 65.43  ? 1222 ALA B C     1 
ATOM   5164 O  O     . ALA D 1 222 ? -7.580  50.942  59.892  1.00 65.23  ? 1222 ALA B O     1 
ATOM   5165 C  CB    . ALA D 1 222 ? -6.130  47.919  59.552  1.00 65.48  ? 1222 ALA B CB    1 
ATOM   5166 N  N     . LYS D 1 223 ? -5.392  50.891  59.375  1.00 65.47  ? 1223 LYS B N     1 
ATOM   5167 C  CA    . LYS D 1 223 ? -5.113  52.228  59.896  1.00 65.70  ? 1223 LYS B CA    1 
ATOM   5168 C  C     . LYS D 1 223 ? -6.005  53.255  59.223  1.00 65.56  ? 1223 LYS B C     1 
ATOM   5169 O  O     . LYS D 1 223 ? -6.740  53.987  59.877  1.00 65.66  ? 1223 LYS B O     1 
ATOM   5170 C  CB    . LYS D 1 223 ? -3.654  52.617  59.644  1.00 65.92  ? 1223 LYS B CB    1 
ATOM   5171 C  CG    . LYS D 1 223 ? -2.615  51.806  60.412  1.00 66.60  ? 1223 LYS B CG    1 
ATOM   5172 C  CD    . LYS D 1 223 ? -1.214  52.189  59.952  1.00 67.63  ? 1223 LYS B CD    1 
ATOM   5173 C  CE    . LYS D 1 223 ? -0.226  51.054  60.163  1.00 68.27  ? 1223 LYS B CE    1 
ATOM   5174 N  NZ    . LYS D 1 223 ? -0.222  50.566  61.572  1.00 68.06  ? 1223 LYS B NZ    1 
ATOM   5175 N  N     . TYR D 1 224 ? -5.914  53.293  57.901  1.00 65.63  ? 1224 TYR B N     1 
ATOM   5176 C  CA    . TYR D 1 224 ? -6.669  54.211  57.061  1.00 65.46  ? 1224 TYR B CA    1 
ATOM   5177 C  C     . TYR D 1 224 ? -8.145  54.283  57.445  1.00 65.33  ? 1224 TYR B C     1 
ATOM   5178 O  O     . TYR D 1 224 ? -8.682  55.362  57.698  1.00 65.19  ? 1224 TYR B O     1 
ATOM   5179 C  CB    . TYR D 1 224 ? -6.511  53.770  55.604  1.00 65.61  ? 1224 TYR B CB    1 
ATOM   5180 C  CG    . TYR D 1 224 ? -7.346  54.524  54.603  1.00 65.78  ? 1224 TYR B CG    1 
ATOM   5181 C  CD1   . TYR D 1 224 ? -6.944  55.766  54.131  1.00 65.68  ? 1224 TYR B CD1   1 
ATOM   5182 C  CD2   . TYR D 1 224 ? -8.525  53.981  54.107  1.00 65.91  ? 1224 TYR B CD2   1 
ATOM   5183 C  CE1   . TYR D 1 224 ? -7.702  56.454  53.207  1.00 66.34  ? 1224 TYR B CE1   1 
ATOM   5184 C  CE2   . TYR D 1 224 ? -9.289  54.659  53.181  1.00 66.21  ? 1224 TYR B CE2   1 
ATOM   5185 C  CZ    . TYR D 1 224 ? -8.875  55.898  52.734  1.00 66.30  ? 1224 TYR B CZ    1 
ATOM   5186 O  OH    . TYR D 1 224 ? -9.635  56.579  51.811  1.00 66.07  ? 1224 TYR B OH    1 
ATOM   5187 N  N     . LEU D 1 225 ? -8.794  53.126  57.496  1.00 65.26  ? 1225 LEU B N     1 
ATOM   5188 C  CA    . LEU D 1 225 ? -10.230 53.062  57.730  1.00 65.25  ? 1225 LEU B CA    1 
ATOM   5189 C  C     . LEU D 1 225 ? -10.629 53.615  59.088  1.00 65.45  ? 1225 LEU B C     1 
ATOM   5190 O  O     . LEU D 1 225 ? -11.380 54.587  59.175  1.00 65.55  ? 1225 LEU B O     1 
ATOM   5191 C  CB    . LEU D 1 225 ? -10.734 51.626  57.589  1.00 65.16  ? 1225 LEU B CB    1 
ATOM   5192 C  CG    . LEU D 1 225 ? -10.966 51.123  56.168  1.00 64.82  ? 1225 LEU B CG    1 
ATOM   5193 C  CD1   . LEU D 1 225 ? -11.665 49.778  56.209  1.00 64.49  ? 1225 LEU B CD1   1 
ATOM   5194 C  CD2   . LEU D 1 225 ? -11.791 52.133  55.392  1.00 64.77  ? 1225 LEU B CD2   1 
ATOM   5195 N  N     . ILE D 1 226 ? -10.127 52.986  60.146  1.00 65.58  ? 1226 ILE B N     1 
ATOM   5196 C  CA    . ILE D 1 226 ? -10.471 53.383  61.504  1.00 65.57  ? 1226 ILE B CA    1 
ATOM   5197 C  C     . ILE D 1 226 ? -10.034 54.818  61.783  1.00 65.60  ? 1226 ILE B C     1 
ATOM   5198 O  O     . ILE D 1 226 ? -10.648 55.516  62.583  1.00 65.58  ? 1226 ILE B O     1 
ATOM   5199 C  CB    . ILE D 1 226 ? -9.901  52.387  62.548  1.00 65.53  ? 1226 ILE B CB    1 
ATOM   5200 C  CG1   . ILE D 1 226 ? -10.603 52.562  63.896  1.00 65.77  ? 1226 ILE B CG1   1 
ATOM   5201 C  CG2   . ILE D 1 226 ? -8.389  52.521  62.668  1.00 65.41  ? 1226 ILE B CG2   1 
ATOM   5202 C  CD1   . ILE D 1 226 ? -10.590 51.320  64.765  1.00 66.32  ? 1226 ILE B CD1   1 
ATOM   5203 N  N     . SER D 1 227 ? -8.991  55.262  61.090  1.00 65.79  ? 1227 SER B N     1 
ATOM   5204 C  CA    . SER D 1 227 ? -8.524  56.641  61.194  1.00 66.08  ? 1227 SER B CA    1 
ATOM   5205 C  C     . SER D 1 227 ? -9.540  57.632  60.618  1.00 66.21  ? 1227 SER B C     1 
ATOM   5206 O  O     . SER D 1 227 ? -9.813  58.670  61.222  1.00 66.27  ? 1227 SER B O     1 
ATOM   5207 C  CB    . SER D 1 227 ? -7.176  56.798  60.492  1.00 66.10  ? 1227 SER B CB    1 
ATOM   5208 O  OG    . SER D 1 227 ? -6.711  58.129  60.578  1.00 66.59  ? 1227 SER B OG    1 
ATOM   5209 N  N     . LEU D 1 228 ? -10.093 57.311  59.450  1.00 66.37  ? 1228 LEU B N     1 
ATOM   5210 C  CA    . LEU D 1 228 ? -11.151 58.117  58.845  1.00 66.53  ? 1228 LEU B CA    1 
ATOM   5211 C  C     . LEU D 1 228 ? -12.400 58.149  59.727  1.00 66.76  ? 1228 LEU B C     1 
ATOM   5212 O  O     . LEU D 1 228 ? -13.089 59.168  59.816  1.00 66.63  ? 1228 LEU B O     1 
ATOM   5213 C  CB    . LEU D 1 228 ? -11.526 57.561  57.472  1.00 66.54  ? 1228 LEU B CB    1 
ATOM   5214 C  CG    . LEU D 1 228 ? -10.632 57.863  56.270  1.00 66.68  ? 1228 LEU B CG    1 
ATOM   5215 C  CD1   . LEU D 1 228 ? -11.130 57.089  55.068  1.00 66.26  ? 1228 LEU B CD1   1 
ATOM   5216 C  CD2   . LEU D 1 228 ? -10.608 59.349  55.974  1.00 66.65  ? 1228 LEU B CD2   1 
ATOM   5217 N  N     . ALA D 1 229 ? -12.695 57.018  60.360  1.00 67.03  ? 1229 ALA B N     1 
ATOM   5218 C  CA    . ALA D 1 229 ? -13.827 56.916  61.270  1.00 67.38  ? 1229 ALA B CA    1 
ATOM   5219 C  C     . ALA D 1 229 ? -13.551 57.670  62.573  1.00 67.66  ? 1229 ALA B C     1 
ATOM   5220 O  O     . ALA D 1 229 ? -14.409 58.404  63.061  1.00 67.64  ? 1229 ALA B O     1 
ATOM   5221 C  CB    . ALA D 1 229 ? -14.157 55.457  61.548  1.00 67.26  ? 1229 ALA B CB    1 
ATOM   5222 N  N     . ARG D 1 230 ? -12.352 57.494  63.126  1.00 68.04  ? 1230 ARG B N     1 
ATOM   5223 C  CA    . ARG D 1 230 ? -11.934 58.244  64.312  1.00 68.36  ? 1230 ARG B CA    1 
ATOM   5224 C  C     . ARG D 1 230 ? -11.639 59.700  63.950  1.00 68.60  ? 1230 ARG B C     1 
ATOM   5225 O  O     . ARG D 1 230 ? -11.278 60.504  64.814  1.00 68.60  ? 1230 ARG B O     1 
ATOM   5226 C  CB    . ARG D 1 230 ? -10.703 57.608  64.963  1.00 68.33  ? 1230 ARG B CB    1 
ATOM   5227 C  CG    . ARG D 1 230 ? -10.966 56.286  65.660  1.00 68.52  ? 1230 ARG B CG    1 
ATOM   5228 C  CD    . ARG D 1 230 ? -9.831  55.945  66.619  1.00 69.48  ? 1230 ARG B CD    1 
ATOM   5229 N  NE    . ARG D 1 230 ? -10.133 54.794  67.471  1.00 69.60  ? 1230 ARG B NE    1 
ATOM   5230 C  CZ    . ARG D 1 230 ? -9.496  53.628  67.410  1.00 69.54  ? 1230 ARG B CZ    1 
ATOM   5231 N  NH1   . ARG D 1 230 ? -8.508  53.449  66.541  1.00 69.17  ? 1230 ARG B NH1   1 
ATOM   5232 N  NH2   . ARG D 1 230 ? -9.840  52.639  68.225  1.00 69.29  ? 1230 ARG B NH2   1 
ATOM   5233 N  N     . ASP D 1 231 ? -11.785 60.018  62.665  1.00 68.74  ? 1231 ASP B N     1 
ATOM   5234 C  CA    . ASP D 1 231 ? -11.643 61.379  62.152  1.00 69.07  ? 1231 ASP B CA    1 
ATOM   5235 C  C     . ASP D 1 231 ? -10.230 61.948  62.314  1.00 69.33  ? 1231 ASP B C     1 
ATOM   5236 O  O     . ASP D 1 231 ? -10.044 63.165  62.361  1.00 69.41  ? 1231 ASP B O     1 
ATOM   5237 C  CB    . ASP D 1 231 ? -12.682 62.306  62.792  1.00 69.03  ? 1231 ASP B CB    1 
ATOM   5238 C  CG    . ASP D 1 231 ? -13.178 63.375  61.837  1.00 69.28  ? 1231 ASP B CG    1 
ATOM   5239 O  OD1   . ASP D 1 231 ? -12.625 63.481  60.718  1.00 69.86  ? 1231 ASP B OD1   1 
ATOM   5240 O  OD2   . ASP D 1 231 ? -14.123 64.107  62.203  1.00 69.19  ? 1231 ASP B OD2   1 
ATOM   5241 N  N     . GLU D 1 232 ? -9.236  61.067  62.375  1.00 69.65  ? 1232 GLU B N     1 
ATOM   5242 C  CA    . GLU D 1 232 ? -7.853  61.484  62.590  1.00 69.97  ? 1232 GLU B CA    1 
ATOM   5243 C  C     . GLU D 1 232 ? -6.957  61.174  61.391  1.00 70.23  ? 1232 GLU B C     1 
ATOM   5244 O  O     . GLU D 1 232 ? -5.793  60.804  61.560  1.00 70.19  ? 1232 GLU B O     1 
ATOM   5245 C  CB    . GLU D 1 232 ? -7.290  60.809  63.841  1.00 69.88  ? 1232 GLU B CB    1 
ATOM   5246 C  CG    . GLU D 1 232 ? -8.068  61.113  65.107  1.00 70.17  ? 1232 GLU B CG    1 
ATOM   5247 C  CD    . GLU D 1 232 ? -7.545  60.352  66.309  1.00 70.24  ? 1232 GLU B CD    1 
ATOM   5248 O  OE1   . GLU D 1 232 ? -6.693  59.457  66.117  1.00 70.58  ? 1232 GLU B OE1   1 
ATOM   5249 O  OE2   . GLU D 1 232 ? -7.986  60.647  67.441  1.00 69.45  ? 1232 GLU B OE2   1 
ATOM   5250 N  N     . TYR D 1 233 ? -7.500  61.337  60.186  1.00 70.64  ? 1233 TYR B N     1 
ATOM   5251 C  CA    . TYR D 1 233 ? -6.779  61.005  58.956  1.00 70.97  ? 1233 TYR B CA    1 
ATOM   5252 C  C     . TYR D 1 233 ? -5.725  62.054  58.603  1.00 71.22  ? 1233 TYR B C     1 
ATOM   5253 O  O     . TYR D 1 233 ? -5.987  62.983  57.838  1.00 71.17  ? 1233 TYR B O     1 
ATOM   5254 C  CB    . TYR D 1 233 ? -7.766  60.807  57.800  1.00 70.91  ? 1233 TYR B CB    1 
ATOM   5255 C  CG    . TYR D 1 233 ? -7.122  60.494  56.461  1.00 71.11  ? 1233 TYR B CG    1 
ATOM   5256 C  CD1   . TYR D 1 233 ? -6.438  59.301  56.255  1.00 71.14  ? 1233 TYR B CD1   1 
ATOM   5257 C  CD2   . TYR D 1 233 ? -7.216  61.386  55.400  1.00 70.74  ? 1233 TYR B CD2   1 
ATOM   5258 C  CE1   . TYR D 1 233 ? -5.855  59.012  55.036  1.00 70.60  ? 1233 TYR B CE1   1 
ATOM   5259 C  CE2   . TYR D 1 233 ? -6.635  61.109  54.183  1.00 70.90  ? 1233 TYR B CE2   1 
ATOM   5260 C  CZ    . TYR D 1 233 ? -5.956  59.918  54.000  1.00 71.14  ? 1233 TYR B CZ    1 
ATOM   5261 O  OH    . TYR D 1 233 ? -5.376  59.639  52.773  1.00 71.46  ? 1233 TYR B OH    1 
ATOM   5262 N  N     . ASN D 1 234 ? -4.535  61.899  59.178  1.00 71.67  ? 1234 ASN B N     1 
ATOM   5263 C  CA    . ASN D 1 234 ? -3.412  62.793  58.908  1.00 72.10  ? 1234 ASN B CA    1 
ATOM   5264 C  C     . ASN D 1 234 ? -2.804  62.501  57.541  1.00 72.43  ? 1234 ASN B C     1 
ATOM   5265 O  O     . ASN D 1 234 ? -1.934  61.637  57.420  1.00 72.73  ? 1234 ASN B O     1 
ATOM   5266 C  CB    . ASN D 1 234 ? -2.330  62.648  59.990  1.00 72.08  ? 1234 ASN B CB    1 
ATOM   5267 C  CG    . ASN D 1 234 ? -2.622  63.475  61.241  1.00 72.34  ? 1234 ASN B CG    1 
ATOM   5268 O  OD1   . ASN D 1 234 ? -2.981  64.650  61.155  1.00 72.51  ? 1234 ASN B OD1   1 
ATOM   5269 N  ND2   . ASN D 1 234 ? -2.445  62.865  62.413  1.00 72.15  ? 1234 ASN B ND2   1 
ATOM   5270 N  N     . GLU D 1 235 ? -3.263  63.208  56.510  1.00 72.52  ? 1235 GLU B N     1 
ATOM   5271 C  CA    . GLU D 1 235 ? -2.704  63.039  55.172  1.00 72.60  ? 1235 GLU B CA    1 
ATOM   5272 C  C     . GLU D 1 235 ? -2.744  64.319  54.351  1.00 72.63  ? 1235 GLU B C     1 
ATOM   5273 O  O     . GLU D 1 235 ? -3.817  64.802  53.988  1.00 72.52  ? 1235 GLU B O     1 
ATOM   5274 C  CB    . GLU D 1 235 ? -3.405  61.907  54.423  1.00 72.73  ? 1235 GLU B CB    1 
ATOM   5275 C  CG    . GLU D 1 235 ? -2.957  60.516  54.842  1.00 73.03  ? 1235 GLU B CG    1 
ATOM   5276 C  CD    . GLU D 1 235 ? -1.476  60.291  54.623  1.00 73.39  ? 1235 GLU B CD    1 
ATOM   5277 O  OE1   . GLU D 1 235 ? -0.666  60.941  55.312  1.00 73.35  ? 1235 GLU B OE1   1 
ATOM   5278 O  OE2   . GLU D 1 235 ? -1.121  59.458  53.762  1.00 73.71  ? 1235 GLU B OE2   1 
ATOM   5279 N  N     . PRO D 1 236 ? -1.558  64.864  54.047  1.00 72.74  ? 1236 PRO B N     1 
ATOM   5280 C  CA    . PRO D 1 236 ? -1.393  66.121  53.336  1.00 72.81  ? 1236 PRO B CA    1 
ATOM   5281 C  C     . PRO D 1 236 ? -1.233  65.947  51.831  1.00 72.89  ? 1236 PRO B C     1 
ATOM   5282 O  O     . PRO D 1 236 ? -0.619  64.981  51.370  1.00 72.79  ? 1236 PRO B O     1 
ATOM   5283 C  CB    . PRO D 1 236 ? -0.089  66.663  53.917  1.00 72.80  ? 1236 PRO B CB    1 
ATOM   5284 C  CG    . PRO D 1 236 ? 0.717   65.423  54.230  1.00 72.81  ? 1236 PRO B CG    1 
ATOM   5285 C  CD    . PRO D 1 236 ? -0.257  64.271  54.407  1.00 72.79  ? 1236 PRO B CD    1 
ATOM   5286 N  N     . ILE D 1 237 ? -1.792  66.891  51.082  1.00 73.04  ? 1237 ILE B N     1 
ATOM   5287 C  CA    . ILE D 1 237 ? -1.520  67.019  49.662  1.00 73.25  ? 1237 ILE B CA    1 
ATOM   5288 C  C     . ILE D 1 237 ? -0.019  66.900  49.428  1.00 73.55  ? 1237 ILE B C     1 
ATOM   5289 O  O     . ILE D 1 237 ? 0.775   67.602  50.055  1.00 73.67  ? 1237 ILE B O     1 
ATOM   5290 C  CB    . ILE D 1 237 ? -1.986  68.392  49.137  1.00 73.13  ? 1237 ILE B CB    1 
ATOM   5291 C  CG1   . ILE D 1 237 ? -3.499  68.406  48.914  1.00 73.00  ? 1237 ILE B CG1   1 
ATOM   5292 C  CG2   . ILE D 1 237 ? -1.249  68.759  47.865  1.00 73.06  ? 1237 ILE B CG2   1 
ATOM   5293 C  CD1   . ILE D 1 237 ? -4.304  68.455  50.187  1.00 72.81  ? 1237 ILE B CD1   1 
ATOM   5294 N  N     . ARG D 1 238 ? 0.373   65.995  48.541  1.00 73.81  ? 1238 ARG B N     1 
ATOM   5295 C  CA    . ARG D 1 238 ? 1.784   65.799  48.246  1.00 74.18  ? 1238 ARG B CA    1 
ATOM   5296 C  C     . ARG D 1 238 ? 1.993   65.697  46.745  1.00 73.99  ? 1238 ARG B C     1 
ATOM   5297 O  O     . ARG D 1 238 ? 1.175   65.112  46.036  1.00 74.04  ? 1238 ARG B O     1 
ATOM   5298 C  CB    . ARG D 1 238 ? 2.318   64.556  48.968  1.00 74.45  ? 1238 ARG B CB    1 
ATOM   5299 C  CG    . ARG D 1 238 ? 1.315   63.418  49.063  1.00 75.86  ? 1238 ARG B CG    1 
ATOM   5300 C  CD    . ARG D 1 238 ? 1.376   62.505  47.842  1.00 79.01  ? 1238 ARG B CD    1 
ATOM   5301 N  NE    . ARG D 1 238 ? 1.833   61.156  48.174  1.00 81.09  ? 1238 ARG B NE    1 
ATOM   5302 C  CZ    . ARG D 1 238 ? 3.094   60.833  48.450  1.00 81.99  ? 1238 ARG B CZ    1 
ATOM   5303 N  NH1   . ARG D 1 238 ? 3.406   59.576  48.742  1.00 82.28  ? 1238 ARG B NH1   1 
ATOM   5304 N  NH2   . ARG D 1 238 ? 4.042   61.764  48.440  1.00 82.16  ? 1238 ARG B NH2   1 
ATOM   5305 N  N     . THR D 1 239 ? 3.079   66.288  46.258  1.00 73.81  ? 1239 THR B N     1 
ATOM   5306 C  CA    . THR D 1 239 ? 3.378   66.233  44.836  1.00 73.57  ? 1239 THR B CA    1 
ATOM   5307 C  C     . THR D 1 239 ? 3.635   64.783  44.458  1.00 73.50  ? 1239 THR B C     1 
ATOM   5308 O  O     . THR D 1 239 ? 4.692   64.234  44.766  1.00 73.65  ? 1239 THR B O     1 
ATOM   5309 C  CB    . THR D 1 239 ? 4.604   67.088  44.467  1.00 73.51  ? 1239 THR B CB    1 
ATOM   5310 O  OG1   . THR D 1 239 ? 4.616   68.277  45.265  1.00 73.62  ? 1239 THR B OG1   1 
ATOM   5311 C  CG2   . THR D 1 239 ? 4.565   67.473  42.996  1.00 72.89  ? 1239 THR B CG2   1 
ATOM   5312 N  N     . ARG D 1 240 ? 2.651   64.160  43.817  1.00 73.31  ? 1240 ARG B N     1 
ATOM   5313 C  CA    . ARG D 1 240 ? 2.804   62.790  43.346  1.00 73.14  ? 1240 ARG B CA    1 
ATOM   5314 C  C     . ARG D 1 240 ? 3.670   62.767  42.092  1.00 72.54  ? 1240 ARG B C     1 
ATOM   5315 O  O     . ARG D 1 240 ? 3.377   63.453  41.110  1.00 72.35  ? 1240 ARG B O     1 
ATOM   5316 C  CB    . ARG D 1 240 ? 1.441   62.140  43.077  1.00 73.42  ? 1240 ARG B CB    1 
ATOM   5317 C  CG    . ARG D 1 240 ? 0.541   62.109  44.298  1.00 74.90  ? 1240 ARG B CG    1 
ATOM   5318 C  CD    . ARG D 1 240 ? -0.098  60.746  44.514  1.00 77.09  ? 1240 ARG B CD    1 
ATOM   5319 N  NE    . ARG D 1 240 ? -0.153  60.440  45.944  1.00 79.08  ? 1240 ARG B NE    1 
ATOM   5320 C  CZ    . ARG D 1 240 ? -0.752  59.374  46.475  1.00 80.27  ? 1240 ARG B CZ    1 
ATOM   5321 N  NH1   . ARG D 1 240 ? -1.371  58.491  45.698  1.00 81.13  ? 1240 ARG B NH1   1 
ATOM   5322 N  NH2   . ARG D 1 240 ? -0.736  59.192  47.792  1.00 80.54  ? 1240 ARG B NH2   1 
ATOM   5323 N  N     . VAL D 1 241 ? 4.746   61.987  42.144  1.00 71.87  ? 1241 VAL B N     1 
ATOM   5324 C  CA    . VAL D 1 241 ? 5.661   61.853  41.015  1.00 71.11  ? 1241 VAL B CA    1 
ATOM   5325 C  C     . VAL D 1 241 ? 5.378   60.544  40.285  1.00 70.54  ? 1241 VAL B C     1 
ATOM   5326 O  O     . VAL D 1 241 ? 5.201   59.501  40.919  1.00 70.62  ? 1241 VAL B O     1 
ATOM   5327 C  CB    . VAL D 1 241 ? 7.140   61.868  41.480  1.00 71.09  ? 1241 VAL B CB    1 
ATOM   5328 C  CG1   . VAL D 1 241 ? 8.075   62.081  40.299  1.00 70.92  ? 1241 VAL B CG1   1 
ATOM   5329 C  CG2   . VAL D 1 241 ? 7.359   62.950  42.527  1.00 71.14  ? 1241 VAL B CG2   1 
ATOM   5330 N  N     . ARG D 1 242 ? 5.322   60.595  38.958  1.00 69.61  ? 1242 ARG B N     1 
ATOM   5331 C  CA    . ARG D 1 242 ? 5.150   59.375  38.181  1.00 68.89  ? 1242 ARG B CA    1 
ATOM   5332 C  C     . ARG D 1 242 ? 6.285   58.413  38.524  1.00 68.00  ? 1242 ARG B C     1 
ATOM   5333 O  O     . ARG D 1 242 ? 7.451   58.806  38.555  1.00 68.18  ? 1242 ARG B O     1 
ATOM   5334 C  CB    . ARG D 1 242 ? 5.109   59.682  36.686  1.00 69.10  ? 1242 ARG B CB    1 
ATOM   5335 C  CG    . ARG D 1 242 ? 5.249   58.466  35.784  1.00 70.37  ? 1242 ARG B CG    1 
ATOM   5336 C  CD    . ARG D 1 242 ? 4.032   57.558  35.834  1.00 72.27  ? 1242 ARG B CD    1 
ATOM   5337 N  NE    . ARG D 1 242 ? 2.947   58.002  34.963  1.00 73.86  ? 1242 ARG B NE    1 
ATOM   5338 C  CZ    . ARG D 1 242 ? 1.824   58.574  35.393  1.00 74.82  ? 1242 ARG B CZ    1 
ATOM   5339 N  NH1   . ARG D 1 242 ? 1.635   58.785  36.695  1.00 74.80  ? 1242 ARG B NH1   1 
ATOM   5340 N  NH2   . ARG D 1 242 ? 0.887   58.935  34.519  1.00 74.63  ? 1242 ARG B NH2   1 
ATOM   5341 N  N     . LYS D 1 243 ? 5.938   57.161  38.804  1.00 66.80  ? 1243 LYS B N     1 
ATOM   5342 C  CA    . LYS D 1 243 ? 6.896   56.191  39.330  1.00 65.64  ? 1243 LYS B CA    1 
ATOM   5343 C  C     . LYS D 1 243 ? 7.161   55.038  38.381  1.00 64.59  ? 1243 LYS B C     1 
ATOM   5344 O  O     . LYS D 1 243 ? 8.154   54.331  38.520  1.00 64.25  ? 1243 LYS B O     1 
ATOM   5345 C  CB    . LYS D 1 243 ? 6.414   55.638  40.672  1.00 65.63  ? 1243 LYS B CB    1 
ATOM   5346 C  CG    . LYS D 1 243 ? 6.775   56.507  41.865  1.00 66.55  ? 1243 LYS B CG    1 
ATOM   5347 C  CD    . LYS D 1 243 ? 6.211   55.927  43.155  1.00 68.11  ? 1243 LYS B CD    1 
ATOM   5348 C  CE    . LYS D 1 243 ? 6.818   56.599  44.376  1.00 68.76  ? 1243 LYS B CE    1 
ATOM   5349 N  NZ    . LYS D 1 243 ? 6.746   58.086  44.291  1.00 69.48  ? 1243 LYS B NZ    1 
ATOM   5350 N  N     . SER D 1 244 ? 6.261   54.838  37.428  1.00 63.67  ? 1244 SER B N     1 
ATOM   5351 C  CA    . SER D 1 244 ? 6.384   53.727  36.499  1.00 62.73  ? 1244 SER B CA    1 
ATOM   5352 C  C     . SER D 1 244 ? 5.628   53.995  35.217  1.00 62.27  ? 1244 SER B C     1 
ATOM   5353 O  O     . SER D 1 244 ? 4.492   54.466  35.233  1.00 62.10  ? 1244 SER B O     1 
ATOM   5354 C  CB    . SER D 1 244 ? 5.887   52.428  37.129  1.00 62.64  ? 1244 SER B CB    1 
ATOM   5355 O  OG    . SER D 1 244 ? 4.472   52.416  37.208  1.00 62.87  ? 1244 SER B OG    1 
ATOM   5356 N  N     . ILE D 1 245 ? 6.282   53.680  34.108  1.00 61.82  ? 1245 ILE B N     1 
ATOM   5357 C  CA    . ILE D 1 245 ? 5.701   53.787  32.787  1.00 61.24  ? 1245 ILE B CA    1 
ATOM   5358 C  C     . ILE D 1 245 ? 5.699   52.394  32.192  1.00 61.37  ? 1245 ILE B C     1 
ATOM   5359 O  O     . ILE D 1 245 ? 6.676   51.657  32.311  1.00 60.72  ? 1245 ILE B O     1 
ATOM   5360 C  CB    . ILE D 1 245 ? 6.537   54.705  31.874  1.00 61.21  ? 1245 ILE B CB    1 
ATOM   5361 C  CG1   . ILE D 1 245 ? 6.491   56.157  32.365  1.00 61.30  ? 1245 ILE B CG1   1 
ATOM   5362 C  CG2   . ILE D 1 245 ? 6.074   54.600  30.415  1.00 60.55  ? 1245 ILE B CG2   1 
ATOM   5363 C  CD1   . ILE D 1 245 ? 5.126   56.812  32.225  1.00 62.98  ? 1245 ILE B CD1   1 
ATOM   5364 N  N     . GLY D 1 246 ? 4.604   52.027  31.543  1.00 61.44  ? 1246 GLY B N     1 
ATOM   5365 C  CA    . GLY D 1 246 ? 4.539   50.721  30.942  1.00 62.13  ? 1246 GLY B CA    1 
ATOM   5366 C  C     . GLY D 1 246 ? 3.504   50.619  29.853  1.00 63.01  ? 1246 GLY B C     1 
ATOM   5367 O  O     . GLY D 1 246 ? 2.733   51.549  29.602  1.00 62.96  ? 1246 GLY B O     1 
ATOM   5368 N  N     . ARG D 1 247 ? 3.494   49.470  29.205  1.00 63.85  ? 1247 ARG B N     1 
ATOM   5369 C  CA    . ARG D 1 247 ? 2.535   49.200  28.182  1.00 65.34  ? 1247 ARG B CA    1 
ATOM   5370 C  C     . ARG D 1 247 ? 2.322   47.709  28.167  1.00 66.29  ? 1247 ARG B C     1 
ATOM   5371 O  O     . ARG D 1 247 ? 3.274   46.943  28.202  1.00 66.46  ? 1247 ARG B O     1 
ATOM   5372 C  CB    . ARG D 1 247 ? 3.049   49.688  26.831  1.00 65.33  ? 1247 ARG B CB    1 
ATOM   5373 C  CG    . ARG D 1 247 ? 2.248   49.189  25.653  1.00 66.27  ? 1247 ARG B CG    1 
ATOM   5374 C  CD    . ARG D 1 247 ? 0.905   49.881  25.519  1.00 68.18  ? 1247 ARG B CD    1 
ATOM   5375 N  NE    . ARG D 1 247 ? 0.390   49.655  24.176  1.00 70.82  ? 1247 ARG B NE    1 
ATOM   5376 C  CZ    . ARG D 1 247 ? -0.784  49.104  23.881  1.00 72.07  ? 1247 ARG B CZ    1 
ATOM   5377 N  NH1   . ARG D 1 247 ? -1.629  48.744  24.839  1.00 72.14  ? 1247 ARG B NH1   1 
ATOM   5378 N  NH2   . ARG D 1 247 ? -1.118  48.932  22.607  1.00 72.97  ? 1247 ARG B NH2   1 
ATOM   5379 N  N     . ILE D 1 248 ? 1.060   47.304  28.152  1.00 67.79  ? 1248 ILE B N     1 
ATOM   5380 C  CA    . ILE D 1 248 ? 0.705   45.912  27.995  1.00 68.91  ? 1248 ILE B CA    1 
ATOM   5381 C  C     . ILE D 1 248 ? 0.119   45.825  26.614  1.00 69.66  ? 1248 ILE B C     1 
ATOM   5382 O  O     . ILE D 1 248 ? -0.655  46.690  26.218  1.00 69.90  ? 1248 ILE B O     1 
ATOM   5383 C  CB    . ILE D 1 248 ? -0.354  45.486  29.021  1.00 69.06  ? 1248 ILE B CB    1 
ATOM   5384 C  CG1   . ILE D 1 248 ? -0.313  43.974  29.246  1.00 69.11  ? 1248 ILE B CG1   1 
ATOM   5385 C  CG2   . ILE D 1 248 ? -1.750  45.984  28.609  1.00 69.51  ? 1248 ILE B CG2   1 
ATOM   5386 C  CD1   . ILE D 1 248 ? 0.750   43.561  30.235  1.00 68.86  ? 1248 ILE B CD1   1 
ATOM   5387 N  N     . VAL D 1 249 ? 0.505   44.810  25.857  1.00 70.83  ? 1249 VAL B N     1 
ATOM   5388 C  CA    . VAL D 1 249 ? -0.050  44.644  24.528  1.00 71.94  ? 1249 VAL B CA    1 
ATOM   5389 C  C     . VAL D 1 249 ? -0.721  43.289  24.433  1.00 72.83  ? 1249 VAL B C     1 
ATOM   5390 O  O     . VAL D 1 249 ? -0.086  42.247  24.622  1.00 73.00  ? 1249 VAL B O     1 
ATOM   5391 C  CB    . VAL D 1 249 ? 1.009   44.787  23.413  1.00 71.93  ? 1249 VAL B CB    1 
ATOM   5392 C  CG1   . VAL D 1 249 ? 0.335   45.155  22.087  1.00 72.47  ? 1249 VAL B CG1   1 
ATOM   5393 C  CG2   . VAL D 1 249 ? 2.035   45.839  23.776  1.00 71.93  ? 1249 VAL B CG2   1 
ATOM   5394 N  N     . THR D 1 250 ? -2.019  43.311  24.157  1.00 73.97  ? 1250 THR B N     1 
ATOM   5395 C  CA    . THR D 1 250 ? -2.763  42.088  23.943  1.00 74.83  ? 1250 THR B CA    1 
ATOM   5396 C  C     . THR D 1 250 ? -2.239  41.423  22.687  1.00 75.39  ? 1250 THR B C     1 
ATOM   5397 O  O     . THR D 1 250 ? -2.202  42.031  21.620  1.00 75.70  ? 1250 THR B O     1 
ATOM   5398 C  CB    . THR D 1 250 ? -4.262  42.371  23.798  1.00 74.95  ? 1250 THR B CB    1 
ATOM   5399 O  OG1   . THR D 1 250 ? -4.753  42.943  25.017  1.00 75.29  ? 1250 THR B OG1   1 
ATOM   5400 C  CG2   . THR D 1 250 ? -5.028  41.089  23.494  1.00 74.94  ? 1250 THR B CG2   1 
ATOM   5401 N  N     . MET D 1 251 ? -1.803  40.179  22.820  1.00 76.08  ? 1251 MET B N     1 
ATOM   5402 C  CA    . MET D 1 251 ? -1.345  39.434  21.663  1.00 76.87  ? 1251 MET B CA    1 
ATOM   5403 C  C     . MET D 1 251 ? -2.530  38.930  20.851  1.00 77.50  ? 1251 MET B C     1 
ATOM   5404 O  O     . MET D 1 251 ? -3.593  38.637  21.404  1.00 77.51  ? 1251 MET B O     1 
ATOM   5405 C  CB    . MET D 1 251 ? -0.447  38.276  22.090  1.00 76.77  ? 1251 MET B CB    1 
ATOM   5406 C  CG    . MET D 1 251 ? 0.842   38.744  22.727  1.00 76.63  ? 1251 MET B CG    1 
ATOM   5407 S  SD    . MET D 1 251 ? 1.903   37.388  23.206  1.00 76.61  ? 1251 MET B SD    1 
ATOM   5408 C  CE    . MET D 1 251 ? 0.963   36.686  24.550  1.00 76.72  ? 1251 MET B CE    1 
ATOM   5409 N  N     . LYS D 1 252 ? -2.329  38.840  19.537  1.00 78.23  ? 1252 LYS B N     1 
ATOM   5410 C  CA    . LYS D 1 252 ? -3.349  38.390  18.598  1.00 78.87  ? 1252 LYS B CA    1 
ATOM   5411 C  C     . LYS D 1 252 ? -3.631  36.895  18.781  1.00 79.15  ? 1252 LYS B C     1 
ATOM   5412 O  O     . LYS D 1 252 ? -4.250  36.256  17.930  1.00 79.21  ? 1252 LYS B O     1 
ATOM   5413 C  CB    . LYS D 1 252 ? -2.880  38.675  17.165  1.00 79.04  ? 1252 LYS B CB    1 
ATOM   5414 C  CG    . LYS D 1 252 ? -3.989  38.944  16.148  1.00 79.62  ? 1252 LYS B CG    1 
ATOM   5415 C  CD    . LYS D 1 252 ? -4.749  40.229  16.458  1.00 80.29  ? 1252 LYS B CD    1 
ATOM   5416 C  CE    . LYS D 1 252 ? -5.413  40.791  15.203  1.00 80.44  ? 1252 LYS B CE    1 
ATOM   5417 N  NZ    . LYS D 1 252 ? -6.177  39.755  14.461  1.00 80.29  ? 1252 LYS B NZ    1 
ATOM   5418 N  N     . ARG D 1 253 ? -3.162  36.348  19.898  1.00 79.53  ? 1253 ARG B N     1 
ATOM   5419 C  CA    . ARG D 1 253 ? -3.394  34.954  20.259  1.00 79.89  ? 1253 ARG B CA    1 
ATOM   5420 C  C     . ARG D 1 253 ? -2.529  34.573  21.454  1.00 80.02  ? 1253 ARG B C     1 
ATOM   5421 O  O     . ARG D 1 253 ? -1.345  34.914  21.509  1.00 80.04  ? 1253 ARG B O     1 
ATOM   5422 C  CB    . ARG D 1 253 ? -3.096  34.020  19.083  1.00 79.99  ? 1253 ARG B CB    1 
ATOM   5423 C  CG    . ARG D 1 253 ? -1.649  34.049  18.604  1.00 80.43  ? 1253 ARG B CG    1 
ATOM   5424 C  CD    . ARG D 1 253 ? -1.489  33.276  17.305  1.00 81.07  ? 1253 ARG B CD    1 
ATOM   5425 N  NE    . ARG D 1 253 ? -1.774  31.853  17.469  1.00 81.47  ? 1253 ARG B NE    1 
ATOM   5426 C  CZ    . ARG D 1 253 ? -0.846  30.901  17.496  1.00 82.03  ? 1253 ARG B CZ    1 
ATOM   5427 N  NH1   . ARG D 1 253 ? 0.437   31.214  17.367  1.00 81.86  ? 1253 ARG B NH1   1 
ATOM   5428 N  NH2   . ARG D 1 253 ? -1.200  29.632  17.647  1.00 82.15  ? 1253 ARG B NH2   1 
ATOM   5429 N  N     . ASN D 1 254 ? -3.124  33.874  22.416  1.00 80.20  ? 1254 ASN B N     1 
ATOM   5430 C  CA    . ASN D 1 254 ? -2.361  33.336  23.532  1.00 80.26  ? 1254 ASN B CA    1 
ATOM   5431 C  C     . ASN D 1 254 ? -1.149  32.616  22.982  1.00 80.11  ? 1254 ASN B C     1 
ATOM   5432 O  O     . ASN D 1 254 ? -1.213  32.011  21.914  1.00 80.22  ? 1254 ASN B O     1 
ATOM   5433 C  CB    . ASN D 1 254 ? -3.208  32.372  24.367  1.00 80.36  ? 1254 ASN B CB    1 
ATOM   5434 C  CG    . ASN D 1 254 ? -4.420  33.046  24.987  1.00 80.83  ? 1254 ASN B CG    1 
ATOM   5435 O  OD1   . ASN D 1 254 ? -4.412  34.250  25.243  1.00 80.67  ? 1254 ASN B OD1   1 
ATOM   5436 N  ND2   . ASN D 1 254 ? -5.472  32.268  25.228  1.00 81.03  ? 1254 ASN B ND2   1 
ATOM   5437 N  N     . SER D 1 255 ? -0.037  32.692  23.697  1.00 79.94  ? 1255 SER B N     1 
ATOM   5438 C  CA    . SER D 1 255 ? 1.177   32.050  23.227  1.00 79.79  ? 1255 SER B CA    1 
ATOM   5439 C  C     . SER D 1 255 ? 2.180   31.870  24.350  1.00 79.51  ? 1255 SER B C     1 
ATOM   5440 O  O     . SER D 1 255 ? 2.284   32.705  25.247  1.00 79.59  ? 1255 SER B O     1 
ATOM   5441 C  CB    . SER D 1 255 ? 1.806   32.857  22.086  1.00 79.86  ? 1255 SER B CB    1 
ATOM   5442 O  OG    . SER D 1 255 ? 2.833   32.120  21.440  1.00 80.09  ? 1255 SER B OG    1 
ATOM   5443 N  N     . ARG D 1 256 ? 2.901   30.757  24.298  1.00 79.16  ? 1256 ARG B N     1 
ATOM   5444 C  CA    . ARG D 1 256 ? 4.059   30.544  25.147  1.00 78.79  ? 1256 ARG B CA    1 
ATOM   5445 C  C     . ARG D 1 256 ? 5.296   30.580  24.259  1.00 78.46  ? 1256 ARG B C     1 
ATOM   5446 O  O     . ARG D 1 256 ? 6.415   30.363  24.718  1.00 78.29  ? 1256 ARG B O     1 
ATOM   5447 C  CB    . ARG D 1 256 ? 3.951   29.208  25.879  1.00 78.88  ? 1256 ARG B CB    1 
ATOM   5448 C  CG    . ARG D 1 256 ? 2.837   29.171  26.907  1.00 79.04  ? 1256 ARG B CG    1 
ATOM   5449 C  CD    . ARG D 1 256 ? 2.725   27.803  27.542  1.00 80.00  ? 1256 ARG B CD    1 
ATOM   5450 N  NE    . ARG D 1 256 ? 4.016   27.317  28.024  1.00 80.67  ? 1256 ARG B NE    1 
ATOM   5451 C  CZ    . ARG D 1 256 ? 4.591   27.722  29.154  1.00 80.84  ? 1256 ARG B CZ    1 
ATOM   5452 N  NH1   . ARG D 1 256 ? 4.001   28.641  29.917  1.00 80.21  ? 1256 ARG B NH1   1 
ATOM   5453 N  NH2   . ARG D 1 256 ? 5.767   27.220  29.512  1.00 80.86  ? 1256 ARG B NH2   1 
ATOM   5454 N  N     . ASN D 1 257 ? 5.067   30.859  22.979  1.00 78.19  ? 1257 ASN B N     1 
ATOM   5455 C  CA    . ASN D 1 257 ? 6.132   30.976  21.995  1.00 78.09  ? 1257 ASN B CA    1 
ATOM   5456 C  C     . ASN D 1 257 ? 6.957   32.242  22.222  1.00 77.90  ? 1257 ASN B C     1 
ATOM   5457 O  O     . ASN D 1 257 ? 6.568   33.332  21.799  1.00 77.99  ? 1257 ASN B O     1 
ATOM   5458 C  CB    . ASN D 1 257 ? 5.537   30.970  20.583  1.00 78.17  ? 1257 ASN B CB    1 
ATOM   5459 C  CG    . ASN D 1 257 ? 6.593   30.855  19.498  1.00 78.36  ? 1257 ASN B CG    1 
ATOM   5460 O  OD1   . ASN D 1 257 ? 6.323   31.121  18.325  1.00 78.40  ? 1257 ASN B OD1   1 
ATOM   5461 N  ND2   . ASN D 1 257 ? 7.800   30.454  19.883  1.00 78.52  ? 1257 ASN B ND2   1 
ATOM   5462 N  N     . LEU D 1 258 ? 8.098   32.086  22.891  1.00 77.51  ? 1258 LEU B N     1 
ATOM   5463 C  CA    . LEU D 1 258 ? 8.965   33.212  23.246  1.00 77.06  ? 1258 LEU B CA    1 
ATOM   5464 C  C     . LEU D 1 258 ? 9.230   34.157  22.082  1.00 76.68  ? 1258 LEU B C     1 
ATOM   5465 O  O     . LEU D 1 258 ? 9.289   35.367  22.269  1.00 76.76  ? 1258 LEU B O     1 
ATOM   5466 C  CB    . LEU D 1 258 ? 10.297  32.709  23.806  1.00 77.16  ? 1258 LEU B CB    1 
ATOM   5467 C  CG    . LEU D 1 258 ? 11.345  33.757  24.196  1.00 77.24  ? 1258 LEU B CG    1 
ATOM   5468 C  CD1   . LEU D 1 258 ? 11.034  34.353  25.557  1.00 77.21  ? 1258 LEU B CD1   1 
ATOM   5469 C  CD2   . LEU D 1 258 ? 12.735  33.142  24.196  1.00 77.46  ? 1258 LEU B CD2   1 
ATOM   5470 N  N     . GLU D 1 259 ? 9.394   33.606  20.884  1.00 76.26  ? 1259 GLU B N     1 
ATOM   5471 C  CA    . GLU D 1 259 ? 9.721   34.419  19.716  1.00 75.76  ? 1259 GLU B CA    1 
ATOM   5472 C  C     . GLU D 1 259 ? 8.512   35.093  19.076  1.00 75.32  ? 1259 GLU B C     1 
ATOM   5473 O  O     . GLU D 1 259 ? 8.659   36.032  18.297  1.00 75.36  ? 1259 GLU B O     1 
ATOM   5474 C  CB    . GLU D 1 259 ? 10.493  33.606  18.675  1.00 75.72  ? 1259 GLU B CB    1 
ATOM   5475 C  CG    . GLU D 1 259 ? 11.980  33.943  18.616  1.00 75.87  ? 1259 GLU B CG    1 
ATOM   5476 C  CD    . GLU D 1 259 ? 12.258  35.290  17.953  1.00 76.02  ? 1259 GLU B CD    1 
ATOM   5477 O  OE1   . GLU D 1 259 ? 11.534  36.269  18.245  1.00 76.37  ? 1259 GLU B OE1   1 
ATOM   5478 O  OE2   . GLU D 1 259 ? 13.203  35.369  17.138  1.00 75.40  ? 1259 GLU B OE2   1 
ATOM   5479 N  N     . GLU D 1 260 ? 7.323   34.608  19.406  1.00 74.77  ? 1260 GLU B N     1 
ATOM   5480 C  CA    . GLU D 1 260 ? 6.095   35.176  18.870  1.00 74.30  ? 1260 GLU B CA    1 
ATOM   5481 C  C     . GLU D 1 260 ? 5.562   36.237  19.824  1.00 73.69  ? 1260 GLU B C     1 
ATOM   5482 O  O     . GLU D 1 260 ? 4.837   37.151  19.424  1.00 73.71  ? 1260 GLU B O     1 
ATOM   5483 C  CB    . GLU D 1 260 ? 5.057   34.079  18.686  1.00 74.49  ? 1260 GLU B CB    1 
