data_3GIL
# 
_entry.id   3GIL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3GIL         
NDB   PD1255       
RCSB  RCSB051905   
WWPDB D_1000051905 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2ASD 'oxoG-modified Dpo4 insertion ternary complex'                                           unspecified 
PDB 2ASJ 'oxoG-modified Dpo4 pre-insertion binary complex'                                        unspecified 
PDB 2ASL 'oxoG-modified Dpo4 post-insertion binary complex'                                       unspecified 
PDB 3GII 'Dpo4 extension ternary complex with disordered A opposite an oxoG in anti conformation' unspecified 
PDB 3GIJ 'Dpo4 extension ternary complex with oxoG(syn)-A(anti) and oxoG(anti)-A(syn) pairs'      unspecified 
PDB 3GIK 'Dpo4 extension ternary complex with the oxoG(anti)-C(anti) pair'                        unspecified 
PDB 3GIM 'Dpo4 extension ternary complex with oxoG(anti)-G(syn) pair'                             unspecified 
# 
_pdbx_database_status.entry_id                        3GIL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2009-03-05 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rechkoblit, O.' 1 
'Malinina, L.'   2 
'Patel, D.J.'    3 
# 
_citation.id                        primary 
_citation.title                     
'Impact of conformational heterogeneity of OxoG lesions and their pairing partners on bypass fidelity by Y family polymerases.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            17 
_citation.page_first                725 
_citation.page_last                 736 
_citation.year                      2009 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19446528 
_citation.pdbx_database_id_DOI      10.1016/j.str.2009.03.011 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Rechkoblit, O.'  1 
primary 'Malinina, L.'    2 
primary 'Cheng, Y.'       3 
primary 'Geacintov, N.E.' 4 
primary 'Broyde, S.'      5 
primary 'Patel, D.J.'     6 
# 
_cell.length_a           53.289 
_cell.length_b           110.682 
_cell.length_c           102.190 
_cell.angle_alpha        90.000 
_cell.angle_beta         99.220 
_cell.angle_gamma        90.000 
_cell.entry_id           3GIL 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.entry_id                         3GIL 
_symmetry.Int_Tables_number                4 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase IV'                                                  38945.379 2   2.7.7.7 ? ? ? 
2 polymer     syn "5'-D(*GP*TP*TP*GP*GP*AP*TP*GP*GP*TP*AP*GP*(2DT))-3'"                4061.656  2   ?       ? ? 
;PRIMER STRAND (DIDEOXY-TERMINATED AT 3'-END)
;
3 polymer     syn "5'-D(*CP*TP*AP*AP*CP*(8OG)P*CP*TP*AP*CP*CP*AP*TP*CP*CP*AP*AP*C)-3'" 5405.521  2   ?       ? ? 
'oxoG-modified template strand'                
4 non-polymer syn "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE"                                  507.181   2   ?       ? ? ? 
5 non-polymer syn 'CALCIUM ION'                                                        40.078    6   ?       ? ? ? 
6 water       nat water                                                                18.015    119 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Pol IV' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;GIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEV
YQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKP
NGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTR
VRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQ
KILEEDERKIRRIGVRFSKFI
;
;GIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEV
YQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKP
NGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTR
VRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQ
KILEEDERKIRRIGVRFSKFI
;
A,B ? 
2 polydeoxyribonucleotide no yes '(DG)(DT)(DT)(DG)(DG)(DA)(DT)(DG)(DG)(DT)(DA)(DG)(2DT)' GTTGGATGGTAGT D,H ? 
3 polydeoxyribonucleotide no yes '(DC)(DT)(DA)(DA)(DC)(8OG)(DC)(DT)(DA)(DC)(DC)(DA)(DT)(DC)(DC)(DA)(DA)(DC)' CTAACGCTACCATCCAAC 
E,J ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ILE n 
1 3   VAL n 
1 4   LEU n 
1 5   PHE n 
1 6   VAL n 
1 7   ASP n 
1 8   PHE n 
1 9   ASP n 
1 10  TYR n 
1 11  PHE n 
1 12  TYR n 
1 13  ALA n 
1 14  GLN n 
1 15  VAL n 
1 16  GLU n 
1 17  GLU n 
1 18  VAL n 
1 19  LEU n 
1 20  ASN n 
1 21  PRO n 
1 22  SER n 
1 23  LEU n 
1 24  LYS n 
1 25  GLY n 
1 26  LYS n 
1 27  PRO n 
1 28  VAL n 
1 29  VAL n 
1 30  VAL n 
1 31  CYS n 
1 32  VAL n 
1 33  PHE n 
1 34  SER n 
1 35  GLY n 
1 36  ARG n 
1 37  PHE n 
1 38  GLU n 
1 39  ASP n 
1 40  SER n 
1 41  GLY n 
1 42  ALA n 
1 43  VAL n 
1 44  ALA n 
1 45  THR n 
1 46  ALA n 
1 47  ASN n 
1 48  TYR n 
1 49  GLU n 
1 50  ALA n 
1 51  ARG n 
1 52  LYS n 
1 53  PHE n 
1 54  GLY n 
1 55  VAL n 
1 56  LYS n 
1 57  ALA n 
1 58  GLY n 
1 59  ILE n 
1 60  PRO n 
1 61  ILE n 
1 62  VAL n 
1 63  GLU n 
1 64  ALA n 
1 65  LYS n 
1 66  LYS n 
1 67  ILE n 
1 68  LEU n 
1 69  PRO n 
1 70  ASN n 
1 71  ALA n 
1 72  VAL n 
1 73  TYR n 
1 74  LEU n 
1 75  PRO n 
1 76  MET n 
1 77  ARG n 
1 78  LYS n 
1 79  GLU n 
1 80  VAL n 
1 81  TYR n 
1 82  GLN n 
1 83  GLN n 
1 84  VAL n 
1 85  SER n 
1 86  SER n 
1 87  ARG n 
1 88  ILE n 
1 89  MET n 
1 90  ASN n 
1 91  LEU n 
1 92  LEU n 
1 93  ARG n 
1 94  GLU n 
1 95  TYR n 
1 96  SER n 
1 97  GLU n 
1 98  LYS n 
1 99  ILE n 
1 100 GLU n 
1 101 ILE n 
1 102 ALA n 
1 103 SER n 
1 104 ILE n 
1 105 ASP n 
1 106 GLU n 
1 107 ALA n 
1 108 TYR n 
1 109 LEU n 
1 110 ASP n 
1 111 ILE n 
1 112 SER n 
1 113 ASP n 
1 114 LYS n 
1 115 VAL n 
1 116 ARG n 
1 117 ASP n 
1 118 TYR n 
1 119 ARG n 
1 120 GLU n 
1 121 ALA n 
1 122 TYR n 
1 123 ASN n 
1 124 LEU n 
1 125 GLY n 
1 126 LEU n 
1 127 GLU n 
1 128 ILE n 
1 129 LYS n 
1 130 ASN n 
1 131 LYS n 
1 132 ILE n 
1 133 LEU n 
1 134 GLU n 
1 135 LYS n 
1 136 GLU n 
1 137 LYS n 
1 138 ILE n 
1 139 THR n 
1 140 VAL n 
1 141 THR n 
1 142 VAL n 
1 143 GLY n 
1 144 ILE n 
1 145 SER n 
1 146 LYS n 
1 147 ASN n 
1 148 LYS n 
1 149 VAL n 
1 150 PHE n 
1 151 ALA n 
1 152 LYS n 
1 153 ILE n 
1 154 ALA n 
1 155 ALA n 
1 156 ASP n 
1 157 MET n 
1 158 ALA n 
1 159 LYS n 
1 160 PRO n 
1 161 ASN n 
1 162 GLY n 
1 163 ILE n 
1 164 LYS n 
1 165 VAL n 
1 166 ILE n 
1 167 ASP n 
1 168 ASP n 
1 169 GLU n 
1 170 GLU n 
1 171 VAL n 
1 172 LYS n 
1 173 ARG n 
1 174 LEU n 
1 175 ILE n 
1 176 ARG n 
1 177 GLU n 
1 178 LEU n 
1 179 ASP n 
1 180 ILE n 
1 181 ALA n 
1 182 ASP n 
1 183 VAL n 
1 184 PRO n 
1 185 GLY n 
1 186 ILE n 
1 187 GLY n 
1 188 ASN n 
1 189 ILE n 
1 190 THR n 
1 191 ALA n 
1 192 GLU n 
1 193 LYS n 
1 194 LEU n 
1 195 LYS n 
1 196 LYS n 
1 197 LEU n 
1 198 GLY n 
1 199 ILE n 
1 200 ASN n 
1 201 LYS n 
1 202 LEU n 
1 203 VAL n 
1 204 ASP n 
1 205 THR n 
1 206 LEU n 
1 207 SER n 
1 208 ILE n 
1 209 GLU n 
1 210 PHE n 
1 211 ASP n 
1 212 LYS n 
1 213 LEU n 
1 214 LYS n 
1 215 GLY n 
1 216 MET n 
1 217 ILE n 
1 218 GLY n 
1 219 GLU n 
1 220 ALA n 
1 221 LYS n 
1 222 ALA n 
1 223 LYS n 
1 224 TYR n 
1 225 LEU n 
1 226 ILE n 
1 227 SER n 
1 228 LEU n 
1 229 ALA n 
1 230 ARG n 
1 231 ASP n 
1 232 GLU n 
1 233 TYR n 
1 234 ASN n 
1 235 GLU n 
1 236 PRO n 
1 237 ILE n 
1 238 ARG n 
1 239 THR n 
1 240 ARG n 
1 241 VAL n 
1 242 ARG n 
1 243 LYS n 
1 244 SER n 
1 245 ILE n 
1 246 GLY n 
1 247 ARG n 
1 248 ILE n 
1 249 VAL n 
1 250 THR n 
1 251 MET n 
1 252 LYS n 
1 253 ARG n 
1 254 ASN n 
1 255 SER n 
1 256 ARG n 
1 257 ASN n 
1 258 LEU n 
1 259 GLU n 
1 260 GLU n 
1 261 ILE n 
1 262 LYS n 
1 263 PRO n 
1 264 TYR n 
1 265 LEU n 
1 266 PHE n 
1 267 ARG n 
1 268 ALA n 
1 269 ILE n 
1 270 GLU n 
1 271 GLU n 
1 272 SER n 
1 273 TYR n 
1 274 TYR n 
1 275 LYS n 
1 276 LEU n 
1 277 ASP n 
1 278 LYS n 
1 279 ARG n 
1 280 ILE n 
1 281 PRO n 
1 282 LYS n 
1 283 ALA n 
1 284 ILE n 
1 285 HIS n 
1 286 VAL n 
1 287 VAL n 
1 288 ALA n 
1 289 VAL n 
1 290 THR n 
1 291 GLU n 
1 292 ASP n 
1 293 LEU n 
1 294 ASP n 
1 295 ILE n 
1 296 VAL n 
1 297 SER n 
1 298 ARG n 
1 299 GLY n 
1 300 ARG n 
1 301 THR n 
1 302 PHE n 
1 303 PRO n 
1 304 HIS n 
1 305 GLY n 
1 306 ILE n 
1 307 SER n 
1 308 LYS n 
1 309 GLU n 
1 310 THR n 
1 311 ALA n 
1 312 TYR n 
1 313 SER n 
1 314 GLU n 
1 315 SER n 
1 316 VAL n 
1 317 LYS n 
1 318 LEU n 
1 319 LEU n 
1 320 GLN n 
1 321 LYS n 
1 322 ILE n 
1 323 LEU n 
1 324 GLU n 
1 325 GLU n 
1 326 ASP n 
1 327 GLU n 
1 328 ARG n 
1 329 LYS n 
1 330 ILE n 
1 331 ARG n 
1 332 ARG n 
1 333 ILE n 
1 334 GLY n 
1 335 VAL n 
1 336 ARG n 
1 337 PHE n 
1 338 SER n 
1 339 LYS n 
1 340 PHE n 
1 341 ILE n 
2 1   DG  n 
2 2   DT  n 
2 3   DT  n 
2 4   DG  n 
2 5   DG  n 
2 6   DA  n 
2 7   DT  n 
2 8   DG  n 
2 9   DG  n 
2 10  DT  n 
2 11  DA  n 
2 12  DG  n 
2 13  2DT n 
3 1   DC  n 
3 2   DT  n 
3 3   DA  n 
3 4   DA  n 
3 5   DC  n 
3 6   8OG n 
3 7   DC  n 
3 8   DT  n 
3 9   DA  n 
3 10  DC  n 
3 11  DC  n 
3 12  DA  n 
3 13  DT  n 
3 14  DC  n 
3 15  DC  n 
3 16  DA  n 
3 17  DA  n 
3 18  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'dbh, dpo4, SSO2448' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'P2 / DSM 1617 / JCM 11322' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Sulfolobus solfataricus P2' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     273057 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 35092 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-RIL(STRATAGENE)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? ? ? ? 'DNA primer strand'                 
3 1 sample ? ? ? ? ? 'DNA OXOG-modified template strand' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPO42_SULSO Q97W02 1 
;IVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEVY
QQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKPN
GIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRV
RKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQK
ILEEDERKIRRIGVRFSKFI
;
2 ? 
2 PDB 3GIL        3GIL   2 GTTGGATGGTAGT 1 ? 
3 PDB 3GIL        3GIL   3 CTAACGCTACCATCCAAC 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3GIL A 2 ? 341 ? Q97W02 2 ? 341 ? 2    341  
2 1 3GIL B 2 ? 341 ? Q97W02 2 ? 341 ? 1002 1341 
3 2 3GIL D 1 ? 13  ? 3GIL   1 ? 13  ? 802  814  
4 3 3GIL E 1 ? 18  ? 3GIL   1 ? 18  ? 901  918  
5 2 3GIL H 1 ? 13  ? 3GIL   1 ? 13  ? 1802 1814 
6 3 3GIL J 1 ? 18  ? 3GIL   1 ? 18  ? 1901 1918 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3GIL GLY A 1 ? UNP Q97W02 ? ? INSERTION 1    1 
2 3GIL GLY B 1 ? UNP Q97W02 ? ? INSERTION 1001 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2DT 'DNA linking'       n "3'-DEOXYTHYMIDINE-5'-MONOPHOSPHATE"        "2',3'-DIDEOXYTHYMIDINE-5'-MONOPHOSPHATE"               
'C10 H15 N2 O7 P'   306.209 
8OG 'DNA linking'       n "8-OXO-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" "8-OXO-7,8-DIHYDRO-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" 
'C10 H14 N5 O8 P'   363.221 
ALA 'L-peptide linking' y ALANINE                                     ?                                                       
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                    ?                                                       
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                  ?                                                       
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                             ?                                                       
'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                               ?                                                       
'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                                    ?                                                       
'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"        ?                                                       
'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"         ?                                                       
'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"        ?                                                       
'C10 H14 N5 O7 P'   347.221 
DGT non-polymer         . "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE"         ?                                                       
'C10 H16 N5 O13 P3' 507.181 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                ?                                                       
'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                                   ?                                                       
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                             ?                                                       
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                     ?                                                       
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                   ?                                                       
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                       ?                                                       
'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                  ?                                                       
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                     ?                                                       
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                      ?                                                       
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                  ?                                                       
'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                               ?                                                       
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                     ?                                                       
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                      ?                                                       
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                   ?                                                       
'C4 H9 N O3'        119.119 
TYR 'L-peptide linking' y TYROSINE                                    ?                                                       
'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                      ?                                                       
'C5 H11 N O2'       117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3GIL 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.07 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   59.96 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.pdbx_details    
'100 mM HEPES, 100 mM Calcium acetate, 10% PEG 4000, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 HEPES             ? ? ? 
1 2 2 'Calcium acetate' ? ? ? 
1 3 3 'PEG 4000'        ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2005-11-22 
_diffrn_detector.details                
'6144 x 6144 pixel elements with an effective pixel size less than 60x60 micron and resolution of order 90x90 micron' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97922 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 24-ID-C' 
_diffrn_source.pdbx_wavelength_list        0.97922 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-C 
# 
_reflns.entry_id                     3GIL 
_reflns.d_resolution_high            2.70 
_reflns.d_resolution_low             20.0 
_reflns.number_obs                   31388 
_reflns.pdbx_Rmerge_I_obs            0.113 
_reflns.pdbx_netI_over_sigmaI        12.553 
_reflns.pdbx_chi_squared             1.016 
_reflns.pdbx_redundancy              4.100 
_reflns.percent_possible_obs         99.200 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.70 2.78  ? ? ? 0.465 2.5 ? 0.955 3.20 ? 2547 96.30 1  1 
2.78 2.87  ? ? ? 0.428 ?   ? 0.890 3.60 ? 2559 98.70 2  1 
2.87 2.97  ? ? ? 0.367 ?   ? 0.941 4.00 ? 2620 99.20 3  1 
2.97 3.09  ? ? ? 0.296 ?   ? 1.051 4.20 ? 2597 99.40 4  1 
3.09 3.23  ? ? ? 0.210 ?   ? 1.035 4.30 ? 2618 99.30 5  1 
3.23 3.40  ? ? ? 0.172 ?   ? 1.054 4.30 ? 2604 99.60 6  1 
3.40 3.61  ? ? ? 0.132 ?   ? 1.079 4.20 ? 2599 99.50 7  1 
3.61 3.89  ? ? ? 0.107 ?   ? 1.009 4.30 ? 2632 99.60 8  1 
3.89 4.28  ? ? ? 0.080 ?   ? 1.016 4.20 ? 2637 99.70 9  1 
4.28 4.89  ? ? ? 0.074 ?   ? 1.053 4.20 ? 2645 99.80 10 1 
4.89 6.13  ? ? ? 0.079 ?   ? 1.015 4.20 ? 2640 99.90 11 1 
6.13 20.00 ? ? ? 0.096 ?   ? 1.039 4.00 ? 2690 99.90 12 1 
# 
_refine.entry_id                                 3GIL 
_refine.ls_d_res_high                            2.710 
_refine.ls_d_res_low                             20.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    98.750 
_refine.ls_number_reflns_obs                     31369 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.203 
_refine.ls_R_factor_R_work                       0.200 
_refine.ls_R_factor_R_free                       0.259 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  1583 
_refine.B_iso_mean                               51.444 
_refine.aniso_B[1][1]                            -1.090 
_refine.aniso_B[2][2]                            0.660 
_refine.aniso_B[3][3]                            0.720 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.900 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.943 
_refine.correlation_coeff_Fo_to_Fc_free          0.908 
_refine.pdbx_overall_ESU_R                       0.979 
_refine.pdbx_overall_ESU_R_Free                  0.346 
_refine.overall_SU_ML                            0.239 
_refine.overall_SU_B                             23.232 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.B_iso_max                                88.20 
_refine.B_iso_min                                21.94 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            0.50 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      'PDB entry 3GIJ' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5480 
_refine_hist.pdbx_number_atoms_nucleic_acid   1217 
_refine_hist.pdbx_number_atoms_ligand         68 
_refine_hist.number_atoms_solvent             119 
_refine_hist.number_atoms_total               6884 
_refine_hist.d_res_high                       2.710 
_refine_hist.d_res_low                        20.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         7023  0.010  0.022  ? 'X-RAY DIFFRACTION' ? 
r_bond_other_d           4583  0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      9688  1.626  2.221  ? 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        11222 0.893  3.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   682   6.717  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   243   32.957 23.621 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   1121  17.419 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   48    14.682 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           1105  0.131  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     6681  0.005  0.020  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       1116  0.002  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            1343  0.212  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbd_other              4737  0.187  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          3245  0.190  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_other            3495  0.083  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    200   0.160  0.200  ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      4     0.194  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   14    0.160  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     43    0.186  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 6     0.191  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              3584  0.513  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_other           1378  0.071  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             5529  0.783  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              4407  1.017  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             4159  1.703  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.71 
_refine_ls_shell.d_res_low                        2.78 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               89.510 
_refine_ls_shell.number_reflns_R_work             1969 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.318 
_refine_ls_shell.R_factor_R_free                  0.409 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             121 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                2090 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3GIL 
_struct.title                     'Dpo4 extension ternary complex with oxoG(anti)-T(anti) pair' 
_struct.pdbx_descriptor           'DNA polymerase IV (E.C.2.7.7.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3GIL 
_struct_keywords.text            
;DNA POLYMERASE, 8-OXOGUANINE, Y-FAMILY, LESION BYPASS, DNA damage, DNA repair, DNA replication, DNA-binding, DNA-directed DNA polymerase, Magnesium, Metal-binding, Mutator protein, Nucleotidyltransferase, Transferase, TRANSFERASE-DNA COMPLEX
;
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
K N N 4 ? 
L N N 5 ? 
M N N 5 ? 
N N N 5 ? 
O N N 6 ? 
P N N 6 ? 
Q N N 6 ? 
R N N 6 ? 
S N N 6 ? 
T N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 10  ? ASN A 20  ? TYR A 10   ASN A 20   1 ? 11 
HELX_P HELX_P2  2  PRO A 21  ? LYS A 24  ? PRO A 21   LYS A 24   5 ? 4  
HELX_P HELX_P3  3  ASN A 47  ? LYS A 52  ? ASN A 47   LYS A 52   1 ? 6  
HELX_P HELX_P4  4  PRO A 60  ? LEU A 68  ? PRO A 60   LEU A 68   1 ? 9  
HELX_P HELX_P5  5  ARG A 77  ? GLU A 94  ? ARG A 77   GLU A 94   1 ? 18 
HELX_P HELX_P6  6  ASP A 117 ? LYS A 137 ? ASP A 117  LYS A 137  1 ? 21 
HELX_P HELX_P7  7  ASN A 147 ? LYS A 159 ? ASN A 147  LYS A 159  1 ? 13 
HELX_P HELX_P8  8  ASP A 167 ? LEU A 178 ? ASP A 167  LEU A 178  1 ? 12 
HELX_P HELX_P9  9  ASP A 179 ? VAL A 183 ? ASP A 179  VAL A 183  5 ? 5  
HELX_P HELX_P10 10 GLY A 187 ? LEU A 197 ? GLY A 187  LEU A 197  1 ? 11 
HELX_P HELX_P11 11 LYS A 201 ? ILE A 208 ? LYS A 201  ILE A 208  5 ? 8  
HELX_P HELX_P12 12 GLU A 209 ? GLY A 218 ? GLU A 209  GLY A 218  1 ? 10 
HELX_P HELX_P13 13 GLY A 218 ? ARG A 230 ? GLY A 218  ARG A 230  1 ? 13 
HELX_P HELX_P14 14 ASN A 257 ? ASP A 277 ? ASN A 257  ASP A 277  1 ? 21 
HELX_P HELX_P15 15 SER A 307 ? ASP A 326 ? SER A 307  ASP A 326  1 ? 20 
HELX_P HELX_P16 16 TYR B 10  ? ASN B 20  ? TYR B 1010 ASN B 1020 1 ? 11 
HELX_P HELX_P17 17 PRO B 21  ? LYS B 24  ? PRO B 1021 LYS B 1024 5 ? 4  
HELX_P HELX_P18 18 ASN B 47  ? LYS B 52  ? ASN B 1047 LYS B 1052 1 ? 6  
HELX_P HELX_P19 19 PRO B 60  ? LEU B 68  ? PRO B 1060 LEU B 1068 1 ? 9  
HELX_P HELX_P20 20 ARG B 77  ? SER B 96  ? ARG B 1077 SER B 1096 1 ? 20 
HELX_P HELX_P21 21 ASP B 117 ? GLU B 136 ? ASP B 1117 GLU B 1136 1 ? 20 
HELX_P HELX_P22 22 ASN B 147 ? ALA B 158 ? ASN B 1147 ALA B 1158 1 ? 12 
HELX_P HELX_P23 23 ASP B 167 ? LEU B 178 ? ASP B 1167 LEU B 1178 1 ? 12 
HELX_P HELX_P24 24 ASP B 179 ? VAL B 183 ? ASP B 1179 VAL B 1183 5 ? 5  
HELX_P HELX_P25 25 GLY B 187 ? LYS B 195 ? GLY B 1187 LYS B 1195 1 ? 9  
HELX_P HELX_P26 26 LEU B 202 ? GLU B 209 ? LEU B 1202 GLU B 1209 5 ? 8  
HELX_P HELX_P27 27 PHE B 210 ? GLY B 218 ? PHE B 1210 GLY B 1218 1 ? 9  
HELX_P HELX_P28 28 GLY B 218 ? ARG B 230 ? GLY B 1218 ARG B 1230 1 ? 13 
HELX_P HELX_P29 29 ASN B 257 ? ASP B 277 ? ASN B 1257 ASP B 1277 1 ? 21 
HELX_P HELX_P30 30 SER B 307 ? GLU B 325 ? SER B 1307 GLU B 1325 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? C DG  12  "O3'" ? ? ? 1_555 C 2DT 13 P  ? ? D DG  813  D 2DT 814  1_555 ? ? ? ? ? ? ?            1.603 ? 
covale2  covale ? ? D DC  5   "O3'" ? ? ? 1_555 D 8OG 6  P  ? ? E DC  905  E 8OG 906  1_555 ? ? ? ? ? ? ?            1.574 ? 
covale3  covale ? ? D 8OG 6   "O3'" ? ? ? 1_555 D DC  7  P  ? ? E 8OG 906  E DC  907  1_555 ? ? ? ? ? ? ?            1.604 ? 
covale4  covale ? ? E DG  12  "O3'" ? ? ? 1_555 E 2DT 13 P  ? ? H DG  1813 H 2DT 1814 1_555 ? ? ? ? ? ? ?            1.608 ? 
covale5  covale ? ? F DC  5   "O3'" ? ? ? 1_555 F 8OG 6  P  ? ? J DC  1905 J 8OG 1906 1_555 ? ? ? ? ? ? ?            1.598 ? 
covale6  covale ? ? F 8OG 6   "O3'" ? ? ? 1_555 F DC  7  P  ? ? J 8OG 1906 J DC  1907 1_555 ? ? ? ? ? ? ?            1.590 ? 
metalc1  metalc ? ? A ASP 7   OD1   ? ? ? 1_555 I CA  .  CA ? ? A ASP 7    A CA  416  1_555 ? ? ? ? ? ? ?            2.280 ? 
metalc2  metalc ? ? A ASP 7   OD2   ? ? ? 1_555 H CA  .  CA ? ? A ASP 7    A CA  415  1_555 ? ? ? ? ? ? ?            2.335 ? 
metalc3  metalc ? ? A PHE 8   O     ? ? ? 1_555 I CA  .  CA ? ? A PHE 8    A CA  416  1_555 ? ? ? ? ? ? ?            2.309 ? 
metalc4  metalc ? ? A ASP 105 OD1   ? ? ? 1_555 H CA  .  CA ? ? A ASP 105  A CA  415  1_555 ? ? ? ? ? ? ?            2.454 ? 
metalc5  metalc ? ? A ASP 105 OD2   ? ? ? 1_555 I CA  .  CA ? ? A ASP 105  A CA  416  1_555 ? ? ? ? ? ? ?            2.333 ? 
metalc6  metalc ? ? A GLU 106 OE2   ? ? ? 1_555 H CA  .  CA ? ? A GLU 106  A CA  415  1_555 ? ? ? ? ? ? ?            2.345 ? 
metalc7  metalc ? ? A ALA 181 O     ? ? ? 1_555 J CA  .  CA ? ? A ALA 181  A CA  417  1_555 ? ? ? ? ? ? ?            2.324 ? 
metalc8  metalc ? ? A ILE 186 O     ? ? ? 1_555 J CA  .  CA ? ? A ILE 186  A CA  417  1_555 ? ? ? ? ? ? ?            2.344 ? 
metalc9  metalc ? ? B ASP 7   OD1   ? ? ? 1_555 M CA  .  CA ? ? B ASP 1007 B CA  1416 1_555 ? ? ? ? ? ? ?            2.303 ? 
metalc10 metalc ? ? B ASP 7   OD2   ? ? ? 1_555 L CA  .  CA ? ? B ASP 1007 B CA  1415 1_555 ? ? ? ? ? ? ?            2.324 ? 
metalc11 metalc ? ? B PHE 8   O     ? ? ? 1_555 M CA  .  CA ? ? B PHE 1008 B CA  1416 1_555 ? ? ? ? ? ? ?            2.314 ? 
metalc12 metalc ? ? B ASP 105 OD1   ? ? ? 1_555 L CA  .  CA ? ? B ASP 1105 B CA  1415 1_555 ? ? ? ? ? ? ?            2.517 ? 
metalc13 metalc ? ? B ASP 105 OD2   ? ? ? 1_555 M CA  .  CA ? ? B ASP 1105 B CA  1416 1_555 ? ? ? ? ? ? ?            2.326 ? 
metalc14 metalc ? ? B GLU 106 OE2   ? ? ? 1_555 L CA  .  CA ? ? B GLU 1106 B CA  1415 1_555 ? ? ? ? ? ? ?            2.324 ? 
metalc15 metalc ? ? B ALA 181 O     ? ? ? 1_555 N CA  .  CA ? ? B ALA 1181 B CA  1417 1_555 ? ? ? ? ? ? ?            2.785 ? 
metalc16 metalc ? ? B ILE 186 O     ? ? ? 1_555 N CA  .  CA ? ? B ILE 1186 B CA  1417 1_555 ? ? ? ? ? ? ?            2.325 ? 
metalc17 metalc ? ? E DG  12  OP1   ? ? ? 1_555 N CA  .  CA ? ? H DG  1813 B CA  1417 1_555 ? ? ? ? ? ? ?            2.331 ? 
metalc18 metalc ? ? G DGT .   O1G   ? ? ? 1_555 I CA  .  CA ? ? A DGT 414  A CA  416  1_555 ? ? ? ? ? ? ?            2.327 ? 
metalc19 metalc ? ? G DGT .   O1B   ? ? ? 1_555 I CA  .  CA ? ? A DGT 414  A CA  416  1_555 ? ? ? ? ? ? ?            2.303 ? 
metalc20 metalc ? ? G DGT .   O2A   ? ? ? 1_555 I CA  .  CA ? ? A DGT 414  A CA  416  1_555 ? ? ? ? ? ? ?            2.320 ? 
metalc21 metalc ? ? G DGT .   O2A   ? ? ? 1_555 H CA  .  CA ? ? A DGT 414  A CA  415  1_555 ? ? ? ? ? ? ?            2.312 ? 
metalc22 metalc ? ? K DGT .   O1G   ? ? ? 1_555 M CA  .  CA ? ? B DGT 1414 B CA  1416 1_555 ? ? ? ? ? ? ?            2.346 ? 
metalc23 metalc ? ? K DGT .   O1B   ? ? ? 1_555 M CA  .  CA ? ? B DGT 1414 B CA  1416 1_555 ? ? ? ? ? ? ?            2.312 ? 
metalc24 metalc ? ? K DGT .   O2A   ? ? ? 1_555 M CA  .  CA ? ? B DGT 1414 B CA  1416 1_555 ? ? ? ? ? ? ?            2.299 ? 
metalc25 metalc ? ? K DGT .   O2A   ? ? ? 1_555 L CA  .  CA ? ? B DGT 1414 B CA  1415 1_555 ? ? ? ? ? ? ?            2.324 ? 
metalc26 metalc ? ? H CA  .   CA    ? ? ? 1_555 O HOH .  O  ? ? A CA  415  A HOH 614  1_555 ? ? ? ? ? ? ?            2.923 ? 
metalc27 metalc ? ? H CA  .   CA    ? ? ? 1_555 O HOH .  O  ? ? A CA  415  A HOH 615  1_555 ? ? ? ? ? ? ?            2.165 ? 
metalc28 metalc ? ? J CA  .   CA    ? ? ? 1_555 O HOH .  O  ? ? A CA  417  A HOH 616  1_555 ? ? ? ? ? ? ?            2.303 ? 
metalc29 metalc ? ? J CA  .   CA    ? ? ? 1_555 O HOH .  O  ? ? A CA  417  A HOH 619  1_555 ? ? ? ? ? ? ?            2.161 ? 
metalc30 metalc ? ? J CA  .   CA    ? ? ? 1_555 Q HOH .  O  ? ? A CA  417  D HOH 617  1_555 ? ? ? ? ? ? ?            2.348 ? 
metalc31 metalc ? ? L CA  .   CA    ? ? ? 1_555 P HOH .  O  ? ? B CA  1415 B HOH 621  1_555 ? ? ? ? ? ? ?            2.566 ? 
metalc32 metalc ? ? N CA  .   CA    ? ? ? 1_555 P HOH .  O  ? ? B CA  1417 B HOH 626  1_555 ? ? ? ? ? ? ?            2.636 ? 
metalc33 metalc ? ? N CA  .   CA    ? ? ? 1_555 P HOH .  O  ? ? B CA  1417 B HOH 627  1_555 ? ? ? ? ? ? ?            2.493 ? 
metalc34 metalc ? ? N CA  .   CA    ? ? ? 1_555 S HOH .  O  ? ? B CA  1417 H HOH 625  1_555 ? ? ? ? ? ? ?            2.670 ? 
metalc35 metalc ? ? M CA  .   CA    ? ? ? 1_555 P HOH .  O  ? ? B CA  1416 B HOH 597  1_555 ? ? ? ? ? ? ?            3.104 ? 
metalc36 metalc ? ? B ASP 7   OD1   ? ? ? 1_555 L CA  .  CA ? ? B ASP 1007 B CA  1415 1_555 ? ? ? ? ? ? ?            3.127 ? 
metalc37 metalc ? ? B ASP 105 OD2   ? ? ? 1_555 L CA  .  CA ? ? B ASP 1105 B CA  1415 1_555 ? ? ? ? ? ? ?            3.137 ? 
metalc38 metalc ? ? A ASP 105 OD2   ? ? ? 1_555 H CA  .  CA ? ? A ASP 105  A CA  415  1_555 ? ? ? ? ? ? ?            3.189 ? 
hydrog1  hydrog ? ? C DG  1   N2    ? ? ? 1_555 D DC  18 O2 ? ? D DG  802  E DC  918  1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog2  hydrog ? ? C DT  2   N3    ? ? ? 1_555 D DA  17 N1 ? ? D DT  803  E DA  917  1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? 
hydrog3  hydrog ? ? C DT  3   N3    ? ? ? 1_555 D DA  16 N1 ? ? D DT  804  E DA  916  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? C DT  3   O4    ? ? ? 1_555 D DA  16 N6 ? ? D DT  804  E DA  916  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? C DG  4   N1    ? ? ? 1_555 D DC  15 N3 ? ? D DG  805  E DC  915  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? C DG  4   N2    ? ? ? 1_555 D DC  15 O2 ? ? D DG  805  E DC  915  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? C DG  4   O6    ? ? ? 1_555 D DC  15 N4 ? ? D DG  805  E DC  915  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? C DG  5   N1    ? ? ? 1_555 D DC  14 N3 ? ? D DG  806  E DC  914  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? C DG  5   N2    ? ? ? 1_555 D DC  14 O2 ? ? D DG  806  E DC  914  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? C DG  5   O6    ? ? ? 1_555 D DC  14 N4 ? ? D DG  806  E DC  914  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? C DA  6   N1    ? ? ? 1_555 D DT  13 N3 ? ? D DA  807  E DT  913  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? C DA  6   N6    ? ? ? 1_555 D DT  13 O4 ? ? D DA  807  E DT  913  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? C DT  7   N3    ? ? ? 1_555 D DA  12 N1 ? ? D DT  808  E DA  912  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? C DT  7   O4    ? ? ? 1_555 D DA  12 N6 ? ? D DT  808  E DA  912  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? C DG  8   N1    ? ? ? 1_555 D DC  11 N3 ? ? D DG  809  E DC  911  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? C DG  8   N2    ? ? ? 1_555 D DC  11 O2 ? ? D DG  809  E DC  911  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? C DG  8   O6    ? ? ? 1_555 D DC  11 N4 ? ? D DG  809  E DC  911  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? C DG  9   N1    ? ? ? 1_555 D DC  10 N3 ? ? D DG  810  E DC  910  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? C DG  9   N2    ? ? ? 1_555 D DC  10 O2 ? ? D DG  810  E DC  910  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? C DG  9   O6    ? ? ? 1_555 D DC  10 N4 ? ? D DG  810  E DC  910  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? C DT  10  N3    ? ? ? 1_555 D DA  9  N1 ? ? D DT  811  E DA  909  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? C DT  10  O4    ? ? ? 1_555 D DA  9  N6 ? ? D DT  811  E DA  909  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? C DA  11  N1    ? ? ? 1_555 D DT  8  N3 ? ? D DA  812  E DT  908  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? C DA  11  N6    ? ? ? 1_555 D DT  8  O4 ? ? D DA  812  E DT  908  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? C DG  12  N1    ? ? ? 1_555 D DC  7  N3 ? ? D DG  813  E DC  907  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? C DG  12  N2    ? ? ? 1_555 D DC  7  O2 ? ? D DG  813  E DC  907  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? C DG  12  O6    ? ? ? 1_555 D DC  7  N4 ? ? D DG  813  E DC  907  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? C 2DT 13  N3    ? ? ? 1_555 D 8OG 6  O6 ? ? D 2DT 814  E 8OG 906  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     ? 
hydrog29 hydrog ? ? C 2DT 13  O2    ? ? ? 1_555 D 8OG 6  N1 ? ? D 2DT 814  E 8OG 906  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     ? 
hydrog30 hydrog ? ? E DG  5   N1    ? ? ? 1_555 F DC  14 N3 ? ? H DG  1806 J DC  1914 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? E DG  5   N2    ? ? ? 1_555 F DC  14 O2 ? ? H DG  1806 J DC  1914 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? E DG  5   O6    ? ? ? 1_555 F DC  14 N4 ? ? H DG  1806 J DC  1914 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? E DG  5   N2    ? ? ? 1_555 F DC  15 O2 ? ? H DG  1806 J DC  1915 1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog34 hydrog ? ? E DA  6   N1    ? ? ? 1_555 F DT  13 N3 ? ? H DA  1807 J DT  1913 1_555 ? ? ? ? ? ? 'DA-DT PAIR' ?     ? 
hydrog35 hydrog ? ? E DT  7   N3    ? ? ? 1_555 F DA  12 N1 ? ? H DT  1808 J DA  1912 1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? 
hydrog36 hydrog ? ? E DG  8   N1    ? ? ? 1_555 F DC  11 N3 ? ? H DG  1809 J DC  1911 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? E DG  8   N2    ? ? ? 1_555 F DC  11 O2 ? ? H DG  1809 J DC  1911 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? E DG  8   O6    ? ? ? 1_555 F DC  11 N4 ? ? H DG  1809 J DC  1911 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? E DG  9   N1    ? ? ? 1_555 F DC  10 N3 ? ? H DG  1810 J DC  1910 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? E DG  9   N2    ? ? ? 1_555 F DC  10 O2 ? ? H DG  1810 J DC  1910 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? E DG  9   O6    ? ? ? 1_555 F DC  10 N4 ? ? H DG  1810 J DC  1910 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? E DT  10  N3    ? ? ? 1_555 F DA  9  N1 ? ? H DT  1811 J DA  1909 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? E DT  10  O4    ? ? ? 1_555 F DA  9  N6 ? ? H DT  1811 J DA  1909 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? E DA  11  N1    ? ? ? 1_555 F DT  8  N3 ? ? H DA  1812 J DT  1908 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? E DA  11  N6    ? ? ? 1_555 F DT  8  O4 ? ? H DA  1812 J DT  1908 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? E DG  12  N1    ? ? ? 1_555 F DC  7  N3 ? ? H DG  1813 J DC  1907 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? E DG  12  N2    ? ? ? 1_555 F DC  7  O2 ? ? H DG  1813 J DC  1907 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? E DG  12  O6    ? ? ? 1_555 F DC  7  N4 ? ? H DG  1813 J DC  1907 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? E 2DT 13  N3    ? ? ? 1_555 F 8OG 6  O6 ? ? H 2DT 1814 J 8OG 1906 1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     ? 
hydrog50 hydrog ? ? E 2DT 13  O2    ? ? ? 1_555 F 8OG 6  N1 ? ? H 2DT 1814 J 8OG 1906 1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 4 ? 
D ? 5 ? 
E ? 3 ? 
F ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 99  ? SER A 103 ? ILE A 99   SER A 103  
A 2 GLU A 106 ? ASP A 110 ? GLU A 106  ASP A 110  
A 3 VAL A 3   ? PHE A 8   ? VAL A 3    PHE A 8    
A 4 VAL A 140 ? SER A 145 ? VAL A 140  SER A 145  
A 5 ILE A 163 ? ILE A 166 ? ILE A 163  ILE A 166  
B 1 GLY A 41  ? ALA A 46  ? GLY A 41   ALA A 46   
B 2 VAL A 28  ? PHE A 33  ? VAL A 28   PHE A 33   
B 3 VAL A 72  ? PRO A 75  ? VAL A 72   PRO A 75   
C 1 SER A 244 ? SER A 255 ? SER A 244  SER A 255  
C 2 ILE A 330 ? PHE A 340 ? ILE A 330  PHE A 340  
C 3 PRO A 281 ? THR A 290 ? PRO A 281  THR A 290  
C 4 ILE A 295 ? THR A 301 ? ILE A 295  THR A 301  
D 1 ILE B 99  ? SER B 103 ? ILE B 1099 SER B 1103 
D 2 GLU B 106 ? ILE B 111 ? GLU B 1106 ILE B 1111 
D 3 ILE B 2   ? PHE B 8   ? ILE B 1002 PHE B 1008 
D 4 VAL B 140 ? SER B 145 ? VAL B 1140 SER B 1145 
D 5 ILE B 163 ? VAL B 165 ? ILE B 1163 VAL B 1165 
E 1 GLY B 41  ? ALA B 46  ? GLY B 1041 ALA B 1046 
E 2 VAL B 28  ? PHE B 33  ? VAL B 1028 PHE B 1033 
E 3 VAL B 72  ? PRO B 75  ? VAL B 1072 PRO B 1075 
F 1 SER B 244 ? SER B 255 ? SER B 1244 SER B 1255 
F 2 ILE B 330 ? PHE B 340 ? ILE B 1330 PHE B 1340 
F 3 PRO B 281 ? THR B 290 ? PRO B 1281 THR B 1290 
F 4 ILE B 295 ? THR B 301 ? ILE B 1295 THR B 1301 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 100 ? N GLU A 100  O TYR A 108 ? O TYR A 108  
A 2 3 O LEU A 109 ? O LEU A 109  N LEU A 4   ? N LEU A 4    
A 3 4 N PHE A 5   ? N PHE A 5    O GLY A 143 ? O GLY A 143  
A 4 5 N ILE A 144 ? N ILE A 144  O LYS A 164 ? O LYS A 164  
B 1 2 O ALA A 44  ? O ALA A 44   N VAL A 30  ? N VAL A 30   
B 2 3 N CYS A 31  ? N CYS A 31   O LEU A 74  ? O LEU A 74   
C 1 2 N ILE A 245 ? N ILE A 245  O PHE A 337 ? O PHE A 337  
C 2 3 O ARG A 331 ? O ARG A 331  N VAL A 289 ? N VAL A 289  
C 3 4 N VAL A 286 ? N VAL A 286  O ARG A 298 ? O ARG A 298  
D 1 2 N GLU B 100 ? N GLU B 1100 O TYR B 108 ? O TYR B 1108 
D 2 3 O LEU B 109 ? O LEU B 1109 N LEU B 4   ? N LEU B 1004 
D 3 4 N PHE B 5   ? N PHE B 1005 O GLY B 143 ? O GLY B 1143 
D 4 5 N ILE B 144 ? N ILE B 1144 O LYS B 164 ? O LYS B 1164 
E 1 2 O ALA B 44  ? O ALA B 1044 N VAL B 30  ? N VAL B 1030 
E 2 3 N VAL B 29  ? N VAL B 1029 O VAL B 72  ? O VAL B 1072 
F 1 2 N ILE B 245 ? N ILE B 1245 O PHE B 337 ? O PHE B 1337 
F 2 3 O ARG B 332 ? O ARG B 1332 N VAL B 289 ? N VAL B 1289 
F 3 4 N VAL B 286 ? N VAL B 1286 O ARG B 298 ? O ARG B 1298 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE DGT A 414'  
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CA A 415'   
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 416'   
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 417'   
AC5 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE DGT B 1414' 
AC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA B 1415'  
AC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA B 1416'  
AC8 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CA B 1417'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 21 ASP A 7   ? ASP A 7    . ? 1_555 ? 
2  AC1 21 PHE A 8   ? PHE A 8    . ? 1_555 ? 
3  AC1 21 TYR A 10  ? TYR A 10   . ? 1_555 ? 
4  AC1 21 PHE A 11  ? PHE A 11   . ? 1_555 ? 
5  AC1 21 TYR A 12  ? TYR A 12   . ? 1_555 ? 
6  AC1 21 ALA A 44  ? ALA A 44   . ? 1_555 ? 
7  AC1 21 THR A 45  ? THR A 45   . ? 1_555 ? 
8  AC1 21 TYR A 48  ? TYR A 48   . ? 1_555 ? 
9  AC1 21 ARG A 51  ? ARG A 51   . ? 1_555 ? 
10 AC1 21 ALA A 57  ? ALA A 57   . ? 1_555 ? 
11 AC1 21 ASP A 105 ? ASP A 105  . ? 1_555 ? 
12 AC1 21 LYS A 159 ? LYS A 159  . ? 1_555 ? 
13 AC1 21 CA  H .   ? CA  A 415  . ? 1_555 ? 
14 AC1 21 CA  I .   ? CA  A 416  . ? 1_555 ? 
15 AC1 21 HOH O .   ? HOH A 518  . ? 1_555 ? 
16 AC1 21 HOH O .   ? HOH A 570  . ? 1_555 ? 
17 AC1 21 HOH O .   ? HOH A 595  . ? 1_555 ? 
18 AC1 21 HOH O .   ? HOH A 615  . ? 1_555 ? 
19 AC1 21 2DT C 13  ? 2DT D 814  . ? 1_555 ? 
20 AC1 21 DC  D 5   ? DC  E 905  . ? 1_555 ? 
21 AC1 21 8OG D 6   ? 8OG E 906  . ? 1_555 ? 
22 AC2 7  ASP A 7   ? ASP A 7    . ? 1_555 ? 
23 AC2 7  ASP A 105 ? ASP A 105  . ? 1_555 ? 
24 AC2 7  GLU A 106 ? GLU A 106  . ? 1_555 ? 
25 AC2 7  DGT G .   ? DGT A 414  . ? 1_555 ? 
26 AC2 7  CA  I .   ? CA  A 416  . ? 1_555 ? 
27 AC2 7  HOH O .   ? HOH A 614  . ? 1_555 ? 
28 AC2 7  HOH O .   ? HOH A 615  . ? 1_555 ? 
29 AC3 5  ASP A 7   ? ASP A 7    . ? 1_555 ? 
30 AC3 5  PHE A 8   ? PHE A 8    . ? 1_555 ? 
31 AC3 5  ASP A 105 ? ASP A 105  . ? 1_555 ? 
32 AC3 5  DGT G .   ? DGT A 414  . ? 1_555 ? 
33 AC3 5  CA  H .   ? CA  A 415  . ? 1_555 ? 
34 AC4 5  ALA A 181 ? ALA A 181  . ? 1_555 ? 
35 AC4 5  ILE A 186 ? ILE A 186  . ? 1_555 ? 
36 AC4 5  HOH O .   ? HOH A 616  . ? 1_555 ? 
37 AC4 5  HOH O .   ? HOH A 619  . ? 1_555 ? 
38 AC4 5  HOH Q .   ? HOH D 617  . ? 1_555 ? 
39 AC5 20 HOH P .   ? HOH B 532  . ? 1_555 ? 
40 AC5 20 HOH P .   ? HOH B 597  . ? 1_555 ? 
41 AC5 20 ASP B 7   ? ASP B 1007 . ? 1_555 ? 
42 AC5 20 PHE B 8   ? PHE B 1008 . ? 1_555 ? 
43 AC5 20 ASP B 9   ? ASP B 1009 . ? 1_555 ? 
44 AC5 20 TYR B 10  ? TYR B 1010 . ? 1_555 ? 
45 AC5 20 PHE B 11  ? PHE B 1011 . ? 1_555 ? 
46 AC5 20 TYR B 12  ? TYR B 1012 . ? 1_555 ? 
47 AC5 20 ALA B 44  ? ALA B 1044 . ? 1_555 ? 
48 AC5 20 THR B 45  ? THR B 1045 . ? 1_555 ? 
49 AC5 20 TYR B 48  ? TYR B 1048 . ? 1_555 ? 
50 AC5 20 ARG B 51  ? ARG B 1051 . ? 1_555 ? 
51 AC5 20 ALA B 57  ? ALA B 1057 . ? 1_555 ? 
52 AC5 20 ASP B 105 ? ASP B 1105 . ? 1_555 ? 
53 AC5 20 LYS B 159 ? LYS B 1159 . ? 1_555 ? 
54 AC5 20 CA  L .   ? CA  B 1415 . ? 1_555 ? 
55 AC5 20 CA  M .   ? CA  B 1416 . ? 1_555 ? 
56 AC5 20 2DT E 13  ? 2DT H 1814 . ? 1_555 ? 
57 AC5 20 DC  F 5   ? DC  J 1905 . ? 1_555 ? 
58 AC5 20 8OG F 6   ? 8OG J 1906 . ? 1_555 ? 
59 AC6 6  HOH P .   ? HOH B 621  . ? 1_555 ? 
60 AC6 6  ASP B 7   ? ASP B 1007 . ? 1_555 ? 
61 AC6 6  ASP B 105 ? ASP B 1105 . ? 1_555 ? 
62 AC6 6  GLU B 106 ? GLU B 1106 . ? 1_555 ? 
63 AC6 6  DGT K .   ? DGT B 1414 . ? 1_555 ? 
64 AC6 6  CA  M .   ? CA  B 1416 . ? 1_555 ? 
65 AC7 5  ASP B 7   ? ASP B 1007 . ? 1_555 ? 
66 AC7 5  PHE B 8   ? PHE B 1008 . ? 1_555 ? 
67 AC7 5  ASP B 105 ? ASP B 1105 . ? 1_555 ? 
68 AC7 5  DGT K .   ? DGT B 1414 . ? 1_555 ? 
69 AC7 5  CA  L .   ? CA  B 1415 . ? 1_555 ? 
70 AC8 7  HOH P .   ? HOH B 626  . ? 1_555 ? 
71 AC8 7  HOH P .   ? HOH B 627  . ? 1_555 ? 
72 AC8 7  ALA B 181 ? ALA B 1181 . ? 1_555 ? 
73 AC8 7  VAL B 183 ? VAL B 1183 . ? 1_555 ? 
74 AC8 7  ILE B 186 ? ILE B 1186 . ? 1_555 ? 
75 AC8 7  HOH S .   ? HOH H 625  . ? 1_555 ? 
76 AC8 7  DG  E 12  ? DG  H 1813 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3GIL 
_atom_sites.fract_transf_matrix[1][1]   0.018766 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003047 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009035 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009914 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 14.075  27.268  10.011  1.00 40.08 ? 1    GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 14.392  25.953  9.351   1.00 40.23 ? 1    GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 13.121  25.303  8.802   1.00 40.35 ? 1    GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 12.173  25.063  9.549   1.00 40.42 ? 1    GLY A O     1 
ATOM   5    N  N     . ILE A 1 2   ? 13.082  25.056  7.496   1.00 40.02 ? 2    ILE A N     1 
ATOM   6    C  CA    . ILE A 1 2   ? 11.906  24.492  6.851   1.00 40.12 ? 2    ILE A CA    1 
ATOM   7    C  C     . ILE A 1 2   ? 12.347  23.330  5.978   1.00 40.33 ? 2    ILE A C     1 
ATOM   8    O  O     . ILE A 1 2   ? 13.313  23.452  5.227   1.00 40.53 ? 2    ILE A O     1 
ATOM   9    C  CB    . ILE A 1 2   ? 11.164  25.531  5.967   1.00 39.99 ? 2    ILE A CB    1 
ATOM   10   C  CG1   . ILE A 1 2   ? 10.852  26.782  6.771   1.00 40.23 ? 2    ILE A CG1   1 
ATOM   11   C  CG2   . ILE A 1 2   ? 9.873   24.939  5.392   1.00 39.01 ? 2    ILE A CG2   1 
ATOM   12   C  CD1   . ILE A 1 2   ? 9.962   27.785  6.050   1.00 40.46 ? 2    ILE A CD1   1 
ATOM   13   N  N     . VAL A 1 3   ? 11.621  22.223  6.066   1.00 40.46 ? 3    VAL A N     1 
ATOM   14   C  CA    . VAL A 1 3   ? 11.957  21.006  5.349   1.00 40.58 ? 3    VAL A CA    1 
ATOM   15   C  C     . VAL A 1 3   ? 10.773  20.577  4.518   1.00 40.87 ? 3    VAL A C     1 
ATOM   16   O  O     . VAL A 1 3   ? 9.654   20.510  5.036   1.00 40.40 ? 3    VAL A O     1 
ATOM   17   C  CB    . VAL A 1 3   ? 12.272  19.877  6.326   1.00 40.83 ? 3    VAL A CB    1 
ATOM   18   C  CG1   . VAL A 1 3   ? 12.402  18.550  5.583   1.00 39.87 ? 3    VAL A CG1   1 
ATOM   19   C  CG2   . VAL A 1 3   ? 13.522  20.226  7.150   1.00 39.65 ? 3    VAL A CG2   1 
ATOM   20   N  N     . LEU A 1 4   ? 11.019  20.283  3.238   1.00 41.18 ? 4    LEU A N     1 
ATOM   21   C  CA    . LEU A 1 4   ? 9.951   19.912  2.314   1.00 41.41 ? 4    LEU A CA    1 
ATOM   22   C  C     . LEU A 1 4   ? 10.178  18.495  1.884   1.00 41.62 ? 4    LEU A C     1 
ATOM   23   O  O     . LEU A 1 4   ? 11.219  18.199  1.300   1.00 42.22 ? 4    LEU A O     1 
ATOM   24   C  CB    . LEU A 1 4   ? 9.944   20.831  1.095   1.00 41.53 ? 4    LEU A CB    1 
ATOM   25   C  CG    . LEU A 1 4   ? 8.710   20.669  0.189   1.00 41.61 ? 4    LEU A CG    1 
ATOM   26   C  CD1   . LEU A 1 4   ? 8.433   21.933  -0.597  1.00 39.50 ? 4    LEU A CD1   1 
ATOM   27   C  CD2   . LEU A 1 4   ? 8.832   19.461  -0.735  1.00 38.31 ? 4    LEU A CD2   1 
ATOM   28   N  N     . PHE A 1 5   ? 9.217   17.624  2.173   1.00 41.66 ? 5    PHE A N     1 
ATOM   29   C  CA    . PHE A 1 5   ? 9.360   16.186  1.942   1.00 41.85 ? 5    PHE A CA    1 
ATOM   30   C  C     . PHE A 1 5   ? 8.381   15.746  0.867   1.00 42.54 ? 5    PHE A C     1 
ATOM   31   O  O     . PHE A 1 5   ? 7.190   16.045  0.945   1.00 42.90 ? 5    PHE A O     1 
ATOM   32   C  CB    . PHE A 1 5   ? 9.092   15.444  3.237   1.00 41.76 ? 5    PHE A CB    1 
ATOM   33   C  CG    . PHE A 1 5   ? 8.973   13.951  3.103   1.00 41.21 ? 5    PHE A CG    1 
ATOM   34   C  CD1   . PHE A 1 5   ? 10.087  13.148  3.097   1.00 41.80 ? 5    PHE A CD1   1 
ATOM   35   C  CD2   . PHE A 1 5   ? 7.736   13.342  3.074   1.00 41.59 ? 5    PHE A CD2   1 
ATOM   36   C  CE1   . PHE A 1 5   ? 9.959   11.737  3.010   1.00 42.15 ? 5    PHE A CE1   1 
ATOM   37   C  CE2   . PHE A 1 5   ? 7.607   11.937  2.996   1.00 40.58 ? 5    PHE A CE2   1 
ATOM   38   C  CZ    . PHE A 1 5   ? 8.713   11.148  2.954   1.00 40.21 ? 5    PHE A CZ    1 
ATOM   39   N  N     . VAL A 1 6   ? 8.896   15.050  -0.142  1.00 42.98 ? 6    VAL A N     1 
ATOM   40   C  CA    . VAL A 1 6   ? 8.098   14.585  -1.271  1.00 42.83 ? 6    VAL A CA    1 
ATOM   41   C  C     . VAL A 1 6   ? 8.152   13.071  -1.302  1.00 42.84 ? 6    VAL A C     1 
ATOM   42   O  O     . VAL A 1 6   ? 9.237   12.490  -1.210  1.00 42.66 ? 6    VAL A O     1 
ATOM   43   C  CB    . VAL A 1 6   ? 8.660   15.122  -2.591  1.00 42.85 ? 6    VAL A CB    1 
ATOM   44   C  CG1   . VAL A 1 6   ? 7.850   14.569  -3.795  1.00 42.18 ? 6    VAL A CG1   1 
ATOM   45   C  CG2   . VAL A 1 6   ? 8.675   16.645  -2.561  1.00 42.00 ? 6    VAL A CG2   1 
ATOM   46   N  N     . ASP A 1 7   ? 6.987   12.446  -1.423  1.00 42.77 ? 7    ASP A N     1 
ATOM   47   C  CA    . ASP A 1 7   ? 6.871   10.980  -1.426  1.00 42.82 ? 7    ASP A CA    1 
ATOM   48   C  C     . ASP A 1 7   ? 5.855   10.580  -2.489  1.00 42.67 ? 7    ASP A C     1 
ATOM   49   O  O     . ASP A 1 7   ? 4.658   10.803  -2.338  1.00 42.69 ? 7    ASP A O     1 
ATOM   50   C  CB    . ASP A 1 7   ? 6.453   10.479  -0.042  1.00 42.78 ? 7    ASP A CB    1 
ATOM   51   C  CG    . ASP A 1 7   ? 6.198   8.965   0.002   1.00 44.38 ? 7    ASP A CG    1 
ATOM   52   O  OD1   . ASP A 1 7   ? 5.476   8.470   -0.897  1.00 43.66 ? 7    ASP A OD1   1 
ATOM   53   O  OD2   . ASP A 1 7   ? 6.652   8.276   0.958   1.00 40.66 ? 7    ASP A OD2   1 
ATOM   54   N  N     . PHE A 1 8   ? 6.345   9.954   -3.549  1.00 42.69 ? 8    PHE A N     1 
ATOM   55   C  CA    . PHE A 1 8   ? 5.520   9.652   -4.717  1.00 42.92 ? 8    PHE A CA    1 
ATOM   56   C  C     . PHE A 1 8   ? 4.363   8.676   -4.386  1.00 42.42 ? 8    PHE A C     1 
ATOM   57   O  O     . PHE A 1 8   ? 4.494   7.829   -3.492  1.00 41.21 ? 8    PHE A O     1 
ATOM   58   C  CB    . PHE A 1 8   ? 6.384   9.095   -5.875  1.00 43.48 ? 8    PHE A CB    1 
ATOM   59   C  CG    . PHE A 1 8   ? 7.751   9.787   -6.063  1.00 43.63 ? 8    PHE A CG    1 
ATOM   60   C  CD1   . PHE A 1 8   ? 7.936   11.116  -5.783  1.00 43.70 ? 8    PHE A CD1   1 
ATOM   61   C  CD2   . PHE A 1 8   ? 8.837   9.064   -6.561  1.00 44.11 ? 8    PHE A CD2   1 
ATOM   62   C  CE1   . PHE A 1 8   ? 9.169   11.709  -5.979  1.00 44.15 ? 8    PHE A CE1   1 
ATOM   63   C  CE2   . PHE A 1 8   ? 10.051  9.652   -6.752  1.00 44.38 ? 8    PHE A CE2   1 
ATOM   64   C  CZ    . PHE A 1 8   ? 10.220  10.980  -6.470  1.00 43.99 ? 8    PHE A CZ    1 
ATOM   65   N  N     . ASP A 1 9   ? 3.243   8.811   -5.100  1.00 42.43 ? 9    ASP A N     1 
ATOM   66   C  CA    . ASP A 1 9   ? 2.033   8.009   -4.825  1.00 43.03 ? 9    ASP A CA    1 
ATOM   67   C  C     . ASP A 1 9   ? 2.099   6.623   -5.483  1.00 43.48 ? 9    ASP A C     1 
ATOM   68   O  O     . ASP A 1 9   ? 2.401   6.501   -6.677  1.00 43.98 ? 9    ASP A O     1 
ATOM   69   C  CB    . ASP A 1 9   ? 0.747   8.725   -5.300  1.00 42.90 ? 9    ASP A CB    1 
ATOM   70   C  CG    . ASP A 1 9   ? 0.533   10.095  -4.645  1.00 43.32 ? 9    ASP A CG    1 
ATOM   71   O  OD1   . ASP A 1 9   ? 1.040   10.325  -3.529  1.00 43.77 ? 9    ASP A OD1   1 
ATOM   72   O  OD2   . ASP A 1 9   ? -0.180  10.946  -5.241  1.00 44.15 ? 9    ASP A OD2   1 
ATOM   73   N  N     . TYR A 1 10  ? 1.777   5.589   -4.706  1.00 44.03 ? 10   TYR A N     1 
ATOM   74   C  CA    . TYR A 1 10  ? 1.728   4.188   -5.174  1.00 44.08 ? 10   TYR A CA    1 
ATOM   75   C  C     . TYR A 1 10  ? 2.689   3.894   -6.319  1.00 44.14 ? 10   TYR A C     1 
ATOM   76   O  O     . TYR A 1 10  ? 2.342   3.288   -7.350  1.00 43.91 ? 10   TYR A O     1 
ATOM   77   C  CB    . TYR A 1 10  ? 0.283   3.781   -5.482  1.00 44.57 ? 10   TYR A CB    1 
ATOM   78   C  CG    . TYR A 1 10  ? -0.413  4.551   -6.565  1.00 44.70 ? 10   TYR A CG    1 
ATOM   79   C  CD1   . TYR A 1 10  ? -0.669  3.955   -7.797  1.00 45.83 ? 10   TYR A CD1   1 
ATOM   80   C  CD2   . TYR A 1 10  ? -0.878  5.849   -6.350  1.00 46.05 ? 10   TYR A CD2   1 
ATOM   81   C  CE1   . TYR A 1 10  ? -1.335  4.633   -8.804  1.00 46.15 ? 10   TYR A CE1   1 
ATOM   82   C  CE2   . TYR A 1 10  ? -1.546  6.549   -7.359  1.00 45.86 ? 10   TYR A CE2   1 
ATOM   83   C  CZ    . TYR A 1 10  ? -1.762  5.926   -8.589  1.00 46.05 ? 10   TYR A CZ    1 
ATOM   84   O  OH    . TYR A 1 10  ? -2.408  6.563   -9.615  1.00 45.78 ? 10   TYR A OH    1 
ATOM   85   N  N     . PHE A 1 11  ? 3.941   4.282   -6.067  1.00 44.18 ? 11   PHE A N     1 
ATOM   86   C  CA    . PHE A 1 11  ? 4.913   4.563   -7.113  1.00 43.77 ? 11   PHE A CA    1 
ATOM   87   C  C     . PHE A 1 11  ? 5.024   3.487   -8.190  1.00 43.77 ? 11   PHE A C     1 
ATOM   88   O  O     . PHE A 1 11  ? 4.773   3.777   -9.357  1.00 43.49 ? 11   PHE A O     1 
ATOM   89   C  CB    . PHE A 1 11  ? 6.280   4.875   -6.486  1.00 44.24 ? 11   PHE A CB    1 
ATOM   90   C  CG    . PHE A 1 11  ? 7.312   5.352   -7.476  1.00 43.86 ? 11   PHE A CG    1 
ATOM   91   C  CD1   . PHE A 1 11  ? 7.017   6.382   -8.367  1.00 43.55 ? 11   PHE A CD1   1 
ATOM   92   C  CD2   . PHE A 1 11  ? 8.560   4.771   -7.515  1.00 42.16 ? 11   PHE A CD2   1 
ATOM   93   C  CE1   . PHE A 1 11  ? 7.941   6.795   -9.282  1.00 44.21 ? 11   PHE A CE1   1 
ATOM   94   C  CE2   . PHE A 1 11  ? 9.501   5.189   -8.426  1.00 43.67 ? 11   PHE A CE2   1 
ATOM   95   C  CZ    . PHE A 1 11  ? 9.202   6.200   -9.313  1.00 43.76 ? 11   PHE A CZ    1 
ATOM   96   N  N     . TYR A 1 12  ? 5.373   2.248   -7.838  1.00 43.63 ? 12   TYR A N     1 
ATOM   97   C  CA    . TYR A 1 12  ? 5.587   1.247   -8.902  1.00 43.38 ? 12   TYR A CA    1 
ATOM   98   C  C     . TYR A 1 12  ? 4.334   1.086   -9.749  1.00 43.78 ? 12   TYR A C     1 
ATOM   99   O  O     . TYR A 1 12  ? 4.404   1.159   -10.978 1.00 44.34 ? 12   TYR A O     1 
ATOM   100  C  CB    . TYR A 1 12  ? 6.012   -0.098  -8.368  1.00 42.90 ? 12   TYR A CB    1 
ATOM   101  C  CG    . TYR A 1 12  ? 7.347   -0.134  -7.689  1.00 42.11 ? 12   TYR A CG    1 
ATOM   102  C  CD1   . TYR A 1 12  ? 8.072   1.020   -7.428  1.00 40.84 ? 12   TYR A CD1   1 
ATOM   103  C  CD2   . TYR A 1 12  ? 7.869   -1.348  -7.259  1.00 41.96 ? 12   TYR A CD2   1 
ATOM   104  C  CE1   . TYR A 1 12  ? 9.273   0.954   -6.770  1.00 41.72 ? 12   TYR A CE1   1 
ATOM   105  C  CE2   . TYR A 1 12  ? 9.072   -1.423  -6.610  1.00 41.36 ? 12   TYR A CE2   1 
ATOM   106  C  CZ    . TYR A 1 12  ? 9.761   -0.275  -6.352  1.00 41.87 ? 12   TYR A CZ    1 
ATOM   107  O  OH    . TYR A 1 12  ? 10.953  -0.364  -5.699  1.00 42.66 ? 12   TYR A OH    1 
ATOM   108  N  N     . ALA A 1 13  ? 3.189   0.915   -9.096  1.00 43.74 ? 13   ALA A N     1 
ATOM   109  C  CA    . ALA A 1 13  ? 1.910   0.817   -9.803  1.00 43.78 ? 13   ALA A CA    1 
ATOM   110  C  C     . ALA A 1 13  ? 1.622   2.049   -10.661 1.00 43.77 ? 13   ALA A C     1 
ATOM   111  O  O     . ALA A 1 13  ? 1.177   1.908   -11.797 1.00 44.30 ? 13   ALA A O     1 
ATOM   112  C  CB    . ALA A 1 13  ? 0.764   0.586   -8.821  1.00 43.68 ? 13   ALA A CB    1 
ATOM   113  N  N     . GLN A 1 14  ? 1.865   3.249   -10.133 1.00 43.23 ? 14   GLN A N     1 
ATOM   114  C  CA    . GLN A 1 14  ? 1.620   4.452   -10.914 1.00 42.76 ? 14   GLN A CA    1 
ATOM   115  C  C     . GLN A 1 14  ? 2.507   4.519   -12.155 1.00 42.83 ? 14   GLN A C     1 
ATOM   116  O  O     . GLN A 1 14  ? 2.033   4.923   -13.216 1.00 43.27 ? 14   GLN A O     1 
ATOM   117  C  CB    . GLN A 1 14  ? 1.779   5.728   -10.082 1.00 42.78 ? 14   GLN A CB    1 
ATOM   118  C  CG    . GLN A 1 14  ? 1.328   6.968   -10.857 1.00 42.79 ? 14   GLN A CG    1 
ATOM   119  C  CD    . GLN A 1 14  ? 1.363   8.270   -10.072 1.00 43.09 ? 14   GLN A CD    1 
ATOM   120  O  OE1   . GLN A 1 14  ? 1.880   8.355   -8.943  1.00 43.11 ? 14   GLN A OE1   1 
ATOM   121  N  NE2   . GLN A 1 14  ? 0.810   9.307   -10.683 1.00 41.29 ? 14   GLN A NE2   1 
ATOM   122  N  N     . VAL A 1 15  ? 3.778   4.125   -12.056 1.00 42.89 ? 15   VAL A N     1 
ATOM   123  C  CA    . VAL A 1 15  ? 4.645   4.146   -13.238 1.00 42.94 ? 15   VAL A CA    1 
ATOM   124  C  C     . VAL A 1 15  ? 4.025   3.296   -14.329 1.00 43.60 ? 15   VAL A C     1 
ATOM   125  O  O     . VAL A 1 15  ? 3.896   3.738   -15.470 1.00 43.75 ? 15   VAL A O     1 
ATOM   126  C  CB    . VAL A 1 15  ? 6.050   3.616   -12.970 1.00 42.93 ? 15   VAL A CB    1 
ATOM   127  C  CG1   . VAL A 1 15  ? 6.792   3.423   -14.282 1.00 41.66 ? 15   VAL A CG1   1 
ATOM   128  C  CG2   . VAL A 1 15  ? 6.812   4.545   -12.071 1.00 42.51 ? 15   VAL A CG2   1 
ATOM   129  N  N     . GLU A 1 16  ? 3.617   2.086   -13.957 1.00 44.21 ? 16   GLU A N     1 
ATOM   130  C  CA    . GLU A 1 16  ? 2.967   1.162   -14.887 1.00 44.66 ? 16   GLU A CA    1 
ATOM   131  C  C     . GLU A 1 16  ? 1.693   1.755   -15.490 1.00 45.30 ? 16   GLU A C     1 
ATOM   132  O  O     . GLU A 1 16  ? 1.448   1.593   -16.692 1.00 45.85 ? 16   GLU A O     1 
ATOM   133  C  CB    . GLU A 1 16  ? 2.670   -0.174  -14.198 1.00 44.60 ? 16   GLU A CB    1 
ATOM   134  C  CG    . GLU A 1 16  ? 3.916   -0.928  -13.709 1.00 43.75 ? 16   GLU A CG    1 
ATOM   135  C  CD    . GLU A 1 16  ? 4.729   -1.572  -14.822 1.00 44.38 ? 16   GLU A CD    1 
ATOM   136  O  OE1   . GLU A 1 16  ? 4.315   -1.536  -15.995 1.00 44.46 ? 16   GLU A OE1   1 
ATOM   137  O  OE2   . GLU A 1 16  ? 5.790   -2.157  -14.523 1.00 46.10 ? 16   GLU A OE2   1 
ATOM   138  N  N     . GLU A 1 17  ? 0.892   2.451   -14.684 1.00 45.97 ? 17   GLU A N     1 
ATOM   139  C  CA    . GLU A 1 17  ? -0.268  3.203   -15.216 1.00 46.84 ? 17   GLU A CA    1 
ATOM   140  C  C     . GLU A 1 17  ? 0.144   4.299   -16.206 1.00 46.63 ? 17   GLU A C     1 
ATOM   141  O  O     . GLU A 1 17  ? -0.585  4.574   -17.144 1.00 47.12 ? 17   GLU A O     1 
ATOM   142  C  CB    . GLU A 1 17  ? -1.101  3.850   -14.098 1.00 46.75 ? 17   GLU A CB    1 
ATOM   143  C  CG    . GLU A 1 17  ? -1.880  2.857   -13.241 1.00 48.03 ? 17   GLU A CG    1 
ATOM   144  C  CD    . GLU A 1 17  ? -2.643  3.522   -12.087 1.00 48.82 ? 17   GLU A CD    1 
ATOM   145  O  OE1   . GLU A 1 17  ? -2.636  4.793   -11.966 1.00 49.89 ? 17   GLU A OE1   1 
ATOM   146  O  OE2   . GLU A 1 17  ? -3.236  2.754   -11.289 1.00 50.69 ? 17   GLU A OE2   1 
ATOM   147  N  N     . VAL A 1 18  ? 1.284   4.945   -15.993 1.00 46.16 ? 18   VAL A N     1 
ATOM   148  C  CA    . VAL A 1 18  ? 1.748   5.946   -16.954 1.00 46.05 ? 18   VAL A CA    1 
ATOM   149  C  C     . VAL A 1 18  ? 2.276   5.286   -18.224 1.00 45.93 ? 18   VAL A C     1 
ATOM   150  O  O     . VAL A 1 18  ? 2.041   5.765   -19.329 1.00 45.65 ? 18   VAL A O     1 
ATOM   151  C  CB    . VAL A 1 18  ? 2.848   6.852   -16.368 1.00 45.99 ? 18   VAL A CB    1 
ATOM   152  C  CG1   . VAL A 1 18  ? 3.603   7.522   -17.471 1.00 44.94 ? 18   VAL A CG1   1 
ATOM   153  C  CG2   . VAL A 1 18  ? 2.229   7.872   -15.446 1.00 45.98 ? 18   VAL A CG2   1 
ATOM   154  N  N     . LEU A 1 19  ? 3.010   4.196   -18.047 1.00 45.97 ? 19   LEU A N     1 
ATOM   155  C  CA    . LEU A 1 19  ? 3.511   3.417   -19.166 1.00 46.05 ? 19   LEU A CA    1 
ATOM   156  C  C     . LEU A 1 19  ? 2.385   2.719   -19.929 1.00 46.26 ? 19   LEU A C     1 
ATOM   157  O  O     . LEU A 1 19  ? 2.587   2.353   -21.080 1.00 46.98 ? 19   LEU A O     1 
ATOM   158  C  CB    . LEU A 1 19  ? 4.553   2.402   -18.692 1.00 46.07 ? 19   LEU A CB    1 
ATOM   159  C  CG    . LEU A 1 19  ? 6.030   2.826   -18.749 1.00 46.57 ? 19   LEU A CG    1 
ATOM   160  C  CD1   . LEU A 1 19  ? 6.255   4.250   -18.328 1.00 45.76 ? 19   LEU A CD1   1 
ATOM   161  C  CD2   . LEU A 1 19  ? 6.887   1.880   -17.923 1.00 45.83 ? 19   LEU A CD2   1 
ATOM   162  N  N     . ASN A 1 20  ? 1.206   2.564   -19.310 1.00 46.31 ? 20   ASN A N     1 
ATOM   163  C  CA    . ASN A 1 20  ? 0.048   1.876   -19.921 1.00 45.82 ? 20   ASN A CA    1 
ATOM   164  C  C     . ASN A 1 20  ? -1.293  2.456   -19.435 1.00 45.73 ? 20   ASN A C     1 
ATOM   165  O  O     . ASN A 1 20  ? -2.000  1.841   -18.643 1.00 45.96 ? 20   ASN A O     1 
ATOM   166  C  CB    . ASN A 1 20  ? 0.144   0.377   -19.585 1.00 45.77 ? 20   ASN A CB    1 
ATOM   167  C  CG    . ASN A 1 20  ? -0.951  -0.460  -20.229 1.00 44.69 ? 20   ASN A CG    1 
ATOM   168  O  OD1   . ASN A 1 20  ? -1.841  0.057   -20.887 1.00 46.10 ? 20   ASN A OD1   1 
ATOM   169  N  ND2   . ASN A 1 20  ? -0.889  -1.759  -20.024 1.00 42.28 ? 20   ASN A ND2   1 
ATOM   170  N  N     . PRO A 1 21  ? -1.649  3.651   -19.900 1.00 45.81 ? 21   PRO A N     1 
ATOM   171  C  CA    . PRO A 1 21  ? -2.845  4.359   -19.404 1.00 45.90 ? 21   PRO A CA    1 
ATOM   172  C  C     . PRO A 1 21  ? -4.183  3.595   -19.428 1.00 45.97 ? 21   PRO A C     1 
ATOM   173  O  O     . PRO A 1 21  ? -5.122  4.001   -18.729 1.00 45.80 ? 21   PRO A O     1 
ATOM   174  C  CB    . PRO A 1 21  ? -2.924  5.588   -20.315 1.00 45.67 ? 21   PRO A CB    1 
ATOM   175  C  CG    . PRO A 1 21  ? -1.532  5.831   -20.731 1.00 46.03 ? 21   PRO A CG    1 
ATOM   176  C  CD    . PRO A 1 21  ? -0.933  4.450   -20.909 1.00 46.22 ? 21   PRO A CD    1 
ATOM   177  N  N     . SER A 1 22  ? -4.287  2.519   -20.212 1.00 45.83 ? 22   SER A N     1 
ATOM   178  C  CA    . SER A 1 22  ? -5.473  1.663   -20.140 1.00 45.80 ? 22   SER A CA    1 
ATOM   179  C  C     . SER A 1 22  ? -5.652  1.065   -18.741 1.00 45.94 ? 22   SER A C     1 
ATOM   180  O  O     . SER A 1 22  ? -6.766  0.871   -18.293 1.00 45.88 ? 22   SER A O     1 
ATOM   181  C  CB    . SER A 1 22  ? -5.430  0.551   -21.196 1.00 45.83 ? 22   SER A CB    1 
ATOM   182  O  OG    . SER A 1 22  ? -4.520  -0.474  -20.856 1.00 45.30 ? 22   SER A OG    1 
ATOM   183  N  N     . LEU A 1 23  ? -4.552  0.791   -18.050 1.00 46.40 ? 23   LEU A N     1 
ATOM   184  C  CA    . LEU A 1 23  ? -4.610  0.334   -16.654 1.00 46.83 ? 23   LEU A CA    1 
ATOM   185  C  C     . LEU A 1 23  ? -5.344  1.297   -15.715 1.00 47.49 ? 23   LEU A C     1 
ATOM   186  O  O     . LEU A 1 23  ? -6.009  0.860   -14.777 1.00 47.69 ? 23   LEU A O     1 
ATOM   187  C  CB    . LEU A 1 23  ? -3.205  0.086   -16.117 1.00 46.47 ? 23   LEU A CB    1 
ATOM   188  C  CG    . LEU A 1 23  ? -2.638  -1.336  -16.244 1.00 46.63 ? 23   LEU A CG    1 
ATOM   189  C  CD1   . LEU A 1 23  ? -2.906  -2.003  -17.579 1.00 44.00 ? 23   LEU A CD1   1 
ATOM   190  C  CD2   . LEU A 1 23  ? -1.120  -1.297  -15.921 1.00 46.74 ? 23   LEU A CD2   1 
ATOM   191  N  N     . LYS A 1 24  ? -5.225  2.599   -15.978 1.00 48.28 ? 24   LYS A N     1 
ATOM   192  C  CA    . LYS A 1 24  ? -5.772  3.644   -15.098 1.00 48.81 ? 24   LYS A CA    1 
ATOM   193  C  C     . LYS A 1 24  ? -7.217  3.335   -14.734 1.00 48.76 ? 24   LYS A C     1 
ATOM   194  O  O     . LYS A 1 24  ? -7.991  2.909   -15.586 1.00 48.97 ? 24   LYS A O     1 
ATOM   195  C  CB    . LYS A 1 24  ? -5.678  5.019   -15.776 1.00 49.26 ? 24   LYS A CB    1 
ATOM   196  C  CG    . LYS A 1 24  ? -5.789  6.236   -14.862 1.00 50.15 ? 24   LYS A CG    1 
ATOM   197  C  CD    . LYS A 1 24  ? -4.555  6.381   -13.956 1.00 53.07 ? 24   LYS A CD    1 
ATOM   198  C  CE    . LYS A 1 24  ? -4.074  7.856   -13.795 1.00 53.58 ? 24   LYS A CE    1 
ATOM   199  N  NZ    . LYS A 1 24  ? -5.212  8.824   -13.698 1.00 52.15 ? 24   LYS A NZ    1 
ATOM   200  N  N     . GLY A 1 25  ? -7.559  3.533   -13.461 1.00 48.80 ? 25   GLY A N     1 
ATOM   201  C  CA    . GLY A 1 25  ? -8.918  3.309   -12.964 1.00 48.79 ? 25   GLY A CA    1 
ATOM   202  C  C     . GLY A 1 25  ? -9.286  1.870   -12.633 1.00 48.79 ? 25   GLY A C     1 
ATOM   203  O  O     . GLY A 1 25  ? -10.454 1.565   -12.458 1.00 49.06 ? 25   GLY A O     1 
ATOM   204  N  N     . LYS A 1 26  ? -8.303  0.987   -12.537 1.00 48.56 ? 26   LYS A N     1 
ATOM   205  C  CA    . LYS A 1 26  ? -8.564  -0.407  -12.212 1.00 48.93 ? 26   LYS A CA    1 
ATOM   206  C  C     . LYS A 1 26  ? -7.548  -0.928  -11.199 1.00 47.91 ? 26   LYS A C     1 
ATOM   207  O  O     . LYS A 1 26  ? -6.454  -0.364  -11.064 1.00 47.61 ? 26   LYS A O     1 
ATOM   208  C  CB    . LYS A 1 26  ? -8.453  -1.274  -13.464 1.00 49.34 ? 26   LYS A CB    1 
ATOM   209  C  CG    . LYS A 1 26  ? -9.327  -0.846  -14.645 1.00 51.06 ? 26   LYS A CG    1 
ATOM   210  C  CD    . LYS A 1 26  ? -9.270  -1.867  -15.811 1.00 50.88 ? 26   LYS A CD    1 
ATOM   211  C  CE    . LYS A 1 26  ? -7.877  -2.508  -15.995 1.00 52.81 ? 26   LYS A CE    1 
ATOM   212  N  NZ    . LYS A 1 26  ? -7.864  -3.516  -17.109 1.00 53.92 ? 26   LYS A NZ    1 
ATOM   213  N  N     . PRO A 1 27  ? -7.886  -2.033  -10.506 1.00 46.80 ? 27   PRO A N     1 
ATOM   214  C  CA    . PRO A 1 27  ? -6.939  -2.626  -9.561  1.00 46.17 ? 27   PRO A CA    1 
ATOM   215  C  C     . PRO A 1 27  ? -5.643  -3.011  -10.247 1.00 45.63 ? 27   PRO A C     1 
ATOM   216  O  O     . PRO A 1 27  ? -5.691  -3.653  -11.296 1.00 45.80 ? 27   PRO A O     1 
ATOM   217  C  CB    . PRO A 1 27  ? -7.668  -3.872  -9.072  1.00 46.12 ? 27   PRO A CB    1 
ATOM   218  C  CG    . PRO A 1 27  ? -9.092  -3.605  -9.335  1.00 46.25 ? 27   PRO A CG    1 
ATOM   219  C  CD    . PRO A 1 27  ? -9.148  -2.782  -10.554 1.00 46.26 ? 27   PRO A CD    1 
ATOM   220  N  N     . VAL A 1 28  ? -4.507  -2.596  -9.675  1.00 45.06 ? 28   VAL A N     1 
ATOM   221  C  CA    . VAL A 1 28  ? -3.175  -2.947  -10.189 1.00 44.63 ? 28   VAL A CA    1 
ATOM   222  C  C     . VAL A 1 28  ? -2.286  -3.335  -9.028  1.00 44.82 ? 28   VAL A C     1 
ATOM   223  O  O     . VAL A 1 28  ? -2.233  -2.623  -8.026  1.00 44.81 ? 28   VAL A O     1 
ATOM   224  C  CB    . VAL A 1 28  ? -2.507  -1.777  -10.950 1.00 44.68 ? 28   VAL A CB    1 
ATOM   225  C  CG1   . VAL A 1 28  ? -1.102  -2.174  -11.454 1.00 43.46 ? 28   VAL A CG1   1 
ATOM   226  C  CG2   . VAL A 1 28  ? -3.393  -1.311  -12.097 1.00 43.04 ? 28   VAL A CG2   1 
ATOM   227  N  N     . VAL A 1 29  ? -1.592  -4.461  -9.180  1.00 45.05 ? 29   VAL A N     1 
ATOM   228  C  CA    . VAL A 1 29  ? -0.765  -5.041  -8.129  1.00 45.17 ? 29   VAL A CA    1 
ATOM   229  C  C     . VAL A 1 29  ? 0.573   -5.419  -8.732  1.00 45.91 ? 29   VAL A C     1 
ATOM   230  O  O     . VAL A 1 29  ? 0.638   -6.286  -9.600  1.00 46.00 ? 29   VAL A O     1 
ATOM   231  C  CB    . VAL A 1 29  ? -1.389  -6.343  -7.538  1.00 45.19 ? 29   VAL A CB    1 
ATOM   232  C  CG1   . VAL A 1 29  ? -0.527  -6.893  -6.395  1.00 43.68 ? 29   VAL A CG1   1 
ATOM   233  C  CG2   . VAL A 1 29  ? -2.791  -6.104  -7.073  1.00 44.25 ? 29   VAL A CG2   1 
ATOM   234  N  N     . VAL A 1 30  ? 1.637   -4.780  -8.250  1.00 46.60 ? 30   VAL A N     1 
ATOM   235  C  CA    . VAL A 1 30  ? 3.005   -5.035  -8.701  1.00 46.38 ? 30   VAL A CA    1 
ATOM   236  C  C     . VAL A 1 30  ? 3.675   -6.057  -7.755  1.00 47.32 ? 30   VAL A C     1 
ATOM   237  O  O     . VAL A 1 30  ? 3.650   -5.902  -6.530  1.00 48.09 ? 30   VAL A O     1 
ATOM   238  C  CB    . VAL A 1 30  ? 3.750   -3.692  -8.780  1.00 46.33 ? 30   VAL A CB    1 
ATOM   239  C  CG1   . VAL A 1 30  ? 5.232   -3.872  -9.082  1.00 44.67 ? 30   VAL A CG1   1 
ATOM   240  C  CG2   . VAL A 1 30  ? 3.042   -2.786  -9.818  1.00 44.25 ? 30   VAL A CG2   1 
ATOM   241  N  N     . CYS A 1 31  ? 4.280   -7.089  -8.337  1.00 47.50 ? 31   CYS A N     1 
ATOM   242  C  CA    . CYS A 1 31  ? 4.614   -8.324  -7.636  1.00 47.65 ? 31   CYS A CA    1 
ATOM   243  C  C     . CYS A 1 31  ? 6.075   -8.696  -7.757  1.00 47.15 ? 31   CYS A C     1 
ATOM   244  O  O     . CYS A 1 31  ? 6.665   -8.560  -8.828  1.00 47.65 ? 31   CYS A O     1 
ATOM   245  C  CB    . CYS A 1 31  ? 3.886   -9.489  -8.291  1.00 47.56 ? 31   CYS A CB    1 
ATOM   246  S  SG    . CYS A 1 31  ? 2.155   -9.388  -8.272  1.00 50.56 ? 31   CYS A SG    1 
ATOM   247  N  N     . VAL A 1 32  ? 6.616   -9.257  -6.688  1.00 46.20 ? 32   VAL A N     1 
ATOM   248  C  CA    . VAL A 1 32  ? 7.928   -9.817  -6.707  1.00 45.91 ? 32   VAL A CA    1 
ATOM   249  C  C     . VAL A 1 32  ? 7.760   -11.316 -6.694  1.00 46.05 ? 32   VAL A C     1 
ATOM   250  O  O     . VAL A 1 32  ? 7.520   -11.901 -5.652  1.00 45.20 ? 32   VAL A O     1 
ATOM   251  C  CB    . VAL A 1 32  ? 8.721   -9.389  -5.472  1.00 46.06 ? 32   VAL A CB    1 
ATOM   252  C  CG1   . VAL A 1 32  ? 10.143  -9.897  -5.568  1.00 44.54 ? 32   VAL A CG1   1 
ATOM   253  C  CG2   . VAL A 1 32  ? 8.659   -7.889  -5.309  1.00 45.34 ? 32   VAL A CG2   1 