ATOM   5484 C  CG    . GLU D 1 260 ? 4.094   34.315  17.548  1.00 75.01  ? 1260 GLU B CG    1 
ATOM   5485 C  CD    . GLU D 1 260 ? 3.001   33.278  17.526  1.00 75.81  ? 1260 GLU B CD    1 
ATOM   5486 O  OE1   . GLU D 1 260 ? 2.169   33.284  18.461  1.00 76.08  ? 1260 GLU B OE1   1 
ATOM   5487 O  OE2   . GLU D 1 260 ? 2.980   32.454  16.584  1.00 75.68  ? 1260 GLU B OE2   1 
ATOM   5488 N  N     . ILE D 1 261 ? 5.934   36.096  21.093  1.00 72.86  ? 1261 ILE B N     1 
ATOM   5489 C  CA    . ILE D 1 261 ? 5.584   37.055  22.127  1.00 71.98  ? 1261 ILE B CA    1 
ATOM   5490 C  C     . ILE D 1 261 ? 6.518   38.250  22.053  1.00 71.41  ? 1261 ILE B C     1 
ATOM   5491 O  O     . ILE D 1 261 ? 6.110   39.382  22.312  1.00 71.52  ? 1261 ILE B O     1 
ATOM   5492 C  CB    . ILE D 1 261 ? 5.722   36.433  23.521  1.00 72.05  ? 1261 ILE B CB    1 
ATOM   5493 C  CG1   . ILE D 1 261 ? 4.816   35.205  23.656  1.00 72.33  ? 1261 ILE B CG1   1 
ATOM   5494 C  CG2   . ILE D 1 261 ? 5.403   37.456  24.586  1.00 71.85  ? 1261 ILE B CG2   1 
ATOM   5495 C  CD1   . ILE D 1 261 ? 5.114   34.357  24.880  1.00 72.65  ? 1261 ILE B CD1   1 
ATOM   5496 N  N     . LYS D 1 262 ? 7.774   37.985  21.695  1.00 70.44  ? 1262 LYS B N     1 
ATOM   5497 C  CA    . LYS D 1 262 ? 8.814   39.015  21.638  1.00 69.49  ? 1262 LYS B CA    1 
ATOM   5498 C  C     . LYS D 1 262 ? 8.434   40.265  20.838  1.00 68.79  ? 1262 LYS B C     1 
ATOM   5499 O  O     . LYS D 1 262 ? 8.606   41.378  21.331  1.00 68.76  ? 1262 LYS B O     1 
ATOM   5500 C  CB    . LYS D 1 262 ? 10.146  38.432  21.137  1.00 69.48  ? 1262 LYS B CB    1 
ATOM   5501 C  CG    . LYS D 1 262 ? 11.038  37.871  22.243  1.00 69.21  ? 1262 LYS B CG    1 
ATOM   5502 C  CD    . LYS D 1 262 ? 12.124  36.943  21.699  1.00 68.36  ? 1262 LYS B CD    1 
ATOM   5503 C  CE    . LYS D 1 262 ? 13.125  37.678  20.823  1.00 67.93  ? 1262 LYS B CE    1 
ATOM   5504 N  NZ    . LYS D 1 262 ? 14.268  36.798  20.446  1.00 67.45  ? 1262 LYS B NZ    1 
ATOM   5505 N  N     . PRO D 1 263 ? 7.917   40.095  19.608  1.00 68.15  ? 1263 PRO B N     1 
ATOM   5506 C  CA    . PRO D 1 263 ? 7.567   41.286  18.832  1.00 67.60  ? 1263 PRO B CA    1 
ATOM   5507 C  C     . PRO D 1 263 ? 6.556   42.165  19.559  1.00 67.01  ? 1263 PRO B C     1 
ATOM   5508 O  O     . PRO D 1 263 ? 6.556   43.383  19.390  1.00 66.95  ? 1263 PRO B O     1 
ATOM   5509 C  CB    . PRO D 1 263 ? 6.959   40.709  17.547  1.00 67.61  ? 1263 PRO B CB    1 
ATOM   5510 C  CG    . PRO D 1 263 ? 6.614   39.301  17.872  1.00 67.84  ? 1263 PRO B CG    1 
ATOM   5511 C  CD    . PRO D 1 263 ? 7.632   38.859  18.863  1.00 68.02  ? 1263 PRO B CD    1 
ATOM   5512 N  N     . TYR D 1 264 ? 5.707   41.545  20.371  1.00 66.37  ? 1264 TYR B N     1 
ATOM   5513 C  CA    . TYR D 1 264 ? 4.728   42.276  21.157  1.00 65.55  ? 1264 TYR B CA    1 
ATOM   5514 C  C     . TYR D 1 264 ? 5.391   42.906  22.373  1.00 64.72  ? 1264 TYR B C     1 
ATOM   5515 O  O     . TYR D 1 264 ? 5.099   44.049  22.728  1.00 64.88  ? 1264 TYR B O     1 
ATOM   5516 C  CB    . TYR D 1 264 ? 3.607   41.340  21.606  1.00 65.92  ? 1264 TYR B CB    1 
ATOM   5517 C  CG    . TYR D 1 264 ? 2.691   40.877  20.504  1.00 66.66  ? 1264 TYR B CG    1 
ATOM   5518 C  CD1   . TYR D 1 264 ? 1.704   41.716  19.997  1.00 68.03  ? 1264 TYR B CD1   1 
ATOM   5519 C  CD2   . TYR D 1 264 ? 2.798   39.595  19.982  1.00 68.02  ? 1264 TYR B CD2   1 
ATOM   5520 C  CE1   . TYR D 1 264 ? 0.855   41.295  18.990  1.00 68.47  ? 1264 TYR B CE1   1 
ATOM   5521 C  CE2   . TYR D 1 264 ? 1.954   39.161  18.978  1.00 68.75  ? 1264 TYR B CE2   1 
ATOM   5522 C  CZ    . TYR D 1 264 ? 0.983   40.016  18.488  1.00 68.90  ? 1264 TYR B CZ    1 
ATOM   5523 O  OH    . TYR D 1 264 ? 0.138   39.589  17.490  1.00 70.40  ? 1264 TYR B OH    1 
ATOM   5524 N  N     . LEU D 1 265 ? 6.267   42.143  23.017  1.00 63.52  ? 1265 LEU B N     1 
ATOM   5525 C  CA    . LEU D 1 265 ? 7.051   42.624  24.149  1.00 62.88  ? 1265 LEU B CA    1 
ATOM   5526 C  C     . LEU D 1 265 ? 7.876   43.854  23.753  1.00 62.49  ? 1265 LEU B C     1 
ATOM   5527 O  O     . LEU D 1 265 ? 8.010   44.806  24.521  1.00 61.89  ? 1265 LEU B O     1 
ATOM   5528 C  CB    . LEU D 1 265 ? 7.980   41.509  24.644  1.00 62.78  ? 1265 LEU B CB    1 
ATOM   5529 C  CG    . LEU D 1 265 ? 8.930   41.797  25.807  1.00 62.40  ? 1265 LEU B CG    1 
ATOM   5530 C  CD1   . LEU D 1 265 ? 8.164   42.124  27.084  1.00 61.58  ? 1265 LEU B CD1   1 
ATOM   5531 C  CD2   . LEU D 1 265 ? 9.869   40.621  26.025  1.00 62.18  ? 1265 LEU B CD2   1 
ATOM   5532 N  N     . PHE D 1 266 ? 8.422   43.812  22.539  1.00 62.30  ? 1266 PHE B N     1 
ATOM   5533 C  CA    . PHE D 1 266 ? 9.255   44.885  22.010  1.00 62.06  ? 1266 PHE B CA    1 
ATOM   5534 C  C     . PHE D 1 266 ? 8.422   46.116  21.681  1.00 61.85  ? 1266 PHE B C     1 
ATOM   5535 O  O     . PHE D 1 266 ? 8.860   47.245  21.890  1.00 61.64  ? 1266 PHE B O     1 
ATOM   5536 C  CB    . PHE D 1 266 ? 9.999   44.412  20.763  1.00 62.11  ? 1266 PHE B CB    1 
ATOM   5537 C  CG    . PHE D 1 266 ? 10.948  43.281  21.018  1.00 62.25  ? 1266 PHE B CG    1 
ATOM   5538 C  CD1   . PHE D 1 266 ? 11.493  43.085  22.283  1.00 62.59  ? 1266 PHE B CD1   1 
ATOM   5539 C  CD2   . PHE D 1 266 ? 11.319  42.427  19.991  1.00 63.05  ? 1266 PHE B CD2   1 
ATOM   5540 C  CE1   . PHE D 1 266 ? 12.385  42.043  22.523  1.00 63.01  ? 1266 PHE B CE1   1 
ATOM   5541 C  CE2   . PHE D 1 266 ? 12.214  41.381  20.222  1.00 63.35  ? 1266 PHE B CE2   1 
ATOM   5542 C  CZ    . PHE D 1 266 ? 12.747  41.192  21.492  1.00 62.93  ? 1266 PHE B CZ    1 
ATOM   5543 N  N     . ARG D 1 267 ? 7.219   45.886  21.165  1.00 61.66  ? 1267 ARG B N     1 
ATOM   5544 C  CA    . ARG D 1 267 ? 6.279   46.965  20.907  1.00 61.45  ? 1267 ARG B CA    1 
ATOM   5545 C  C     . ARG D 1 267 ? 5.926   47.641  22.223  1.00 60.70  ? 1267 ARG B C     1 
ATOM   5546 O  O     . ARG D 1 267 ? 5.881   48.859  22.305  1.00 60.75  ? 1267 ARG B O     1 
ATOM   5547 C  CB    . ARG D 1 267 ? 5.024   46.429  20.216  1.00 61.86  ? 1267 ARG B CB    1 
ATOM   5548 C  CG    . ARG D 1 267 ? 4.277   47.455  19.370  1.00 63.48  ? 1267 ARG B CG    1 
ATOM   5549 C  CD    . ARG D 1 267 ? 3.195   46.779  18.511  1.00 67.24  ? 1267 ARG B CD    1 
ATOM   5550 N  NE    . ARG D 1 267 ? 3.742   45.898  17.468  1.00 68.74  ? 1267 ARG B NE    1 
ATOM   5551 C  CZ    . ARG D 1 267 ? 3.003   45.290  16.534  1.00 70.64  ? 1267 ARG B CZ    1 
ATOM   5552 N  NH1   . ARG D 1 267 ? 1.682   45.463  16.504  1.00 71.46  ? 1267 ARG B NH1   1 
ATOM   5553 N  NH2   . ARG D 1 267 ? 3.580   44.513  15.621  1.00 70.03  ? 1267 ARG B NH2   1 
ATOM   5554 N  N     . ALA D 1 268 ? 5.695   46.846  23.261  1.00 60.19  ? 1268 ALA B N     1 
ATOM   5555 C  CA    . ALA D 1 268 ? 5.443   47.392  24.595  1.00 59.57  ? 1268 ALA B CA    1 
ATOM   5556 C  C     . ALA D 1 268 ? 6.639   48.197  25.088  1.00 59.26  ? 1268 ALA B C     1 
ATOM   5557 O  O     . ALA D 1 268 ? 6.473   49.267  25.668  1.00 59.23  ? 1268 ALA B O     1 
ATOM   5558 C  CB    . ALA D 1 268 ? 5.110   46.282  25.574  1.00 59.36  ? 1268 ALA B CB    1 
ATOM   5559 N  N     . ILE D 1 269 ? 7.844   47.678  24.861  1.00 58.82  ? 1269 ILE B N     1 
ATOM   5560 C  CA    . ILE D 1 269 ? 9.058   48.397  25.219  1.00 58.60  ? 1269 ILE B CA    1 
ATOM   5561 C  C     . ILE D 1 269 ? 9.157   49.673  24.398  1.00 58.53  ? 1269 ILE B C     1 
ATOM   5562 O  O     . ILE D 1 269 ? 9.434   50.743  24.936  1.00 58.36  ? 1269 ILE B O     1 
ATOM   5563 C  CB    . ILE D 1 269 ? 10.336  47.543  25.011  1.00 58.66  ? 1269 ILE B CB    1 
ATOM   5564 C  CG1   . ILE D 1 269 ? 10.316  46.309  25.906  1.00 58.28  ? 1269 ILE B CG1   1 
ATOM   5565 C  CG2   . ILE D 1 269 ? 11.580  48.339  25.358  1.00 58.50  ? 1269 ILE B CG2   1 
ATOM   5566 C  CD1   . ILE D 1 269 ? 11.371  45.320  25.548  1.00 58.15  ? 1269 ILE B CD1   1 
ATOM   5567 N  N     . GLU D 1 270 ? 8.912   49.554  23.095  1.00 58.66  ? 1270 GLU B N     1 
ATOM   5568 C  CA    . GLU D 1 270 ? 8.936   50.708  22.191  1.00 58.74  ? 1270 GLU B CA    1 
ATOM   5569 C  C     . GLU D 1 270 ? 7.999   51.820  22.647  1.00 58.29  ? 1270 GLU B C     1 
ATOM   5570 O  O     . GLU D 1 270 ? 8.379   52.980  22.694  1.00 58.86  ? 1270 GLU B O     1 
ATOM   5571 C  CB    . GLU D 1 270 ? 8.596   50.291  20.762  1.00 58.51  ? 1270 GLU B CB    1 
ATOM   5572 C  CG    . GLU D 1 270 ? 9.748   49.661  20.023  1.00 60.41  ? 1270 GLU B CG    1 
ATOM   5573 C  CD    . GLU D 1 270 ? 10.872  50.649  19.737  1.00 62.32  ? 1270 GLU B CD    1 
ATOM   5574 O  OE1   . GLU D 1 270 ? 10.567  51.786  19.308  1.00 64.22  ? 1270 GLU B OE1   1 
ATOM   5575 O  OE2   . GLU D 1 270 ? 12.053  50.287  19.932  1.00 62.06  ? 1270 GLU B OE2   1 
ATOM   5576 N  N     . GLU D 1 271 ? 6.773   51.466  22.984  1.00 57.90  ? 1271 GLU B N     1 
ATOM   5577 C  CA    . GLU D 1 271 ? 5.823   52.458  23.447  1.00 57.92  ? 1271 GLU B CA    1 
ATOM   5578 C  C     . GLU D 1 271 ? 6.170   52.928  24.849  1.00 57.28  ? 1271 GLU B C     1 
ATOM   5579 O  O     . GLU D 1 271 ? 5.973   54.082  25.177  1.00 57.76  ? 1271 GLU B O     1 
ATOM   5580 C  CB    . GLU D 1 271 ? 4.408   51.892  23.402  1.00 57.95  ? 1271 GLU B CB    1 
ATOM   5581 C  CG    . GLU D 1 271 ? 4.217   50.965  22.224  1.00 60.48  ? 1271 GLU B CG    1 
ATOM   5582 C  CD    . GLU D 1 271 ? 2.763   50.742  21.855  1.00 63.61  ? 1271 GLU B CD    1 
ATOM   5583 O  OE1   . GLU D 1 271 ? 1.886   50.901  22.745  1.00 63.19  ? 1271 GLU B OE1   1 
ATOM   5584 O  OE2   . GLU D 1 271 ? 2.518   50.409  20.664  1.00 64.71  ? 1271 GLU B OE2   1 
ATOM   5585 N  N     . SER D 1 272 ? 6.690   52.041  25.685  1.00 56.98  ? 1272 SER B N     1 
ATOM   5586 C  CA    . SER D 1 272 ? 7.105   52.450  27.025  1.00 56.08  ? 1272 SER B CA    1 
ATOM   5587 C  C     . SER D 1 272 ? 8.225   53.456  26.944  1.00 56.05  ? 1272 SER B C     1 
ATOM   5588 O  O     . SER D 1 272 ? 8.252   54.409  27.709  1.00 55.96  ? 1272 SER B O     1 
ATOM   5589 C  CB    . SER D 1 272 ? 7.536   51.255  27.857  1.00 56.12  ? 1272 SER B CB    1 
ATOM   5590 O  OG    . SER D 1 272 ? 6.432   50.423  28.126  1.00 53.71  ? 1272 SER B OG    1 
ATOM   5591 N  N     . TYR D 1 273 ? 9.139   53.255  26.000  1.00 56.15  ? 1273 TYR B N     1 
ATOM   5592 C  CA    . TYR D 1 273 ? 10.253  54.165  25.831  1.00 56.38  ? 1273 TYR B CA    1 
ATOM   5593 C  C     . TYR D 1 273 ? 9.858   55.481  25.202  1.00 57.12  ? 1273 TYR B C     1 
ATOM   5594 O  O     . TYR D 1 273 ? 10.456  56.522  25.498  1.00 56.72  ? 1273 TYR B O     1 
ATOM   5595 C  CB    . TYR D 1 273 ? 11.391  53.510  25.061  1.00 56.22  ? 1273 TYR B CB    1 
ATOM   5596 C  CG    . TYR D 1 273 ? 12.382  52.905  26.005  1.00 55.52  ? 1273 TYR B CG    1 
ATOM   5597 C  CD1   . TYR D 1 273 ? 13.492  53.619  26.428  1.00 54.46  ? 1273 TYR B CD1   1 
ATOM   5598 C  CD2   . TYR D 1 273 ? 12.182  51.639  26.521  1.00 54.54  ? 1273 TYR B CD2   1 
ATOM   5599 C  CE1   . TYR D 1 273 ? 14.388  53.066  27.318  1.00 54.51  ? 1273 TYR B CE1   1 
ATOM   5600 C  CE2   . TYR D 1 273 ? 13.072  51.086  27.400  1.00 54.41  ? 1273 TYR B CE2   1 
ATOM   5601 C  CZ    . TYR D 1 273 ? 14.166  51.800  27.803  1.00 53.46  ? 1273 TYR B CZ    1 
ATOM   5602 O  OH    . TYR D 1 273 ? 15.038  51.234  28.690  1.00 53.29  ? 1273 TYR B OH    1 
ATOM   5603 N  N     . TYR D 1 274 ? 8.850   55.437  24.337  1.00 57.88  ? 1274 TYR B N     1 
ATOM   5604 C  CA    . TYR D 1 274 ? 8.231   56.663  23.858  1.00 58.90  ? 1274 TYR B CA    1 
ATOM   5605 C  C     . TYR D 1 274 ? 7.589   57.391  25.033  1.00 59.01  ? 1274 TYR B C     1 
ATOM   5606 O  O     . TYR D 1 274 ? 7.710   58.604  25.181  1.00 59.14  ? 1274 TYR B O     1 
ATOM   5607 C  CB    . TYR D 1 274 ? 7.175   56.369  22.791  1.00 59.01  ? 1274 TYR B CB    1 
ATOM   5608 C  CG    . TYR D 1 274 ? 6.547   57.621  22.224  1.00 59.80  ? 1274 TYR B CG    1 
ATOM   5609 C  CD1   . TYR D 1 274 ? 7.168   58.325  21.197  1.00 60.79  ? 1274 TYR B CD1   1 
ATOM   5610 C  CD2   . TYR D 1 274 ? 5.341   58.108  22.727  1.00 60.59  ? 1274 TYR B CD2   1 
ATOM   5611 C  CE1   . TYR D 1 274 ? 6.597   59.482  20.679  1.00 62.18  ? 1274 TYR B CE1   1 
ATOM   5612 C  CE2   . TYR D 1 274 ? 4.765   59.262  22.223  1.00 61.07  ? 1274 TYR B CE2   1 
ATOM   5613 C  CZ    . TYR D 1 274 ? 5.394   59.946  21.201  1.00 62.77  ? 1274 TYR B CZ    1 
ATOM   5614 O  OH    . TYR D 1 274 ? 4.825   61.098  20.689  1.00 64.71  ? 1274 TYR B OH    1 
ATOM   5615 N  N     . LYS D 1 275 ? 6.904   56.633  25.872  1.00 59.74  ? 1275 LYS B N     1 
ATOM   5616 C  CA    . LYS D 1 275 ? 6.207   57.206  27.012  1.00 60.60  ? 1275 LYS B CA    1 
ATOM   5617 C  C     . LYS D 1 275 ? 7.189   57.784  28.033  1.00 60.65  ? 1275 LYS B C     1 
ATOM   5618 O  O     . LYS D 1 275 ? 7.007   58.902  28.500  1.00 60.95  ? 1275 LYS B O     1 
ATOM   5619 C  CB    . LYS D 1 275 ? 5.272   56.177  27.643  1.00 60.56  ? 1275 LYS B CB    1 
ATOM   5620 C  CG    . LYS D 1 275 ? 3.797   56.302  27.216  1.00 63.02  ? 1275 LYS B CG    1 
ATOM   5621 C  CD    . LYS D 1 275 ? 3.442   55.566  25.910  1.00 64.90  ? 1275 LYS B CD    1 
ATOM   5622 C  CE    . LYS D 1 275 ? 1.928   55.679  25.611  1.00 66.89  ? 1275 LYS B CE    1 
ATOM   5623 N  NZ    . LYS D 1 275 ? 1.350   54.495  24.849  1.00 67.33  ? 1275 LYS B NZ    1 
ATOM   5624 N  N     . LEU D 1 276 ? 8.236   57.027  28.357  1.00 60.87  ? 1276 LEU B N     1 
ATOM   5625 C  CA    . LEU D 1 276 ? 9.278   57.492  29.276  1.00 60.96  ? 1276 LEU B CA    1 
ATOM   5626 C  C     . LEU D 1 276 ? 9.807   58.844  28.865  1.00 61.40  ? 1276 LEU B C     1 
ATOM   5627 O  O     . LEU D 1 276 ? 9.857   59.764  29.669  1.00 61.78  ? 1276 LEU B O     1 
ATOM   5628 C  CB    . LEU D 1 276 ? 10.432  56.493  29.346  1.00 60.50  ? 1276 LEU B CB    1 
ATOM   5629 C  CG    . LEU D 1 276 ? 10.064  55.199  30.063  1.00 59.36  ? 1276 LEU B CG    1 
ATOM   5630 C  CD1   . LEU D 1 276 ? 10.963  54.059  29.615  1.00 58.45  ? 1276 LEU B CD1   1 
ATOM   5631 C  CD2   . LEU D 1 276 ? 10.110  55.394  31.564  1.00 58.28  ? 1276 LEU B CD2   1 
ATOM   5632 N  N     . ASP D 1 277 ? 10.205  58.954  27.607  1.00 62.22  ? 1277 ASP B N     1 
ATOM   5633 C  CA    . ASP D 1 277 ? 10.660  60.218  27.053  1.00 62.82  ? 1277 ASP B CA    1 
ATOM   5634 C  C     . ASP D 1 277 ? 11.590  60.965  27.999  1.00 62.83  ? 1277 ASP B C     1 
ATOM   5635 O  O     . ASP D 1 277 ? 11.140  61.769  28.820  1.00 63.56  ? 1277 ASP B O     1 
ATOM   5636 C  CB    . ASP D 1 277 ? 9.460   61.097  26.737  1.00 63.11  ? 1277 ASP B CB    1 
ATOM   5637 C  CG    . ASP D 1 277 ? 9.852   62.523  26.444  1.00 64.75  ? 1277 ASP B CG    1 
ATOM   5638 O  OD1   . ASP D 1 277 ? 9.289   63.428  27.101  1.00 66.51  ? 1277 ASP B OD1   1 
ATOM   5639 O  OD2   . ASP D 1 277 ? 10.740  62.737  25.582  1.00 66.48  ? 1277 ASP B OD2   1 
ATOM   5640 N  N     . LYS D 1 278 ? 12.886  60.715  27.879  1.00 62.42  ? 1278 LYS B N     1 
ATOM   5641 C  CA    . LYS D 1 278 ? 13.883  61.412  28.694  1.00 62.02  ? 1278 LYS B CA    1 
ATOM   5642 C  C     . LYS D 1 278 ? 14.052  60.742  30.046  1.00 61.34  ? 1278 LYS B C     1 
ATOM   5643 O  O     . LYS D 1 278 ? 15.168  60.619  30.541  1.00 61.36  ? 1278 LYS B O     1 
ATOM   5644 C  CB    . LYS D 1 278 ? 13.539  62.897  28.896  1.00 62.26  ? 1278 LYS B CB    1 
ATOM   5645 C  CG    . LYS D 1 278 ? 13.067  63.657  27.647  1.00 63.68  ? 1278 LYS B CG    1 
ATOM   5646 C  CD    . LYS D 1 278 ? 14.075  63.662  26.494  1.00 64.85  ? 1278 LYS B CD    1 
ATOM   5647 C  CE    . LYS D 1 278 ? 13.489  64.412  25.291  1.00 65.67  ? 1278 LYS B CE    1 
ATOM   5648 N  NZ    . LYS D 1 278 ? 14.262  64.235  24.019  1.00 65.73  ? 1278 LYS B NZ    1 
ATOM   5649 N  N     . ARG D 1 279 ? 12.942  60.327  30.651  1.00 60.62  ? 1279 ARG B N     1 
ATOM   5650 C  CA    . ARG D 1 279 ? 13.002  59.563  31.889  1.00 59.65  ? 1279 ARG B CA    1 
ATOM   5651 C  C     . ARG D 1 279 ? 13.766  58.272  31.660  1.00 58.68  ? 1279 ARG B C     1 
ATOM   5652 O  O     . ARG D 1 279 ? 13.452  57.522  30.748  1.00 58.59  ? 1279 ARG B O     1 
ATOM   5653 C  CB    . ARG D 1 279 ? 11.603  59.256  32.410  1.00 59.86  ? 1279 ARG B CB    1 
ATOM   5654 C  CG    . ARG D 1 279 ? 11.181  60.135  33.572  1.00 61.27  ? 1279 ARG B CG    1 
ATOM   5655 C  CD    . ARG D 1 279 ? 9.683   60.153  33.661  1.00 64.63  ? 1279 ARG B CD    1 
ATOM   5656 N  NE    . ARG D 1 279 ? 9.145   60.410  32.334  1.00 66.70  ? 1279 ARG B NE    1 
ATOM   5657 C  CZ    . ARG D 1 279 ? 7.891   60.187  31.975  1.00 68.42  ? 1279 ARG B CZ    1 
ATOM   5658 N  NH1   . ARG D 1 279 ? 7.027   59.688  32.852  1.00 69.24  ? 1279 ARG B NH1   1 
ATOM   5659 N  NH2   . ARG D 1 279 ? 7.510   60.453  30.730  1.00 68.91  ? 1279 ARG B NH2   1 
ATOM   5660 N  N     . ILE D 1 280 ? 14.784  58.030  32.481  1.00 57.51  ? 1280 ILE B N     1 
ATOM   5661 C  CA    . ILE D 1 280 ? 15.584  56.820  32.359  1.00 56.15  ? 1280 ILE B CA    1 
ATOM   5662 C  C     . ILE D 1 280 ? 15.278  55.853  33.503  1.00 55.22  ? 1280 ILE B C     1 
ATOM   5663 O  O     . ILE D 1 280 ? 15.569  56.145  34.666  1.00 54.69  ? 1280 ILE B O     1 
ATOM   5664 C  CB    . ILE D 1 280 ? 17.097  57.132  32.349  1.00 56.21  ? 1280 ILE B CB    1 
ATOM   5665 C  CG1   . ILE D 1 280 ? 17.423  58.214  31.320  1.00 55.97  ? 1280 ILE B CG1   1 
ATOM   5666 C  CG2   . ILE D 1 280 ? 17.902  55.869  32.085  1.00 55.93  ? 1280 ILE B CG2   1 
ATOM   5667 C  CD1   . ILE D 1 280 ? 17.162  57.802  29.900  1.00 57.10  ? 1280 ILE B CD1   1 
ATOM   5668 N  N     . PRO D 1 281 ? 14.706  54.684  33.170  1.00 54.19  ? 1281 PRO B N     1 
ATOM   5669 C  CA    . PRO D 1 281 ? 14.351  53.719  34.198  1.00 53.52  ? 1281 PRO B CA    1 
ATOM   5670 C  C     . PRO D 1 281 ? 15.547  52.871  34.626  1.00 52.71  ? 1281 PRO B C     1 
ATOM   5671 O  O     . PRO D 1 281 ? 16.423  52.583  33.819  1.00 52.15  ? 1281 PRO B O     1 
ATOM   5672 C  CB    . PRO D 1 281 ? 13.302  52.853  33.502  1.00 53.45  ? 1281 PRO B CB    1 
ATOM   5673 C  CG    . PRO D 1 281 ? 13.707  52.865  32.075  1.00 53.89  ? 1281 PRO B CG    1 
ATOM   5674 C  CD    . PRO D 1 281 ? 14.375  54.201  31.818  1.00 54.07  ? 1281 PRO B CD    1 
ATOM   5675 N  N     . LYS D 1 282 ? 15.580  52.473  35.893  1.00 52.22  ? 1282 LYS B N     1 
ATOM   5676 C  CA    . LYS D 1 282 ? 16.613  51.553  36.350  1.00 51.98  ? 1282 LYS B CA    1 
ATOM   5677 C  C     . LYS D 1 282 ? 16.034  50.167  36.567  1.00 51.60  ? 1282 LYS B C     1 
ATOM   5678 O  O     . LYS D 1 282 ? 16.770  49.188  36.696  1.00 51.47  ? 1282 LYS B O     1 
ATOM   5679 C  CB    . LYS D 1 282 ? 17.286  52.071  37.619  1.00 52.06  ? 1282 LYS B CB    1 
ATOM   5680 C  CG    . LYS D 1 282 ? 18.137  53.302  37.384  1.00 52.77  ? 1282 LYS B CG    1 
ATOM   5681 C  CD    . LYS D 1 282 ? 18.895  53.707  38.639  1.00 54.38  ? 1282 LYS B CD    1 
ATOM   5682 C  CE    . LYS D 1 282 ? 17.990  54.456  39.619  1.00 54.71  ? 1282 LYS B CE    1 
ATOM   5683 N  NZ    . LYS D 1 282 ? 18.765  55.526  40.337  1.00 55.51  ? 1282 LYS B NZ    1 
ATOM   5684 N  N     . ALA D 1 283 ? 14.706  50.095  36.596  1.00 51.27  ? 1283 ALA B N     1 
ATOM   5685 C  CA    . ALA D 1 283 ? 14.004  48.834  36.771  1.00 50.97  ? 1283 ALA B CA    1 
ATOM   5686 C  C     . ALA D 1 283 ? 13.140  48.511  35.557  1.00 51.19  ? 1283 ALA B C     1 
ATOM   5687 O  O     . ALA D 1 283 ? 12.480  49.387  34.993  1.00 50.82  ? 1283 ALA B O     1 
ATOM   5688 C  CB    . ALA D 1 283 ? 13.156  48.871  38.031  1.00 50.60  ? 1283 ALA B CB    1 
ATOM   5689 N  N     . ILE D 1 284 ? 13.165  47.244  35.155  1.00 51.58  ? 1284 ILE B N     1 
ATOM   5690 C  CA    . ILE D 1 284 ? 12.250  46.736  34.148  1.00 51.94  ? 1284 ILE B CA    1 
ATOM   5691 C  C     . ILE D 1 284 ? 11.537  45.497  34.669  1.00 52.69  ? 1284 ILE B C     1 
ATOM   5692 O  O     . ILE D 1 284 ? 12.138  44.635  35.295  1.00 52.31  ? 1284 ILE B O     1 
ATOM   5693 C  CB    . ILE D 1 284 ? 12.962  46.388  32.812  1.00 51.95  ? 1284 ILE B CB    1 
ATOM   5694 C  CG1   . ILE D 1 284 ? 11.971  45.741  31.829  1.00 50.84  ? 1284 ILE B CG1   1 
ATOM   5695 C  CG2   . ILE D 1 284 ? 14.180  45.500  33.057  1.00 51.30  ? 1284 ILE B CG2   1 
ATOM   5696 C  CD1   . ILE D 1 284 ? 12.590  45.266  30.532  1.00 49.63  ? 1284 ILE B CD1   1 
ATOM   5697 N  N     . HIS D 1 285 ? 10.239  45.426  34.414  1.00 53.91  ? 1285 HIS B N     1 
ATOM   5698 C  CA    . HIS D 1 285 ? 9.475   44.237  34.721  1.00 54.83  ? 1285 HIS B CA    1 
ATOM   5699 C  C     . HIS D 1 285 ? 8.751   43.826  33.471  1.00 55.29  ? 1285 HIS B C     1 
ATOM   5700 O  O     . HIS D 1 285 ? 8.123   44.648  32.835  1.00 55.29  ? 1285 HIS B O     1 
ATOM   5701 C  CB    . HIS D 1 285 ? 8.479   44.520  35.840  1.00 55.00  ? 1285 HIS B CB    1 
ATOM   5702 C  CG    . HIS D 1 285 ? 9.130   44.923  37.122  1.00 55.58  ? 1285 HIS B CG    1 
ATOM   5703 N  ND1   . HIS D 1 285 ? 9.249   44.070  38.195  1.00 56.62  ? 1285 HIS B ND1   1 
ATOM   5704 C  CD2   . HIS D 1 285 ? 9.726   46.080  37.492  1.00 55.97  ? 1285 HIS B CD2   1 
ATOM   5705 C  CE1   . HIS D 1 285 ? 9.880   44.688  39.177  1.00 56.71  ? 1285 HIS B CE1   1 
ATOM   5706 N  NE2   . HIS D 1 285 ? 10.177  45.911  38.777  1.00 55.53  ? 1285 HIS B NE2   1 
ATOM   5707 N  N     . VAL D 1 286 ? 8.871   42.562  33.093  1.00 56.54  ? 1286 VAL B N     1 
ATOM   5708 C  CA    . VAL D 1 286 ? 8.080   42.059  31.990  1.00 57.70  ? 1286 VAL B CA    1 
ATOM   5709 C  C     . VAL D 1 286 ? 6.813   41.494  32.590  1.00 58.79  ? 1286 VAL B C     1 
ATOM   5710 O  O     . VAL D 1 286 ? 6.841   40.526  33.355  1.00 59.14  ? 1286 VAL B O     1 
ATOM   5711 C  CB    . VAL D 1 286 ? 8.805   40.991  31.172  1.00 57.50  ? 1286 VAL B CB    1 
ATOM   5712 C  CG1   . VAL D 1 286 ? 7.847   40.363  30.182  1.00 57.49  ? 1286 VAL B CG1   1 
ATOM   5713 C  CG2   . VAL D 1 286 ? 9.989   41.601  30.449  1.00 57.19  ? 1286 VAL B CG2   1 
ATOM   5714 N  N     . VAL D 1 287 ? 5.704   42.136  32.260  1.00 59.83  ? 1287 VAL B N     1 
ATOM   5715 C  CA    . VAL D 1 287 ? 4.420   41.772  32.808  1.00 60.71  ? 1287 VAL B CA    1 
ATOM   5716 C  C     . VAL D 1 287 ? 3.703   40.888  31.804  1.00 61.48  ? 1287 VAL B C     1 
ATOM   5717 O  O     . VAL D 1 287 ? 3.503   41.268  30.653  1.00 61.63  ? 1287 VAL B O     1 
ATOM   5718 C  CB    . VAL D 1 287 ? 3.597   43.033  33.149  1.00 60.74  ? 1287 VAL B CB    1 
ATOM   5719 C  CG1   . VAL D 1 287 ? 2.185   42.669  33.569  1.00 60.59  ? 1287 VAL B CG1   1 
ATOM   5720 C  CG2   . VAL D 1 287 ? 4.302   43.828  34.244  1.00 60.10  ? 1287 VAL B CG2   1 
ATOM   5721 N  N     . ALA D 1 288 ? 3.363   39.683  32.244  1.00 62.46  ? 1288 ALA B N     1 
ATOM   5722 C  CA    . ALA D 1 288 ? 2.642   38.737  31.422  1.00 63.37  ? 1288 ALA B CA    1 
ATOM   5723 C  C     . ALA D 1 288 ? 1.226   38.601  31.952  1.00 64.19  ? 1288 ALA B C     1 
ATOM   5724 O  O     . ALA D 1 288 ? 1.025   38.303  33.128  1.00 64.15  ? 1288 ALA B O     1 
ATOM   5725 C  CB    . ALA D 1 288 ? 3.336   37.395  31.442  1.00 63.20  ? 1288 ALA B CB    1 
ATOM   5726 N  N     . VAL D 1 289 ? 0.247   38.852  31.093  1.00 65.17  ? 1289 VAL B N     1 
ATOM   5727 C  CA    . VAL D 1 289 ? -1.122  38.516  31.423  1.00 66.19  ? 1289 VAL B CA    1 
ATOM   5728 C  C     . VAL D 1 289 ? -1.392  37.121  30.886  1.00 67.02  ? 1289 VAL B C     1 
ATOM   5729 O  O     . VAL D 1 289 ? -1.381  36.894  29.675  1.00 66.89  ? 1289 VAL B O     1 
ATOM   5730 C  CB    . VAL D 1 289 ? -2.124  39.506  30.833  1.00 66.29  ? 1289 VAL B CB    1 
ATOM   5731 C  CG1   . VAL D 1 289 ? -3.555  39.033  31.109  1.00 66.10  ? 1289 VAL B CG1   1 
ATOM   5732 C  CG2   . VAL D 1 289 ? -1.882  40.902  31.410  1.00 66.39  ? 1289 VAL B CG2   1 
ATOM   5733 N  N     . THR D 1 290 ? -1.617  36.185  31.799  1.00 67.96  ? 1290 THR B N     1 
ATOM   5734 C  CA    . THR D 1 290 ? -1.791  34.797  31.421  1.00 68.99  ? 1290 THR B CA    1 
ATOM   5735 C  C     . THR D 1 290 ? -3.143  34.593  30.747  1.00 69.57  ? 1290 THR B C     1 
ATOM   5736 O  O     . THR D 1 290 ? -4.009  35.471  30.794  1.00 69.65  ? 1290 THR B O     1 
ATOM   5737 C  CB    . THR D 1 290 ? -1.655  33.870  32.638  1.00 69.01  ? 1290 THR B CB    1 
ATOM   5738 O  OG1   . THR D 1 290 ? -2.640  34.226  33.616  1.00 69.73  ? 1290 THR B OG1   1 
ATOM   5739 C  CG2   . THR D 1 290 ? -0.256  34.000  33.251  1.00 68.86  ? 1290 THR B CG2   1 
ATOM   5740 N  N     . GLU D 1 291 ? -3.302  33.436  30.108  1.00 70.33  ? 1291 GLU B N     1 
ATOM   5741 C  CA    . GLU D 1 291 ? -4.542  33.074  29.429  1.00 70.97  ? 1291 GLU B CA    1 
ATOM   5742 C  C     . GLU D 1 291 ? -5.741  33.217  30.359  1.00 71.34  ? 1291 GLU B C     1 
ATOM   5743 O  O     . GLU D 1 291 ? -6.756  33.807  29.983  1.00 71.46  ? 1291 GLU B O     1 
ATOM   5744 C  CB    . GLU D 1 291 ? -4.452  31.644  28.893  1.00 71.06  ? 1291 GLU B CB    1 
ATOM   5745 C  CG    . GLU D 1 291 ? -5.784  31.044  28.450  1.00 71.51  ? 1291 GLU B CG    1 
ATOM   5746 C  CD    . GLU D 1 291 ? -5.655  29.583  28.042  1.00 71.76  ? 1291 GLU B CD    1 
ATOM   5747 O  OE1   . GLU D 1 291 ? -4.760  29.264  27.230  1.00 71.40  ? 1291 GLU B OE1   1 
ATOM   5748 O  OE2   . GLU D 1 291 ? -6.451  28.754  28.534  1.00 72.38  ? 1291 GLU B OE2   1 
ATOM   5749 N  N     . ASP D 1 292 ? -5.613  32.685  31.574  1.00 71.76  ? 1292 ASP B N     1 
ATOM   5750 C  CA    . ASP D 1 292 ? -6.676  32.783  32.572  1.00 72.19  ? 1292 ASP B CA    1 
ATOM   5751 C  C     . ASP D 1 292 ? -6.710  34.173  33.206  1.00 72.28  ? 1292 ASP B C     1 
ATOM   5752 O  O     . ASP D 1 292 ? -7.016  34.322  34.393  1.00 72.29  ? 1292 ASP B O     1 
ATOM   5753 C  CB    . ASP D 1 292 ? -6.534  31.690  33.642  1.00 72.29  ? 1292 ASP B CB    1 
ATOM   5754 C  CG    . ASP D 1 292 ? -5.398  31.960  34.617  1.00 73.07  ? 1292 ASP B CG    1 
ATOM   5755 O  OD1   . ASP D 1 292 ? -5.670  31.986  35.838  1.00 73.67  ? 1292 ASP B OD1   1 
ATOM   5756 O  OD2   . ASP D 1 292 ? -4.242  32.149  34.173  1.00 73.49  ? 1292 ASP B OD2   1 
ATOM   5757 N  N     . LEU D 1 293 ? -6.385  35.183  32.398  1.00 72.42  ? 1293 LEU B N     1 
ATOM   5758 C  CA    . LEU D 1 293 ? -6.451  36.591  32.797  1.00 72.30  ? 1293 LEU B CA    1 
ATOM   5759 C  C     . LEU D 1 293 ? -5.683  36.950  34.066  1.00 72.16  ? 1293 LEU B C     1 
ATOM   5760 O  O     . LEU D 1 293 ? -5.971  37.969  34.699  1.00 72.31  ? 1293 LEU B O     1 
ATOM   5761 C  CB    . LEU D 1 293 ? -7.905  37.047  32.950  1.00 72.46  ? 1293 LEU B CB    1 
ATOM   5762 C  CG    . LEU D 1 293 ? -8.511  37.869  31.816  1.00 72.86  ? 1293 LEU B CG    1 
ATOM   5763 C  CD1   . LEU D 1 293 ? -9.270  39.050  32.421  1.00 73.09  ? 1293 LEU B CD1   1 
ATOM   5764 C  CD2   . LEU D 1 293 ? -7.433  38.372  30.880  1.00 73.37  ? 1293 LEU B CD2   1 
ATOM   5765 N  N     . ASP D 1 294 ? -4.719  36.125  34.452  1.00 71.83  ? 1294 ASP B N     1 
ATOM   5766 C  CA    . ASP D 1 294 ? -3.914  36.462  35.616  1.00 71.70  ? 1294 ASP B CA    1 
ATOM   5767 C  C     . ASP D 1 294 ? -2.674  37.250  35.187  1.00 71.35  ? 1294 ASP B C     1 
ATOM   5768 O  O     . ASP D 1 294 ? -2.274  37.220  34.021  1.00 71.37  ? 1294 ASP B O     1 
ATOM   5769 C  CB    . ASP D 1 294 ? -3.531  35.207  36.404  1.00 71.87  ? 1294 ASP B CB    1 
ATOM   5770 C  CG    . ASP D 1 294 ? -3.113  35.519  37.835  1.00 72.50  ? 1294 ASP B CG    1 
ATOM   5771 O  OD1   . ASP D 1 294 ? -3.007  36.717  38.183  1.00 72.89  ? 1294 ASP B OD1   1 
ATOM   5772 O  OD2   . ASP D 1 294 ? -2.892  34.564  38.613  1.00 72.77  ? 1294 ASP B OD2   1 
ATOM   5773 N  N     . ILE D 1 295 ? -2.073  37.964  36.129  1.00 70.75  ? 1295 ILE B N     1 
ATOM   5774 C  CA    . ILE D 1 295 ? -0.907  38.768  35.817  1.00 70.26  ? 1295 ILE B CA    1 
ATOM   5775 C  C     . ILE D 1 295 ? 0.330   38.254  36.538  1.00 69.80  ? 1295 ILE B C     1 
ATOM   5776 O  O     . ILE D 1 295 ? 0.337   38.096  37.759  1.00 69.96  ? 1295 ILE B O     1 
ATOM   5777 C  CB    . ILE D 1 295 ? -1.128  40.254  36.164  1.00 70.45  ? 1295 ILE B CB    1 
ATOM   5778 C  CG1   . ILE D 1 295 ? -2.324  40.815  35.390  1.00 70.41  ? 1295 ILE B CG1   1 
ATOM   5779 C  CG2   . ILE D 1 295 ? 0.124   41.056  35.867  1.00 70.29  ? 1295 ILE B CG2   1 
ATOM   5780 C  CD1   . ILE D 1 295 ? -2.848  42.128  35.948  1.00 71.16  ? 1295 ILE B CD1   1 
ATOM   5781 N  N     . VAL D 1 296 ? 1.375   37.985  35.764  1.00 68.99  ? 1296 VAL B N     1 
ATOM   5782 C  CA    . VAL D 1 296 ? 2.654   37.576  36.314  1.00 68.09  ? 1296 VAL B CA    1 
ATOM   5783 C  C     . VAL D 1 296 ? 3.705   38.574  35.851  1.00 67.36  ? 1296 VAL B C     1 
ATOM   5784 O  O     . VAL D 1 296 ? 3.674   39.032  34.708  1.00 67.35  ? 1296 VAL B O     1 
ATOM   5785 C  CB    . VAL D 1 296 ? 3.029   36.153  35.856  1.00 68.18  ? 1296 VAL B CB    1 
ATOM   5786 C  CG1   . VAL D 1 296 ? 4.430   35.785  36.322  1.00 68.37  ? 1296 VAL B CG1   1 
ATOM   5787 C  CG2   . VAL D 1 296 ? 2.008   35.145  36.378  1.00 68.35  ? 1296 VAL B CG2   1 
ATOM   5788 N  N     . SER D 1 297 ? 4.619   38.936  36.742  1.00 66.29  ? 1297 SER B N     1 
ATOM   5789 C  CA    . SER D 1 297 ? 5.685   39.850  36.367  1.00 65.28  ? 1297 SER B CA    1 
ATOM   5790 C  C     . SER D 1 297 ? 7.050   39.370  36.849  1.00 64.42  ? 1297 SER B C     1 
ATOM   5791 O  O     . SER D 1 297 ? 7.202   38.894  37.974  1.00 64.18  ? 1297 SER B O     1 
ATOM   5792 C  CB    . SER D 1 297 ? 5.401   41.263  36.882  1.00 65.28  ? 1297 SER B CB    1 
ATOM   5793 O  OG    . SER D 1 297 ? 5.802   41.405  38.234  1.00 65.81  ? 1297 SER B OG    1 
ATOM   5794 N  N     . ARG D 1 298 ? 8.037   39.484  35.969  1.00 63.41  ? 1298 ARG B N     1 
ATOM   5795 C  CA    . ARG D 1 298 ? 9.424   39.265  36.338  1.00 62.34  ? 1298 ARG B CA    1 
ATOM   5796 C  C     . ARG D 1 298 ? 10.160  40.551  36.062  1.00 61.33  ? 1298 ARG B C     1 
ATOM   5797 O  O     . ARG D 1 298 ? 9.997   41.148  35.004  1.00 61.24  ? 1298 ARG B O     1 
ATOM   5798 C  CB    . ARG D 1 298 ? 10.032  38.121  35.536  1.00 62.37  ? 1298 ARG B CB    1 
ATOM   5799 C  CG    . ARG D 1 298 ? 9.473   36.759  35.910  1.00 63.44  ? 1298 ARG B CG    1 
ATOM   5800 C  CD    . ARG D 1 298 ? 9.698   36.447  37.383  1.00 64.37  ? 1298 ARG B CD    1 
ATOM   5801 N  NE    . ARG D 1 298 ? 9.046   35.204  37.782  1.00 65.42  ? 1298 ARG B NE    1 
ATOM   5802 C  CZ    . ARG D 1 298 ? 7.892   35.141  38.440  1.00 66.14  ? 1298 ARG B CZ    1 
ATOM   5803 N  NH1   . ARG D 1 298 ? 7.255   36.251  38.788  1.00 66.75  ? 1298 ARG B NH1   1 