ATOM   254  N  N     . PHE A 1 33  ? 7.872   -11.924 -7.866  1.00 46.52 ? 33   PHE A N     1 
ATOM   255  C  CA    . PHE A 1 33  ? 7.685   -13.359 -8.015  1.00 46.78 ? 33   PHE A CA    1 
ATOM   256  C  C     . PHE A 1 33  ? 8.977   -14.056 -7.653  1.00 47.32 ? 33   PHE A C     1 
ATOM   257  O  O     . PHE A 1 33  ? 10.025  -13.735 -8.196  1.00 47.36 ? 33   PHE A O     1 
ATOM   258  C  CB    . PHE A 1 33  ? 7.310   -13.708 -9.453  1.00 46.75 ? 33   PHE A CB    1 
ATOM   259  C  CG    . PHE A 1 33  ? 5.935   -13.265 -9.850  1.00 46.74 ? 33   PHE A CG    1 
ATOM   260  C  CD1   . PHE A 1 33  ? 4.824   -14.043 -9.541  1.00 47.61 ? 33   PHE A CD1   1 
ATOM   261  C  CD2   . PHE A 1 33  ? 5.744   -12.093 -10.551 1.00 47.38 ? 33   PHE A CD2   1 
ATOM   262  C  CE1   . PHE A 1 33  ? 3.553   -13.652 -9.910  1.00 46.57 ? 33   PHE A CE1   1 
ATOM   263  C  CE2   . PHE A 1 33  ? 4.461   -11.693 -10.932 1.00 47.25 ? 33   PHE A CE2   1 
ATOM   264  C  CZ    . PHE A 1 33  ? 3.371   -12.476 -10.608 1.00 47.10 ? 33   PHE A CZ    1 
ATOM   265  N  N     . SER A 1 34  ? 8.894   -15.029 -6.754  1.00 47.84 ? 34   SER A N     1 
ATOM   266  C  CA    . SER A 1 34  ? 10.080  -15.661 -6.198  1.00 48.18 ? 34   SER A CA    1 
ATOM   267  C  C     . SER A 1 34  ? 10.651  -16.784 -7.066  1.00 48.31 ? 34   SER A C     1 
ATOM   268  O  O     . SER A 1 34  ? 11.799  -17.196 -6.863  1.00 48.57 ? 34   SER A O     1 
ATOM   269  C  CB    . SER A 1 34  ? 9.777   -16.197 -4.794  1.00 48.40 ? 34   SER A CB    1 
ATOM   270  O  OG    . SER A 1 34  ? 8.829   -17.250 -4.838  1.00 48.61 ? 34   SER A OG    1 
ATOM   271  N  N     . GLY A 1 35  ? 9.853   -17.288 -8.003  1.00 48.41 ? 35   GLY A N     1 
ATOM   272  C  CA    . GLY A 1 35  ? 10.267  -18.377 -8.888  1.00 48.50 ? 35   GLY A CA    1 
ATOM   273  C  C     . GLY A 1 35  ? 10.049  -19.764 -8.314  1.00 48.84 ? 35   GLY A C     1 
ATOM   274  O  O     . GLY A 1 35  ? 10.298  -20.777 -8.983  1.00 49.42 ? 35   GLY A O     1 
ATOM   275  N  N     . ARG A 1 36  ? 9.550   -19.824 -7.089  1.00 48.82 ? 36   ARG A N     1 
ATOM   276  C  CA    . ARG A 1 36  ? 9.558   -21.063 -6.330  1.00 48.91 ? 36   ARG A CA    1 
ATOM   277  C  C     . ARG A 1 36  ? 8.446   -22.019 -6.743  1.00 48.47 ? 36   ARG A C     1 
ATOM   278  O  O     . ARG A 1 36  ? 8.653   -23.219 -6.825  1.00 48.27 ? 36   ARG A O     1 
ATOM   279  C  CB    . ARG A 1 36  ? 9.427   -20.744 -4.845  1.00 49.29 ? 36   ARG A CB    1 
ATOM   280  C  CG    . ARG A 1 36  ? 10.401  -21.507 -4.025  1.00 51.07 ? 36   ARG A CG    1 
ATOM   281  C  CD    . ARG A 1 36  ? 9.857   -21.940 -2.685  1.00 52.91 ? 36   ARG A CD    1 
ATOM   282  N  NE    . ARG A 1 36  ? 10.940  -22.592 -1.943  1.00 53.34 ? 36   ARG A NE    1 
ATOM   283  C  CZ    . ARG A 1 36  ? 10.776  -23.341 -0.867  1.00 52.23 ? 36   ARG A CZ    1 
ATOM   284  N  NH1   . ARG A 1 36  ? 9.581   -23.554 -0.366  1.00 51.04 ? 36   ARG A NH1   1 
ATOM   285  N  NH2   . ARG A 1 36  ? 11.830  -23.870 -0.288  1.00 54.08 ? 36   ARG A NH2   1 
ATOM   286  N  N     . PHE A 1 37  ? 7.256   -21.465 -6.938  1.00 48.22 ? 37   PHE A N     1 
ATOM   287  C  CA    . PHE A 1 37  ? 6.138   -22.155 -7.555  1.00 48.20 ? 37   PHE A CA    1 
ATOM   288  C  C     . PHE A 1 37  ? 5.268   -21.075 -8.182  1.00 48.22 ? 37   PHE A C     1 
ATOM   289  O  O     . PHE A 1 37  ? 5.577   -19.889 -8.085  1.00 47.67 ? 37   PHE A O     1 
ATOM   290  C  CB    . PHE A 1 37  ? 5.345   -22.988 -6.527  1.00 48.18 ? 37   PHE A CB    1 
ATOM   291  C  CG    . PHE A 1 37  ? 4.845   -22.187 -5.349  1.00 48.57 ? 37   PHE A CG    1 
ATOM   292  C  CD1   . PHE A 1 37  ? 3.553   -21.682 -5.330  1.00 47.76 ? 37   PHE A CD1   1 
ATOM   293  C  CD2   . PHE A 1 37  ? 5.677   -21.924 -4.261  1.00 48.95 ? 37   PHE A CD2   1 
ATOM   294  C  CE1   . PHE A 1 37  ? 3.108   -20.943 -4.263  1.00 47.66 ? 37   PHE A CE1   1 
ATOM   295  C  CE2   . PHE A 1 37  ? 5.224   -21.172 -3.177  1.00 48.17 ? 37   PHE A CE2   1 
ATOM   296  C  CZ    . PHE A 1 37  ? 3.947   -20.686 -3.180  1.00 47.75 ? 37   PHE A CZ    1 
ATOM   297  N  N     . GLU A 1 38  ? 4.187   -21.490 -8.827  1.00 48.67 ? 38   GLU A N     1 
ATOM   298  C  CA    . GLU A 1 38  ? 3.274   -20.558 -9.468  1.00 49.51 ? 38   GLU A CA    1 
ATOM   299  C  C     . GLU A 1 38  ? 2.718   -19.530 -8.450  1.00 48.91 ? 38   GLU A C     1 
ATOM   300  O  O     . GLU A 1 38  ? 2.072   -19.902 -7.466  1.00 48.97 ? 38   GLU A O     1 
ATOM   301  C  CB    . GLU A 1 38  ? 2.145   -21.326 -10.170 1.00 49.39 ? 38   GLU A CB    1 
ATOM   302  C  CG    . GLU A 1 38  ? 1.415   -20.537 -11.279 1.00 50.98 ? 38   GLU A CG    1 
ATOM   303  C  CD    . GLU A 1 38  ? 0.364   -21.374 -12.024 1.00 52.12 ? 38   GLU A CD    1 
ATOM   304  O  OE1   . GLU A 1 38  ? -0.578  -20.776 -12.610 1.00 55.92 ? 38   GLU A OE1   1 
ATOM   305  O  OE2   . GLU A 1 38  ? 0.474   -22.635 -12.028 1.00 56.49 ? 38   GLU A OE2   1 
ATOM   306  N  N     . ASP A 1 39  ? 3.015   -18.251 -8.687  1.00 48.12 ? 39   ASP A N     1 
ATOM   307  C  CA    . ASP A 1 39  ? 2.563   -17.142 -7.830  1.00 47.93 ? 39   ASP A CA    1 
ATOM   308  C  C     . ASP A 1 39  ? 3.208   -17.066 -6.426  1.00 47.01 ? 39   ASP A C     1 
ATOM   309  O  O     . ASP A 1 39  ? 2.654   -16.438 -5.502  1.00 46.77 ? 39   ASP A O     1 
ATOM   310  C  CB    . ASP A 1 39  ? 1.025   -17.110 -7.732  1.00 48.05 ? 39   ASP A CB    1 
ATOM   311  C  CG    . ASP A 1 39  ? 0.359   -16.944 -9.091  1.00 49.56 ? 39   ASP A CG    1 
ATOM   312  O  OD1   . ASP A 1 39  ? 0.996   -16.339 -9.992  1.00 50.66 ? 39   ASP A OD1   1 
ATOM   313  O  OD2   . ASP A 1 39  ? -0.798  -17.421 -9.264  1.00 51.43 ? 39   ASP A OD2   1 
ATOM   314  N  N     . SER A 1 40  ? 4.380   -17.676 -6.277  1.00 45.87 ? 40   SER A N     1 
ATOM   315  C  CA    . SER A 1 40  ? 5.143   -17.566 -5.041  1.00 45.29 ? 40   SER A CA    1 
ATOM   316  C  C     . SER A 1 40  ? 5.789   -16.186 -4.958  1.00 45.07 ? 40   SER A C     1 
ATOM   317  O  O     . SER A 1 40  ? 6.323   -15.694 -5.945  1.00 45.47 ? 40   SER A O     1 
ATOM   318  C  CB    . SER A 1 40  ? 6.225   -18.619 -5.013  1.00 45.12 ? 40   SER A CB    1 
ATOM   319  O  OG    . SER A 1 40  ? 7.197   -18.335 -6.001  1.00 45.15 ? 40   SER A OG    1 
ATOM   320  N  N     . GLY A 1 41  ? 5.755   -15.569 -3.783  1.00 44.46 ? 41   GLY A N     1 
ATOM   321  C  CA    . GLY A 1 41  ? 6.373   -14.268 -3.591  1.00 43.81 ? 41   GLY A CA    1 
ATOM   322  C  C     . GLY A 1 41  ? 5.469   -13.332 -2.847  1.00 43.54 ? 41   GLY A C     1 
ATOM   323  O  O     . GLY A 1 41  ? 4.485   -13.760 -2.277  1.00 43.53 ? 41   GLY A O     1 
ATOM   324  N  N     . ALA A 1 42  ? 5.802   -12.042 -2.858  1.00 43.44 ? 42   ALA A N     1 
ATOM   325  C  CA    . ALA A 1 42  ? 4.991   -11.040 -2.178  1.00 43.03 ? 42   ALA A CA    1 
ATOM   326  C  C     . ALA A 1 42  ? 4.744   -9.839  -3.059  1.00 42.80 ? 42   ALA A C     1 
ATOM   327  O  O     . ALA A 1 42  ? 5.351   -9.700  -4.100  1.00 42.36 ? 42   ALA A O     1 
ATOM   328  C  CB    . ALA A 1 42  ? 5.661   -10.621 -0.919  1.00 43.36 ? 42   ALA A CB    1 
ATOM   329  N  N     . VAL A 1 43  ? 3.841   -8.969  -2.620  1.00 43.12 ? 43   VAL A N     1 
ATOM   330  C  CA    . VAL A 1 43  ? 3.459   -7.774  -3.385  1.00 43.00 ? 43   VAL A CA    1 
ATOM   331  C  C     . VAL A 1 43  ? 4.381   -6.613  -3.045  1.00 43.02 ? 43   VAL A C     1 
ATOM   332  O  O     . VAL A 1 43  ? 4.682   -6.408  -1.890  1.00 43.23 ? 43   VAL A O     1 
ATOM   333  C  CB    . VAL A 1 43  ? 2.005   -7.391  -3.088  1.00 42.62 ? 43   VAL A CB    1 
ATOM   334  C  CG1   . VAL A 1 43  ? 1.662   -6.067  -3.723  1.00 42.37 ? 43   VAL A CG1   1 
ATOM   335  C  CG2   . VAL A 1 43  ? 1.079   -8.485  -3.595  1.00 42.15 ? 43   VAL A CG2   1 
ATOM   336  N  N     . ALA A 1 44  ? 4.835   -5.864  -4.041  1.00 43.27 ? 44   ALA A N     1 
ATOM   337  C  CA    . ALA A 1 44  ? 5.700   -4.700  -3.793  1.00 43.81 ? 44   ALA A CA    1 
ATOM   338  C  C     . ALA A 1 44  ? 4.861   -3.489  -3.406  1.00 44.32 ? 44   ALA A C     1 
ATOM   339  O  O     . ALA A 1 44  ? 5.175   -2.766  -2.460  1.00 45.09 ? 44   ALA A O     1 
ATOM   340  C  CB    . ALA A 1 44  ? 6.544   -4.383  -5.012  1.00 43.63 ? 44   ALA A CB    1 
ATOM   341  N  N     . THR A 1 45  ? 3.799   -3.271  -4.166  1.00 44.29 ? 45   THR A N     1 
ATOM   342  C  CA    . THR A 1 45  ? 2.799   -2.286  -3.846  1.00 44.27 ? 45   THR A CA    1 
ATOM   343  C  C     . THR A 1 45  ? 1.543   -2.564  -4.701  1.00 43.90 ? 45   THR A C     1 
ATOM   344  O  O     . THR A 1 45  ? 1.504   -3.512  -5.488  1.00 43.84 ? 45   THR A O     1 
ATOM   345  C  CB    . THR A 1 45  ? 3.328   -0.869  -4.069  1.00 44.34 ? 45   THR A CB    1 
ATOM   346  O  OG1   . THR A 1 45  ? 2.340   0.087   -3.660  1.00 46.24 ? 45   THR A OG1   1 
ATOM   347  C  CG2   . THR A 1 45  ? 3.667   -0.660  -5.520  1.00 44.59 ? 45   THR A CG2   1 
ATOM   348  N  N     . ALA A 1 46  ? 0.503   -1.774  -4.498  1.00 43.49 ? 46   ALA A N     1 
ATOM   349  C  CA    . ALA A 1 46  ? -0.732  -1.894  -5.288  1.00 43.29 ? 46   ALA A CA    1 
ATOM   350  C  C     . ALA A 1 46  ? -1.415  -0.543  -5.282  1.00 42.75 ? 46   ALA A C     1 
ATOM   351  O  O     . ALA A 1 46  ? -1.165  0.268   -4.392  1.00 42.53 ? 46   ALA A O     1 
ATOM   352  C  CB    . ALA A 1 46  ? -1.663  -2.973  -4.715  1.00 43.29 ? 46   ALA A CB    1 
ATOM   353  N  N     . ASN A 1 47  ? -2.246  -0.277  -6.276  1.00 42.33 ? 47   ASN A N     1 
ATOM   354  C  CA    . ASN A 1 47  ? -2.839  1.040   -6.370  1.00 42.22 ? 47   ASN A CA    1 
ATOM   355  C  C     . ASN A 1 47  ? -4.069  1.117   -5.453  1.00 42.82 ? 47   ASN A C     1 
ATOM   356  O  O     . ASN A 1 47  ? -4.493  0.105   -4.871  1.00 42.29 ? 47   ASN A O     1 
ATOM   357  C  CB    . ASN A 1 47  ? -3.116  1.413   -7.824  1.00 41.96 ? 47   ASN A CB    1 
ATOM   358  C  CG    . ASN A 1 47  ? -4.217  0.594   -8.442  1.00 42.16 ? 47   ASN A CG    1 
ATOM   359  O  OD1   . ASN A 1 47  ? -4.911  -0.149  -7.746  1.00 43.21 ? 47   ASN A OD1   1 
ATOM   360  N  ND2   . ASN A 1 47  ? -4.392  0.721   -9.758  1.00 39.98 ? 47   ASN A ND2   1 
ATOM   361  N  N     . TYR A 1 48  ? -4.617  2.320   -5.296  1.00 43.42 ? 48   TYR A N     1 
ATOM   362  C  CA    . TYR A 1 48  ? -5.624  2.560   -4.261  1.00 43.72 ? 48   TYR A CA    1 
ATOM   363  C  C     . TYR A 1 48  ? -6.882  1.732   -4.508  1.00 44.58 ? 48   TYR A C     1 
ATOM   364  O  O     . TYR A 1 48  ? -7.506  1.243   -3.572  1.00 44.52 ? 48   TYR A O     1 
ATOM   365  C  CB    . TYR A 1 48  ? -5.870  4.077   -4.067  1.00 43.01 ? 48   TYR A CB    1 
ATOM   366  C  CG    . TYR A 1 48  ? -4.797  4.649   -3.148  1.00 42.76 ? 48   TYR A CG    1 
ATOM   367  C  CD1   . TYR A 1 48  ? -3.495  4.831   -3.596  1.00 42.89 ? 48   TYR A CD1   1 
ATOM   368  C  CD2   . TYR A 1 48  ? -5.061  4.896   -1.794  1.00 42.86 ? 48   TYR A CD2   1 
ATOM   369  C  CE1   . TYR A 1 48  ? -2.475  5.287   -2.725  1.00 42.96 ? 48   TYR A CE1   1 
ATOM   370  C  CE2   . TYR A 1 48  ? -4.068  5.367   -0.921  1.00 42.05 ? 48   TYR A CE2   1 
ATOM   371  C  CZ    . TYR A 1 48  ? -2.769  5.549   -1.386  1.00 42.63 ? 48   TYR A CZ    1 
ATOM   372  O  OH    . TYR A 1 48  ? -1.786  6.011   -0.525  1.00 40.88 ? 48   TYR A OH    1 
ATOM   373  N  N     . GLU A 1 49  ? -7.192  1.488   -5.771  1.00 45.72 ? 49   GLU A N     1 
ATOM   374  C  CA    . GLU A 1 49  ? -8.319  0.627   -6.125  1.00 46.85 ? 49   GLU A CA    1 
ATOM   375  C  C     . GLU A 1 49  ? -8.092  -0.774  -5.545  1.00 46.94 ? 49   GLU A C     1 
ATOM   376  O  O     . GLU A 1 49  ? -9.002  -1.364  -5.008  1.00 47.69 ? 49   GLU A O     1 
ATOM   377  C  CB    . GLU A 1 49  ? -8.513  0.567   -7.655  1.00 47.34 ? 49   GLU A CB    1 
ATOM   378  C  CG    . GLU A 1 49  ? -8.913  1.919   -8.342  1.00 50.17 ? 49   GLU A CG    1 
ATOM   379  C  CD    . GLU A 1 49  ? -7.787  3.005   -8.383  1.00 54.20 ? 49   GLU A CD    1 
ATOM   380  O  OE1   . GLU A 1 49  ? -6.574  2.666   -8.260  1.00 56.17 ? 49   GLU A OE1   1 
ATOM   381  O  OE2   . GLU A 1 49  ? -8.122  4.213   -8.520  1.00 56.68 ? 49   GLU A OE2   1 
ATOM   382  N  N     . ALA A 1 50  ? -6.871  -1.294  -5.633  1.00 47.02 ? 50   ALA A N     1 
ATOM   383  C  CA    . ALA A 1 50  ? -6.551  -2.595  -5.068  1.00 46.89 ? 50   ALA A CA    1 
ATOM   384  C  C     . ALA A 1 50  ? -6.554  -2.560  -3.546  1.00 47.08 ? 50   ALA A C     1 
ATOM   385  O  O     . ALA A 1 50  ? -6.942  -3.530  -2.909  1.00 47.48 ? 50   ALA A O     1 
ATOM   386  C  CB    . ALA A 1 50  ? -5.199  -3.096  -5.584  1.00 46.65 ? 50   ALA A CB    1 
ATOM   387  N  N     . ARG A 1 51  ? -6.124  -1.449  -2.955  1.00 47.52 ? 51   ARG A N     1 
ATOM   388  C  CA    . ARG A 1 51  ? -6.071  -1.352  -1.489  1.00 47.71 ? 51   ARG A CA    1 
ATOM   389  C  C     . ARG A 1 51  ? -7.460  -1.372  -0.838  1.00 47.97 ? 51   ARG A C     1 
ATOM   390  O  O     . ARG A 1 51  ? -7.625  -1.862  0.278   1.00 47.57 ? 51   ARG A O     1 
ATOM   391  C  CB    . ARG A 1 51  ? -5.266  -0.131  -1.049  1.00 47.71 ? 51   ARG A CB    1 
ATOM   392  C  CG    . ARG A 1 51  ? -3.776  -0.337  -1.212  1.00 47.63 ? 51   ARG A CG    1 
ATOM   393  C  CD    . ARG A 1 51  ? -2.969  0.897   -0.829  1.00 47.96 ? 51   ARG A CD    1 
ATOM   394  N  NE    . ARG A 1 51  ? -1.804  1.038   -1.702  1.00 47.64 ? 51   ARG A NE    1 
ATOM   395  C  CZ    . ARG A 1 51  ? -0.883  1.987   -1.597  1.00 48.02 ? 51   ARG A CZ    1 
ATOM   396  N  NH1   . ARG A 1 51  ? -0.943  2.890   -0.635  1.00 49.13 ? 51   ARG A NH1   1 
ATOM   397  N  NH2   . ARG A 1 51  ? 0.123   2.024   -2.461  1.00 49.36 ? 51   ARG A NH2   1 
ATOM   398  N  N     . LYS A 1 52  ? -8.466  -0.901  -1.563  1.00 48.44 ? 52   LYS A N     1 
ATOM   399  C  CA    . LYS A 1 52  ? -9.835  -1.008  -1.078  1.00 48.75 ? 52   LYS A CA    1 
ATOM   400  C  C     . LYS A 1 52  ? -10.119 -2.465  -0.748  1.00 48.62 ? 52   LYS A C     1 
ATOM   401  O  O     . LYS A 1 52  ? -10.933 -2.728  0.118   1.00 49.33 ? 52   LYS A O     1 
ATOM   402  C  CB    . LYS A 1 52  ? -10.873 -0.480  -2.090  1.00 48.71 ? 52   LYS A CB    1 
ATOM   403  C  CG    . LYS A 1 52  ? -10.540 0.874   -2.732  1.00 50.22 ? 52   LYS A CG    1 
ATOM   404  C  CD    . LYS A 1 52  ? -11.307 2.076   -2.194  1.00 52.75 ? 52   LYS A CD    1 
ATOM   405  C  CE    . LYS A 1 52  ? -12.368 2.582   -3.186  1.00 55.19 ? 52   LYS A CE    1 
ATOM   406  N  NZ    . LYS A 1 52  ? -11.890 2.633   -4.626  1.00 56.79 ? 52   LYS A NZ    1 
ATOM   407  N  N     . PHE A 1 53  ? -9.447  -3.412  -1.405  1.00 48.28 ? 53   PHE A N     1 
ATOM   408  C  CA    . PHE A 1 53  ? -9.766  -4.841  -1.197  1.00 48.12 ? 53   PHE A CA    1 
ATOM   409  C  C     . PHE A 1 53  ? -8.789  -5.593  -0.296  1.00 48.19 ? 53   PHE A C     1 
ATOM   410  O  O     . PHE A 1 53  ? -8.873  -6.816  -0.171  1.00 48.09 ? 53   PHE A O     1 
ATOM   411  C  CB    . PHE A 1 53  ? -9.873  -5.576  -2.536  1.00 47.73 ? 53   PHE A CB    1 
ATOM   412  C  CG    . PHE A 1 53  ? -11.057 -5.170  -3.352  1.00 46.79 ? 53   PHE A CG    1 
ATOM   413  C  CD1   . PHE A 1 53  ? -12.269 -5.808  -3.196  1.00 46.12 ? 53   PHE A CD1   1 
ATOM   414  C  CD2   . PHE A 1 53  ? -10.953 -4.150  -4.283  1.00 46.52 ? 53   PHE A CD2   1 
ATOM   415  C  CE1   . PHE A 1 53  ? -13.369 -5.444  -3.958  1.00 46.21 ? 53   PHE A CE1   1 
ATOM   416  C  CE2   . PHE A 1 53  ? -12.042 -3.769  -5.044  1.00 46.57 ? 53   PHE A CE2   1 
ATOM   417  C  CZ    . PHE A 1 53  ? -13.256 -4.416  -4.886  1.00 46.57 ? 53   PHE A CZ    1 
ATOM   418  N  N     . GLY A 1 54  ? -7.887  -4.870  0.350   1.00 48.21 ? 54   GLY A N     1 
ATOM   419  C  CA    . GLY A 1 54  ? -6.986  -5.484  1.302   1.00 48.38 ? 54   GLY A CA    1 
ATOM   420  C  C     . GLY A 1 54  ? -5.648  -5.864  0.705   1.00 48.79 ? 54   GLY A C     1 
ATOM   421  O  O     . GLY A 1 54  ? -4.786  -6.375  1.414   1.00 48.89 ? 54   GLY A O     1 
ATOM   422  N  N     . VAL A 1 55  ? -5.452  -5.605  -0.586  1.00 49.16 ? 55   VAL A N     1 
ATOM   423  C  CA    . VAL A 1 55  ? -4.184  -5.917  -1.227  1.00 49.66 ? 55   VAL A CA    1 
ATOM   424  C  C     . VAL A 1 55  ? -3.212  -4.766  -1.025  1.00 50.24 ? 55   VAL A C     1 
ATOM   425  O  O     . VAL A 1 55  ? -3.494  -3.639  -1.436  1.00 51.20 ? 55   VAL A O     1 
ATOM   426  C  CB    . VAL A 1 55  ? -4.353  -6.174  -2.724  1.00 49.62 ? 55   VAL A CB    1 
ATOM   427  C  CG1   . VAL A 1 55  ? -2.985  -6.482  -3.367  1.00 48.75 ? 55   VAL A CG1   1 
ATOM   428  C  CG2   . VAL A 1 55  ? -5.341  -7.320  -2.944  1.00 49.80 ? 55   VAL A CG2   1 
ATOM   429  N  N     . LYS A 1 56  ? -2.073  -5.038  -0.391  1.00 50.12 ? 56   LYS A N     1 
ATOM   430  C  CA    . LYS A 1 56  ? -1.098  -3.981  -0.108  1.00 50.08 ? 56   LYS A CA    1 
ATOM   431  C  C     . LYS A 1 56  ? 0.345   -4.510  0.017   1.00 49.04 ? 56   LYS A C     1 
ATOM   432  O  O     . LYS A 1 56  ? 0.574   -5.709  0.137   1.00 48.85 ? 56   LYS A O     1 
ATOM   433  C  CB    . LYS A 1 56  ? -1.525  -3.217  1.157   1.00 50.78 ? 56   LYS A CB    1 
ATOM   434  C  CG    . LYS A 1 56  ? -1.304  -3.973  2.486   1.00 52.25 ? 56   LYS A CG    1 
ATOM   435  C  CD    . LYS A 1 56  ? -2.414  -3.652  3.497   1.00 55.05 ? 56   LYS A CD    1 
ATOM   436  C  CE    . LYS A 1 56  ? -2.027  -4.002  4.953   1.00 56.33 ? 56   LYS A CE    1 
ATOM   437  N  NZ    . LYS A 1 56  ? -1.337  -5.337  5.110   1.00 57.80 ? 56   LYS A NZ    1 
ATOM   438  N  N     . ALA A 1 57  ? 1.307   -3.599  -0.014  1.00 48.41 ? 57   ALA A N     1 
ATOM   439  C  CA    . ALA A 1 57  ? 2.716   -3.968  0.027   1.00 48.04 ? 57   ALA A CA    1 
ATOM   440  C  C     . ALA A 1 57  ? 2.939   -4.978  1.134   1.00 47.54 ? 57   ALA A C     1 
ATOM   441  O  O     . ALA A 1 57  ? 2.474   -4.792  2.246   1.00 48.49 ? 57   ALA A O     1 
ATOM   442  C  CB    . ALA A 1 57  ? 3.581   -2.754  0.254   1.00 47.22 ? 57   ALA A CB    1 
ATOM   443  N  N     . GLY A 1 58  ? 3.600   -6.071  0.818   1.00 46.78 ? 58   GLY A N     1 
ATOM   444  C  CA    . GLY A 1 58  ? 4.040   -6.971  1.843   1.00 46.97 ? 58   GLY A CA    1 
ATOM   445  C  C     . GLY A 1 58  ? 3.330   -8.298  1.864   1.00 47.19 ? 58   GLY A C     1 
ATOM   446  O  O     . GLY A 1 58  ? 3.943   -9.312  2.184   1.00 47.03 ? 58   GLY A O     1 
ATOM   447  N  N     . ILE A 1 59  ? 2.039   -8.313  1.541   1.00 47.36 ? 59   ILE A N     1 
ATOM   448  C  CA    . ILE A 1 59  ? 1.290   -9.557  1.632   1.00 47.33 ? 59   ILE A CA    1 
ATOM   449  C  C     . ILE A 1 59  ? 1.716   -10.568 0.551   1.00 46.73 ? 59   ILE A C     1 
ATOM   450  O  O     . ILE A 1 59  ? 2.326   -10.198 -0.448  1.00 46.92 ? 59   ILE A O     1 
ATOM   451  C  CB    . ILE A 1 59  ? -0.222  -9.299  1.575   1.00 48.04 ? 59   ILE A CB    1 
ATOM   452  C  CG1   . ILE A 1 59  ? -0.645  -8.750  0.206   1.00 48.27 ? 59   ILE A CG1   1 
ATOM   453  C  CG2   . ILE A 1 59  ? -0.641  -8.341  2.711   1.00 48.08 ? 59   ILE A CG2   1 
ATOM   454  C  CD1   . ILE A 1 59  ? -2.110  -9.033  -0.080  1.00 49.11 ? 59   ILE A CD1   1 
ATOM   455  N  N     . PRO A 1 60  ? 1.418   -11.851 0.756   1.00 45.95 ? 60   PRO A N     1 
ATOM   456  C  CA    . PRO A 1 60  ? 1.731   -12.842 -0.267  1.00 45.60 ? 60   PRO A CA    1 
ATOM   457  C  C     . PRO A 1 60  ? 0.866   -12.739 -1.534  1.00 45.55 ? 60   PRO A C     1 
ATOM   458  O  O     . PRO A 1 60  ? -0.340  -12.525 -1.461  1.00 45.72 ? 60   PRO A O     1 
ATOM   459  C  CB    . PRO A 1 60  ? 1.471   -14.177 0.439   1.00 45.55 ? 60   PRO A CB    1 
ATOM   460  C  CG    . PRO A 1 60  ? 1.312   -13.855 1.870   1.00 46.08 ? 60   PRO A CG    1 
ATOM   461  C  CD    . PRO A 1 60  ? 0.812   -12.464 1.941   1.00 45.98 ? 60   PRO A CD    1 
ATOM   462  N  N     . ILE A 1 61  ? 1.490   -12.927 -2.692  1.00 45.34 ? 61   ILE A N     1 
ATOM   463  C  CA    . ILE A 1 61  ? 0.779   -12.933 -3.965  1.00 44.79 ? 61   ILE A CA    1 
ATOM   464  C  C     . ILE A 1 61  ? -0.419  -13.890 -3.930  1.00 45.49 ? 61   ILE A C     1 
ATOM   465  O  O     . ILE A 1 61  ? -1.462  -13.571 -4.486  1.00 46.19 ? 61   ILE A O     1 
ATOM   466  C  CB    . ILE A 1 61  ? 1.733   -13.306 -5.119  1.00 44.70 ? 61   ILE A CB    1 
ATOM   467  C  CG1   . ILE A 1 61  ? 2.864   -12.271 -5.239  1.00 44.09 ? 61   ILE A CG1   1 
ATOM   468  C  CG2   . ILE A 1 61  ? 0.989   -13.429 -6.415  1.00 43.58 ? 61   ILE A CG2   1 
ATOM   469  C  CD1   . ILE A 1 61  ? 3.916   -12.609 -6.242  1.00 43.91 ? 61   ILE A CD1   1 
ATOM   470  N  N     . VAL A 1 62  ? -0.302  -15.045 -3.277  1.00 45.77 ? 62   VAL A N     1 
ATOM   471  C  CA    . VAL A 1 62  ? -1.451  -15.953 -3.209  1.00 46.21 ? 62   VAL A CA    1 
ATOM   472  C  C     . VAL A 1 62  ? -2.582  -15.385 -2.320  1.00 47.14 ? 62   VAL A C     1 
ATOM   473  O  O     . VAL A 1 62  ? -3.744  -15.653 -2.577  1.00 47.05 ? 62   VAL A O     1 
ATOM   474  C  CB    . VAL A 1 62  ? -1.093  -17.438 -2.781  1.00 46.08 ? 62   VAL A CB    1 
ATOM   475  C  CG1   . VAL A 1 62  ? -0.142  -18.102 -3.780  1.00 44.62 ? 62   VAL A CG1   1 
ATOM   476  C  CG2   . VAL A 1 62  ? -0.534  -17.492 -1.378  1.00 45.79 ? 62   VAL A CG2   1 
ATOM   477  N  N     . GLU A 1 63  ? -2.253  -14.612 -1.285  1.00 48.17 ? 63   GLU A N     1 
ATOM   478  C  CA    . GLU A 1 63  ? -3.292  -13.910 -0.504  1.00 49.32 ? 63   GLU A CA    1 
ATOM   479  C  C     . GLU A 1 63  ? -3.982  -12.858 -1.374  1.00 48.15 ? 63   GLU A C     1 
ATOM   480  O  O     . GLU A 1 63  ? -5.204  -12.708 -1.314  1.00 48.36 ? 63   GLU A O     1 
ATOM   481  C  CB    . GLU A 1 63  ? -2.725  -13.250 0.777   1.00 49.37 ? 63   GLU A CB    1 
ATOM   482  C  CG    . GLU A 1 63  ? -3.073  -13.960 2.114   1.00 51.86 ? 63   GLU A CG    1 
ATOM   483  C  CD    . GLU A 1 63  ? -1.982  -13.784 3.236   1.00 53.65 ? 63   GLU A CD    1 
ATOM   484  O  OE1   . GLU A 1 63  ? -1.376  -14.820 3.666   1.00 56.47 ? 63   GLU A OE1   1 
ATOM   485  O  OE2   . GLU A 1 63  ? -1.734  -12.613 3.680   1.00 59.19 ? 63   GLU A OE2   1 
ATOM   486  N  N     . ALA A 1 64  ? -3.204  -12.136 -2.174  1.00 47.07 ? 64   ALA A N     1 
ATOM   487  C  CA    . ALA A 1 64  ? -3.769  -11.137 -3.070  1.00 46.64 ? 64   ALA A CA    1 
ATOM   488  C  C     . ALA A 1 64  ? -4.770  -11.770 -4.035  1.00 46.35 ? 64   ALA A C     1 
ATOM   489  O  O     . ALA A 1 64  ? -5.932  -11.339 -4.111  1.00 45.39 ? 64   ALA A O     1 
ATOM   490  C  CB    . ALA A 1 64  ? -2.679  -10.429 -3.843  1.00 46.49 ? 64   ALA A CB    1 
ATOM   491  N  N     . LYS A 1 65  ? -4.323  -12.799 -4.756  1.00 45.87 ? 65   LYS A N     1 
ATOM   492  C  CA    . LYS A 1 65  ? -5.156  -13.401 -5.790  1.00 46.11 ? 65   LYS A CA    1 
ATOM   493  C  C     . LYS A 1 65  ? -6.409  -14.046 -5.197  1.00 46.24 ? 65   LYS A C     1 
ATOM   494  O  O     . LYS A 1 65  ? -7.460  -14.083 -5.843  1.00 46.00 ? 65   LYS A O     1 
ATOM   495  C  CB    . LYS A 1 65  ? -4.375  -14.408 -6.633  1.00 46.18 ? 65   LYS A CB    1 
ATOM   496  C  CG    . LYS A 1 65  ? -3.345  -13.789 -7.582  1.00 46.57 ? 65   LYS A CG    1 
ATOM   497  C  CD    . LYS A 1 65  ? -3.097  -14.705 -8.781  1.00 47.20 ? 65   LYS A CD    1 
ATOM   498  C  CE    . LYS A 1 65  ? -1.783  -14.440 -9.489  1.00 47.08 ? 65   LYS A CE    1 
ATOM   499  N  NZ    . LYS A 1 65  ? -1.804  -13.157 -10.198 1.00 48.25 ? 65   LYS A NZ    1 
ATOM   500  N  N     . LYS A 1 66  ? -6.300  -14.522 -3.960  1.00 46.72 ? 66   LYS A N     1 
ATOM   501  C  CA    . LYS A 1 66  ? -7.441  -15.068 -3.229  1.00 47.47 ? 66   LYS A CA    1 
ATOM   502  C  C     . LYS A 1 66  ? -8.543  -14.011 -3.014  1.00 47.37 ? 66   LYS A C     1 
ATOM   503  O  O     . LYS A 1 66  ? -9.698  -14.259 -3.313  1.00 47.04 ? 66   LYS A O     1 
ATOM   504  C  CB    . LYS A 1 66  ? -6.988  -15.677 -1.892  1.00 47.55 ? 66   LYS A CB    1 
ATOM   505  C  CG    . LYS A 1 66  ? -8.137  -16.173 -1.005  1.00 48.74 ? 66   LYS A CG    1 
ATOM   506  C  CD    . LYS A 1 66  ? -7.652  -16.920 0.237   1.00 48.98 ? 66   LYS A CD    1 
ATOM   507  C  CE    . LYS A 1 66  ? -8.844  -17.466 1.049   1.00 50.26 ? 66   LYS A CE    1 
ATOM   508  N  NZ    . LYS A 1 66  ? -9.612  -18.573 0.354   1.00 51.63 ? 66   LYS A NZ    1 
ATOM   509  N  N     . ILE A 1 67  ? -8.175  -12.831 -2.533  1.00 47.97 ? 67   ILE A N     1 
ATOM   510  C  CA    . ILE A 1 67  ? -9.152  -11.767 -2.279  1.00 48.42 ? 67   ILE A CA    1 
ATOM   511  C  C     . ILE A 1 67  ? -9.430  -10.830 -3.478  1.00 49.00 ? 67   ILE A C     1 
ATOM   512  O  O     . ILE A 1 67  ? -10.456 -10.167 -3.502  1.00 49.47 ? 67   ILE A O     1 
ATOM   513  C  CB    . ILE A 1 67  ? -8.774  -10.949 -0.998  1.00 48.35 ? 67   ILE A CB    1 
ATOM   514  C  CG1   . ILE A 1 67  ? -7.651  -9.953  -1.252  1.00 47.87 ? 67   ILE A CG1   1 
ATOM   515  C  CG2   . ILE A 1 67  ? -8.373  -11.898 0.136   1.00 49.02 ? 67   ILE A CG2   1 
ATOM   516  C  CD1   . ILE A 1 67  ? -7.039  -9.398  0.015   1.00 48.10 ? 67   ILE A CD1   1 
ATOM   517  N  N     . LEU A 1 68  ? -8.537  -10.782 -4.467  1.00 49.63 ? 68   LEU A N     1 
ATOM   518  C  CA    . LEU A 1 68  ? -8.724  -9.921  -5.645  1.00 50.02 ? 68   LEU A CA    1 
ATOM   519  C  C     . LEU A 1 68  ? -8.213  -10.656 -6.897  1.00 50.37 ? 68   LEU A C     1 
ATOM   520  O  O     . LEU A 1 68  ? -7.157  -10.309 -7.438  1.00 50.28 ? 68   LEU A O     1 
ATOM   521  C  CB    . LEU A 1 68  ? -7.968  -8.596  -5.462  1.00 49.85 ? 68   LEU A CB    1 
ATOM   522  C  CG    . LEU A 1 68  ? -8.621  -7.237  -5.790  1.00 50.60 ? 68   LEU A CG    1 
ATOM   523  C  CD1   . LEU A 1 68  ? -7.669  -6.382  -6.596  1.00 50.07 ? 68   LEU A CD1   1 
ATOM   524  C  CD2   . LEU A 1 68  ? -9.972  -7.317  -6.491  1.00 49.90 ? 68   LEU A CD2   1 
ATOM   525  N  N     . PRO A 1 69  ? -8.963  -11.682 -7.363  1.00 50.75 ? 69   PRO A N     1 
ATOM   526  C  CA    . PRO A 1 69  ? -8.591  -12.540 -8.506  1.00 50.57 ? 69   PRO A CA    1 
ATOM   527  C  C     . PRO A 1 69  ? -8.415  -11.790 -9.817  1.00 50.73 ? 69   PRO A C     1 
ATOM   528  O  O     . PRO A 1 69  ? -7.464  -12.054 -10.555 1.00 50.58 ? 69   PRO A O     1 
ATOM   529  C  CB    . PRO A 1 69  ? -9.796  -13.475 -8.647  1.00 50.52 ? 69   PRO A CB    1 
ATOM   530  C  CG    . PRO A 1 69  ? -10.432 -13.466 -7.341  1.00 50.73 ? 69   PRO A CG    1 
ATOM   531  C  CD    . PRO A 1 69  ? -10.271 -12.081 -6.818  1.00 50.83 ? 69   PRO A CD    1 
ATOM   532  N  N     . ASN A 1 70  ? -9.332  -10.855 -10.083 1.00 50.84 ? 70   ASN A N     1 
ATOM   533  C  CA    . ASN A 1 70  ? -9.440  -10.201 -11.389 1.00 50.80 ? 70   ASN A CA    1 
ATOM   534  C  C     . ASN A 1 70  ? -8.613  -8.930  -11.557 1.00 50.24 ? 70   ASN A C     1 
ATOM   535  O  O     . ASN A 1 70  ? -8.731  -8.262  -12.579 1.00 50.58 ? 70   ASN A O     1 
ATOM   536  C  CB    . ASN A 1 70  ? -10.912 -9.917  -11.724 1.00 50.79 ? 70   ASN A CB    1 
ATOM   537  C  CG    . ASN A 1 70  ? -11.567 -11.049 -12.497 1.00 52.61 ? 70   ASN A CG    1 
ATOM   538  O  OD1   . ASN A 1 70  ? -11.103 -12.204 -12.489 1.00 54.14 ? 70   ASN A OD1   1 
ATOM   539  N  ND2   . ASN A 1 70  ? -12.665 -10.723 -13.175 1.00 55.11 ? 70   ASN A ND2   1 
ATOM   540  N  N     . ALA A 1 71  ? -7.770  -8.595  -10.590 1.00 49.34 ? 71   ALA A N     1 
ATOM   541  C  CA    . ALA A 1 71  ? -6.901  -7.436  -10.746 1.00 48.90 ? 71   ALA A CA    1 
ATOM   542  C  C     . ALA A 1 71  ? -5.841  -7.719  -11.809 1.00 48.54 ? 71   ALA A C     1 
ATOM   543  O  O     . ALA A 1 71  ? -5.608  -8.867  -12.166 1.00 48.87 ? 71   ALA A O     1 
ATOM   544  C  CB    . ALA A 1 71  ? -6.246  -7.093  -9.423  1.00 48.70 ? 71   ALA A CB    1 
ATOM   545  N  N     . VAL A 1 72  ? -5.186  -6.680  -12.309 1.00 48.38 ? 72   VAL A N     1 
ATOM   546  C  CA    . VAL A 1 72  ? -4.010  -6.875  -13.178 1.00 48.16 ? 72   VAL A CA    1 
ATOM   547  C  C     . VAL A 1 72  ? -2.740  -7.060  -12.324 1.00 48.03 ? 72   VAL A C     1 
ATOM   548  O  O     . VAL A 1 72  ? -2.394  -6.214  -11.505 1.00 48.66 ? 72   VAL A O     1 
ATOM   549  C  CB    . VAL A 1 72  ? -3.816  -5.711  -14.191 1.00 48.15 ? 72   VAL A CB    1 
ATOM   550  C  CG1   . VAL A 1 72  ? -2.719  -6.056  -15.167 1.00 47.34 ? 72   VAL A CG1   1 
ATOM   551  C  CG2   . VAL A 1 72  ? -5.136  -5.403  -14.955 1.00 47.79 ? 72   VAL A CG2   1 
ATOM   552  N  N     . TYR A 1 73  ? -2.061  -8.186  -12.502 1.00 47.68 ? 73   TYR A N     1 
ATOM   553  C  CA    . TYR A 1 73  ? -0.868  -8.484  -11.744 1.00 47.13 ? 73   TYR A CA    1 
ATOM   554  C  C     . TYR A 1 73  ? 0.320   -8.401  -12.688 1.00 47.35 ? 73   TYR A C     1 
ATOM   555  O  O     . TYR A 1 73  ? 0.404   -9.151  -13.662 1.00 47.42 ? 73   TYR A O     1 
ATOM   556  C  CB    . TYR A 1 73  ? -0.966  -9.864  -11.097 1.00 46.65 ? 73   TYR A CB    1 
ATOM   557  C  CG    . TYR A 1 73  ? -1.976  -9.945  -9.967  1.00 46.35 ? 73   TYR A CG    1 
ATOM   558  C  CD1   . TYR A 1 73  ? -1.587  -9.823  -8.646  1.00 45.72 ? 73   TYR A CD1   1 
ATOM   559  C  CD2   . TYR A 1 73  ? -3.321  -10.132 -10.228 1.00 46.24 ? 73   TYR A CD2   1 
ATOM   560  C  CE1   . TYR A 1 73  ? -2.506  -9.897  -7.616  1.00 45.05 ? 73   TYR A CE1   1 
ATOM   561  C  CE2   . TYR A 1 73  ? -4.246  -10.195 -9.210  1.00 45.86 ? 73   TYR A CE2   1 
ATOM   562  C  CZ    . TYR A 1 73  ? -3.836  -10.079 -7.904  1.00 46.00 ? 73   TYR A CZ    1 
ATOM   563  O  OH    . TYR A 1 73  ? -4.775  -10.160 -6.889  1.00 45.98 ? 73   TYR A OH    1 
ATOM   564  N  N     . LEU A 1 74  ? 1.224   -7.470  -12.385 1.00 47.48 ? 74   LEU A N     1 
ATOM   565  C  CA    . LEU A 1 74  ? 2.419   -7.208  -13.172 1.00 47.44 ? 74   LEU A CA    1 
ATOM   566  C  C     . LEU A 1 74  ? 3.647   -7.542  -12.350 1.00 47.47 ? 74   LEU A C     1 
ATOM   567  O  O     . LEU A 1 74  ? 3.610   -7.417  -11.136 1.00 47.89 ? 74   LEU A O     1 
ATOM   568  C  CB    . LEU A 1 74  ? 2.457   -5.730  -13.520 1.00 47.52 ? 74   LEU A CB    1 
ATOM   569  C  CG    . LEU A 1 74  ? 1.260   -5.253  -14.338 1.00 47.63 ? 74   LEU A CG    1 
ATOM   570  C  CD1   . LEU A 1 74  ? 1.168   -3.702  -14.327 1.00 46.99 ? 74   LEU A CD1   1 
ATOM   571  C  CD2   . LEU A 1 74  ? 1.384   -5.821  -15.738 1.00 45.52 ? 74   LEU A CD2   1 
ATOM   572  N  N     . PRO A 1 75  ? 4.737   -7.985  -12.997 1.00 47.53 ? 75   PRO A N     1 
ATOM   573  C  CA    . PRO A 1 75  ? 5.973   -8.198  -12.250 1.00 47.78 ? 75   PRO A CA    1 
ATOM   574  C  C     . PRO A 1 75  ? 6.736   -6.903  -12.042 1.00 48.42 ? 75   PRO A C     1 
ATOM   575  O  O     . PRO A 1 75  ? 6.543   -5.932  -12.777 1.00 47.93 ? 75   PRO A O     1 
ATOM   576  C  CB    . PRO A 1 75  ? 6.771   -9.146  -13.144 1.00 47.61 ? 75   PRO A CB    1 
ATOM   577  C  CG    . PRO A 1 75  ? 6.311   -8.846  -14.513 1.00 47.24 ? 75   PRO A CG    1 
ATOM   578  C  CD    . PRO A 1 75  ? 4.890   -8.337  -14.419 1.00 47.35 ? 75   PRO A CD    1 
ATOM   579  N  N     . MET A 1 76  ? 7.607   -6.913  -11.039 1.00 49.16 ? 76   MET A N     1 
ATOM   580  C  CA    . MET A 1 76  ? 8.328   -5.738  -10.636 1.00 49.73 ? 76   MET A CA    1 
ATOM   581  C  C     . MET A 1 76  ? 9.545   -5.572  -11.548 1.00 50.23 ? 76   MET A C     1 
ATOM   582  O  O     . MET A 1 76  ? 10.340  -6.505  -11.712 1.00 50.02 ? 76   MET A O     1 
ATOM   583  C  CB    . MET A 1 76  ? 8.759   -5.897  -9.181  1.00 49.81 ? 76   MET A CB    1 
ATOM   584  C  CG    . MET A 1 76  ? 9.296   -4.632  -8.528  1.00 50.09 ? 76   MET A CG    1 
ATOM   585  S  SD    . MET A 1 76  ? 10.335  -4.958  -7.085  1.00 50.91 ? 76   MET A SD    1 
ATOM   586  C  CE    . MET A 1 76  ? 11.587  -6.026  -7.799  1.00 48.89 ? 76   MET A CE    1 
ATOM   587  N  N     . ARG A 1 77  ? 9.659   -4.385  -12.149 1.00 50.53 ? 77   ARG A N     1 
ATOM   588  C  CA    . ARG A 1 77  ? 10.839  -3.970  -12.907 1.00 50.62 ? 77   ARG A CA    1 
ATOM   589  C  C     . ARG A 1 77  ? 11.470  -2.766  -12.206 1.00 50.74 ? 77   ARG A C     1 
ATOM   590  O  O     . ARG A 1 77  ? 11.140  -1.610  -12.513 1.00 50.31 ? 77   ARG A O     1 
ATOM   591  C  CB    . ARG A 1 77  ? 10.442  -3.578  -14.335 1.00 50.70 ? 77   ARG A CB    1 
ATOM   592  C  CG    . ARG A 1 77  ? 9.339   -4.432  -14.940 1.00 50.71 ? 77   ARG A CG    1 
ATOM   593  C  CD    . ARG A 1 77  ? 9.072   -4.052  -16.387 1.00 50.62 ? 77   ARG A CD    1 
ATOM   594  N  NE    . ARG A 1 77  ? 7.999   -3.069  -16.533 1.00 50.75 ? 77   ARG A NE    1 
ATOM   595  C  CZ    . ARG A 1 77  ? 7.689   -2.474  -17.682 1.00 50.19 ? 77   ARG A CZ    1 
ATOM   596  N  NH1   . ARG A 1 77  ? 8.379   -2.727  -18.785 1.00 50.33 ? 77   ARG A NH1   1 
ATOM   597  N  NH2   . ARG A 1 77  ? 6.697   -1.606  -17.727 1.00 50.39 ? 77   ARG A NH2   1 
ATOM   598  N  N     . LYS A 1 78  ? 12.383  -3.032  -11.273 1.00 51.06 ? 78   LYS A N     1 
ATOM   599  C  CA    . LYS A 1 78  ? 12.880  -1.981  -10.377 1.00 51.33 ? 78   LYS A CA    1 
ATOM   600  C  C     . LYS A 1 78  ? 13.657  -0.953  -11.170 1.00 51.31 ? 78   LYS A C     1 
ATOM   601  O  O     . LYS A 1 78  ? 13.553  0.246   -10.935 1.00 51.35 ? 78   LYS A O     1 
ATOM   602  C  CB    . LYS A 1 78  ? 13.753  -2.555  -9.261  1.00 51.34 ? 78   LYS A CB    1 
ATOM   603  C  CG    . LYS A 1 78  ? 13.940  -1.575  -8.092  1.00 52.36 ? 78   LYS A CG    1 
ATOM   604  C  CD    . LYS A 1 78  ? 14.751  -2.154  -6.950  1.00 52.30 ? 78   LYS A CD    1 
ATOM   605  C  CE    . LYS A 1 78  ? 14.698  -1.261  -5.716  1.00 53.54 ? 78   LYS A CE    1 
ATOM   606  N  NZ    . LYS A 1 78  ? 15.804  -0.233  -5.635  1.00 55.19 ? 78   LYS A NZ    1 
ATOM   607  N  N     . GLU A 1 79  ? 14.392  -1.450  -12.152 1.00 51.10 ? 79   GLU A N     1 
ATOM   608  C  CA    . GLU A 1 79  ? 15.236  -0.630  -12.998 1.00 51.22 ? 79   GLU A CA    1 
ATOM   609  C  C     . GLU A 1 79  ? 14.391  0.400   -13.768 1.00 49.98 ? 79   GLU A C     1 
ATOM   610  O  O     . GLU A 1 79  ? 14.745  1.571   -13.866 1.00 49.54 ? 79   GLU A O     1 
ATOM   611  C  CB    . GLU A 1 79  ? 16.033  -1.525  -13.952 1.00 51.79 ? 79   GLU A CB    1 
ATOM   612  C  CG    . GLU A 1 79  ? 16.209  -3.035  -13.475 1.00 56.45 ? 79   GLU A CG    1 
ATOM   613  C  CD    . GLU A 1 79  ? 14.943  -3.969  -13.693 1.00 61.46 ? 79   GLU A CD    1 
ATOM   614  O  OE1   . GLU A 1 79  ? 14.083  -3.667  -14.584 1.00 64.20 ? 79   GLU A OE1   1 
ATOM   615  O  OE2   . GLU A 1 79  ? 14.823  -5.005  -12.968 1.00 62.03 ? 79   GLU A OE2   1 
ATOM   616  N  N     . VAL A 1 80  ? 13.262  -0.038  -14.308 1.00 48.89 ? 80   VAL A N     1 
ATOM   617  C  CA    . VAL A 1 80  ? 12.369  0.884   -14.984 1.00 48.00 ? 80   VAL A CA    1 
ATOM   618  C  C     . VAL A 1 80  ? 11.910  1.980   -14.022 1.00 47.47 ? 80   VAL A C     1 
ATOM   619  O  O     . VAL A 1 80  ? 11.940  3.160   -14.388 1.00 47.56 ? 80   VAL A O     1 
ATOM   620  C  CB    . VAL A 1 80  ? 11.164  0.170   -15.568 1.00 47.94 ? 80   VAL A CB    1 
ATOM   621  C  CG1   . VAL A 1 80  ? 10.225  1.161   -16.262 1.00 47.25 ? 80   VAL A CG1   1 
ATOM   622  C  CG2   . VAL A 1 80  ? 11.630  -0.897  -16.542 1.00 48.43 ? 80   VAL A CG2   1 
ATOM   623  N  N     . TYR A 1 81  ? 11.526  1.594   -12.799 1.00 46.43 ? 81   TYR A N     1 
ATOM   624  C  CA    . TYR A 1 81  ? 11.024  2.554   -11.810 1.00 45.76 ? 81   TYR A CA    1 
ATOM   625  C  C     . TYR A 1 81  ? 12.155  3.455   -11.332 1.00 45.65 ? 81   TYR A C     1 
ATOM   626  O  O     . TYR A 1 81  ? 11.959  4.645   -11.124 1.00 45.80 ? 81   TYR A O     1 
ATOM   627  C  CB    . TYR A 1 81  ? 10.329  1.863   -10.612 1.00 45.23 ? 81   TYR A CB    1 
ATOM   628  C  CG    . TYR A 1 81  ? 9.434   0.724   -10.999 1.00 44.05 ? 81   TYR A CG    1 
ATOM   629  C  CD1   . TYR A 1 81  ? 8.556   0.851   -12.059 1.00 43.76 ? 81   TYR A CD1   1 
ATOM   630  C  CD2   . TYR A 1 81  ? 9.454   -0.486  -10.305 1.00 43.86 ? 81   TYR A CD2   1 
ATOM   631  C  CE1   . TYR A 1 81  ? 7.737   -0.194  -12.446 1.00 43.83 ? 81   TYR A CE1   1 
ATOM   632  C  CE2   . TYR A 1 81  ? 8.630   -1.554  -10.689 1.00 42.61 ? 81   TYR A CE2   1 
ATOM   633  C  CZ    . TYR A 1 81  ? 7.775   -1.398  -11.765 1.00 43.80 ? 81   TYR A CZ    1 
ATOM   634  O  OH    . TYR A 1 81  ? 6.946   -2.417  -12.199 1.00 43.22 ? 81   TYR A OH    1 
ATOM   635  N  N     . GLN A 1 82  ? 13.343  2.885   -11.196 1.00 45.83 ? 82   GLN A N     1 
ATOM   636  C  CA    . GLN A 1 82  ? 14.539  3.638   -10.805 1.00 46.02 ? 82   GLN A CA    1 
ATOM   637  C  C     . GLN A 1 82  ? 14.923  4.730   -11.812 1.00 46.23 ? 82   GLN A C     1 
ATOM   638  O  O     . GLN A 1 82  ? 15.461  5.777   -11.428 1.00 46.73 ? 82   GLN A O     1 
ATOM   639  C  CB    . GLN A 1 82  ? 15.718  2.675   -10.610 1.00 45.88 ? 82   GLN A CB    1 
ATOM   640  C  CG    . GLN A 1 82  ? 17.037  3.329   -10.182 1.00 46.50 ? 82   GLN A CG    1 
ATOM   641  C  CD    . GLN A 1 82  ? 16.915  4.127   -8.914  1.00 47.39 ? 82   GLN A CD    1 
ATOM   642  O  OE1   . GLN A 1 82  ? 16.697  3.570   -7.840  1.00 49.09 ? 82   GLN A OE1   1 
ATOM   643  N  NE2   . GLN A 1 82  ? 17.041  5.448   -9.026  1.00 46.86 ? 82   GLN A NE2   1 
ATOM   644  N  N     . GLN A 1 83  ? 14.667  4.490   -13.095 1.00 46.11 ? 83   GLN A N     1 
ATOM   645  C  CA    . GLN A 1 83  ? 14.945  5.490   -14.106 1.00 46.22 ? 83   GLN A CA    1 
ATOM   646  C  C     . GLN A 1 83  ? 13.999  6.682   -13.932 1.00 46.01 ? 83   GLN A C     1 
ATOM   647  O  O     . GLN A 1 83  ? 14.428  7.833   -13.993 1.00 46.03 ? 83   GLN A O     1 
ATOM   648  C  CB    . GLN A 1 83  ? 14.841  4.889   -15.504 1.00 46.38 ? 83   GLN A CB    1 
ATOM   649  C  CG    . GLN A 1 83  ? 16.044  4.020   -15.895 1.00 47.00 ? 83   GLN A CG    1 
ATOM   650  C  CD    . GLN A 1 83  ? 15.722  2.985   -16.986 1.00 47.62 ? 83   GLN A CD    1 
ATOM   651  O  OE1   . GLN A 1 83  ? 14.578  2.560   -17.136 1.00 49.38 ? 83   GLN A OE1   1 
ATOM   652  N  NE2   . GLN A 1 83  ? 16.743  2.580   -17.750 1.00 49.34 ? 83   GLN A NE2   1 
ATOM   653  N  N     . VAL A 1 84  ? 12.719  6.415   -13.675 1.00 45.56 ? 84   VAL A N     1 
ATOM   654  C  CA    . VAL A 1 84  ? 11.770  7.505   -13.490 1.00 44.99 ? 84   VAL A CA    1 
ATOM   655  C  C     . VAL A 1 84  ? 12.128  8.253   -12.221 1.00 44.86 ? 84   VAL A C     1 
ATOM   656  O  O     . VAL A 1 84  ? 12.147  9.483   -12.206 1.00 44.70 ? 84   VAL A O     1 
ATOM   657  C  CB    . VAL A 1 84  ? 10.302  7.022   -13.424 1.00 45.09 ? 84   VAL A CB    1 
ATOM   658  C  CG1   . VAL A 1 84  ? 9.381   8.173   -13.122 1.00 43.99 ? 84   VAL A CG1   1 
ATOM   659  C  CG2   . VAL A 1 84  ? 9.878   6.378   -14.732 1.00 44.23 ? 84   VAL A CG2   1 
ATOM   660  N  N     . SER A 1 85  ? 12.440  7.508   -11.165 1.00 44.68 ? 85   SER A N     1 
ATOM   661  C  CA    . SER A 1 85  ? 12.815  8.116   -9.897  1.00 44.62 ? 85   SER A CA    1 
ATOM   662  C  C     . SER A 1 85  ? 13.974  9.088   -10.053 1.00 44.83 ? 85   SER A C     1 
ATOM   663  O  O     . SER A 1 85  ? 13.900  10.207  -9.548  1.00 45.65 ? 85   SER A O     1 
ATOM   664  C  CB    . SER A 1 85  ? 13.196  7.062   -8.877  1.00 44.82 ? 85   SER A CB    1 
ATOM   665  O  OG    . SER A 1 85  ? 13.566  7.691   -7.663  1.00 45.51 ? 85   SER A OG    1 
ATOM   666  N  N     . SER A 1 86  ? 15.029  8.689   -10.769 1.00 44.22 ? 86   SER A N     1 
ATOM   667  C  CA    . SER A 1 86  ? 16.190  9.556   -10.927 1.00 43.63 ? 86   SER A CA    1 
ATOM   668  C  C     . SER A 1 86  ? 15.856  10.832  -11.683 1.00 43.10 ? 86   SER A C     1 
ATOM   669  O  O     . SER A 1 86  ? 16.416  11.901  -11.393 1.00 42.81 ? 86   SER A O     1 
ATOM   670  C  CB    . SER A 1 86  ? 17.313  8.826   -11.646 1.00 43.77 ? 86   SER A CB    1 
ATOM   671  O  OG    . SER A 1 86  ? 17.885  7.834   -10.825 1.00 44.61 ? 86   SER A OG    1 
ATOM   672  N  N     . ARG A 1 87  ? 14.959  10.720  -12.662 1.00 42.54 ? 87   ARG A N     1 
ATOM   673  C  CA    . ARG A 1 87  ? 14.528  11.890  -13.408 1.00 42.35 ? 87   ARG A CA    1 
ATOM   674  C  C     . ARG A 1 87  ? 13.752  12.840  -12.528 1.00 42.50 ? 87   ARG A C     1 
ATOM   675  O  O     . ARG A 1 87  ? 13.902  14.053  -12.662 1.00 42.05 ? 87   ARG A O     1 
ATOM   676  C  CB    . ARG A 1 87  ? 13.672  11.522  -14.595 1.00 42.32 ? 87   ARG A CB    1 
ATOM   677  C  CG    . ARG A 1 87  ? 14.447  11.033  -15.786 1.00 42.35 ? 87   ARG A CG    1 
ATOM   678  C  CD    . ARG A 1 87  ? 13.614  11.190  -17.046 1.00 42.45 ? 87   ARG A CD    1 
ATOM   679  N  NE    . ARG A 1 87  ? 12.342  10.466  -16.991 1.00 41.38 ? 87   ARG A NE    1 
ATOM   680  C  CZ    . ARG A 1 87  ? 12.157  9.225   -17.432 1.00 40.76 ? 87   ARG A CZ    1 
ATOM   681  N  NH1   . ARG A 1 87  ? 13.166  8.535   -17.915 1.00 40.95 ? 87   ARG A NH1   1 
ATOM   682  N  NH2   . ARG A 1 87  ? 10.952  8.662   -17.365 1.00 40.97 ? 87   ARG A NH2   1 
ATOM   683  N  N     . ILE A 1 88  ? 12.929  12.292  -11.627 1.00 42.90 ? 88   ILE A N     1 
ATOM   684  C  CA    . ILE A 1 88  ? 12.170  13.132  -10.694 1.00 42.91 ? 88   ILE A CA    1 
ATOM   685  C  C     . ILE A 1 88  ? 13.117  13.753  -9.678  1.00 43.26 ? 88   ILE A C     1 
ATOM   686  O  O     . ILE A 1 88  ? 13.094  14.961  -9.449  1.00 43.26 ? 88   ILE A O     1 
ATOM   687  C  CB    . ILE A 1 88  ? 11.030  12.372  -10.003 1.00 42.79 ? 88   ILE A CB    1 
ATOM   688  C  CG1   . ILE A 1 88  ? 9.953   12.006  -11.037 1.00 42.13 ? 88   ILE A CG1   1 
ATOM   689  C  CG2   . ILE A 1 88  ? 10.440  13.232  -8.908  1.00 41.84 ? 88   ILE A CG2   1 
ATOM   690  C  CD1   . ILE A 1 88  ? 8.885   11.042  -10.546 1.00 42.26 ? 88   ILE A CD1   1 
ATOM   691  N  N     . MET A 1 89  ? 13.984  12.938  -9.109  1.00 43.75 ? 89   MET A N     1 
ATOM   692  C  CA    . MET A 1 89  ? 15.001  13.458  -8.206  1.00 44.70 ? 89   MET A CA    1 
ATOM   693  C  C     . MET A 1 89  ? 15.749  14.684  -8.765  1.00 44.83 ? 89   MET A C     1 
ATOM   694  O  O     . MET A 1 89  ? 16.009  15.622  -8.028  1.00 44.79 ? 89   MET A O     1 
ATOM   695  C  CB    . MET A 1 89  ? 15.983  12.354  -7.814  1.00 44.86 ? 89   MET A CB    1 
ATOM   696  C  CG    . MET A 1 89  ? 15.381  11.289  -6.885  1.00 46.04 ? 89   MET A CG    1 
ATOM   697  S  SD    . MET A 1 89  ? 14.294  11.910  -5.567  1.00 47.85 ? 89   MET A SD    1 
ATOM   698  C  CE    . MET A 1 89  ? 13.631  10.338  -4.984  1.00 46.00 ? 89   MET A CE    1 
ATOM   699  N  N     . ASN A 1 90  ? 16.066  14.698  -10.054 1.00 45.20 ? 90   ASN A N     1 
ATOM   700  C  CA    . ASN A 1 90  ? 16.735  15.858  -10.633 1.00 45.74 ? 90   ASN A CA    1 
ATOM   701  C  C     . ASN A 1 90  ? 15.838  17.071  -10.797 1.00 46.14 ? 90   ASN A C     1 
ATOM   702  O  O     . ASN A 1 90  ? 16.300  18.187  -10.687 1.00 46.18 ? 90   ASN A O     1 
ATOM   703  C  CB    . ASN A 1 90  ? 17.380  15.506  -11.967 1.00 46.13 ? 90   ASN A CB    1 
ATOM   704  C  CG    . ASN A 1 90  ? 18.623  14.675  -11.796 1.00 47.12 ? 90   ASN A CG    1 
ATOM   705  O  OD1   . ASN A 1 90  ? 19.314  14.755  -10.766 1.00 48.10 ? 90   ASN A OD1   1 
ATOM   706  N  ND2   . ASN A 1 90  ? 18.924  13.865  -12.801 1.00 47.96 ? 90   ASN A ND2   1 
ATOM   707  N  N     . LEU A 1 91  ? 14.557  16.862  -11.060 1.00 47.17 ? 91   LEU A N     1 
ATOM   708  C  CA    . LEU A 1 91  ? 13.592  17.954  -10.998 1.00 47.69 ? 91   LEU A CA    1 
ATOM   709  C  C     . LEU A 1 91  ? 13.596  18.550  -9.598  1.00 48.32 ? 91   LEU A C     1 
ATOM   710  O  O     . LEU A 1 91  ? 13.668  19.766  -9.435  1.00 48.26 ? 91   LEU A O     1 
ATOM   711  C  CB    . LEU A 1 91  ? 12.186  17.462  -11.327 1.00 47.90 ? 91   LEU A CB    1 
ATOM   712  C  CG    . LEU A 1 91  ? 11.930  16.934  -12.740 1.00 48.10 ? 91   LEU A CG    1 
ATOM   713  C  CD1   . LEU A 1 91  ? 10.533  16.292  -12.803 1.00 48.81 ? 91   LEU A CD1   1 
ATOM   714  C  CD2   . LEU A 1 91  ? 12.079  18.038  -13.782 1.00 46.68 ? 91   LEU A CD2   1 
ATOM   715  N  N     . LEU A 1 92  ? 13.543  17.694  -8.577  1.00 49.07 ? 92   LEU A N     1 
ATOM   716  C  CA    . LEU A 1 92  ? 13.584  18.190  -7.205  1.00 49.65 ? 92   LEU A CA    1 
ATOM   717  C  C     . LEU A 1 92  ? 14.843  19.002  -6.995  1.00 50.54 ? 92   LEU A C     1 
ATOM   718  O  O     . LEU A 1 92  ? 14.809  20.074  -6.383  1.00 50.49 ? 92   LEU A O     1 
ATOM   719  C  CB    . LEU A 1 92  ? 13.493  17.054  -6.198  1.00 49.44 ? 92   LEU A CB    1 
ATOM   720  C  CG    . LEU A 1 92  ? 12.125  16.371  -6.206  1.00 49.75 ? 92   LEU A CG    1 
ATOM   721  C  CD1   . LEU A 1 92  ? 12.137  15.143  -5.285  1.00 49.14 ? 92   LEU A CD1   1 
ATOM   722  C  CD2   . LEU A 1 92  ? 11.030  17.352  -5.830  1.00 47.62 ? 92   LEU A CD2   1 
ATOM   723  N  N     . ARG A 1 93  ? 15.947  18.514  -7.549  1.00 51.63 ? 93   ARG A N     1 
ATOM   724  C  CA    . ARG A 1 93  ? 17.228  19.218  -7.448  1.00 52.66 ? 93   ARG A CA    1 
ATOM   725  C  C     . ARG A 1 93  ? 17.230  20.658  -7.954  1.00 53.02 ? 93   ARG A C     1 
ATOM   726  O  O     . ARG A 1 93  ? 18.058  21.443  -7.514  1.00 52.88 ? 93   ARG A O     1 
ATOM   727  C  CB    . ARG A 1 93  ? 18.334  18.450  -8.166  1.00 52.89 ? 93   ARG A CB    1 
ATOM   728  C  CG    . ARG A 1 93  ? 19.433  17.978  -7.259  1.00 54.43 ? 93   ARG A CG    1 
ATOM   729  C  CD    . ARG A 1 93  ? 20.411  17.128  -8.020  1.00 57.16 ? 93   ARG A CD    1 
ATOM   730  N  NE    . ARG A 1 93  ? 19.967  15.732  -8.069  1.00 58.68 ? 93   ARG A NE    1 
ATOM   731  C  CZ    . ARG A 1 93  ? 20.423  14.762  -7.280  1.00 59.42 ? 93   ARG A CZ    1 
ATOM   732  N  NH1   . ARG A 1 93  ? 21.346  15.010  -6.343  1.00 60.53 ? 93   ARG A NH1   1 
ATOM   733  N  NH2   . ARG A 1 93  ? 19.953  13.528  -7.430  1.00 59.25 ? 93   ARG A NH2   1 
ATOM   734  N  N     . GLU A 1 94  ? 16.327  21.005  -8.874  1.00 53.85 ? 94   GLU A N     1 
ATOM   735  C  CA    . GLU A 1 94  ? 16.311  22.360  -9.437  1.00 54.47 ? 94   GLU A CA    1 
ATOM   736  C  C     . GLU A 1 94  ? 15.484  23.319  -8.584  1.00 54.28 ? 94   GLU A C     1 
ATOM   737  O  O     . GLU A 1 94  ? 15.411  24.499  -8.899  1.00 54.83 ? 94   GLU A O     1 
ATOM   738  C  CB    . GLU A 1 94  ? 15.854  22.372  -10.912 1.00 54.77 ? 94   GLU A CB    1 
ATOM   739  C  CG    . GLU A 1 94  ? 16.798  23.206  -11.850 1.00 57.21 ? 94   GLU A CG    1 
ATOM   740  C  CD    . GLU A 1 94  ? 16.655  24.752  -11.710 1.00 59.32 ? 94   GLU A CD    1 
ATOM   741  O  OE1   . GLU A 1 94  ? 15.594  25.295  -12.103 1.00 60.48 ? 94   GLU A OE1   1 
ATOM   742  O  OE2   . GLU A 1 94  ? 17.609  25.427  -11.230 1.00 60.09 ? 94   GLU A OE2   1 
ATOM   743  N  N     . TYR A 1 95  ? 14.875  22.815  -7.509  1.00 54.25 ? 95   TYR A N     1 
ATOM   744  C  CA    . TYR A 1 95  ? 14.255  23.658  -6.480  1.00 54.04 ? 95   TYR A CA    1 
ATOM   745  C  C     . TYR A 1 95  ? 15.122  23.792  -5.237  1.00 54.38 ? 95   TYR A C     1 
ATOM   746  O  O     . TYR A 1 95  ? 15.035  24.803  -4.546  1.00 54.90 ? 95   TYR A O     1 
ATOM   747  C  CB    . TYR A 1 95  ? 12.892  23.117  -6.069  1.00 53.84 ? 95   TYR A CB    1 
ATOM   748  C  CG    . TYR A 1 95  ? 11.872  23.171  -7.175  1.00 53.74 ? 95   TYR A CG    1 
ATOM   749  C  CD1   . TYR A 1 95  ? 11.174  24.335  -7.446  1.00 53.37 ? 95   TYR A CD1   1 
ATOM   750  C  CD2   . TYR A 1 95  ? 11.622  22.059  -7.964  1.00 53.51 ? 95   TYR A CD2   1 
ATOM   751  C  CE1   . TYR A 1 95  ? 10.245  24.385  -8.469  1.00 53.14 ? 95   TYR A CE1   1 
ATOM   752  C  CE2   . TYR A 1 95  ? 10.700  22.101  -8.978  1.00 53.10 ? 95   TYR A CE2   1 
ATOM   753  C  CZ    . TYR A 1 95  ? 10.012  23.260  -9.223  1.00 53.19 ? 95   TYR A CZ    1 
ATOM   754  O  OH    . TYR A 1 95  ? 9.099   23.285  -10.241 1.00 53.40 ? 95   TYR A OH    1 
ATOM   755  N  N     . SER A 1 96  ? 15.928  22.779  -4.924  1.00 54.78 ? 96   SER A N     1 
ATOM   756  C  CA    . SER A 1 96  ? 16.934  22.914  -3.873  1.00 55.19 ? 96   SER A CA    1 
ATOM   757  C  C     . SER A 1 96  ? 18.090  21.942  -4.065  1.00 56.38 ? 96   SER A C     1 
ATOM   758  O  O     . SER A 1 96  ? 17.875  20.764  -4.346  1.00 56.90 ? 96   SER A O     1 
ATOM   759  C  CB    . SER A 1 96  ? 16.323  22.711  -2.490  1.00 54.94 ? 96   SER A CB    1 
ATOM   760  O  OG    . SER A 1 96  ? 17.317  22.793  -1.479  1.00 53.76 ? 96   SER A OG    1 
ATOM   761  N  N     . GLU A 1 97  ? 19.311  22.441  -3.885  1.00 57.33 ? 97   GLU A N     1 
ATOM   762  C  CA    . GLU A 1 97  ? 20.521  21.613  -3.977  1.00 58.22 ? 97   GLU A CA    1 
ATOM   763  C  C     . GLU A 1 97  ? 20.680  20.782  -2.707  1.00 58.19 ? 97   GLU A C     1 
ATOM   764  O  O     . GLU A 1 97  ? 21.291  19.715  -2.714  1.00 58.40 ? 97   GLU A O     1 
ATOM   765  C  CB    . GLU A 1 97  ? 21.792  22.456  -4.209  1.00 58.70 ? 97   GLU A CB    1 
ATOM   766  C  CG    . GLU A 1 97  ? 21.635  24.010  -4.224  1.00 61.19 ? 97   GLU A CG    1 
ATOM   767  C  CD    . GLU A 1 97  ? 21.510  24.647  -2.833  1.00 64.09 ? 97   GLU A CD    1 
ATOM   768  O  OE1   . GLU A 1 97  ? 22.524  24.666  -2.099  1.00 66.17 ? 97   GLU A OE1   1 
ATOM   769  O  OE2   . GLU A 1 97  ? 20.415  25.160  -2.488  1.00 65.84 ? 97   GLU A OE2   1 
ATOM   770  N  N     . LYS A 1 98  ? 20.115  21.289  -1.618  1.00 57.84 ? 98   LYS A N     1 
ATOM   771  C  CA    . LYS A 1 98  ? 20.224  20.662  -0.324  1.00 57.38 ? 98   LYS A CA    1 
ATOM   772  C  C     . LYS A 1 98  ? 19.156  19.584  -0.239  1.00 55.56 ? 98   LYS A C     1 
ATOM   773  O  O     . LYS A 1 98  ? 18.039  19.850  0.175   1.00 55.64 ? 98   LYS A O     1 
ATOM   774  C  CB    . LYS A 1 98  ? 20.061  21.749  0.758   1.00 57.97 ? 98   LYS A CB    1 
ATOM   775  C  CG    . LYS A 1 98  ? 20.653  21.379  2.113   1.00 59.28 ? 98   LYS A CG    1 
ATOM   776  C  CD    . LYS A 1 98  ? 21.084  22.617  2.944   1.00 59.52 ? 98   LYS A CD    1 
ATOM   777  C  CE    . LYS A 1 98  ? 21.887  22.170  4.213   1.00 61.23 ? 98   LYS A CE    1 
ATOM   778  N  NZ    . LYS A 1 98  ? 21.292  20.937  4.905   1.00 61.16 ? 98   LYS A NZ    1 
ATOM   779  N  N     . ILE A 1 99  ? 19.505  18.366  -0.643  1.00 53.97 ? 99   ILE A N     1 
ATOM   780  C  CA    . ILE A 1 99  ? 18.520  17.301  -0.859  1.00 52.48 ? 99   ILE A CA    1 
ATOM   781  C  C     . ILE A 1 99  ? 18.924  15.960  -0.245  1.00 51.77 ? 99   ILE A C     1 
ATOM   782  O  O     . ILE A 1 99  ? 20.063  15.560  -0.350  1.00 51.26 ? 99   ILE A O     1 
ATOM   783  C  CB    . ILE A 1 99  ? 18.278  17.104  -2.372  1.00 52.37 ? 99   ILE A CB    1 
ATOM   784  C  CG1   . ILE A 1 99  ? 17.087  16.182  -2.619  1.00 51.82 ? 99   ILE A CG1   1 
ATOM   785  C  CG2   . ILE A 1 99  ? 19.527  16.574  -3.073  1.00 51.32 ? 99   ILE A CG2   1 
ATOM   786  C  CD1   . ILE A 1 99  ? 16.976  15.748  -4.040  1.00 51.79 ? 99   ILE A CD1   1 
ATOM   787  N  N     . GLU A 1 100 ? 17.972  15.262  0.381   1.00 51.16 ? 100  GLU A N     1 
ATOM   788  C  CA    . GLU A 1 100 ? 18.216  13.923  0.934   1.00 50.53 ? 100  GLU A CA    1 
ATOM   789  C  C     . GLU A 1 100 ? 17.270  12.864  0.350   1.00 49.59 ? 100  GLU A C     1 
ATOM   790  O  O     . GLU A 1 100 ? 16.072  12.858  0.591   1.00 49.31 ? 100  GLU A O     1 
ATOM   791  C  CB    . GLU A 1 100 ? 18.145  13.941  2.462   1.00 50.44 ? 100  GLU A CB    1 
ATOM   792  C  CG    . GLU A 1 100 ? 18.586  12.629  3.097   1.00 50.67 ? 100  GLU A CG    1 
ATOM   793  C  CD    . GLU A 1 100 ? 18.731  12.672  4.632   1.00 51.88 ? 100  GLU A CD    1 
ATOM   794  O  OE1   . GLU A 1 100 ? 19.044  13.750  5.236   1.00 51.11 ? 100  GLU A OE1   1 
ATOM   795  O  OE2   . GLU A 1 100 ? 18.543  11.579  5.236   1.00 55.34 ? 100  GLU A OE2   1 
ATOM   796  N  N     . ILE A 1 101 ? 17.841  11.961  -0.422  1.00 49.12 ? 101  ILE A N     1 
ATOM   797  C  CA    . ILE A 1 101 ? 17.099  10.919  -1.096  1.00 48.79 ? 101  ILE A CA    1 
ATOM   798  C  C     . ILE A 1 101 ? 17.029  9.735   -0.146  1.00 48.39 ? 101  ILE A C     1 
ATOM   799  O  O     . ILE A 1 101 ? 18.065  9.160   0.148   1.00 49.27 ? 101  ILE A O     1 
ATOM   800  C  CB    . ILE A 1 101 ? 17.843  10.523  -2.391  1.00 48.83 ? 101  ILE A CB    1 
ATOM   801  C  CG1   . ILE A 1 101 ? 17.796  11.698  -3.378  1.00 48.65 ? 101  ILE A CG1   1 
ATOM   802  C  CG2   . ILE A 1 101 ? 17.255  9.233   -2.977  1.00 48.78 ? 101  ILE A CG2   1 
ATOM   803  C  CD1   . ILE A 1 101 ? 18.571  11.484  -4.664  1.00 48.36 ? 101  ILE A CD1   1 
ATOM   804  N  N     . ALA A 1 102 ? 15.833  9.379   0.326   1.00 47.44 ? 102  ALA A N     1 
ATOM   805  C  CA    . ALA A 1 102 ? 15.659  8.393   1.407   1.00 47.21 ? 102  ALA A CA    1 
ATOM   806  C  C     . ALA A 1 102 ? 15.252  6.995   0.916   1.00 47.19 ? 102  ALA A C     1 
ATOM   807  O  O     . ALA A 1 102 ? 15.514  5.996   1.584   1.00 47.84 ? 102  ALA A O     1 
ATOM   808  C  CB    . ALA A 1 102 ? 14.639  8.891   2.430   1.00 46.65 ? 102  ALA A CB    1 
ATOM   809  N  N     . SER A 1 103 ? 14.588  6.925   -0.231  1.00 46.74 ? 103  SER A N     1 
ATOM   810  C  CA    . SER A 1 103 ? 14.155  5.659   -0.806  1.00 45.97 ? 103  SER A CA    1 
ATOM   811  C  C     . SER A 1 103 ? 14.014  5.860   -2.298  1.00 46.00 ? 103  SER A C     1 
ATOM   812  O  O     . SER A 1 103 ? 14.141  6.984   -2.802  1.00 45.37 ? 103  SER A O     1 
ATOM   813  C  CB    . SER A 1 103 ? 12.809  5.235   -0.238  1.00 45.76 ? 103  SER A CB    1 
ATOM   814  O  OG    . SER A 1 103 ? 11.744  5.845   -0.948  1.00 45.35 ? 103  SER A OG    1 
ATOM   815  N  N     . ILE A 1 104 ? 13.685  4.782   -3.007  1.00 45.74 ? 104  ILE A N     1 
ATOM   816  C  CA    . ILE A 1 104 ? 13.436  4.908   -4.436  1.00 45.32 ? 104  ILE A CA    1 
ATOM   817  C  C     . ILE A 1 104 ? 12.339  5.957   -4.773  1.00 45.39 ? 104  ILE A C     1 
ATOM   818  O  O     . ILE A 1 104 ? 12.322  6.466   -5.903  1.00 45.28 ? 104  ILE A O     1 
ATOM   819  C  CB    . ILE A 1 104 ? 13.106  3.555   -5.088  1.00 45.04 ? 104  ILE A CB    1 
ATOM   820  C  CG1   . ILE A 1 104 ? 13.248  3.678   -6.615  1.00 45.34 ? 104  ILE A CG1   1 
ATOM   821  C  CG2   . ILE A 1 104 ? 11.724  3.081   -4.669  1.00 43.72 ? 104  ILE A CG2   1 
ATOM   822  C  CD1   . ILE A 1 104 ? 13.387  2.366   -7.348  1.00 45.21 ? 104  ILE A CD1   1 
ATOM   823  N  N     . ASP A 1 105 ? 11.455  6.285   -3.818  1.00 44.88 ? 105  ASP A N     1 
ATOM   824  C  CA    . ASP A 1 105 ? 10.363  7.210   -4.104  1.00 45.45 ? 105  ASP A CA    1 
ATOM   825  C  C     . ASP A 1 105 ? 10.193  8.440   -3.207  1.00 45.66 ? 105  ASP A C     1 
ATOM   826  O  O     . ASP A 1 105 ? 9.204   9.130   -3.346  1.00 46.07 ? 105  ASP A O     1 
ATOM   827  C  CB    . ASP A 1 105 ? 9.024   6.464   -4.171  1.00 45.75 ? 105  ASP A CB    1 
ATOM   828  C  CG    . ASP A 1 105 ? 8.353   6.335   -2.826  1.00 45.73 ? 105  ASP A CG    1 
ATOM   829  O  OD1   . ASP A 1 105 ? 9.090   6.154   -1.824  1.00 45.41 ? 105  ASP A OD1   1 
ATOM   830  O  OD2   . ASP A 1 105 ? 7.084   6.409   -2.780  1.00 43.38 ? 105  ASP A OD2   1 
ATOM   831  N  N     . GLU A 1 106 ? 11.137  8.741   -2.320  1.00 46.01 ? 106  GLU A N     1 
ATOM   832  C  CA    . GLU A 1 106 ? 11.003  9.925   -1.482  1.00 45.80 ? 106  GLU A CA    1 
ATOM   833  C  C     . GLU A 1 106 ? 12.317  10.681  -1.263  1.00 46.01 ? 106  GLU A C     1 
ATOM   834  O  O     . GLU A 1 106 ? 13.395  10.106  -1.390  1.00 46.13 ? 106  GLU A O     1 
ATOM   835  C  CB    . GLU A 1 106 ? 10.373  9.552   -0.137  1.00 45.96 ? 106  GLU A CB    1 
ATOM   836  C  CG    . GLU A 1 106 ? 11.192  8.592   0.697   1.00 45.08 ? 106  GLU A CG    1 
ATOM   837  C  CD    . GLU A 1 106 ? 10.414  8.058   1.904   1.00 45.78 ? 106  GLU A CD    1 
ATOM   838  O  OE1   . GLU A 1 106 ? 11.028  7.975   3.005   1.00 45.46 ? 106  GLU A OE1   1 
ATOM   839  O  OE2   . GLU A 1 106 ? 9.200   7.721   1.746   1.00 41.42 ? 106  GLU A OE2   1 
ATOM   840  N  N     . ALA A 1 107 ? 12.197  11.968  -0.930  1.00 45.65 ? 107  ALA A N     1 