ATOM   5804 N  NH2   . ARG D 1 298 ? 7.376   33.962  38.756  1.00 66.69  ? 1298 ARG B NH2   1 
ATOM   5805 N  N     . GLY D 1 299 ? 10.960  40.985  37.024  1.00 60.41  ? 1299 GLY B N     1 
ATOM   5806 C  CA    . GLY D 1 299 ? 11.652  42.250  36.900  1.00 59.36  ? 1299 GLY B CA    1 
ATOM   5807 C  C     . GLY D 1 299 ? 13.108  42.239  37.302  1.00 58.48  ? 1299 GLY B C     1 
ATOM   5808 O  O     . GLY D 1 299 ? 13.562  41.378  38.050  1.00 58.54  ? 1299 GLY B O     1 
ATOM   5809 N  N     . ARG D 1 300 ? 13.844  43.210  36.787  1.00 57.69  ? 1300 ARG B N     1 
ATOM   5810 C  CA    . ARG D 1 300 ? 15.205  43.430  37.205  1.00 56.74  ? 1300 ARG B CA    1 
ATOM   5811 C  C     . ARG D 1 300 ? 15.413  44.906  37.466  1.00 56.07  ? 1300 ARG B C     1 
ATOM   5812 O  O     . ARG D 1 300 ? 14.924  45.759  36.727  1.00 55.83  ? 1300 ARG B O     1 
ATOM   5813 C  CB    . ARG D 1 300 ? 16.194  42.944  36.151  1.00 56.85  ? 1300 ARG B CB    1 
ATOM   5814 C  CG    . ARG D 1 300 ? 17.649  43.024  36.605  1.00 57.68  ? 1300 ARG B CG    1 
ATOM   5815 C  CD    . ARG D 1 300 ? 18.551  42.303  35.638  1.00 59.42  ? 1300 ARG B CD    1 
ATOM   5816 N  NE    . ARG D 1 300 ? 19.967  42.466  35.953  1.00 60.94  ? 1300 ARG B NE    1 
ATOM   5817 C  CZ    . ARG D 1 300 ? 20.957  42.113  35.137  1.00 61.11  ? 1300 ARG B CZ    1 
ATOM   5818 N  NH1   . ARG D 1 300 ? 20.688  41.585  33.947  1.00 60.96  ? 1300 ARG B NH1   1 
ATOM   5819 N  NH2   . ARG D 1 300 ? 22.218  42.292  35.507  1.00 61.71  ? 1300 ARG B NH2   1 
ATOM   5820 N  N     . THR D 1 301 ? 16.136  45.197  38.538  1.00 55.61  ? 1301 THR B N     1 
ATOM   5821 C  CA    . THR D 1 301 ? 16.575  46.545  38.821  1.00 54.98  ? 1301 THR B CA    1 
ATOM   5822 C  C     . THR D 1 301 ? 18.072  46.595  38.570  1.00 54.60  ? 1301 THR B C     1 
ATOM   5823 O  O     . THR D 1 301 ? 18.837  45.848  39.171  1.00 54.64  ? 1301 THR B O     1 
ATOM   5824 C  CB    . THR D 1 301 ? 16.251  46.951  40.269  1.00 55.18  ? 1301 THR B CB    1 
ATOM   5825 O  OG1   . THR D 1 301 ? 14.825  47.022  40.442  1.00 55.34  ? 1301 THR B OG1   1 
ATOM   5826 C  CG2   . THR D 1 301 ? 16.887  48.303  40.617  1.00 54.86  ? 1301 THR B CG2   1 
ATOM   5827 N  N     . PHE D 1 302 ? 18.482  47.462  37.657  1.00 53.85  ? 1302 PHE B N     1 
ATOM   5828 C  CA    . PHE D 1 302 ? 19.883  47.634  37.360  1.00 53.25  ? 1302 PHE B CA    1 
ATOM   5829 C  C     . PHE D 1 302 ? 20.441  48.729  38.252  1.00 53.02  ? 1302 PHE B C     1 
ATOM   5830 O  O     . PHE D 1 302 ? 19.685  49.545  38.773  1.00 53.08  ? 1302 PHE B O     1 
ATOM   5831 C  CB    . PHE D 1 302 ? 20.065  48.009  35.887  1.00 53.24  ? 1302 PHE B CB    1 
ATOM   5832 C  CG    . PHE D 1 302 ? 19.686  46.913  34.929  1.00 52.72  ? 1302 PHE B CG    1 
ATOM   5833 C  CD1   . PHE D 1 302 ? 18.362  46.717  34.565  1.00 51.53  ? 1302 PHE B CD1   1 
ATOM   5834 C  CD2   . PHE D 1 302 ? 20.658  46.079  34.394  1.00 52.55  ? 1302 PHE B CD2   1 
ATOM   5835 C  CE1   . PHE D 1 302 ? 18.016  45.710  33.691  1.00 51.54  ? 1302 PHE B CE1   1 
ATOM   5836 C  CE2   . PHE D 1 302 ? 20.321  45.073  33.512  1.00 52.39  ? 1302 PHE B CE2   1 
ATOM   5837 C  CZ    . PHE D 1 302 ? 18.998  44.887  33.158  1.00 52.11  ? 1302 PHE B CZ    1 
ATOM   5838 N  N     . PRO D 1 303 ? 21.771  48.747  38.441  1.00 52.55  ? 1303 PRO B N     1 
ATOM   5839 C  CA    . PRO D 1 303 ? 22.392  49.841  39.179  1.00 52.15  ? 1303 PRO B CA    1 
ATOM   5840 C  C     . PRO D 1 303 ? 22.575  51.074  38.294  1.00 51.57  ? 1303 PRO B C     1 
ATOM   5841 O  O     . PRO D 1 303 ? 23.182  52.055  38.712  1.00 51.70  ? 1303 PRO B O     1 
ATOM   5842 C  CB    . PRO D 1 303 ? 23.760  49.266  39.602  1.00 52.25  ? 1303 PRO B CB    1 
ATOM   5843 C  CG    . PRO D 1 303 ? 23.827  47.858  39.034  1.00 52.48  ? 1303 PRO B CG    1 
ATOM   5844 C  CD    . PRO D 1 303 ? 22.755  47.749  37.994  1.00 52.47  ? 1303 PRO B CD    1 
ATOM   5845 N  N     . HIS D 1 304 ? 22.040  51.021  37.081  1.00 51.03  ? 1304 HIS B N     1 
ATOM   5846 C  CA    . HIS D 1 304 ? 22.165  52.122  36.128  1.00 50.11  ? 1304 HIS B CA    1 
ATOM   5847 C  C     . HIS D 1 304 ? 20.879  52.240  35.333  1.00 49.92  ? 1304 HIS B C     1 
ATOM   5848 O  O     . HIS D 1 304 ? 20.006  51.379  35.421  1.00 49.73  ? 1304 HIS B O     1 
ATOM   5849 C  CB    . HIS D 1 304 ? 23.321  51.854  35.169  1.00 49.81  ? 1304 HIS B CB    1 
ATOM   5850 C  CG    . HIS D 1 304 ? 23.229  50.529  34.477  1.00 48.92  ? 1304 HIS B CG    1 
ATOM   5851 N  ND1   . HIS D 1 304 ? 23.960  49.430  34.874  1.00 48.37  ? 1304 HIS B ND1   1 
ATOM   5852 C  CD2   . HIS D 1 304 ? 22.488  50.125  33.418  1.00 48.26  ? 1304 HIS B CD2   1 
ATOM   5853 C  CE1   . HIS D 1 304 ? 23.676  48.407  34.087  1.00 48.22  ? 1304 HIS B CE1   1 
ATOM   5854 N  NE2   . HIS D 1 304 ? 22.784  48.802  33.197  1.00 48.30  ? 1304 HIS B NE2   1 
ATOM   5855 N  N     . GLY D 1 305 ? 20.766  53.310  34.556  1.00 49.65  ? 1305 GLY B N     1 
ATOM   5856 C  CA    . GLY D 1 305 ? 19.651  53.459  33.638  1.00 49.71  ? 1305 GLY B CA    1 
ATOM   5857 C  C     . GLY D 1 305 ? 19.601  52.329  32.627  1.00 49.41  ? 1305 GLY B C     1 
ATOM   5858 O  O     . GLY D 1 305 ? 20.615  51.728  32.307  1.00 49.30  ? 1305 GLY B O     1 
ATOM   5859 N  N     . ILE D 1 306 ? 18.407  52.031  32.139  1.00 49.60  ? 1306 ILE B N     1 
ATOM   5860 C  CA    . ILE D 1 306 ? 18.224  50.970  31.160  1.00 49.79  ? 1306 ILE B CA    1 
ATOM   5861 C  C     . ILE D 1 306 ? 18.097  51.570  29.770  1.00 49.96  ? 1306 ILE B C     1 
ATOM   5862 O  O     . ILE D 1 306 ? 17.166  52.323  29.496  1.00 49.73  ? 1306 ILE B O     1 
ATOM   5863 C  CB    . ILE D 1 306 ? 16.961  50.153  31.456  1.00 49.72  ? 1306 ILE B CB    1 
ATOM   5864 C  CG1   . ILE D 1 306 ? 16.986  49.629  32.892  1.00 49.83  ? 1306 ILE B CG1   1 
ATOM   5865 C  CG2   . ILE D 1 306 ? 16.810  49.010  30.461  1.00 49.36  ? 1306 ILE B CG2   1 
ATOM   5866 C  CD1   . ILE D 1 306 ? 15.736  48.872  33.266  1.00 49.87  ? 1306 ILE B CD1   1 
ATOM   5867 N  N     . SER D 1 307 ? 19.052  51.254  28.903  1.00 50.32  ? 1307 SER B N     1 
ATOM   5868 C  CA    . SER D 1 307 ? 18.980  51.671  27.513  1.00 50.50  ? 1307 SER B CA    1 
ATOM   5869 C  C     . SER D 1 307 ? 17.922  50.822  26.846  1.00 51.12  ? 1307 SER B C     1 
ATOM   5870 O  O     . SER D 1 307 ? 17.622  49.730  27.313  1.00 51.11  ? 1307 SER B O     1 
ATOM   5871 C  CB    . SER D 1 307 ? 20.319  51.453  26.822  1.00 50.12  ? 1307 SER B CB    1 
ATOM   5872 O  OG    . SER D 1 307 ? 20.570  50.077  26.650  1.00 49.28  ? 1307 SER B OG    1 
ATOM   5873 N  N     . LYS D 1 308 ? 17.355  51.315  25.751  1.00 52.00  ? 1308 LYS B N     1 
ATOM   5874 C  CA    . LYS D 1 308 ? 16.321  50.556  25.067  1.00 52.97  ? 1308 LYS B CA    1 
ATOM   5875 C  C     . LYS D 1 308 ? 16.845  49.172  24.678  1.00 53.41  ? 1308 LYS B C     1 
ATOM   5876 O  O     . LYS D 1 308 ? 16.142  48.167  24.827  1.00 53.45  ? 1308 LYS B O     1 
ATOM   5877 C  CB    . LYS D 1 308 ? 15.757  51.319  23.864  1.00 53.15  ? 1308 LYS B CB    1 
ATOM   5878 C  CG    . LYS D 1 308 ? 14.464  50.719  23.343  1.00 54.06  ? 1308 LYS B CG    1 
ATOM   5879 C  CD    . LYS D 1 308 ? 13.484  51.777  22.876  1.00 56.14  ? 1308 LYS B CD    1 
ATOM   5880 C  CE    . LYS D 1 308 ? 13.965  52.471  21.618  1.00 56.74  ? 1308 LYS B CE    1 
ATOM   5881 N  NZ    . LYS D 1 308 ? 14.442  51.467  20.633  1.00 58.70  ? 1308 LYS B NZ    1 
ATOM   5882 N  N     . GLU D 1 309 ? 18.090  49.132  24.211  1.00 54.01  ? 1309 GLU B N     1 
ATOM   5883 C  CA    . GLU D 1 309 ? 18.759  47.882  23.866  1.00 54.84  ? 1309 GLU B CA    1 
ATOM   5884 C  C     . GLU D 1 309 ? 18.790  46.910  25.038  1.00 54.77  ? 1309 GLU B C     1 
ATOM   5885 O  O     . GLU D 1 309 ? 18.527  45.722  24.865  1.00 54.97  ? 1309 GLU B O     1 
ATOM   5886 C  CB    . GLU D 1 309 ? 20.188  48.151  23.379  1.00 55.13  ? 1309 GLU B CB    1 
ATOM   5887 C  CG    . GLU D 1 309 ? 20.253  48.960  22.100  1.00 57.44  ? 1309 GLU B CG    1 
ATOM   5888 C  CD    . GLU D 1 309 ? 20.073  50.465  22.317  1.00 60.37  ? 1309 GLU B CD    1 
ATOM   5889 O  OE1   . GLU D 1 309 ? 20.272  50.941  23.459  1.00 60.87  ? 1309 GLU B OE1   1 
ATOM   5890 O  OE2   . GLU D 1 309 ? 19.748  51.175  21.334  1.00 61.89  ? 1309 GLU B OE2   1 
ATOM   5891 N  N     . THR D 1 310 ? 19.119  47.415  26.225  1.00 54.85  ? 1310 THR B N     1 
ATOM   5892 C  CA    . THR D 1 310 ? 19.126  46.596  27.433  1.00 54.98  ? 1310 THR B CA    1 
ATOM   5893 C  C     . THR D 1 310 ? 17.711  46.165  27.812  1.00 55.28  ? 1310 THR B C     1 
ATOM   5894 O  O     . THR D 1 310 ? 17.495  45.042  28.268  1.00 55.14  ? 1310 THR B O     1 
ATOM   5895 C  CB    . THR D 1 310 ? 19.750  47.339  28.626  1.00 54.84  ? 1310 THR B CB    1 
ATOM   5896 O  OG1   . THR D 1 310 ? 21.036  47.844  28.260  1.00 54.82  ? 1310 THR B OG1   1 
ATOM   5897 C  CG2   . THR D 1 310 ? 19.901  46.403  29.806  1.00 54.46  ? 1310 THR B CG2   1 
ATOM   5898 N  N     . ALA D 1 311 ? 16.753  47.068  27.627  1.00 55.74  ? 1311 ALA B N     1 
ATOM   5899 C  CA    . ALA D 1 311 ? 15.347  46.747  27.825  1.00 56.35  ? 1311 ALA B CA    1 
ATOM   5900 C  C     . ALA D 1 311 ? 14.905  45.633  26.877  1.00 56.81  ? 1311 ALA B C     1 
ATOM   5901 O  O     . ALA D 1 311 ? 14.210  44.704  27.276  1.00 56.96  ? 1311 ALA B O     1 
ATOM   5902 C  CB    . ALA D 1 311 ? 14.495  47.981  27.635  1.00 56.28  ? 1311 ALA B CB    1 
ATOM   5903 N  N     . TYR D 1 312 ? 15.322  45.720  25.622  1.00 57.44  ? 1312 TYR B N     1 
ATOM   5904 C  CA    . TYR D 1 312 ? 15.069  44.646  24.665  1.00 58.21  ? 1312 TYR B CA    1 
ATOM   5905 C  C     . TYR D 1 312 ? 15.688  43.317  25.109  1.00 58.73  ? 1312 TYR B C     1 
ATOM   5906 O  O     . TYR D 1 312 ? 15.064  42.260  24.988  1.00 59.37  ? 1312 TYR B O     1 
ATOM   5907 C  CB    . TYR D 1 312 ? 15.603  45.027  23.281  1.00 58.02  ? 1312 TYR B CB    1 
ATOM   5908 C  CG    . TYR D 1 312 ? 14.580  45.683  22.388  1.00 58.13  ? 1312 TYR B CG    1 
ATOM   5909 C  CD1   . TYR D 1 312 ? 14.197  45.086  21.193  1.00 59.20  ? 1312 TYR B CD1   1 
ATOM   5910 C  CD2   . TYR D 1 312 ? 13.990  46.888  22.734  1.00 58.08  ? 1312 TYR B CD2   1 
ATOM   5911 C  CE1   . TYR D 1 312 ? 13.266  45.673  20.363  1.00 58.97  ? 1312 TYR B CE1   1 
ATOM   5912 C  CE2   . TYR D 1 312 ? 13.040  47.483  21.910  1.00 58.49  ? 1312 TYR B CE2   1 
ATOM   5913 C  CZ    . TYR D 1 312 ? 12.688  46.868  20.726  1.00 58.74  ? 1312 TYR B CZ    1 
ATOM   5914 O  OH    . TYR D 1 312 ? 11.758  47.438  19.890  1.00 59.60  ? 1312 TYR B OH    1 
ATOM   5915 N  N     . SER D 1 313 ? 16.915  43.372  25.623  1.00 58.76  ? 1313 SER B N     1 
ATOM   5916 C  CA    . SER D 1 313 ? 17.650  42.163  25.973  1.00 58.87  ? 1313 SER B CA    1 
ATOM   5917 C  C     . SER D 1 313 ? 17.228  41.588  27.317  1.00 58.79  ? 1313 SER B C     1 
ATOM   5918 O  O     . SER D 1 313 ? 17.102  40.374  27.471  1.00 58.93  ? 1313 SER B O     1 
ATOM   5919 C  CB    . SER D 1 313 ? 19.150  42.444  25.980  1.00 58.72  ? 1313 SER B CB    1 
ATOM   5920 O  OG    . SER D 1 313 ? 19.541  43.038  24.756  1.00 59.56  ? 1313 SER B OG    1 
ATOM   5921 N  N     . GLU D 1 314 ? 17.029  42.462  28.294  1.00 58.66  ? 1314 GLU B N     1 
ATOM   5922 C  CA    . GLU D 1 314 ? 16.648  42.021  29.617  1.00 58.79  ? 1314 GLU B CA    1 
ATOM   5923 C  C     . GLU D 1 314 ? 15.218  41.529  29.580  1.00 58.87  ? 1314 GLU B C     1 
ATOM   5924 O  O     . GLU D 1 314 ? 14.872  40.547  30.236  1.00 59.08  ? 1314 GLU B O     1 
ATOM   5925 C  CB    . GLU D 1 314 ? 16.786  43.159  30.625  1.00 58.86  ? 1314 GLU B CB    1 
ATOM   5926 C  CG    . GLU D 1 314 ? 16.436  42.768  32.052  1.00 59.52  ? 1314 GLU B CG    1 
ATOM   5927 C  CD    . GLU D 1 314 ? 17.373  41.720  32.628  1.00 60.59  ? 1314 GLU B CD    1 
ATOM   5928 O  OE1   . GLU D 1 314 ? 16.910  40.931  33.478  1.00 61.16  ? 1314 GLU B OE1   1 
ATOM   5929 O  OE2   . GLU D 1 314 ? 18.564  41.683  32.236  1.00 61.41  ? 1314 GLU B OE2   1 
ATOM   5930 N  N     . SER D 1 315 ? 14.393  42.219  28.799  1.00 58.99  ? 1315 SER B N     1 
ATOM   5931 C  CA    . SER D 1 315 ? 12.983  41.886  28.676  1.00 59.04  ? 1315 SER B CA    1 
ATOM   5932 C  C     . SER D 1 315 ? 12.824  40.440  28.243  1.00 59.19  ? 1315 SER B C     1 
ATOM   5933 O  O     . SER D 1 315 ? 11.947  39.729  28.732  1.00 59.38  ? 1315 SER B O     1 
ATOM   5934 C  CB    . SER D 1 315 ? 12.297  42.802  27.663  1.00 58.82  ? 1315 SER B CB    1 
ATOM   5935 O  OG    . SER D 1 315 ? 12.623  42.423  26.335  1.00 58.61  ? 1315 SER B OG    1 
ATOM   5936 N  N     . VAL D 1 316 ? 13.670  40.010  27.315  1.00 59.28  ? 1316 VAL B N     1 
ATOM   5937 C  CA    . VAL D 1 316 ? 13.593  38.649  26.826  1.00 59.46  ? 1316 VAL B CA    1 
ATOM   5938 C  C     . VAL D 1 316 ? 13.901  37.686  27.968  1.00 59.77  ? 1316 VAL B C     1 
ATOM   5939 O  O     . VAL D 1 316 ? 13.153  36.746  28.207  1.00 59.70  ? 1316 VAL B O     1 
ATOM   5940 C  CB    . VAL D 1 316 ? 14.522  38.432  25.624  1.00 59.43  ? 1316 VAL B CB    1 
ATOM   5941 C  CG1   . VAL D 1 316 ? 14.683  36.950  25.327  1.00 59.41  ? 1316 VAL B CG1   1 
ATOM   5942 C  CG2   . VAL D 1 316 ? 13.971  39.166  24.410  1.00 59.21  ? 1316 VAL B CG2   1 
ATOM   5943 N  N     . LYS D 1 317 ? 14.986  37.947  28.690  1.00 60.25  ? 1317 LYS B N     1 
ATOM   5944 C  CA    . LYS D 1 317 ? 15.369  37.118  29.830  1.00 60.79  ? 1317 LYS B CA    1 
ATOM   5945 C  C     . LYS D 1 317 ? 14.248  37.046  30.866  1.00 61.31  ? 1317 LYS B C     1 
ATOM   5946 O  O     . LYS D 1 317 ? 13.979  35.984  31.430  1.00 61.28  ? 1317 LYS B O     1 
ATOM   5947 C  CB    . LYS D 1 317 ? 16.647  37.649  30.478  1.00 60.84  ? 1317 LYS B CB    1 
ATOM   5948 C  CG    . LYS D 1 317 ? 17.863  37.647  29.564  1.00 60.96  ? 1317 LYS B CG    1 
ATOM   5949 C  CD    . LYS D 1 317 ? 19.087  38.190  30.278  1.00 61.53  ? 1317 LYS B CD    1 
ATOM   5950 C  CE    . LYS D 1 317 ? 20.233  38.398  29.306  1.00 62.56  ? 1317 LYS B CE    1 
ATOM   5951 N  NZ    . LYS D 1 317 ? 21.540  38.577  30.002  1.00 63.43  ? 1317 LYS B NZ    1 
ATOM   5952 N  N     . LEU D 1 318 ? 13.596  38.182  31.105  1.00 61.84  ? 1318 LEU B N     1 
ATOM   5953 C  CA    . LEU D 1 318 ? 12.456  38.247  32.011  1.00 62.19  ? 1318 LEU B CA    1 
ATOM   5954 C  C     . LEU D 1 318 ? 11.248  37.527  31.426  1.00 62.55  ? 1318 LEU B C     1 
ATOM   5955 O  O     . LEU D 1 318 ? 10.439  36.959  32.156  1.00 62.67  ? 1318 LEU B O     1 
ATOM   5956 C  CB    . LEU D 1 318 ? 12.094  39.700  32.315  1.00 62.04  ? 1318 LEU B CB    1 
ATOM   5957 C  CG    . LEU D 1 318 ? 13.101  40.527  33.111  1.00 62.01  ? 1318 LEU B CG    1 
ATOM   5958 C  CD1   . LEU D 1 318 ? 12.631  41.973  33.187  1.00 61.95  ? 1318 LEU B CD1   1 
ATOM   5959 C  CD2   . LEU D 1 318 ? 13.316  39.939  34.503  1.00 61.00  ? 1318 LEU B CD2   1 
ATOM   5960 N  N     . LEU D 1 319 ? 11.119  37.567  30.106  1.00 63.04  ? 1319 LEU B N     1 
ATOM   5961 C  CA    . LEU D 1 319 ? 10.071  36.820  29.432  1.00 63.61  ? 1319 LEU B CA    1 
ATOM   5962 C  C     . LEU D 1 319 ? 10.309  35.329  29.646  1.00 64.24  ? 1319 LEU B C     1 
ATOM   5963 O  O     . LEU D 1 319 ? 9.393   34.590  30.013  1.00 64.33  ? 1319 LEU B O     1 
ATOM   5964 C  CB    . LEU D 1 319 ? 10.058  37.148  27.939  1.00 63.45  ? 1319 LEU B CB    1 
ATOM   5965 C  CG    . LEU D 1 319 ? 8.937   36.497  27.133  1.00 63.09  ? 1319 LEU B CG    1 
ATOM   5966 C  CD1   . LEU D 1 319 ? 7.600   36.693  27.832  1.00 63.00  ? 1319 LEU B CD1   1 
ATOM   5967 C  CD2   . LEU D 1 319 ? 8.905   37.055  25.721  1.00 62.26  ? 1319 LEU B CD2   1 
ATOM   5968 N  N     . GLN D 1 320 ? 11.553  34.907  29.422  1.00 64.97  ? 1320 GLN B N     1 
ATOM   5969 C  CA    . GLN D 1 320 ? 11.973  33.523  29.613  1.00 65.64  ? 1320 GLN B CA    1 
ATOM   5970 C  C     . GLN D 1 320 ? 11.721  33.063  31.045  1.00 66.19  ? 1320 GLN B C     1 
ATOM   5971 O  O     . GLN D 1 320 ? 11.158  31.995  31.269  1.00 66.35  ? 1320 GLN B O     1 
ATOM   5972 C  CB    . GLN D 1 320 ? 13.460  33.372  29.283  1.00 65.60  ? 1320 GLN B CB    1 
ATOM   5973 C  CG    . GLN D 1 320 ? 13.817  33.656  27.830  1.00 65.58  ? 1320 GLN B CG    1 
ATOM   5974 C  CD    . GLN D 1 320 ? 15.317  33.820  27.609  1.00 65.18  ? 1320 GLN B CD    1 
ATOM   5975 O  OE1   . GLN D 1 320 ? 16.089  33.951  28.560  1.00 65.20  ? 1320 GLN B OE1   1 
ATOM   5976 N  NE2   . GLN D 1 320 ? 15.731  33.818  26.347  1.00 64.53  ? 1320 GLN B NE2   1 
ATOM   5977 N  N     . LYS D 1 321 ? 12.153  33.880  32.002  1.00 66.85  ? 1321 LYS B N     1 
ATOM   5978 C  CA    . LYS D 1 321 ? 11.937  33.634  33.426  1.00 67.43  ? 1321 LYS B CA    1 
ATOM   5979 C  C     . LYS D 1 321 ? 10.479  33.275  33.711  1.00 67.90  ? 1321 LYS B C     1 
ATOM   5980 O  O     . LYS D 1 321 ? 10.191  32.366  34.488  1.00 68.13  ? 1321 LYS B O     1 
ATOM   5981 C  CB    . LYS D 1 321 ? 12.336  34.877  34.225  1.00 67.48  ? 1321 LYS B CB    1 
ATOM   5982 C  CG    . LYS D 1 321 ? 12.745  34.626  35.667  1.00 67.72  ? 1321 LYS B CG    1 
ATOM   5983 C  CD    . LYS D 1 321 ? 13.285  35.909  36.301  1.00 68.22  ? 1321 LYS B CD    1 
ATOM   5984 C  CE    . LYS D 1 321 ? 13.651  35.708  37.767  1.00 68.04  ? 1321 LYS B CE    1 
ATOM   5985 N  NZ    . LYS D 1 321 ? 14.825  34.809  37.928  1.00 68.08  ? 1321 LYS B NZ    1 
ATOM   5986 N  N     . ILE D 1 322 ? 9.560   33.994  33.080  1.00 68.40  ? 1322 ILE B N     1 
ATOM   5987 C  CA    . ILE D 1 322 ? 8.142   33.708  33.231  1.00 68.95  ? 1322 ILE B CA    1 
ATOM   5988 C  C     . ILE D 1 322 ? 7.807   32.387  32.537  1.00 69.31  ? 1322 ILE B C     1 
ATOM   5989 O  O     . ILE D 1 322 ? 7.089   31.551  33.084  1.00 69.52  ? 1322 ILE B O     1 
ATOM   5990 C  CB    . ILE D 1 322 ? 7.270   34.865  32.679  1.00 68.95  ? 1322 ILE B CB    1 
ATOM   5991 C  CG1   . ILE D 1 322 ? 7.565   36.157  33.445  1.00 68.92  ? 1322 ILE B CG1   1 
ATOM   5992 C  CG2   . ILE D 1 322 ? 5.788   34.522  32.768  1.00 68.74  ? 1322 ILE B CG2   1 
ATOM   5993 C  CD1   . ILE D 1 322 ? 6.775   37.361  32.974  1.00 69.39  ? 1322 ILE B CD1   1 
ATOM   5994 N  N     . LEU D 1 323 ? 8.355   32.197  31.341  1.00 69.69  ? 1323 LEU B N     1 
ATOM   5995 C  CA    . LEU D 1 323 ? 8.148   30.969  30.570  1.00 70.06  ? 1323 LEU B CA    1 
ATOM   5996 C  C     . LEU D 1 323 ? 8.846   29.746  31.185  1.00 70.41  ? 1323 LEU B C     1 
ATOM   5997 O  O     . LEU D 1 323 ? 9.037   28.718  30.524  1.00 70.43  ? 1323 LEU B O     1 
ATOM   5998 C  CB    . LEU D 1 323 ? 8.609   31.180  29.127  1.00 69.96  ? 1323 LEU B CB    1 
ATOM   5999 C  CG    . LEU D 1 323 ? 7.512   31.627  28.164  1.00 69.60  ? 1323 LEU B CG    1 
ATOM   6000 C  CD1   . LEU D 1 323 ? 6.292   32.086  28.929  1.00 69.70  ? 1323 LEU B CD1   1 
ATOM   6001 C  CD2   . LEU D 1 323 ? 8.019   32.705  27.223  1.00 69.40  ? 1323 LEU B CD2   1 
ATOM   6002 N  N     . GLU D 1 324 ? 9.226   29.868  32.452  1.00 70.71  ? 1324 GLU B N     1 
ATOM   6003 C  CA    . GLU D 1 324 ? 9.871   28.787  33.175  1.00 70.99  ? 1324 GLU B CA    1 
ATOM   6004 C  C     . GLU D 1 324 ? 9.235   28.668  34.549  1.00 71.18  ? 1324 GLU B C     1 
ATOM   6005 O  O     . GLU D 1 324 ? 8.995   27.566  35.044  1.00 71.24  ? 1324 GLU B O     1 
ATOM   6006 C  CB    . GLU D 1 324 ? 11.369  29.057  33.329  1.00 71.01  ? 1324 GLU B CB    1 
ATOM   6007 C  CG    . GLU D 1 324 ? 12.141  29.157  32.024  1.00 71.20  ? 1324 GLU B CG    1 
ATOM   6008 C  CD    . GLU D 1 324 ? 13.590  29.557  32.241  1.00 71.55  ? 1324 GLU B CD    1 
ATOM   6009 O  OE1   . GLU D 1 324 ? 14.032  30.560  31.639  1.00 71.62  ? 1324 GLU B OE1   1 
ATOM   6010 O  OE2   . GLU D 1 324 ? 14.287  28.876  33.023  1.00 71.83  ? 1324 GLU B OE2   1 
ATOM   6011 N  N     . GLU D 1 325 ? 8.964   29.816  35.160  1.00 71.47  ? 1325 GLU B N     1 
ATOM   6012 C  CA    . GLU D 1 325 ? 8.380   29.854  36.495  1.00 71.74  ? 1325 GLU B CA    1 
ATOM   6013 C  C     . GLU D 1 325 ? 6.858   29.869  36.420  1.00 72.06  ? 1325 GLU B C     1 
ATOM   6014 O  O     . GLU D 1 325 ? 6.170   29.838  37.445  1.00 72.09  ? 1325 GLU B O     1 
ATOM   6015 C  CB    . GLU D 1 325 ? 8.915   31.054  37.280  1.00 71.61  ? 1325 GLU B CB    1 
ATOM   6016 C  CG    . GLU D 1 325 ? 10.368  30.883  37.701  1.00 71.11  ? 1325 GLU B CG    1 
ATOM   6017 C  CD    . GLU D 1 325 ? 11.058  32.194  38.014  1.00 70.32  ? 1325 GLU B CD    1 
ATOM   6018 O  OE1   . GLU D 1 325 ? 10.352  33.196  38.262  1.00 69.34  ? 1325 GLU B OE1   1 
ATOM   6019 O  OE2   . GLU D 1 325 ? 12.312  32.213  38.013  1.00 69.43  ? 1325 GLU B OE2   1 
ATOM   6020 N  N     . ASP D 1 326 ? 6.342   29.907  35.196  1.00 72.38  ? 1326 ASP B N     1 
ATOM   6021 C  CA    . ASP D 1 326 ? 4.910   29.782  34.972  1.00 72.77  ? 1326 ASP B CA    1 
ATOM   6022 C  C     . ASP D 1 326 ? 4.635   29.010  33.688  1.00 72.93  ? 1326 ASP B C     1 
ATOM   6023 O  O     . ASP D 1 326 ? 5.259   29.255  32.650  1.00 72.97  ? 1326 ASP B O     1 
ATOM   6024 C  CB    . ASP D 1 326 ? 4.240   31.151  34.921  1.00 72.86  ? 1326 ASP B CB    1 
ATOM   6025 C  CG    . ASP D 1 326 ? 2.858   31.137  35.536  1.00 73.22  ? 1326 ASP B CG    1 
ATOM   6026 O  OD1   . ASP D 1 326 ? 2.755   30.858  36.752  1.00 73.73  ? 1326 ASP B OD1   1 
ATOM   6027 O  OD2   . ASP D 1 326 ? 1.877   31.403  34.810  1.00 73.40  ? 1326 ASP B OD2   1 
ATOM   6028 N  N     . GLU D 1 327 ? 3.696   28.074  33.772  1.00 73.08  ? 1327 GLU B N     1 
ATOM   6029 C  CA    . GLU D 1 327 ? 3.392   27.185  32.658  1.00 73.14  ? 1327 GLU B CA    1 
ATOM   6030 C  C     . GLU D 1 327 ? 2.145   27.666  31.936  1.00 73.04  ? 1327 GLU B C     1 
ATOM   6031 O  O     . GLU D 1 327 ? 1.824   27.191  30.846  1.00 72.93  ? 1327 GLU B O     1 
ATOM   6032 C  CB    . GLU D 1 327 ? 3.196   25.744  33.146  1.00 73.21  ? 1327 GLU B CB    1 
ATOM   6033 C  CG    . GLU D 1 327 ? 3.800   25.445  34.517  1.00 73.35  ? 1327 GLU B CG    1 
ATOM   6034 C  CD    . GLU D 1 327 ? 2.884   25.859  35.667  1.00 73.73  ? 1327 GLU B CD    1 
ATOM   6035 O  OE1   . GLU D 1 327 ? 2.449   24.966  36.430  1.00 73.77  ? 1327 GLU B OE1   1 
ATOM   6036 O  OE2   . GLU D 1 327 ? 2.590   27.070  35.803  1.00 73.29  ? 1327 GLU B OE2   1 
ATOM   6037 N  N     . ARG D 1 328 ? 1.446   28.615  32.550  1.00 73.04  ? 1328 ARG B N     1 
ATOM   6038 C  CA    . ARG D 1 328 ? 0.258   29.197  31.943  1.00 73.07  ? 1328 ARG B CA    1 
ATOM   6039 C  C     . ARG D 1 328 ? 0.602   29.862  30.621  1.00 72.98  ? 1328 ARG B C     1 
ATOM   6040 O  O     . ARG D 1 328 ? 1.728   30.330  30.425  1.00 73.02  ? 1328 ARG B O     1 
ATOM   6041 C  CB    . ARG D 1 328 ? -0.393  30.211  32.879  1.00 73.07  ? 1328 ARG B CB    1 
ATOM   6042 C  CG    . ARG D 1 328 ? -1.336  29.603  33.891  1.00 73.53  ? 1328 ARG B CG    1 
ATOM   6043 C  CD    . ARG D 1 328 ? -1.803  30.651  34.879  1.00 74.12  ? 1328 ARG B CD    1 
ATOM   6044 N  NE    . ARG D 1 328 ? -0.708  31.118  35.725  1.00 74.38  ? 1328 ARG B NE    1 
ATOM   6045 C  CZ    . ARG D 1 328 ? -0.844  32.012  36.698  1.00 74.66  ? 1328 ARG B CZ    1 
ATOM   6046 N  NH1   . ARG D 1 328 ? -2.031  32.545  36.955  1.00 74.56  ? 1328 ARG B NH1   1 
ATOM   6047 N  NH2   . ARG D 1 328 ? 0.210   32.374  37.416  1.00 74.87  ? 1328 ARG B NH2   1 
ATOM   6048 N  N     . LYS D 1 329 ? -0.374  29.890  29.718  1.00 72.82  ? 1329 LYS B N     1 
ATOM   6049 C  CA    . LYS D 1 329 ? -0.204  30.514  28.414  1.00 72.66  ? 1329 LYS B CA    1 
ATOM   6050 C  C     . LYS D 1 329 ? -0.432  32.015  28.548  1.00 72.33  ? 1329 LYS B C     1 
ATOM   6051 O  O     . LYS D 1 329 ? -1.264  32.448  29.341  1.00 72.31  ? 1329 LYS B O     1 
ATOM   6052 C  CB    . LYS D 1 329 ? -1.173  29.896  27.400  1.00 72.80  ? 1329 LYS B CB    1 
ATOM   6053 C  CG    . LYS D 1 329 ? -1.539  28.451  27.725  1.00 73.31  ? 1329 LYS B CG    1 
ATOM   6054 C  CD    . LYS D 1 329 ? -2.008  27.676  26.499  1.00 74.37  ? 1329 LYS B CD    1 
ATOM   6055 C  CE    . LYS D 1 329 ? -0.831  27.160  25.681  1.00 74.40  ? 1329 LYS B CE    1 
ATOM   6056 N  NZ    . LYS D 1 329 ? -1.275  26.281  24.563  1.00 74.38  ? 1329 LYS B NZ    1 
ATOM   6057 N  N     . ILE D 1 330 ? 0.317   32.804  27.782  1.00 72.06  ? 1330 ILE B N     1 
ATOM   6058 C  CA    . ILE D 1 330 ? 0.277   34.264  27.901  1.00 71.54  ? 1330 ILE B CA    1 
ATOM   6059 C  C     . ILE D 1 330 ? -0.685  34.893  26.898  1.00 71.19  ? 1330 ILE B C     1 
ATOM   6060 O  O     . ILE D 1 330 ? -0.654  34.575  25.714  1.00 71.21  ? 1330 ILE B O     1 
ATOM   6061 C  CB    . ILE D 1 330 ? 1.684   34.879  27.719  1.00 71.59  ? 1330 ILE B CB    1 
ATOM   6062 C  CG1   . ILE D 1 330 ? 2.693   34.171  28.622  1.00 71.44  ? 1330 ILE B CG1   1 
ATOM   6063 C  CG2   . ILE D 1 330 ? 1.674   36.382  28.007  1.00 71.77  ? 1330 ILE B CG2   1 
ATOM   6064 C  CD1   . ILE D 1 330 ? 4.088   34.727  28.517  1.00 71.64  ? 1330 ILE B CD1   1 
ATOM   6065 N  N     . ARG D 1 331 ? -1.530  35.795  27.383  1.00 70.79  ? 1331 ARG B N     1 
ATOM   6066 C  CA    . ARG D 1 331 ? -2.498  36.492  26.545  1.00 70.59  ? 1331 ARG B CA    1 
ATOM   6067 C  C     . ARG D 1 331 ? -2.026  37.913  26.231  1.00 70.00  ? 1331 ARG B C     1 
ATOM   6068 O  O     . ARG D 1 331 ? -2.002  38.343  25.074  1.00 69.80  ? 1331 ARG B O     1 
ATOM   6069 C  CB    . ARG D 1 331 ? -3.852  36.538  27.257  1.00 70.95  ? 1331 ARG B CB    1 
ATOM   6070 C  CG    . ARG D 1 331 ? -4.951  37.235  26.482  1.00 72.32  ? 1331 ARG B CG    1 
ATOM   6071 C  CD    . ARG D 1 331 ? -6.210  37.350  27.326  1.00 75.24  ? 1331 ARG B CD    1 
ATOM   6072 N  NE    . ARG D 1 331 ? -7.148  38.325  26.773  1.00 77.31  ? 1331 ARG B NE    1 
ATOM   6073 C  CZ    . ARG D 1 331 ? -8.239  38.011  26.079  1.00 78.24  ? 1331 ARG B CZ    1 
ATOM   6074 N  NH1   . ARG D 1 331 ? -8.540  36.737  25.851  1.00 77.87  ? 1331 ARG B NH1   1 
ATOM   6075 N  NH2   . ARG D 1 331 ? -9.028  38.976  25.615  1.00 78.80  ? 1331 ARG B NH2   1 
ATOM   6076 N  N     . ARG D 1 332 ? -1.660  38.640  27.278  1.00 69.34  ? 1332 ARG B N     1 
ATOM   6077 C  CA    . ARG D 1 332 ? -1.137  39.985  27.129  1.00 68.70  ? 1332 ARG B CA    1 
ATOM   6078 C  C     . ARG D 1 332 ? 0.301   40.035  27.614  1.00 67.76  ? 1332 ARG B C     1 
ATOM   6079 O  O     . ARG D 1 332 ? 0.619   39.577  28.712  1.00 67.65  ? 1332 ARG B O     1 
ATOM   6080 C  CB    . ARG D 1 332 ? -2.006  40.990  27.892  1.00 69.11  ? 1332 ARG B CB    1 
ATOM   6081 C  CG    . ARG D 1 332 ? -3.296  41.316  27.174  1.00 70.51  ? 1332 ARG B CG    1 
ATOM   6082 C  CD    . ARG D 1 332 ? -4.435  41.673  28.107  1.00 72.94  ? 1332 ARG B CD    1 
ATOM   6083 N  NE    . ARG D 1 332 ? -5.709  41.480  27.411  1.00 75.45  ? 1332 ARG B NE    1 
ATOM   6084 C  CZ    . ARG D 1 332 ? -6.898  41.403  28.003  1.00 76.83  ? 1332 ARG B CZ    1 
ATOM   6085 N  NH1   . ARG D 1 332 ? -6.999  41.509  29.326  1.00 77.34  ? 1332 ARG B NH1   1 
ATOM   6086 N  NH2   . ARG D 1 332 ? -7.991  41.220  27.267  1.00 77.52  ? 1332 ARG B NH2   1 
ATOM   6087 N  N     . ILE D 1 333 ? 1.174   40.577  26.777  1.00 66.65  ? 1333 ILE B N     1 
ATOM   6088 C  CA    . ILE D 1 333 ? 2.558   40.757  27.167  1.00 65.59  ? 1333 ILE B CA    1 
ATOM   6089 C  C     . ILE D 1 333 ? 2.916   42.232  27.144  1.00 64.71  ? 1333 ILE B C     1 
ATOM   6090 O  O     . ILE D 1 333 ? 2.663   42.944  26.168  1.00 64.58  ? 1333 ILE B O     1 
ATOM   6091 C  CB    . ILE D 1 333 ? 3.517   39.979  26.259  1.00 65.63  ? 1333 ILE B CB    1 
ATOM   6092 C  CG1   . ILE D 1 333 ? 4.925   39.964  26.867  1.00 66.13  ? 1333 ILE B CG1   1 
ATOM   6093 C  CG2   . ILE D 1 333 ? 3.506   40.559  24.859  1.00 65.25  ? 1333 ILE B CG2   1 
ATOM   6094 C  CD1   . ILE D 1 333 ? 5.019   39.212  28.193  1.00 66.09  ? 1333 ILE B CD1   1 
ATOM   6095 N  N     . GLY D 1 334 ? 3.501   42.694  28.235  1.00 63.39  ? 1334 GLY B N     1 
ATOM   6096 C  CA    . GLY D 1 334 ? 3.865   44.083  28.317  1.00 61.81  ? 1334 GLY B CA    1 
ATOM   6097 C  C     . GLY D 1 334 ? 5.092   44.263  29.157  1.00 60.57  ? 1334 GLY B C     1 
ATOM   6098 O  O     . GLY D 1 334 ? 5.785   43.303  29.482  1.00 60.56  ? 1334 GLY B O     1 
ATOM   6099 N  N     . VAL D 1 335 ? 5.349   45.506  29.525  1.00 59.40  ? 1335 VAL B N     1 
ATOM   6100 C  CA    . VAL D 1 335 ? 6.558   45.836  30.242  1.00 58.30  ? 1335 VAL B CA    1 
ATOM   6101 C  C     . VAL D 1 335 ? 6.291   47.049  31.109  1.00 57.56  ? 1335 VAL B C     1 
ATOM   6102 O  O     . VAL D 1 335 ? 5.480   47.906  30.770  1.00 57.18  ? 1335 VAL B O     1 
ATOM   6103 C  CB    . VAL D 1 335 ? 7.726   46.112  29.265  1.00 57.97  ? 1335 VAL B CB    1 
ATOM   6104 C  CG1   . VAL D 1 335 ? 7.594   47.483  28.660  1.00 57.81  ? 1335 VAL B CG1   1 
ATOM   6105 C  CG2   . VAL D 1 335 ? 9.033   45.981  29.967  1.00 58.12  ? 1335 VAL B CG2   1 
ATOM   6106 N  N     . ARG D 1 336 ? 6.954   47.105  32.250  1.00 56.91  ? 1336 ARG B N     1 
ATOM   6107 C  CA    . ARG D 1 336 ? 6.810   48.249  33.108  1.00 56.56  ? 1336 ARG B CA    1 
ATOM   6108 C  C     . ARG D 1 336 ? 8.181   48.738  33.500  1.00 55.91  ? 1336 ARG B C     1 
ATOM   6109 O  O     . ARG D 1 336 ? 9.078   47.951  33.798  1.00 55.92  ? 1336 ARG B O     1 
ATOM   6110 C  CB    . ARG D 1 336 ? 5.955   47.919  34.327  1.00 56.55  ? 1336 ARG B CB    1 
ATOM   6111 C  CG    . ARG D 1 336 ? 5.725   49.107  35.249  1.00 58.32  ? 1336 ARG B CG    1 
ATOM   6112 C  CD    . ARG D 1 336 ? 4.294   49.134  35.760  1.00 60.24  ? 1336 ARG B CD    1 
ATOM   6113 N  NE    . ARG D 1 336 ? 3.394   49.403  34.646  1.00 62.02  ? 1336 ARG B NE    1 
ATOM   6114 C  CZ    . ARG D 1 336 ? 2.971   50.614  34.304  1.00 61.31  ? 1336 ARG B CZ    1 
ATOM   6115 N  NH1   . ARG D 1 336 ? 3.340   51.668  35.019  1.00 61.34  ? 1336 ARG B NH1   1 
ATOM   6116 N  NH2   . ARG D 1 336 ? 2.166   50.763  33.257  1.00 60.20  ? 1336 ARG B NH2   1 
ATOM   6117 N  N     . PHE D 1 337 ? 8.343   50.049  33.464  1.00 55.40  ? 1337 PHE B N     1 
ATOM   6118 C  CA    . PHE D 1 337 ? 9.607   50.659  33.769  1.00 54.97  ? 1337 PHE B CA    1 
ATOM   6119 C  C     . PHE D 1 337 ? 9.435   51.558  34.960  1.00 55.16  ? 1337 PHE B C     1 
ATOM   6120 O  O     . PHE D 1 337 ? 8.424   52.245  35.084  1.00 54.80  ? 1337 PHE B O     1 
ATOM   6121 C  CB    . PHE D 1 337 ? 10.108  51.446  32.574  1.00 54.57  ? 1337 PHE B CB    1 
ATOM   6122 C  CG    . PHE D 1 337 ? 10.585  50.584  31.465  1.00 54.42  ? 1337 PHE B CG    1 
ATOM   6123 C  CD1   . PHE D 1 337 ? 11.841  49.995  31.523  1.00 54.00  ? 1337 PHE B CD1   1 