ATOM   841  C  CA    . ALA A 1 107 ? 13.342  12.838  -0.752  1.00 45.73 ? 107  ALA A CA    1 
ATOM   842  C  C     . ALA A 1 107 ? 12.981  14.054  0.106   1.00 45.86 ? 107  ALA A C     1 
ATOM   843  O  O     . ALA A 1 107 ? 11.847  14.535  0.054   1.00 46.21 ? 107  ALA A O     1 
ATOM   844  C  CB    . ALA A 1 107 ? 13.843  13.293  -2.076  1.00 45.55 ? 107  ALA A CB    1 
ATOM   845  N  N     . TYR A 1 108 ? 13.952  14.518  0.892   1.00 45.19 ? 108  TYR A N     1 
ATOM   846  C  CA    . TYR A 1 108 ? 13.792  15.650  1.763   1.00 45.26 ? 108  TYR A CA    1 
ATOM   847  C  C     . TYR A 1 108 ? 14.584  16.807  1.203   1.00 45.54 ? 108  TYR A C     1 
ATOM   848  O  O     . TYR A 1 108 ? 15.772  16.642  0.891   1.00 45.53 ? 108  TYR A O     1 
ATOM   849  C  CB    . TYR A 1 108 ? 14.401  15.377  3.126   1.00 45.24 ? 108  TYR A CB    1 
ATOM   850  C  CG    . TYR A 1 108 ? 13.790  14.272  3.906   1.00 44.97 ? 108  TYR A CG    1 
ATOM   851  C  CD1   . TYR A 1 108 ? 12.874  14.544  4.900   1.00 44.40 ? 108  TYR A CD1   1 
ATOM   852  C  CD2   . TYR A 1 108 ? 14.171  12.955  3.694   1.00 45.16 ? 108  TYR A CD2   1 
ATOM   853  C  CE1   . TYR A 1 108 ? 12.331  13.543  5.640   1.00 45.04 ? 108  TYR A CE1   1 
ATOM   854  C  CE2   . TYR A 1 108 ? 13.615  11.933  4.431   1.00 44.86 ? 108  TYR A CE2   1 
ATOM   855  C  CZ    . TYR A 1 108 ? 12.699  12.237  5.408   1.00 44.55 ? 108  TYR A CZ    1 
ATOM   856  O  OH    . TYR A 1 108 ? 12.128  11.240  6.163   1.00 45.03 ? 108  TYR A OH    1 
ATOM   857  N  N     . LEU A 1 109 ? 13.944  17.970  1.113   1.00 45.37 ? 109  LEU A N     1 
ATOM   858  C  CA    . LEU A 1 109 ? 14.589  19.190  0.664   1.00 45.53 ? 109  LEU A CA    1 
ATOM   859  C  C     . LEU A 1 109 ? 14.605  20.175  1.810   1.00 45.86 ? 109  LEU A C     1 
ATOM   860  O  O     . LEU A 1 109 ? 13.589  20.417  2.461   1.00 46.41 ? 109  LEU A O     1 
ATOM   861  C  CB    . LEU A 1 109 ? 13.814  19.825  -0.496  1.00 45.68 ? 109  LEU A CB    1 
ATOM   862  C  CG    . LEU A 1 109 ? 13.855  19.217  -1.899  1.00 45.24 ? 109  LEU A CG    1 
ATOM   863  C  CD1   . LEU A 1 109 ? 13.418  17.790  -1.858  1.00 45.23 ? 109  LEU A CD1   1 
ATOM   864  C  CD2   . LEU A 1 109 ? 12.956  20.026  -2.837  1.00 45.26 ? 109  LEU A CD2   1 
ATOM   865  N  N     . ASP A 1 110 ? 15.756  20.757  2.061   1.00 46.11 ? 110  ASP A N     1 
ATOM   866  C  CA    . ASP A 1 110 ? 15.823  21.879  2.964   1.00 46.46 ? 110  ASP A CA    1 
ATOM   867  C  C     . ASP A 1 110 ? 15.584  23.112  2.104   1.00 46.11 ? 110  ASP A C     1 
ATOM   868  O  O     . ASP A 1 110 ? 16.326  23.367  1.160   1.00 45.93 ? 110  ASP A O     1 
ATOM   869  C  CB    . ASP A 1 110 ? 17.182  21.935  3.631   1.00 46.62 ? 110  ASP A CB    1 
ATOM   870  C  CG    . ASP A 1 110 ? 17.291  23.059  4.611   1.00 49.04 ? 110  ASP A CG    1 
ATOM   871  O  OD1   . ASP A 1 110 ? 16.449  23.993  4.567   1.00 51.14 ? 110  ASP A OD1   1 
ATOM   872  O  OD2   . ASP A 1 110 ? 18.239  23.013  5.421   1.00 53.02 ? 110  ASP A OD2   1 
ATOM   873  N  N     . ILE A 1 111 ? 14.540  23.866  2.412   1.00 46.02 ? 111  ILE A N     1 
ATOM   874  C  CA    . ILE A 1 111 ? 14.169  24.979  1.551   1.00 46.12 ? 111  ILE A CA    1 
ATOM   875  C  C     . ILE A 1 111 ? 14.180  26.313  2.286   1.00 46.70 ? 111  ILE A C     1 
ATOM   876  O  O     . ILE A 1 111 ? 13.537  27.256  1.865   1.00 46.29 ? 111  ILE A O     1 
ATOM   877  C  CB    . ILE A 1 111 ? 12.822  24.709  0.842   1.00 46.01 ? 111  ILE A CB    1 
ATOM   878  C  CG1   . ILE A 1 111 ? 11.699  24.461  1.847   1.00 45.25 ? 111  ILE A CG1   1 
ATOM   879  C  CG2   . ILE A 1 111 ? 12.968  23.527  -0.096  1.00 44.35 ? 111  ILE A CG2   1 
ATOM   880  C  CD1   . ILE A 1 111 ? 10.328  24.541  1.211   1.00 45.54 ? 111  ILE A CD1   1 
ATOM   881  N  N     . SER A 1 112 ? 14.968  26.381  3.358   1.00 47.95 ? 112  SER A N     1 
ATOM   882  C  CA    . SER A 1 112 ? 15.067  27.566  4.225   1.00 48.69 ? 112  SER A CA    1 
ATOM   883  C  C     . SER A 1 112 ? 15.674  28.803  3.552   1.00 49.61 ? 112  SER A C     1 
ATOM   884  O  O     . SER A 1 112 ? 15.490  29.917  4.038   1.00 49.95 ? 112  SER A O     1 
ATOM   885  C  CB    . SER A 1 112 ? 15.915  27.243  5.461   1.00 48.51 ? 112  SER A CB    1 
ATOM   886  O  OG    . SER A 1 112 ? 15.808  25.887  5.829   1.00 48.13 ? 112  SER A OG    1 
ATOM   887  N  N     . ASP A 1 113 ? 16.423  28.597  2.471   1.00 50.67 ? 113  ASP A N     1 
ATOM   888  C  CA    . ASP A 1 113 ? 17.031  29.690  1.713   1.00 51.55 ? 113  ASP A CA    1 
ATOM   889  C  C     . ASP A 1 113 ? 16.335  29.964  0.387   1.00 51.44 ? 113  ASP A C     1 
ATOM   890  O  O     . ASP A 1 113 ? 16.826  30.769  -0.406  1.00 51.74 ? 113  ASP A O     1 
ATOM   891  C  CB    . ASP A 1 113 ? 18.503  29.379  1.460   1.00 52.01 ? 113  ASP A CB    1 
ATOM   892  C  CG    . ASP A 1 113 ? 19.295  29.254  2.753   1.00 54.94 ? 113  ASP A CG    1 
ATOM   893  O  OD1   . ASP A 1 113 ? 18.777  29.703  3.815   1.00 57.94 ? 113  ASP A OD1   1 
ATOM   894  O  OD2   . ASP A 1 113 ? 20.433  28.719  2.705   1.00 57.49 ? 113  ASP A OD2   1 
ATOM   895  N  N     . LYS A 1 114 ? 15.211  29.287  0.151   1.00 51.33 ? 114  LYS A N     1 
ATOM   896  C  CA    . LYS A 1 114 ? 14.368  29.518  -1.019  1.00 51.34 ? 114  LYS A CA    1 
ATOM   897  C  C     . LYS A 1 114 ? 13.062  30.203  -0.628  1.00 50.81 ? 114  LYS A C     1 
ATOM   898  O  O     . LYS A 1 114 ? 12.570  31.025  -1.378  1.00 51.08 ? 114  LYS A O     1 
ATOM   899  C  CB    . LYS A 1 114 ? 14.033  28.209  -1.744  1.00 51.88 ? 114  LYS A CB    1 
ATOM   900  C  CG    . LYS A 1 114 ? 15.204  27.243  -1.992  1.00 52.99 ? 114  LYS A CG    1 
ATOM   901  C  CD    . LYS A 1 114 ? 16.297  27.832  -2.887  1.00 54.15 ? 114  LYS A CD    1 
ATOM   902  C  CE    . LYS A 1 114 ? 17.353  26.772  -3.232  1.00 54.24 ? 114  LYS A CE    1 
ATOM   903  N  NZ    . LYS A 1 114 ? 18.628  27.397  -3.662  1.00 56.79 ? 114  LYS A NZ    1 
ATOM   904  N  N     . VAL A 1 115 ? 12.504  29.862  0.533   1.00 50.36 ? 115  VAL A N     1 
ATOM   905  C  CA    . VAL A 1 115 ? 11.243  30.453  1.017   1.00 50.01 ? 115  VAL A CA    1 
ATOM   906  C  C     . VAL A 1 115 ? 11.426  31.207  2.345   1.00 49.99 ? 115  VAL A C     1 
ATOM   907  O  O     . VAL A 1 115 ? 12.316  30.876  3.131   1.00 50.41 ? 115  VAL A O     1 
ATOM   908  C  CB    . VAL A 1 115 ? 10.145  29.373  1.214   1.00 49.91 ? 115  VAL A CB    1 
ATOM   909  C  CG1   . VAL A 1 115 ? 9.824   28.688  -0.092  1.00 49.62 ? 115  VAL A CG1   1 
ATOM   910  C  CG2   . VAL A 1 115 ? 10.569  28.351  2.244   1.00 49.53 ? 115  VAL A CG2   1 
ATOM   911  N  N     . ARG A 1 116 ? 10.572  32.206  2.583   1.00 49.57 ? 116  ARG A N     1 
ATOM   912  C  CA    . ARG A 1 116 ? 10.573  33.006  3.814   1.00 49.46 ? 116  ARG A CA    1 
ATOM   913  C  C     . ARG A 1 116 ? 9.796   32.358  4.962   1.00 48.85 ? 116  ARG A C     1 
ATOM   914  O  O     . ARG A 1 116 ? 10.118  32.569  6.132   1.00 48.63 ? 116  ARG A O     1 
ATOM   915  C  CB    . ARG A 1 116 ? 9.920   34.375  3.559   1.00 49.96 ? 116  ARG A CB    1 
ATOM   916  C  CG    . ARG A 1 116 ? 10.763  35.381  2.791   1.00 51.52 ? 116  ARG A CG    1 
ATOM   917  C  CD    . ARG A 1 116 ? 11.961  35.848  3.600   1.00 53.97 ? 116  ARG A CD    1 
ATOM   918  N  NE    . ARG A 1 116 ? 12.194  37.291  3.462   1.00 55.42 ? 116  ARG A NE    1 
ATOM   919  C  CZ    . ARG A 1 116 ? 11.522  38.238  4.121   1.00 56.34 ? 116  ARG A CZ    1 
ATOM   920  N  NH1   . ARG A 1 116 ? 10.542  37.926  4.967   1.00 57.43 ? 116  ARG A NH1   1 
ATOM   921  N  NH2   . ARG A 1 116 ? 11.823  39.517  3.925   1.00 56.71 ? 116  ARG A NH2   1 
ATOM   922  N  N     . ASP A 1 117 ? 8.742   31.613  4.628   1.00 48.29 ? 117  ASP A N     1 
ATOM   923  C  CA    . ASP A 1 117 ? 7.814   31.082  5.634   1.00 47.55 ? 117  ASP A CA    1 
ATOM   924  C  C     . ASP A 1 117 ? 6.967   29.925  5.089   1.00 46.81 ? 117  ASP A C     1 
ATOM   925  O  O     . ASP A 1 117 ? 7.116   29.525  3.936   1.00 47.04 ? 117  ASP A O     1 
ATOM   926  C  CB    . ASP A 1 117 ? 6.922   32.214  6.143   1.00 47.50 ? 117  ASP A CB    1 
ATOM   927  C  CG    . ASP A 1 117 ? 6.041   32.800  5.057   1.00 47.49 ? 117  ASP A CG    1 
ATOM   928  O  OD1   . ASP A 1 117 ? 5.812   34.026  5.069   1.00 49.06 ? 117  ASP A OD1   1 
ATOM   929  O  OD2   . ASP A 1 117 ? 5.565   32.041  4.193   1.00 47.24 ? 117  ASP A OD2   1 
ATOM   930  N  N     . TYR A 1 118 ? 6.062   29.405  5.909   1.00 45.98 ? 118  TYR A N     1 
ATOM   931  C  CA    . TYR A 1 118 ? 5.298   28.207  5.543   1.00 45.41 ? 118  TYR A CA    1 
ATOM   932  C  C     . TYR A 1 118 ? 4.331   28.388  4.383   1.00 45.31 ? 118  TYR A C     1 
ATOM   933  O  O     . TYR A 1 118 ? 3.950   27.417  3.721   1.00 45.58 ? 118  TYR A O     1 
ATOM   934  C  CB    . TYR A 1 118 ? 4.542   27.667  6.754   1.00 45.07 ? 118  TYR A CB    1 
ATOM   935  C  CG    . TYR A 1 118 ? 5.405   26.874  7.699   1.00 44.74 ? 118  TYR A CG    1 
ATOM   936  C  CD1   . TYR A 1 118 ? 6.246   25.879  7.228   1.00 44.08 ? 118  TYR A CD1   1 
ATOM   937  C  CD2   . TYR A 1 118 ? 5.360   27.097  9.066   1.00 44.03 ? 118  TYR A CD2   1 
ATOM   938  C  CE1   . TYR A 1 118 ? 7.031   25.150  8.090   1.00 45.00 ? 118  TYR A CE1   1 
ATOM   939  C  CE2   . TYR A 1 118 ? 6.143   26.368  9.935   1.00 44.05 ? 118  TYR A CE2   1 
ATOM   940  C  CZ    . TYR A 1 118 ? 6.971   25.397  9.440   1.00 44.95 ? 118  TYR A CZ    1 
ATOM   941  O  OH    . TYR A 1 118 ? 7.753   24.655  10.281  1.00 46.17 ? 118  TYR A OH    1 
ATOM   942  N  N     . ARG A 1 119 ? 3.927   29.623  4.152   1.00 45.16 ? 119  ARG A N     1 
ATOM   943  C  CA    . ARG A 1 119 ? 3.033   29.958  3.061   1.00 45.18 ? 119  ARG A CA    1 
ATOM   944  C  C     . ARG A 1 119 ? 3.772   29.804  1.737   1.00 44.72 ? 119  ARG A C     1 
ATOM   945  O  O     . ARG A 1 119 ? 3.303   29.131  0.829   1.00 44.93 ? 119  ARG A O     1 
ATOM   946  C  CB    . ARG A 1 119 ? 2.565   31.396  3.255   1.00 45.12 ? 119  ARG A CB    1 
ATOM   947  C  CG    . ARG A 1 119 ? 1.573   31.926  2.272   1.00 45.48 ? 119  ARG A CG    1 
ATOM   948  C  CD    . ARG A 1 119 ? 1.257   33.426  2.590   1.00 46.23 ? 119  ARG A CD    1 
ATOM   949  N  NE    . ARG A 1 119 ? 2.414   34.311  2.378   1.00 46.93 ? 119  ARG A NE    1 
ATOM   950  C  CZ    . ARG A 1 119 ? 2.820   34.765  1.190   1.00 47.01 ? 119  ARG A CZ    1 
ATOM   951  N  NH1   . ARG A 1 119 ? 2.168   34.438  0.072   1.00 46.16 ? 119  ARG A NH1   1 
ATOM   952  N  NH2   . ARG A 1 119 ? 3.884   35.563  1.118   1.00 47.40 ? 119  ARG A NH2   1 
ATOM   953  N  N     . GLU A 1 120 ? 4.941   30.419  1.643   1.00 44.31 ? 120  GLU A N     1 
ATOM   954  C  CA    . GLU A 1 120 ? 5.754   30.332  0.447   1.00 44.13 ? 120  GLU A CA    1 
ATOM   955  C  C     . GLU A 1 120 ? 6.198   28.891  0.272   1.00 43.47 ? 120  GLU A C     1 
ATOM   956  O  O     . GLU A 1 120 ? 6.377   28.441  -0.854  1.00 43.74 ? 120  GLU A O     1 
ATOM   957  C  CB    . GLU A 1 120 ? 6.969   31.278  0.526   1.00 44.05 ? 120  GLU A CB    1 
ATOM   958  C  CG    . GLU A 1 120 ? 6.634   32.783  0.501   1.00 44.48 ? 120  GLU A CG    1 
ATOM   959  C  CD    . GLU A 1 120 ? 7.854   33.673  0.216   1.00 45.89 ? 120  GLU A CD    1 
ATOM   960  O  OE1   . GLU A 1 120 ? 8.998   33.161  0.177   1.00 48.38 ? 120  GLU A OE1   1 
ATOM   961  O  OE2   . GLU A 1 120 ? 7.679   34.901  0.025   1.00 49.12 ? 120  GLU A OE2   1 
ATOM   962  N  N     . ALA A 1 121 ? 6.366   28.171  1.385   1.00 42.80 ? 121  ALA A N     1 
ATOM   963  C  CA    . ALA A 1 121 ? 6.711   26.743  1.342   1.00 42.42 ? 121  ALA A CA    1 
ATOM   964  C  C     . ALA A 1 121 ? 5.623   25.960  0.662   1.00 41.63 ? 121  ALA A C     1 
ATOM   965  O  O     . ALA A 1 121 ? 5.886   25.229  -0.277  1.00 41.47 ? 121  ALA A O     1 
ATOM   966  C  CB    . ALA A 1 121 ? 6.941   26.195  2.733   1.00 42.66 ? 121  ALA A CB    1 
ATOM   967  N  N     . TYR A 1 122 ? 4.401   26.132  1.148   1.00 41.22 ? 122  TYR A N     1 
ATOM   968  C  CA    . TYR A 1 122 ? 3.216   25.518  0.553   1.00 40.95 ? 122  TYR A CA    1 
ATOM   969  C  C     . TYR A 1 122 ? 3.094   25.840  -0.945  1.00 41.09 ? 122  TYR A C     1 
ATOM   970  O  O     . TYR A 1 122 ? 2.781   24.958  -1.756  1.00 40.23 ? 122  TYR A O     1 
ATOM   971  C  CB    . TYR A 1 122 ? 1.965   25.984  1.301   1.00 40.85 ? 122  TYR A CB    1 
ATOM   972  C  CG    . TYR A 1 122 ? 0.674   25.376  0.815   1.00 40.17 ? 122  TYR A CG    1 
ATOM   973  C  CD1   . TYR A 1 122 ? 0.291   24.126  1.246   1.00 40.72 ? 122  TYR A CD1   1 
ATOM   974  C  CD2   . TYR A 1 122 ? -0.171  26.058  -0.051  1.00 40.32 ? 122  TYR A CD2   1 
ATOM   975  C  CE1   . TYR A 1 122 ? -0.870  23.551  0.836   1.00 40.94 ? 122  TYR A CE1   1 
ATOM   976  C  CE2   . TYR A 1 122 ? -1.359  25.489  -0.484  1.00 40.69 ? 122  TYR A CE2   1 
ATOM   977  C  CZ    . TYR A 1 122 ? -1.700  24.221  -0.026  1.00 41.64 ? 122  TYR A CZ    1 
ATOM   978  O  OH    . TYR A 1 122 ? -2.859  23.581  -0.412  1.00 41.68 ? 122  TYR A OH    1 
ATOM   979  N  N     . ASN A 1 123 ? 3.348   27.094  -1.318  1.00 41.15 ? 123  ASN A N     1 
ATOM   980  C  CA    . ASN A 1 123 ? 3.260   27.457  -2.723  1.00 41.68 ? 123  ASN A CA    1 
ATOM   981  C  C     . ASN A 1 123 ? 4.346   26.759  -3.562  1.00 42.47 ? 123  ASN A C     1 
ATOM   982  O  O     . ASN A 1 123 ? 4.094   26.362  -4.704  1.00 42.42 ? 123  ASN A O     1 
ATOM   983  C  CB    . ASN A 1 123 ? 3.288   28.966  -2.908  1.00 41.39 ? 123  ASN A CB    1 
ATOM   984  C  CG    . ASN A 1 123 ? 2.053   29.651  -2.332  1.00 41.15 ? 123  ASN A CG    1 
ATOM   985  O  OD1   . ASN A 1 123 ? 1.002   29.035  -2.169  1.00 40.17 ? 123  ASN A OD1   1 
ATOM   986  N  ND2   . ASN A 1 123 ? 2.185   30.936  -2.011  1.00 41.41 ? 123  ASN A ND2   1 
ATOM   987  N  N     . LEU A 1 124 ? 5.533   26.587  -2.982  1.00 43.03 ? 124  LEU A N     1 
ATOM   988  C  CA    . LEU A 1 124 ? 6.598   25.820  -3.619  1.00 43.61 ? 124  LEU A CA    1 
ATOM   989  C  C     . LEU A 1 124 ? 6.159   24.363  -3.775  1.00 44.18 ? 124  LEU A C     1 
ATOM   990  O  O     . LEU A 1 124 ? 6.346   23.737  -4.819  1.00 44.25 ? 124  LEU A O     1 
ATOM   991  C  CB    . LEU A 1 124 ? 7.879   25.895  -2.787  1.00 43.67 ? 124  LEU A CB    1 
ATOM   992  C  CG    . LEU A 1 124 ? 9.193   25.673  -3.551  1.00 44.52 ? 124  LEU A CG    1 
ATOM   993  C  CD1   . LEU A 1 124 ? 9.513   26.874  -4.451  1.00 44.21 ? 124  LEU A CD1   1 
ATOM   994  C  CD2   . LEU A 1 124 ? 10.347  25.422  -2.584  1.00 43.90 ? 124  LEU A CD2   1 
ATOM   995  N  N     . GLY A 1 125 ? 5.554   23.824  -2.731  1.00 44.71 ? 125  GLY A N     1 
ATOM   996  C  CA    . GLY A 1 125 ? 5.064   22.459  -2.785  1.00 45.29 ? 125  GLY A CA    1 
ATOM   997  C  C     . GLY A 1 125 ? 4.026   22.212  -3.862  1.00 45.46 ? 125  GLY A C     1 
ATOM   998  O  O     . GLY A 1 125 ? 3.932   21.106  -4.350  1.00 45.58 ? 125  GLY A O     1 
ATOM   999  N  N     . LEU A 1 126 ? 3.241   23.233  -4.210  1.00 45.98 ? 126  LEU A N     1 
ATOM   1000 C  CA    . LEU A 1 126 ? 2.251   23.141  -5.295  1.00 46.20 ? 126  LEU A CA    1 
ATOM   1001 C  C     . LEU A 1 126 ? 2.909   23.264  -6.660  1.00 46.76 ? 126  LEU A C     1 
ATOM   1002 O  O     . LEU A 1 126 ? 2.459   22.654  -7.644  1.00 47.23 ? 126  LEU A O     1 
ATOM   1003 C  CB    . LEU A 1 126 ? 1.238   24.276  -5.207  1.00 45.96 ? 126  LEU A CB    1 
ATOM   1004 C  CG    . LEU A 1 126 ? 0.141   24.197  -4.162  1.00 45.31 ? 126  LEU A CG    1 
ATOM   1005 C  CD1   . LEU A 1 126 ? -0.719  25.479  -4.282  1.00 41.92 ? 126  LEU A CD1   1 
ATOM   1006 C  CD2   . LEU A 1 126 ? -0.657  22.922  -4.335  1.00 42.67 ? 126  LEU A CD2   1 
ATOM   1007 N  N     . GLU A 1 127 ? 3.928   24.115  -6.708  1.00 46.97 ? 127  GLU A N     1 
ATOM   1008 C  CA    . GLU A 1 127 ? 4.825   24.240  -7.844  1.00 47.34 ? 127  GLU A CA    1 
ATOM   1009 C  C     . GLU A 1 127 ? 5.524   22.898  -8.117  1.00 46.33 ? 127  GLU A C     1 
ATOM   1010 O  O     . GLU A 1 127 ? 5.530   22.428  -9.239  1.00 46.41 ? 127  GLU A O     1 
ATOM   1011 C  CB    . GLU A 1 127 ? 5.844   25.340  -7.537  1.00 47.51 ? 127  GLU A CB    1 
ATOM   1012 C  CG    . GLU A 1 127 ? 6.553   25.970  -8.733  1.00 49.29 ? 127  GLU A CG    1 
ATOM   1013 C  CD    . GLU A 1 127 ? 7.117   27.350  -8.399  1.00 49.52 ? 127  GLU A CD    1 
ATOM   1014 O  OE1   . GLU A 1 127 ? 6.323   28.201  -7.936  1.00 52.71 ? 127  GLU A OE1   1 
ATOM   1015 O  OE2   . GLU A 1 127 ? 8.343   27.578  -8.588  1.00 52.89 ? 127  GLU A OE2   1 
ATOM   1016 N  N     . ILE A 1 128 ? 6.084   22.272  -7.087  1.00 45.69 ? 128  ILE A N     1 
ATOM   1017 C  CA    . ILE A 1 128 ? 6.757   20.974  -7.252  1.00 45.03 ? 128  ILE A CA    1 
ATOM   1018 C  C     . ILE A 1 128 ? 5.792   19.887  -7.736  1.00 44.84 ? 128  ILE A C     1 
ATOM   1019 O  O     . ILE A 1 128 ? 6.122   19.118  -8.631  1.00 44.20 ? 128  ILE A O     1 
ATOM   1020 C  CB    . ILE A 1 128 ? 7.460   20.499  -5.941  1.00 45.15 ? 128  ILE A CB    1 
ATOM   1021 C  CG1   . ILE A 1 128 ? 8.640   21.413  -5.590  1.00 44.57 ? 128  ILE A CG1   1 
ATOM   1022 C  CG2   . ILE A 1 128 ? 7.961   19.062  -6.078  1.00 43.88 ? 128  ILE A CG2   1 
ATOM   1023 C  CD1   . ILE A 1 128 ? 9.200   21.193  -4.219  1.00 44.19 ? 128  ILE A CD1   1 
ATOM   1024 N  N     . LYS A 1 129 ? 4.602   19.831  -7.150  1.00 44.89 ? 129  LYS A N     1 
ATOM   1025 C  CA    . LYS A 1 129 ? 3.573   18.876  -7.594  1.00 44.99 ? 129  LYS A CA    1 
ATOM   1026 C  C     . LYS A 1 129 ? 3.247   19.058  -9.073  1.00 45.37 ? 129  LYS A C     1 
ATOM   1027 O  O     . LYS A 1 129 ? 3.242   18.100  -9.835  1.00 45.63 ? 129  LYS A O     1 
ATOM   1028 C  CB    . LYS A 1 129 ? 2.316   18.985  -6.736  1.00 44.37 ? 129  LYS A CB    1 
ATOM   1029 C  CG    . LYS A 1 129 ? 2.519   18.407  -5.332  1.00 44.69 ? 129  LYS A CG    1 
ATOM   1030 C  CD    . LYS A 1 129 ? 1.377   18.722  -4.375  1.00 45.17 ? 129  LYS A CD    1 
ATOM   1031 C  CE    . LYS A 1 129 ? 0.093   17.967  -4.727  1.00 46.39 ? 129  LYS A CE    1 
ATOM   1032 N  NZ    . LYS A 1 129 ? 0.158   16.474  -4.473  1.00 46.01 ? 129  LYS A NZ    1 
ATOM   1033 N  N     . ASN A 1 130 ? 3.030   20.300  -9.483  1.00 46.13 ? 130  ASN A N     1 
ATOM   1034 C  CA    . ASN A 1 130 ? 2.737   20.606  -10.877 1.00 46.42 ? 130  ASN A CA    1 
ATOM   1035 C  C     . ASN A 1 130 ? 3.836   20.164  -11.815 1.00 46.10 ? 130  ASN A C     1 
ATOM   1036 O  O     . ASN A 1 130 ? 3.545   19.595  -12.858 1.00 46.02 ? 130  ASN A O     1 
ATOM   1037 C  CB    . ASN A 1 130 ? 2.466   22.108  -11.072 1.00 46.58 ? 130  ASN A CB    1 
ATOM   1038 C  CG    . ASN A 1 130 ? 1.104   22.538  -10.531 1.00 48.68 ? 130  ASN A CG    1 
ATOM   1039 O  OD1   . ASN A 1 130 ? 0.165   21.728  -10.425 1.00 52.74 ? 130  ASN A OD1   1 
ATOM   1040 N  ND2   . ASN A 1 130 ? 0.985   23.817  -10.192 1.00 49.86 ? 130  ASN A ND2   1 
ATOM   1041 N  N     . LYS A 1 131 ? 5.092   20.422  -11.449 1.00 45.96 ? 131  LYS A N     1 
ATOM   1042 C  CA    . LYS A 1 131 ? 6.210   20.136  -12.350 1.00 46.07 ? 131  LYS A CA    1 
ATOM   1043 C  C     . LYS A 1 131 ? 6.359   18.648  -12.614 1.00 45.69 ? 131  LYS A C     1 
ATOM   1044 O  O     . LYS A 1 131 ? 6.570   18.226  -13.751 1.00 45.20 ? 131  LYS A O     1 
ATOM   1045 C  CB    . LYS A 1 131 ? 7.536   20.659  -11.807 1.00 46.14 ? 131  LYS A CB    1 
ATOM   1046 C  CG    . LYS A 1 131 ? 8.570   20.902  -12.925 1.00 47.58 ? 131  LYS A CG    1 
ATOM   1047 C  CD    . LYS A 1 131 ? 8.773   22.414  -13.220 1.00 49.22 ? 131  LYS A CD    1 
ATOM   1048 C  CE    . LYS A 1 131 ? 8.967   22.719  -14.703 1.00 50.23 ? 131  LYS A CE    1 
ATOM   1049 N  NZ    . LYS A 1 131 ? 7.655   23.077  -15.345 1.00 52.23 ? 131  LYS A NZ    1 
ATOM   1050 N  N     . ILE A 1 132 ? 6.253   17.863  -11.551 1.00 45.72 ? 132  ILE A N     1 
ATOM   1051 C  CA    . ILE A 1 132 ? 6.381   16.424  -11.660 1.00 45.83 ? 132  ILE A CA    1 
ATOM   1052 C  C     . ILE A 1 132 ? 5.225   15.878  -12.477 1.00 46.56 ? 132  ILE A C     1 
ATOM   1053 O  O     . ILE A 1 132 ? 5.414   14.949  -13.260 1.00 46.61 ? 132  ILE A O     1 
ATOM   1054 C  CB    . ILE A 1 132 ? 6.446   15.751  -10.287 1.00 45.72 ? 132  ILE A CB    1 
ATOM   1055 C  CG1   . ILE A 1 132 ? 7.679   16.238  -9.515  1.00 44.51 ? 132  ILE A CG1   1 
ATOM   1056 C  CG2   . ILE A 1 132 ? 6.490   14.228  -10.429 1.00 44.55 ? 132  ILE A CG2   1 
ATOM   1057 C  CD1   . ILE A 1 132 ? 7.601   15.923  -8.062  1.00 43.34 ? 132  ILE A CD1   1 
ATOM   1058 N  N     . LEU A 1 133 ? 4.046   16.475  -12.325 1.00 47.23 ? 133  LEU A N     1 
ATOM   1059 C  CA    . LEU A 1 133 ? 2.888   16.046  -13.090 1.00 47.98 ? 133  LEU A CA    1 
ATOM   1060 C  C     . LEU A 1 133 ? 3.045   16.370  -14.578 1.00 48.98 ? 133  LEU A C     1 
ATOM   1061 O  O     . LEU A 1 133 ? 2.632   15.593  -15.419 1.00 49.71 ? 133  LEU A O     1 
ATOM   1062 C  CB    . LEU A 1 133 ? 1.604   16.670  -12.549 1.00 47.96 ? 133  LEU A CB    1 
ATOM   1063 C  CG    . LEU A 1 133 ? 0.363   15.787  -12.732 1.00 48.60 ? 133  LEU A CG    1 
ATOM   1064 C  CD1   . LEU A 1 133 ? 0.296   14.772  -11.607 1.00 48.93 ? 133  LEU A CD1   1 
ATOM   1065 C  CD2   . LEU A 1 133 ? -0.933  16.590  -12.786 1.00 47.80 ? 133  LEU A CD2   1 
ATOM   1066 N  N     . GLU A 1 134 ? 3.626   17.516  -14.904 1.00 50.00 ? 134  GLU A N     1 
ATOM   1067 C  CA    . GLU A 1 134 ? 3.845   17.902  -16.300 1.00 50.97 ? 134  GLU A CA    1 
ATOM   1068 C  C     . GLU A 1 134 ? 4.952   17.052  -16.945 1.00 50.88 ? 134  GLU A C     1 
ATOM   1069 O  O     . GLU A 1 134 ? 4.818   16.584  -18.068 1.00 50.93 ? 134  GLU A O     1 
ATOM   1070 C  CB    . GLU A 1 134 ? 4.208   19.400  -16.402 1.00 50.80 ? 134  GLU A CB    1 
ATOM   1071 C  CG    . GLU A 1 134 ? 3.024   20.355  -16.162 1.00 52.44 ? 134  GLU A CG    1 
ATOM   1072 C  CD    . GLU A 1 134 ? 3.415   21.866  -16.110 1.00 53.62 ? 134  GLU A CD    1 
ATOM   1073 O  OE1   . GLU A 1 134 ? 4.632   22.192  -15.999 1.00 58.55 ? 134  GLU A OE1   1 
ATOM   1074 O  OE2   . GLU A 1 134 ? 2.494   22.727  -16.167 1.00 54.12 ? 134  GLU A OE2   1 
ATOM   1075 N  N     . LYS A 1 135 ? 6.041   16.842  -16.217 1.00 51.03 ? 135  LYS A N     1 
ATOM   1076 C  CA    . LYS A 1 135 ? 7.245   16.265  -16.795 1.00 50.99 ? 135  LYS A CA    1 
ATOM   1077 C  C     . LYS A 1 135 ? 7.256   14.751  -16.840 1.00 51.03 ? 135  LYS A C     1 
ATOM   1078 O  O     . LYS A 1 135 ? 7.821   14.175  -17.765 1.00 51.25 ? 135  LYS A O     1 
ATOM   1079 C  CB    . LYS A 1 135 ? 8.469   16.760  -16.033 1.00 50.96 ? 135  LYS A CB    1 
ATOM   1080 C  CG    . LYS A 1 135 ? 8.764   18.231  -16.261 1.00 51.04 ? 135  LYS A CG    1 
ATOM   1081 C  CD    . LYS A 1 135 ? 9.369   18.461  -17.640 1.00 50.96 ? 135  LYS A CD    1 
ATOM   1082 C  CE    . LYS A 1 135 ? 9.896   19.872  -17.793 1.00 50.20 ? 135  LYS A CE    1 
ATOM   1083 N  NZ    . LYS A 1 135 ? 10.204  20.140  -19.214 1.00 50.09 ? 135  LYS A NZ    1 
ATOM   1084 N  N     . GLU A 1 136 ? 6.656   14.112  -15.836 1.00 51.24 ? 136  GLU A N     1 
ATOM   1085 C  CA    . GLU A 1 136 ? 6.598   12.647  -15.756 1.00 51.05 ? 136  GLU A CA    1 
ATOM   1086 C  C     . GLU A 1 136 ? 5.203   12.053  -15.568 1.00 50.58 ? 136  GLU A C     1 
ATOM   1087 O  O     . GLU A 1 136 ? 5.063   10.833  -15.555 1.00 50.37 ? 136  GLU A O     1 
ATOM   1088 C  CB    . GLU A 1 136 ? 7.522   12.167  -14.634 1.00 51.34 ? 136  GLU A CB    1 
ATOM   1089 C  CG    . GLU A 1 136 ? 9.008   12.472  -14.901 1.00 53.04 ? 136  GLU A CG    1 
ATOM   1090 C  CD    . GLU A 1 136 ? 9.555   11.841  -16.203 1.00 55.32 ? 136  GLU A CD    1 
ATOM   1091 O  OE1   . GLU A 1 136 ? 9.086   10.737  -16.616 1.00 56.57 ? 136  GLU A OE1   1 
ATOM   1092 O  OE2   . GLU A 1 136 ? 10.474  12.448  -16.802 1.00 55.36 ? 136  GLU A OE2   1 
ATOM   1093 N  N     . LYS A 1 137 ? 4.181   12.906  -15.457 1.00 50.47 ? 137  LYS A N     1 
ATOM   1094 C  CA    . LYS A 1 137 ? 2.788   12.485  -15.182 1.00 50.60 ? 137  LYS A CA    1 
ATOM   1095 C  C     . LYS A 1 137 ? 2.653   11.638  -13.926 1.00 49.77 ? 137  LYS A C     1 
ATOM   1096 O  O     . LYS A 1 137 ? 1.751   10.822  -13.840 1.00 50.05 ? 137  LYS A O     1 
ATOM   1097 C  CB    . LYS A 1 137 ? 2.167   11.724  -16.365 1.00 50.48 ? 137  LYS A CB    1 
ATOM   1098 C  CG    . LYS A 1 137 ? 2.218   12.465  -17.679 1.00 51.41 ? 137  LYS A CG    1 
ATOM   1099 C  CD    . LYS A 1 137 ? 1.438   11.740  -18.762 1.00 52.57 ? 137  LYS A CD    1 
ATOM   1100 C  CE    . LYS A 1 137 ? 1.877   12.191  -20.172 1.00 55.55 ? 137  LYS A CE    1 
ATOM   1101 N  NZ    . LYS A 1 137 ? 1.623   13.659  -20.409 1.00 56.92 ? 137  LYS A NZ    1 
ATOM   1102 N  N     . ILE A 1 138 ? 3.542   11.847  -12.961 1.00 49.06 ? 138  ILE A N     1 
ATOM   1103 C  CA    . ILE A 1 138 ? 3.443   11.212  -11.649 1.00 48.64 ? 138  ILE A CA    1 
ATOM   1104 C  C     . ILE A 1 138 ? 2.884   12.188  -10.602 1.00 47.67 ? 138  ILE A C     1 
ATOM   1105 O  O     . ILE A 1 138 ? 3.322   13.333  -10.535 1.00 47.65 ? 138  ILE A O     1 
ATOM   1106 C  CB    . ILE A 1 138 ? 4.834   10.729  -11.157 1.00 48.28 ? 138  ILE A CB    1 
ATOM   1107 C  CG1   . ILE A 1 138 ? 5.277   9.535   -11.988 1.00 49.06 ? 138  ILE A CG1   1 
ATOM   1108 C  CG2   . ILE A 1 138 ? 4.775   10.370  -9.697  1.00 47.22 ? 138  ILE A CG2   1 
ATOM   1109 C  CD1   . ILE A 1 138 ? 4.268   8.402   -12.034 1.00 48.83 ? 138  ILE A CD1   1 
ATOM   1110 N  N     . THR A 1 139 ? 1.941   11.716  -9.788  1.00 46.44 ? 139  THR A N     1 
ATOM   1111 C  CA    . THR A 1 139 ? 1.432   12.483  -8.661  1.00 45.83 ? 139  THR A CA    1 
ATOM   1112 C  C     . THR A 1 139 ? 2.122   12.074  -7.384  1.00 45.39 ? 139  THR A C     1 
ATOM   1113 O  O     . THR A 1 139 ? 2.396   10.896  -7.151  1.00 45.71 ? 139  THR A O     1 
ATOM   1114 C  CB    . THR A 1 139 ? -0.068  12.319  -8.451  1.00 45.62 ? 139  THR A CB    1 
ATOM   1115 O  OG1   . THR A 1 139 ? -0.338  11.015  -7.931  1.00 45.69 ? 139  THR A OG1   1 
ATOM   1116 C  CG2   . THR A 1 139 ? -0.830  12.545  -9.758  1.00 44.75 ? 139  THR A CG2   1 
ATOM   1117 N  N     . VAL A 1 140 ? 2.376   13.067  -6.550  1.00 44.88 ? 140  VAL A N     1 
ATOM   1118 C  CA    . VAL A 1 140 ? 3.182   12.900  -5.367  1.00 44.40 ? 140  VAL A CA    1 
ATOM   1119 C  C     . VAL A 1 140 ? 2.505   13.542  -4.168  1.00 44.81 ? 140  VAL A C     1 
ATOM   1120 O  O     . VAL A 1 140 ? 1.580   14.357  -4.325  1.00 45.12 ? 140  VAL A O     1 
ATOM   1121 C  CB    . VAL A 1 140 ? 4.516   13.588  -5.563  1.00 44.32 ? 140  VAL A CB    1 
ATOM   1122 C  CG1   . VAL A 1 140 ? 5.201   13.049  -6.794  1.00 42.80 ? 140  VAL A CG1   1 
ATOM   1123 C  CG2   . VAL A 1 140 ? 4.324   15.107  -5.637  1.00 42.78 ? 140  VAL A CG2   1 
ATOM   1124 N  N     . THR A 1 141 ? 2.973   13.194  -2.972  1.00 44.52 ? 141  THR A N     1 
ATOM   1125 C  CA    . THR A 1 141 ? 2.490   13.849  -1.759  1.00 44.46 ? 141  THR A CA    1 
ATOM   1126 C  C     . THR A 1 141 ? 3.589   14.691  -1.100  1.00 44.11 ? 141  THR A C     1 
ATOM   1127 O  O     . THR A 1 141 ? 4.654   14.171  -0.788  1.00 44.96 ? 141  THR A O     1 
ATOM   1128 C  CB    . THR A 1 141 ? 1.957   12.825  -0.777  1.00 44.23 ? 141  THR A CB    1 
ATOM   1129 O  OG1   . THR A 1 141 ? 0.945   12.038  -1.420  1.00 44.69 ? 141  THR A OG1   1 
ATOM   1130 C  CG2   . THR A 1 141 ? 1.374   13.517  0.427   1.00 44.26 ? 141  THR A CG2   1 
ATOM   1131 N  N     . VAL A 1 142 ? 3.336   15.984  -0.908  1.00 43.34 ? 142  VAL A N     1 
ATOM   1132 C  CA    . VAL A 1 142 ? 4.253   16.852  -0.181  1.00 42.91 ? 142  VAL A CA    1 
ATOM   1133 C  C     . VAL A 1 142 ? 3.893   17.050  1.314   1.00 43.53 ? 142  VAL A C     1 
ATOM   1134 O  O     . VAL A 1 142 ? 2.725   17.250  1.685   1.00 43.29 ? 142  VAL A O     1 
ATOM   1135 C  CB    . VAL A 1 142 ? 4.336   18.216  -0.858  1.00 42.84 ? 142  VAL A CB    1 
ATOM   1136 C  CG1   . VAL A 1 142 ? 5.175   19.190  -0.032  1.00 41.35 ? 142  VAL A CG1   1 
ATOM   1137 C  CG2   . VAL A 1 142 ? 4.914   18.060  -2.255  1.00 42.24 ? 142  VAL A CG2   1 
ATOM   1138 N  N     . GLY A 1 143 ? 4.919   16.998  2.167   1.00 43.95 ? 143  GLY A N     1 
ATOM   1139 C  CA    . GLY A 1 143 ? 4.780   17.279  3.602   1.00 44.05 ? 143  GLY A CA    1 
ATOM   1140 C  C     . GLY A 1 143 ? 5.798   18.342  3.979   1.00 44.28 ? 143  GLY A C     1 
ATOM   1141 O  O     . GLY A 1 143 ? 6.975   18.187  3.688   1.00 45.43 ? 143  GLY A O     1 
ATOM   1142 N  N     . ILE A 1 144 ? 5.348   19.427  4.604   1.00 44.00 ? 144  ILE A N     1 
ATOM   1143 C  CA    . ILE A 1 144 ? 6.211   20.524  5.005   1.00 43.63 ? 144  ILE A CA    1 
ATOM   1144 C  C     . ILE A 1 144 ? 6.173   20.706  6.533   1.00 43.76 ? 144  ILE A C     1 
ATOM   1145 O  O     . ILE A 1 144 ? 5.095   20.828  7.128   1.00 43.26 ? 144  ILE A O     1 
ATOM   1146 C  CB    . ILE A 1 144 ? 5.749   21.847  4.330   1.00 43.80 ? 144  ILE A CB    1 
ATOM   1147 C  CG1   . ILE A 1 144 ? 5.857   21.743  2.803   1.00 43.76 ? 144  ILE A CG1   1 
ATOM   1148 C  CG2   . ILE A 1 144 ? 6.560   23.041  4.834   1.00 42.33 ? 144  ILE A CG2   1 
ATOM   1149 C  CD1   . ILE A 1 144 ? 4.984   22.754  2.043   1.00 43.28 ? 144  ILE A CD1   1 
ATOM   1150 N  N     . SER A 1 145 ? 7.344   20.733  7.167   1.00 43.62 ? 145  SER A N     1 
ATOM   1151 C  CA    . SER A 1 145 ? 7.429   21.158  8.566   1.00 43.46 ? 145  SER A CA    1 
ATOM   1152 C  C     . SER A 1 145 ? 8.815   21.656  8.903   1.00 43.49 ? 145  SER A C     1 
ATOM   1153 O  O     . SER A 1 145 ? 9.674   21.763  8.030   1.00 43.42 ? 145  SER A O     1 
ATOM   1154 C  CB    . SER A 1 145 ? 7.037   20.027  9.529   1.00 43.54 ? 145  SER A CB    1 
ATOM   1155 O  OG    . SER A 1 145 ? 6.832   20.539  10.842  1.00 41.58 ? 145  SER A OG    1 
ATOM   1156 N  N     . LYS A 1 146 ? 9.027   21.935  10.185  1.00 43.40 ? 146  LYS A N     1 
ATOM   1157 C  CA    . LYS A 1 146 ? 10.314  22.422  10.670  1.00 43.53 ? 146  LYS A CA    1 
ATOM   1158 C  C     . LYS A 1 146 ? 11.421  21.358  10.704  1.00 43.21 ? 146  LYS A C     1 
ATOM   1159 O  O     . LYS A 1 146 ? 12.571  21.691  10.959  1.00 43.40 ? 146  LYS A O     1 
ATOM   1160 C  CB    . LYS A 1 146 ? 10.165  23.031  12.075  1.00 43.65 ? 146  LYS A CB    1 
ATOM   1161 C  CG    . LYS A 1 146 ? 10.322  22.005  13.208  1.00 44.90 ? 146  LYS A CG    1 
ATOM   1162 C  CD    . LYS A 1 146 ? 9.549   22.380  14.452  1.00 45.78 ? 146  LYS A CD    1 
ATOM   1163 C  CE    . LYS A 1 146 ? 10.203  23.486  15.230  1.00 45.24 ? 146  LYS A CE    1 
ATOM   1164 N  NZ    . LYS A 1 146 ? 9.199   24.021  16.185  1.00 45.86 ? 146  LYS A NZ    1 
ATOM   1165 N  N     . ASN A 1 147 ? 11.090  20.087  10.507  1.00 43.14 ? 147  ASN A N     1 
ATOM   1166 C  CA    . ASN A 1 147 ? 12.124  19.049  10.443  1.00 43.10 ? 147  ASN A CA    1 
ATOM   1167 C  C     . ASN A 1 147 ? 11.735  17.759  9.718   1.00 42.89 ? 147  ASN A C     1 
ATOM   1168 O  O     . ASN A 1 147 ? 10.587  17.530  9.394   1.00 42.64 ? 147  ASN A O     1 
ATOM   1169 C  CB    . ASN A 1 147 ? 12.637  18.725  11.850  1.00 43.34 ? 147  ASN A CB    1 
ATOM   1170 C  CG    . ASN A 1 147 ? 11.619  18.020  12.693  1.00 42.99 ? 147  ASN A CG    1 
ATOM   1171 O  OD1   . ASN A 1 147 ? 10.932  17.103  12.234  1.00 43.72 ? 147  ASN A OD1   1 
ATOM   1172 N  ND2   . ASN A 1 147 ? 11.524  18.428  13.948  1.00 42.43 ? 147  ASN A ND2   1 
ATOM   1173 N  N     . LYS A 1 148 ? 12.721  16.915  9.479   1.00 43.29 ? 148  LYS A N     1 
ATOM   1174 C  CA    . LYS A 1 148 ? 12.522  15.703  8.708   1.00 43.65 ? 148  LYS A CA    1 
ATOM   1175 C  C     . LYS A 1 148 ? 11.396  14.829  9.246   1.00 43.52 ? 148  LYS A C     1 
ATOM   1176 O  O     . LYS A 1 148 ? 10.520  14.407  8.478   1.00 43.22 ? 148  LYS A O     1 
ATOM   1177 C  CB    . LYS A 1 148 ? 13.814  14.909  8.635   1.00 43.88 ? 148  LYS A CB    1 
ATOM   1178 C  CG    . LYS A 1 148 ? 14.921  15.646  7.875   1.00 46.01 ? 148  LYS A CG    1 
ATOM   1179 C  CD    . LYS A 1 148 ? 15.966  14.702  7.299   1.00 47.45 ? 148  LYS A CD    1 
ATOM   1180 C  CE    . LYS A 1 148 ? 16.967  14.243  8.342   1.00 48.18 ? 148  LYS A CE    1 
ATOM   1181 N  NZ    . LYS A 1 148 ? 17.993  13.340  7.695   1.00 50.19 ? 148  LYS A NZ    1 
ATOM   1182 N  N     . VAL A 1 149 ? 11.400  14.581  10.554  1.00 43.32 ? 149  VAL A N     1 
ATOM   1183 C  CA    . VAL A 1 149 ? 10.385  13.727  11.149  1.00 43.33 ? 149  VAL A CA    1 
ATOM   1184 C  C     . VAL A 1 149 ? 8.998   14.268  10.846  1.00 43.38 ? 149  VAL A C     1 
ATOM   1185 O  O     . VAL A 1 149 ? 8.162   13.553  10.316  1.00 43.52 ? 149  VAL A O     1 
ATOM   1186 C  CB    . VAL A 1 149 ? 10.556  13.566  12.660  1.00 43.28 ? 149  VAL A CB    1 
ATOM   1187 C  CG1   . VAL A 1 149 ? 9.392   12.763  13.245  1.00 43.70 ? 149  VAL A CG1   1 
ATOM   1188 C  CG2   . VAL A 1 149 ? 11.858  12.867  12.967  1.00 43.45 ? 149  VAL A CG2   1 
ATOM   1189 N  N     . PHE A 1 150 ? 8.759   15.534  11.146  1.00 43.81 ? 150  PHE A N     1 
ATOM   1190 C  CA    . PHE A 1 150 ? 7.410   16.100  10.972  1.00 44.24 ? 150  PHE A CA    1 
ATOM   1191 C  C     . PHE A 1 150 ? 6.991   16.329  9.524   1.00 43.75 ? 150  PHE A C     1 
ATOM   1192 O  O     . PHE A 1 150 ? 5.809   16.253  9.221   1.00 43.81 ? 150  PHE A O     1 
ATOM   1193 C  CB    . PHE A 1 150 ? 7.219   17.351  11.839  1.00 44.59 ? 150  PHE A CB    1 
ATOM   1194 C  CG    . PHE A 1 150 ? 7.091   17.022  13.297  1.00 45.62 ? 150  PHE A CG    1 
ATOM   1195 C  CD1   . PHE A 1 150 ? 5.921   16.458  13.785  1.00 46.29 ? 150  PHE A CD1   1 
ATOM   1196 C  CD2   . PHE A 1 150 ? 8.164   17.193  14.165  1.00 46.63 ? 150  PHE A CD2   1 
ATOM   1197 C  CE1   . PHE A 1 150 ? 5.809   16.104  15.118  1.00 46.76 ? 150  PHE A CE1   1 
ATOM   1198 C  CE2   . PHE A 1 150 ? 8.055   16.848  15.499  1.00 46.38 ? 150  PHE A CE2   1 
ATOM   1199 C  CZ    . PHE A 1 150 ? 6.880   16.298  15.977  1.00 46.04 ? 150  PHE A CZ    1 
ATOM   1200 N  N     . ALA A 1 151 ? 7.949   16.562  8.635   1.00 43.52 ? 151  ALA A N     1 
ATOM   1201 C  CA    . ALA A 1 151 ? 7.661   16.595  7.200   1.00 43.45 ? 151  ALA A CA    1 
ATOM   1202 C  C     . ALA A 1 151 ? 7.120   15.261  6.756   1.00 43.68 ? 151  ALA A C     1 
ATOM   1203 O  O     . ALA A 1 151 ? 6.153   15.217  6.013   1.00 44.22 ? 151  ALA A O     1 
ATOM   1204 C  CB    . ALA A 1 151 ? 8.889   16.948  6.398   1.00 42.95 ? 151  ALA A CB    1 
ATOM   1205 N  N     . LYS A 1 152 ? 7.733   14.176  7.233   1.00 44.07 ? 152  LYS A N     1 
ATOM   1206 C  CA    . LYS A 1 152 ? 7.289   12.819  6.916   1.00 44.11 ? 152  LYS A CA    1 
ATOM   1207 C  C     . LYS A 1 152 ? 5.929   12.495  7.513   1.00 43.55 ? 152  LYS A C     1 
ATOM   1208 O  O     . LYS A 1 152 ? 5.086   11.933  6.826   1.00 43.32 ? 152  LYS A O     1 
ATOM   1209 C  CB    . LYS A 1 152 ? 8.315   11.791  7.397   1.00 44.94 ? 152  LYS A CB    1 
ATOM   1210 C  CG    . LYS A 1 152 ? 8.029   10.347  6.938   1.00 47.07 ? 152  LYS A CG    1 
ATOM   1211 C  CD    . LYS A 1 152 ? 9.314   9.617   6.486   1.00 49.68 ? 152  LYS A CD    1 
ATOM   1212 C  CE    . LYS A 1 152 ? 9.014   8.313   5.738   1.00 48.34 ? 152  LYS A CE    1 
ATOM   1213 N  NZ    . LYS A 1 152 ? 8.369   7.389   6.692   1.00 50.95 ? 152  LYS A NZ    1 
ATOM   1214 N  N     . ILE A 1 153 ? 5.725   12.818  8.792   1.00 43.41 ? 153  ILE A N     1 
ATOM   1215 C  CA    . ILE A 1 153 ? 4.406   12.673  9.430   1.00 43.26 ? 153  ILE A CA    1 
ATOM   1216 C  C     . ILE A 1 153 ? 3.342   13.443  8.651   1.00 43.89 ? 153  ILE A C     1 
ATOM   1217 O  O     . ILE A 1 153 ? 2.249   12.931  8.429   1.00 44.02 ? 153  ILE A O     1 
ATOM   1218 C  CB    . ILE A 1 153 ? 4.385   13.163  10.897  1.00 43.11 ? 153  ILE A CB    1 
ATOM   1219 C  CG1   . ILE A 1 153 ? 5.217   12.207  11.773  1.00 43.59 ? 153  ILE A CG1   1 
ATOM   1220 C  CG2   . ILE A 1 153 ? 2.944   13.257  11.410  1.00 39.98 ? 153  ILE A CG2   1 
ATOM   1221 C  CD1   . ILE A 1 153 ? 5.350   12.605  13.270  1.00 43.02 ? 153  ILE A CD1   1 
ATOM   1222 N  N     . ALA A 1 154 ? 3.672   14.654  8.206   1.00 44.14 ? 154  ALA A N     1 
ATOM   1223 C  CA    . ALA A 1 154 ? 2.693   15.482  7.510   1.00 44.56 ? 154  ALA A CA    1 
ATOM   1224 C  C     . ALA A 1 154 ? 2.324   14.841  6.174   1.00 44.78 ? 154  ALA A C     1 
ATOM   1225 O  O     . ALA A 1 154 ? 1.157   14.795  5.810   1.00 44.50 ? 154  ALA A O     1 
ATOM   1226 C  CB    . ALA A 1 154 ? 3.203   16.952  7.329   1.00 44.13 ? 154  ALA A CB    1 
ATOM   1227 N  N     . ALA A 1 155 ? 3.314   14.330  5.455   1.00 45.43 ? 155  ALA A N     1 
ATOM   1228 C  CA    . ALA A 1 155 ? 3.039   13.646  4.202   1.00 46.24 ? 155  ALA A CA    1 
ATOM   1229 C  C     . ALA A 1 155 ? 2.128   12.444  4.440   1.00 47.40 ? 155  ALA A C     1 
ATOM   1230 O  O     . ALA A 1 155 ? 1.205   12.200  3.652   1.00 47.33 ? 155  ALA A O     1 
ATOM   1231 C  CB    . ALA A 1 155 ? 4.322   13.204  3.543   1.00 45.87 ? 155  ALA A CB    1 
ATOM   1232 N  N     . ASP A 1 156 ? 2.373   11.701  5.522   1.00 48.60 ? 156  ASP A N     1 
ATOM   1233 C  CA    . ASP A 1 156 ? 1.622   10.471  5.772   1.00 50.14 ? 156  ASP A CA    1 
ATOM   1234 C  C     . ASP A 1 156 ? 0.135   10.772  5.985   1.00 50.39 ? 156  ASP A C     1 
ATOM   1235 O  O     . ASP A 1 156 ? -0.727  9.975   5.619   1.00 50.84 ? 156  ASP A O     1 
ATOM   1236 C  CB    . ASP A 1 156 ? 2.190   9.697   6.973   1.00 50.63 ? 156  ASP A CB    1 
ATOM   1237 C  CG    . ASP A 1 156 ? 3.623   9.151   6.727   1.00 53.41 ? 156  ASP A CG    1 
ATOM   1238 O  OD1   . ASP A 1 156 ? 4.011   8.871   5.550   1.00 54.78 ? 156  ASP A OD1   1 
ATOM   1239 O  OD2   . ASP A 1 156 ? 4.365   9.012   7.740   1.00 56.07 ? 156  ASP A OD2   1 
ATOM   1240 N  N     . MET A 1 157 ? -0.150  11.932  6.559   1.00 50.28 ? 157  MET A N     1 
ATOM   1241 C  CA    . MET A 1 157 ? -1.506  12.345  6.841   1.00 50.59 ? 157  MET A CA    1 
ATOM   1242 C  C     . MET A 1 157 ? -2.276  12.792  5.604   1.00 50.19 ? 157  MET A C     1 
ATOM   1243 O  O     . MET A 1 157 ? -3.508  12.813  5.604   1.00 50.43 ? 157  MET A O     1 
ATOM   1244 C  CB    . MET A 1 157 ? -1.473  13.511  7.819   1.00 50.73 ? 157  MET A CB    1 
ATOM   1245 C  CG    . MET A 1 157 ? -0.914  13.160  9.163   1.00 50.72 ? 157  MET A CG    1 
ATOM   1246 S  SD    . MET A 1 157 ? -0.993  14.629  10.177  1.00 52.55 ? 157  MET A SD    1 
ATOM   1247 C  CE    . MET A 1 157 ? -0.770  13.952  11.833  1.00 52.33 ? 157  MET A CE    1 
ATOM   1248 N  N     . ALA A 1 158 ? -1.547  13.176  4.567   1.00 49.77 ? 158  ALA A N     1 
ATOM   1249 C  CA    . ALA A 1 158 ? -2.134  13.734  3.366   1.00 49.35 ? 158  ALA A CA    1 
ATOM   1250 C  C     . ALA A 1 158 ? -2.115  12.781  2.160   1.00 49.25 ? 158  ALA A C     1 
ATOM   1251 O  O     . ALA A 1 158 ? -2.722  13.103  1.149   1.00 49.54 ? 158  ALA A O     1 
ATOM   1252 C  CB    . ALA A 1 158 ? -1.429  15.013  3.025   1.00 49.12 ? 158  ALA A CB    1 
ATOM   1253 N  N     . LYS A 1 159 ? -1.456  11.625  2.266   1.00 49.08 ? 159  LYS A N     1 
ATOM   1254 C  CA    . LYS A 1 159 ? -1.392  10.627  1.170   1.00 49.38 ? 159  LYS A CA    1 
ATOM   1255 C  C     . LYS A 1 159 ? -2.705  10.397  0.453   1.00 49.45 ? 159  LYS A C     1 
ATOM   1256 O  O     . LYS A 1 159 ? -3.737  10.318  1.093   1.00 48.98 ? 159  LYS A O     1 
ATOM   1257 C  CB    . LYS A 1 159 ? -0.792  9.281   1.630   1.00 49.38 ? 159  LYS A CB    1 
ATOM   1258 C  CG    . LYS A 1 159 ? 0.689   9.242   1.434   1.00 50.37 ? 159  LYS A CG    1 
ATOM   1259 C  CD    . LYS A 1 159 ? 1.325   7.964   1.924   1.00 51.66 ? 159  LYS A CD    1 
ATOM   1260 C  CE    . LYS A 1 159 ? 2.851   8.053   1.825   1.00 51.16 ? 159  LYS A CE    1 
ATOM   1261 N  NZ    . LYS A 1 159 ? 3.459   7.118   2.756   1.00 52.46 ? 159  LYS A NZ    1 
ATOM   1262 N  N     . PRO A 1 160 ? -2.600  9.996   -0.826  1.00 50.11 ? 160  PRO A N     1 
ATOM   1263 C  CA    . PRO A 1 160 ? -2.765  10.304  -2.213  1.00 49.95 ? 160  PRO A CA    1 
ATOM   1264 C  C     . PRO A 1 160 ? -2.848  11.770  -2.571  1.00 49.55 ? 160  PRO A C     1 
ATOM   1265 O  O     . PRO A 1 160 ? -3.771  12.478  -2.169  1.00 49.21 ? 160  PRO A O     1 
ATOM   1266 C  CB    . PRO A 1 160 ? -4.065  9.551   -2.572  1.00 50.20 ? 160  PRO A CB    1 
ATOM   1267 C  CG    . PRO A 1 160 ? -4.236  8.554   -1.509  1.00 50.10 ? 160  PRO A CG    1 
ATOM   1268 C  CD    . PRO A 1 160 ? -2.927  8.575   -0.741  1.00 50.72 ? 160  PRO A CD    1 
ATOM   1269 N  N     . ASN A 1 161 ? -1.876  12.203  -3.352  1.00 49.17 ? 161  ASN A N     1 
ATOM   1270 C  CA    . ASN A 1 161 ? -2.019  13.420  -4.092  1.00 49.12 ? 161  ASN A CA    1 
ATOM   1271 C  C     . ASN A 1 161 ? -2.416  14.569  -3.167  1.00 48.58 ? 161  ASN A C     1 
ATOM   1272 O  O     . ASN A 1 161 ? -3.340  15.319  -3.454  1.00 48.91 ? 161  ASN A O     1 
ATOM   1273 C  CB    . ASN A 1 161 ? -3.073  13.214  -5.194  1.00 49.08 ? 161  ASN A CB    1 
ATOM   1274 C  CG    . ASN A 1 161 ? -3.067  14.323  -6.245  1.00 49.92 ? 161  ASN A CG    1 
ATOM   1275 O  OD1   . ASN A 1 161 ? -2.198  15.215  -6.255  1.00 51.36 ? 161  ASN A OD1   1 
ATOM   1276 N  ND2   . ASN A 1 161 ? -4.050  14.276  -7.131  1.00 50.45 ? 161  ASN A ND2   1 
ATOM   1277 N  N     . GLY A 1 162 ? -1.718  14.705  -2.053  1.00 47.75 ? 162  GLY A N     1 
ATOM   1278 C  CA    . GLY A 1 162 ? -1.980  15.818  -1.167  1.00 47.37 ? 162  GLY A CA    1 
ATOM   1279 C  C     . GLY A 1 162 ? -0.776  16.705  -0.925  1.00 46.90 ? 162  GLY A C     1 
ATOM   1280 O  O     . GLY A 1 162 ? 0.278   16.556  -1.545  1.00 46.92 ? 162  GLY A O     1 
ATOM   1281 N  N     . ILE A 1 163 ? -0.969  17.634  0.001   1.00 46.26 ? 163  ILE A N     1 
ATOM   1282 C  CA    . ILE A 1 163 ? 0.055   18.551  0.454   1.00 45.50 ? 163  ILE A CA    1 
ATOM   1283 C  C     . ILE A 1 163 ? -0.399  19.013  1.837   1.00 44.90 ? 163  ILE A C     1 
ATOM   1284 O  O     . ILE A 1 163 ? -1.563  19.302  2.027   1.00 43.81 ? 163  ILE A O     1 
ATOM   1285 C  CB    . ILE A 1 163 ? 0.232   19.757  -0.525  1.00 45.57 ? 163  ILE A CB    1 
ATOM   1286 C  CG1   . ILE A 1 163 ? 1.223   20.788  0.053   1.00 45.76 ? 163  ILE A CG1   1 
ATOM   1287 C  CG2   . ILE A 1 163 ? -1.122  20.396  -0.844  1.00 43.96 ? 163  ILE A CG2   1 
ATOM   1288 C  CD1   . ILE A 1 163 ? 1.745   21.829  -0.957  1.00 45.37 ? 163  ILE A CD1   1 
ATOM   1289 N  N     . LYS A 1 164 ? 0.528   19.045  2.793   1.00 44.89 ? 164  LYS A N     1 
ATOM   1290 C  CA    . LYS A 1 164 ? 0.226   19.439  4.163   1.00 44.88 ? 164  LYS A CA    1 
ATOM   1291 C  C     . LYS A 1 164 ? 1.411   20.099  4.893   1.00 44.81 ? 164  LYS A C     1 
ATOM   1292 O  O     . LYS A 1 164 ? 2.546   19.637  4.827   1.00 44.72 ? 164  LYS A O     1 
ATOM   1293 C  CB    . LYS A 1 164 ? -0.280  18.241  4.971   1.00 44.64 ? 164  LYS A CB    1 
ATOM   1294 C  CG    . LYS A 1 164 ? -0.577  18.595  6.431   1.00 45.25 ? 164  LYS A CG    1 
ATOM   1295 C  CD    . LYS A 1 164 ? -1.516  17.605  7.095   1.00 46.02 ? 164  LYS A CD    1 
ATOM   1296 C  CE    . LYS A 1 164 ? -1.673  17.889  8.569   1.00 46.86 ? 164  LYS A CE    1 
ATOM   1297 N  NZ    . LYS A 1 164 ? -1.748  19.354  8.858   1.00 48.48 ? 164  LYS A NZ    1 
ATOM   1298 N  N     . VAL A 1 165 ? 1.107   21.181  5.599   1.00 44.72 ? 165  VAL A N     1 
ATOM   1299 C  CA    . VAL A 1 165 ? 2.053   21.857  6.458   1.00 44.64 ? 165  VAL A CA    1 
ATOM   1300 C  C     . VAL A 1 165 ? 1.702   21.528  7.912   1.00 45.24 ? 165  VAL A C     1 
ATOM   1301 O  O     . VAL A 1 165 ? 0.554   21.659  8.304   1.00 45.64 ? 165  VAL A O     1 
ATOM   1302 C  CB    . VAL A 1 165 ? 1.992   23.402  6.251   1.00 44.29 ? 165  VAL A CB    1 
ATOM   1303 C  CG1   . VAL A 1 165 ? 2.948   24.119  7.194   1.00 42.76 ? 165  VAL A CG1   1 
ATOM   1304 C  CG2   . VAL A 1 165 ? 2.312   23.758  4.810   1.00 43.35 ? 165  VAL A CG2   1 
ATOM   1305 N  N     . ILE A 1 166 ? 2.687   21.092  8.698   1.00 45.68 ? 166  ILE A N     1 
ATOM   1306 C  CA    . ILE A 1 166 ? 2.569   21.058  10.149  1.00 46.06 ? 166  ILE A CA    1 
ATOM   1307 C  C     . ILE A 1 166 ? 3.379   22.224  10.716  1.00 46.88 ? 166  ILE A C     1 
ATOM   1308 O  O     . ILE A 1 166 ? 4.589   22.137  10.849  1.00 47.60 ? 166  ILE A O     1 
ATOM   1309 C  CB    . ILE A 1 166 ? 3.078   19.744  10.716  1.00 45.72 ? 166  ILE A CB    1 
ATOM   1310 C  CG1   . ILE A 1 166 ? 2.153   18.605  10.293  1.00 46.79 ? 166  ILE A CG1   1 
ATOM   1311 C  CG2   . ILE A 1 166 ? 3.138   19.808  12.218  1.00 45.85 ? 166  ILE A CG2   1 
ATOM   1312 C  CD1   . ILE A 1 166 ? 2.674   17.196  10.632  1.00 45.79 ? 166  ILE A CD1   1 
ATOM   1313 N  N     . ASP A 1 167 ? 2.724   23.328  11.040  1.00 48.01 ? 167  ASP A N     1 
ATOM   1314 C  CA    . ASP A 1 167 ? 3.461   24.519  11.494  1.00 48.94 ? 167  ASP A CA    1 
ATOM   1315 C  C     . ASP A 1 167 ? 3.825   24.360  12.971  1.00 49.63 ? 167  ASP A C     1 
ATOM   1316 O  O     . ASP A 1 167 ? 3.480   23.349  13.578  1.00 50.11 ? 167  ASP A O     1 
ATOM   1317 C  CB    . ASP A 1 167 ? 2.682   25.818  11.203  1.00 48.64 ? 167  ASP A CB    1 
ATOM   1318 C  CG    . ASP A 1 167 ? 1.393   25.953  12.020  1.00 49.46 ? 167  ASP A CG    1 
ATOM   1319 O  OD1   . ASP A 1 167 ? 1.140   25.140  12.934  1.00 50.12 ? 167  ASP A OD1   1 
ATOM   1320 O  OD2   . ASP A 1 167 ? 0.620   26.900  11.746  1.00 51.10 ? 167  ASP A OD2   1 
ATOM   1321 N  N     . ASP A 1 168 ? 4.511   25.340  13.545  1.00 50.35 ? 168  ASP A N     1 
ATOM   1322 C  CA    . ASP A 1 168 ? 5.076   25.186  14.885  1.00 51.22 ? 168  ASP A CA    1 
ATOM   1323 C  C     . ASP A 1 168 ? 4.034   24.885  15.974  1.00 51.80 ? 168  ASP A C     1 
ATOM   1324 O  O     . ASP A 1 168 ? 4.310   24.114  16.891  1.00 51.89 ? 168  ASP A O     1 
ATOM   1325 C  CB    . ASP A 1 168 ? 5.948   26.405  15.253  1.00 51.32 ? 168  ASP A CB    1 
ATOM   1326 C  CG    . ASP A 1 168 ? 7.310   26.414  14.513  1.00 52.24 ? 168  ASP A CG    1 
ATOM   1327 O  OD1   . ASP A 1 168 ? 7.449   25.771  13.445  1.00 53.36 ? 168  ASP A OD1   1 
ATOM   1328 O  OD2   . ASP A 1 168 ? 8.256   27.071  14.999  1.00 53.94 ? 168  ASP A OD2   1 
ATOM   1329 N  N     . GLU A 1 169 ? 2.842   25.469  15.862  1.00 52.60 ? 169  GLU A N     1 
ATOM   1330 C  CA    . GLU A 1 169 ? 1.770   25.226  16.834  1.00 53.16 ? 169  GLU A CA    1 
ATOM   1331 C  C     . GLU A 1 169 ? 1.254   23.786  16.741  1.00 53.18 ? 169  GLU A C     1 
ATOM   1332 O  O     . GLU A 1 169 ? 0.929   23.177  17.755  1.00 53.47 ? 169  GLU A O     1 
ATOM   1333 C  CB    . GLU A 1 169 ? 0.597   26.199  16.634  1.00 53.29 ? 169  GLU A CB    1 
ATOM   1334 C  CG    . GLU A 1 169 ? 0.972   27.661  16.698  1.00 55.09 ? 169  GLU A CG    1 
ATOM   1335 C  CD    . GLU A 1 169 ? 1.419   28.102  18.095  1.00 58.18 ? 169  GLU A CD    1 
ATOM   1336 O  OE1   . GLU A 1 169 ? 0.553   28.490  18.911  1.00 59.52 ? 169  GLU A OE1   1 
ATOM   1337 O  OE2   . GLU A 1 169 ? 2.641   28.076  18.377  1.00 59.88 ? 169  GLU A OE2   1 
ATOM   1338 N  N     . GLU A 1 170 ? 1.163   23.246  15.531  1.00 53.13 ? 170  GLU A N     1 
ATOM   1339 C  CA    . GLU A 1 170 ? 0.651   21.887  15.359  1.00 53.44 ? 170  GLU A CA    1 
ATOM   1340 C  C     . GLU A 1 170 ? 1.676   20.867  15.846  1.00 52.94 ? 170  GLU A C     1 
ATOM   1341 O  O     . GLU A 1 170 ? 1.312   19.788  16.315  1.00 53.03 ? 170  GLU A O     1 
ATOM   1342 C  CB    . GLU A 1 170 ? 0.225   21.610  13.902  1.00 53.63 ? 170  GLU A CB    1 
ATOM   1343 C  CG    . GLU A 1 170 ? -0.354  20.193  13.691  1.00 55.98 ? 170  GLU A CG    1 
ATOM   1344 C  CD    . GLU A 1 170 ? -1.636  20.149  12.849  1.00 59.44 ? 170  GLU A CD    1 
ATOM   1345 O  OE1   . GLU A 1 170 ? -1.677  19.407  11.833  1.00 60.25 ? 170  GLU A OE1   1 
ATOM   1346 O  OE2   . GLU A 1 170 ? -2.615  20.841  13.222  1.00 62.20 ? 170  GLU A OE2   1 
ATOM   1347 N  N     . VAL A 1 171 ? 2.955   21.215  15.737  1.00 52.45 ? 171  VAL A N     1 
ATOM   1348 C  CA    . VAL A 1 171 ? 4.021   20.385  16.279  1.00 51.92 ? 171  VAL A CA    1 
ATOM   1349 C  C     . VAL A 1 171 ? 3.781   20.252  17.772  1.00 52.21 ? 171  VAL A C     1 
ATOM   1350 O  O     . VAL A 1 171 ? 3.745   19.143  18.295  1.00 51.76 ? 171  VAL A O     1 
ATOM   1351 C  CB    . VAL A 1 171 ? 5.413   20.985  15.988  1.00 51.62 ? 171  VAL A CB    1 
ATOM   1352 C  CG1   . VAL A 1 171 ? 6.495   20.251  16.747  1.00 50.46 ? 171  VAL A CG1   1 
ATOM   1353 C  CG2   . VAL A 1 171 ? 5.687   20.964  14.489  1.00 51.07 ? 171  VAL A CG2   1 
ATOM   1354 N  N     . LYS A 1 172 ? 3.570   21.387  18.447  1.00 52.94 ? 172  LYS A N     1 
ATOM   1355 C  CA    . LYS A 1 172 ? 3.278   21.387  19.887  1.00 53.23 ? 172  LYS A CA    1 
ATOM   1356 C  C     . LYS A 1 172 ? 2.102   20.453  20.166  1.00 53.29 ? 172  LYS A C     1 
ATOM   1357 O  O     . LYS A 1 172 ? 2.178   19.602  21.041  1.00 53.08 ? 172  LYS A O     1 
ATOM   1358 C  CB    . LYS A 1 172 ? 2.964   22.796  20.412  1.00 53.42 ? 172  LYS A CB    1 
ATOM   1359 C  CG    . LYS A 1 172 ? 4.086   23.854  20.264  1.00 54.32 ? 172  LYS A CG    1 
ATOM   1360 C  CD    . LYS A 1 172 ? 5.085   23.897  21.434  1.00 54.33 ? 172  LYS A CD    1 
ATOM   1361 C  CE    . LYS A 1 172 ? 6.052   22.692  21.406  1.00 54.67 ? 172  LYS A CE    1 
ATOM   1362 N  NZ    . LYS A 1 172 ? 7.357   22.952  22.097  1.00 53.46 ? 172  LYS A NZ    1 
ATOM   1363 N  N     . ARG A 1 173 ? 1.036   20.595  19.387  1.00 53.68 ? 173  ARG A N     1 
ATOM   1364 C  CA    . ARG A 1 173 ? -0.175  19.803  19.579  1.00 54.19 ? 173  ARG A CA    1 
ATOM   1365 C  C     . ARG A 1 173 ? 0.054   18.321  19.305  1.00 54.15 ? 173  ARG A C     1 
ATOM   1366 O  O     . ARG A 1 173 ? -0.454  17.472  20.032  1.00 54.19 ? 173  ARG A O     1 
ATOM   1367 C  CB    . ARG A 1 173 ? -1.291  20.329  18.678  1.00 54.35 ? 173  ARG A CB    1 
ATOM   1368 C  CG    . ARG A 1 173 ? -2.665  19.710  18.922  1.00 54.72 ? 173  ARG A CG    1 
ATOM   1369 C  CD    . ARG A 1 173 ? -3.698  20.229  17.908  1.00 55.08 ? 173  ARG A CD    1 
ATOM   1370 N  NE    . ARG A 1 173 ? -3.521  19.647  16.577  1.00 55.26 ? 173  ARG A NE    1 
ATOM   1371 C  CZ    . ARG A 1 173 ? -3.868  18.407  16.234  1.00 56.09 ? 173  ARG A CZ    1 
ATOM   1372 N  NH1   . ARG A 1 173 ? -4.411  17.583  17.127  1.00 56.25 ? 173  ARG A NH1   1 
ATOM   1373 N  NH2   . ARG A 1 173 ? -3.656  17.975  14.991  1.00 56.51 ? 173  ARG A NH2   1 
ATOM   1374 N  N     . LEU A 1 174 ? 0.810   18.014  18.258  1.00 54.38 ? 174  LEU A N     1 
ATOM   1375 C  CA    . LEU A 1 174 ? 1.071   16.628  17.881  1.00 54.57 ? 174  LEU A CA    1 
ATOM   1376 C  C     . LEU A 1 174 ? 1.991   15.939  18.887  1.00 54.87 ? 174  LEU A C     1 
ATOM   1377 O  O     . LEU A 1 174 ? 1.813   14.766  19.175  1.00 55.05 ? 174  LEU A O     1 
ATOM   1378 C  CB    . LEU A 1 174 ? 1.656   16.544  16.468  1.00 54.69 ? 174  LEU A CB    1 
ATOM   1379 C  CG    . LEU A 1 174 ? 0.680   16.667  15.290  1.00 54.99 ? 174  LEU A CG    1 
ATOM   1380 C  CD1   . LEU A 1 174 ? 1.416   16.494  13.968  1.00 54.19 ? 174  LEU A CD1   1 
ATOM   1381 C  CD2   . LEU A 1 174 ? -0.455  15.645  15.397  1.00 55.20 ? 174  LEU A CD2   1 
ATOM   1382 N  N     . ILE A 1 175 ? 2.967   16.667  19.423  1.00 55.34 ? 175  ILE A N     1 
ATOM   1383 C  CA    . ILE A 1 175 ? 3.747   16.196  20.573  1.00 55.57 ? 175  ILE A CA    1 
ATOM   1384 C  C     . ILE A 1 175 ? 2.835   15.823  21.759  1.00 55.71 ? 175  ILE A C     1 
ATOM   1385 O  O     . ILE A 1 175 ? 3.158   14.914  22.523  1.00 55.83 ? 175  ILE A O     1 
ATOM   1386 C  CB    . ILE A 1 175 ? 4.775   17.264  21.027  1.00 55.54 ? 175  ILE A CB    1 
ATOM   1387 C  CG1   . ILE A 1 175 ? 5.948   17.320  20.057  1.00 55.78 ? 175  ILE A CG1   1 
ATOM   1388 C  CG2   . ILE A 1 175 ? 5.317   16.967  22.414  1.00 55.61 ? 175  ILE A CG2   1 
ATOM   1389 C  CD1   . ILE A 1 175 ? 6.901   18.470  20.342  1.00 55.93 ? 175  ILE A CD1   1 
ATOM   1390 N  N     . ARG A 1 176 ? 1.708   16.518  21.907  1.00 55.78 ? 176  ARG A N     1 
ATOM   1391 C  CA    . ARG A 1 176 ? 0.744   16.222  22.981  1.00 56.25 ? 176  ARG A CA    1 
ATOM   1392 C  C     . ARG A 1 176 ? -0.272  15.138  22.631  1.00 56.34 ? 176  ARG A C     1 
ATOM   1393 O  O     . ARG A 1 176 ? -0.609  14.326  23.479  1.00 56.34 ? 176  ARG A O     1 
ATOM   1394 C  CB    . ARG A 1 176 ? -0.015  17.489  23.410  1.00 56.13 ? 176  ARG A CB    1 
ATOM   1395 C  CG    . ARG A 1 176 ? 0.786   18.388  24.339  1.00 56.43 ? 176  ARG A CG    1 
ATOM   1396 C  CD    . ARG A 1 176 ? 0.024   19.624  24.773  1.00 56.64 ? 176  ARG A CD    1 
ATOM   1397 N  NE    . ARG A 1 176 ? 0.206   20.765  23.870  1.00 57.13 ? 176  ARG A NE    1 
ATOM   1398 C  CZ    . ARG A 1 176 ? -0.719  21.259  23.043  1.00 57.84 ? 176  ARG A CZ    1 
ATOM   1399 N  NH1   . ARG A 1 176 ? -1.936  20.721  22.955  1.00 59.33 ? 176  ARG A NH1   1 
ATOM   1400 N  NH2   . ARG A 1 176 ? -0.426  22.311  22.288  1.00 57.63 ? 176  ARG A NH2   1 
ATOM   1401 N  N     . GLU A 1 177 ? -0.762  15.134  21.396  1.00 56.52 ? 177  GLU A N     1 
ATOM   1402 C  CA    . GLU A 1 177 ? -1.928  14.323  21.033  1.00 56.92 ? 177  GLU A CA    1 
ATOM   1403 C  C     . GLU A 1 177 ? -1.638  13.101  20.151  1.00 56.64 ? 177  GLU A C     1 
ATOM   1404 O  O     . GLU A 1 177 ? -2.443  12.170  20.106  1.00 56.31 ? 177  GLU A O     1 
ATOM   1405 C  CB    . GLU A 1 177 ? -2.975  15.210  20.352  1.00 56.83 ? 177  GLU A CB    1 
ATOM   1406 C  CG    . GLU A 1 177 ? -3.458  16.361  21.235  1.00 57.72 ? 177  GLU A CG    1 
ATOM   1407 C  CD    . GLU A 1 177 ? -4.832  16.916  20.841  1.00 58.35 ? 177  GLU A CD    1 
ATOM   1408 O  OE1   . GLU A 1 177 ? -5.375  16.539  19.774  1.00 59.99 ? 177  GLU A OE1   1 
ATOM   1409 O  OE2   . GLU A 1 177 ? -5.374  17.745  21.612  1.00 60.93 ? 177  GLU A OE2   1 
ATOM   1410 N  N     . LEU A 1 178 ? -0.505  13.106  19.449  1.00 56.65 ? 178  LEU A N     1 
ATOM   1411 C  CA    . LEU A 1 178 ? -0.171  12.021  18.541  1.00 56.63 ? 178  LEU A CA    1 
ATOM   1412 C  C     . LEU A 1 178 ? 0.162   10.777  19.339  1.00 57.24 ? 178  LEU A C     1 
ATOM   1413 O  O     . LEU A 1 178 ? 1.056   10.794  20.188  1.00 56.97 ? 178  LEU A O     1 
ATOM   1414 C  CB    . LEU A 1 178 ? 1.014   12.381  17.640  1.00 56.69 ? 178  LEU A CB    1 
ATOM   1415 C  CG    . LEU A 1 178 ? 1.348   11.368  16.536  1.00 56.31 ? 178  LEU A CG    1 
ATOM   1416 C  CD1   . LEU A 1 178 ? 0.165   11.229  15.591  1.00 55.29 ? 178  LEU A CD1   1 
ATOM   1417 C  CD2   . LEU A 1 178 ? 2.608   11.758  15.787  1.00 55.74 ? 178  LEU A CD2   1 
ATOM   1418 N  N     . ASP A 1 179 ? -0.568  9.701   19.064  1.00 58.03 ? 179  ASP A N     1 
ATOM   1419 C  CA    . ASP A 1 179 ? -0.259  8.411   19.652  1.00 58.95 ? 179  ASP A CA    1 
ATOM   1420 C  C     . ASP A 1 179 ? 1.209   8.066   19.355  1.00 58.90 ? 179  ASP A C     1 
ATOM   1421 O  O     . ASP A 1 179 ? 1.673   8.173   18.216  1.00 59.11 ? 179  ASP A O     1 
ATOM   1422 C  CB    . ASP A 1 179 ? -1.226  7.325   19.146  1.00 59.38 ? 179  ASP A CB    1 
ATOM   1423 C  CG    . ASP A 1 179 ? -0.542  5.972   18.950  1.00 61.76 ? 179  ASP A CG    1 
ATOM   1424 O  OD1   . ASP A 1 179 ? 0.006   5.404   19.935  1.00 64.60 ? 179  ASP A OD1   1 
ATOM   1425 O  OD2   . ASP A 1 179 ? -0.545  5.480   17.793  1.00 64.60 ? 179  ASP A OD2   1 
ATOM   1426 N  N     . ILE A 1 180 ? 1.933   7.661   20.393  1.00 58.93 ? 180  ILE A N     1 
ATOM   1427 C  CA    . ILE A 1 180 ? 3.372   7.439   20.290  1.00 58.85 ? 180  ILE A CA    1 