ATOM   6124 C  CD2   . PHE D 1 337 ? 9.778   50.341  30.367  1.00 54.28  ? 1337 PHE B CD2   1 
ATOM   6125 C  CE1   . PHE D 1 337 ? 12.287  49.191  30.502  1.00 53.97  ? 1337 PHE B CE1   1 
ATOM   6126 C  CE2   . PHE D 1 337 ? 10.223  49.538  29.340  1.00 54.84  ? 1337 PHE B CE2   1 
ATOM   6127 C  CZ    . PHE D 1 337 ? 11.483  48.965  29.410  1.00 54.32  ? 1337 PHE B CZ    1 
ATOM   6128 N  N     . SER D 1 338 ? 10.435  51.542  35.834  1.00 55.46  ? 1338 SER B N     1 
ATOM   6129 C  CA    . SER D 1 338 ? 10.339  52.223  37.106  1.00 56.03  ? 1338 SER B CA    1 
ATOM   6130 C  C     . SER D 1 338 ? 11.717  52.605  37.636  1.00 56.33  ? 1338 SER B C     1 
ATOM   6131 O  O     . SER D 1 338 ? 12.733  52.351  36.985  1.00 56.64  ? 1338 SER B O     1 
ATOM   6132 C  CB    . SER D 1 338 ? 9.597   51.344  38.114  1.00 55.89  ? 1338 SER B CB    1 
ATOM   6133 O  OG    . SER D 1 338 ? 10.083  50.011  38.096  1.00 55.89  ? 1338 SER B OG    1 
ATOM   6134 N  N     . LYS D 1 339 ? 11.735  53.222  38.814  1.00 56.54  ? 1339 LYS B N     1 
ATOM   6135 C  CA    . LYS D 1 339 ? 12.962  53.694  39.435  1.00 56.95  ? 1339 LYS B CA    1 
ATOM   6136 C  C     . LYS D 1 339 ? 13.724  54.609  38.481  1.00 57.19  ? 1339 LYS B C     1 
ATOM   6137 O  O     . LYS D 1 339 ? 14.835  54.309  38.048  1.00 57.20  ? 1339 LYS B O     1 
ATOM   6138 C  CB    . LYS D 1 339 ? 13.818  52.517  39.902  1.00 56.96  ? 1339 LYS B CB    1 
ATOM   6139 C  CG    . LYS D 1 339 ? 13.053  51.522  40.750  1.00 56.92  ? 1339 LYS B CG    1 
ATOM   6140 C  CD    . LYS D 1 339 ? 13.949  50.424  41.292  1.00 57.99  ? 1339 LYS B CD    1 
ATOM   6141 C  CE    . LYS D 1 339 ? 13.159  49.448  42.164  1.00 58.64  ? 1339 LYS B CE    1 
ATOM   6142 N  NZ    . LYS D 1 339 ? 14.030  48.801  43.193  1.00 59.92  ? 1339 LYS B NZ    1 
ATOM   6143 N  N     . PHE D 1 340 ? 13.101  55.734  38.158  1.00 57.51  ? 1340 PHE B N     1 
ATOM   6144 C  CA    . PHE D 1 340 ? 13.668  56.674  37.217  1.00 57.84  ? 1340 PHE B CA    1 
ATOM   6145 C  C     . PHE D 1 340 ? 14.771  57.463  37.864  1.00 58.18  ? 1340 PHE B C     1 
ATOM   6146 O  O     . PHE D 1 340 ? 14.710  57.769  39.051  1.00 58.47  ? 1340 PHE B O     1 
ATOM   6147 C  CB    . PHE D 1 340 ? 12.595  57.618  36.686  1.00 57.86  ? 1340 PHE B CB    1 
ATOM   6148 C  CG    . PHE D 1 340 ? 11.415  56.909  36.121  1.00 57.95  ? 1340 PHE B CG    1 
ATOM   6149 C  CD1   . PHE D 1 340 ? 11.575  55.693  35.481  1.00 57.63  ? 1340 PHE B CD1   1 
ATOM   6150 C  CD2   . PHE D 1 340 ? 10.150  57.450  36.229  1.00 58.07  ? 1340 PHE B CD2   1 
ATOM   6151 C  CE1   . PHE D 1 340 ? 10.496  55.025  34.973  1.00 58.74  ? 1340 PHE B CE1   1 
ATOM   6152 C  CE2   . PHE D 1 340 ? 9.068   56.795  35.708  1.00 58.81  ? 1340 PHE B CE2   1 
ATOM   6153 C  CZ    . PHE D 1 340 ? 9.240   55.578  35.075  1.00 58.97  ? 1340 PHE B CZ    1 
ATOM   6154 N  N     . ILE D 1 341 ? 15.779  57.791  37.069  1.00 58.64  ? 1341 ILE B N     1 
ATOM   6155 C  CA    . ILE D 1 341 ? 16.939  58.504  37.563  1.00 58.99  ? 1341 ILE B CA    1 
ATOM   6156 C  C     . ILE D 1 341 ? 16.561  59.935  37.941  1.00 59.34  ? 1341 ILE B C     1 
ATOM   6157 O  O     . ILE D 1 341 ? 15.790  60.581  37.229  1.00 59.06  ? 1341 ILE B O     1 
ATOM   6158 C  CB    . ILE D 1 341 ? 18.071  58.477  36.523  1.00 59.01  ? 1341 ILE B CB    1 
ATOM   6159 C  CG1   . ILE D 1 341 ? 18.631  57.054  36.417  1.00 58.83  ? 1341 ILE B CG1   1 
ATOM   6160 C  CG2   . ILE D 1 341 ? 19.166  59.479  36.878  1.00 58.63  ? 1341 ILE B CG2   1 
ATOM   6161 C  CD1   . ILE D 1 341 ? 19.534  56.850  35.230  1.00 59.52  ? 1341 ILE B CD1   1 
ATOM   6162 O  OXT   . ILE D 1 341 ? 17.002  60.455  38.979  1.00 59.71  ? 1341 ILE B OXT   1 
ATOM   6163 O  "O5'" . DG  E 2 1   ? 15.874  41.812  66.922  1.00 101.08 ? 1802 DG  H "O5'" 1 
ATOM   6164 C  "C5'" . DG  E 2 1   ? 16.079  41.703  65.518  1.00 101.17 ? 1802 DG  H "C5'" 1 
ATOM   6165 C  "C4'" . DG  E 2 1   ? 16.585  43.013  64.939  1.00 101.26 ? 1802 DG  H "C4'" 1 
ATOM   6166 O  "O4'" . DG  E 2 1   ? 17.683  42.748  64.027  1.00 101.49 ? 1802 DG  H "O4'" 1 
ATOM   6167 C  "C3'" . DG  E 2 1   ? 15.562  43.798  64.125  1.00 101.21 ? 1802 DG  H "C3'" 1 
ATOM   6168 O  "O3'" . DG  E 2 1   ? 15.838  45.194  64.223  1.00 100.83 ? 1802 DG  H "O3'" 1 
ATOM   6169 C  "C2'" . DG  E 2 1   ? 15.813  43.269  62.718  1.00 101.45 ? 1802 DG  H "C2'" 1 
ATOM   6170 C  "C1'" . DG  E 2 1   ? 17.332  43.173  62.724  1.00 101.79 ? 1802 DG  H "C1'" 1 
ATOM   6171 N  N9    . DG  E 2 1   ? 17.862  42.215  61.758  1.00 102.19 ? 1802 DG  H N9    1 
ATOM   6172 C  C8    . DG  E 2 1   ? 17.760  40.846  61.819  1.00 102.36 ? 1802 DG  H C8    1 
ATOM   6173 N  N7    . DG  E 2 1   ? 18.330  40.238  60.817  1.00 102.50 ? 1802 DG  H N7    1 
ATOM   6174 C  C5    . DG  E 2 1   ? 18.843  41.269  60.041  1.00 102.49 ? 1802 DG  H C5    1 
ATOM   6175 C  C6    . DG  E 2 1   ? 19.568  41.219  58.827  1.00 102.53 ? 1802 DG  H C6    1 
ATOM   6176 O  O6    . DG  E 2 1   ? 19.907  40.218  58.180  1.00 102.64 ? 1802 DG  H O6    1 
ATOM   6177 N  N1    . DG  E 2 1   ? 19.903  42.491  58.367  1.00 102.44 ? 1802 DG  H N1    1 
ATOM   6178 C  C2    . DG  E 2 1   ? 19.580  43.665  59.005  1.00 102.36 ? 1802 DG  H C2    1 
ATOM   6179 N  N2    . DG  E 2 1   ? 19.991  44.794  58.409  1.00 102.23 ? 1802 DG  H N2    1 
ATOM   6180 N  N3    . DG  E 2 1   ? 18.899  43.726  60.145  1.00 102.38 ? 1802 DG  H N3    1 
ATOM   6181 C  C4    . DG  E 2 1   ? 18.565  42.494  60.605  1.00 102.37 ? 1802 DG  H C4    1 
ATOM   6182 P  P     . DT  E 2 2   ? 15.049  46.267  63.330  1.00 100.51 ? 1803 DT  H P     1 
ATOM   6183 O  OP1   . DT  E 2 2   ? 14.852  47.478  64.159  1.00 100.54 ? 1803 DT  H OP1   1 
ATOM   6184 O  OP2   . DT  E 2 2   ? 13.878  45.599  62.717  1.00 100.53 ? 1803 DT  H OP2   1 
ATOM   6185 O  "O5'" . DT  E 2 2   ? 16.095  46.606  62.167  1.00 100.06 ? 1803 DT  H "O5'" 1 
ATOM   6186 C  "C5'" . DT  E 2 2   ? 16.561  47.942  61.990  1.00 99.36  ? 1803 DT  H "C5'" 1 
ATOM   6187 C  "C4'" . DT  E 2 2   ? 17.090  48.158  60.582  1.00 98.87  ? 1803 DT  H "C4'" 1 
ATOM   6188 O  "O4'" . DT  E 2 2   ? 17.386  46.881  59.958  1.00 98.88  ? 1803 DT  H "O4'" 1 
ATOM   6189 C  "C3'" . DT  E 2 2   ? 16.135  48.885  59.636  1.00 98.50  ? 1803 DT  H "C3'" 1 
ATOM   6190 O  "O3'" . DT  E 2 2   ? 16.858  49.869  58.904  1.00 97.75  ? 1803 DT  H "O3'" 1 
ATOM   6191 C  "C2'" . DT  E 2 2   ? 15.614  47.771  58.729  1.00 98.61  ? 1803 DT  H "C2'" 1 
ATOM   6192 C  "C1'" . DT  E 2 2   ? 16.836  46.864  58.655  1.00 98.82  ? 1803 DT  H "C1'" 1 
ATOM   6193 N  N1    . DT  E 2 2   ? 16.548  45.446  58.272  1.00 98.87  ? 1803 DT  H N1    1 
ATOM   6194 C  C2    . DT  E 2 2   ? 17.202  44.899  57.187  1.00 98.85  ? 1803 DT  H C2    1 
ATOM   6195 O  O2    . DT  E 2 2   ? 18.010  45.511  56.512  1.00 98.76  ? 1803 DT  H O2    1 
ATOM   6196 N  N3    . DT  E 2 2   ? 16.875  43.594  56.921  1.00 98.95  ? 1803 DT  H N3    1 
ATOM   6197 C  C4    . DT  E 2 2   ? 15.979  42.799  57.613  1.00 99.05  ? 1803 DT  H C4    1 
ATOM   6198 O  O4    . DT  E 2 2   ? 15.752  41.637  57.293  1.00 99.19  ? 1803 DT  H O4    1 
ATOM   6199 C  C5    . DT  E 2 2   ? 15.330  43.431  58.735  1.00 99.02  ? 1803 DT  H C5    1 
ATOM   6200 C  C7    . DT  E 2 2   ? 14.338  42.664  59.558  1.00 98.99  ? 1803 DT  H C7    1 
ATOM   6201 C  C6    . DT  E 2 2   ? 15.642  44.706  59.008  1.00 98.97  ? 1803 DT  H C6    1 
ATOM   6202 P  P     . DT  E 2 3   ? 16.101  51.069  58.162  1.00 97.22  ? 1804 DT  H P     1 
ATOM   6203 O  OP1   . DT  E 2 3   ? 16.741  52.333  58.591  1.00 97.07  ? 1804 DT  H OP1   1 
ATOM   6204 O  OP2   . DT  E 2 3   ? 14.643  50.880  58.341  1.00 97.33  ? 1804 DT  H OP2   1 
ATOM   6205 O  "O5'" . DT  E 2 3   ? 16.443  50.797  56.620  1.00 96.53  ? 1804 DT  H "O5'" 1 
ATOM   6206 C  "C5'" . DT  E 2 3   ? 17.725  50.276  56.270  1.00 95.48  ? 1804 DT  H "C5'" 1 
ATOM   6207 C  "C4'" . DT  E 2 3   ? 17.776  49.775  54.834  1.00 94.49  ? 1804 DT  H "C4'" 1 
ATOM   6208 O  "O4'" . DT  E 2 3   ? 17.366  48.384  54.774  1.00 94.33  ? 1804 DT  H "O4'" 1 
ATOM   6209 C  "C3'" . DT  E 2 3   ? 16.901  50.530  53.837  1.00 93.77  ? 1804 DT  H "C3'" 1 
ATOM   6210 O  "O3'" . DT  E 2 3   ? 17.675  50.838  52.687  1.00 92.82  ? 1804 DT  H "O3'" 1 
ATOM   6211 C  "C2'" . DT  E 2 3   ? 15.785  49.541  53.511  1.00 93.84  ? 1804 DT  H "C2'" 1 
ATOM   6212 C  "C1'" . DT  E 2 3   ? 16.492  48.203  53.681  1.00 94.02  ? 1804 DT  H "C1'" 1 
ATOM   6213 N  N1    . DT  E 2 3   ? 15.567  47.082  54.004  1.00 94.02  ? 1804 DT  H N1    1 
ATOM   6214 C  C2    . DT  E 2 3   ? 15.974  45.781  53.798  1.00 93.89  ? 1804 DT  H C2    1 
ATOM   6215 O  O2    . DT  E 2 3   ? 17.068  45.484  53.355  1.00 93.72  ? 1804 DT  H O2    1 
ATOM   6216 N  N3    . DT  E 2 3   ? 15.039  44.833  54.135  1.00 94.04  ? 1804 DT  H N3    1 
ATOM   6217 C  C4    . DT  E 2 3   ? 13.768  45.056  54.642  1.00 94.29  ? 1804 DT  H C4    1 
ATOM   6218 O  O4    . DT  E 2 3   ? 12.997  44.140  54.912  1.00 94.48  ? 1804 DT  H O4    1 
ATOM   6219 C  C5    . DT  E 2 3   ? 13.409  46.440  54.832  1.00 94.28  ? 1804 DT  H C5    1 
ATOM   6220 C  C7    . DT  E 2 3   ? 12.059  46.808  55.375  1.00 94.22  ? 1804 DT  H C7    1 
ATOM   6221 C  C6    . DT  E 2 3   ? 14.314  47.372  54.508  1.00 94.21  ? 1804 DT  H C6    1 
ATOM   6222 P  P     . DG  E 2 4   ? 17.073  51.706  51.485  1.00 92.15  ? 1805 DG  H P     1 
ATOM   6223 O  OP1   . DG  E 2 4   ? 18.095  52.717  51.129  1.00 92.07  ? 1805 DG  H OP1   1 
ATOM   6224 O  OP2   . DG  E 2 4   ? 15.702  52.135  51.846  1.00 92.30  ? 1805 DG  H OP2   1 
ATOM   6225 O  "O5'" . DG  E 2 4   ? 16.953  50.637  50.297  1.00 91.16  ? 1805 DG  H "O5'" 1 
ATOM   6226 C  "C5'" . DG  E 2 4   ? 18.025  49.725  50.062  1.00 89.24  ? 1805 DG  H "C5'" 1 
ATOM   6227 C  "C4'" . DG  E 2 4   ? 17.645  48.611  49.096  1.00 87.68  ? 1805 DG  H "C4'" 1 
ATOM   6228 O  "O4'" . DG  E 2 4   ? 16.981  47.529  49.802  1.00 87.43  ? 1805 DG  H "O4'" 1 
ATOM   6229 C  "C3'" . DG  E 2 4   ? 16.719  48.995  47.944  1.00 86.58  ? 1805 DG  H "C3'" 1 
ATOM   6230 O  "O3'" . DG  E 2 4   ? 17.254  48.411  46.756  1.00 84.79  ? 1805 DG  H "O3'" 1 
ATOM   6231 C  "C2'" . DG  E 2 4   ? 15.380  48.378  48.349  1.00 86.81  ? 1805 DG  H "C2'" 1 
ATOM   6232 C  "C1'" . DG  E 2 4   ? 15.864  47.112  49.044  1.00 87.19  ? 1805 DG  H "C1'" 1 
ATOM   6233 N  N9    . DG  E 2 4   ? 14.906  46.480  49.949  1.00 87.32  ? 1805 DG  H N9    1 
ATOM   6234 C  C8    . DG  E 2 4   ? 14.006  47.093  50.791  1.00 87.34  ? 1805 DG  H C8    1 
ATOM   6235 N  N7    . DG  E 2 4   ? 13.287  46.251  51.483  1.00 87.30  ? 1805 DG  H N7    1 
ATOM   6236 C  C5    . DG  E 2 4   ? 13.739  44.999  51.079  1.00 87.28  ? 1805 DG  H C5    1 
ATOM   6237 C  C6    . DG  E 2 4   ? 13.338  43.699  51.483  1.00 87.23  ? 1805 DG  H C6    1 
ATOM   6238 O  O6    . DG  E 2 4   ? 12.468  43.381  52.308  1.00 87.20  ? 1805 DG  H O6    1 
ATOM   6239 N  N1    . DG  E 2 4   ? 14.056  42.706  50.818  1.00 87.18  ? 1805 DG  H N1    1 
ATOM   6240 C  C2    . DG  E 2 4   ? 15.038  42.937  49.882  1.00 87.30  ? 1805 DG  H C2    1 
ATOM   6241 N  N2    . DG  E 2 4   ? 15.625  41.856  49.347  1.00 87.50  ? 1805 DG  H N2    1 
ATOM   6242 N  N3    . DG  E 2 4   ? 15.426  44.147  49.499  1.00 87.31  ? 1805 DG  H N3    1 
ATOM   6243 C  C4    . DG  E 2 4   ? 14.736  45.126  50.135  1.00 87.30  ? 1805 DG  H C4    1 
ATOM   6244 P  P     . DG  E 2 5   ? 16.578  48.567  45.310  1.00 83.17  ? 1806 DG  H P     1 
ATOM   6245 O  OP1   . DG  E 2 5   ? 17.666  48.888  44.358  1.00 83.07  ? 1806 DG  H OP1   1 
ATOM   6246 O  OP2   . DG  E 2 5   ? 15.394  49.454  45.412  1.00 83.05  ? 1806 DG  H OP2   1 
ATOM   6247 O  "O5'" . DG  E 2 5   ? 16.060  47.081  45.010  1.00 81.38  ? 1806 DG  H "O5'" 1 
ATOM   6248 C  "C5'" . DG  E 2 5   ? 16.970  45.978  45.063  1.00 78.15  ? 1806 DG  H "C5'" 1 
ATOM   6249 C  "C4'" . DG  E 2 5   ? 16.277  44.657  44.756  1.00 75.65  ? 1806 DG  H "C4'" 1 
ATOM   6250 O  "O4'" . DG  E 2 5   ? 15.433  44.264  45.870  1.00 75.23  ? 1806 DG  H "O4'" 1 
ATOM   6251 C  "C3'" . DG  E 2 5   ? 15.369  44.648  43.528  1.00 73.86  ? 1806 DG  H "C3'" 1 
ATOM   6252 O  "O3'" . DG  E 2 5   ? 15.458  43.369  42.912  1.00 71.09  ? 1806 DG  H "O3'" 1 
ATOM   6253 C  "C2'" . DG  E 2 5   ? 13.987  44.891  44.126  1.00 74.20  ? 1806 DG  H "C2'" 1 
ATOM   6254 C  "C1'" . DG  E 2 5   ? 14.101  44.097  45.421  1.00 74.79  ? 1806 DG  H "C1'" 1 
ATOM   6255 N  N9    . DG  E 2 5   ? 13.196  44.528  46.485  1.00 74.99  ? 1806 DG  H N9    1 
ATOM   6256 C  C8    . DG  E 2 5   ? 12.773  45.805  46.780  1.00 75.04  ? 1806 DG  H C8    1 
ATOM   6257 N  N7    . DG  E 2 5   ? 11.960  45.858  47.800  1.00 74.97  ? 1806 DG  H N7    1 
ATOM   6258 C  C5    . DG  E 2 5   ? 11.836  44.533  48.209  1.00 74.92  ? 1806 DG  H C5    1 
ATOM   6259 C  C6    . DG  E 2 5   ? 11.086  43.959  49.267  1.00 74.80  ? 1806 DG  H C6    1 
ATOM   6260 O  O6    . DG  E 2 5   ? 10.354  44.526  50.092  1.00 74.77  ? 1806 DG  H O6    1 
ATOM   6261 N  N1    . DG  E 2 5   ? 11.248  42.575  49.321  1.00 74.58  ? 1806 DG  H N1    1 
ATOM   6262 C  C2    . DG  E 2 5   ? 12.032  41.838  48.464  1.00 74.61  ? 1806 DG  H C2    1 
ATOM   6263 N  N2    . DG  E 2 5   ? 12.068  40.514  48.667  1.00 74.63  ? 1806 DG  H N2    1 
ATOM   6264 N  N3    . DG  E 2 5   ? 12.738  42.361  47.472  1.00 74.74  ? 1806 DG  H N3    1 
ATOM   6265 C  C4    . DG  E 2 5   ? 12.592  43.706  47.407  1.00 74.86  ? 1806 DG  H C4    1 
ATOM   6266 P  P     . DA  E 2 6   ? 14.978  43.126  41.404  1.00 68.52  ? 1807 DA  H P     1 
ATOM   6267 O  OP1   . DA  E 2 6   ? 16.178  43.048  40.541  1.00 68.19  ? 1807 DA  H OP1   1 
ATOM   6268 O  OP2   . DA  E 2 6   ? 13.910  44.102  41.091  1.00 68.35  ? 1807 DA  H OP2   1 
ATOM   6269 O  "O5'" . DA  E 2 6   ? 14.327  41.666  41.494  1.00 66.96  ? 1807 DA  H "O5'" 1 
ATOM   6270 C  "C5'" . DA  E 2 6   ? 14.353  40.933  42.720  1.00 64.16  ? 1807 DA  H "C5'" 1 
ATOM   6271 C  "C4'" . DA  E 2 6   ? 13.033  40.215  42.950  1.00 62.02  ? 1807 DA  H "C4'" 1 
ATOM   6272 O  "O4'" . DA  E 2 6   ? 12.339  40.786  44.088  1.00 61.36  ? 1807 DA  H "O4'" 1 
ATOM   6273 C  "C3'" . DA  E 2 6   ? 12.040  40.285  41.793  1.00 60.89  ? 1807 DA  H "C3'" 1 
ATOM   6274 O  "O3'" . DA  E 2 6   ? 11.516  38.997  41.577  1.00 59.67  ? 1807 DA  H "O3'" 1 
ATOM   6275 C  "C2'" . DA  E 2 6   ? 10.950  41.235  42.282  1.00 60.32  ? 1807 DA  H "C2'" 1 
ATOM   6276 C  "C1'" . DA  E 2 6   ? 10.968  40.904  43.764  1.00 60.40  ? 1807 DA  H "C1'" 1 
ATOM   6277 N  N9    . DA  E 2 6   ? 10.416  41.930  44.635  1.00 60.07  ? 1807 DA  H N9    1 
ATOM   6278 C  C8    . DA  E 2 6   ? 10.624  43.280  44.575  1.00 60.17  ? 1807 DA  H C8    1 
ATOM   6279 N  N7    . DA  E 2 6   ? 9.996   43.953  45.511  1.00 60.07  ? 1807 DA  H N7    1 
ATOM   6280 C  C5    . DA  E 2 6   ? 9.338   42.972  46.236  1.00 59.87  ? 1807 DA  H C5    1 
ATOM   6281 C  C6    . DA  E 2 6   ? 8.497   43.027  47.363  1.00 59.96  ? 1807 DA  H C6    1 
ATOM   6282 N  N6    . DA  E 2 6   ? 8.168   44.168  47.977  1.00 60.41  ? 1807 DA  H N6    1 
ATOM   6283 N  N1    . DA  E 2 6   ? 8.008   41.861  47.833  1.00 59.68  ? 1807 DA  H N1    1 
ATOM   6284 C  C2    . DA  E 2 6   ? 8.336   40.722  47.212  1.00 59.62  ? 1807 DA  H C2    1 
ATOM   6285 N  N3    . DA  E 2 6   ? 9.116   40.542  46.149  1.00 59.62  ? 1807 DA  H N3    1 
ATOM   6286 C  C4    . DA  E 2 6   ? 9.588   41.719  45.709  1.00 59.88  ? 1807 DA  H C4    1 
ATOM   6287 P  P     . DT  E 2 7   ? 10.829  38.677  40.179  1.00 58.69  ? 1808 DT  H P     1 
ATOM   6288 O  OP1   . DT  E 2 7   ? 11.397  37.404  39.694  1.00 59.03  ? 1808 DT  H OP1   1 
ATOM   6289 O  OP2   . DT  E 2 7   ? 10.920  39.899  39.351  1.00 59.78  ? 1808 DT  H OP2   1 
ATOM   6290 O  "O5'" . DT  E 2 7   ? 9.289   38.461  40.561  1.00 57.92  ? 1808 DT  H "O5'" 1 
ATOM   6291 C  "C5'" . DT  E 2 7   ? 8.946   37.661  41.683  1.00 56.25  ? 1808 DT  H "C5'" 1 
ATOM   6292 C  "C4'" . DT  E 2 7   ? 7.604   38.071  42.257  1.00 55.40  ? 1808 DT  H "C4'" 1 
ATOM   6293 O  "O4'" . DT  E 2 7   ? 7.727   39.309  43.001  1.00 54.74  ? 1808 DT  H "O4'" 1 
ATOM   6294 C  "C3'" . DT  E 2 7   ? 6.502   38.305  41.225  1.00 55.08  ? 1808 DT  H "C3'" 1 
ATOM   6295 O  "O3'" . DT  E 2 7   ? 5.464   37.364  41.437  1.00 56.01  ? 1808 DT  H "O3'" 1 
ATOM   6296 C  "C2'" . DT  E 2 7   ? 6.022   39.729  41.495  1.00 54.23  ? 1808 DT  H "C2'" 1 
ATOM   6297 C  "C1'" . DT  E 2 7   ? 6.460   39.926  42.937  1.00 54.23  ? 1808 DT  H "C1'" 1 
ATOM   6298 N  N1    . DT  E 2 7   ? 6.572   41.351  43.349  1.00 53.86  ? 1808 DT  H N1    1 
ATOM   6299 C  C2    . DT  E 2 7   ? 5.968   41.759  44.519  1.00 53.46  ? 1808 DT  H C2    1 
ATOM   6300 O  O2    . DT  E 2 7   ? 5.342   41.007  45.244  1.00 53.13  ? 1808 DT  H O2    1 
ATOM   6301 N  N3    . DT  E 2 7   ? 6.124   43.089  44.812  1.00 52.97  ? 1808 DT  H N3    1 
ATOM   6302 C  C4    . DT  E 2 7   ? 6.808   44.025  44.063  1.00 53.46  ? 1808 DT  H C4    1 
ATOM   6303 O  O4    . DT  E 2 7   ? 6.896   45.198  44.410  1.00 53.67  ? 1808 DT  H O4    1 
ATOM   6304 C  C5    . DT  E 2 7   ? 7.415   43.531  42.849  1.00 54.08  ? 1808 DT  H C5    1 
ATOM   6305 C  C7    . DT  E 2 7   ? 8.191   44.453  41.950  1.00 54.07  ? 1808 DT  H C7    1 
ATOM   6306 C  C6    . DT  E 2 7   ? 7.269   42.234  42.552  1.00 53.77  ? 1808 DT  H C6    1 
ATOM   6307 P  P     . DG  E 2 8   ? 4.289   37.159  40.363  1.00 57.40  ? 1809 DG  H P     1 
ATOM   6308 O  OP1   . DG  E 2 8   ? 4.660   35.948  39.592  1.00 57.55  ? 1809 DG  H OP1   1 
ATOM   6309 O  OP2   . DG  E 2 8   ? 4.011   38.442  39.667  1.00 57.00  ? 1809 DG  H OP2   1 
ATOM   6310 O  "O5'" . DG  E 2 8   ? 3.013   36.844  41.273  1.00 56.64  ? 1809 DG  H "O5'" 1 
ATOM   6311 C  "C5'" . DG  E 2 8   ? 3.171   36.737  42.680  1.00 56.67  ? 1809 DG  H "C5'" 1 
ATOM   6312 C  "C4'" . DG  E 2 8   ? 2.096   37.511  43.421  1.00 56.75  ? 1809 DG  H "C4'" 1 
ATOM   6313 O  "O4'" . DG  E 2 8   ? 2.593   38.825  43.771  1.00 56.91  ? 1809 DG  H "O4'" 1 
ATOM   6314 C  "C3'" . DG  E 2 8   ? 0.787   37.731  42.665  1.00 57.00  ? 1809 DG  H "C3'" 1 
ATOM   6315 O  "O3'" . DG  E 2 8   ? -0.260  37.249  43.488  1.00 57.65  ? 1809 DG  H "O3'" 1 
ATOM   6316 C  "C2'" . DG  E 2 8   ? 0.703   39.246  42.467  1.00 56.63  ? 1809 DG  H "C2'" 1 
ATOM   6317 C  "C1'" . DG  E 2 8   ? 1.530   39.750  43.641  1.00 56.47  ? 1809 DG  H "C1'" 1 
ATOM   6318 N  N9    . DG  E 2 8   ? 2.117   41.072  43.461  1.00 55.97  ? 1809 DG  H N9    1 
ATOM   6319 C  C8    . DG  E 2 8   ? 2.910   41.501  42.425  1.00 56.22  ? 1809 DG  H C8    1 
ATOM   6320 N  N7    . DG  E 2 8   ? 3.299   42.740  42.546  1.00 55.99  ? 1809 DG  H N7    1 
ATOM   6321 C  C5    . DG  E 2 8   ? 2.729   43.161  43.740  1.00 55.91  ? 1809 DG  H C5    1 
ATOM   6322 C  C6    . DG  E 2 8   ? 2.800   44.417  44.396  1.00 55.86  ? 1809 DG  H C6    1 
ATOM   6323 O  O6    . DG  E 2 8   ? 3.399   45.447  44.041  1.00 55.38  ? 1809 DG  H O6    1 
ATOM   6324 N  N1    . DG  E 2 8   ? 2.071   44.412  45.584  1.00 55.59  ? 1809 DG  H N1    1 
ATOM   6325 C  C2    . DG  E 2 8   ? 1.372   43.333  46.078  1.00 56.08  ? 1809 DG  H C2    1 
ATOM   6326 N  N2    . DG  E 2 8   ? 0.737   43.514  47.243  1.00 55.97  ? 1809 DG  H N2    1 
ATOM   6327 N  N3    . DG  E 2 8   ? 1.304   42.153  45.476  1.00 56.29  ? 1809 DG  H N3    1 
ATOM   6328 C  C4    . DG  E 2 8   ? 2.002   42.142  44.315  1.00 55.97  ? 1809 DG  H C4    1 
ATOM   6329 P  P     . DG  E 2 9   ? -1.803  37.442  43.107  1.00 58.26  ? 1810 DG  H P     1 
ATOM   6330 O  OP1   . DG  E 2 9   ? -2.496  36.218  43.585  1.00 58.02  ? 1810 DG  H OP1   1 
ATOM   6331 O  OP2   . DG  E 2 9   ? -1.929  37.883  41.695  1.00 57.40  ? 1810 DG  H OP2   1 
ATOM   6332 O  "O5'" . DG  E 2 9   ? -2.233  38.672  44.028  1.00 57.39  ? 1810 DG  H "O5'" 1 
ATOM   6333 C  "C5'" . DG  E 2 9   ? -1.945  38.629  45.416  1.00 56.93  ? 1810 DG  H "C5'" 1 
ATOM   6334 C  "C4'" . DG  E 2 9   ? -2.820  39.624  46.149  1.00 56.42  ? 1810 DG  H "C4'" 1 
ATOM   6335 O  "O4'" . DG  E 2 9   ? -2.209  40.936  46.096  1.00 55.29  ? 1810 DG  H "O4'" 1 
ATOM   6336 C  "C3'" . DG  E 2 9   ? -4.204  39.806  45.551  1.00 56.76  ? 1810 DG  H "C3'" 1 
ATOM   6337 O  "O3'" . DG  E 2 9   ? -5.102  40.202  46.568  1.00 58.73  ? 1810 DG  H "O3'" 1 
ATOM   6338 C  "C2'" . DG  E 2 9   ? -3.988  40.933  44.552  1.00 55.78  ? 1810 DG  H "C2'" 1 
ATOM   6339 C  "C1'" . DG  E 2 9   ? -2.988  41.800  45.303  1.00 53.94  ? 1810 DG  H "C1'" 1 
ATOM   6340 N  N9    . DG  E 2 9   ? -2.077  42.500  44.416  1.00 52.31  ? 1810 DG  H N9    1 
ATOM   6341 C  C8    . DG  E 2 9   ? -1.485  42.014  43.273  1.00 51.71  ? 1810 DG  H C8    1 
ATOM   6342 N  N7    . DG  E 2 9   ? -0.716  42.887  42.686  1.00 51.42  ? 1810 DG  H N7    1 
ATOM   6343 C  C5    . DG  E 2 9   ? -0.806  44.018  43.494  1.00 50.79  ? 1810 DG  H C5    1 
ATOM   6344 C  C6    . DG  E 2 9   ? -0.191  45.283  43.372  1.00 49.48  ? 1810 DG  H C6    1 
ATOM   6345 O  O6    . DG  E 2 9   ? 0.590   45.664  42.497  1.00 49.72  ? 1810 DG  H O6    1 
ATOM   6346 N  N1    . DG  E 2 9   ? -0.557  46.144  44.403  1.00 48.91  ? 1810 DG  H N1    1 
ATOM   6347 C  C2    . DG  E 2 9   ? -1.406  45.816  45.438  1.00 49.23  ? 1810 DG  H C2    1 
ATOM   6348 N  N2    . DG  E 2 9   ? -1.641  46.769  46.350  1.00 48.70  ? 1810 DG  H N2    1 
ATOM   6349 N  N3    . DG  E 2 9   ? -1.988  44.635  45.570  1.00 49.71  ? 1810 DG  H N3    1 
ATOM   6350 C  C4    . DG  E 2 9   ? -1.643  43.794  44.564  1.00 51.08  ? 1810 DG  H C4    1 
ATOM   6351 P  P     . DT  E 2 10  ? -6.639  40.447  46.202  1.00 60.53  ? 1811 DT  H P     1 
ATOM   6352 O  OP1   . DT  E 2 10  ? -7.466  39.908  47.312  1.00 59.98  ? 1811 DT  H OP1   1 
ATOM   6353 O  OP2   . DT  E 2 10  ? -6.875  40.007  44.804  1.00 60.78  ? 1811 DT  H OP2   1 
ATOM   6354 O  "O5'" . DT  E 2 10  ? -6.703  42.046  46.196  1.00 60.03  ? 1811 DT  H "O5'" 1 
ATOM   6355 C  "C5'" . DT  E 2 10  ? -6.350  42.765  47.362  1.00 59.19  ? 1811 DT  H "C5'" 1 
ATOM   6356 C  "C4'" . DT  E 2 10  ? -6.501  44.239  47.071  1.00 58.62  ? 1811 DT  H "C4'" 1 
ATOM   6357 O  "O4'" . DT  E 2 10  ? -5.404  44.648  46.222  1.00 58.83  ? 1811 DT  H "O4'" 1 
ATOM   6358 C  "C3'" . DT  E 2 10  ? -7.773  44.595  46.312  1.00 58.23  ? 1811 DT  H "C3'" 1 
ATOM   6359 O  "O3'" . DT  E 2 10  ? -8.563  45.416  47.148  1.00 58.11  ? 1811 DT  H "O3'" 1 
ATOM   6360 C  "C2'" . DT  E 2 10  ? -7.294  45.340  45.064  1.00 58.09  ? 1811 DT  H "C2'" 1 
ATOM   6361 C  "C1'" . DT  E 2 10  ? -5.846  45.683  45.385  1.00 57.31  ? 1811 DT  H "C1'" 1 
ATOM   6362 N  N1    . DT  E 2 10  ? -4.973  45.690  44.190  1.00 57.10  ? 1811 DT  H N1    1 
ATOM   6363 C  C2    . DT  E 2 10  ? -4.217  46.808  43.930  1.00 56.23  ? 1811 DT  H C2    1 
ATOM   6364 O  O2    . DT  E 2 10  ? -4.219  47.801  44.636  1.00 56.12  ? 1811 DT  H O2    1 
ATOM   6365 N  N3    . DT  E 2 10  ? -3.453  46.716  42.799  1.00 55.92  ? 1811 DT  H N3    1 
ATOM   6366 C  C4    . DT  E 2 10  ? -3.366  45.653  41.922  1.00 56.66  ? 1811 DT  H C4    1 
ATOM   6367 O  O4    . DT  E 2 10  ? -2.634  45.696  40.932  1.00 57.68  ? 1811 DT  H O4    1 
ATOM   6368 C  C5    . DT  E 2 10  ? -4.187  44.512  42.253  1.00 56.44  ? 1811 DT  H C5    1 
ATOM   6369 C  C7    . DT  E 2 10  ? -4.193  43.287  41.388  1.00 55.78  ? 1811 DT  H C7    1 
ATOM   6370 C  C6    . DT  E 2 10  ? -4.942  44.586  43.357  1.00 56.98  ? 1811 DT  H C6    1 
ATOM   6371 P  P     . DA  E 2 11  ? -9.906  46.105  46.631  1.00 57.61  ? 1812 DA  H P     1 
ATOM   6372 O  OP1   . DA  E 2 11  ? -10.784 46.279  47.807  1.00 58.06  ? 1812 DA  H OP1   1 
ATOM   6373 O  OP2   . DA  E 2 11  ? -10.401 45.370  45.449  1.00 59.08  ? 1812 DA  H OP2   1 
ATOM   6374 O  "O5'" . DA  E 2 11  ? -9.410  47.528  46.133  1.00 57.17  ? 1812 DA  H "O5'" 1 
ATOM   6375 C  "C5'" . DA  E 2 11  ? -8.516  48.278  46.918  1.00 57.52  ? 1812 DA  H "C5'" 1 
ATOM   6376 C  "C4'" . DA  E 2 11  ? -8.251  49.548  46.157  1.00 57.73  ? 1812 DA  H "C4'" 1 
ATOM   6377 O  "O4'" . DA  E 2 11  ? -7.254  49.230  45.168  1.00 57.72  ? 1812 DA  H "O4'" 1 
ATOM   6378 C  "C3'" . DA  E 2 11  ? -9.473  50.046  45.393  1.00 58.89  ? 1812 DA  H "C3'" 1 
ATOM   6379 O  "O3'" . DA  E 2 11  ? -9.825  51.348  45.823  1.00 60.58  ? 1812 DA  H "O3'" 1 
ATOM   6380 C  "C2'" . DA  E 2 11  ? -9.066  50.027  43.917  1.00 58.57  ? 1812 DA  H "C2'" 1 
ATOM   6381 C  "C1'" . DA  E 2 11  ? -7.552  49.891  43.964  1.00 57.57  ? 1812 DA  H "C1'" 1 
ATOM   6382 N  N9    . DA  E 2 11  ? -7.030  49.077  42.875  1.00 56.98  ? 1812 DA  H N9    1 
ATOM   6383 C  C8    . DA  E 2 11  ? -7.433  47.819  42.521  1.00 56.32  ? 1812 DA  H C8    1 
ATOM   6384 N  N7    . DA  E 2 11  ? -6.781  47.336  41.495  1.00 56.16  ? 1812 DA  H N7    1 
ATOM   6385 C  C5    . DA  E 2 11  ? -5.889  48.346  41.158  1.00 55.97  ? 1812 DA  H C5    1 
ATOM   6386 C  C6    . DA  E 2 11  ? -4.911  48.463  40.156  1.00 55.21  ? 1812 DA  H C6    1 
ATOM   6387 N  N6    . DA  E 2 11  ? -4.646  47.511  39.263  1.00 55.26  ? 1812 DA  H N6    1 
ATOM   6388 N  N1    . DA  E 2 11  ? -4.203  49.602  40.105  1.00 55.72  ? 1812 DA  H N1    1 
ATOM   6389 C  C2    . DA  E 2 11  ? -4.450  50.570  40.988  1.00 55.61  ? 1812 DA  H C2    1 
ATOM   6390 N  N3    . DA  E 2 11  ? -5.335  50.576  41.975  1.00 56.09  ? 1812 DA  H N3    1 
ATOM   6391 C  C4    . DA  E 2 11  ? -6.030  49.426  42.001  1.00 56.23  ? 1812 DA  H C4    1 
ATOM   6392 P  P     . DG  E 2 12  ? -11.115 52.058  45.216  1.00 61.11  ? 1813 DG  H P     1 
ATOM   6393 O  OP1   . DG  E 2 12  ? -11.970 52.529  46.323  1.00 66.65  ? 1813 DG  H OP1   1 
ATOM   6394 O  OP2   . DG  E 2 12  ? -11.684 51.177  44.183  1.00 62.38  ? 1813 DG  H OP2   1 
ATOM   6395 O  "O5'" . DG  E 2 12  ? -10.510 53.346  44.513  1.00 62.75  ? 1813 DG  H "O5'" 1 
ATOM   6396 C  "C5'" . DG  E 2 12  ? -9.137  53.669  44.652  1.00 64.38  ? 1813 DG  H "C5'" 1 
ATOM   6397 C  "C4'" . DG  E 2 12  ? -8.750  54.398  43.390  1.00 64.95  ? 1813 DG  H "C4'" 1 
ATOM   6398 O  "O4'" . DG  E 2 12  ? -8.005  53.471  42.562  1.00 64.25  ? 1813 DG  H "O4'" 1 
ATOM   6399 C  "C3'" . DG  E 2 12  ? -10.008 54.820  42.624  1.00 65.69  ? 1813 DG  H "C3'" 1 
ATOM   6400 O  "O3'" . DG  E 2 12  ? -9.999  56.196  42.184  1.00 67.13  ? 1813 DG  H "O3'" 1 
ATOM   6401 C  "C2'" . DG  E 2 12  ? -10.065 53.827  41.466  1.00 64.86  ? 1813 DG  H "C2'" 1 
ATOM   6402 C  "C1'" . DG  E 2 12  ? -8.588  53.492  41.283  1.00 64.04  ? 1813 DG  H "C1'" 1 
ATOM   6403 N  N9    . DG  E 2 12  ? -8.412  52.241  40.559  1.00 62.20  ? 1813 DG  H N9    1 
ATOM   6404 C  C8    . DG  E 2 12  ? -9.114  51.064  40.682  1.00 61.77  ? 1813 DG  H C8    1 
ATOM   6405 N  N7    . DG  E 2 12  ? -8.724  50.142  39.846  1.00 60.92  ? 1813 DG  H N7    1 
ATOM   6406 C  C5    . DG  E 2 12  ? -7.706  50.757  39.116  1.00 61.41  ? 1813 DG  H C5    1 
ATOM   6407 C  C6    . DG  E 2 12  ? -6.892  50.273  38.058  1.00 60.59  ? 1813 DG  H C6    1 
ATOM   6408 O  O6    . DG  E 2 12  ? -6.906  49.154  37.529  1.00 60.15  ? 1813 DG  H O6    1 
ATOM   6409 N  N1    . DG  E 2 12  ? -5.999  51.244  37.611  1.00 60.17  ? 1813 DG  H N1    1 
ATOM   6410 C  C2    . DG  E 2 12  ? -5.895  52.519  38.121  1.00 60.89  ? 1813 DG  H C2    1 
ATOM   6411 N  N2    . DG  E 2 12  ? -4.981  53.325  37.571  1.00 60.81  ? 1813 DG  H N2    1 
ATOM   6412 N  N3    . DG  E 2 12  ? -6.643  52.987  39.108  1.00 61.22  ? 1813 DG  H N3    1 
ATOM   6413 C  C4    . DG  E 2 12  ? -7.517  52.053  39.546  1.00 61.60  ? 1813 DG  H C4    1 
HETATM 6414 P  P     . 2DA E 2 13  ? -11.280 56.864  41.429  1.00 68.13  ? 1814 2DA H P     1 
HETATM 6415 O  OP1   . 2DA E 2 13  ? -11.662 58.135  42.095  1.00 70.07  ? 1814 2DA H OP1   1 
HETATM 6416 O  OP2   . 2DA E 2 13  ? -12.349 55.901  41.054  1.00 69.71  ? 1814 2DA H OP2   1 
HETATM 6417 O  "O5'" . 2DA E 2 13  ? -10.458 57.259  40.121  1.00 68.00  ? 1814 2DA H "O5'" 1 
HETATM 6418 C  "C5'" . 2DA E 2 13  ? -9.108  57.612  40.396  1.00 66.58  ? 1814 2DA H "C5'" 1 
HETATM 6419 C  "C4'" . 2DA E 2 13  ? -8.428  57.933  39.087  1.00 64.72  ? 1814 2DA H "C4'" 1 
HETATM 6420 O  "O4'" . 2DA E 2 13  ? -7.631  56.789  38.692  1.00 64.02  ? 1814 2DA H "O4'" 1 
HETATM 6421 C  "C3'" . 2DA E 2 13  ? -9.412  58.159  37.948  1.00 64.22  ? 1814 2DA H "C3'" 1 
HETATM 6422 C  "C2'" . 2DA E 2 13  ? -8.631  57.681  36.722  1.00 63.27  ? 1814 2DA H "C2'" 1 
HETATM 6423 C  "C1'" . 2DA E 2 13  ? -7.816  56.528  37.309  1.00 62.70  ? 1814 2DA H "C1'" 1 
HETATM 6424 N  N9    . 2DA E 2 13  ? -8.416  55.198  37.195  1.00 61.12  ? 1814 2DA H N9    1 
HETATM 6425 C  C8    . 2DA E 2 13  ? -9.336  54.634  38.030  1.00 60.20  ? 1814 2DA H C8    1 
HETATM 6426 N  N7    . 2DA E 2 13  ? -9.688  53.419  37.700  1.00 60.00  ? 1814 2DA H N7    1 
HETATM 6427 C  C5    . 2DA E 2 13  ? -8.936  53.160  36.576  1.00 59.61  ? 1814 2DA H C5    1 
HETATM 6428 C  C6    . 2DA E 2 13  ? -8.852  52.030  35.752  1.00 58.89  ? 1814 2DA H C6    1 
HETATM 6429 N  N6    . 2DA E 2 13  ? -9.576  50.933  35.984  1.00 57.66  ? 1814 2DA H N6    1 
HETATM 6430 N  N1    . 2DA E 2 13  ? -8.008  52.086  34.697  1.00 58.43  ? 1814 2DA H N1    1 
HETATM 6431 C  C2    . 2DA E 2 13  ? -7.299  53.205  34.502  1.00 59.17  ? 1814 2DA H C2    1 
HETATM 6432 N  N3    . 2DA E 2 13  ? -7.292  54.333  35.209  1.00 59.51  ? 1814 2DA H N3    1 
HETATM 6433 C  C4    . 2DA E 2 13  ? -8.142  54.243  36.246  1.00 60.43  ? 1814 2DA H C4    1 
ATOM   6434 P  P     . DC  F 3 5   ? -10.113 42.601  30.333  1.00 75.77  ? 1905 DC  J P     1 
ATOM   6435 O  OP1   . DC  F 3 5   ? -11.063 41.488  30.075  1.00 75.07  ? 1905 DC  J OP1   1 
ATOM   6436 O  OP2   . DC  F 3 5   ? -8.993  42.447  31.296  1.00 75.38  ? 1905 DC  J OP2   1 
ATOM   6437 O  "O5'" . DC  F 3 5   ? -9.505  43.110  28.935  1.00 73.71  ? 1905 DC  J "O5'" 1 
ATOM   6438 C  "C5'" . DC  F 3 5   ? -10.297 43.917  28.044  1.00 70.67  ? 1905 DC  J "C5'" 1 
ATOM   6439 C  "C4'" . DC  F 3 5   ? -9.509  45.065  27.419  1.00 67.71  ? 1905 DC  J "C4'" 1 
ATOM   6440 O  "O4'" . DC  F 3 5   ? -10.030 46.332  27.891  1.00 65.97  ? 1905 DC  J "O4'" 1 
ATOM   6441 C  "C3'" . DC  F 3 5   ? -8.015  45.118  27.721  1.00 66.66  ? 1905 DC  J "C3'" 1 
ATOM   6442 O  "O3'" . DC  F 3 5   ? -7.342  45.678  26.584  1.00 66.49  ? 1905 DC  J "O3'" 1 
ATOM   6443 C  "C2'" . DC  F 3 5   ? -7.958  45.995  28.973  1.00 65.48  ? 1905 DC  J "C2'" 1 
ATOM   6444 C  "C1'" . DC  F 3 5   ? -9.124  46.957  28.779  1.00 63.88  ? 1905 DC  J "C1'" 1 