ATOM   1428 C  C     . ILE A 1 180 ? 3.712   6.400   19.214  1.00 58.80 ? 180  ILE A C     1 
ATOM   1429 O  O     . ILE A 1 180 ? 4.705   6.543   18.506  1.00 58.77 ? 180  ILE A O     1 
ATOM   1430 C  CB    . ILE A 1 180 ? 3.970   7.029   21.659  1.00 58.78 ? 180  ILE A CB    1 
ATOM   1431 C  CG1   . ILE A 1 180 ? 5.434   7.468   21.757  1.00 58.75 ? 180  ILE A CG1   1 
ATOM   1432 C  CG2   . ILE A 1 180 ? 3.816   5.536   21.891  1.00 58.87 ? 180  ILE A CG2   1 
ATOM   1433 C  CD1   . ILE A 1 180 ? 5.946   7.564   23.171  1.00 58.28 ? 180  ILE A CD1   1 
ATOM   1434 N  N     . ALA A 1 181 ? 2.858   5.388   19.071  1.00 58.69 ? 181  ALA A N     1 
ATOM   1435 C  CA    . ALA A 1 181 ? 3.025   4.368   18.043  1.00 58.73 ? 181  ALA A CA    1 
ATOM   1436 C  C     . ALA A 1 181 ? 3.117   4.948   16.629  1.00 58.86 ? 181  ALA A C     1 
ATOM   1437 O  O     . ALA A 1 181 ? 3.745   4.352   15.748  1.00 59.21 ? 181  ALA A O     1 
ATOM   1438 C  CB    . ALA A 1 181 ? 1.897   3.363   18.121  1.00 58.67 ? 181  ALA A CB    1 
ATOM   1439 N  N     . ASP A 1 182 ? 2.509   6.112   16.412  1.00 58.73 ? 182  ASP A N     1 
ATOM   1440 C  CA    . ASP A 1 182 ? 2.500   6.716   15.088  1.00 58.72 ? 182  ASP A CA    1 
ATOM   1441 C  C     . ASP A 1 182 ? 3.755   7.528   14.801  1.00 58.57 ? 182  ASP A C     1 
ATOM   1442 O  O     . ASP A 1 182 ? 3.877   8.127   13.733  1.00 58.59 ? 182  ASP A O     1 
ATOM   1443 C  CB    . ASP A 1 182 ? 1.246   7.562   14.907  1.00 58.97 ? 182  ASP A CB    1 
ATOM   1444 C  CG    . ASP A 1 182 ? -0.038  6.757   15.139  1.00 60.21 ? 182  ASP A CG    1 
ATOM   1445 O  OD1   . ASP A 1 182 ? -0.005  5.514   14.959  1.00 61.36 ? 182  ASP A OD1   1 
ATOM   1446 O  OD2   . ASP A 1 182 ? -1.072  7.360   15.521  1.00 60.33 ? 182  ASP A OD2   1 
ATOM   1447 N  N     . VAL A 1 183 ? 4.695   7.533   15.745  1.00 58.44 ? 183  VAL A N     1 
ATOM   1448 C  CA    . VAL A 1 183 ? 6.008   8.145   15.536  1.00 58.13 ? 183  VAL A CA    1 
ATOM   1449 C  C     . VAL A 1 183 ? 6.922   7.240   14.693  1.00 57.87 ? 183  VAL A C     1 
ATOM   1450 O  O     . VAL A 1 183 ? 7.132   6.079   15.038  1.00 57.89 ? 183  VAL A O     1 
ATOM   1451 C  CB    . VAL A 1 183 ? 6.712   8.404   16.882  1.00 58.08 ? 183  VAL A CB    1 
ATOM   1452 C  CG1   . VAL A 1 183 ? 8.122   8.909   16.659  1.00 58.14 ? 183  VAL A CG1   1 
ATOM   1453 C  CG2   . VAL A 1 183 ? 5.922   9.386   17.704  1.00 58.13 ? 183  VAL A CG2   1 
ATOM   1454 N  N     . PRO A 1 184 ? 7.478   7.769   13.595  1.00 57.42 ? 184  PRO A N     1 
ATOM   1455 C  CA    . PRO A 1 184 ? 8.458   7.028   12.836  1.00 57.10 ? 184  PRO A CA    1 
ATOM   1456 C  C     . PRO A 1 184 ? 9.499   6.403   13.728  1.00 57.39 ? 184  PRO A C     1 
ATOM   1457 O  O     . PRO A 1 184 ? 10.073  7.083   14.564  1.00 57.20 ? 184  PRO A O     1 
ATOM   1458 C  CB    . PRO A 1 184 ? 9.105   8.100   11.971  1.00 56.82 ? 184  PRO A CB    1 
ATOM   1459 C  CG    . PRO A 1 184 ? 8.017   9.039   11.712  1.00 57.37 ? 184  PRO A CG    1 
ATOM   1460 C  CD    . PRO A 1 184 ? 7.198   9.075   12.978  1.00 57.49 ? 184  PRO A CD    1 
ATOM   1461 N  N     . GLY A 1 185 ? 9.735   5.109   13.538  1.00 57.92 ? 185  GLY A N     1 
ATOM   1462 C  CA    . GLY A 1 185 ? 10.759  4.393   14.273  1.00 57.99 ? 185  GLY A CA    1 
ATOM   1463 C  C     . GLY A 1 185 ? 10.223  3.647   15.467  1.00 58.25 ? 185  GLY A C     1 
ATOM   1464 O  O     . GLY A 1 185 ? 10.965  2.897   16.083  1.00 58.32 ? 185  GLY A O     1 
ATOM   1465 N  N     . ILE A 1 186 ? 8.946   3.853   15.802  1.00 58.62 ? 186  ILE A N     1 
ATOM   1466 C  CA    . ILE A 1 186 ? 8.286   3.070   16.846  1.00 58.91 ? 186  ILE A CA    1 
ATOM   1467 C  C     . ILE A 1 186 ? 7.354   2.035   16.234  1.00 59.24 ? 186  ILE A C     1 
ATOM   1468 O  O     . ILE A 1 186 ? 6.235   2.335   15.794  1.00 59.58 ? 186  ILE A O     1 
ATOM   1469 C  CB    . ILE A 1 186 ? 7.499   3.951   17.824  1.00 59.05 ? 186  ILE A CB    1 
ATOM   1470 C  CG1   . ILE A 1 186 ? 8.393   5.061   18.382  1.00 59.29 ? 186  ILE A CG1   1 
ATOM   1471 C  CG2   . ILE A 1 186 ? 6.938   3.104   18.963  1.00 58.42 ? 186  ILE A CG2   1 
ATOM   1472 C  CD1   . ILE A 1 186 ? 9.688   4.553   18.999  1.00 59.79 ? 186  ILE A CD1   1 
ATOM   1473 N  N     . GLY A 1 187 ? 7.839   0.801   16.213  1.00 59.68 ? 187  GLY A N     1 
ATOM   1474 C  CA    . GLY A 1 187 ? 7.084   -0.320  15.683  1.00 59.88 ? 187  GLY A CA    1 
ATOM   1475 C  C     . GLY A 1 187 ? 6.305   -0.994  16.785  1.00 60.03 ? 187  GLY A C     1 
ATOM   1476 O  O     . GLY A 1 187 ? 6.173   -0.447  17.885  1.00 60.13 ? 187  GLY A O     1 
ATOM   1477 N  N     . ASN A 1 188 ? 5.809   -2.193  16.481  1.00 60.25 ? 188  ASN A N     1 
ATOM   1478 C  CA    . ASN A 1 188 ? 4.973   -2.974  17.392  1.00 60.27 ? 188  ASN A CA    1 
ATOM   1479 C  C     . ASN A 1 188 ? 5.676   -3.208  18.711  1.00 59.95 ? 188  ASN A C     1 
ATOM   1480 O  O     . ASN A 1 188 ? 5.140   -2.910  19.779  1.00 59.93 ? 188  ASN A O     1 
ATOM   1481 C  CB    . ASN A 1 188 ? 4.637   -4.339  16.782  1.00 60.54 ? 188  ASN A CB    1 
ATOM   1482 C  CG    . ASN A 1 188 ? 3.665   -4.250  15.606  1.00 61.85 ? 188  ASN A CG    1 
ATOM   1483 O  OD1   . ASN A 1 188 ? 3.042   -5.256  15.232  1.00 62.87 ? 188  ASN A OD1   1 
ATOM   1484 N  ND2   . ASN A 1 188 ? 3.524   -3.056  15.022  1.00 62.21 ? 188  ASN A ND2   1 
ATOM   1485 N  N     . ILE A 1 189 ? 6.888   -3.744  18.616  1.00 59.55 ? 189  ILE A N     1 
ATOM   1486 C  CA    . ILE A 1 189 ? 7.646   -4.133  19.786  1.00 59.26 ? 189  ILE A CA    1 
ATOM   1487 C  C     . ILE A 1 189 ? 7.818   -2.956  20.717  1.00 58.95 ? 189  ILE A C     1 
ATOM   1488 O  O     . ILE A 1 189 ? 7.449   -3.028  21.886  1.00 58.96 ? 189  ILE A O     1 
ATOM   1489 C  CB    . ILE A 1 189 ? 9.020   -4.689  19.393  1.00 59.39 ? 189  ILE A CB    1 
ATOM   1490 C  CG1   . ILE A 1 189 ? 8.859   -6.054  18.713  1.00 59.55 ? 189  ILE A CG1   1 
ATOM   1491 C  CG2   . ILE A 1 189 ? 9.908   -4.825  20.617  1.00 59.34 ? 189  ILE A CG2   1 
ATOM   1492 C  CD1   . ILE A 1 189 ? 8.399   -7.141  19.648  1.00 59.55 ? 189  ILE A CD1   1 
ATOM   1493 N  N     . THR A 1 190 ? 8.357   -1.867  20.186  1.00 58.74 ? 190  THR A N     1 
ATOM   1494 C  CA    . THR A 1 190 ? 8.642   -0.683  20.989  1.00 58.64 ? 190  THR A CA    1 
ATOM   1495 C  C     . THR A 1 190 ? 7.374   -0.024  21.507  1.00 58.62 ? 190  THR A C     1 
ATOM   1496 O  O     . THR A 1 190 ? 7.375   0.521   22.599  1.00 58.40 ? 190  THR A O     1 
ATOM   1497 C  CB    . THR A 1 190 ? 9.455   0.357   20.194  1.00 58.63 ? 190  THR A CB    1 
ATOM   1498 O  OG1   . THR A 1 190 ? 10.581  -0.286  19.594  1.00 58.54 ? 190  THR A OG1   1 
ATOM   1499 C  CG2   . THR A 1 190 ? 9.943   1.487   21.096  1.00 58.04 ? 190  THR A CG2   1 
ATOM   1500 N  N     . ALA A 1 191 ? 6.298   -0.066  20.723  1.00 58.87 ? 191  ALA A N     1 
ATOM   1501 C  CA    . ALA A 1 191 ? 5.003   0.456   21.181  1.00 59.11 ? 191  ALA A CA    1 
ATOM   1502 C  C     . ALA A 1 191 ? 4.507   -0.284  22.430  1.00 59.36 ? 191  ALA A C     1 
ATOM   1503 O  O     . ALA A 1 191 ? 4.070   0.355   23.382  1.00 59.41 ? 191  ALA A O     1 
ATOM   1504 C  CB    . ALA A 1 191 ? 3.961   0.395   20.070  1.00 58.81 ? 191  ALA A CB    1 
ATOM   1505 N  N     . GLU A 1 192 ? 4.600   -1.615  22.433  1.00 59.87 ? 192  GLU A N     1 
ATOM   1506 C  CA    . GLU A 1 192 ? 4.175   -2.420  23.589  1.00 60.33 ? 192  GLU A CA    1 
ATOM   1507 C  C     . GLU A 1 192 ? 4.950   -2.043  24.829  1.00 60.01 ? 192  GLU A C     1 
ATOM   1508 O  O     . GLU A 1 192 ? 4.365   -1.818  25.886  1.00 60.09 ? 192  GLU A O     1 
ATOM   1509 C  CB    . GLU A 1 192 ? 4.355   -3.923  23.338  1.00 60.73 ? 192  GLU A CB    1 
ATOM   1510 C  CG    . GLU A 1 192 ? 3.429   -4.497  22.280  1.00 62.41 ? 192  GLU A CG    1 
ATOM   1511 C  CD    . GLU A 1 192 ? 1.971   -4.253  22.600  1.00 65.22 ? 192  GLU A CD    1 
ATOM   1512 O  OE1   . GLU A 1 192 ? 1.439   -4.936  23.506  1.00 67.29 ? 192  GLU A OE1   1 
ATOM   1513 O  OE2   . GLU A 1 192 ? 1.361   -3.368  21.953  1.00 66.90 ? 192  GLU A OE2   1 
ATOM   1514 N  N     . LYS A 1 193 ? 6.268   -1.976  24.697  1.00 59.76 ? 193  LYS A N     1 
ATOM   1515 C  CA    . LYS A 1 193 ? 7.118   -1.597  25.819  1.00 59.88 ? 193  LYS A CA    1 
ATOM   1516 C  C     . LYS A 1 193 ? 6.729   -0.223  26.377  1.00 59.57 ? 193  LYS A C     1 
ATOM   1517 O  O     . LYS A 1 193 ? 6.646   -0.058  27.596  1.00 59.76 ? 193  LYS A O     1 
ATOM   1518 C  CB    . LYS A 1 193 ? 8.599   -1.626  25.427  1.00 59.93 ? 193  LYS A CB    1 
ATOM   1519 C  CG    . LYS A 1 193 ? 9.176   -3.035  25.256  1.00 60.22 ? 193  LYS A CG    1 
ATOM   1520 C  CD    . LYS A 1 193 ? 10.555  -2.997  24.565  1.00 60.57 ? 193  LYS A CD    1 
ATOM   1521 C  CE    . LYS A 1 193 ? 11.251  -4.367  24.538  1.00 60.83 ? 193  LYS A CE    1 
ATOM   1522 N  NZ    . LYS A 1 193 ? 12.527  -4.318  23.775  1.00 60.55 ? 193  LYS A NZ    1 
ATOM   1523 N  N     . LEU A 1 194 ? 6.462   0.743   25.501  1.00 59.05 ? 194  LEU A N     1 
ATOM   1524 C  CA    . LEU A 1 194 ? 6.043   2.068   25.951  1.00 58.88 ? 194  LEU A CA    1 
ATOM   1525 C  C     . LEU A 1 194 ? 4.673   2.066   26.624  1.00 58.94 ? 194  LEU A C     1 
ATOM   1526 O  O     . LEU A 1 194 ? 4.429   2.895   27.495  1.00 59.08 ? 194  LEU A O     1 
ATOM   1527 C  CB    . LEU A 1 194 ? 6.058   3.083   24.808  1.00 58.93 ? 194  LEU A CB    1 
ATOM   1528 C  CG    . LEU A 1 194 ? 7.424   3.439   24.198  1.00 58.34 ? 194  LEU A CG    1 
ATOM   1529 C  CD1   . LEU A 1 194 ? 7.244   4.480   23.123  1.00 57.37 ? 194  LEU A CD1   1 
ATOM   1530 C  CD2   . LEU A 1 194 ? 8.417   3.932   25.234  1.00 58.10 ? 194  LEU A CD2   1 
ATOM   1531 N  N     . LYS A 1 195 ? 3.786   1.148   26.240  1.00 58.90 ? 195  LYS A N     1 
ATOM   1532 C  CA    . LYS A 1 195 ? 2.507   0.986   26.955  1.00 58.93 ? 195  LYS A CA    1 
ATOM   1533 C  C     . LYS A 1 195 ? 2.704   0.417   28.357  1.00 58.47 ? 195  LYS A C     1 
ATOM   1534 O  O     . LYS A 1 195 ? 2.066   0.871   29.293  1.00 58.56 ? 195  LYS A O     1 
ATOM   1535 C  CB    . LYS A 1 195 ? 1.525   0.097   26.188  1.00 58.94 ? 195  LYS A CB    1 
ATOM   1536 C  CG    . LYS A 1 195 ? 0.458   0.865   25.391  1.00 59.90 ? 195  LYS A CG    1 
ATOM   1537 C  CD    . LYS A 1 195 ? -0.675  -0.050  24.864  1.00 59.96 ? 195  LYS A CD    1 
ATOM   1538 C  CE    . LYS A 1 195 ? -1.318  -0.887  25.994  1.00 61.33 ? 195  LYS A CE    1 
ATOM   1539 N  NZ    . LYS A 1 195 ? -2.694  -1.395  25.679  1.00 61.27 ? 195  LYS A NZ    1 
ATOM   1540 N  N     . LYS A 1 196 ? 3.580   -0.571  28.507  1.00 58.09 ? 196  LYS A N     1 
ATOM   1541 C  CA    . LYS A 1 196 ? 3.859   -1.142  29.828  1.00 57.90 ? 196  LYS A CA    1 
ATOM   1542 C  C     . LYS A 1 196 ? 4.329   -0.097  30.841  1.00 57.42 ? 196  LYS A C     1 
ATOM   1543 O  O     . LYS A 1 196 ? 4.121   -0.273  32.042  1.00 57.80 ? 196  LYS A O     1 
ATOM   1544 C  CB    . LYS A 1 196 ? 4.916   -2.244  29.746  1.00 58.05 ? 196  LYS A CB    1 
ATOM   1545 C  CG    . LYS A 1 196 ? 4.407   -3.600  29.283  1.00 58.50 ? 196  LYS A CG    1 
ATOM   1546 C  CD    . LYS A 1 196 ? 5.551   -4.631  29.276  1.00 58.43 ? 196  LYS A CD    1 
ATOM   1547 C  CE    . LYS A 1 196 ? 5.039   -6.052  29.395  1.00 58.82 ? 196  LYS A CE    1 
ATOM   1548 N  NZ    . LYS A 1 196 ? 4.355   -6.267  30.709  1.00 59.46 ? 196  LYS A NZ    1 
ATOM   1549 N  N     . LEU A 1 197 ? 4.986   0.965   30.368  1.00 56.73 ? 197  LEU A N     1 
ATOM   1550 C  CA    . LEU A 1 197 ? 5.377   2.087   31.232  1.00 55.97 ? 197  LEU A CA    1 
ATOM   1551 C  C     . LEU A 1 197 ? 4.306   3.182   31.264  1.00 55.53 ? 197  LEU A C     1 
ATOM   1552 O  O     . LEU A 1 197 ? 4.492   4.218   31.911  1.00 55.57 ? 197  LEU A O     1 
ATOM   1553 C  CB    . LEU A 1 197 ? 6.702   2.699   30.769  1.00 55.84 ? 197  LEU A CB    1 
ATOM   1554 C  CG    . LEU A 1 197 ? 7.896   1.775   30.542  1.00 55.57 ? 197  LEU A CG    1 
ATOM   1555 C  CD1   . LEU A 1 197 ? 9.162   2.603   30.375  1.00 54.57 ? 197  LEU A CD1   1 
ATOM   1556 C  CD2   . LEU A 1 197 ? 8.046   0.776   31.676  1.00 55.84 ? 197  LEU A CD2   1 
ATOM   1557 N  N     . GLY A 1 198 ? 3.196   2.956   30.564  1.00 54.87 ? 198  GLY A N     1 
ATOM   1558 C  CA    . GLY A 1 198 ? 2.097   3.918   30.508  1.00 54.48 ? 198  GLY A CA    1 
ATOM   1559 C  C     . GLY A 1 198 ? 2.461   5.196   29.784  1.00 54.08 ? 198  GLY A C     1 
ATOM   1560 O  O     . GLY A 1 198 ? 2.025   6.278   30.166  1.00 53.89 ? 198  GLY A O     1 
ATOM   1561 N  N     . ILE A 1 199 ? 3.271   5.055   28.738  1.00 53.72 ? 199  ILE A N     1 
ATOM   1562 C  CA    . ILE A 1 199 ? 3.709   6.167   27.911  1.00 53.42 ? 199  ILE A CA    1 
ATOM   1563 C  C     . ILE A 1 199 ? 2.982   6.046   26.583  1.00 53.37 ? 199  ILE A C     1 
ATOM   1564 O  O     . ILE A 1 199 ? 3.280   5.166   25.780  1.00 53.57 ? 199  ILE A O     1 
ATOM   1565 C  CB    . ILE A 1 199 ? 5.246   6.145   27.721  1.00 53.39 ? 199  ILE A CB    1 
ATOM   1566 C  CG1   . ILE A 1 199 ? 5.922   6.679   28.987  1.00 53.30 ? 199  ILE A CG1   1 
ATOM   1567 C  CG2   . ILE A 1 199 ? 5.666   6.970   26.520  1.00 52.84 ? 199  ILE A CG2   1 
ATOM   1568 C  CD1   . ILE A 1 199 ? 7.254   6.070   29.276  1.00 53.03 ? 199  ILE A CD1   1 
ATOM   1569 N  N     . ASN A 1 200 ? 2.017   6.938   26.375  1.00 53.25 ? 200  ASN A N     1 
ATOM   1570 C  CA    . ASN A 1 200 ? 1.096   6.875   25.236  1.00 52.88 ? 200  ASN A CA    1 
ATOM   1571 C  C     . ASN A 1 200 ? 1.302   7.978   24.195  1.00 52.52 ? 200  ASN A C     1 
ATOM   1572 O  O     . ASN A 1 200 ? 0.887   7.836   23.049  1.00 52.70 ? 200  ASN A O     1 
ATOM   1573 C  CB    . ASN A 1 200 ? -0.337  6.940   25.766  1.00 52.90 ? 200  ASN A CB    1 
ATOM   1574 C  CG    . ASN A 1 200 ? -0.603  5.895   26.833  1.00 52.67 ? 200  ASN A CG    1 
ATOM   1575 O  OD1   . ASN A 1 200 ? -0.447  4.700   26.594  1.00 53.73 ? 200  ASN A OD1   1 
ATOM   1576 N  ND2   . ASN A 1 200 ? -0.987  6.339   28.015  1.00 52.31 ? 200  ASN A ND2   1 
ATOM   1577 N  N     . LYS A 1 201 ? 1.925   9.077   24.601  1.00 52.14 ? 201  LYS A N     1 
ATOM   1578 C  CA    . LYS A 1 201 ? 2.100   10.243  23.745  1.00 51.83 ? 201  LYS A CA    1 
ATOM   1579 C  C     . LYS A 1 201 ? 3.521   10.739  23.943  1.00 51.58 ? 201  LYS A C     1 
ATOM   1580 O  O     . LYS A 1 201 ? 4.115   10.506  24.984  1.00 51.23 ? 201  LYS A O     1 
ATOM   1581 C  CB    . LYS A 1 201 ? 1.093   11.346  24.125  1.00 51.84 ? 201  LYS A CB    1 
ATOM   1582 C  CG    . LYS A 1 201 ? -0.402  10.907  24.217  1.00 51.89 ? 201  LYS A CG    1 
ATOM   1583 C  CD    . LYS A 1 201 ? -1.166  11.093  22.896  1.00 52.28 ? 201  LYS A CD    1 
ATOM   1584 C  CE    . LYS A 1 201 ? -2.266  10.045  22.681  1.00 52.19 ? 201  LYS A CE    1 
ATOM   1585 N  NZ    . LYS A 1 201 ? -3.306  10.057  23.733  1.00 52.49 ? 201  LYS A NZ    1 
ATOM   1586 N  N     . LEU A 1 202 ? 4.073   11.410  22.942  1.00 51.81 ? 202  LEU A N     1 
ATOM   1587 C  CA    . LEU A 1 202 ? 5.440   11.936  23.044  1.00 51.95 ? 202  LEU A CA    1 
ATOM   1588 C  C     . LEU A 1 202 ? 5.661   12.716  24.343  1.00 52.40 ? 202  LEU A C     1 
ATOM   1589 O  O     . LEU A 1 202 ? 6.717   12.605  24.968  1.00 52.65 ? 202  LEU A O     1 
ATOM   1590 C  CB    . LEU A 1 202 ? 5.779   12.842  21.853  1.00 51.77 ? 202  LEU A CB    1 
ATOM   1591 C  CG    . LEU A 1 202 ? 6.429   12.192  20.641  1.00 50.78 ? 202  LEU A CG    1 
ATOM   1592 C  CD1   . LEU A 1 202 ? 6.564   13.195  19.521  1.00 49.59 ? 202  LEU A CD1   1 
ATOM   1593 C  CD2   . LEU A 1 202 ? 7.778   11.673  21.028  1.00 51.66 ? 202  LEU A CD2   1 
ATOM   1594 N  N     . VAL A 1 203 ? 4.670   13.501  24.753  1.00 52.61 ? 203  VAL A N     1 
ATOM   1595 C  CA    . VAL A 1 203 ? 4.833   14.348  25.926  1.00 52.90 ? 203  VAL A CA    1 
ATOM   1596 C  C     . VAL A 1 203 ? 5.101   13.506  27.174  1.00 53.14 ? 203  VAL A C     1 
ATOM   1597 O  O     . VAL A 1 203 ? 5.785   13.949  28.098  1.00 53.32 ? 203  VAL A O     1 
ATOM   1598 C  CB    . VAL A 1 203 ? 3.608   15.278  26.146  1.00 52.95 ? 203  VAL A CB    1 
ATOM   1599 C  CG1   . VAL A 1 203 ? 2.438   14.515  26.764  1.00 52.76 ? 203  VAL A CG1   1 
ATOM   1600 C  CG2   . VAL A 1 203 ? 4.001   16.467  27.009  1.00 52.79 ? 203  VAL A CG2   1 
ATOM   1601 N  N     . ASP A 1 204 ? 4.585   12.280  27.180  1.00 53.31 ? 204  ASP A N     1 
ATOM   1602 C  CA    . ASP A 1 204 ? 4.797   11.359  28.292  1.00 53.52 ? 204  ASP A CA    1 
ATOM   1603 C  C     . ASP A 1 204 ? 6.268   10.989  28.539  1.00 53.32 ? 204  ASP A C     1 
ATOM   1604 O  O     . ASP A 1 204 ? 6.605   10.472  29.600  1.00 53.49 ? 204  ASP A O     1 
ATOM   1605 C  CB    . ASP A 1 204 ? 3.982   10.075  28.082  1.00 53.70 ? 204  ASP A CB    1 
ATOM   1606 C  CG    . ASP A 1 204 ? 2.472   10.319  28.080  1.00 54.60 ? 204  ASP A CG    1 
ATOM   1607 O  OD1   . ASP A 1 204 ? 1.985   11.207  28.830  1.00 55.72 ? 204  ASP A OD1   1 
ATOM   1608 O  OD2   . ASP A 1 204 ? 1.769   9.594   27.340  1.00 55.23 ? 204  ASP A OD2   1 
ATOM   1609 N  N     . THR A 1 205 ? 7.145   11.251  27.579  1.00 53.29 ? 205  THR A N     1 
ATOM   1610 C  CA    . THR A 1 205 ? 8.553   10.886  27.729  1.00 53.30 ? 205  THR A CA    1 
ATOM   1611 C  C     . THR A 1 205 ? 9.366   11.910  28.536  1.00 53.75 ? 205  THR A C     1 
ATOM   1612 O  O     . THR A 1 205 ? 10.462  11.595  29.000  1.00 53.80 ? 205  THR A O     1 
ATOM   1613 C  CB    . THR A 1 205 ? 9.215   10.650  26.360  1.00 53.05 ? 205  THR A CB    1 
ATOM   1614 O  OG1   . THR A 1 205 ? 9.143   11.841  25.575  1.00 52.47 ? 205  THR A OG1   1 
ATOM   1615 C  CG2   . THR A 1 205 ? 8.518   9.525   25.620  1.00 52.38 ? 205  THR A CG2   1 
ATOM   1616 N  N     . LEU A 1 206 ? 8.828   13.117  28.712  1.00 54.18 ? 206  LEU A N     1 
ATOM   1617 C  CA    . LEU A 1 206 ? 9.511   14.180  29.463  1.00 54.69 ? 206  LEU A CA    1 
ATOM   1618 C  C     . LEU A 1 206 ? 9.273   14.054  30.975  1.00 55.26 ? 206  LEU A C     1 
ATOM   1619 O  O     . LEU A 1 206 ? 9.909   14.759  31.775  1.00 55.47 ? 206  LEU A O     1 
ATOM   1620 C  CB    . LEU A 1 206 ? 9.046   15.566  28.981  1.00 54.63 ? 206  LEU A CB    1 
ATOM   1621 C  CG    . LEU A 1 206 ? 9.121   15.838  27.468  1.00 54.76 ? 206  LEU A CG    1 
ATOM   1622 C  CD1   . LEU A 1 206 ? 8.431   17.144  27.093  1.00 54.38 ? 206  LEU A CD1   1 
ATOM   1623 C  CD2   . LEU A 1 206 ? 10.558  15.835  26.978  1.00 54.45 ? 206  LEU A CD2   1 
ATOM   1624 N  N     . SER A 1 207 ? 8.350   13.170  31.359  1.00 55.75 ? 207  SER A N     1 
ATOM   1625 C  CA    . SER A 1 207 ? 7.973   12.974  32.761  1.00 56.00 ? 207  SER A CA    1 
ATOM   1626 C  C     . SER A 1 207 ? 8.395   11.596  33.252  1.00 56.09 ? 207  SER A C     1 
ATOM   1627 O  O     . SER A 1 207 ? 7.676   10.964  34.019  1.00 56.07 ? 207  SER A O     1 
ATOM   1628 C  CB    . SER A 1 207 ? 6.462   13.119  32.914  1.00 55.95 ? 207  SER A CB    1 
ATOM   1629 O  OG    . SER A 1 207 ? 6.015   14.295  32.277  1.00 56.22 ? 207  SER A OG    1 
ATOM   1630 N  N     . ILE A 1 208 ? 9.558   11.141  32.797  1.00 56.25 ? 208  ILE A N     1 
ATOM   1631 C  CA    . ILE A 1 208 ? 10.107  9.855   33.206  1.00 56.52 ? 208  ILE A CA    1 
ATOM   1632 C  C     . ILE A 1 208 ? 11.638  9.937   33.262  1.00 56.98 ? 208  ILE A C     1 
ATOM   1633 O  O     . ILE A 1 208 ? 12.255  10.622  32.449  1.00 56.89 ? 208  ILE A O     1 
ATOM   1634 C  CB    . ILE A 1 208 ? 9.653   8.739   32.249  1.00 56.33 ? 208  ILE A CB    1 
ATOM   1635 C  CG1   . ILE A 1 208 ? 10.207  7.385   32.691  1.00 56.29 ? 208  ILE A CG1   1 
ATOM   1636 C  CG2   . ILE A 1 208 ? 10.083  9.046   30.831  1.00 56.32 ? 208  ILE A CG2   1 
ATOM   1637 C  CD1   . ILE A 1 208 ? 9.655   6.214   31.905  1.00 56.47 ? 208  ILE A CD1   1 
ATOM   1638 N  N     . GLU A 1 209 ? 12.239  9.247   34.231  1.00 57.60 ? 209  GLU A N     1 
ATOM   1639 C  CA    . GLU A 1 209 ? 13.700  9.248   34.402  1.00 58.07 ? 209  GLU A CA    1 
ATOM   1640 C  C     . GLU A 1 209 ? 14.364  8.700   33.144  1.00 58.09 ? 209  GLU A C     1 
ATOM   1641 O  O     . GLU A 1 209 ? 13.945  7.674   32.605  1.00 57.92 ? 209  GLU A O     1 
ATOM   1642 C  CB    . GLU A 1 209 ? 14.116  8.388   35.599  1.00 58.17 ? 209  GLU A CB    1 
ATOM   1643 C  CG    . GLU A 1 209 ? 13.521  8.830   36.937  1.00 59.34 ? 209  GLU A CG    1 
ATOM   1644 C  CD    . GLU A 1 209 ? 13.032  7.664   37.808  1.00 60.70 ? 209  GLU A CD    1 
ATOM   1645 O  OE1   . GLU A 1 209 ? 12.642  6.604   37.255  1.00 61.92 ? 209  GLU A OE1   1 
ATOM   1646 O  OE2   . GLU A 1 209 ? 13.024  7.822   39.051  1.00 60.33 ? 209  GLU A OE2   1 
ATOM   1647 N  N     . PHE A 1 210 ? 15.397  9.384   32.674  1.00 58.26 ? 210  PHE A N     1 
ATOM   1648 C  CA    . PHE A 1 210 ? 16.075  8.951   31.465  1.00 58.44 ? 210  PHE A CA    1 
ATOM   1649 C  C     . PHE A 1 210 ? 16.533  7.504   31.613  1.00 58.84 ? 210  PHE A C     1 
ATOM   1650 O  O     . PHE A 1 210 ? 16.332  6.688   30.710  1.00 58.56 ? 210  PHE A O     1 
ATOM   1651 C  CB    . PHE A 1 210 ? 17.272  9.851   31.147  1.00 58.40 ? 210  PHE A CB    1 
ATOM   1652 C  CG    . PHE A 1 210 ? 17.964  9.480   29.885  1.00 58.07 ? 210  PHE A CG    1 
ATOM   1653 C  CD1   . PHE A 1 210 ? 17.583  10.046  28.687  1.00 58.32 ? 210  PHE A CD1   1 
ATOM   1654 C  CD2   . PHE A 1 210 ? 18.970  8.523   29.886  1.00 58.46 ? 210  PHE A CD2   1 
ATOM   1655 C  CE1   . PHE A 1 210 ? 18.204  9.681   27.508  1.00 58.67 ? 210  PHE A CE1   1 
ATOM   1656 C  CE2   . PHE A 1 210 ? 19.595  8.151   28.715  1.00 58.61 ? 210  PHE A CE2   1 
ATOM   1657 C  CZ    . PHE A 1 210 ? 19.212  8.729   27.521  1.00 58.79 ? 210  PHE A CZ    1 
ATOM   1658 N  N     . ASP A 1 211 ? 17.136  7.195   32.761  1.00 59.34 ? 211  ASP A N     1 
ATOM   1659 C  CA    . ASP A 1 211 ? 17.705  5.869   33.007  1.00 59.86 ? 211  ASP A CA    1 
ATOM   1660 C  C     . ASP A 1 211 ? 16.642  4.764   32.955  1.00 60.00 ? 211  ASP A C     1 
ATOM   1661 O  O     . ASP A 1 211 ? 16.896  3.676   32.427  1.00 59.95 ? 211  ASP A O     1 
ATOM   1662 C  CB    . ASP A 1 211 ? 18.445  5.834   34.354  1.00 60.08 ? 211  ASP A CB    1 
ATOM   1663 C  CG    . ASP A 1 211 ? 19.748  6.649   34.346  1.00 60.88 ? 211  ASP A CG    1 
ATOM   1664 O  OD1   . ASP A 1 211 ? 20.363  6.817   33.262  1.00 61.34 ? 211  ASP A OD1   1 
ATOM   1665 O  OD2   . ASP A 1 211 ? 20.163  7.109   35.440  1.00 61.75 ? 211  ASP A OD2   1 
ATOM   1666 N  N     . LYS A 1 212 ? 15.452  5.047   33.480  1.00 60.10 ? 212  LYS A N     1 
ATOM   1667 C  CA    . LYS A 1 212 ? 14.367  4.066   33.444  1.00 60.33 ? 212  LYS A CA    1 
ATOM   1668 C  C     . LYS A 1 212 ? 13.859  3.846   32.013  1.00 60.14 ? 212  LYS A C     1 
ATOM   1669 O  O     . LYS A 1 212 ? 13.478  2.731   31.654  1.00 60.12 ? 212  LYS A O     1 
ATOM   1670 C  CB    . LYS A 1 212 ? 13.211  4.487   34.359  1.00 60.42 ? 212  LYS A CB    1 
ATOM   1671 C  CG    . LYS A 1 212 ? 12.440  3.308   34.958  1.00 60.90 ? 212  LYS A CG    1 
ATOM   1672 C  CD    . LYS A 1 212 ? 11.105  3.744   35.568  1.00 60.98 ? 212  LYS A CD    1 
ATOM   1673 C  CE    . LYS A 1 212 ? 10.607  2.762   36.640  1.00 61.36 ? 212  LYS A CE    1 
ATOM   1674 N  NZ    . LYS A 1 212 ? 11.082  3.111   38.012  1.00 61.28 ? 212  LYS A NZ    1 
ATOM   1675 N  N     . LEU A 1 213 ? 13.865  4.904   31.202  1.00 59.97 ? 213  LEU A N     1 
ATOM   1676 C  CA    . LEU A 1 213 ? 13.403  4.812   29.815  1.00 59.85 ? 213  LEU A CA    1 
ATOM   1677 C  C     . LEU A 1 213 ? 14.412  4.114   28.908  1.00 60.21 ? 213  LEU A C     1 
ATOM   1678 O  O     . LEU A 1 213 ? 14.023  3.334   28.046  1.00 60.30 ? 213  LEU A O     1 
ATOM   1679 C  CB    . LEU A 1 213 ? 13.077  6.200   29.253  1.00 59.81 ? 213  LEU A CB    1 
ATOM   1680 C  CG    . LEU A 1 213 ? 12.524  6.247   27.824  1.00 59.26 ? 213  LEU A CG    1 
ATOM   1681 C  CD1   . LEU A 1 213 ? 11.372  5.276   27.651  1.00 58.77 ? 213  LEU A CD1   1 
ATOM   1682 C  CD2   . LEU A 1 213 ? 12.096  7.654   27.447  1.00 59.15 ? 213  LEU A CD2   1 
ATOM   1683 N  N     . LYS A 1 214 ? 15.698  4.398   29.103  1.00 60.54 ? 214  LYS A N     1 
ATOM   1684 C  CA    . LYS A 1 214 ? 16.761  3.821   28.269  1.00 60.87 ? 214  LYS A CA    1 
ATOM   1685 C  C     . LYS A 1 214 ? 16.909  2.318   28.503  1.00 60.90 ? 214  LYS A C     1 
ATOM   1686 O  O     . LYS A 1 214 ? 17.228  1.567   27.582  1.00 61.05 ? 214  LYS A O     1 
ATOM   1687 C  CB    . LYS A 1 214 ? 18.091  4.575   28.483  1.00 60.88 ? 214  LYS A CB    1 
ATOM   1688 C  CG    . LYS A 1 214 ? 19.287  3.738   28.967  1.00 61.36 ? 214  LYS A CG    1 
ATOM   1689 C  CD    . LYS A 1 214 ? 20.496  4.649   29.294  1.00 61.71 ? 214  LYS A CD    1 
ATOM   1690 C  CE    . LYS A 1 214 ? 21.574  3.955   30.144  1.00 61.86 ? 214  LYS A CE    1 
ATOM   1691 N  NZ    . LYS A 1 214 ? 21.236  3.935   31.602  1.00 62.26 ? 214  LYS A NZ    1 
ATOM   1692 N  N     . GLY A 1 215 ? 16.676  1.881   29.734  1.00 60.94 ? 215  GLY A N     1 
ATOM   1693 C  CA    . GLY A 1 215 ? 16.702  0.459   30.051  1.00 60.94 ? 215  GLY A CA    1 
ATOM   1694 C  C     . GLY A 1 215 ? 15.677  -0.335  29.259  1.00 60.99 ? 215  GLY A C     1 
ATOM   1695 O  O     . GLY A 1 215 ? 15.952  -1.455  28.819  1.00 61.08 ? 215  GLY A O     1 
ATOM   1696 N  N     . MET A 1 216 ? 14.498  0.249   29.053  1.00 60.88 ? 216  MET A N     1 
ATOM   1697 C  CA    . MET A 1 216 ? 13.407  -0.467  28.401  1.00 60.80 ? 216  MET A CA    1 
ATOM   1698 C  C     . MET A 1 216 ? 13.537  -0.494  26.873  1.00 60.11 ? 216  MET A C     1 
ATOM   1699 O  O     . MET A 1 216 ? 13.455  -1.565  26.274  1.00 60.14 ? 216  MET A O     1 
ATOM   1700 C  CB    . MET A 1 216 ? 12.054  0.119   28.817  1.00 61.14 ? 216  MET A CB    1 
ATOM   1701 C  CG    . MET A 1 216 ? 10.930  -0.921  28.892  1.00 62.83 ? 216  MET A CG    1 
ATOM   1702 S  SD    . MET A 1 216 ? 11.276  -2.287  30.052  1.00 66.98 ? 216  MET A SD    1 
ATOM   1703 C  CE    . MET A 1 216 ? 11.254  -1.461  31.657  1.00 65.69 ? 216  MET A CE    1 
ATOM   1704 N  N     . ILE A 1 217 ? 13.758  0.667   26.256  1.00 59.22 ? 217  ILE A N     1 
ATOM   1705 C  CA    . ILE A 1 217 ? 13.734  0.787   24.786  1.00 58.59 ? 217  ILE A CA    1 
ATOM   1706 C  C     . ILE A 1 217 ? 15.104  1.019   24.127  1.00 58.03 ? 217  ILE A C     1 
ATOM   1707 O  O     . ILE A 1 217 ? 15.239  0.903   22.904  1.00 57.94 ? 217  ILE A O     1 
ATOM   1708 C  CB    . ILE A 1 217 ? 12.740  1.884   24.322  1.00 58.53 ? 217  ILE A CB    1 
ATOM   1709 C  CG1   . ILE A 1 217 ? 13.103  3.250   24.914  1.00 58.53 ? 217  ILE A CG1   1 
ATOM   1710 C  CG2   . ILE A 1 217 ? 11.329  1.502   24.714  1.00 57.88 ? 217  ILE A CG2   1 
ATOM   1711 C  CD1   . ILE A 1 217 ? 12.362  4.414   24.280  1.00 58.57 ? 217  ILE A CD1   1 
ATOM   1712 N  N     . GLY A 1 218 ? 16.105  1.353   24.936  1.00 57.36 ? 218  GLY A N     1 
ATOM   1713 C  CA    . GLY A 1 218 ? 17.460  1.599   24.446  1.00 56.78 ? 218  GLY A CA    1 
ATOM   1714 C  C     . GLY A 1 218 ? 17.843  3.067   24.508  1.00 56.26 ? 218  GLY A C     1 
ATOM   1715 O  O     . GLY A 1 218 ? 16.978  3.947   24.539  1.00 56.27 ? 218  GLY A O     1 
ATOM   1716 N  N     . GLU A 1 219 ? 19.147  3.327   24.512  1.00 55.47 ? 219  GLU A N     1 
ATOM   1717 C  CA    . GLU A 1 219 ? 19.665  4.687   24.579  1.00 54.95 ? 219  GLU A CA    1 
ATOM   1718 C  C     . GLU A 1 219 ? 19.238  5.516   23.374  1.00 53.98 ? 219  GLU A C     1 
ATOM   1719 O  O     . GLU A 1 219 ? 18.613  6.552   23.549  1.00 53.80 ? 219  GLU A O     1 
ATOM   1720 C  CB    . GLU A 1 219 ? 21.198  4.686   24.716  1.00 54.99 ? 219  GLU A CB    1 