ATOM   6445 N  N1    . DC  F 3 5   ? -9.858  47.318  30.039  1.00 62.22  ? 1905 DC  J N1    1 
ATOM   6446 C  C2    . DC  F 3 5   ? -9.917  48.659  30.447  1.00 60.86  ? 1905 DC  J C2    1 
ATOM   6447 O  O2    . DC  F 3 5   ? -9.361  49.528  29.774  1.00 60.17  ? 1905 DC  J O2    1 
ATOM   6448 N  N3    . DC  F 3 5   ? -10.583 48.979  31.579  1.00 60.53  ? 1905 DC  J N3    1 
ATOM   6449 C  C4    . DC  F 3 5   ? -11.179 48.028  32.302  1.00 60.85  ? 1905 DC  J C4    1 
ATOM   6450 N  N4    . DC  F 3 5   ? -11.820 48.413  33.410  1.00 59.07  ? 1905 DC  J N4    1 
ATOM   6451 C  C5    . DC  F 3 5   ? -11.141 46.653  31.911  1.00 61.28  ? 1905 DC  J C5    1 
ATOM   6452 C  C6    . DC  F 3 5   ? -10.473 46.349  30.786  1.00 61.71  ? 1905 DC  J C6    1 
HETATM 6453 P  P     . 8OG F 3 6   ? -5.770  46.015  26.526  1.00 65.70  ? 1906 8OG J P     1 
HETATM 6454 O  OP1   . 8OG F 3 6   ? -5.297  45.780  25.109  1.00 66.38  ? 1906 8OG J OP1   1 
HETATM 6455 O  OP2   . 8OG F 3 6   ? -5.043  45.423  27.716  1.00 66.21  ? 1906 8OG J OP2   1 
HETATM 6456 O  "O5'" . 8OG F 3 6   ? -5.853  47.601  26.727  1.00 64.82  ? 1906 8OG J "O5'" 1 
HETATM 6457 C  "C5'" . 8OG F 3 6   ? -4.732  48.465  26.631  1.00 62.42  ? 1906 8OG J "C5'" 1 
HETATM 6458 C  "C4'" . 8OG F 3 6   ? -4.727  49.193  27.944  1.00 60.99  ? 1906 8OG J "C4'" 1 
HETATM 6459 O  "O4'" . 8OG F 3 6   ? -5.923  49.476  28.710  1.00 59.92  ? 1906 8OG J "O4'" 1 
HETATM 6460 C  "C3'" . 8OG F 3 6   ? -3.632  49.429  28.615  1.00 60.33  ? 1906 8OG J "C3'" 1 
HETATM 6461 O  "O3'" . 8OG F 3 6   ? -2.898  50.321  28.221  1.00 59.91  ? 1906 8OG J "O3'" 1 
HETATM 6462 C  "C2'" . 8OG F 3 6   ? -3.886  49.236  30.075  1.00 60.25  ? 1906 8OG J "C2'" 1 
HETATM 6463 C  "C1'" . 8OG F 3 6   ? -5.374  49.474  30.053  1.00 60.31  ? 1906 8OG J "C1'" 1 
HETATM 6464 N  N9    . 8OG F 3 6   ? -6.133  49.550  31.184  1.00 60.56  ? 1906 8OG J N9    1 
HETATM 6465 C  C8    . 8OG F 3 6   ? -6.483  50.656  31.833  1.00 59.47  ? 1906 8OG J C8    1 
HETATM 6466 N  N7    . 8OG F 3 6   ? -7.237  50.406  32.906  1.00 60.30  ? 1906 8OG J N7    1 
HETATM 6467 C  C5    . 8OG F 3 6   ? -7.375  49.063  32.928  1.00 61.11  ? 1906 8OG J C5    1 
HETATM 6468 C  C6    . 8OG F 3 6   ? -8.066  48.097  33.807  1.00 61.69  ? 1906 8OG J C6    1 
HETATM 6469 O  O6    . 8OG F 3 6   ? -8.712  48.510  34.803  1.00 61.95  ? 1906 8OG J O6    1 
HETATM 6470 N  N1    . 8OG F 3 6   ? -7.968  46.789  33.489  1.00 62.33  ? 1906 8OG J N1    1 
HETATM 6471 C  C2    . 8OG F 3 6   ? -7.269  46.342  32.413  1.00 62.19  ? 1906 8OG J C2    1 
HETATM 6472 N  N2    . 8OG F 3 6   ? -7.203  45.015  32.139  1.00 62.13  ? 1906 8OG J N2    1 
HETATM 6473 N  N3    . 8OG F 3 6   ? -6.617  47.165  31.577  1.00 62.10  ? 1906 8OG J N3    1 
HETATM 6474 C  C4    . 8OG F 3 6   ? -6.637  48.485  31.778  1.00 61.41  ? 1906 8OG J C4    1 
HETATM 6475 O  O8    . 8OG F 3 6   ? -6.146  51.848  31.495  1.00 57.81  ? 1906 8OG J O8    1 
ATOM   6476 P  P     . DC  F 3 7   ? -1.347  50.401  28.584  1.00 58.18  ? 1907 DC  J P     1 
ATOM   6477 O  OP1   . DC  F 3 7   ? -0.672  51.064  27.446  1.00 60.08  ? 1907 DC  J OP1   1 
ATOM   6478 O  OP2   . DC  F 3 7   ? -0.910  49.077  29.098  1.00 59.28  ? 1907 DC  J OP2   1 
ATOM   6479 O  "O5'" . DC  F 3 7   ? -1.273  51.382  29.818  1.00 56.63  ? 1907 DC  J "O5'" 1 
ATOM   6480 C  "C5'" . DC  F 3 7   ? -1.872  52.633  29.750  1.00 55.58  ? 1907 DC  J "C5'" 1 
ATOM   6481 C  "C4'" . DC  F 3 7   ? -1.851  53.070  31.183  1.00 54.76  ? 1907 DC  J "C4'" 1 
ATOM   6482 O  "O4'" . DC  F 3 7   ? -2.830  52.278  31.873  1.00 54.87  ? 1907 DC  J "O4'" 1 
ATOM   6483 C  "C3'" . DC  F 3 7   ? -0.533  52.743  31.862  1.00 54.68  ? 1907 DC  J "C3'" 1 
ATOM   6484 O  "O3'" . DC  F 3 7   ? 0.003   53.981  32.259  1.00 55.57  ? 1907 DC  J "O3'" 1 
ATOM   6485 C  "C2'" . DC  F 3 7   ? -0.901  51.855  33.049  1.00 54.47  ? 1907 DC  J "C2'" 1 
ATOM   6486 C  "C1'" . DC  F 3 7   ? -2.383  52.164  33.190  1.00 54.08  ? 1907 DC  J "C1'" 1 
ATOM   6487 N  N1    . DC  F 3 7   ? -3.174  51.094  33.812  1.00 53.21  ? 1907 DC  J N1    1 
ATOM   6488 C  C2    . DC  F 3 7   ? -3.916  51.430  34.931  1.00 52.13  ? 1907 DC  J C2    1 
ATOM   6489 O  O2    . DC  F 3 7   ? -3.862  52.606  35.312  1.00 52.77  ? 1907 DC  J O2    1 
ATOM   6490 N  N3    . DC  F 3 7   ? -4.652  50.472  35.539  1.00 50.79  ? 1907 DC  J N3    1 
ATOM   6491 C  C4    . DC  F 3 7   ? -4.654  49.231  35.062  1.00 51.15  ? 1907 DC  J C4    1 
ATOM   6492 N  N4    . DC  F 3 7   ? -5.399  48.317  35.694  1.00 50.99  ? 1907 DC  J N4    1 
ATOM   6493 C  C5    . DC  F 3 7   ? -3.892  48.867  33.913  1.00 52.08  ? 1907 DC  J C5    1 
ATOM   6494 C  C6    . DC  F 3 7   ? -3.172  49.825  33.314  1.00 53.00  ? 1907 DC  J C6    1 
ATOM   6495 P  P     . DT  F 3 8   ? 1.526   54.138  32.700  1.00 55.27  ? 1908 DT  J P     1 
ATOM   6496 O  OP1   . DT  F 3 8   ? 1.992   55.448  32.194  1.00 56.23  ? 1908 DT  J OP1   1 
ATOM   6497 O  OP2   . DT  F 3 8   ? 2.296   52.917  32.402  1.00 54.48  ? 1908 DT  J OP2   1 
ATOM   6498 O  "O5'" . DT  F 3 8   ? 1.314   54.218  34.279  1.00 55.38  ? 1908 DT  J "O5'" 1 
ATOM   6499 C  "C5'" . DT  F 3 8   ? 0.321   55.103  34.761  1.00 54.54  ? 1908 DT  J "C5'" 1 
ATOM   6500 C  "C4'" . DT  F 3 8   ? 0.127   54.865  36.234  1.00 54.45  ? 1908 DT  J "C4'" 1 
ATOM   6501 O  "O4'" . DT  F 3 8   ? -0.819  53.783  36.403  1.00 56.17  ? 1908 DT  J "O4'" 1 
ATOM   6502 C  "C3'" . DT  F 3 8   ? 1.383   54.448  36.988  1.00 53.89  ? 1908 DT  J "C3'" 1 
ATOM   6503 O  "O3'" . DT  F 3 8   ? 1.445   55.237  38.146  1.00 53.20  ? 1908 DT  J "O3'" 1 
ATOM   6504 C  "C2'" . DT  F 3 8   ? 1.127   52.996  37.359  1.00 54.41  ? 1908 DT  J "C2'" 1 
ATOM   6505 C  "C1'" . DT  F 3 8   ? -0.384  53.031  37.505  1.00 54.99  ? 1908 DT  J "C1'" 1 
ATOM   6506 N  N1    . DT  F 3 8   ? -0.982  51.693  37.438  1.00 54.77  ? 1908 DT  J N1    1 
ATOM   6507 C  C2    . DT  F 3 8   ? -1.984  51.382  38.317  1.00 54.26  ? 1908 DT  J C2    1 
ATOM   6508 O  O2    . DT  F 3 8   ? -2.409  52.168  39.146  1.00 54.28  ? 1908 DT  J O2    1 
ATOM   6509 N  N3    . DT  F 3 8   ? -2.457  50.107  38.179  1.00 54.05  ? 1908 DT  J N3    1 
ATOM   6510 C  C4    . DT  F 3 8   ? -2.046  49.146  37.278  1.00 54.30  ? 1908 DT  J C4    1 
ATOM   6511 O  O4    . DT  F 3 8   ? -2.555  48.030  37.250  1.00 54.10  ? 1908 DT  J O4    1 
ATOM   6512 C  C5    . DT  F 3 8   ? -0.991  49.550  36.377  1.00 55.01  ? 1908 DT  J C5    1 
ATOM   6513 C  C7    . DT  F 3 8   ? -0.435  48.612  35.341  1.00 54.46  ? 1908 DT  J C7    1 
ATOM   6514 C  C6    . DT  F 3 8   ? -0.512  50.792  36.507  1.00 55.25  ? 1908 DT  J C6    1 
ATOM   6515 P  P     . DA  F 3 9   ? 2.754   55.360  39.058  1.00 50.80  ? 1909 DA  J P     1 
ATOM   6516 O  OP1   . DA  F 3 9   ? 3.195   56.756  38.961  1.00 51.08  ? 1909 DA  J OP1   1 
ATOM   6517 O  OP2   . DA  F 3 9   ? 3.651   54.199  38.884  1.00 49.07  ? 1909 DA  J OP2   1 
ATOM   6518 O  "O5'" . DA  F 3 9   ? 2.076   55.210  40.481  1.00 52.41  ? 1909 DA  J "O5'" 1 
ATOM   6519 C  "C5'" . DA  F 3 9   ? 0.769   55.739  40.611  1.00 54.31  ? 1909 DA  J "C5'" 1 
ATOM   6520 C  "C4'" . DA  F 3 9   ? 0.283   55.459  42.009  1.00 55.36  ? 1909 DA  J "C4'" 1 
ATOM   6521 O  "O4'" . DA  F 3 9   ? -0.483  54.236  41.981  1.00 55.69  ? 1909 DA  J "O4'" 1 
ATOM   6522 C  "C3'" . DA  F 3 9   ? 1.430   55.233  42.972  1.00 56.80  ? 1909 DA  J "C3'" 1 
ATOM   6523 O  "O3'" . DA  F 3 9   ? 1.042   55.700  44.246  1.00 58.92  ? 1909 DA  J "O3'" 1 
ATOM   6524 C  "C2'" . DA  F 3 9   ? 1.620   53.719  42.905  1.00 56.30  ? 1909 DA  J "C2'" 1 
ATOM   6525 C  "C1'" . DA  F 3 9   ? 0.191   53.234  42.703  1.00 55.29  ? 1909 DA  J "C1'" 1 
ATOM   6526 N  N9    . DA  F 3 9   ? 0.099   51.977  41.963  1.00 54.99  ? 1909 DA  J N9    1 
ATOM   6527 C  C8    . DA  F 3 9   ? 0.814   51.595  40.863  1.00 54.41  ? 1909 DA  J C8    1 
ATOM   6528 N  N7    . DA  F 3 9   ? 0.514   50.397  40.425  1.00 54.18  ? 1909 DA  J N7    1 
ATOM   6529 C  C5    . DA  F 3 9   ? -0.466  49.966  41.303  1.00 53.99  ? 1909 DA  J C5    1 
ATOM   6530 C  C6    . DA  F 3 9   ? -1.201  48.776  41.391  1.00 54.33  ? 1909 DA  J C6    1 
ATOM   6531 N  N6    . DA  F 3 9   ? -1.051  47.759  40.543  1.00 54.62  ? 1909 DA  J N6    1 
ATOM   6532 N  N1    . DA  F 3 9   ? -2.101  48.670  42.390  1.00 54.63  ? 1909 DA  J N1    1 
ATOM   6533 C  C2    . DA  F 3 9   ? -2.249  49.689  43.244  1.00 54.18  ? 1909 DA  J C2    1 
ATOM   6534 N  N3    . DA  F 3 9   ? -1.618  50.857  43.263  1.00 53.74  ? 1909 DA  J N3    1 
ATOM   6535 C  C4    . DA  F 3 9   ? -0.735  50.927  42.255  1.00 54.26  ? 1909 DA  J C4    1 
ATOM   6536 P  P     . DC  F 3 10  ? 2.136   55.958  45.385  1.00 60.39  ? 1910 DC  J P     1 
ATOM   6537 O  OP1   . DC  F 3 10  ? 2.058   57.397  45.731  1.00 61.20  ? 1910 DC  J OP1   1 
ATOM   6538 O  OP2   . DC  F 3 10  ? 3.423   55.343  44.979  1.00 60.46  ? 1910 DC  J OP2   1 
ATOM   6539 O  "O5'" . DC  F 3 10  ? 1.573   55.127  46.629  1.00 60.19  ? 1910 DC  J "O5'" 1 
ATOM   6540 C  "C5'" . DC  F 3 10  ? 0.187   54.829  46.701  1.00 60.22  ? 1910 DC  J "C5'" 1 
ATOM   6541 C  "C4'" . DC  F 3 10  ? -0.015  53.446  47.286  1.00 59.75  ? 1910 DC  J "C4'" 1 
ATOM   6542 O  "O4'" . DC  F 3 10  ? -0.085  52.475  46.214  1.00 59.15  ? 1910 DC  J "O4'" 1 
ATOM   6543 C  "C3'" . DC  F 3 10  ? 1.100   52.989  48.227  1.00 60.05  ? 1910 DC  J "C3'" 1 
ATOM   6544 O  "O3'" . DC  F 3 10  ? 0.529   52.757  49.505  1.00 60.75  ? 1910 DC  J "O3'" 1 
ATOM   6545 C  "C2'" . DC  F 3 10  ? 1.617   51.697  47.601  1.00 59.00  ? 1910 DC  J "C2'" 1 
ATOM   6546 C  "C1'" . DC  F 3 10  ? 0.456   51.277  46.702  1.00 58.78  ? 1910 DC  J "C1'" 1 
ATOM   6547 N  N1    . DC  F 3 10  ? 0.922   50.432  45.579  1.00 58.08  ? 1910 DC  J N1    1 
ATOM   6548 C  C2    . DC  F 3 10  ? 0.256   49.246  45.296  1.00 58.00  ? 1910 DC  J C2    1 
ATOM   6549 O  O2    . DC  F 3 10  ? -0.730  48.949  45.982  1.00 59.37  ? 1910 DC  J O2    1 
ATOM   6550 N  N3    . DC  F 3 10  ? 0.706   48.465  44.285  1.00 57.54  ? 1910 DC  J N3    1 
ATOM   6551 C  C4    . DC  F 3 10  ? 1.775   48.831  43.579  1.00 57.17  ? 1910 DC  J C4    1 
ATOM   6552 N  N4    . DC  F 3 10  ? 2.187   48.035  42.587  1.00 56.03  ? 1910 DC  J N4    1 
ATOM   6553 C  C5    . DC  F 3 10  ? 2.470   50.038  43.862  1.00 57.86  ? 1910 DC  J C5    1 
ATOM   6554 C  C6    . DC  F 3 10  ? 2.018   50.798  44.864  1.00 58.06  ? 1910 DC  J C6    1 
ATOM   6555 P  P     . DC  F 3 11  ? 1.405   52.475  50.809  1.00 61.13  ? 1911 DC  J P     1 
ATOM   6556 O  OP1   . DC  F 3 11  ? 1.389   53.721  51.600  1.00 61.52  ? 1911 DC  J OP1   1 
ATOM   6557 O  OP2   . DC  F 3 11  ? 2.701   51.843  50.462  1.00 61.25  ? 1911 DC  J OP2   1 
ATOM   6558 O  "O5'" . DC  F 3 11  ? 0.505   51.371  51.534  1.00 61.87  ? 1911 DC  J "O5'" 1 
ATOM   6559 C  "C5'" . DC  F 3 11  ? -0.636  50.866  50.846  1.00 62.26  ? 1911 DC  J "C5'" 1 
ATOM   6560 C  "C4'" . DC  F 3 11  ? -0.751  49.358  50.979  1.00 62.39  ? 1911 DC  J "C4'" 1 
ATOM   6561 O  "O4'" . DC  F 3 11  ? -0.412  48.720  49.722  1.00 62.53  ? 1911 DC  J "O4'" 1 
ATOM   6562 C  "C3'" . DC  F 3 11  ? 0.152   48.697  52.012  1.00 62.32  ? 1911 DC  J "C3'" 1 
ATOM   6563 O  "O3'" . DC  F 3 11  ? -0.536  47.565  52.482  1.00 62.12  ? 1911 DC  J "O3'" 1 
ATOM   6564 C  "C2'" . DC  F 3 11  ? 1.353   48.270  51.180  1.00 62.44  ? 1911 DC  J "C2'" 1 
ATOM   6565 C  "C1'" . DC  F 3 11  ? 0.612   47.771  49.947  1.00 62.69  ? 1911 DC  J "C1'" 1 
ATOM   6566 N  N1    . DC  F 3 11  ? 1.443   47.670  48.718  1.00 63.05  ? 1911 DC  J N1    1 
ATOM   6567 C  C2    . DC  F 3 11  ? 1.394   46.498  47.966  1.00 63.02  ? 1911 DC  J C2    1 
ATOM   6568 O  O2    . DC  F 3 11  ? 0.667   45.576  48.349  1.00 62.81  ? 1911 DC  J O2    1 
ATOM   6569 N  N3    . DC  F 3 11  ? 2.150   46.407  46.846  1.00 63.32  ? 1911 DC  J N3    1 
ATOM   6570 C  C4    . DC  F 3 11  ? 2.924   47.430  46.475  1.00 63.55  ? 1911 DC  J C4    1 
ATOM   6571 N  N4    . DC  F 3 11  ? 3.651   47.295  45.359  1.00 63.67  ? 1911 DC  J N4    1 
ATOM   6572 C  C5    . DC  F 3 11  ? 2.987   48.637  47.230  1.00 63.09  ? 1911 DC  J C5    1 
ATOM   6573 C  C6    . DC  F 3 11  ? 2.235   48.712  48.331  1.00 63.15  ? 1911 DC  J C6    1 
ATOM   6574 P  P     . DA  F 3 12  ? -0.235  46.945  53.918  1.00 62.20  ? 1912 DA  J P     1 
ATOM   6575 O  OP1   . DA  F 3 12  ? -1.345  47.344  54.809  1.00 62.29  ? 1912 DA  J OP1   1 
ATOM   6576 O  OP2   . DA  F 3 12  ? 1.168   47.232  54.295  1.00 62.09  ? 1912 DA  J OP2   1 
ATOM   6577 O  "O5'" . DA  F 3 12  ? -0.368  45.385  53.605  1.00 62.45  ? 1912 DA  J "O5'" 1 
ATOM   6578 C  "C5'" . DA  F 3 12  ? -0.932  44.963  52.362  1.00 62.48  ? 1912 DA  J "C5'" 1 
ATOM   6579 C  "C4'" . DA  F 3 12  ? -0.527  43.528  52.079  1.00 62.81  ? 1912 DA  J "C4'" 1 
ATOM   6580 O  "O4'" . DA  F 3 12  ? 0.318   43.466  50.899  1.00 62.23  ? 1912 DA  J "O4'" 1 
ATOM   6581 C  "C3'" . DA  F 3 12  ? 0.302   42.902  53.188  1.00 62.96  ? 1912 DA  J "C3'" 1 
ATOM   6582 O  "O3'" . DA  F 3 12  ? 0.155   41.494  53.158  1.00 64.45  ? 1912 DA  J "O3'" 1 
ATOM   6583 C  "C2'" . DA  F 3 12  ? 1.710   43.319  52.782  1.00 62.40  ? 1912 DA  J "C2'" 1 
ATOM   6584 C  "C1'" . DA  F 3 12  ? 1.626   43.082  51.281  1.00 61.75  ? 1912 DA  J "C1'" 1 
ATOM   6585 N  N9    . DA  F 3 12  ? 2.583   43.873  50.519  1.00 61.18  ? 1912 DA  J N9    1 
ATOM   6586 C  C8    . DA  F 3 12  ? 3.002   45.147  50.788  1.00 60.83  ? 1912 DA  J C8    1 
ATOM   6587 N  N7    . DA  F 3 12  ? 3.873   45.607  49.923  1.00 60.67  ? 1912 DA  J N7    1 
ATOM   6588 C  C5    . DA  F 3 12  ? 4.034   44.562  49.025  1.00 60.81  ? 1912 DA  J C5    1 
ATOM   6589 C  C6    . DA  F 3 12  ? 4.824   44.412  47.867  1.00 60.87  ? 1912 DA  J C6    1 
ATOM   6590 N  N6    . DA  F 3 12  ? 5.634   45.370  47.401  1.00 61.25  ? 1912 DA  J N6    1 
ATOM   6591 N  N1    . DA  F 3 12  ? 4.748   43.238  47.204  1.00 60.49  ? 1912 DA  J N1    1 
ATOM   6592 C  C2    . DA  F 3 12  ? 3.936   42.283  47.671  1.00 60.26  ? 1912 DA  J C2    1 
ATOM   6593 N  N3    . DA  F 3 12  ? 3.147   42.307  48.742  1.00 60.25  ? 1912 DA  J N3    1 
ATOM   6594 C  C4    . DA  F 3 12  ? 3.245   43.484  49.379  1.00 60.72  ? 1912 DA  J C4    1 
ATOM   6595 P  P     . DT  F 3 13  ? 0.706   40.612  54.379  1.00 66.10  ? 1913 DT  J P     1 
ATOM   6596 O  OP1   . DT  F 3 13  ? -0.447  40.363  55.275  1.00 66.15  ? 1913 DT  J OP1   1 
ATOM   6597 O  OP2   . DT  F 3 13  ? 1.933   41.242  54.923  1.00 65.51  ? 1913 DT  J OP2   1 
ATOM   6598 O  "O5'" . DT  F 3 13  ? 1.136   39.237  53.674  1.00 66.73  ? 1913 DT  J "O5'" 1 
ATOM   6599 C  "C5'" . DT  F 3 13  ? 1.195   39.121  52.249  1.00 67.56  ? 1913 DT  J "C5'" 1 
ATOM   6600 C  "C4'" . DT  F 3 13  ? 2.464   38.413  51.798  1.00 68.13  ? 1913 DT  J "C4'" 1 
ATOM   6601 O  "O4'" . DT  F 3 13  ? 3.253   39.324  50.987  1.00 67.70  ? 1913 DT  J "O4'" 1 
ATOM   6602 C  "C3'" . DT  F 3 13  ? 3.383   37.904  52.915  1.00 68.98  ? 1913 DT  J "C3'" 1 
ATOM   6603 O  "O3'" . DT  F 3 13  ? 3.799   36.557  52.633  1.00 70.56  ? 1913 DT  J "O3'" 1 
ATOM   6604 C  "C2'" . DT  F 3 13  ? 4.550   38.891  52.892  1.00 68.37  ? 1913 DT  J "C2'" 1 
ATOM   6605 C  "C1'" . DT  F 3 13  ? 4.599   39.271  51.415  1.00 67.84  ? 1913 DT  J "C1'" 1 
ATOM   6606 N  N1    . DT  F 3 13  ? 5.278   40.581  51.150  1.00 67.13  ? 1913 DT  J N1    1 
ATOM   6607 C  C2    . DT  F 3 13  ? 6.018   40.734  49.998  1.00 66.53  ? 1913 DT  J C2    1 
ATOM   6608 O  O2    . DT  F 3 13  ? 6.149   39.859  49.161  1.00 66.02  ? 1913 DT  J O2    1 
ATOM   6609 N  N3    . DT  F 3 13  ? 6.603   41.968  49.857  1.00 66.53  ? 1913 DT  J N3    1 
ATOM   6610 C  C4    . DT  F 3 13  ? 6.525   43.038  50.733  1.00 66.81  ? 1913 DT  J C4    1 
ATOM   6611 O  O4    . DT  F 3 13  ? 7.087   44.107  50.518  1.00 67.04  ? 1913 DT  J O4    1 
ATOM   6612 C  C5    . DT  F 3 13  ? 5.740   42.810  51.920  1.00 66.88  ? 1913 DT  J C5    1 
ATOM   6613 C  C7    . DT  F 3 13  ? 5.587   43.899  52.943  1.00 66.86  ? 1913 DT  J C7    1 
ATOM   6614 C  C6    . DT  F 3 13  ? 5.163   41.608  52.069  1.00 67.12  ? 1913 DT  J C6    1 
ATOM   6615 P  P     . DC  F 3 14  ? 4.810   35.728  53.568  1.00 72.08  ? 1914 DC  J P     1 
ATOM   6616 O  OP1   . DC  F 3 14  ? 4.110   34.507  54.023  1.00 72.17  ? 1914 DC  J OP1   1 
ATOM   6617 O  OP2   . DC  F 3 14  ? 5.417   36.635  54.571  1.00 71.98  ? 1914 DC  J OP2   1 
ATOM   6618 O  "O5'" . DC  F 3 14  ? 5.951   35.286  52.535  1.00 72.59  ? 1914 DC  J "O5'" 1 
ATOM   6619 C  "C5'" . DC  F 3 14  ? 5.950   35.785  51.197  1.00 73.19  ? 1914 DC  J "C5'" 1 
ATOM   6620 C  "C4'" . DC  F 3 14  ? 7.359   36.150  50.761  1.00 73.89  ? 1914 DC  J "C4'" 1 
ATOM   6621 O  "O4'" . DC  F 3 14  ? 7.481   37.597  50.664  1.00 73.22  ? 1914 DC  J "O4'" 1 
ATOM   6622 C  "C3'" . DC  F 3 14  ? 8.471   35.676  51.706  1.00 74.43  ? 1914 DC  J "C3'" 1 
ATOM   6623 O  "O3'" . DC  F 3 14  ? 9.511   35.025  50.980  1.00 76.04  ? 1914 DC  J "O3'" 1 
ATOM   6624 C  "C2'" . DC  F 3 14  ? 8.982   36.971  52.328  1.00 73.82  ? 1914 DC  J "C2'" 1 
ATOM   6625 C  "C1'" . DC  F 3 14  ? 8.758   37.933  51.164  1.00 73.23  ? 1914 DC  J "C1'" 1 
ATOM   6626 N  N1    . DC  F 3 14  ? 8.846   39.377  51.545  1.00 72.37  ? 1914 DC  J N1    1 
ATOM   6627 C  C2    . DC  F 3 14  ? 9.551   40.251  50.712  1.00 71.74  ? 1914 DC  J C2    1 
ATOM   6628 O  O2    . DC  F 3 14  ? 10.064  39.804  49.680  1.00 71.18  ? 1914 DC  J O2    1 
ATOM   6629 N  N3    . DC  F 3 14  ? 9.647   41.560  51.060  1.00 71.53  ? 1914 DC  J N3    1 
ATOM   6630 C  C4    . DC  F 3 14  ? 9.077   41.996  52.186  1.00 71.73  ? 1914 DC  J C4    1 
ATOM   6631 N  N4    . DC  F 3 14  ? 9.195   43.293  52.489  1.00 71.64  ? 1914 DC  J N4    1 
ATOM   6632 C  C5    . DC  F 3 14  ? 8.359   41.117  53.053  1.00 72.01  ? 1914 DC  J C5    1 
ATOM   6633 C  C6    . DC  F 3 14  ? 8.271   39.829  52.699  1.00 72.31  ? 1914 DC  J C6    1 
ATOM   6634 P  P     . DC  F 3 15  ? 10.079  33.602  51.449  1.00 77.83  ? 1915 DC  J P     1 
ATOM   6635 O  OP1   . DC  F 3 15  ? 9.027   32.598  51.173  1.00 77.89  ? 1915 DC  J OP1   1 
ATOM   6636 O  OP2   . DC  F 3 15  ? 10.642  33.737  52.813  1.00 77.66  ? 1915 DC  J OP2   1 
ATOM   6637 O  "O5'" . DC  F 3 15  ? 11.309  33.350  50.456  1.00 78.79  ? 1915 DC  J "O5'" 1 
ATOM   6638 C  "C5'" . DC  F 3 15  ? 11.728  34.373  49.558  1.00 80.14  ? 1915 DC  J "C5'" 1 
ATOM   6639 C  "C4'" . DC  F 3 15  ? 12.899  35.163  50.120  1.00 81.11  ? 1915 DC  J "C4'" 1 
ATOM   6640 O  "O4'" . DC  F 3 15  ? 12.432  36.462  50.553  1.00 81.07  ? 1915 DC  J "O4'" 1 
ATOM   6641 C  "C3'" . DC  F 3 15  ? 13.600  34.576  51.344  1.00 81.63  ? 1915 DC  J "C3'" 1 
ATOM   6642 O  "O3'" . DC  F 3 15  ? 14.714  33.773  50.915  1.00 83.24  ? 1915 DC  J "O3'" 1 
ATOM   6643 C  "C2'" . DC  F 3 15  ? 13.980  35.794  52.195  1.00 81.19  ? 1915 DC  J "C2'" 1 
ATOM   6644 C  "C1'" . DC  F 3 15  ? 13.421  36.984  51.414  1.00 81.05  ? 1915 DC  J "C1'" 1 
ATOM   6645 N  N1    . DC  F 3 15  ? 12.811  38.071  52.250  1.00 80.64  ? 1915 DC  J N1    1 
ATOM   6646 C  C2    . DC  F 3 15  ? 12.818  39.390  51.776  1.00 80.19  ? 1915 DC  J C2    1 
ATOM   6647 O  O2    . DC  F 3 15  ? 13.327  39.634  50.677  1.00 80.23  ? 1915 DC  J O2    1 
ATOM   6648 N  N3    . DC  F 3 15  ? 12.269  40.369  52.533  1.00 79.83  ? 1915 DC  J N3    1 
ATOM   6649 C  C4    . DC  F 3 15  ? 11.727  40.072  53.713  1.00 79.98  ? 1915 DC  J C4    1 
ATOM   6650 N  N4    . DC  F 3 15  ? 11.199  41.074  54.422  1.00 79.82  ? 1915 DC  J N4    1 
ATOM   6651 C  C5    . DC  F 3 15  ? 11.708  38.737  54.218  1.00 80.33  ? 1915 DC  J C5    1 
ATOM   6652 C  C6    . DC  F 3 15  ? 12.256  37.778  53.463  1.00 80.61  ? 1915 DC  J C6    1 
ATOM   6653 P  P     . DA  F 3 16  ? 16.252  34.047  51.294  1.00 84.81  ? 1916 DA  J P     1 
ATOM   6654 O  OP1   . DA  F 3 16  ? 17.069  33.009  50.623  1.00 84.59  ? 1916 DA  J OP1   1 
ATOM   6655 O  OP2   . DA  F 3 16  ? 16.379  34.209  52.762  1.00 84.86  ? 1916 DA  J OP2   1 
ATOM   6656 O  "O5'" . DA  F 3 16  ? 16.536  35.454  50.587  1.00 85.52  ? 1916 DA  J "O5'" 1 
ATOM   6657 C  "C5'" . DA  F 3 16  ? 17.016  35.494  49.244  1.00 86.84  ? 1916 DA  J "C5'" 1 
ATOM   6658 C  "C4'" . DA  F 3 16  ? 17.913  36.700  49.013  1.00 87.84  ? 1916 DA  J "C4'" 1 
ATOM   6659 O  "O4'" . DA  F 3 16  ? 17.276  37.892  49.544  1.00 88.00  ? 1916 DA  J "O4'" 1 
ATOM   6660 C  "C3'" . DA  F 3 16  ? 19.292  36.632  49.665  1.00 88.50  ? 1916 DA  J "C3'" 1 
ATOM   6661 O  "O3'" . DA  F 3 16  ? 20.249  37.262  48.818  1.00 89.73  ? 1916 DA  J "O3'" 1 
ATOM   6662 C  "C2'" . DA  F 3 16  ? 19.092  37.409  50.964  1.00 88.22  ? 1916 DA  J "C2'" 1 
ATOM   6663 C  "C1'" . DA  F 3 16  ? 18.106  38.488  50.526  1.00 88.01  ? 1916 DA  J "C1'" 1 
ATOM   6664 N  N9    . DA  F 3 16  ? 17.266  38.995  51.612  1.00 87.72  ? 1916 DA  J N9    1 
ATOM   6665 C  C8    . DA  F 3 16  ? 16.485  38.258  52.459  1.00 87.53  ? 1916 DA  J C8    1 
ATOM   6666 N  N7    . DA  F 3 16  ? 15.832  38.974  53.343  1.00 87.34  ? 1916 DA  J N7    1 
ATOM   6667 C  C5    . DA  F 3 16  ? 16.212  40.275  53.059  1.00 87.28  ? 1916 DA  J C5    1 
ATOM   6668 C  C6    . DA  F 3 16  ? 15.869  41.512  53.641  1.00 87.09  ? 1916 DA  J C6    1 
ATOM   6669 N  N6    . DA  F 3 16  ? 15.030  41.632  54.674  1.00 86.95  ? 1916 DA  J N6    1 
ATOM   6670 N  N1    . DA  F 3 16  ? 16.423  42.626  53.119  1.00 87.04  ? 1916 DA  J N1    1 
ATOM   6671 C  C2    . DA  F 3 16  ? 17.263  42.505  52.086  1.00 87.20  ? 1916 DA  J C2    1 
ATOM   6672 N  N3    . DA  F 3 16  ? 17.661  41.401  51.455  1.00 87.42  ? 1916 DA  J N3    1 
ATOM   6673 C  C4    . DA  F 3 16  ? 17.095  40.308  51.995  1.00 87.48  ? 1916 DA  J C4    1 
ATOM   6674 P  P     . DA  F 3 17  ? 21.825  37.111  49.068  1.00 90.79  ? 1917 DA  J P     1 
ATOM   6675 O  OP1   . DA  F 3 17  ? 22.437  36.715  47.780  1.00 90.77  ? 1917 DA  J OP1   1 
ATOM   6676 O  OP2   . DA  F 3 17  ? 22.040  36.278  50.273  1.00 90.82  ? 1917 DA  J OP2   1 
ATOM   6677 O  "O5'" . DA  F 3 17  ? 22.282  38.605  49.421  1.00 91.54  ? 1917 DA  J "O5'" 1 
ATOM   6678 C  "C5'" . DA  F 3 17  ? 22.170  39.646  48.451  1.00 92.59  ? 1917 DA  J "C5'" 1 
ATOM   6679 C  "C4'" . DA  F 3 17  ? 22.394  41.016  49.073  1.00 93.32  ? 1917 DA  J "C4'" 1 
ATOM   6680 O  "O4'" . DA  F 3 17  ? 21.391  41.268  50.094  1.00 93.50  ? 1917 DA  J "O4'" 1 
ATOM   6681 C  "C3'" . DA  F 3 17  ? 23.747  41.219  49.750  1.00 93.74  ? 1917 DA  J "C3'" 1 
ATOM   6682 O  "O3'" . DA  F 3 17  ? 24.197  42.549  49.493  1.00 94.40  ? 1917 DA  J "O3'" 1 
ATOM   6683 C  "C2'" . DA  F 3 17  ? 23.424  40.979  51.222  1.00 93.71  ? 1917 DA  J "C2'" 1 
ATOM   6684 C  "C1'" . DA  F 3 17  ? 22.030  41.587  51.316  1.00 93.70  ? 1917 DA  J "C1'" 1 
ATOM   6685 N  N9    . DA  F 3 17  ? 21.233  41.066  52.425  1.00 93.74  ? 1917 DA  J N9    1 
ATOM   6686 C  C8    . DA  F 3 17  ? 21.076  39.756  52.786  1.00 93.68  ? 1917 DA  J C8    1 
ATOM   6687 N  N7    . DA  F 3 17  ? 20.297  39.582  53.826  1.00 93.58  ? 1917 DA  J N7    1 
ATOM   6688 C  C5    . DA  F 3 17  ? 19.918  40.868  54.175  1.00 93.61  ? 1917 DA  J C5    1 
ATOM   6689 C  C6    . DA  F 3 17  ? 19.091  41.368  55.200  1.00 93.59  ? 1917 DA  J C6    1 
ATOM   6690 N  N6    . DA  F 3 17  ? 18.478  40.586  56.094  1.00 93.50  ? 1917 DA  J N6    1 
ATOM   6691 N  N1    . DA  F 3 17  ? 18.919  42.705  55.271  1.00 93.67  ? 1917 DA  J N1    1 
ATOM   6692 C  C2    . DA  F 3 17  ? 19.534  43.484  54.373  1.00 93.70  ? 1917 DA  J C2    1 
ATOM   6693 N  N3    . DA  F 3 17  ? 20.331  43.131  53.365  1.00 93.72  ? 1917 DA  J N3    1 
ATOM   6694 C  C4    . DA  F 3 17  ? 20.485  41.796  53.321  1.00 93.70  ? 1917 DA  J C4    1 
ATOM   6695 P  P     . DC  F 3 18  ? 25.215  43.319  50.465  1.00 95.07  ? 1918 DC  J P     1 
ATOM   6696 O  OP1   . DC  F 3 18  ? 25.909  44.337  49.645  1.00 95.18  ? 1918 DC  J OP1   1 
ATOM   6697 O  OP2   . DC  F 3 18  ? 26.013  42.330  51.229  1.00 94.90  ? 1918 DC  J OP2   1 
ATOM   6698 O  "O5'" . DC  F 3 18  ? 24.229  44.067  51.482  1.00 95.17  ? 1918 DC  J "O5'" 1 
ATOM   6699 C  "C5'" . DC  F 3 18  ? 24.073  45.484  51.433  1.00 95.27  ? 1918 DC  J "C5'" 1 
ATOM   6700 C  "C4'" . DC  F 3 18  ? 24.503  46.129  52.742  1.00 95.31  ? 1918 DC  J "C4'" 1 
ATOM   6701 O  "O4'" . DC  F 3 18  ? 23.720  45.586  53.836  1.00 95.33  ? 1918 DC  J "O4'" 1 
ATOM   6702 C  "C3'" . DC  F 3 18  ? 25.965  45.919  53.121  1.00 95.36  ? 1918 DC  J "C3'" 1 
ATOM   6703 O  "O3'" . DC  F 3 18  ? 26.492  47.111  53.690  1.00 95.43  ? 1918 DC  J "O3'" 1 
ATOM   6704 C  "C2'" . DC  F 3 18  ? 25.915  44.787  54.143  1.00 95.37  ? 1918 DC  J "C2'" 1 
ATOM   6705 C  "C1'" . DC  F 3 18  ? 24.564  45.012  54.814  1.00 95.40  ? 1918 DC  J "C1'" 1 
ATOM   6706 N  N1    . DC  F 3 18  ? 23.929  43.751  55.297  1.00 95.46  ? 1918 DC  J N1    1 
ATOM   6707 C  C2    . DC  F 3 18  ? 22.703  43.793  55.976  1.00 95.40  ? 1918 DC  J C2    1 
ATOM   6708 O  O2    . DC  F 3 18  ? 22.151  44.883  56.176  1.00 95.23  ? 1918 DC  J O2    1 
ATOM   6709 N  N3    . DC  F 3 18  ? 22.150  42.630  56.401  1.00 95.48  ? 1918 DC  J N3    1 
ATOM   6710 C  C4    . DC  F 3 18  ? 22.770  41.470  56.171  1.00 95.59  ? 1918 DC  J C4    1 
ATOM   6711 N  N4    . DC  F 3 18  ? 22.185  40.350  56.610  1.00 95.64  ? 1918 DC  J N4    1 
ATOM   6712 C  C5    . DC  F 3 18  ? 24.017  41.405  55.482  1.00 95.62  ? 1918 DC  J C5    1 
ATOM   6713 C  C6    . DC  F 3 18  ? 24.553  42.558  55.067  1.00 95.57  ? 1918 DC  J C6    1 
HETATM 6714 P  PG    . DGT G 4 .   ? 2.195   5.019   -0.899  1.00 40.05  ? 414  DGT A PG    1 
HETATM 6715 O  O1G   . DGT G 4 .   ? 3.156   5.805   -0.013  1.00 40.93  ? 414  DGT A O1G   1 
HETATM 6716 O  O2G   . DGT G 4 .   ? 0.869   5.603   -1.376  1.00 37.84  ? 414  DGT A O2G   1 
HETATM 6717 O  O3G   . DGT G 4 .   ? 1.583   4.579   0.412   1.00 38.82  ? 414  DGT A O3G   1 
HETATM 6718 O  O3B   . DGT G 4 .   ? 2.394   3.443   -1.097  1.00 38.85  ? 414  DGT A O3B   1 
HETATM 6719 P  PB    . DGT G 4 .   ? 3.763   3.120   -1.850  1.00 34.46  ? 414  DGT A PB    1 
HETATM 6720 O  O1B   . DGT G 4 .   ? 4.440   4.303   -2.495  1.00 41.01  ? 414  DGT A O1B   1 
HETATM 6721 O  O2B   . DGT G 4 .   ? 3.490   2.129   -2.926  1.00 39.19  ? 414  DGT A O2B   1 
HETATM 6722 O  O3A   . DGT G 4 .   ? 4.669   2.317   -0.833  1.00 37.14  ? 414  DGT A O3A   1 
HETATM 6723 P  PA    . DGT G 4 .   ? 5.840   2.963   0.070   1.00 32.98  ? 414  DGT A PA    1 
HETATM 6724 O  O1A   . DGT G 4 .   ? 5.719   2.363   1.443   1.00 36.44  ? 414  DGT A O1A   1 
HETATM 6725 O  O2A   . DGT G 4 .   ? 5.855   4.458   0.119   1.00 39.83  ? 414  DGT A O2A   1 
HETATM 6726 O  "O5'" . DGT G 4 .   ? 7.201   2.489   -0.595  1.00 34.23  ? 414  DGT A "O5'" 1 
HETATM 6727 C  "C5'" . DGT G 4 .   ? 7.499   3.028   -1.882  1.00 33.99  ? 414  DGT A "C5'" 1 
HETATM 6728 C  "C4'" . DGT G 4 .   ? 7.849   1.880   -2.811  1.00 35.26  ? 414  DGT A "C4'" 1 
HETATM 6729 O  "O4'" . DGT G 4 .   ? 8.735   1.025   -2.090  1.00 35.51  ? 414  DGT A "O4'" 1 
HETATM 6730 C  "C3'" . DGT G 4 .   ? 6.683   0.984   -3.200  1.00 35.31  ? 414  DGT A "C3'" 1 
HETATM 6731 O  "O3'" . DGT G 4 .   ? 6.023   1.402   -4.396  1.00 37.51  ? 414  DGT A "O3'" 1 
HETATM 6732 C  "C2'" . DGT G 4 .   ? 7.348   -0.346  -3.433  1.00 36.43  ? 414  DGT A "C2'" 1 
HETATM 6733 C  "C1'" . DGT G 4 .   ? 8.598   -0.319  -2.549  1.00 37.29  ? 414  DGT A "C1'" 1 
HETATM 6734 N  N9    . DGT G 4 .   ? 8.171   -1.196  -1.474  1.00 38.88  ? 414  DGT A N9    1 
HETATM 6735 C  C8    . DGT G 4 .   ? 7.494   -0.824  -0.333  1.00 40.47  ? 414  DGT A C8    1 
HETATM 6736 N  N7    . DGT G 4 .   ? 7.194   -1.821  0.429   1.00 40.56  ? 414  DGT A N7    1 
HETATM 6737 C  C5    . DGT G 4 .   ? 7.682   -2.917  -0.278  1.00 39.66  ? 414  DGT A C5    1 
HETATM 6738 C  C6    . DGT G 4 .   ? 7.652   -4.277  0.062   1.00 39.43  ? 414  DGT A C6    1 
HETATM 6739 O  O6    . DGT G 4 .   ? 7.149   -4.751  1.081   1.00 39.41  ? 414  DGT A O6    1 
HETATM 6740 N  N1    . DGT G 4 .   ? 8.273   -5.072  -0.907  1.00 38.43  ? 414  DGT A N1    1 
HETATM 6741 C  C2    . DGT G 4 .   ? 8.861   -4.625  -2.079  1.00 40.19  ? 414  DGT A C2    1 
HETATM 6742 N  N2    . DGT G 4 .   ? 9.397   -5.524  -2.906  1.00 41.22  ? 414  DGT A N2    1 
HETATM 6743 N  N3    . DGT G 4 .   ? 8.887   -3.332  -2.396  1.00 40.31  ? 414  DGT A N3    1 
HETATM 6744 C  C4    . DGT G 4 .   ? 8.285   -2.555  -1.452  1.00 39.19  ? 414  DGT A C4    1 
HETATM 6745 CA CA    . CA  H 5 .   ? 7.000   6.077   2.914   1.00 57.72  ? 415  CA  A CA    1 
HETATM 6746 CA CA    . CA  I 5 .   ? 5.096   6.158   -1.264  1.00 42.97  ? 416  CA  A CA    1 
HETATM 6747 CA CA    . CA  J 5 .   ? 4.085   2.482   13.442  1.00 59.36  ? 417  CA  A CA    1 
HETATM 6748 P  PG    . DGT K 4 .   ? -16.505 61.121  36.516  1.00 56.96  ? 1414 DGT B PG    1 
HETATM 6749 O  O1G   . DGT K 4 .   ? -15.659 60.991  37.774  1.00 57.49  ? 1414 DGT B O1G   1 
HETATM 6750 O  O2G   . DGT K 4 .   ? -17.592 62.216  36.474  1.00 56.30  ? 1414 DGT B O2G   1 
HETATM 6751 O  O3G   . DGT K 4 .   ? -17.549 60.308  37.237  1.00 56.64  ? 1414 DGT B O3G   1 
HETATM 6752 O  O3B   . DGT K 4 .   ? -16.497 59.883  35.468  1.00 56.55  ? 1414 DGT B O3B   1 
HETATM 6753 P  PB    . DGT K 4 .   ? -15.021 59.647  34.863  1.00 54.59  ? 1414 DGT B PB    1 
HETATM 6754 O  O1B   . DGT K 4 .   ? -14.141 60.825  35.149  1.00 56.99  ? 1414 DGT B O1B   1 
HETATM 6755 O  O2B   . DGT K 4 .   ? -15.108 59.498  33.375  1.00 55.69  ? 1414 DGT B O2B   1 
HETATM 6756 O  O3A   . DGT K 4 .   ? -14.418 58.287  35.491  1.00 56.68  ? 1414 DGT B O3A   1 
HETATM 6757 P  PA    . DGT K 4 .   ? -13.286 58.508  36.620  1.00 56.98  ? 1414 DGT B PA    1 
HETATM 6758 O  O1A   . DGT K 4 .   ? -13.352 57.402  37.649  1.00 58.11  ? 1414 DGT B O1A   1 
HETATM 6759 O  O2A   . DGT K 4 .   ? -13.429 59.829  37.344  1.00 57.26  ? 1414 DGT B O2A   1 
HETATM 6760 O  "O5'" . DGT K 4 .   ? -11.867 58.455  35.860  1.00 56.83  ? 1414 DGT B "O5'" 1 
HETATM 6761 C  "C5'" . DGT K 4 .   ? -11.520 59.481  34.927  1.00 55.49  ? 1414 DGT B "C5'" 1 
HETATM 6762 C  "C4'" . DGT K 4 .   ? -10.983 58.873  33.643  1.00 53.94  ? 1414 DGT B "C4'" 1 
HETATM 6763 O  "O4'" . DGT K 4 .   ? -10.194 57.715  33.941  1.00 54.99  ? 1414 DGT B "O4'" 1 
HETATM 6764 C  "C3'" . DGT K 4 .   ? -12.104 58.374  32.759  1.00 52.87  ? 1414 DGT B "C3'" 1 
HETATM 6765 O  "O3'" . DGT K 4 .   ? -12.589 59.414  31.894  1.00 51.70  ? 1414 DGT B "O3'" 1 
HETATM 6766 C  "C2'" . DGT K 4 .   ? -11.450 57.228  32.016  1.00 53.41  ? 1414 DGT B "C2'" 1 
HETATM 6767 C  "C1'" . DGT K 4 .   ? -10.366 56.702  32.950  1.00 53.45  ? 1414 DGT B "C1'" 1 
HETATM 6768 N  N9    . DGT K 4 .   ? -10.900 55.455  33.519  1.00 52.31  ? 1414 DGT B N9    1 
HETATM 6769 C  C8    . DGT K 4 .   ? -11.699 55.328  34.623  1.00 52.56  ? 1414 DGT B C8    1 
HETATM 6770 N  N7    . DGT K 4 .   ? -12.052 54.098  34.886  1.00 51.94  ? 1414 DGT B N7    1 
HETATM 6771 C  C5    . DGT K 4 .   ? -11.454 53.363  33.886  1.00 51.15  ? 1414 DGT B C5    1 
HETATM 6772 C  C6    . DGT K 4 .   ? -11.484 51.979  33.649  1.00 50.89  ? 1414 DGT B C6    1 
HETATM 6773 O  O6    . DGT K 4 .   ? -12.067 51.112  34.307  1.00 51.22  ? 1414 DGT B O6    1 
HETATM 6774 N  N1    . DGT K 4 .   ? -10.742 51.631  32.529  1.00 50.14  ? 1414 DGT B N1    1 
HETATM 6775 C  C2    . DGT K 4 .   ? -10.042 52.497  31.713  1.00 51.69  ? 1414 DGT B C2    1 
HETATM 6776 N  N2    . DGT K 4 .   ? -9.377  51.980  30.671  1.00 51.40  ? 1414 DGT B N2    1 
HETATM 6777 N  N3    . DGT K 4 .   ? -10.027 53.810  31.944  1.00 52.04  ? 1414 DGT B N3    1 
HETATM 6778 C  C4    . DGT K 4 .   ? -10.744 54.174  33.034  1.00 52.03  ? 1414 DGT B C4    1 
HETATM 6779 CA CA    . CA  L 5 .   ? -12.226 60.424  40.311  1.00 68.86  ? 1415 CA  B CA    1 
HETATM 6780 CA CA    . CA  M 5 .   ? -13.748 62.107  37.039  1.00 57.52  ? 1416 CA  B CA    1 
HETATM 6781 CA CA    . CA  N 5 .   ? -14.084 53.208  47.009  1.00 69.58  ? 1417 CA  B CA    1 
HETATM 6782 O  O     . HOH O 6 .   ? 7.943   5.899   0.607   1.00 17.18  ? 501  HOH A O     1 
HETATM 6783 O  O     . HOH O 6 .   ? 12.006  4.062   -16.227 1.00 33.70  ? 503  HOH A O     1 
HETATM 6784 O  O     . HOH O 6 .   ? 19.576  10.705  8.010   1.00 42.90  ? 504  HOH A O     1 
HETATM 6785 O  O     . HOH O 6 .   ? 17.090  -0.125  -9.550  1.00 40.57  ? 505  HOH A O     1 
HETATM 6786 O  O     . HOH O 6 .   ? 0.300   16.737  -15.077 1.00 59.52  ? 506  HOH A O     1 
HETATM 6787 O  O     . HOH O 6 .   ? 27.857  -7.021  4.867   1.00 39.56  ? 507  HOH A O     1 
HETATM 6788 O  O     . HOH O 6 .   ? -7.263  2.235   -0.738  1.00 47.42  ? 508  HOH A O     1 
HETATM 6789 O  O     . HOH O 6 .   ? 29.446  1.141   4.471   1.00 46.60  ? 509  HOH A O     1 
HETATM 6790 O  O     . HOH O 6 .   ? 12.222  8.027   5.777   1.00 46.10  ? 510  HOH A O     1 
HETATM 6791 O  O     . HOH O 6 .   ? 11.156  -2.514  -3.865  1.00 29.30  ? 511  HOH A O     1 
HETATM 6792 O  O     . HOH O 6 .   ? 2.045   2.522   12.253  1.00 66.89  ? 512  HOH A O     1 
HETATM 6793 O  O     . HOH O 6 .   ? 13.108  8.137   12.396  1.00 49.57  ? 513  HOH A O     1 
HETATM 6794 O  O     . HOH O 6 .   ? 27.753  4.056   -0.448  1.00 52.86  ? 514  HOH A O     1 
HETATM 6795 O  O     . HOH O 6 .   ? 21.002  -8.077  4.662   1.00 38.65  ? 516  HOH A O     1 
HETATM 6796 O  O     . HOH O 6 .   ? 16.229  2.833   16.589  1.00 52.79  ? 517  HOH A O     1 
HETATM 6797 O  O     . HOH O 6 .   ? 3.281   15.192  -8.007  1.00 27.42  ? 518  HOH A O     1 
HETATM 6798 O  O     . HOH O 6 .   ? 10.289  12.397  -18.124 1.00 40.13  ? 519  HOH A O     1 
HETATM 6799 O  O     . HOH O 6 .   ? 38.081  -16.120 1.913   1.00 54.24  ? 520  HOH A O     1 
HETATM 6800 O  O     . HOH O 6 .   ? 29.010  3.898   3.511   1.00 38.02  ? 521  HOH A O     1 
HETATM 6801 O  O     . HOH O 6 .   ? -1.349  7.494   -12.830 1.00 47.50  ? 522  HOH A O     1 
HETATM 6802 O  O     . HOH O 6 .   ? 18.198  8.921   -6.997  1.00 49.41  ? 523  HOH A O     1 
HETATM 6803 O  O     . HOH O 6 .   ? 32.819  -15.453 12.305  1.00 55.82  ? 525  HOH A O     1 
HETATM 6804 O  O     . HOH O 6 .   ? 1.487   27.121  14.474  1.00 59.39  ? 526  HOH A O     1 
HETATM 6805 O  O     . HOH O 6 .   ? 28.431  -4.420  8.183   1.00 53.30  ? 529  HOH A O     1 
HETATM 6806 O  O     . HOH O 6 .   ? 9.782   14.848  -18.262 1.00 43.40  ? 531  HOH A O     1 
HETATM 6807 O  O     . HOH O 6 .   ? 13.096  -5.777  -10.208 1.00 40.08  ? 532  HOH A O     1 
HETATM 6808 O  O     . HOH O 6 .   ? 1.016   15.166  -6.380  1.00 35.52  ? 533  HOH A O     1 
HETATM 6809 O  O     . HOH O 6 .   ? 19.390  3.518   -15.644 1.00 50.96  ? 534  HOH A O     1 
HETATM 6810 O  O     . HOH O 6 .   ? 28.493  -0.369  6.359   1.00 44.67  ? 539  HOH A O     1 
HETATM 6811 O  O     . HOH O 6 .   ? 11.520  -14.217 5.975   1.00 50.61  ? 540  HOH A O     1 
HETATM 6812 O  O     . HOH O 6 .   ? -5.837  1.830   1.193   1.00 57.09  ? 541  HOH A O     1 
HETATM 6813 O  O     . HOH O 6 .   ? 6.002   -4.676  -14.782 1.00 46.86  ? 545  HOH A O     1 
HETATM 6814 O  O     . HOH O 6 .   ? -3.911  6.693   25.516  1.00 67.58  ? 546  HOH A O     1 
HETATM 6815 O  O     . HOH O 6 .   ? -6.075  18.960  20.138  1.00 61.76  ? 547  HOH A O     1 
HETATM 6816 O  O     . HOH O 6 .   ? 18.707  11.174  -8.419  1.00 53.78  ? 548  HOH A O     1 
HETATM 6817 O  O     . HOH O 6 .   ? 5.441   23.549  -10.180 1.00 41.69  ? 549  HOH A O     1 
HETATM 6818 O  O     . HOH O 6 .   ? -10.916 -9.155  -8.745  1.00 61.71  ? 550  HOH A O     1 
HETATM 6819 O  O     . HOH O 6 .   ? 32.610  -22.329 6.624   1.00 59.69  ? 551  HOH A O     1 
HETATM 6820 O  O     . HOH O 6 .   ? 2.761   -15.855 -3.869  1.00 44.13  ? 554  HOH A O     1 
HETATM 6821 O  O     . HOH O 6 .   ? 12.786  29.346  6.837   1.00 51.27  ? 556  HOH A O     1 
HETATM 6822 O  O     . HOH O 6 .   ? 0.839   19.112  -15.043 1.00 53.02  ? 559  HOH A O     1 
HETATM 6823 O  O     . HOH O 6 .   ? 17.833  -2.993  -5.694  1.00 48.01  ? 561  HOH A O     1 
HETATM 6824 O  O     . HOH O 6 .   ? 14.538  15.058  -13.502 1.00 41.95  ? 562  HOH A O     1 
HETATM 6825 O  O     . HOH O 6 .   ? 16.807  8.276   -14.163 1.00 33.50  ? 563  HOH A O     1 
HETATM 6826 O  O     . HOH O 6 .   ? 4.554   27.267  13.118  1.00 57.00  ? 568  HOH A O     1 
HETATM 6827 O  O     . HOH O 6 .   ? -4.964  4.161   -10.375 1.00 36.90  ? 571  HOH A O     1 
HETATM 6828 O  O     . HOH O 6 .   ? 20.235  8.533   -5.376  1.00 58.61  ? 573  HOH A O     1 
HETATM 6829 O  O     . HOH O 6 .   ? 10.687  33.635  8.455   1.00 58.77  ? 574  HOH A O     1 
HETATM 6830 O  O     . HOH O 6 .   ? -10.967 -0.520  -6.788  1.00 71.61  ? 575  HOH A O     1 
HETATM 6831 O  O     . HOH O 6 .   ? 18.191  10.651  -13.657 1.00 34.29  ? 577  HOH A O     1 
HETATM 6832 O  O     . HOH O 6 .   ? 10.593  34.551  2.183   1.00 84.73  ? 578  HOH A O     1 
HETATM 6833 O  O     . HOH O 6 .   ? 22.347  14.912  -8.740  1.00 58.86  ? 579  HOH A O     1 
HETATM 6834 O  O     . HOH O 6 .   ? 38.322  -10.967 8.181   1.00 56.08  ? 580  HOH A O     1 
HETATM 6835 O  O     . HOH O 6 .   ? 12.122  -1.141  31.925  1.00 87.98  ? 581  HOH A O     1 
HETATM 6836 O  O     . HOH O 6 .   ? 20.540  12.039  -0.178  1.00 49.62  ? 585  HOH A O     1 
HETATM 6837 O  O     . HOH O 6 .   ? 5.985   9.623   -18.255 1.00 56.79  ? 588  HOH A O     1 
HETATM 6838 O  O     . HOH O 6 .   ? -10.564 -13.025 -12.141 1.00 87.04  ? 589  HOH A O     1 
HETATM 6839 O  O     . HOH O 6 .   ? -0.329  6.701   5.619   1.00 46.39  ? 590  HOH A O     1 
HETATM 6840 O  O     . HOH O 6 .   ? -3.343  -3.018  25.574  1.00 75.55  ? 592  HOH A O     1 
HETATM 6841 O  O     . HOH O 6 .   ? 10.799  -25.797 -1.855  1.00 61.72  ? 595  HOH A O     1 
HETATM 6842 O  O     . HOH O 6 .   ? 25.248  -6.296  6.406   1.00 45.79  ? 597  HOH A O     1 
HETATM 6843 O  O     . HOH O 6 .   ? 37.009  2.464   5.207   1.00 59.88  ? 599  HOH A O     1 
HETATM 6844 O  O     . HOH O 6 .   ? 5.644   -5.160  -17.381 1.00 57.22  ? 601  HOH A O     1 
HETATM 6845 O  O     . HOH O 6 .   ? 6.066   29.466  9.675   1.00 54.92  ? 602  HOH A O     1 
HETATM 6846 O  O     . HOH O 6 .   ? 15.246  -1.757  -16.401 1.00 57.16  ? 603  HOH A O     1 
HETATM 6847 O  O     . HOH O 6 .   ? 29.709  -25.414 11.438  1.00 68.11  ? 606  HOH A O     1 
HETATM 6848 O  O     . HOH O 6 .   ? 33.852  -17.613 7.853   1.00 54.67  ? 608  HOH A O     1 
HETATM 6849 O  O     . HOH O 6 .   ? 2.693   17.016  -19.171 1.00 64.22  ? 609  HOH A O     1 
HETATM 6850 O  O     . HOH O 6 .   ? 22.946  1.999   -3.760  1.00 71.81  ? 610  HOH A O     1 
HETATM 6851 O  O     . HOH O 6 .   ? -7.716  17.068  18.851  1.00 65.94  ? 611  HOH A O     1 
HETATM 6852 O  O     . HOH O 6 .   ? 14.792  16.940  11.094  1.00 49.64  ? 612  HOH A O     1 
HETATM 6853 O  O     . HOH O 6 .   ? 13.935  -26.220 7.895   1.00 66.95  ? 613  HOH A O     1 
HETATM 6854 O  O     . HOH O 6 .   ? 20.089  6.318   1.213   1.00 53.89  ? 617  HOH A O     1 
HETATM 6855 O  O     . HOH O 6 .   ? 18.023  5.466   0.409   1.00 56.02  ? 619  HOH A O     1 
HETATM 6856 O  O     . HOH O 6 .   ? 16.792  12.948  23.577  1.00 60.69  ? 628  HOH A O     1 
HETATM 6857 O  O     . HOH O 6 .   ? 11.719  -27.533 2.022   1.00 51.85  ? 629  HOH A O     1 
HETATM 6858 O  O     . HOH O 6 .   ? -1.092  5.453   3.002   1.00 51.36  ? 631  HOH A O     1 
HETATM 6859 O  O     . HOH O 6 .   ? 18.558  -20.372 -11.253 1.00 71.54  ? 632  HOH A O     1 
HETATM 6860 O  O     . HOH O 6 .   ? 38.265  -10.234 -8.449  1.00 47.95  ? 633  HOH A O     1 
HETATM 6861 O  O     . HOH O 6 .   ? 22.417  7.603   4.941   1.00 66.81  ? 635  HOH A O     1 
HETATM 6862 O  O     . HOH O 6 .   ? 5.386   34.191  8.217   1.00 51.58  ? 638  HOH A O     1 
HETATM 6863 O  O     . HOH O 6 .   ? -4.498  13.817  1.308   1.00 49.81  ? 639  HOH A O     1 
HETATM 6864 O  O     . HOH O 6 .   ? 5.733   -1.405  2.596   1.00 51.40  ? 640  HOH A O     1 
HETATM 6865 O  O     . HOH O 6 .   ? 13.486  26.417  -4.487  1.00 60.61  ? 641  HOH A O     1 
HETATM 6866 O  O     . HOH O 6 .   ? -3.636  16.772  1.401   1.00 46.62  ? 642  HOH A O     1 
HETATM 6867 O  O     . HOH O 6 .   ? -11.677 1.990   -7.040  1.00 70.12  ? 646  HOH A O     1 
HETATM 6868 O  O     . HOH O 6 .   ? -4.055  4.288   -7.156  1.00 40.07  ? 648  HOH A O     1 
HETATM 6869 O  O     . HOH O 6 .   ? 18.726  6.259   -13.214 1.00 41.47  ? 649  HOH A O     1 
HETATM 6870 O  O     . HOH O 6 .   ? 21.683  17.341  -4.494  1.00 62.81  ? 650  HOH A O     1 
HETATM 6871 O  O     . HOH O 6 .   ? 16.084  7.333   -5.994  1.00 42.20  ? 652  HOH A O     1 
HETATM 6872 O  O     . HOH O 6 .   ? -4.542  1.819   24.453  1.00 68.93  ? 653  HOH A O     1 
HETATM 6873 O  O     . HOH O 6 .   ? 11.496  6.046   -17.532 1.00 49.52  ? 655  HOH A O     1 
HETATM 6874 O  O     . HOH O 6 .   ? -3.199  20.125  4.210   1.00 47.41  ? 656  HOH A O     1 
HETATM 6875 O  O     . HOH O 6 .   ? 36.920  -6.780  -7.517  1.00 57.75  ? 657  HOH A O     1 
HETATM 6876 O  O     . HOH O 6 .   ? -3.679  20.911  1.792   1.00 49.26  ? 658  HOH A O     1 
HETATM 6877 O  O     . HOH O 6 .   ? 18.632  1.014   -11.136 1.00 51.14  ? 662  HOH A O     1 
HETATM 6878 O  O     . HOH O 6 .   ? 36.210  -0.881  -7.740  1.00 68.09  ? 663  HOH A O     1 
HETATM 6879 O  O     . HOH O 6 .   ? 4.097   19.050  23.728  1.00 66.81  ? 665  HOH A O     1 
HETATM 6880 O  O     . HOH O 6 .   ? 16.432  32.294  2.830   1.00 57.65  ? 667  HOH A O     1 
HETATM 6881 O  O     . HOH O 6 .   ? 7.281   9.283   -15.476 1.00 54.53  ? 669  HOH A O     1 
HETATM 6882 O  O     . HOH O 6 .   ? -9.770  -6.350  -10.744 1.00 74.62  ? 670  HOH A O     1 
HETATM 6883 O  O     . HOH O 6 .   ? 3.213   -0.652  -16.897 1.00 34.83  ? 671  HOH A O     1 
HETATM 6884 O  O     . HOH O 6 .   ? 15.643  17.622  -13.905 1.00 52.76  ? 672  HOH A O     1 
HETATM 6885 O  O     . HOH O 6 .   ? 21.433  -19.856 12.758  1.00 77.77  ? 675  HOH A O     1 
HETATM 6886 O  O     . HOH O 6 .   ? -4.880  6.841   -6.272  1.00 47.56  ? 677  HOH A O     1 
HETATM 6887 O  O     . HOH O 6 .   ? 21.453  13.765  -2.355  1.00 59.07  ? 678  HOH A O     1 
HETATM 6888 O  O     . HOH O 6 .   ? 2.236   25.317  -8.680  1.00 57.09  ? 681  HOH A O     1 
HETATM 6889 O  O     . HOH O 6 .   ? -3.574  9.016   -5.586  1.00 43.61  ? 682  HOH A O     1 
HETATM 6890 O  O     . HOH O 6 .   ? 40.468  0.764   4.755   1.00 59.24  ? 683  HOH A O     1 
HETATM 6891 O  O     . HOH O 6 .   ? 7.433   29.704  -7.811  1.00 57.57  ? 684  HOH A O     1 
HETATM 6892 O  O     . HOH O 6 .   ? 46.546  -1.655  6.187   1.00 61.15  ? 685  HOH A O     1 
HETATM 6893 O  O     . HOH O 6 .   ? -6.283  6.502   -8.471  1.00 54.22  ? 687  HOH A O     1 
HETATM 6894 O  O     . HOH O 6 .   ? -6.039  13.676  3.543   1.00 60.36  ? 689  HOH A O     1 
HETATM 6895 O  O     . HOH O 6 .   ? 17.567  13.249  -13.843 1.00 36.18  ? 691  HOH A O     1 
HETATM 6896 O  O     . HOH O 6 .   ? 30.982  -3.841  12.479  1.00 49.58  ? 692  HOH A O     1 
HETATM 6897 O  O     . HOH O 6 .   ? 23.113  -7.961  6.595   1.00 55.82  ? 693  HOH A O     1 
HETATM 6898 O  O     . HOH O 6 .   ? 9.806   23.591  21.197  1.00 65.47  ? 696  HOH A O     1 
HETATM 6899 O  O     . HOH O 6 .   ? 29.793  -7.967  -10.929 1.00 57.63  ? 697  HOH A O     1 
HETATM 6900 O  O     . HOH O 6 .   ? 10.772  -29.417 -6.166  1.00 64.85  ? 700  HOH A O     1 
HETATM 6901 O  O     . HOH O 6 .   ? -3.746  13.547  15.865  1.00 55.14  ? 702  HOH A O     1 
HETATM 6902 O  O     . HOH O 6 .   ? 2.743   22.728  -16.259 1.00 77.68  ? 708  HOH A O     1 
HETATM 6903 O  O     . HOH O 6 .   ? 18.753  -15.493 -9.155  1.00 57.96  ? 709  HOH A O     1 
HETATM 6904 O  O     . HOH O 6 .   ? 15.076  5.232   16.008  1.00 57.56  ? 710  HOH A O     1 
HETATM 6905 O  O     . HOH O 6 .   ? 1.005   -1.687  -0.777  1.00 53.54  ? 719  HOH A O     1 
HETATM 6906 O  O     . HOH O 6 .   ? 2.365   8.584   -0.781  1.00 47.41  ? 721  HOH A O     1 
HETATM 6907 O  O     . HOH O 6 .   ? 34.152  2.614   -1.278  1.00 54.53  ? 722  HOH A O     1 
HETATM 6908 O  O     . HOH O 6 .   ? -4.743  -1.258  -13.929 1.00 80.06  ? 729  HOH A O     1 
HETATM 6909 O  O     . HOH O 6 .   ? 5.721   -4.397  3.181   1.00 41.38  ? 731  HOH A O     1 
HETATM 6910 O  O     . HOH O 6 .   ? 36.652  6.087   0.234   1.00 53.60  ? 733  HOH A O     1 
HETATM 6911 O  O     . HOH P 6 .   ? 5.265   4.501   2.838   1.00 38.55  ? 502  HOH D O     1 
HETATM 6912 O  O     . HOH P 6 .   ? 4.912   0.960   11.685  1.00 45.18  ? 514  HOH D O     1 
HETATM 6913 O  O     . HOH P 6 .   ? 29.883  -8.413  10.859  1.00 43.17  ? 515  HOH D O     1 
HETATM 6914 O  O     . HOH P 6 .   ? 5.726   4.135   12.775  1.00 38.24  ? 516  HOH D O     1 
HETATM 6915 O  O     . HOH P 6 .   ? 29.394  -6.111  10.733  1.00 74.20  ? 527  HOH D O     1 
HETATM 6916 O  O     . HOH P 6 .   ? 33.768  -13.290 10.412  1.00 51.50  ? 544  HOH D O     1 
HETATM 6917 O  O     . HOH P 6 .   ? 14.908  -0.109  13.260  1.00 53.86  ? 553  HOH D O     1 
HETATM 6918 O  O     . HOH P 6 .   ? 15.796  -8.168  8.486   1.00 48.82  ? 557  HOH D O     1 
HETATM 6919 O  O     . HOH P 6 .   ? 13.566  1.913   5.064   1.00 59.89  ? 576  HOH D O     1 
HETATM 6920 O  O     . HOH P 6 .   ? 23.267  -9.235  9.613   1.00 46.26  ? 584  HOH D O     1 
HETATM 6921 O  O     . HOH P 6 .   ? 30.383  2.600   33.018  1.00 76.72  ? 587  HOH D O     1 
HETATM 6922 O  O     . HOH P 6 .   ? 15.076  2.037   1.909   1.00 55.13  ? 593  HOH D O     1 
HETATM 6923 O  O     . HOH P 6 .   ? 13.851  1.796   9.232   1.00 46.97  ? 616  HOH D O     1 
HETATM 6924 O  O     . HOH P 6 .   ? 12.217  -6.874  8.048   1.00 62.78  ? 634  HOH D O     1 
HETATM 6925 O  O     . HOH P 6 .   ? 25.717  -4.917  11.695  1.00 39.84  ? 664  HOH D O     1 
HETATM 6926 O  O     . HOH P 6 .   ? 15.659  2.036   -0.544  1.00 46.80  ? 676  HOH D O     1 
HETATM 6927 O  O     . HOH P 6 .   ? 13.394  -5.725  20.186  1.00 69.29  ? 686  HOH D O     1 
HETATM 6928 O  O     . HOH P 6 .   ? 16.351  -4.998  17.361  1.00 57.61  ? 704  HOH D O     1 
HETATM 6929 O  O     . HOH P 6 .   ? 6.223   7.503   4.721   1.00 81.61  ? 717  HOH D O     1 
HETATM 6930 O  O     . HOH P 6 .   ? 11.440  -8.504  14.652  1.00 65.25  ? 727  HOH D O     1 
HETATM 6931 O  O     . HOH Q 6 .   ? 36.313  -10.879 26.838  1.00 76.81  ? 536  HOH E O     1 
HETATM 6932 O  O     . HOH Q 6 .   ? 20.583  -4.430  6.058   1.00 40.83  ? 537  HOH E O     1 
HETATM 6933 O  O     . HOH Q 6 .   ? 27.297  -14.496 20.430  1.00 72.91  ? 555  HOH E O     1 
HETATM 6934 O  O     . HOH Q 6 .   ? 1.157   -23.826 -7.039  1.00 65.32  ? 558  HOH E O     1 
HETATM 6935 O  O     . HOH Q 6 .   ? 20.439  -3.842  -4.261  1.00 45.78  ? 564  HOH E O     1 
HETATM 6936 O  O     . HOH Q 6 .   ? 18.174  -8.090  -0.038  1.00 49.80  ? 582  HOH E O     1 
HETATM 6937 O  O     . HOH Q 6 .   ? 16.567  -7.592  6.324   1.00 46.21  ? 596  HOH E O     1 
HETATM 6938 O  O     . HOH Q 6 .   ? 31.718  -16.940 21.496  1.00 75.63  ? 600  HOH E O     1 
HETATM 6939 O  O     . HOH Q 6 .   ? 6.366   -20.839 3.607   1.00 58.87  ? 620  HOH E O     1 
HETATM 6940 O  O     . HOH Q 6 .   ? 22.353  -3.777  7.468   1.00 52.81  ? 621  HOH E O     1 
HETATM 6941 O  O     . HOH Q 6 .   ? 1.849   -32.416 -5.704  1.00 29.26  ? 626  HOH E O     1 
HETATM 6942 O  O     . HOH Q 6 .   ? 16.744  -10.278 4.294   1.00 50.77  ? 654  HOH E O     1 
HETATM 6943 O  O     . HOH Q 6 .   ? 38.460  -15.331 25.062  1.00 67.52  ? 694  HOH E O     1 
HETATM 6944 O  O     . HOH Q 6 .   ? 21.971  0.025   -2.087  1.00 56.08  ? 698  HOH E O     1 
HETATM 6945 O  O     . HOH Q 6 .   ? 35.631  -12.722 18.339  1.00 81.72  ? 711  HOH E O     1 
HETATM 6946 O  O     . HOH Q 6 .   ? 10.434  -16.377 -1.117  1.00 52.11  ? 714  HOH E O     1 
HETATM 6947 O  O     . HOH Q 6 .   ? 22.306  4.878   4.217   1.00 45.78  ? 715  HOH E O     1 
HETATM 6948 O  O     . HOH Q 6 .   ? 5.281   -27.491 -1.093  1.00 66.81  ? 723  HOH E O     1 
HETATM 6949 O  O     . HOH Q 6 .   ? 8.554   -5.639  4.771   1.00 55.54  ? 730  HOH E O     1 
HETATM 6950 O  O     . HOH Q 6 .   ? 24.303  5.223   12.368  1.00 49.73  ? 734  HOH E O     1 
HETATM 6951 O  O     . HOH R 6 .   ? -9.730  42.369  25.529  1.00 56.78  ? 502  HOH B O     1 
HETATM 6952 O  O     . HOH R 6 .   ? 5.147   51.219  19.244  1.00 60.63  ? 524  HOH B O     1 
HETATM 6953 O  O     . HOH R 6 .   ? -16.891 50.542  18.190  1.00 62.31  ? 528  HOH B O     1 
HETATM 6954 O  O     . HOH R 6 .   ? -6.032  50.521  65.582  1.00 92.71  ? 530  HOH B O     1 
HETATM 6955 O  O     . HOH R 6 .   ? 2.172   54.241  28.471  1.00 50.52  ? 538  HOH B O     1 
HETATM 6956 O  O     . HOH R 6 .   ? -15.967 62.325  17.447  1.00 42.64  ? 542  HOH B O     1 
HETATM 6957 O  O     . HOH R 6 .   ? -0.763  74.496  52.583  1.00 63.68  ? 543  HOH B O     1 
HETATM 6958 O  O     . HOH R 6 .   ? -22.416 63.923  30.352  1.00 58.88  ? 552  HOH B O     1 
HETATM 6959 O  O     . HOH R 6 .   ? 15.225  59.482  34.544  1.00 63.19  ? 560  HOH B O     1 
HETATM 6960 O  O     . HOH R 6 .   ? -19.718 54.977  17.031  1.00 52.45  ? 567  HOH B O     1 
HETATM 6961 O  O     . HOH R 6 .   ? 13.947  55.790  29.113  1.00 57.55  ? 569  HOH B O     1 
HETATM 6962 O  O     . HOH R 6 .   ? 16.231  62.592  39.781  1.00 68.18  ? 572  HOH B O     1 
HETATM 6963 O  O     . HOH R 6 .   ? 1.731   48.458  32.153  1.00 50.95  ? 583  HOH B O     1 
HETATM 6964 O  O     . HOH R 6 .   ? -14.880 63.572  19.482  1.00 40.51  ? 586  HOH B O     1 
HETATM 6965 O  O     . HOH R 6 .   ? -6.600  60.259  45.480  1.00 53.72  ? 591  HOH B O     1 
HETATM 6966 O  O     . HOH R 6 .   ? 20.277  42.280  29.603  1.00 75.45  ? 594  HOH B O     1 
HETATM 6967 O  O     . HOH R 6 .   ? -6.014  52.848  65.227  1.00 61.78  ? 598  HOH B O     1 
HETATM 6968 O  O     . HOH R 6 .   ? -4.607  59.265  35.572  1.00 73.14  ? 604  HOH B O     1 
HETATM 6969 O  O     . HOH R 6 .   ? -19.848 47.697  51.964  1.00 66.59  ? 605  HOH B O     1 
HETATM 6970 O  O     . HOH R 6 .   ? -13.657 38.583  56.524  1.00 80.73  ? 614  HOH B O     1 
HETATM 6971 O  O     . HOH R 6 .   ? -1.881  26.371  17.744  1.00 66.17  ? 615  HOH B O     1 
HETATM 6972 O  O     . HOH R 6 .   ? -5.526  34.228  38.774  1.00 76.20  ? 618  HOH B O     1 
HETATM 6973 O  O     . HOH R 6 .   ? -10.921 36.034  21.510  1.00 68.98  ? 622  HOH B O     1 
HETATM 6974 O  O     . HOH R 6 .   ? -14.057 54.148  36.845  1.00 71.52  ? 624  HOH B O     1 
HETATM 6975 O  O     . HOH R 6 .   ? -29.416 59.775  26.599  1.00 73.30  ? 625  HOH B O     1 
HETATM 6976 O  O     . HOH R 6 .   ? -13.020 60.001  67.333  1.00 64.63  ? 627  HOH B O     1 
HETATM 6977 O  O     . HOH R 6 .   ? 6.650   48.315  37.842  1.00 59.08  ? 636  HOH B O     1 
HETATM 6978 O  O     . HOH R 6 .   ? 19.889  49.203  19.060  1.00 64.41  ? 637  HOH B O     1 
HETATM 6979 O  O     . HOH R 6 .   ? 0.822   50.126  56.938  1.00 73.91  ? 643  HOH B O     1 
HETATM 6980 O  O     . HOH R 6 .   ? 20.282  48.636  41.464  1.00 63.57  ? 644  HOH B O     1 
HETATM 6981 O  O     . HOH R 6 .   ? -3.417  61.411  45.143  1.00 87.04  ? 645  HOH B O     1 
HETATM 6982 O  O     . HOH R 6 .   ? 5.721   58.153  46.937  1.00 65.52  ? 647  HOH B O     1 
HETATM 6983 O  O     . HOH R 6 .   ? -4.991  56.119  23.730  1.00 66.53  ? 651  HOH B O     1 
HETATM 6984 O  O     . HOH R 6 .   ? 13.248  56.877  26.654  1.00 53.76  ? 659  HOH B O     1 
HETATM 6985 O  O     . HOH R 6 .   ? -7.410  29.404  31.451  1.00 62.78  ? 660  HOH B O     1 
HETATM 6986 O  O     . HOH R 6 .   ? -12.392 43.288  13.553  1.00 60.67  ? 668  HOH B O     1 
HETATM 6987 O  O     . HOH R 6 .   ? 16.397  36.284  33.465  1.00 73.44  ? 674  HOH B O     1 
HETATM 6988 O  O     . HOH R 6 .   ? -19.151 69.395  27.428  1.00 55.34  ? 679  HOH B O     1 
HETATM 6989 O  O     . HOH R 6 .   ? -11.844 59.651  20.374  1.00 45.25  ? 680  HOH B O     1 
HETATM 6990 O  O     . HOH R 6 .   ? -26.662 52.150  53.068  1.00 64.20  ? 688  HOH B O     1 
HETATM 6991 O  O     . HOH R 6 .   ? -9.685  43.646  15.412  1.00 65.48  ? 695  HOH B O     1 
HETATM 6992 O  O     . HOH R 6 .   ? -16.301 42.797  10.259  1.00 53.48  ? 699  HOH B O     1 
HETATM 6993 O  O     . HOH R 6 .   ? -0.187  62.340  51.559  1.00 93.07  ? 701  HOH B O     1 
HETATM 6994 O  O     . HOH R 6 .   ? 14.586  39.287  18.450  1.00 77.15  ? 703  HOH B O     1 
HETATM 6995 O  O     . HOH R 6 .   ? 17.960  46.878  20.473  1.00 64.19  ? 705  HOH B O     1 
HETATM 6996 O  O     . HOH R 6 .   ? 5.884   45.827  37.871  1.00 74.59  ? 706  HOH B O     1 
HETATM 6997 O  O     . HOH R 6 .   ? -1.719  35.646  40.457  1.00 65.61  ? 707  HOH B O     1 
HETATM 6998 O  O     . HOH R 6 .   ? -31.139 61.917  31.711  1.00 74.54  ? 712  HOH B O     1 
HETATM 6999 O  O     . HOH R 6 .   ? 9.309   48.365  36.422  1.00 57.12  ? 713  HOH B O     1 
HETATM 7000 O  O     . HOH R 6 .   ? -23.878 65.906  25.969  1.00 89.02  ? 716  HOH B O     1 
HETATM 7001 O  O     . HOH R 6 .   ? -6.696  37.317  17.732  1.00 59.29  ? 718  HOH B O     1 
HETATM 7002 O  O     . HOH R 6 .   ? 16.171  54.531  28.672  1.00 51.39  ? 724  HOH B O     1 
HETATM 7003 O  O     . HOH R 6 .   ? -17.912 48.869  35.397  1.00 70.64  ? 725  HOH B O     1 
HETATM 7004 O  O     . HOH R 6 .   ? -11.432 36.070  23.998  1.00 68.69  ? 728  HOH B O     1 
HETATM 7005 O  O     . HOH R 6 .   ? 21.234  50.039  29.945  1.00 50.41  ? 732  HOH B O     1 
HETATM 7006 O  O     . HOH R 6 .   ? -14.224 59.740  40.425  1.00 44.87  ? 1501 HOH B O     1 
HETATM 7007 O  O     . HOH R 6 .   ? -13.324 60.526  42.911  1.00 64.75  ? 1502 HOH B O     1 
HETATM 7008 O  O     . HOH R 6 .   ? -16.464 58.577  41.712  1.00 74.02  ? 1503 HOH B O     1 
HETATM 7009 O  O     . HOH R 6 .   ? -17.758 54.820  45.148  1.00 85.60  ? 1512 HOH B O     1 
HETATM 7010 O  O     . HOH R 6 .   ? -15.622 50.957  46.389  1.00 51.49  ? 1515 HOH B O     1 
HETATM 7011 O  O     . HOH R 6 .   ? -15.145 55.328  46.199  1.00 62.58  ? 1516 HOH B O     1 
HETATM 7012 O  O     . HOH S 6 .   ? -5.098  57.016  39.536  1.00 66.51  ? 566  HOH H O     1 
HETATM 7013 O  O     . HOH S 6 .   ? -12.074 50.110  41.754  1.00 54.17  ? 570  HOH H O     1 
HETATM 7014 O  O     . HOH S 6 .   ? -6.988  45.250  40.028  1.00 60.79  ? 623  HOH H O     1 
HETATM 7015 O  O     . HOH S 6 .   ? 19.394  44.826  65.830  1.00 63.51  ? 630  HOH H O     1 
HETATM 7016 O  O     . HOH S 6 .   ? 11.626  44.762  41.503  1.00 72.41  ? 661  HOH H O     1 
HETATM 7017 O  O     . HOH S 6 .   ? 5.487   46.739  42.042  1.00 64.02  ? 690  HOH H O     1 
HETATM 7018 O  O     . HOH S 6 .   ? 1.432   39.332  47.250  1.00 73.09  ? 726  HOH H O     1 
HETATM 7019 O  O     . HOH S 6 .   ? -14.413 49.994  44.249  1.00 65.88  ? 1514 HOH H O     1 
HETATM 7020 O  O     . HOH T 6 .   ? -4.970  54.206  31.135  1.00 58.90  ? 535  HOH J O     1 
HETATM 7021 O  O     . HOH T 6 .   ? 4.677   53.226  44.600  1.00 77.46  ? 565  HOH J O     1 
HETATM 7022 O  O     . HOH T 6 .   ? 1.888   34.844  51.110  1.00 81.73  ? 607  HOH J O     1 
HETATM 7023 O  O     . HOH T 6 .   ? 3.865   49.345  40.573  1.00 73.96  ? 666  HOH J O     1 
HETATM 7024 O  O     . HOH T 6 .   ? 24.233  42.652  58.815  1.00 66.94  ? 673  HOH J O     1 
HETATM 7025 O  O     . HOH T 6 .   ? -0.623  48.195  31.397  1.00 57.66  ? 720  HOH J O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1    1    GLY GLY A . n 
A 1 2   ILE 2   2    2    ILE ILE A . n 
A 1 3   VAL 3   3    3    VAL VAL A . n 
A 1 4   LEU 4   4    4    LEU LEU A . n 
A 1 5   PHE 5   5    5    PHE PHE A . n 
A 1 6   VAL 6   6    6    VAL VAL A . n 
A 1 7   ASP 7   7    7    ASP ASP A . n 
A 1 8   PHE 8   8    8    PHE PHE A . n 
A 1 9   ASP 9   9    9    ASP ASP A . n 
A 1 10  TYR 10  10   10   TYR TYR A . n 
A 1 11  PHE 11  11   11   PHE PHE A . n 
A 1 12  TYR 12  12   12   TYR TYR A . n 
A 1 13  ALA 13  13   13   ALA ALA A . n 
A 1 14  GLN 14  14   14   GLN GLN A . n 
A 1 15  VAL 15  15   15   VAL VAL A . n 
A 1 16  GLU 16  16   16   GLU GLU A . n 
A 1 17  GLU 17  17   17   GLU GLU A . n 
A 1 18  VAL 18  18   18   VAL VAL A . n 
A 1 19  LEU 19  19   19   LEU LEU A . n 
A 1 20  ASN 20  20   20   ASN ASN A . n 
A 1 21  PRO 21  21   21   PRO PRO A . n 
A 1 22  SER 22  22   22   SER SER A . n 
A 1 23  LEU 23  23   23   LEU LEU A . n 
A 1 24  LYS 24  24   24   LYS LYS A . n 
A 1 25  GLY 25  25   25   GLY GLY A . n 
A 1 26  LYS 26  26   26   LYS LYS A . n 
A 1 27  PRO 27  27   27   PRO PRO A . n 
A 1 28  VAL 28  28   28   VAL VAL A . n 
A 1 29  VAL 29  29   29   VAL VAL A . n 
A 1 30  VAL 30  30   30   VAL VAL A . n 
A 1 31  CYS 31  31   31   CYS CYS A . n 
A 1 32  VAL 32  32   32   VAL VAL A . n 
A 1 33  PHE 33  33   33   PHE PHE A . n 
A 1 34  SER 34  34   34   SER SER A . n 
A 1 35  GLY 35  35   35   GLY GLY A . n 
A 1 36  ARG 36  36   36   ARG ARG A . n 
A 1 37  PHE 37  37   37   PHE PHE A . n 
A 1 38  GLU 38  38   38   GLU GLU A . n 
A 1 39  ASP 39  39   39   ASP ASP A . n 
A 1 40  SER 40  40   40   SER SER A . n 
A 1 41  GLY 41  41   41   GLY GLY A . n 
A 1 42  ALA 42  42   42   ALA ALA A . n 
A 1 43  VAL 43  43   43   VAL VAL A . n 
A 1 44  ALA 44  44   44   ALA ALA A . n 
A 1 45  THR 45  45   45   THR THR A . n 
A 1 46  ALA 46  46   46   ALA ALA A . n 
A 1 47  ASN 47  47   47   ASN ASN A . n 
A 1 48  TYR 48  48   48   TYR TYR A . n 
A 1 49  GLU 49  49   49   GLU GLU A . n 
A 1 50  ALA 50  50   50   ALA ALA A . n 
A 1 51  ARG 51  51   51   ARG ARG A . n 
A 1 52  LYS 52  52   52   LYS LYS A . n 
A 1 53  PHE 53  53   53   PHE PHE A . n 
A 1 54  GLY 54  54   54   GLY GLY A . n 
A 1 55  VAL 55  55   55   VAL VAL A . n 
A 1 56  LYS 56  56   56   LYS LYS A . n 
A 1 57  ALA 57  57   57   ALA ALA A . n 
A 1 58  GLY 58  58   58   GLY GLY A . n 
A 1 59  ILE 59  59   59   ILE ILE A . n 
A 1 60  PRO 60  60   60   PRO PRO A . n 
A 1 61  ILE 61  61   61   ILE ILE A . n 
A 1 62  VAL 62  62   62   VAL VAL A . n 
A 1 63  GLU 63  63   63   GLU GLU A . n 
A 1 64  ALA 64  64   64   ALA ALA A . n 
A 1 65  LYS 65  65   65   LYS LYS A . n 
A 1 66  LYS 66  66   66   LYS LYS A . n 
A 1 67  ILE 67  67   67   ILE ILE A . n 
A 1 68  LEU 68  68   68   LEU LEU A . n 
A 1 69  PRO 69  69   69   PRO PRO A . n 
A 1 70  ASN 70  70   70   ASN ASN A . n 
A 1 71  ALA 71  71   71   ALA ALA A . n 
A 1 72  VAL 72  72   72   VAL VAL A . n 
A 1 73  TYR 73  73   73   TYR TYR A . n 
A 1 74  LEU 74  74   74   LEU LEU A . n 
A 1 75  PRO 75  75   75   PRO PRO A . n 
A 1 76  MET 76  76   76   MET MET A . n 
A 1 77  ARG 77  77   77   ARG ARG A . n 
A 1 78  LYS 78  78   78   LYS LYS A . n 
A 1 79  GLU 79  79   79   GLU GLU A . n 
A 1 80  VAL 80  80   80   VAL VAL A . n 
A 1 81  TYR 81  81   81   TYR TYR A . n 
A 1 82  GLN 82  82   82   GLN GLN A . n 
A 1 83  GLN 83  83   83   GLN GLN A . n 
A 1 84  VAL 84  84   84   VAL VAL A . n 
A 1 85  SER 85  85   85   SER SER A . n 
A 1 86  SER 86  86   86   SER SER A . n 
A 1 87  ARG 87  87   87   ARG ARG A . n 
A 1 88  ILE 88  88   88   ILE ILE A . n 
A 1 89  MET 89  89   89   MET MET A . n 
A 1 90  ASN 90  90   90   ASN ASN A . n 
A 1 91  LEU 91  91   91   LEU LEU A . n 
A 1 92  LEU 92  92   92   LEU LEU A . n 
A 1 93  ARG 93  93   93   ARG ARG A . n 
A 1 94  GLU 94  94   94   GLU GLU A . n 
A 1 95  TYR 95  95   95   TYR TYR A . n 
A 1 96  SER 96  96   96   SER SER A . n 
A 1 97  GLU 97  97   97   GLU GLU A . n 
A 1 98  LYS 98  98   98   LYS LYS A . n 
A 1 99  ILE 99  99   99   ILE ILE A . n 
A 1 100 GLU 100 100  100  GLU GLU A . n 
A 1 101 ILE 101 101  101  ILE ILE A . n 
A 1 102 ALA 102 102  102  ALA ALA A . n 
A 1 103 SER 103 103  103  SER SER A . n 
A 1 104 ILE 104 104  104  ILE ILE A . n 
A 1 105 ASP 105 105  105  ASP ASP A . n 
A 1 106 GLU 106 106  106  GLU GLU A . n 
A 1 107 ALA 107 107  107  ALA ALA A . n 
A 1 108 TYR 108 108  108  TYR TYR A . n 
A 1 109 LEU 109 109  109  LEU LEU A . n 
A 1 110 ASP 110 110  110  ASP ASP A . n 
A 1 111 ILE 111 111  111  ILE ILE A . n 
A 1 112 SER 112 112  112  SER SER A . n 
A 1 113 ASP 113 113  113  ASP ASP A . n 
A 1 114 LYS 114 114  114  LYS LYS A . n 
A 1 115 VAL 115 115  115  VAL VAL A . n 
A 1 116 ARG 116 116  116  ARG ARG A . n 
A 1 117 ASP 117 117  117  ASP ASP A . n 
A 1 118 TYR 118 118  118  TYR TYR A . n 
A 1 119 ARG 119 119  119  ARG ARG A . n 
A 1 120 GLU 120 120  120  GLU GLU A . n 
A 1 121 ALA 121 121  121  ALA ALA A . n 
A 1 122 TYR 122 122  122  TYR TYR A . n 
A 1 123 ASN 123 123  123  ASN ASN A . n 
A 1 124 LEU 124 124  124  LEU LEU A . n 
A 1 125 GLY 125 125  125  GLY GLY A . n 
A 1 126 LEU 126 126  126  LEU LEU A . n 
A 1 127 GLU 127 127  127  GLU GLU A . n 
A 1 128 ILE 128 128  128  ILE ILE A . n 
A 1 129 LYS 129 129  129  LYS LYS A . n 
A 1 130 ASN 130 130  130  ASN ASN A . n 
A 1 131 LYS 131 131  131  LYS LYS A . n 
A 1 132 ILE 132 132  132  ILE ILE A . n 
A 1 133 LEU 133 133  133  LEU LEU A . n 
A 1 134 GLU 134 134  134  GLU GLU A . n 
A 1 135 LYS 135 135  135  LYS LYS A . n 
A 1 136 GLU 136 136  136  GLU GLU A . n 
A 1 137 LYS 137 137  137  LYS LYS A . n 
A 1 138 ILE 138 138  138  ILE ILE A . n 
A 1 139 THR 139 139  139  THR THR A . n 
A 1 140 VAL 140 140  140  VAL VAL A . n 
A 1 141 THR 141 141  141  THR THR A . n 
A 1 142 VAL 142 142  142  VAL VAL A . n 
A 1 143 GLY 143 143  143  GLY GLY A . n 
A 1 144 ILE 144 144  144  ILE ILE A . n 
A 1 145 SER 145 145  145  SER SER A . n 
A 1 146 LYS 146 146  146  LYS LYS A . n 
A 1 147 ASN 147 147  147  ASN ASN A . n 
A 1 148 LYS 148 148  148  LYS LYS A . n 
A 1 149 VAL 149 149  149  VAL VAL A . n 
A 1 150 PHE 150 150  150  PHE PHE A . n 
A 1 151 ALA 151 151  151  ALA ALA A . n 
A 1 152 LYS 152 152  152  LYS LYS A . n 
A 1 153 ILE 153 153  153  ILE ILE A . n 
A 1 154 ALA 154 154  154  ALA ALA A . n 
A 1 155 ALA 155 155  155  ALA ALA A . n 
A 1 156 ASP 156 156  156  ASP ASP A . n 
A 1 157 MET 157 157  157  MET MET A . n 
A 1 158 ALA 158 158  158  ALA ALA A . n 
A 1 159 LYS 159 159  159  LYS LYS A . n 
A 1 160 PRO 160 160  160  PRO PRO A . n 
A 1 161 ASN 161 161  161  ASN ASN A . n 
A 1 162 GLY 162 162  162  GLY GLY A . n 
A 1 163 ILE 163 163  163  ILE ILE A . n 
A 1 164 LYS 164 164  164  LYS LYS A . n 
A 1 165 VAL 165 165  165  VAL VAL A . n 
A 1 166 ILE 166 166  166  ILE ILE A . n 
A 1 167 ASP 167 167  167  ASP ASP A . n 
A 1 168 ASP 168 168  168  ASP ASP A . n 
A 1 169 GLU 169 169  169  GLU GLU A . n 
A 1 170 GLU 170 170  170  GLU GLU A . n 
A 1 171 VAL 171 171  171  VAL VAL A . n 
A 1 172 LYS 172 172  172  LYS LYS A . n 
A 1 173 ARG 173 173  173  ARG ARG A . n 
A 1 174 LEU 174 174  174  LEU LEU A . n 
A 1 175 ILE 175 175  175  ILE ILE A . n 
A 1 176 ARG 176 176  176  ARG ARG A . n 
A 1 177 GLU 177 177  177  GLU GLU A . n 
A 1 178 LEU 178 178  178  LEU LEU A . n 
A 1 179 ASP 179 179  179  ASP ASP A . n 
A 1 180 ILE 180 180  180  ILE ILE A . n 
A 1 181 ALA 181 181  181  ALA ALA A . n 
A 1 182 ASP 182 182  182  ASP ASP A . n 
A 1 183 VAL 183 183  183  VAL VAL A . n 
A 1 184 PRO 184 184  184  PRO PRO A . n 
A 1 185 GLY 185 185  185  GLY GLY A . n 
A 1 186 ILE 186 186  186  ILE ILE A . n 
A 1 187 GLY 187 187  187  GLY GLY A . n 
A 1 188 ASN 188 188  188  ASN ASN A . n 
A 1 189 ILE 189 189  189  ILE ILE A . n 
A 1 190 THR 190 190  190  THR THR A . n 
A 1 191 ALA 191 191  191  ALA ALA A . n 
A 1 192 GLU 192 192  192  GLU GLU A . n 
A 1 193 LYS 193 193  193  LYS LYS A . n 
A 1 194 LEU 194 194  194  LEU LEU A . n 
A 1 195 LYS 195 195  195  LYS LYS A . n 
A 1 196 LYS 196 196  196  LYS LYS A . n 
A 1 197 LEU 197 197  197  LEU LEU A . n 
A 1 198 GLY 198 198  198  GLY GLY A . n 
A 1 199 ILE 199 199  199  ILE ILE A . n 
A 1 200 ASN 200 200  200  ASN ASN A . n 
A 1 201 LYS 201 201  201  LYS LYS A . n 
A 1 202 LEU 202 202  202  LEU LEU A . n 
A 1 203 VAL 203 203  203  VAL VAL A . n 
A 1 204 ASP 204 204  204  ASP ASP A . n 
A 1 205 THR 205 205  205  THR THR A . n 
A 1 206 LEU 206 206  206  LEU LEU A . n 
A 1 207 SER 207 207  207  SER SER A . n 
A 1 208 ILE 208 208  208  ILE ILE A . n 
A 1 209 GLU 209 209  209  GLU GLU A . n 
A 1 210 PHE 210 210  210  PHE PHE A . n 
A 1 211 ASP 211 211  211  ASP ASP A . n 
A 1 212 LYS 212 212  212  LYS LYS A . n 
A 1 213 LEU 213 213  213  LEU LEU A . n 
A 1 214 LYS 214 214  214  LYS LYS A . n 
A 1 215 GLY 215 215  215  GLY GLY A . n 
A 1 216 MET 216 216  216  MET MET A . n 
A 1 217 ILE 217 217  217  ILE ILE A . n 
A 1 218 GLY 218 218  218  GLY GLY A . n 
A 1 219 GLU 219 219  219  GLU GLU A . n 
A 1 220 ALA 220 220  220  ALA ALA A . n 
A 1 221 LYS 221 221  221  LYS LYS A . n 
A 1 222 ALA 222 222  222  ALA ALA A . n 
A 1 223 LYS 223 223  223  LYS LYS A . n 
A 1 224 TYR 224 224  224  TYR TYR A . n 
A 1 225 LEU 225 225  225  LEU LEU A . n 
A 1 226 ILE 226 226  226  ILE ILE A . n 
A 1 227 SER 227 227  227  SER SER A . n 
A 1 228 LEU 228 228  228  LEU LEU A . n 
A 1 229 ALA 229 229  229  ALA ALA A . n 
A 1 230 ARG 230 230  230  ARG ARG A . n 
A 1 231 ASP 231 231  231  ASP ASP A . n 
A 1 232 GLU 232 232  232  GLU GLU A . n 
A 1 233 TYR 233 233  233  TYR TYR A . n 
A 1 234 ASN 234 234  234  ASN ASN A . n 
A 1 235 GLU 235 235  235  GLU GLU A . n 
A 1 236 PRO 236 236  236  PRO PRO A . n 
A 1 237 ILE 237 237  237  ILE ILE A . n 
A 1 238 ARG 238 238  238  ARG ARG A . n 
A 1 239 THR 239 239  239  THR THR A . n 
A 1 240 ARG 240 240  240  ARG ARG A . n 
A 1 241 VAL 241 241  241  VAL VAL A . n 
A 1 242 ARG 242 242  242  ARG ARG A . n 
A 1 243 LYS 243 243  243  LYS LYS A . n 
A 1 244 SER 244 244  244  SER SER A . n 
A 1 245 ILE 245 245  245  ILE ILE A . n 
A 1 246 GLY 246 246  246  GLY GLY A . n 
A 1 247 ARG 247 247  247  ARG ARG A . n 
A 1 248 ILE 248 248  248  ILE ILE A . n 
A 1 249 VAL 249 249  249  VAL VAL A . n 
A 1 250 THR 250 250  250  THR THR A . n 
A 1 251 MET 251 251  251  MET MET A . n 
A 1 252 LYS 252 252  252  LYS LYS A . n 
A 1 253 ARG 253 253  253  ARG ARG A . n 
A 1 254 ASN 254 254  254  ASN ASN A . n 
A 1 255 SER 255 255  255  SER SER A . n 
A 1 256 ARG 256 256  256  ARG ARG A . n 
A 1 257 ASN 257 257  257  ASN ASN A . n 
A 1 258 LEU 258 258  258  LEU LEU A . n 
A 1 259 GLU 259 259  259  GLU GLU A . n 
A 1 260 GLU 260 260  260  GLU GLU A . n 
A 1 261 ILE 261 261  261  ILE ILE A . n 
A 1 262 LYS 262 262  262  LYS LYS A . n 
A 1 263 PRO 263 263  263  PRO PRO A . n 
A 1 264 TYR 264 264  264  TYR TYR A . n 
A 1 265 LEU 265 265  265  LEU LEU A . n 
A 1 266 PHE 266 266  266  PHE PHE A . n 
A 1 267 ARG 267 267  267  ARG ARG A . n 
A 1 268 ALA 268 268  268  ALA ALA A . n 
A 1 269 ILE 269 269  269  ILE ILE A . n 
A 1 270 GLU 270 270  270  GLU GLU A . n 
A 1 271 GLU 271 271  271  GLU GLU A . n 
A 1 272 SER 272 272  272  SER SER A . n 
A 1 273 TYR 273 273  273  TYR TYR A . n 
A 1 274 TYR 274 274  274  TYR TYR A . n 
A 1 275 LYS 275 275  275  LYS LYS A . n 
A 1 276 LEU 276 276  276  LEU LEU A . n 
A 1 277 ASP 277 277  277  ASP ASP A . n 
A 1 278 LYS 278 278  278  LYS LYS A . n 
A 1 279 ARG 279 279  279  ARG ARG A . n 
A 1 280 ILE 280 280  280  ILE ILE A . n 
A 1 281 PRO 281 281  281  PRO PRO A . n 
A 1 282 LYS 282 282  282  LYS LYS A . n 
A 1 283 ALA 283 283  283  ALA ALA A . n 
A 1 284 ILE 284 284  284  ILE ILE A . n 
A 1 285 HIS 285 285  285  HIS HIS A . n 
A 1 286 VAL 286 286  286  VAL VAL A . n 
A 1 287 VAL 287 287  287  VAL VAL A . n 
A 1 288 ALA 288 288  288  ALA ALA A . n 
A 1 289 VAL 289 289  289  VAL VAL A . n 
A 1 290 THR 290 290  290  THR THR A . n 
A 1 291 GLU 291 291  291  GLU GLU A . n 
A 1 292 ASP 292 292  292  ASP ASP A . n 
A 1 293 LEU 293 293  293  LEU LEU A . n 
A 1 294 ASP 294 294  294  ASP ASP A . n 
A 1 295 ILE 295 295  295  ILE ILE A . n 
A 1 296 VAL 296 296  296  VAL VAL A . n 
A 1 297 SER 297 297  297  SER SER A . n 
A 1 298 ARG 298 298  298  ARG ARG A . n 
A 1 299 GLY 299 299  299  GLY GLY A . n 
A 1 300 ARG 300 300  300  ARG ARG A . n 
A 1 301 THR 301 301  301  THR THR A . n 
A 1 302 PHE 302 302  302  PHE PHE A . n 
A 1 303 PRO 303 303  303  PRO PRO A . n 
A 1 304 HIS 304 304  304  HIS HIS A . n 
A 1 305 GLY 305 305  305  GLY GLY A . n 
A 1 306 ILE 306 306  306  ILE ILE A . n 
A 1 307 SER 307 307  307  SER SER A . n 
A 1 308 LYS 308 308  308  LYS LYS A . n 
A 1 309 GLU 309 309  309  GLU GLU A . n 
A 1 310 THR 310 310  310  THR THR A . n 
A 1 311 ALA 311 311  311  ALA ALA A . n 
A 1 312 TYR 312 312  312  TYR TYR A . n 
A 1 313 SER 313 313  313  SER SER A . n 
A 1 314 GLU 314 314  314  GLU GLU A . n 
A 1 315 SER 315 315  315  SER SER A . n 
A 1 316 VAL 316 316  316  VAL VAL A . n 
A 1 317 LYS 317 317  317  LYS LYS A . n 
A 1 318 LEU 318 318  318  LEU LEU A . n 
A 1 319 LEU 319 319  319  LEU LEU A . n 
A 1 320 GLN 320 320  320  GLN GLN A . n 
A 1 321 LYS 321 321  321  LYS LYS A . n 
A 1 322 ILE 322 322  322  ILE ILE A . n 
A 1 323 LEU 323 323  323  LEU LEU A . n 
A 1 324 GLU 324 324  324  GLU GLU A . n 
A 1 325 GLU 325 325  325  GLU GLU A . n 
A 1 326 ASP 326 326  326  ASP ASP A . n 
A 1 327 GLU 327 327  327  GLU GLU A . n 
A 1 328 ARG 328 328  328  ARG ARG A . n 
A 1 329 LYS 329 329  329  LYS LYS A . n 
A 1 330 ILE 330 330  330  ILE ILE A . n 
A 1 331 ARG 331 331  331  ARG ARG A . n 
A 1 332 ARG 332 332  332  ARG ARG A . n 
A 1 333 ILE 333 333  333  ILE ILE A . n 
A 1 334 GLY 334 334  334  GLY GLY A . n 
A 1 335 VAL 335 335  335  VAL VAL A . n 
A 1 336 ARG 336 336  336  ARG ARG A . n 
A 1 337 PHE 337 337  337  PHE PHE A . n 
A 1 338 SER 338 338  338  SER SER A . n 
A 1 339 LYS 339 339  339  LYS LYS A . n 
A 1 340 PHE 340 340  340  PHE PHE A . n 
A 1 341 ILE 341 341  341  ILE ILE A . n 
B 2 1   DG  1   802  802  DG  G   D . n 
B 2 2   DT  2   803  803  DT  T   D . n 
B 2 3   DT  3   804  804  DT  T   D . n 
B 2 4   DG  4   805  805  DG  G   D . n 
B 2 5   DG  5   806  806  DG  G   D . n 
B 2 6   DA  6   807  807  DA  A   D . n 
B 2 7   DT  7   808  808  DT  T   D . n 
B 2 8   DG  8   809  809  DG  G   D . n 
B 2 9   DG  9   810  810  DG  G   D . n 
B 2 10  DT  10  811  811  DT  T   D . n 
B 2 11  DA  11  812  812  DA  A   D . n 
B 2 12  DG  12  813  813  DG  G   D . n 
B 2 13  2DA 13  814  814  2DA 2DA D . n 
C 3 1   DC  1   901  901  DC  C   E . n 
C 3 2   DT  2   902  902  DT  T   E . n 
C 3 3   DA  3   903  903  DA  A   E . n 
C 3 4   DA  4   904  904  DA  A   E . n 
C 3 5   DC  5   905  905  DC  C   E . n 
C 3 6   8OG 6   906  906  8OG 8OG E . n 
C 3 7   DC  7   907  907  DC  C   E . n 
C 3 8   DT  8   908  908  DT  T   E . n 
C 3 9   DA  9   909  909  DA  A   E . n 
C 3 10  DC  10  910  910  DC  C   E . n 
C 3 11  DC  11  911  911  DC  C   E . n 
C 3 12  DA  12  912  912  DA  A   E . n 
C 3 13  DT  13  913  913  DT  T   E . n 
C 3 14  DC  14  914  914  DC  C   E . n 
C 3 15  DC  15  915  915  DC  C   E . n 
C 3 16  DA  16  916  916  DA  A   E . n 
C 3 17  DA  17  917  917  DA  A   E . n 
C 3 18  DC  18  918  918  DC  C   E . n 
D 1 1   GLY 1   1001 1001 GLY GLY B . n 
D 1 2   ILE 2   1002 1002 ILE ILE B . n 
D 1 3   VAL 3   1003 1003 VAL VAL B . n 
D 1 4   LEU 4   1004 1004 LEU LEU B . n 
D 1 5   PHE 5   1005 1005 PHE PHE B . n 
D 1 6   VAL 6   1006 1006 VAL VAL B . n 
D 1 7   ASP 7   1007 1007 ASP ASP B . n 
D 1 8   PHE 8   1008 1008 PHE PHE B . n 
D 1 9   ASP 9   1009 1009 ASP ASP B . n 
D 1 10  TYR 10  1010 1010 TYR TYR B . n 
D 1 11  PHE 11  1011 1011 PHE PHE B . n 
D 1 12  TYR 12  1012 1012 TYR TYR B . n 
D 1 13  ALA 13  1013 1013 ALA ALA B . n 
D 1 14  GLN 14  1014 1014 GLN GLN B . n 
D 1 15  VAL 15  1015 1015 VAL VAL B . n 
D 1 16  GLU 16  1016 1016 GLU GLU B . n 
D 1 17  GLU 17  1017 1017 GLU GLU B . n 
D 1 18  VAL 18  1018 1018 VAL VAL B . n 
D 1 19  LEU 19  1019 1019 LEU LEU B . n 
D 1 20  ASN 20  1020 1020 ASN ASN B . n 
D 1 21  PRO 21  1021 1021 PRO PRO B . n 
D 1 22  SER 22  1022 1022 SER SER B . n 
D 1 23  LEU 23  1023 1023 LEU LEU B . n 
D 1 24  LYS 24  1024 1024 LYS LYS B . n 
D 1 25  GLY 25  1025 1025 GLY GLY B . n 
D 1 26  LYS 26  1026 1026 LYS LYS B . n 
D 1 27  PRO 27  1027 1027 PRO PRO B . n 
D 1 28  VAL 28  1028 1028 VAL VAL B . n 
D 1 29  VAL 29  1029 1029 VAL VAL B . n 
D 1 30  VAL 30  1030 1030 VAL VAL B . n 
D 1 31  CYS 31  1031 1031 CYS CYS B . n 
D 1 32  VAL 32  1032 1032 VAL VAL B . n 
D 1 33  PHE 33  1033 1033 PHE PHE B . n 
D 1 34  SER 34  1034 1034 SER SER B . n 
D 1 35  GLY 35  1035 1035 GLY GLY B . n 
D 1 36  ARG 36  1036 1036 ARG ARG B . n 
D 1 37  PHE 37  1037 1037 PHE PHE B . n 
D 1 38  GLU 38  1038 1038 GLU GLU B . n 
D 1 39  ASP 39  1039 1039 ASP ASP B . n 
D 1 40  SER 40  1040 1040 SER SER B . n 
D 1 41  GLY 41  1041 1041 GLY GLY B . n 
D 1 42  ALA 42  1042 1042 ALA ALA B . n 
D 1 43  VAL 43  1043 1043 VAL VAL B . n 
D 1 44  ALA 44  1044 1044 ALA ALA B . n 
D 1 45  THR 45  1045 1045 THR THR B . n 
D 1 46  ALA 46  1046 1046 ALA ALA B . n 
D 1 47  ASN 47  1047 1047 ASN ASN B . n 
D 1 48  TYR 48  1048 1048 TYR TYR B . n 
D 1 49  GLU 49  1049 1049 GLU GLU B . n 
D 1 50  ALA 50  1050 1050 ALA ALA B . n 
D 1 51  ARG 51  1051 1051 ARG ARG B . n 
D 1 52  LYS 52  1052 1052 LYS LYS B . n 
D 1 53  PHE 53  1053 1053 PHE PHE B . n 
D 1 54  GLY 54  1054 1054 GLY GLY B . n 
D 1 55  VAL 55  1055 1055 VAL VAL B . n 
D 1 56  LYS 56  1056 1056 LYS LYS B . n 
D 1 57  ALA 57  1057 1057 ALA ALA B . n 
D 1 58  GLY 58  1058 1058 GLY GLY B . n 
D 1 59  ILE 59  1059 1059 ILE ILE B . n 
D 1 60  PRO 60  1060 1060 PRO PRO B . n 
D 1 61  ILE 61  1061 1061 ILE ILE B . n 
D 1 62  VAL 62  1062 1062 VAL VAL B . n 
D 1 63  GLU 63  1063 1063 GLU GLU B . n 
D 1 64  ALA 64  1064 1064 ALA ALA B . n 
D 1 65  LYS 65  1065 1065 LYS LYS B . n 
D 1 66  LYS 66  1066 1066 LYS LYS B . n 
D 1 67  ILE 67  1067 1067 ILE ILE B . n 
D 1 68  LEU 68  1068 1068 LEU LEU B . n 
D 1 69  PRO 69  1069 1069 PRO PRO B . n 
D 1 70  ASN 70  1070 1070 ASN ASN B . n 
D 1 71  ALA 71  1071 1071 ALA ALA B . n 
D 1 72  VAL 72  1072 1072 VAL VAL B . n 
D 1 73  TYR 73  1073 1073 TYR TYR B . n 
D 1 74  LEU 74  1074 1074 LEU LEU B . n 
D 1 75  PRO 75  1075 1075 PRO PRO B . n 
D 1 76  MET 76  1076 1076 MET MET B . n 
D 1 77  ARG 77  1077 1077 ARG ARG B . n 
D 1 78  LYS 78  1078 1078 LYS LYS B . n 
D 1 79  GLU 79  1079 1079 GLU GLU B . n 
D 1 80  VAL 80  1080 1080 VAL VAL B . n 
D 1 81  TYR 81  1081 1081 TYR TYR B . n 
D 1 82  GLN 82  1082 1082 GLN GLN B . n 
D 1 83  GLN 83  1083 1083 GLN GLN B . n 
D 1 84  VAL 84  1084 1084 VAL VAL B . n 
D 1 85  SER 85  1085 1085 SER SER B . n 
D 1 86  SER 86  1086 1086 SER SER B . n 
D 1 87  ARG 87  1087 1087 ARG ARG B . n 
D 1 88  ILE 88  1088 1088 ILE ILE B . n 
D 1 89  MET 89  1089 1089 MET MET B . n 
D 1 90  ASN 90  1090 1090 ASN ASN B . n 
D 1 91  LEU 91  1091 1091 LEU LEU B . n 
D 1 92  LEU 92  1092 1092 LEU LEU B . n 
D 1 93  ARG 93  1093 1093 ARG ARG B . n 
D 1 94  GLU 94  1094 1094 GLU GLU B . n 
D 1 95  TYR 95  1095 1095 TYR TYR B . n 
D 1 96  SER 96  1096 1096 SER SER B . n 
D 1 97  GLU 97  1097 1097 GLU GLU B . n 
D 1 98  LYS 98  1098 1098 LYS LYS B . n 
D 1 99  ILE 99  1099 1099 ILE ILE B . n 
D 1 100 GLU 100 1100 1100 GLU GLU B . n 
D 1 101 ILE 101 1101 1101 ILE ILE B . n 
D 1 102 ALA 102 1102 1102 ALA ALA B . n 
D 1 103 SER 103 1103 1103 SER SER B . n 
D 1 104 ILE 104 1104 1104 ILE ILE B . n 
D 1 105 ASP 105 1105 1105 ASP ASP B . n 
D 1 106 GLU 106 1106 1106 GLU GLU B . n 
D 1 107 ALA 107 1107 1107 ALA ALA B . n 
D 1 108 TYR 108 1108 1108 TYR TYR B . n 
D 1 109 LEU 109 1109 1109 LEU LEU B . n 
D 1 110 ASP 110 1110 1110 ASP ASP B . n 
D 1 111 ILE 111 1111 1111 ILE ILE B . n 
D 1 112 SER 112 1112 1112 SER SER B . n 
D 1 113 ASP 113 1113 1113 ASP ASP B . n 
D 1 114 LYS 114 1114 1114 LYS LYS B . n 
D 1 115 VAL 115 1115 1115 VAL VAL B . n 
D 1 116 ARG 116 1116 1116 ARG ARG B . n 
D 1 117 ASP 117 1117 1117 ASP ASP B . n 
D 1 118 TYR 118 1118 1118 TYR TYR B . n 
D 1 119 ARG 119 1119 1119 ARG ARG B . n 
D 1 120 GLU 120 1120 1120 GLU GLU B . n 
D 1 121 ALA 121 1121 1121 ALA ALA B . n 
D 1 122 TYR 122 1122 1122 TYR TYR B . n 
D 1 123 ASN 123 1123 1123 ASN ASN B . n 
D 1 124 LEU 124 1124 1124 LEU LEU B . n 
D 1 125 GLY 125 1125 1125 GLY GLY B . n 
D 1 126 LEU 126 1126 1126 LEU LEU B . n 
D 1 127 GLU 127 1127 1127 GLU GLU B . n 
D 1 128 ILE 128 1128 1128 ILE ILE B . n 
D 1 129 LYS 129 1129 1129 LYS LYS B . n 
D 1 130 ASN 130 1130 1130 ASN ASN B . n 
D 1 131 LYS 131 1131 1131 LYS LYS B . n 
D 1 132 ILE 132 1132 1132 ILE ILE B . n 
D 1 133 LEU 133 1133 1133 LEU LEU B . n 
D 1 134 GLU 134 1134 1134 GLU GLU B . n 
D 1 135 LYS 135 1135 1135 LYS LYS B . n 
D 1 136 GLU 136 1136 1136 GLU GLU B . n 
D 1 137 LYS 137 1137 1137 LYS LYS B . n 
D 1 138 ILE 138 1138 1138 ILE ILE B . n 
D 1 139 THR 139 1139 1139 THR THR B . n 
D 1 140 VAL 140 1140 1140 VAL VAL B . n 
D 1 141 THR 141 1141 1141 THR THR B . n 
D 1 142 VAL 142 1142 1142 VAL VAL B . n 
D 1 143 GLY 143 1143 1143 GLY GLY B . n 
D 1 144 ILE 144 1144 1144 ILE ILE B . n 
D 1 145 SER 145 1145 1145 SER SER B . n 
D 1 146 LYS 146 1146 1146 LYS LYS B . n 
D 1 147 ASN 147 1147 1147 ASN ASN B . n 
D 1 148 LYS 148 1148 1148 LYS LYS B . n 
D 1 149 VAL 149 1149 1149 VAL VAL B . n 
D 1 150 PHE 150 1150 1150 PHE PHE B . n 
D 1 151 ALA 151 1151 1151 ALA ALA B . n 
D 1 152 LYS 152 1152 1152 LYS LYS B . n 
D 1 153 ILE 153 1153 1153 ILE ILE B . n 
D 1 154 ALA 154 1154 1154 ALA ALA B . n 
D 1 155 ALA 155 1155 1155 ALA ALA B . n 
D 1 156 ASP 156 1156 1156 ASP ASP B . n 
D 1 157 MET 157 1157 1157 MET MET B . n 
D 1 158 ALA 158 1158 1158 ALA ALA B . n 
D 1 159 LYS 159 1159 1159 LYS LYS B . n 
D 1 160 PRO 160 1160 1160 PRO PRO B . n 
D 1 161 ASN 161 1161 1161 ASN ASN B . n 
D 1 162 GLY 162 1162 1162 GLY GLY B . n 
D 1 163 ILE 163 1163 1163 ILE ILE B . n 
D 1 164 LYS 164 1164 1164 LYS LYS B . n 
D 1 165 VAL 165 1165 1165 VAL VAL B . n 
D 1 166 ILE 166 1166 1166 ILE ILE B . n 
D 1 167 ASP 167 1167 1167 ASP ASP B . n 
D 1 168 ASP 168 1168 1168 ASP ASP B . n 
D 1 169 GLU 169 1169 1169 GLU GLU B . n 
D 1 170 GLU 170 1170 1170 GLU GLU B . n 
D 1 171 VAL 171 1171 1171 VAL VAL B . n 
D 1 172 LYS 172 1172 1172 LYS LYS B . n 
D 1 173 ARG 173 1173 1173 ARG ARG B . n 
D 1 174 LEU 174 1174 1174 LEU LEU B . n 
D 1 175 ILE 175 1175 1175 ILE ILE B . n 
D 1 176 ARG 176 1176 1176 ARG ARG B . n 
D 1 177 GLU 177 1177 1177 GLU GLU B . n 
D 1 178 LEU 178 1178 1178 LEU LEU B . n 
D 1 179 ASP 179 1179 1179 ASP ASP B . n 
D 1 180 ILE 180 1180 1180 ILE ILE B . n 
D 1 181 ALA 181 1181 1181 ALA ALA B . n 
D 1 182 ASP 182 1182 1182 ASP ASP B . n 
D 1 183 VAL 183 1183 1183 VAL VAL B . n 
D 1 184 PRO 184 1184 1184 PRO PRO B . n 
D 1 185 GLY 185 1185 1185 GLY GLY B . n 
D 1 186 ILE 186 1186 1186 ILE ILE B . n 
D 1 187 GLY 187 1187 1187 GLY GLY B . n 
D 1 188 ASN 188 1188 1188 ASN ASN B . n 
D 1 189 ILE 189 1189 1189 ILE ILE B . n 
D 1 190 THR 190 1190 1190 THR THR B . n 
D 1 191 ALA 191 1191 1191 ALA ALA B . n 
D 1 192 GLU 192 1192 1192 GLU GLU B . n 
D 1 193 LYS 193 1193 1193 LYS LYS B . n 
D 1 194 LEU 194 1194 1194 LEU LEU B . n 
D 1 195 LYS 195 1195 1195 LYS LYS B . n 
D 1 196 LYS 196 1196 1196 LYS LYS B . n 
D 1 197 LEU 197 1197 1197 LEU LEU B . n 
D 1 198 GLY 198 1198 1198 GLY GLY B . n 
D 1 199 ILE 199 1199 1199 ILE ILE B . n 
D 1 200 ASN 200 1200 1200 ASN ASN B . n 
D 1 201 LYS 201 1201 1201 LYS LYS B . n 
D 1 202 LEU 202 1202 1202 LEU LEU B . n 
D 1 203 VAL 203 1203 1203 VAL VAL B . n 
D 1 204 ASP 204 1204 1204 ASP ASP B . n 
D 1 205 THR 205 1205 1205 THR THR B . n 
D 1 206 LEU 206 1206 1206 LEU LEU B . n 
D 1 207 SER 207 1207 1207 SER SER B . n 
D 1 208 ILE 208 1208 1208 ILE ILE B . n 
D 1 209 GLU 209 1209 1209 GLU GLU B . n 
D 1 210 PHE 210 1210 1210 PHE PHE B . n 
D 1 211 ASP 211 1211 1211 ASP ASP B . n 
D 1 212 LYS 212 1212 1212 LYS LYS B . n 
D 1 213 LEU 213 1213 1213 LEU LEU B . n 
D 1 214 LYS 214 1214 1214 LYS LYS B . n 
D 1 215 GLY 215 1215 1215 GLY GLY B . n 
D 1 216 MET 216 1216 1216 MET MET B . n 
D 1 217 ILE 217 1217 1217 ILE ILE B . n 
D 1 218 GLY 218 1218 1218 GLY GLY B . n 
D 1 219 GLU 219 1219 1219 GLU GLU B . n 
D 1 220 ALA 220 1220 1220 ALA ALA B . n 
D 1 221 LYS 221 1221 1221 LYS LYS B . n 
D 1 222 ALA 222 1222 1222 ALA ALA B . n 
D 1 223 LYS 223 1223 1223 LYS LYS B . n 
D 1 224 TYR 224 1224 1224 TYR TYR B . n 
D 1 225 LEU 225 1225 1225 LEU LEU B . n 
D 1 226 ILE 226 1226 1226 ILE ILE B . n 
D 1 227 SER 227 1227 1227 SER SER B . n 
D 1 228 LEU 228 1228 1228 LEU LEU B . n 
D 1 229 ALA 229 1229 1229 ALA ALA B . n 
D 1 230 ARG 230 1230 1230 ARG ARG B . n 
D 1 231 ASP 231 1231 1231 ASP ASP B . n 
D 1 232 GLU 232 1232 1232 GLU GLU B . n 
D 1 233 TYR 233 1233 1233 TYR TYR B . n 
D 1 234 ASN 234 1234 1234 ASN ASN B . n 
D 1 235 GLU 235 1235 1235 GLU GLU B . n 
D 1 236 PRO 236 1236 1236 PRO PRO B . n 
D 1 237 ILE 237 1237 1237 ILE ILE B . n 
D 1 238 ARG 238 1238 1238 ARG ARG B . n 
D 1 239 THR 239 1239 1239 THR THR B . n 
D 1 240 ARG 240 1240 1240 ARG ARG B . n 
D 1 241 VAL 241 1241 1241 VAL VAL B . n 
D 1 242 ARG 242 1242 1242 ARG ARG B . n 
D 1 243 LYS 243 1243 1243 LYS LYS B . n 
D 1 244 SER 244 1244 1244 SER SER B . n 
D 1 245 ILE 245 1245 1245 ILE ILE B . n 
D 1 246 GLY 246 1246 1246 GLY GLY B . n 
D 1 247 ARG 247 1247 1247 ARG ARG B . n 
D 1 248 ILE 248 1248 1248 ILE ILE B . n 
D 1 249 VAL 249 1249 1249 VAL VAL B . n 
D 1 250 THR 250 1250 1250 THR THR B . n 
D 1 251 MET 251 1251 1251 MET MET B . n 
D 1 252 LYS 252 1252 1252 LYS LYS B . n 
D 1 253 ARG 253 1253 1253 ARG ARG B . n 
D 1 254 ASN 254 1254 1254 ASN ASN B . n 
D 1 255 SER 255 1255 1255 SER SER B . n 
D 1 256 ARG 256 1256 1256 ARG ARG B . n 
D 1 257 ASN 257 1257 1257 ASN ASN B . n 
D 1 258 LEU 258 1258 1258 LEU LEU B . n 
D 1 259 GLU 259 1259 1259 GLU GLU B . n 
D 1 260 GLU 260 1260 1260 GLU GLU B . n 
D 1 261 ILE 261 1261 1261 ILE ILE B . n 
D 1 262 LYS 262 1262 1262 LYS LYS B . n 
D 1 263 PRO 263 1263 1263 PRO PRO B . n 
D 1 264 TYR 264 1264 1264 TYR TYR B . n 
D 1 265 LEU 265 1265 1265 LEU LEU B . n 
D 1 266 PHE 266 1266 1266 PHE PHE B . n 
D 1 267 ARG 267 1267 1267 ARG ARG B . n 
D 1 268 ALA 268 1268 1268 ALA ALA B . n 
D 1 269 ILE 269 1269 1269 ILE ILE B . n 
D 1 270 GLU 270 1270 1270 GLU GLU B . n 
D 1 271 GLU 271 1271 1271 GLU GLU B . n 
D 1 272 SER 272 1272 1272 SER SER B . n 
D 1 273 TYR 273 1273 1273 TYR TYR B . n 
D 1 274 TYR 274 1274 1274 TYR TYR B . n 
D 1 275 LYS 275 1275 1275 LYS LYS B . n 
D 1 276 LEU 276 1276 1276 LEU LEU B . n 
D 1 277 ASP 277 1277 1277 ASP ASP B . n 
D 1 278 LYS 278 1278 1278 LYS LYS B . n 
D 1 279 ARG 279 1279 1279 ARG ARG B . n 
D 1 280 ILE 280 1280 1280 ILE ILE B . n 
D 1 281 PRO 281 1281 1281 PRO PRO B . n 
D 1 282 LYS 282 1282 1282 LYS LYS B . n 
D 1 283 ALA 283 1283 1283 ALA ALA B . n 
D 1 284 ILE 284 1284 1284 ILE ILE B . n 
D 1 285 HIS 285 1285 1285 HIS HIS B . n 
D 1 286 VAL 286 1286 1286 VAL VAL B . n 
D 1 287 VAL 287 1287 1287 VAL VAL B . n 
D 1 288 ALA 288 1288 1288 ALA ALA B . n 
D 1 289 VAL 289 1289 1289 VAL VAL B . n 
D 1 290 THR 290 1290 1290 THR THR B . n 
D 1 291 GLU 291 1291 1291 GLU GLU B . n 
D 1 292 ASP 292 1292 1292 ASP ASP B . n 
D 1 293 LEU 293 1293 1293 LEU LEU B . n 
D 1 294 ASP 294 1294 1294 ASP ASP B . n 
D 1 295 ILE 295 1295 1295 ILE ILE B . n 
D 1 296 VAL 296 1296 1296 VAL VAL B . n 
D 1 297 SER 297 1297 1297 SER SER B . n 
D 1 298 ARG 298 1298 1298 ARG ARG B . n 
D 1 299 GLY 299 1299 1299 GLY GLY B . n 
D 1 300 ARG 300 1300 1300 ARG ARG B . n 
D 1 301 THR 301 1301 1301 THR THR B . n 
D 1 302 PHE 302 1302 1302 PHE PHE B . n 
D 1 303 PRO 303 1303 1303 PRO PRO B . n 
D 1 304 HIS 304 1304 1304 HIS HIS B . n 
D 1 305 GLY 305 1305 1305 GLY GLY B . n 
D 1 306 ILE 306 1306 1306 ILE ILE B . n 
D 1 307 SER 307 1307 1307 SER SER B . n 
D 1 308 LYS 308 1308 1308 LYS LYS B . n 
D 1 309 GLU 309 1309 1309 GLU GLU B . n 
D 1 310 THR 310 1310 1310 THR THR B . n 
D 1 311 ALA 311 1311 1311 ALA ALA B . n 
D 1 312 TYR 312 1312 1312 TYR TYR B . n 
D 1 313 SER 313 1313 1313 SER SER B . n 
D 1 314 GLU 314 1314 1314 GLU GLU B . n 
D 1 315 SER 315 1315 1315 SER SER B . n 
D 1 316 VAL 316 1316 1316 VAL VAL B . n 
D 1 317 LYS 317 1317 1317 LYS LYS B . n 
D 1 318 LEU 318 1318 1318 LEU LEU B . n 
D 1 319 LEU 319 1319 1319 LEU LEU B . n 
D 1 320 GLN 320 1320 1320 GLN GLN B . n 
D 1 321 LYS 321 1321 1321 LYS LYS B . n 
D 1 322 ILE 322 1322 1322 ILE ILE B . n 
D 1 323 LEU 323 1323 1323 LEU LEU B . n 
D 1 324 GLU 324 1324 1324 GLU GLU B . n 
D 1 325 GLU 325 1325 1325 GLU GLU B . n 
D 1 326 ASP 326 1326 1326 ASP ASP B . n 
D 1 327 GLU 327 1327 1327 GLU GLU B . n 
D 1 328 ARG 328 1328 1328 ARG ARG B . n 
D 1 329 LYS 329 1329 1329 LYS LYS B . n 
D 1 330 ILE 330 1330 1330 ILE ILE B . n 
D 1 331 ARG 331 1331 1331 ARG ARG B . n 
D 1 332 ARG 332 1332 1332 ARG ARG B . n 
D 1 333 ILE 333 1333 1333 ILE ILE B . n 
D 1 334 GLY 334 1334 1334 GLY GLY B . n 
D 1 335 VAL 335 1335 1335 VAL VAL B . n 
D 1 336 ARG 336 1336 1336 ARG ARG B . n 
D 1 337 PHE 337 1337 1337 PHE PHE B . n 
D 1 338 SER 338 1338 1338 SER SER B . n 
D 1 339 LYS 339 1339 1339 LYS LYS B . n 
D 1 340 PHE 340 1340 1340 PHE PHE B . n 
D 1 341 ILE 341 1341 1341 ILE ILE B . n 
E 2 1   DG  1   1802 1802 DG  G   H . n 
E 2 2   DT  2   1803 1803 DT  T   H . n 
E 2 3   DT  3   1804 1804 DT  T   H . n 
E 2 4   DG  4   1805 1805 DG  G   H . n 
E 2 5   DG  5   1806 1806 DG  G   H . n 
E 2 6   DA  6   1807 1807 DA  A   H . n 
E 2 7   DT  7   1808 1808 DT  T   H . n 
E 2 8   DG  8   1809 1809 DG  G   H . n 
E 2 9   DG  9   1810 1810 DG  G   H . n 
E 2 10  DT  10  1811 1811 DT  T   H . n 
E 2 11  DA  11  1812 1812 DA  A   H . n 
E 2 12  DG  12  1813 1813 DG  G   H . n 
E 2 13  2DA 13  1814 1814 2DA 2DA H . n 
F 3 1   DC  1   1901 ?    ?   ?   J . n 
F 3 2   DT  2   1902 ?    ?   ?   J . n 
F 3 3   DA  3   1903 ?    ?   ?   J . n 
F 3 4   DA  4   1904 ?    ?   ?   J . n 
F 3 5   DC  5   1905 1905 DC  C   J . n 
F 3 6   8OG 6   1906 1906 8OG 8OG J . n 
F 3 7   DC  7   1907 1907 DC  C   J . n 
F 3 8   DT  8   1908 1908 DT  T   J . n 
F 3 9   DA  9   1909 1909 DA  A   J . n 
F 3 10  DC  10  1910 1910 DC  C   J . n 
F 3 11  DC  11  1911 1911 DC  C   J . n 
F 3 12  DA  12  1912 1912 DA  A   J . n 
F 3 13  DT  13  1913 1913 DT  T   J . n 
F 3 14  DC  14  1914 1914 DC  C   J . n 
F 3 15  DC  15  1915 1915 DC  C   J . n 
F 3 16  DA  16  1916 1916 DA  A   J . n 
F 3 17  DA  17  1917 1917 DA  A   J . n 
F 3 18  DC  18  1918 1918 DC  C   J . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 B 2DA 13 D 2DA 814  ? DA "2',3'-DIDEOXYADENOSINE-5'-MONOPHOSPHATE" 
2 C 8OG 6  E 8OG 906  ? DG ?                                         
3 E 2DA 13 H 2DA 1814 ? DA "2',3'-DIDEOXYADENOSINE-5'-MONOPHOSPHATE" 
4 F 8OG 6  J 8OG 1906 ? DG ?                                         
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA trimeric 3 
2 author_and_software_defined_assembly PISA trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,G,H,I,J,O,P,Q 
2 1 D,E,F,K,L,M,N,R,S,T 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4170  ? 
1 MORE         -28.7 ? 
1 'SSA (A^2)'  19850 ? 
2 'ABSA (A^2)' 3570  ? 
2 MORE         -31.5 ? 
2 'SSA (A^2)'  19930 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 7   ? A ASP 7    ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O   ? A PHE 8   ? A PHE 8    ? 1_555 103.8 ? 
2  OD1 ? A ASP 7   ? A ASP 7    ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 OD2 ? A ASP 105 ? A ASP 105  ? 1_555 72.5  ? 
3  O   ? A PHE 8   ? A PHE 8    ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 OD2 ? A ASP 105 ? A ASP 105  ? 1_555 83.7  ? 
4  OD1 ? A ASP 7   ? A ASP 7    ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O1G ? G DGT .   ? A DGT 414  ? 1_555 105.5 ? 
5  O   ? A PHE 8   ? A PHE 8    ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O1G ? G DGT .   ? A DGT 414  ? 1_555 112.9 ? 
6  OD2 ? A ASP 105 ? A ASP 105  ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O1G ? G DGT .   ? A DGT 414  ? 1_555 162.9 ? 
7  OD1 ? A ASP 7   ? A ASP 7    ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O1B ? G DGT .   ? A DGT 414  ? 1_555 161.4 ? 
8  O   ? A PHE 8   ? A PHE 8    ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O1B ? G DGT .   ? A DGT 414  ? 1_555 84.4  ? 
9  OD2 ? A ASP 105 ? A ASP 105  ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O1B ? G DGT .   ? A DGT 414  ? 1_555 92.3  ? 
10 O1G ? G DGT .   ? A DGT 414  ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O1B ? G DGT .   ? A DGT 414  ? 1_555 85.9  ? 
11 OD1 ? A ASP 7   ? A ASP 7    ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O2A ? G DGT .   ? A DGT 414  ? 1_555 87.4  ? 
12 O   ? A PHE 8   ? A PHE 8    ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O2A ? G DGT .   ? A DGT 414  ? 1_555 158.3 ? 
13 OD2 ? A ASP 105 ? A ASP 105  ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O2A ? G DGT .   ? A DGT 414  ? 1_555 82.1  ? 
14 O1G ? G DGT .   ? A DGT 414  ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O2A ? G DGT .   ? A DGT 414  ? 1_555 80.9  ? 
15 O1B ? G DGT .   ? A DGT 414  ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O2A ? G DGT .   ? A DGT 414  ? 1_555 79.8  ? 
16 OD2 ? A ASP 7   ? A ASP 7    ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 OE2 ? A GLU 106 ? A GLU 106  ? 1_555 77.7  ? 
17 OD2 ? A ASP 7   ? A ASP 7    ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 OP1 A B 2DA 13  ? D 2DA 814  ? 1_555 136.8 ? 
18 OE2 ? A GLU 106 ? A GLU 106  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 OP1 A B 2DA 13  ? D 2DA 814  ? 1_555 101.1 ? 
19 OD2 ? A ASP 7   ? A ASP 7    ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 OP2 B B 2DA 13  ? D 2DA 814  ? 1_555 147.6 ? 
20 OE2 ? A GLU 106 ? A GLU 106  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 OP2 B B 2DA 13  ? D 2DA 814  ? 1_555 124.8 ? 
21 OP1 A B 2DA 13  ? D 2DA 814  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 OP2 B B 2DA 13  ? D 2DA 814  ? 1_555 28.9  ? 
22 OD2 ? A ASP 7   ? A ASP 7    ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 O   ? P HOH .   ? D HOH 502  ? 1_555 109.1 ? 
23 OE2 ? A GLU 106 ? A GLU 106  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 O   ? P HOH .   ? D HOH 502  ? 1_555 158.4 ? 
24 OP1 A B 2DA 13  ? D 2DA 814  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 O   ? P HOH .   ? D HOH 502  ? 1_555 87.8  ? 
25 OP2 B B 2DA 13  ? D 2DA 814  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 O   ? P HOH .   ? D HOH 502  ? 1_555 59.6  ? 
26 OD2 ? A ASP 7   ? A ASP 7    ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 O   ? O HOH .   ? A HOH 501  ? 1_555 82.0  ? 
27 OE2 ? A GLU 106 ? A GLU 106  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 O   ? O HOH .   ? A HOH 501  ? 1_555 58.3  ? 
28 OP1 A B 2DA 13  ? D 2DA 814  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 O   ? O HOH .   ? A HOH 501  ? 1_555 134.6 ? 
29 OP2 B B 2DA 13  ? D 2DA 814  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 O   ? O HOH .   ? A HOH 501  ? 1_555 128.7 ? 
30 O   ? P HOH .   ? D HOH 502  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 O   ? O HOH .   ? A HOH 501  ? 1_555 101.6 ? 
31 OD2 ? A ASP 7   ? A ASP 7    ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 O   ? P HOH .   ? D HOH 717  ? 1_555 69.2  ? 
32 OE2 ? A GLU 106 ? A GLU 106  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 O   ? P HOH .   ? D HOH 717  ? 1_555 101.0 ? 
33 OP1 A B 2DA 13  ? D 2DA 814  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 O   ? P HOH .   ? D HOH 717  ? 1_555 68.7  ? 
34 OP2 B B 2DA 13  ? D 2DA 814  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 O   ? P HOH .   ? D HOH 717  ? 1_555 82.6  ? 
35 O   ? P HOH .   ? D HOH 502  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 O   ? P HOH .   ? D HOH 717  ? 1_555 100.5 ? 
36 O   ? O HOH .   ? A HOH 501  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 O   ? P HOH .   ? D HOH 717  ? 1_555 148.1 ? 
37 O   ? A ALA 181 ? A ALA 181  ? 1_555 CA ? J CA . ? A CA 417  ? 1_555 O   ? A ILE 186 ? A ILE 186  ? 1_555 88.2  ? 
38 O   ? A ALA 181 ? A ALA 181  ? 1_555 CA ? J CA . ? A CA 417  ? 1_555 O   ? O HOH .   ? A HOH 512  ? 1_555 93.8  ? 
39 O   ? A ILE 186 ? A ILE 186  ? 1_555 CA ? J CA . ? A CA 417  ? 1_555 O   ? O HOH .   ? A HOH 512  ? 1_555 170.8 ? 
40 O   ? A ALA 181 ? A ALA 181  ? 1_555 CA ? J CA . ? A CA 417  ? 1_555 O   ? P HOH .   ? D HOH 514  ? 1_555 172.4 ? 
41 O   ? A ILE 186 ? A ILE 186  ? 1_555 CA ? J CA . ? A CA 417  ? 1_555 O   ? P HOH .   ? D HOH 514  ? 1_555 92.7  ? 
42 O   ? O HOH .   ? A HOH 512  ? 1_555 CA ? J CA . ? A CA 417  ? 1_555 O   ? P HOH .   ? D HOH 514  ? 1_555 86.6  ? 
43 O   ? A ALA 181 ? A ALA 181  ? 1_555 CA ? J CA . ? A CA 417  ? 1_555 O   ? P HOH .   ? D HOH 516  ? 1_555 83.1  ? 
44 O   ? A ILE 186 ? A ILE 186  ? 1_555 CA ? J CA . ? A CA 417  ? 1_555 O   ? P HOH .   ? D HOH 516  ? 1_555 73.4  ? 
45 O   ? O HOH .   ? A HOH 512  ? 1_555 CA ? J CA . ? A CA 417  ? 1_555 O   ? P HOH .   ? D HOH 516  ? 1_555 115.8 ? 
46 O   ? P HOH .   ? D HOH 514  ? 1_555 CA ? J CA . ? A CA 417  ? 1_555 O   ? P HOH .   ? D HOH 516  ? 1_555 89.9  ? 
47 OD1 ? D ASP 7   ? B ASP 1007 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O   ? D PHE 8   ? B PHE 1008 ? 1_555 93.7  ? 
48 OD1 ? D ASP 7   ? B ASP 1007 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 OD2 ? D ASP 105 ? B ASP 1105 ? 1_555 83.8  ? 
49 O   ? D PHE 8   ? B PHE 1008 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 OD2 ? D ASP 105 ? B ASP 1105 ? 1_555 85.0  ? 
50 OD1 ? D ASP 7   ? B ASP 1007 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O1G ? K DGT .   ? B DGT 1414 ? 1_555 108.6 ? 
51 O   ? D PHE 8   ? B PHE 1008 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O1G ? K DGT .   ? B DGT 1414 ? 1_555 116.8 ? 
52 OD2 ? D ASP 105 ? B ASP 1105 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O1G ? K DGT .   ? B DGT 1414 ? 1_555 153.2 ? 
53 OD1 ? D ASP 7   ? B ASP 1007 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O1B ? K DGT .   ? B DGT 1414 ? 1_555 164.1 ? 
54 O   ? D PHE 8   ? B PHE 1008 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O1B ? K DGT .   ? B DGT 1414 ? 1_555 92.3  ? 
55 OD2 ? D ASP 105 ? B ASP 1105 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O1B ? K DGT .   ? B DGT 1414 ? 1_555 82.1  ? 
56 O1G ? K DGT .   ? B DGT 1414 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O1B ? K DGT .   ? B DGT 1414 ? 1_555 81.6  ? 
57 OD1 ? D ASP 7   ? B ASP 1007 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O2A ? K DGT .   ? B DGT 1414 ? 1_555 106.5 ? 
58 O   ? D PHE 8   ? B PHE 1008 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O2A ? K DGT .   ? B DGT 1414 ? 1_555 157.5 ? 
59 OD2 ? D ASP 105 ? B ASP 1105 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O2A ? K DGT .   ? B DGT 1414 ? 1_555 87.4  ? 
60 O1G ? K DGT .   ? B DGT 1414 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O2A ? K DGT .   ? B DGT 1414 ? 1_555 66.5  ? 
61 O1B ? K DGT .   ? B DGT 1414 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O2A ? K DGT .   ? B DGT 1414 ? 1_555 65.6  ? 
62 OD2 ? D ASP 7   ? B ASP 1007 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 OE2 ? D GLU 106 ? B GLU 1106 ? 1_555 101.0 ? 
63 OD2 ? D ASP 7   ? B ASP 1007 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 OP1 ? E 2DA 13  ? H 2DA 1814 ? 1_555 129.0 ? 
64 OE2 ? D GLU 106 ? B GLU 1106 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 OP1 ? E 2DA 13  ? H 2DA 1814 ? 1_555 67.5  ? 
65 OD2 ? D ASP 7   ? B ASP 1007 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 O   ? R HOH .   ? B HOH 1501 ? 1_555 74.4  ? 
66 OE2 ? D GLU 106 ? B GLU 1106 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 O   ? R HOH .   ? B HOH 1501 ? 1_555 139.5 ? 
67 OP1 ? E 2DA 13  ? H 2DA 1814 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 O   ? R HOH .   ? B HOH 1501 ? 1_555 84.1  ? 
68 OD2 ? D ASP 7   ? B ASP 1007 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 O   ? R HOH .   ? B HOH 1502 ? 1_555 66.0  ? 
69 OE2 ? D GLU 106 ? B GLU 1106 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 O   ? R HOH .   ? B HOH 1502 ? 1_555 75.2  ? 
70 OP1 ? E 2DA 13  ? H 2DA 1814 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 O   ? R HOH .   ? B HOH 1502 ? 1_555 63.0  ? 
71 O   ? R HOH .   ? B HOH 1501 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 O   ? R HOH .   ? B HOH 1502 ? 1_555 66.1  ? 
72 OD2 ? D ASP 7   ? B ASP 1007 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 OD1 ? D ASP 7   ? B ASP 1007 ? 1_555 43.9  ? 
73 OE2 ? D GLU 106 ? B GLU 1106 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 OD1 ? D ASP 7   ? B ASP 1007 ? 1_555 105.5 ? 
74 OP1 ? E 2DA 13  ? H 2DA 1814 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 OD1 ? D ASP 7   ? B ASP 1007 ? 1_555 170.2 ? 
75 O   ? R HOH .   ? B HOH 1501 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 OD1 ? D ASP 7   ? B ASP 1007 ? 1_555 98.4  ? 
76 O   ? R HOH .   ? B HOH 1502 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 OD1 ? D ASP 7   ? B ASP 1007 ? 1_555 109.2 ? 
77 O   ? D ALA 181 ? B ALA 1181 ? 1_555 CA ? N CA . ? B CA 1417 ? 1_555 O   ? D VAL 183 ? B VAL 1183 ? 1_555 86.1  ? 
78 O   ? D ALA 181 ? B ALA 1181 ? 1_555 CA ? N CA . ? B CA 1417 ? 1_555 O   ? D ILE 186 ? B ILE 1186 ? 1_555 65.8  ? 
79 O   ? D VAL 183 ? B VAL 1183 ? 1_555 CA ? N CA . ? B CA 1417 ? 1_555 O   ? D ILE 186 ? B ILE 1186 ? 1_555 82.0  ? 
80 O   ? D ALA 181 ? B ALA 1181 ? 1_555 CA ? N CA . ? B CA 1417 ? 1_555 OP1 ? E DG  12  ? H DG  1813 ? 1_555 135.6 ? 
81 O   ? D VAL 183 ? B VAL 1183 ? 1_555 CA ? N CA . ? B CA 1417 ? 1_555 OP1 ? E DG  12  ? H DG  1813 ? 1_555 91.5  ? 
82 O   ? D ILE 186 ? B ILE 1186 ? 1_555 CA ? N CA . ? B CA 1417 ? 1_555 OP1 ? E DG  12  ? H DG  1813 ? 1_555 69.9  ? 
83 O   ? D ALA 181 ? B ALA 1181 ? 1_555 CA ? N CA . ? B CA 1417 ? 1_555 O   ? R HOH .   ? B HOH 1515 ? 1_555 45.8  ? 
84 O   ? D VAL 183 ? B VAL 1183 ? 1_555 CA ? N CA . ? B CA 1417 ? 1_555 O   ? R HOH .   ? B HOH 1515 ? 1_555 120.8 ? 
85 O   ? D ILE 186 ? B ILE 1186 ? 1_555 CA ? N CA . ? B CA 1417 ? 1_555 O   ? R HOH .   ? B HOH 1515 ? 1_555 51.2  ? 
86 OP1 ? E DG  12  ? H DG  1813 ? 1_555 CA ? N CA . ? B CA 1417 ? 1_555 O   ? R HOH .   ? B HOH 1515 ? 1_555 101.5 ? 
87 O   ? D ALA 181 ? B ALA 1181 ? 1_555 CA ? N CA . ? B CA 1417 ? 1_555 O   ? R HOH .   ? B HOH 1516 ? 1_555 100.2 ? 
88 O   ? D VAL 183 ? B VAL 1183 ? 1_555 CA ? N CA . ? B CA 1417 ? 1_555 O   ? R HOH .   ? B HOH 1516 ? 1_555 107.8 ? 
89 O   ? D ILE 186 ? B ILE 1186 ? 1_555 CA ? N CA . ? B CA 1417 ? 1_555 O   ? R HOH .   ? B HOH 1516 ? 1_555 162.8 ? 
90 OP1 ? E DG  12  ? H DG  1813 ? 1_555 CA ? N CA . ? B CA 1417 ? 1_555 O   ? R HOH .   ? B HOH 1516 ? 1_555 122.5 ? 
91 O   ? R HOH .   ? B HOH 1515 ? 1_555 CA ? N CA . ? B CA 1417 ? 1_555 O   ? R HOH .   ? B HOH 1516 ? 1_555 112.1 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-05-19 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2011-12-07 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Database references'       
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 12.3022 1.3516  2.6298  -0.3253 -0.3027 -0.2169 -0.0054 0.0349  0.0033  3.4061 2.3432 1.6964 -0.9851 -0.2138 0.2917  
-0.0781 0.1309  -0.0528 -0.3154 -0.1499 0.0620  0.1960 -0.0753 0.1774 'X-RAY DIFFRACTION' 
2 ? refined -6.8513 55.7932 38.1771 0.0198  0.0414  -0.2689 -0.0998 0.0304  -0.0697 3.9334 1.5622 2.9038 -0.1365 -0.4382 -1.1906 
0.0738  -0.0484 -0.0254 -0.6451 -0.0844 0.1225  0.5037 -0.4026 0.0765 'X-RAY DIFFRACTION' 
3 ? refined 20.4268 -7.0623 12.1054 -0.0093 0.2398  0.0120  0.1296  -0.0935 0.1179  0.8412 2.4379 2.3517 0.1551  -1.3366 0.4944  
-0.3812 0.3207  0.0605  -0.8919 -0.3688 -0.1500 0.7634 -0.0938 0.5279 'X-RAY DIFFRACTION' 
4 ? refined 4.1830  46.0957 45.3566 0.0693  0.6431  0.2167  0.0358  -0.2095 0.2473  5.4159 6.1565 5.1614 -1.7647 -3.7860 1.0971  
-0.4963 0.1872  0.3091  -1.5869 -0.7870 -1.0173 1.2143 0.3375  1.2087 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A A 341  ? 1    . . . . 'X-RAY DIFFRACTION' ? 
2 2 B B 1341 ? 1001 . . . . 'X-RAY DIFFRACTION' ? 
3 3 D D 814  ? 802  . . . . 'X-RAY DIFFRACTION' ? 
4 3 E E 918  ? 901  . . . . 'X-RAY DIFFRACTION' ? 
5 3 A A 414  ? 414  . . . . 'X-RAY DIFFRACTION' ? 
6 4 H H 1814 ? 1802 . . . . 'X-RAY DIFFRACTION' ? 
7 4 J J 1918 ? 1905 . . . . 'X-RAY DIFFRACTION' ? 
8 4 B B 1414 ? 1414 . . . . 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC      5.2.0019 ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 1 
PDB_EXTRACT 3.006    'June 11, 2008' package PDB                  help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 2 
HKL-2000    .        ?               ?       ?                    ?                     'data collection' ? ?          ? 3 
DENZO       .        ?               ?       ?                    ?                     'data reduction'  ? ?          ? 4 
HKL-2000    .        ?               ?       ?                    ?                     'data scaling'    ? ?          ? 5 
AMoRE       .        ?               ?       ?                    ?                     phasing           ? ?          ? 6 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            "O3'" 
_pdbx_validate_rmsd_bond.auth_asym_id_1            E 
_pdbx_validate_rmsd_bond.auth_comp_id_1            DC 
_pdbx_validate_rmsd_bond.auth_seq_id_1             910 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            "C3'" 
_pdbx_validate_rmsd_bond.auth_asym_id_2            E 
_pdbx_validate_rmsd_bond.auth_comp_id_2            DC 
_pdbx_validate_rmsd_bond.auth_seq_id_2             910 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.381 
_pdbx_validate_rmsd_bond.bond_target_value         1.419 
_pdbx_validate_rmsd_bond.bond_deviation            -0.038 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.006 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" D DT 803  ? ? "C1'" D DT  803  ? ? N1    D DT  803  ? ? 110.78 108.30 2.48  0.30 N 
2  1 "C3'" D DG 805  ? ? "C2'" D DG  805  ? ? "C1'" D DG  805  ? ? 96.53  102.40 -5.87 0.80 N 
3  1 "O4'" D DG 805  ? ? "C1'" D DG  805  ? ? N9    D DG  805  ? ? 113.32 108.30 5.02  0.30 N 
4  1 "C1'" D DT 808  ? ? "O4'" D DT  808  ? ? "C4'" D DT  808  ? ? 103.98 110.10 -6.12 1.00 N 
5  1 "O4'" D DG 813  ? ? "C1'" D DG  813  ? ? N9    D DG  813  ? ? 112.72 108.30 4.42  0.30 N 
6  1 "C3'" D DG 813  ? ? "O3'" D DG  813  ? ? P     D 2DA 814  ? B 131.16 119.70 11.46 1.20 Y 
7  1 "O3'" D DG 813  ? ? P     D 2DA 814  ? B OP2   D 2DA 814  ? B 118.16 110.50 7.66  1.10 Y 
8  1 "O4'" E DC 901  ? ? "C1'" E DC  901  ? ? N1    E DC  901  ? ? 110.22 108.30 1.92  0.30 N 
9  1 "O4'" E DC 905  ? ? "C1'" E DC  905  ? ? N1    E DC  905  ? ? 110.64 108.30 2.34  0.30 N 
10 1 "O4'" E DC 907  ? ? "C4'" E DC  907  ? ? "C3'" E DC  907  ? ? 102.07 104.50 -2.43 0.40 N 
11 1 "C1'" E DC 907  ? ? "O4'" E DC  907  ? ? "C4'" E DC  907  ? ? 102.33 110.10 -7.77 1.00 N 
12 1 "O4'" E DC 907  ? ? "C1'" E DC  907  ? ? N1    E DC  907  ? ? 112.19 108.30 3.89  0.30 N 
13 1 "O5'" E DA 909  ? ? "C5'" E DA  909  ? ? "C4'" E DA  909  ? ? 101.27 109.40 -8.13 0.80 N 
14 1 "O4'" E DT 913  ? ? "C1'" E DT  913  ? ? N1    E DT  913  ? ? 112.36 108.30 4.06  0.30 N 
15 1 "C3'" E DT 913  ? ? "O3'" E DT  913  ? ? P     E DC  914  ? ? 127.55 119.70 7.85  1.20 Y 
16 1 "O4'" E DC 915  ? ? "C1'" E DC  915  ? ? N1    E DC  915  ? ? 112.10 108.30 3.80  0.30 N 
17 1 "O4'" H DG 1813 ? ? "C1'" H DG  1813 ? ? N9    H DG  1813 ? ? 112.92 108.30 4.62  0.30 N 
18 1 "O5'" J DC 1907 ? ? "C5'" J DC  1907 ? ? "C4'" J DC  1907 ? ? 102.11 109.40 -7.29 0.80 N 
19 1 "O4'" J DC 1910 ? ? "C1'" J DC  1910 ? ? N1    J DC  1910 ? ? 110.19 108.30 1.89  0.30 N 
20 1 "O4'" J DT 1913 ? ? "C1'" J DT  1913 ? ? N1    J DT  1913 ? ? 110.18 108.30 1.88  0.30 N 
21 1 "O4'" J DC 1914 ? ? "C1'" J DC  1914 ? ? N1    J DC  1914 ? ? 111.91 108.30 3.61  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR A 10   ? ? 19.59   59.55   
2  1 ALA A 71   ? ? -46.18  163.66  
3  1 ARG A 77   ? ? -104.34 76.64   
4  1 ASN A 234  ? ? -148.38 35.31   
5  1 ASP A 277  ? ? 44.22   87.52   
6  1 LYS A 278  ? ? 84.64   -36.54  
7  1 PRO A 303  ? ? -56.86  -80.86  
8  1 PRO A 303  ? ? -56.86  -80.76  
9  1 HIS A 304  ? B -53.29  174.04  
10 1 TYR B 1010 ? ? 23.51   54.58   
11 1 ASN B 1020 ? ? -159.34 82.41   
12 1 ARG B 1036 ? ? -67.11  -113.48 
13 1 ASN B 1047 ? ? -39.95  160.34  
14 1 LYS B 1052 ? ? -34.72  -39.67  
15 1 VAL B 1115 ? ? 46.85   107.35  
16 1 ASP B 1117 ? ? 154.74  137.22  
17 1 SER B 1145 ? ? -164.47 -170.00 
18 1 LYS B 1159 ? ? -40.34  -72.79  
19 1 LYS B 1252 ? ? -69.46  14.31   
20 1 ARG B 1253 ? ? 169.94  135.51  
21 1 ASP B 1277 ? ? 43.69   90.39   
22 1 LYS B 1278 ? ? 84.32   -41.28  
23 1 ASP B 1292 ? ? -77.13  34.17   
24 1 LEU B 1323 ? ? -69.74  16.73   
25 1 GLU B 1324 ? ? -134.76 -40.84  
# 
loop_
_pdbx_validate_chiral.id 
_pdbx_validate_chiral.PDB_model_num 
_pdbx_validate_chiral.auth_atom_id 
_pdbx_validate_chiral.label_alt_id 
_pdbx_validate_chiral.auth_asym_id 
_pdbx_validate_chiral.auth_comp_id 
_pdbx_validate_chiral.auth_seq_id 
_pdbx_validate_chiral.PDB_ins_code 
_pdbx_validate_chiral.details 
_pdbx_validate_chiral.omega 
1 1 "C1'" A E 8OG 906  ? PLANAR . 
2 1 "C1'" B E 8OG 906  ? PLANAR . 
3 1 "C4'" ? J 8OG 1906 ? PLANAR . 
4 1 "C1'" ? J 8OG 1906 ? PLANAR . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 J DC 1901 ? F DC 1 
2 1 Y 1 J DT 1902 ? F DT 2 
3 1 Y 1 J DA 1903 ? F DA 3 
4 1 Y 1 J DA 1904 ? F DA 4 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
3GIJ 'double helix'         
3GIJ 'b-form double helix'  
3GIJ 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG  1  1_555 C DC  18 1_555 -1.142 -0.345 0.557  -7.128  -11.525 -9.335  1  D_DG802:DC918_E     D 802  ? E 918  ? 19 1 
1 B DT  2  1_555 C DA  17 1_555 1.079  -0.497 0.770  -9.193  -4.372  -8.838  2  D_DT803:DA917_E     D 803  ? E 917  ? 20 1 
1 B DT  3  1_555 C DA  16 1_555 -0.295 -0.234 -0.463 2.049   -12.813 -13.878 3  D_DT804:DA916_E     D 804  ? E 916  ? 20 1 
1 B DG  4  1_555 C DC  15 1_555 -0.138 -0.235 -0.042 2.887   -7.757  -6.461  4  D_DG805:DC915_E     D 805  ? E 915  ? 19 1 
1 B DG  5  1_555 C DC  14 1_555 0.055  -0.139 0.035  -1.520  -16.927 1.540   5  D_DG806:DC914_E     D 806  ? E 914  ? 19 1 
1 B DA  6  1_555 C DT  13 1_555 -0.521 -0.408 -0.059 -9.106  -16.110 1.602   6  D_DA807:DT913_E     D 807  ? E 913  ? 20 1 
1 B DT  7  1_555 C DA  12 1_555 -0.221 -0.150 0.044  3.260   -8.743  3.264   7  D_DT808:DA912_E     D 808  ? E 912  ? 20 1 
1 B DG  8  1_555 C DC  11 1_555 -0.442 -0.358 -0.012 -3.277  -8.062  3.447   8  D_DG809:DC911_E     D 809  ? E 911  ? 19 1 
1 B DG  9  1_555 C DC  10 1_555 -0.350 -0.344 -0.080 -10.639 -10.530 3.358   9  D_DG810:DC910_E     D 810  ? E 910  ? 19 1 
1 B DT  10 1_555 C DA  9  1_555 0.135  -0.447 -0.012 1.447   -7.597  1.627   10 D_DT811:DA909_E     D 811  ? E 909  ? 20 1 
1 B DA  11 1_555 C DT  8  1_555 0.136  -0.404 -0.319 -2.155  -2.444  2.277   11 D_DA812:DT908_E     D 812  ? E 908  ? 20 1 
1 B DG  12 1_555 C DC  7  1_555 -0.409 -0.672 -0.176 -0.131  -16.629 2.434   12 D_DG813:DC907_E     D 813  ? E 907  ? 19 1 
1 B 2DA 13 1_555 C 8OG 6  1_555 -1.319 -3.306 -0.025 7.666   23.866  81.726  13 D_2DA814:8OG906_E   D 814  ? E 906  ? 9  3 
1 E DG  1  1_555 F DC  18 1_555 0.043  0.024  -0.162 -28.399 -11.972 -7.053  14 H_DG1802:DC1918_J   H 1802 ? J 1918 ? 19 1 
1 E DT  2  1_555 F DA  17 1_555 0.279  -0.343 1.015  -10.286 -19.539 -1.279  15 H_DT1803:DA1917_J   H 1803 ? J 1917 ? 20 1 
1 E DT  3  1_555 F DA  16 1_555 0.860  -0.352 0.210  9.826   -27.328 2.680   16 H_DT1804:DA1916_J   H 1804 ? J 1916 ? 20 1 
1 E DG  4  1_555 F DC  15 1_555 -1.769 -0.294 -0.599 -11.323 -18.267 0.886   17 H_DG1805:DC1915_J   H 1805 ? J 1915 ? 19 1 
1 E DG  5  1_555 F DC  14 1_555 -0.639 -0.467 0.018  6.695   -18.287 8.828   18 H_DG1806:DC1914_J   H 1806 ? J 1914 ? 19 1 
1 E DA  6  1_555 F DT  13 1_555 -0.284 -0.525 0.014  -3.400  -15.027 2.908   19 H_DA1807:DT1913_J   H 1807 ? J 1913 ? 20 1 
1 E DT  7  1_555 F DA  12 1_555 0.598  -0.229 0.219  1.649   -10.617 8.057   20 H_DT1808:DA1912_J   H 1808 ? J 1912 ? 20 1 
1 E DG  8  1_555 F DC  11 1_555 -0.042 -0.675 0.066  -1.361  -5.819  -2.137  21 H_DG1809:DC1911_J   H 1809 ? J 1911 ? 19 1 
1 E DG  9  1_555 F DC  10 1_555 -0.517 -0.390 -0.210 -11.278 -10.758 4.977   22 H_DG1810:DC1910_J   H 1810 ? J 1910 ? 19 1 
1 E DT  10 1_555 F DA  9  1_555 -0.041 -0.536 0.068  -2.779  -3.033  2.791   23 H_DT1811:DA1909_J   H 1811 ? J 1909 ? 20 1 
1 E DA  11 1_555 F DT  8  1_555 -0.159 -0.307 -0.181 -0.113  -4.484  5.531   24 H_DA1812:DT1908_J   H 1812 ? J 1908 ? 20 1 
1 E DG  12 1_555 F DC  7  1_555 -0.209 -0.471 0.054  6.661   -6.506  -1.490  25 H_DG1813:DC1907_J   H 1813 ? J 1907 ? 19 1 
1 E 2DA 13 1_555 F 8OG 6  1_555 0.043  4.495  0.665  -16.936 -3.906  -82.080 26 H_2DA1814:8OG1906_J H 1814 ? J 1906 ? ?  ? 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 1  1_555 C DC 18 1_555 B DT  2  1_555 C DA  17 1_555 -0.062 -0.918 3.380  -1.479  0.326   46.529   -1.190 -0.050 3.374  
0.413   1.871   46.552   1  DD_DG802DT803:DA917DC918_EE       D 802  ? E 918  ? D 803  ? E 917  ? 
1 B DT 2  1_555 C DA 17 1_555 B DT  3  1_555 C DA  16 1_555 -1.093 -0.662 2.736  10.000  -5.094  30.992   -0.470 3.300  2.356  
-9.165  -17.990 32.915   2  DD_DT803DT804:DA916DA917_EE       D 803  ? E 917  ? D 804  ? E 916  ? 
1 B DT 3  1_555 C DA 16 1_555 B DG  4  1_555 C DC  15 1_555 1.096  0.353  3.204  0.778   9.418   32.468   -0.917 -1.760 3.203  
16.414  -1.356  33.779   3  DD_DT804DG805:DC915DA916_EE       D 804  ? E 916  ? D 805  ? E 915  ? 
1 B DG 4  1_555 C DC 15 1_555 B DG  5  1_555 C DC  14 1_555 -0.344 0.249  3.165  -4.170  9.119   35.453   -0.826 -0.014 3.151  
14.618  6.685   36.800   4  DD_DG805DG806:DC914DC915_EE       D 805  ? E 915  ? D 806  ? E 914  ? 
1 B DG 5  1_555 C DC 14 1_555 B DA  6  1_555 C DT  13 1_555 -0.140 0.181  3.223  -0.801  5.666   38.059   -0.422 0.115  3.218  
8.629   1.219   38.471   5  DD_DG806DA807:DT913DC914_EE       D 806  ? E 914  ? D 807  ? E 913  ? 
1 B DA 6  1_555 C DT 13 1_555 B DT  7  1_555 C DA  12 1_555 0.278  -0.421 2.951  -0.430  0.913   28.070   -1.061 -0.664 2.932  
1.882   0.885   28.088   6  DD_DA807DT808:DA912DT913_EE       D 807  ? E 913  ? D 808  ? E 912  ? 
1 B DT 7  1_555 C DA 12 1_555 B DG  8  1_555 C DC  11 1_555 0.823  -0.084 3.331  3.784   5.245   37.073   -0.833 -0.770 3.353  
8.172   -5.897  37.613   7  DD_DT808DG809:DC911DA912_EE       D 808  ? E 912  ? D 809  ? E 911  ? 
1 B DG 8  1_555 C DC 11 1_555 B DG  9  1_555 C DC  10 1_555 -0.552 -0.323 3.445  -1.484  3.514   35.535   -1.061 0.674  3.418  
5.738   2.423   35.733   8  DD_DG809DG810:DC910DC911_EE       D 809  ? E 911  ? D 810  ? E 910  ? 
1 B DG 9  1_555 C DC 10 1_555 B DT  10 1_555 C DA  9  1_555 -0.121 -0.498 2.982  -0.196  1.757   31.037   -1.235 0.193  2.951  
3.281   0.365   31.086   9  DD_DG810DT811:DA909DC910_EE       D 810  ? E 910  ? D 811  ? E 909  ? 
1 B DT 10 1_555 C DA 9  1_555 B DA  11 1_555 C DT  8  1_555 0.314  -0.405 3.335  1.659   5.471   32.218   -1.676 -0.267 3.236  
9.763   -2.961  32.708   10 DD_DT811DA812:DT908DA909_EE       D 811  ? E 909  ? D 812  ? E 908  ? 
1 B DA 11 1_555 C DT 8  1_555 B DG  12 1_555 C DC  7  1_555 0.485  -0.687 3.334  -2.924  8.132   26.234   -3.385 -1.715 2.923  
17.328  6.230   27.597   11 DD_DA812DG813:DC907DT908_EE       D 812  ? E 908  ? D 813  ? E 907  ? 
1 B DG 12 1_555 C DC 7  1_555 B 2DA 13 1_555 C 8OG 6  1_555 -0.498 3.511  -0.272 175.877 -17.204 -144.966 -1.758 -0.270 -0.007 
8.609   88.014  -179.012 12 DD_DG8132DA814:8OG906DC907_EE     D 813  ? E 907  ? D 814  ? E 906  ? 
1 E DG 1  1_555 F DC 18 1_555 E DT  2  1_555 F DA  17 1_555 -0.188 -0.064 3.012  -9.176  -6.551  41.650   0.513  -0.585 2.963  
-9.016  12.629  43.084   13 HH_DG1802DT1803:DA1917DC1918_JJ   H 1802 ? J 1918 ? H 1803 ? J 1917 ? 
1 E DT 2  1_555 F DA 17 1_555 E DT  3  1_555 F DA  16 1_555 0.452  0.476  2.968  12.010  -10.826 42.444   1.498  0.389  2.797  
-14.345 -15.914 45.286   14 HH_DT1803DT1804:DA1916DA1917_JJ   H 1803 ? J 1917 ? H 1804 ? J 1916 ? 
1 E DT 3  1_555 F DA 16 1_555 E DG  4  1_555 F DC  15 1_555 0.621  -0.162 3.435  7.610   17.699  22.797   -4.278 0.495  2.705  
37.350  -16.060 29.765   15 HH_DT1804DG1805:DC1915DA1916_JJ   H 1804 ? J 1916 ? H 1805 ? J 1915 ? 
1 E DG 4  1_555 F DC 15 1_555 E DG  5  1_555 F DC  14 1_555 0.145  0.747  2.691  -5.340  5.312   37.984   0.583  -0.767 2.723  
8.064   8.106   38.697   16 HH_DG1805DG1806:DC1914DC1915_JJ   H 1805 ? J 1915 ? H 1806 ? J 1914 ? 
1 E DG 5  1_555 F DC 14 1_555 E DA  6  1_555 F DT  13 1_555 -0.823 -0.452 3.296  -3.891  9.325   30.943   -2.446 0.786  3.110  
16.922  7.060   32.512   17 HH_DG1806DA1807:DT1913DC1914_JJ   H 1806 ? J 1914 ? H 1807 ? J 1913 ? 
1 E DA 6  1_555 F DT 13 1_555 E DT  7  1_555 F DA  12 1_555 0.600  -0.210 3.188  0.275   4.276   33.500   -1.034 -0.989 3.142  
7.381   -0.474  33.766   18 HH_DA1807DT1808:DA1912DT1913_JJ   H 1807 ? J 1913 ? H 1808 ? J 1912 ? 
1 E DT 7  1_555 F DA 12 1_555 E DG  8  1_555 F DC  11 1_555 -0.276 -0.345 3.270  2.293   2.213   33.882   -0.940 0.835  3.217  
3.787   -3.924  34.027   19 HH_DT1808DG1809:DC1911DA1912_JJ   H 1808 ? J 1912 ? H 1809 ? J 1911 ? 
1 E DG 8  1_555 F DC 11 1_555 E DG  9  1_555 F DC  10 1_555 0.025  -0.275 3.353  2.381   7.815   35.787   -1.526 0.292  3.219  
12.516  -3.814  36.678   20 HH_DG1809DG1810:DC1910DC1911_JJ   H 1809 ? J 1911 ? H 1810 ? J 1910 ? 
1 E DG 9  1_555 F DC 10 1_555 E DT  10 1_555 F DA  9  1_555 -0.169 -0.343 3.102  -2.237  -2.098  32.461   -0.264 -0.070 3.122  
-3.742  3.990   32.601   21 HH_DG1810DT1811:DA1909DC1910_JJ   H 1810 ? J 1910 ? H 1811 ? J 1909 ? 
1 E DT 10 1_555 F DA 9  1_555 E DA  11 1_555 F DT  8  1_555 0.599  -0.303 3.238  2.889   4.318   33.238   -1.224 -0.568 3.213  
7.492   -5.012  33.630   22 HH_DT1811DA1812:DT1908DA1909_JJ   H 1811 ? J 1909 ? H 1812 ? J 1908 ? 
1 E DA 11 1_555 F DT 8  1_555 E DG  12 1_555 F DC  7  1_555 -0.319 -0.411 3.176  -2.928  4.892   26.801   -2.036 -0.025 3.070  
10.405  6.227   27.390   23 HH_DA1812DG1813:DC1907DT1908_JJ   H 1812 ? J 1908 ? H 1813 ? J 1907 ? 
1 E DG 12 1_555 F DC 7  1_555 E 2DA 13 1_555 F 8OG 6  1_555 1.041  -2.116 3.212  -0.670  5.343   82.541   -1.728 -0.803 3.088  
4.046   0.507   82.685   24 HH_DG18132DA1814:8OG1906DC1907_JJ H 1813 ? J 1907 ? H 1814 ? J 1906 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE" DGT 
5 'CALCIUM ION'                       CA  
6 water                               HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 DGT 1   414  414  DGT DGT A . 
H 5 CA  1   415  415  CA  CA  A . 
I 5 CA  1   416  416  CA  CA  A . 
J 5 CA  1   417  417  CA  CA  A . 
K 4 DGT 1   1414 1414 DGT DGT B . 
L 5 CA  1   1415 1415 CA  CA  B . 
M 5 CA  1   1416 1416 CA  CA  B . 
N 5 CA  1   1417 1417 CA  CA  B . 
O 6 HOH 1   501  501  HOH HOH A . 
O 6 HOH 2   503  2    HOH HOH A . 
O 6 HOH 3   504  3    HOH HOH A . 
O 6 HOH 4   505  4    HOH HOH A . 
O 6 HOH 5   506  5    HOH HOH A . 
O 6 HOH 6   507  7    HOH HOH A . 
O 6 HOH 7   508  8    HOH HOH A . 
O 6 HOH 8   509  9    HOH HOH A . 
O 6 HOH 9   510  10   HOH HOH A . 
O 6 HOH 10  511  11   HOH HOH A . 
O 6 HOH 11  512  512  HOH HOH A . 
O 6 HOH 12  513  12   HOH HOH A . 
O 6 HOH 13  514  13   HOH HOH A . 
O 6 HOH 14  516  15   HOH HOH A . 
O 6 HOH 15  517  16   HOH HOH A . 
O 6 HOH 16  518  17   HOH HOH A . 
O 6 HOH 17  519  18   HOH HOH A . 
O 6 HOH 18  520  19   HOH HOH A . 
O 6 HOH 19  521  20   HOH HOH A . 
O 6 HOH 20  522  21   HOH HOH A . 
O 6 HOH 21  523  22   HOH HOH A . 
O 6 HOH 22  525  24   HOH HOH A . 
O 6 HOH 23  526  25   HOH HOH A . 
O 6 HOH 24  529  31   HOH HOH A . 
O 6 HOH 25  531  33   HOH HOH A . 
O 6 HOH 26  532  35   HOH HOH A . 
O 6 HOH 27  533  36   HOH HOH A . 
O 6 HOH 28  534  37   HOH HOH A . 
O 6 HOH 29  539  42   HOH HOH A . 
O 6 HOH 30  540  43   HOH HOH A . 
O 6 HOH 31  541  44   HOH HOH A . 
O 6 HOH 32  545  48   HOH HOH A . 
O 6 HOH 33  546  49   HOH HOH A . 
O 6 HOH 34  547  50   HOH HOH A . 
O 6 HOH 35  548  51   HOH HOH A . 
O 6 HOH 36  549  52   HOH HOH A . 
O 6 HOH 37  550  53   HOH HOH A . 
O 6 HOH 38  551  54   HOH HOH A . 
O 6 HOH 39  554  58   HOH HOH A . 
O 6 HOH 40  556  60   HOH HOH A . 
O 6 HOH 41  559  64   HOH HOH A . 
O 6 HOH 42  561  66   HOH HOH A . 
O 6 HOH 43  562  67   HOH HOH A . 
O 6 HOH 44  563  68   HOH HOH A . 
O 6 HOH 45  568  74   HOH HOH A . 
O 6 HOH 46  571  77   HOH HOH A . 
O 6 HOH 47  573  79   HOH HOH A . 
O 6 HOH 48  574  81   HOH HOH A . 
O 6 HOH 49  575  82   HOH HOH A . 
O 6 HOH 50  577  84   HOH HOH A . 
O 6 HOH 51  578  85   HOH HOH A . 
O 6 HOH 52  579  86   HOH HOH A . 
O 6 HOH 53  580  87   HOH HOH A . 
O 6 HOH 54  581  88   HOH HOH A . 
O 6 HOH 55  585  93   HOH HOH A . 
O 6 HOH 56  588  96   HOH HOH A . 
O 6 HOH 57  589  97   HOH HOH A . 
O 6 HOH 58  590  98   HOH HOH A . 
O 6 HOH 59  592  100  HOH HOH A . 
O 6 HOH 60  595  104  HOH HOH A . 
O 6 HOH 61  597  106  HOH HOH A . 
O 6 HOH 62  599  108  HOH HOH A . 
O 6 HOH 63  601  111  HOH HOH A . 
O 6 HOH 64  602  112  HOH HOH A . 
O 6 HOH 65  603  113  HOH HOH A . 
O 6 HOH 66  606  116  HOH HOH A . 
O 6 HOH 67  608  118  HOH HOH A . 
O 6 HOH 68  609  119  HOH HOH A . 
O 6 HOH 69  610  120  HOH HOH A . 
O 6 HOH 70  611  121  HOH HOH A . 
O 6 HOH 71  612  123  HOH HOH A . 
O 6 HOH 72  613  125  HOH HOH A . 
O 6 HOH 73  617  133  HOH HOH A . 
O 6 HOH 74  619  136  HOH HOH A . 
O 6 HOH 75  628  146  HOH HOH A . 
O 6 HOH 76  629  147  HOH HOH A . 
O 6 HOH 77  631  149  HOH HOH A . 
O 6 HOH 78  632  150  HOH HOH A . 
O 6 HOH 79  633  151  HOH HOH A . 
O 6 HOH 80  635  153  HOH HOH A . 
O 6 HOH 81  638  156  HOH HOH A . 
O 6 HOH 82  639  157  HOH HOH A . 
O 6 HOH 83  640  158  HOH HOH A . 
O 6 HOH 84  641  159  HOH HOH A . 
O 6 HOH 85  642  160  HOH HOH A . 
O 6 HOH 86  646  166  HOH HOH A . 
O 6 HOH 87  648  168  HOH HOH A . 
O 6 HOH 88  649  169  HOH HOH A . 
O 6 HOH 89  650  170  HOH HOH A . 
O 6 HOH 90  652  172  HOH HOH A . 
O 6 HOH 91  653  174  HOH HOH A . 
O 6 HOH 92  655  177  HOH HOH A . 
O 6 HOH 93  656  178  HOH HOH A . 
O 6 HOH 94  657  180  HOH HOH A . 
O 6 HOH 95  658  181  HOH HOH A . 
O 6 HOH 96  662  188  HOH HOH A . 
O 6 HOH 97  663  189  HOH HOH A . 
O 6 HOH 98  665  191  HOH HOH A . 
O 6 HOH 99  667  193  HOH HOH A . 
O 6 HOH 100 669  195  HOH HOH A . 
O 6 HOH 101 670  196  HOH HOH A . 
O 6 HOH 102 671  197  HOH HOH A . 
O 6 HOH 103 672  198  HOH HOH A . 
O 6 HOH 104 675  202  HOH HOH A . 
O 6 HOH 105 677  204  HOH HOH A . 
O 6 HOH 106 678  205  HOH HOH A . 
O 6 HOH 107 681  209  HOH HOH A . 
O 6 HOH 108 682  210  HOH HOH A . 
O 6 HOH 109 683  211  HOH HOH A . 
O 6 HOH 110 684  212  HOH HOH A . 
O 6 HOH 111 685  213  HOH HOH A . 
O 6 HOH 112 687  216  HOH HOH A . 
O 6 HOH 113 689  218  HOH HOH A . 
O 6 HOH 114 691  220  HOH HOH A . 
O 6 HOH 115 692  221  HOH HOH A . 
O 6 HOH 116 693  222  HOH HOH A . 
O 6 HOH 117 696  227  HOH HOH A . 
O 6 HOH 118 697  228  HOH HOH A . 
O 6 HOH 119 700  231  HOH HOH A . 
O 6 HOH 120 702  234  HOH HOH A . 
O 6 HOH 121 708  244  HOH HOH A . 
O 6 HOH 122 709  245  HOH HOH A . 
O 6 HOH 123 710  247  HOH HOH A . 
O 6 HOH 124 719  258  HOH HOH A . 
O 6 HOH 125 721  260  HOH HOH A . 
O 6 HOH 126 722  262  HOH HOH A . 
O 6 HOH 127 729  269  HOH HOH A . 
O 6 HOH 128 731  271  HOH HOH A . 
O 6 HOH 129 733  273  HOH HOH A . 
P 6 HOH 1   502  502  HOH HOH D . 
P 6 HOH 2   514  514  HOH HOH D . 
P 6 HOH 3   515  14   HOH HOH D . 
P 6 HOH 4   516  516  HOH HOH D . 
P 6 HOH 5   527  27   HOH HOH D . 
P 6 HOH 6   544  47   HOH HOH D . 
P 6 HOH 7   553  57   HOH HOH D . 
P 6 HOH 8   557  62   HOH HOH D . 
P 6 HOH 9   576  83   HOH HOH D . 
P 6 HOH 10  584  92   HOH HOH D . 
P 6 HOH 11  587  95   HOH HOH D . 
P 6 HOH 12  593  101  HOH HOH D . 
P 6 HOH 13  616  132  HOH HOH D . 
P 6 HOH 14  634  152  HOH HOH D . 
P 6 HOH 15  664  190  HOH HOH D . 
P 6 HOH 16  676  203  HOH HOH D . 
P 6 HOH 17  686  215  HOH HOH D . 
P 6 HOH 18  704  239  HOH HOH D . 
P 6 HOH 19  717  256  HOH HOH D . 
P 6 HOH 20  727  267  HOH HOH D . 
Q 6 HOH 1   536  39   HOH HOH E . 
Q 6 HOH 2   537  40   HOH HOH E . 
Q 6 HOH 3   555  59   HOH HOH E . 
Q 6 HOH 4   558  63   HOH HOH E . 
Q 6 HOH 5   564  69   HOH HOH E . 
Q 6 HOH 6   582  90   HOH HOH E . 
Q 6 HOH 7   596  105  HOH HOH E . 
Q 6 HOH 8   600  109  HOH HOH E . 
Q 6 HOH 9   620  137  HOH HOH E . 
Q 6 HOH 10  621  138  HOH HOH E . 
Q 6 HOH 11  626  144  HOH HOH E . 
Q 6 HOH 12  654  176  HOH HOH E . 
Q 6 HOH 13  694  224  HOH HOH E . 
Q 6 HOH 14  698  229  HOH HOH E . 
Q 6 HOH 15  711  249  HOH HOH E . 
Q 6 HOH 16  714  253  HOH HOH E . 
Q 6 HOH 17  715  254  HOH HOH E . 
Q 6 HOH 18  723  263  HOH HOH E . 
Q 6 HOH 19  730  270  HOH HOH E . 
Q 6 HOH 20  734  274  HOH HOH E . 
R 6 HOH 1   502  1    HOH HOH B . 
R 6 HOH 2   524  23   HOH HOH B . 
R 6 HOH 3   528  30   HOH HOH B . 
R 6 HOH 4   530  32   HOH HOH B . 
R 6 HOH 5   538  41   HOH HOH B . 
R 6 HOH 6   542  45   HOH HOH B . 
R 6 HOH 7   543  46   HOH HOH B . 
R 6 HOH 8   552  56   HOH HOH B . 
R 6 HOH 9   560  65   HOH HOH B . 
R 6 HOH 10  567  72   HOH HOH B . 
R 6 HOH 11  569  75   HOH HOH B . 
R 6 HOH 12  572  78   HOH HOH B . 
R 6 HOH 13  583  91   HOH HOH B . 
R 6 HOH 14  586  94   HOH HOH B . 
R 6 HOH 15  591  99   HOH HOH B . 
R 6 HOH 16  594  103  HOH HOH B . 
R 6 HOH 17  598  107  HOH HOH B . 
R 6 HOH 18  604  114  HOH HOH B . 
R 6 HOH 19  605  115  HOH HOH B . 
R 6 HOH 20  614  130  HOH HOH B . 
R 6 HOH 21  615  131  HOH HOH B . 
R 6 HOH 22  618  135  HOH HOH B . 
R 6 HOH 23  622  139  HOH HOH B . 
R 6 HOH 24  624  141  HOH HOH B . 
R 6 HOH 25  625  142  HOH HOH B . 
R 6 HOH 26  627  145  HOH HOH B . 
R 6 HOH 27  636  154  HOH HOH B . 
R 6 HOH 28  637  155  HOH HOH B . 
R 6 HOH 29  643  161  HOH HOH B . 
R 6 HOH 30  644  162  HOH HOH B . 
R 6 HOH 31  645  165  HOH HOH B . 
R 6 HOH 32  647  167  HOH HOH B . 
R 6 HOH 33  651  171  HOH HOH B . 
R 6 HOH 34  659  183  HOH HOH B . 
R 6 HOH 35  660  184  HOH HOH B . 
R 6 HOH 36  668  194  HOH HOH B . 
R 6 HOH 37  674  201  HOH HOH B . 
R 6 HOH 38  679  206  HOH HOH B . 
R 6 HOH 39  680  208  HOH HOH B . 
R 6 HOH 40  688  217  HOH HOH B . 
R 6 HOH 41  695  226  HOH HOH B . 
R 6 HOH 42  699  230  HOH HOH B . 
R 6 HOH 43  701  232  HOH HOH B . 
R 6 HOH 44  703  237  HOH HOH B . 
R 6 HOH 45  705  240  HOH HOH B . 
R 6 HOH 46  706  241  HOH HOH B . 
R 6 HOH 47  707  242  HOH HOH B . 
R 6 HOH 48  712  250  HOH HOH B . 
R 6 HOH 49  713  252  HOH HOH B . 
R 6 HOH 50  716  255  HOH HOH B . 
R 6 HOH 51  718  257  HOH HOH B . 
R 6 HOH 52  724  264  HOH HOH B . 
R 6 HOH 53  725  265  HOH HOH B . 
R 6 HOH 54  728  268  HOH HOH B . 
R 6 HOH 55  732  272  HOH HOH B . 
R 6 HOH 56  1501 1501 HOH HOH B . 
R 6 HOH 57  1502 1502 HOH HOH B . 
R 6 HOH 58  1503 1503 HOH HOH B . 
R 6 HOH 59  1512 1512 HOH HOH B . 
R 6 HOH 60  1515 1515 HOH HOH B . 
R 6 HOH 61  1516 1516 HOH HOH B . 
S 6 HOH 1   566  71   HOH HOH H . 
S 6 HOH 2   570  76   HOH HOH H . 
S 6 HOH 3   623  140  HOH HOH H . 
S 6 HOH 4   630  148  HOH HOH H . 
S 6 HOH 5   661  185  HOH HOH H . 
S 6 HOH 6   690  219  HOH HOH H . 
S 6 HOH 7   726  266  HOH HOH H . 
S 6 HOH 8   1514 1514 HOH HOH H . 
T 6 HOH 1   535  38   HOH HOH J . 
T 6 HOH 2   565  70   HOH HOH J . 
T 6 HOH 3   607  117  HOH HOH J . 
T 6 HOH 4   666  192  HOH HOH J . 
T 6 HOH 5   673  200  HOH HOH J . 
T 6 HOH 6   720  259  HOH HOH J . 
#