ATOM   1721 C  CG    . GLU A 1 219 ? 21.814  6.061   25.024  1.00 55.60 ? 219  GLU A CG    1 
ATOM   1722 C  CD    . GLU A 1 219 ? 23.270  5.984   25.494  1.00 56.04 ? 219  GLU A CD    1 
ATOM   1723 O  OE1   . GLU A 1 219 ? 24.063  5.219   24.889  1.00 57.44 ? 219  GLU A OE1   1 
ATOM   1724 O  OE2   . GLU A 1 219 ? 23.620  6.696   26.469  1.00 56.79 ? 219  GLU A OE2   1 
ATOM   1725 N  N     . ALA A 1 220 ? 19.566  5.058   22.163  1.00 53.24 ? 220  ALA A N     1 
ATOM   1726 C  CA    . ALA A 1 220 ? 19.336  5.847   20.938  1.00 52.60 ? 220  ALA A CA    1 
ATOM   1727 C  C     . ALA A 1 220 ? 17.867  6.189   20.765  1.00 52.31 ? 220  ALA A C     1 
ATOM   1728 O  O     . ALA A 1 220 ? 17.519  7.331   20.471  1.00 52.06 ? 220  ALA A O     1 
ATOM   1729 C  CB    . ALA A 1 220 ? 19.854  5.118   19.717  1.00 52.27 ? 220  ALA A CB    1 
ATOM   1730 N  N     . LYS A 1 221 ? 17.012  5.201   20.987  1.00 52.08 ? 221  LYS A N     1 
ATOM   1731 C  CA    . LYS A 1 221 ? 15.572  5.384   20.878  1.00 52.37 ? 221  LYS A CA    1 
ATOM   1732 C  C     . LYS A 1 221 ? 15.012  6.349   21.936  1.00 52.39 ? 221  LYS A C     1 
ATOM   1733 O  O     . LYS A 1 221 ? 14.061  7.094   21.671  1.00 52.73 ? 221  LYS A O     1 
ATOM   1734 C  CB    . LYS A 1 221 ? 14.873  4.027   20.995  1.00 52.59 ? 221  LYS A CB    1 
ATOM   1735 C  CG    . LYS A 1 221 ? 13.843  3.755   19.907  1.00 53.19 ? 221  LYS A CG    1 
ATOM   1736 C  CD    . LYS A 1 221 ? 13.999  2.329   19.364  1.00 53.90 ? 221  LYS A CD    1 
ATOM   1737 C  CE    . LYS A 1 221 ? 13.409  2.179   17.979  1.00 54.56 ? 221  LYS A CE    1 
ATOM   1738 N  NZ    . LYS A 1 221 ? 14.065  3.065   16.964  1.00 54.76 ? 221  LYS A NZ    1 
ATOM   1739 N  N     . ALA A 1 222 ? 15.582  6.317   23.135  1.00 52.15 ? 222  ALA A N     1 
ATOM   1740 C  CA    . ALA A 1 222 ? 15.192  7.233   24.195  1.00 52.05 ? 222  ALA A CA    1 
ATOM   1741 C  C     . ALA A 1 222 ? 15.598  8.669   23.843  1.00 52.22 ? 222  ALA A C     1 
ATOM   1742 O  O     . ALA A 1 222 ? 14.765  9.581   23.871  1.00 52.09 ? 222  ALA A O     1 
ATOM   1743 C  CB    . ALA A 1 222 ? 15.823  6.807   25.508  1.00 51.93 ? 222  ALA A CB    1 
ATOM   1744 N  N     . LYS A 1 223 ? 16.875  8.863   23.505  1.00 52.31 ? 223  LYS A N     1 
ATOM   1745 C  CA    . LYS A 1 223 ? 17.373  10.179  23.083  1.00 52.79 ? 223  LYS A CA    1 
ATOM   1746 C  C     . LYS A 1 223 ? 16.549  10.743  21.904  1.00 52.20 ? 223  LYS A C     1 
ATOM   1747 O  O     . LYS A 1 223 ? 16.283  11.932  21.837  1.00 52.43 ? 223  LYS A O     1 
ATOM   1748 C  CB    . LYS A 1 223 ? 18.869  10.128  22.705  1.00 52.82 ? 223  LYS A CB    1 
ATOM   1749 C  CG    . LYS A 1 223 ? 19.812  9.637   23.806  1.00 54.13 ? 223  LYS A CG    1 
ATOM   1750 C  CD    . LYS A 1 223 ? 21.187  10.369  23.818  1.00 54.45 ? 223  LYS A CD    1 
ATOM   1751 C  CE    . LYS A 1 223 ? 22.009  10.119  22.531  1.00 56.26 ? 223  LYS A CE    1 
ATOM   1752 N  NZ    . LYS A 1 223 ? 23.457  10.488  22.684  1.00 55.91 ? 223  LYS A NZ    1 
ATOM   1753 N  N     . TYR A 1 224 ? 16.143  9.876   20.987  1.00 51.79 ? 224  TYR A N     1 
ATOM   1754 C  CA    . TYR A 1 224 ? 15.277  10.257  19.860  1.00 51.45 ? 224  TYR A CA    1 
ATOM   1755 C  C     . TYR A 1 224 ? 13.918  10.783  20.321  1.00 50.79 ? 224  TYR A C     1 
ATOM   1756 O  O     . TYR A 1 224 ? 13.541  11.895  19.965  1.00 50.87 ? 224  TYR A O     1 
ATOM   1757 C  CB    . TYR A 1 224 ? 15.106  9.046   18.945  1.00 51.42 ? 224  TYR A CB    1 
ATOM   1758 C  CG    . TYR A 1 224 ? 14.128  9.171   17.806  1.00 51.65 ? 224  TYR A CG    1 
ATOM   1759 C  CD1   . TYR A 1 224 ? 14.326  10.079  16.779  1.00 52.08 ? 224  TYR A CD1   1 
ATOM   1760 C  CD2   . TYR A 1 224 ? 13.031  8.310   17.719  1.00 51.82 ? 224  TYR A CD2   1 
ATOM   1761 C  CE1   . TYR A 1 224 ? 13.424  10.148  15.704  1.00 52.36 ? 224  TYR A CE1   1 
ATOM   1762 C  CE2   . TYR A 1 224 ? 12.136  8.378   16.676  1.00 50.89 ? 224  TYR A CE2   1 
ATOM   1763 C  CZ    . TYR A 1 224 ? 12.333  9.291   15.669  1.00 51.56 ? 224  TYR A CZ    1 
ATOM   1764 O  OH    . TYR A 1 224 ? 11.433  9.341   14.631  1.00 51.63 ? 224  TYR A OH    1 
ATOM   1765 N  N     . LEU A 1 225 ? 13.205  9.999   21.128  1.00 49.99 ? 225  LEU A N     1 
ATOM   1766 C  CA    . LEU A 1 225 ? 11.865  10.384  21.587  1.00 49.55 ? 225  LEU A CA    1 
ATOM   1767 C  C     . LEU A 1 225 ? 11.878  11.642  22.459  1.00 49.31 ? 225  LEU A C     1 
ATOM   1768 O  O     . LEU A 1 225 ? 11.067  12.544  22.265  1.00 48.97 ? 225  LEU A O     1 
ATOM   1769 C  CB    . LEU A 1 225 ? 11.203  9.236   22.348  1.00 49.33 ? 225  LEU A CB    1 
ATOM   1770 C  CG    . LEU A 1 225 ? 10.930  7.983   21.513  1.00 48.83 ? 225  LEU A CG    1 
ATOM   1771 C  CD1   . LEU A 1 225 ? 10.532  6.835   22.426  1.00 48.39 ? 225  LEU A CD1   1 
ATOM   1772 C  CD2   . LEU A 1 225 ? 9.868   8.231   20.459  1.00 47.31 ? 225  LEU A CD2   1 
ATOM   1773 N  N     . ILE A 1 226 ? 12.799  11.698  23.411  1.00 49.25 ? 226  ILE A N     1 
ATOM   1774 C  CA    . ILE A 1 226 ? 12.936  12.871  24.262  1.00 49.48 ? 226  ILE A CA    1 
ATOM   1775 C  C     . ILE A 1 226 ? 13.245  14.132  23.442  1.00 49.79 ? 226  ILE A C     1 
ATOM   1776 O  O     . ILE A 1 226 ? 12.689  15.204  23.708  1.00 49.23 ? 226  ILE A O     1 
ATOM   1777 C  CB    . ILE A 1 226 ? 14.018  12.647  25.347  1.00 49.63 ? 226  ILE A CB    1 
ATOM   1778 C  CG1   . ILE A 1 226 ? 13.476  11.713  26.431  1.00 49.47 ? 226  ILE A CG1   1 
ATOM   1779 C  CG2   . ILE A 1 226 ? 14.463  13.976  25.976  1.00 49.02 ? 226  ILE A CG2   1 
ATOM   1780 C  CD1   . ILE A 1 226 ? 14.456  11.437  27.537  1.00 49.31 ? 226  ILE A CD1   1 
ATOM   1781 N  N     . SER A 1 227 ? 14.115  13.978  22.440  1.00 50.32 ? 227  SER A N     1 
ATOM   1782 C  CA    . SER A 1 227 ? 14.543  15.071  21.553  1.00 50.61 ? 227  SER A CA    1 
ATOM   1783 C  C     . SER A 1 227 ? 13.365  15.618  20.735  1.00 50.83 ? 227  SER A C     1 
ATOM   1784 O  O     . SER A 1 227 ? 13.150  16.836  20.641  1.00 50.24 ? 227  SER A O     1 
ATOM   1785 C  CB    . SER A 1 227 ? 15.647  14.556  20.619  1.00 50.58 ? 227  SER A CB    1 
ATOM   1786 O  OG    . SER A 1 227 ? 16.227  15.591  19.846  1.00 51.30 ? 227  SER A OG    1 
ATOM   1787 N  N     . LEU A 1 228 ? 12.612  14.706  20.136  1.00 51.34 ? 228  LEU A N     1 
ATOM   1788 C  CA    . LEU A 1 228 ? 11.375  15.073  19.481  1.00 51.98 ? 228  LEU A CA    1 
ATOM   1789 C  C     . LEU A 1 228 ? 10.461  15.782  20.449  1.00 52.63 ? 228  LEU A C     1 
ATOM   1790 O  O     . LEU A 1 228 ? 9.959   16.861  20.142  1.00 52.94 ? 228  LEU A O     1 
ATOM   1791 C  CB    . LEU A 1 228 ? 10.657  13.844  18.954  1.00 51.86 ? 228  LEU A CB    1 
ATOM   1792 C  CG    . LEU A 1 228 ? 11.199  13.322  17.633  1.00 52.35 ? 228  LEU A CG    1 
ATOM   1793 C  CD1   . LEU A 1 228 ? 10.705  11.900  17.387  1.00 52.89 ? 228  LEU A CD1   1 
ATOM   1794 C  CD2   . LEU A 1 228 ? 10.788  14.234  16.488  1.00 52.30 ? 228  LEU A CD2   1 
ATOM   1795 N  N     . ALA A 1 229 ? 10.255  15.180  21.622  1.00 53.38 ? 229  ALA A N     1 
ATOM   1796 C  CA    . ALA A 1 229 ? 9.267   15.678  22.582  1.00 53.87 ? 229  ALA A CA    1 
ATOM   1797 C  C     . ALA A 1 229 ? 9.622   17.060  23.091  1.00 54.65 ? 229  ALA A C     1 
ATOM   1798 O  O     . ALA A 1 229 ? 8.738   17.846  23.419  1.00 54.80 ? 229  ALA A O     1 
ATOM   1799 C  CB    . ALA A 1 229 ? 9.118   14.720  23.732  1.00 53.79 ? 229  ALA A CB    1 
ATOM   1800 N  N     . ARG A 1 230 ? 10.916  17.358  23.145  1.00 55.77 ? 230  ARG A N     1 
ATOM   1801 C  CA    . ARG A 1 230 ? 11.383  18.673  23.569  1.00 56.90 ? 230  ARG A CA    1 
ATOM   1802 C  C     . ARG A 1 230 ? 11.325  19.717  22.459  1.00 57.80 ? 230  ARG A C     1 
ATOM   1803 O  O     . ARG A 1 230 ? 11.636  20.883  22.695  1.00 57.74 ? 230  ARG A O     1 
ATOM   1804 C  CB    . ARG A 1 230 ? 12.804  18.571  24.131  1.00 56.88 ? 230  ARG A CB    1 
ATOM   1805 C  CG    . ARG A 1 230 ? 12.812  17.918  25.488  1.00 57.34 ? 230  ARG A CG    1 
ATOM   1806 C  CD    . ARG A 1 230 ? 14.143  17.954  26.207  1.00 57.39 ? 230  ARG A CD    1 
ATOM   1807 N  NE    . ARG A 1 230 ? 13.894  17.719  27.631  1.00 58.43 ? 230  ARG A NE    1 
ATOM   1808 C  CZ    . ARG A 1 230 ? 14.741  17.146  28.485  1.00 59.17 ? 230  ARG A CZ    1 
ATOM   1809 N  NH1   . ARG A 1 230 ? 15.948  16.728  28.095  1.00 59.43 ? 230  ARG A NH1   1 
ATOM   1810 N  NH2   . ARG A 1 230 ? 14.369  16.990  29.754  1.00 58.65 ? 230  ARG A NH2   1 
ATOM   1811 N  N     . ASP A 1 231 ? 10.920  19.302  21.259  1.00 59.09 ? 231  ASP A N     1 
ATOM   1812 C  CA    . ASP A 1 231 ? 10.891  20.177  20.087  1.00 60.05 ? 231  ASP A CA    1 
ATOM   1813 C  C     . ASP A 1 231 ? 12.312  20.643  19.746  1.00 60.96 ? 231  ASP A C     1 
ATOM   1814 O  O     . ASP A 1 231 ? 12.524  21.792  19.349  1.00 61.32 ? 231  ASP A O     1 
ATOM   1815 C  CB    . ASP A 1 231 ? 9.960   21.372  20.348  1.00 60.07 ? 231  ASP A CB    1 
ATOM   1816 C  CG    . ASP A 1 231 ? 9.342   21.947  19.075  1.00 60.18 ? 231  ASP A CG    1 
ATOM   1817 O  OD1   . ASP A 1 231 ? 9.734   21.540  17.951  1.00 60.26 ? 231  ASP A OD1   1 
ATOM   1818 O  OD2   . ASP A 1 231 ? 8.453   22.822  19.218  1.00 59.00 ? 231  ASP A OD2   1 
ATOM   1819 N  N     . GLU A 1 232 ? 13.280  19.745  19.930  1.00 61.81 ? 232  GLU A N     1 
ATOM   1820 C  CA    . GLU A 1 232 ? 14.694  20.052  19.702  1.00 62.66 ? 232  GLU A CA    1 
ATOM   1821 C  C     . GLU A 1 232 ? 15.295  19.243  18.557  1.00 63.21 ? 232  GLU A C     1 
ATOM   1822 O  O     . GLU A 1 232 ? 16.343  19.623  18.035  1.00 63.49 ? 232  GLU A O     1 
ATOM   1823 C  CB    . GLU A 1 232 ? 15.509  19.801  20.971  1.00 62.47 ? 232  GLU A CB    1 
ATOM   1824 C  CG    . GLU A 1 232 ? 15.383  20.897  22.007  1.00 63.11 ? 232  GLU A CG    1 
ATOM   1825 C  CD    . GLU A 1 232 ? 16.078  20.563  23.328  1.00 63.66 ? 232  GLU A CD    1 
ATOM   1826 O  OE1   . GLU A 1 232 ? 16.676  19.464  23.455  1.00 64.08 ? 232  GLU A OE1   1 
ATOM   1827 O  OE2   . GLU A 1 232 ? 16.016  21.413  24.250  1.00 65.26 ? 232  GLU A OE2   1 
ATOM   1828 N  N     . TYR A 1 233 ? 14.655  18.134  18.177  1.00 63.78 ? 233  TYR A N     1 
ATOM   1829 C  CA    . TYR A 1 233 ? 15.180  17.272  17.128  1.00 64.26 ? 233  TYR A CA    1 
ATOM   1830 C  C     . TYR A 1 233 ? 15.426  18.109  15.895  1.00 64.31 ? 233  TYR A C     1 
ATOM   1831 O  O     . TYR A 1 233 ? 14.539  18.816  15.450  1.00 64.66 ? 233  TYR A O     1 
ATOM   1832 C  CB    . TYR A 1 233 ? 14.204  16.149  16.799  1.00 64.77 ? 233  TYR A CB    1 
ATOM   1833 C  CG    . TYR A 1 233 ? 14.682  15.254  15.675  1.00 65.35 ? 233  TYR A CG    1 
ATOM   1834 C  CD1   . TYR A 1 233 ? 15.296  14.031  15.938  1.00 65.86 ? 233  TYR A CD1   1 
ATOM   1835 C  CD2   . TYR A 1 233 ? 14.517  15.635  14.344  1.00 66.10 ? 233  TYR A CD2   1 
ATOM   1836 C  CE1   . TYR A 1 233 ? 15.729  13.206  14.897  1.00 66.47 ? 233  TYR A CE1   1 
ATOM   1837 C  CE2   . TYR A 1 233 ? 14.940  14.828  13.300  1.00 66.16 ? 233  TYR A CE2   1 
ATOM   1838 C  CZ    . TYR A 1 233 ? 15.543  13.618  13.576  1.00 66.50 ? 233  TYR A CZ    1 
ATOM   1839 O  OH    . TYR A 1 233 ? 15.964  12.841  12.521  1.00 66.32 ? 233  TYR A OH    1 
ATOM   1840 N  N     . ASN A 1 234 ? 16.628  18.031  15.341  1.00 64.36 ? 234  ASN A N     1 
ATOM   1841 C  CA    . ASN A 1 234 ? 16.996  18.926  14.258  1.00 64.35 ? 234  ASN A CA    1 
ATOM   1842 C  C     . ASN A 1 234 ? 18.033  18.348  13.297  1.00 63.98 ? 234  ASN A C     1 
ATOM   1843 O  O     . ASN A 1 234 ? 18.855  19.091  12.766  1.00 63.89 ? 234  ASN A O     1 
ATOM   1844 C  CB    . ASN A 1 234 ? 17.514  20.237  14.861  1.00 64.69 ? 234  ASN A CB    1 
ATOM   1845 C  CG    . ASN A 1 234 ? 17.428  21.407  13.896  1.00 65.61 ? 234  ASN A CG    1 
ATOM   1846 O  OD1   . ASN A 1 234 ? 16.525  21.472  13.059  1.00 67.11 ? 234  ASN A OD1   1 
ATOM   1847 N  ND2   . ASN A 1 234 ? 18.364  22.346  14.020  1.00 65.46 ? 234  ASN A ND2   1 
ATOM   1848 N  N     . GLU A 1 235 ? 17.983  17.035  13.060  1.00 63.61 ? 235  GLU A N     1 
ATOM   1849 C  CA    . GLU A 1 235 ? 18.923  16.386  12.152  1.00 63.45 ? 235  GLU A CA    1 
ATOM   1850 C  C     . GLU A 1 235 ? 18.823  17.081  10.800  1.00 62.86 ? 235  GLU A C     1 
ATOM   1851 O  O     . GLU A 1 235 ? 17.720  17.348  10.326  1.00 63.26 ? 235  GLU A O     1 
ATOM   1852 C  CB    . GLU A 1 235 ? 18.636  14.883  12.014  1.00 63.77 ? 235  GLU A CB    1 
ATOM   1853 C  CG    . GLU A 1 235 ? 18.984  14.034  13.267  1.00 65.31 ? 235  GLU A CG    1 
ATOM   1854 C  CD    . GLU A 1 235 ? 20.513  13.918  13.539  1.00 68.02 ? 235  GLU A CD    1 
ATOM   1855 O  OE1   . GLU A 1 235 ? 21.268  13.537  12.605  1.00 68.99 ? 235  GLU A OE1   1 
ATOM   1856 O  OE2   . GLU A 1 235 ? 20.959  14.201  14.688  1.00 68.13 ? 235  GLU A OE2   1 
ATOM   1857 N  N     . PRO A 1 236 ? 19.968  17.413  10.186  1.00 62.12 ? 236  PRO A N     1 
ATOM   1858 C  CA    . PRO A 1 236 ? 19.909  18.178  8.957   1.00 61.54 ? 236  PRO A CA    1 
ATOM   1859 C  C     . PRO A 1 236 ? 19.855  17.295  7.723   1.00 60.98 ? 236  PRO A C     1 
ATOM   1860 O  O     . PRO A 1 236 ? 20.086  16.090  7.810   1.00 61.55 ? 236  PRO A O     1 
ATOM   1861 C  CB    . PRO A 1 236 ? 21.216  18.982  8.987   1.00 61.49 ? 236  PRO A CB    1 
ATOM   1862 C  CG    . PRO A 1 236 ? 22.130  18.229  9.899   1.00 61.51 ? 236  PRO A CG    1 
ATOM   1863 C  CD    . PRO A 1 236 ? 21.362  17.120  10.557  1.00 62.11 ? 236  PRO A CD    1 
ATOM   1864 N  N     . ILE A 1 237 ? 19.554  17.913  6.589   1.00 60.36 ? 237  ILE A N     1 
ATOM   1865 C  CA    . ILE A 1 237 ? 19.495  17.242  5.299   1.00 59.97 ? 237  ILE A CA    1 
ATOM   1866 C  C     . ILE A 1 237 ? 20.927  16.972  4.845   1.00 60.04 ? 237  ILE A C     1 
ATOM   1867 O  O     . ILE A 1 237 ? 21.732  17.878  4.743   1.00 59.77 ? 237  ILE A O     1 
ATOM   1868 C  CB    . ILE A 1 237 ? 18.711  18.095  4.250   1.00 59.54 ? 237  ILE A CB    1 
ATOM   1869 C  CG1   . ILE A 1 237 ? 17.216  17.995  4.489   1.00 59.34 ? 237  ILE A CG1   1 
ATOM   1870 C  CG2   . ILE A 1 237 ? 18.938  17.623  2.845   1.00 59.24 ? 237  ILE A CG2   1 
ATOM   1871 C  CD1   . ILE A 1 237 ? 16.785  18.291  5.884   1.00 59.81 ? 237  ILE A CD1   1 
ATOM   1872 N  N     . ARG A 1 238 ? 21.232  15.706  4.603   1.00 60.63 ? 238  ARG A N     1 
ATOM   1873 C  CA    . ARG A 1 238 ? 22.553  15.296  4.173   1.00 61.61 ? 238  ARG A CA    1 
ATOM   1874 C  C     . ARG A 1 238 ? 22.454  14.224  3.095   1.00 60.78 ? 238  ARG A C     1 
ATOM   1875 O  O     . ARG A 1 238 ? 21.603  13.360  3.167   1.00 60.60 ? 238  ARG A O     1 
ATOM   1876 C  CB    . ARG A 1 238 ? 23.356  14.772  5.371   1.00 61.72 ? 238  ARG A CB    1 
ATOM   1877 C  CG    . ARG A 1 238 ? 22.681  13.631  6.144   1.00 63.35 ? 238  ARG A CG    1 
ATOM   1878 C  CD    . ARG A 1 238 ? 23.565  13.094  7.293   1.00 64.78 ? 238  ARG A CD    1 
ATOM   1879 N  NE    . ARG A 1 238 ? 24.146  14.156  8.133   1.00 67.34 ? 238  ARG A NE    1 
ATOM   1880 C  CZ    . ARG A 1 238 ? 25.422  14.568  8.104   1.00 69.14 ? 238  ARG A CZ    1 
ATOM   1881 N  NH1   . ARG A 1 238 ? 25.824  15.548  8.920   1.00 68.89 ? 238  ARG A NH1   1 
ATOM   1882 N  NH2   . ARG A 1 238 ? 26.314  14.017  7.275   1.00 70.56 ? 238  ARG A NH2   1 
ATOM   1883 N  N     . THR A 1 239 ? 23.328  14.294  2.099   1.00 60.50 ? 239  THR A N     1 
ATOM   1884 C  CA    . THR A 1 239 ? 23.411  13.264  1.084   1.00 60.74 ? 239  THR A CA    1 
ATOM   1885 C  C     . THR A 1 239 ? 23.615  11.889  1.729   1.00 61.42 ? 239  THR A C     1 
ATOM   1886 O  O     . THR A 1 239 ? 24.476  11.720  2.578   1.00 60.93 ? 239  THR A O     1 
ATOM   1887 C  CB    . THR A 1 239 ? 24.564  13.550  0.117   1.00 60.57 ? 239  THR A CB    1 
ATOM   1888 O  OG1   . THR A 1 239 ? 24.326  14.799  -0.529  1.00 60.62 ? 239  THR A OG1   1 
ATOM   1889 C  CG2   . THR A 1 239 ? 24.689  12.469  -0.927  1.00 59.34 ? 239  THR A CG2   1 
ATOM   1890 N  N     . ARG A 1 240 ? 22.807  10.915  1.336   1.00 62.39 ? 240  ARG A N     1 
ATOM   1891 C  CA    . ARG A 1 240 ? 22.908  9.589   1.928   1.00 63.88 ? 240  ARG A CA    1 
ATOM   1892 C  C     . ARG A 1 240 ? 24.005  8.775   1.251   1.00 62.66 ? 240  ARG A C     1 
ATOM   1893 O  O     . ARG A 1 240 ? 24.099  8.739   0.028   1.00 62.70 ? 240  ARG A O     1 
ATOM   1894 C  CB    . ARG A 1 240 ? 21.562  8.849   1.880   1.00 64.09 ? 240  ARG A CB    1 
ATOM   1895 C  CG    . ARG A 1 240 ? 21.198  8.094   0.569   1.00 66.51 ? 240  ARG A CG    1 
ATOM   1896 C  CD    . ARG A 1 240 ? 20.380  6.813   0.895   1.00 67.87 ? 240  ARG A CD    1 
ATOM   1897 N  NE    . ARG A 1 240 ? 19.318  6.537   -0.083  1.00 71.07 ? 240  ARG A NE    1 
ATOM   1898 C  CZ    . ARG A 1 240 ? 18.347  5.640   0.092   1.00 72.52 ? 240  ARG A CZ    1 
ATOM   1899 N  NH1   . ARG A 1 240 ? 18.290  4.908   1.205   1.00 74.61 ? 240  ARG A NH1   1 
ATOM   1900 N  NH2   . ARG A 1 240 ? 17.429  5.457   -0.855  1.00 72.86 ? 240  ARG A NH2   1 
ATOM   1901 N  N     . VAL A 1 241 ? 24.842  8.136   2.055   1.00 61.83 ? 241  VAL A N     1 
ATOM   1902 C  CA    . VAL A 1 241 ? 25.909  7.305   1.519   1.00 61.23 ? 241  VAL A CA    1 
ATOM   1903 C  C     . VAL A 1 241 ? 25.542  5.854   1.781   1.00 60.78 ? 241  VAL A C     1 
ATOM   1904 O  O     . VAL A 1 241 ? 25.322  5.454   2.922   1.00 60.52 ? 241  VAL A O     1 
ATOM   1905 C  CB    . VAL A 1 241 ? 27.279  7.650   2.142   1.00 61.30 ? 241  VAL A CB    1 
ATOM   1906 C  CG1   . VAL A 1 241 ? 28.363  6.781   1.528   1.00 60.59 ? 241  VAL A CG1   1 
ATOM   1907 C  CG2   . VAL A 1 241 ? 27.591  9.153   1.966   1.00 59.72 ? 241  VAL A CG2   1 
ATOM   1908 N  N     . ARG A 1 242 ? 25.451  5.077   0.711   1.00 60.34 ? 242  ARG A N     1 
ATOM   1909 C  CA    . ARG A 1 242 ? 25.082  3.687   0.826   1.00 60.30 ? 242  ARG A CA    1 
ATOM   1910 C  C     . ARG A 1 242 ? 26.121  2.980   1.713   1.00 59.32 ? 242  ARG A C     1 
ATOM   1911 O  O     . ARG A 1 242 ? 27.332  3.058   1.476   1.00 59.21 ? 242  ARG A O     1 
ATOM   1912 C  CB    . ARG A 1 242 ? 24.969  3.055   -0.556  1.00 60.75 ? 242  ARG A CB    1 
ATOM   1913 C  CG    . ARG A 1 242 ? 23.997  1.899   -0.620  1.00 64.62 ? 242  ARG A CG    1 
ATOM   1914 C  CD    . ARG A 1 242 ? 22.518  2.351   -0.526  1.00 69.12 ? 242  ARG A CD    1 
ATOM   1915 N  NE    . ARG A 1 242 ? 21.812  2.349   -1.818  1.00 71.56 ? 242  ARG A NE    1 
ATOM   1916 C  CZ    . ARG A 1 242 ? 20.490  2.536   -1.967  1.00 73.57 ? 242  ARG A CZ    1 
ATOM   1917 N  NH1   . ARG A 1 242 ? 19.691  2.748   -0.909  1.00 74.30 ? 242  ARG A NH1   1 
ATOM   1918 N  NH2   . ARG A 1 242 ? 19.948  2.514   -3.187  1.00 72.88 ? 242  ARG A NH2   1 
ATOM   1919 N  N     . LYS A 1 243 ? 25.627  2.346   2.768   1.00 58.22 ? 243  LYS A N     1 
ATOM   1920 C  CA    . LYS A 1 243 ? 26.462  1.727   3.797   1.00 57.46 ? 243  LYS A CA    1 
ATOM   1921 C  C     . LYS A 1 243 ? 26.734  0.242   3.489   1.00 56.13 ? 243  LYS A C     1 
ATOM   1922 O  O     . LYS A 1 243 ? 27.785  -0.273  3.829   1.00 55.92 ? 243  LYS A O     1 
ATOM   1923 C  CB    . LYS A 1 243 ? 25.781  1.858   5.179   1.00 57.92 ? 243  LYS A CB    1 
ATOM   1924 C  CG    . LYS A 1 243 ? 26.513  2.715   6.210   1.00 58.54 ? 243  LYS A CG    1 
ATOM   1925 C  CD    . LYS A 1 243 ? 26.218  4.212   6.073   1.00 60.65 ? 243  LYS A CD    1 
ATOM   1926 C  CE    . LYS A 1 243 ? 26.982  5.045   7.132   1.00 61.28 ? 243  LYS A CE    1 
ATOM   1927 N  NZ    . LYS A 1 243 ? 28.494  4.835   7.136   1.00 60.79 ? 243  LYS A NZ    1 
ATOM   1928 N  N     . SER A 1 244 ? 25.771  -0.427  2.857   1.00 54.75 ? 244  SER A N     1 
ATOM   1929 C  CA    . SER A 1 244 ? 25.850  -1.845  2.550   1.00 53.85 ? 244  SER A CA    1 
ATOM   1930 C  C     . SER A 1 244 ? 25.112  -2.164  1.265   1.00 52.98 ? 244  SER A C     1 
ATOM   1931 O  O     . SER A 1 244 ? 24.124  -1.510  0.932   1.00 53.41 ? 244  SER A O     1 
ATOM   1932 C  CB    . SER A 1 244 ? 25.215  -2.653  3.669   1.00 54.03 ? 244  SER A CB    1 
ATOM   1933 O  OG    . SER A 1 244 ? 23.855  -2.298  3.823   1.00 54.92 ? 244  SER A OG    1 
ATOM   1934 N  N     . ILE A 1 245 ? 25.585  -3.173  0.549   1.00 51.83 ? 245  ILE A N     1 
ATOM   1935 C  CA    . ILE A 1 245 ? 24.962  -3.598  -0.696  1.00 51.55 ? 245  ILE A CA    1 
ATOM   1936 C  C     . ILE A 1 245 ? 24.943  -5.112  -0.778  1.00 50.25 ? 245  ILE A C     1 
ATOM   1937 O  O     . ILE A 1 245 ? 25.930  -5.777  -0.456  1.00 49.56 ? 245  ILE A O     1 
ATOM   1938 C  CB    . ILE A 1 245 ? 25.731  -3.067  -1.915  1.00 51.68 ? 245  ILE A CB    1 
ATOM   1939 C  CG1   . ILE A 1 245 ? 25.689  -1.541  -1.943  1.00 53.24 ? 245  ILE A CG1   1 
ATOM   1940 C  CG2   . ILE A 1 245 ? 25.133  -3.600  -3.213  1.00 51.92 ? 245  ILE A CG2   1 
ATOM   1941 C  CD1   . ILE A 1 245 ? 26.302  -0.946  -3.222  1.00 53.24 ? 245  ILE A CD1   1 
ATOM   1942 N  N     . GLY A 1 246 ? 23.839  -5.670  -1.246  1.00 48.87 ? 246  GLY A N     1 
ATOM   1943 C  CA    . GLY A 1 246 ? 23.796  -7.108  -1.385  1.00 48.21 ? 246  GLY A CA    1 
ATOM   1944 C  C     . GLY A 1 246 ? 22.632  -7.640  -2.161  1.00 47.59 ? 246  GLY A C     1 
ATOM   1945 O  O     . GLY A 1 246 ? 21.881  -6.898  -2.765  1.00 47.22 ? 246  GLY A O     1 
ATOM   1946 N  N     . ARG A 1 247 ? 22.480  -8.953  -2.103  1.00 47.40 ? 247  ARG A N     1 
ATOM   1947 C  CA    . ARG A 1 247 ? 21.577  -9.664  -2.977  1.00 47.39 ? 247  ARG A CA    1 
ATOM   1948 C  C     . ARG A 1 247 ? 21.180  -10.970 -2.278  1.00 46.42 ? 247  ARG A C     1 
ATOM   1949 O  O     . ARG A 1 247 ? 22.003  -11.607 -1.644  1.00 46.56 ? 247  ARG A O     1 
ATOM   1950 C  CB    . ARG A 1 247 ? 22.301  -9.901  -4.306  1.00 47.67 ? 247  ARG A CB    1 
ATOM   1951 C  CG    . ARG A 1 247 ? 21.538  -10.650 -5.377  1.00 51.51 ? 247  ARG A CG    1 
ATOM   1952 C  CD    . ARG A 1 247 ? 20.332  -9.869  -5.970  1.00 56.35 ? 247  ARG A CD    1 
ATOM   1953 N  NE    . ARG A 1 247 ? 19.523  -10.724 -6.860  1.00 57.93 ? 247  ARG A NE    1 
ATOM   1954 C  CZ    . ARG A 1 247 ? 18.216  -10.572 -7.099  1.00 60.40 ? 247  ARG A CZ    1 
ATOM   1955 N  NH1   . ARG A 1 247 ? 17.508  -9.600  -6.520  1.00 60.82 ? 247  ARG A NH1   1 
ATOM   1956 N  NH2   . ARG A 1 247 ? 17.597  -11.412 -7.926  1.00 61.00 ? 247  ARG A NH2   1 
ATOM   1957 N  N     . ILE A 1 248 ? 19.909  -11.338 -2.360  1.00 45.57 ? 248  ILE A N     1 
ATOM   1958 C  CA    . ILE A 1 248 ? 19.404  -12.563 -1.729  1.00 45.34 ? 248  ILE A CA    1 
ATOM   1959 C  C     . ILE A 1 248 ? 18.379  -13.195 -2.678  1.00 44.85 ? 248  ILE A C     1 
ATOM   1960 O  O     . ILE A 1 248 ? 17.648  -12.477 -3.368  1.00 45.25 ? 248  ILE A O     1 
ATOM   1961 C  CB    . ILE A 1 248 ? 18.809  -12.262 -0.305  1.00 45.31 ? 248  ILE A CB    1 
ATOM   1962 C  CG1   . ILE A 1 248 ? 18.241  -13.503 0.366   1.00 45.34 ? 248  ILE A CG1   1 
ATOM   1963 C  CG2   . ILE A 1 248 ? 17.731  -11.228 -0.369  1.00 45.59 ? 248  ILE A CG2   1 
ATOM   1964 C  CD1   . ILE A 1 248 ? 17.952  -13.273 1.843   1.00 45.24 ? 248  ILE A CD1   1 
ATOM   1965 N  N     . VAL A 1 249 ? 18.351  -14.520 -2.759  1.00 43.70 ? 249  VAL A N     1 
ATOM   1966 C  CA    . VAL A 1 249 ? 17.474  -15.171 -3.716  1.00 43.44 ? 249  VAL A CA    1 
ATOM   1967 C  C     . VAL A 1 249 ? 16.754  -16.355 -3.094  1.00 43.42 ? 249  VAL A C     1 
ATOM   1968 O  O     . VAL A 1 249 ? 17.250  -16.964 -2.150  1.00 42.68 ? 249  VAL A O     1 
ATOM   1969 C  CB    . VAL A 1 249 ? 18.231  -15.601 -5.006  1.00 43.45 ? 249  VAL A CB    1 
ATOM   1970 C  CG1   . VAL A 1 249 ? 18.936  -14.420 -5.625  1.00 42.95 ? 249  VAL A CG1   1 
ATOM   1971 C  CG2   . VAL A 1 249 ? 19.221  -16.729 -4.733  1.00 43.80 ? 249  VAL A CG2   1 
ATOM   1972 N  N     . THR A 1 250 ? 15.566  -16.660 -3.611  1.00 43.82 ? 250  THR A N     1 
ATOM   1973 C  CA    . THR A 1 250 ? 14.796  -17.791 -3.096  1.00 44.34 ? 250  THR A CA    1 
ATOM   1974 C  C     . THR A 1 250 ? 15.116  -19.013 -3.932  1.00 44.91 ? 250  THR A C     1 
ATOM   1975 O  O     . THR A 1 250 ? 15.174  -18.944 -5.157  1.00 44.76 ? 250  THR A O     1 
ATOM   1976 C  CB    . THR A 1 250 ? 13.278  -17.514 -3.056  1.00 44.24 ? 250  THR A CB    1 
ATOM   1977 O  OG1   . THR A 1 250 ? 13.030  -16.299 -2.332  1.00 44.09 ? 250  THR A OG1   1 
ATOM   1978 C  CG2   . THR A 1 250 ? 12.544  -18.658 -2.382  1.00 42.70 ? 250  THR A CG2   1 
ATOM   1979 N  N     . MET A 1 251 ? 15.370  -20.124 -3.261  1.00 45.93 ? 251  MET A N     1 
ATOM   1980 C  CA    . MET A 1 251 ? 15.751  -21.341 -3.953  1.00 47.21 ? 251  MET A CA    1 
ATOM   1981 C  C     . MET A 1 251 ? 14.511  -22.101 -4.383  1.00 48.05 ? 251  MET A C     1 
ATOM   1982 O  O     . MET A 1 251 ? 13.498  -22.145 -3.667  1.00 48.04 ? 251  MET A O     1 
ATOM   1983 C  CB    . MET A 1 251 ? 16.629  -22.214 -3.065  1.00 47.23 ? 251  MET A CB    1 
ATOM   1984 C  CG    . MET A 1 251 ? 17.940  -21.533 -2.649  1.00 47.36 ? 251  MET A CG    1 
ATOM   1985 S  SD    . MET A 1 251 ? 19.012  -22.608 -1.676  1.00 48.40 ? 251  MET A SD    1 
ATOM   1986 C  CE    . MET A 1 251 ? 17.993  -22.896 -0.233  1.00 48.46 ? 251  MET A CE    1 
ATOM   1987 N  N     . LYS A 1 252 ? 14.609  -22.683 -5.575  1.00 49.10 ? 252  LYS A N     1 
ATOM   1988 C  CA    . LYS A 1 252 ? 13.575  -23.545 -6.159  1.00 49.66 ? 252  LYS A CA    1 
ATOM   1989 C  C     . LYS A 1 252 ? 13.041  -24.525 -5.111  1.00 49.81 ? 252  LYS A C     1 
ATOM   1990 O  O     . LYS A 1 252 ? 11.856  -24.854 -5.121  1.00 50.35 ? 252  LYS A O     1 
ATOM   1991 C  CB    . LYS A 1 252 ? 14.169  -24.323 -7.352  1.00 50.21 ? 252  LYS A CB    1 
ATOM   1992 C  CG    . LYS A 1 252 ? 13.410  -24.242 -8.660  1.00 51.27 ? 252  LYS A CG    1 
ATOM   1993 C  CD    . LYS A 1 252 ? 13.715  -22.966 -9.453  1.00 53.24 ? 252  LYS A CD    1 
ATOM   1994 C  CE    . LYS A 1 252 ? 13.065  -22.980 -10.878 1.00 54.11 ? 252  LYS A CE    1 
ATOM   1995 N  NZ    . LYS A 1 252 ? 11.638  -23.533 -10.957 1.00 55.67 ? 252  LYS A NZ    1 
ATOM   1996 N  N     . ARG A 1 253 ? 13.913  -24.990 -4.214  1.00 49.81 ? 253  ARG A N     1 
ATOM   1997 C  CA    . ARG A 1 253 ? 13.479  -25.812 -3.075  1.00 50.14 ? 253  ARG A CA    1 
ATOM   1998 C  C     . ARG A 1 253 ? 14.497  -25.828 -1.915  1.00 49.76 ? 253  ARG A C     1 
ATOM   1999 O  O     . ARG A 1 253 ? 15.695  -25.617 -2.130  1.00 49.70 ? 253  ARG A O     1 
ATOM   2000 C  CB    . ARG A 1 253 ? 13.205  -27.235 -3.546  1.00 50.48 ? 253  ARG A CB    1 
ATOM   2001 C  CG    . ARG A 1 253 ? 14.357  -27.832 -4.300  1.00 51.30 ? 253  ARG A CG    1 
ATOM   2002 C  CD    . ARG A 1 253 ? 14.161  -29.295 -4.539  1.00 52.71 ? 253  ARG A CD    1 
ATOM   2003 N  NE    . ARG A 1 253 ? 15.381  -30.032 -4.226  1.00 53.78 ? 253  ARG A NE    1 
ATOM   2004 C  CZ    . ARG A 1 253 ? 15.525  -31.341 -4.376  1.00 53.22 ? 253  ARG A CZ    1 
ATOM   2005 N  NH1   . ARG A 1 253 ? 14.521  -32.083 -4.831  1.00 53.77 ? 253  ARG A NH1   1 
ATOM   2006 N  NH2   . ARG A 1 253 ? 16.682  -31.904 -4.063  1.00 53.42 ? 253  ARG A NH2   1 
ATOM   2007 N  N     . ASN A 1 254 ? 14.014  -26.071 -0.692  1.00 49.17 ? 254  ASN A N     1 
ATOM   2008 C  CA    . ASN A 1 254 ? 14.893  -26.040 0.482   1.00 49.01 ? 254  ASN A CA    1 
ATOM   2009 C  C     . ASN A 1 254 ? 15.970  -27.104 0.361   1.00 48.77 ? 254  ASN A C     1 
ATOM   2010 O  O     . ASN A 1 254 ? 15.719  -28.171 -0.195  1.00 48.87 ? 254  ASN A O     1 
ATOM   2011 C  CB    . ASN A 1 254 ? 14.155  -26.306 1.801   1.00 48.87 ? 254  ASN A CB    1 
ATOM   2012 C  CG    . ASN A 1 254 ? 12.966  -25.412 2.014   1.00 48.56 ? 254  ASN A CG    1 
ATOM   2013 O  OD1   . ASN A 1 254 ? 13.039  -24.200 1.877   1.00 44.49 ? 254  ASN A OD1   1 
ATOM   2014 N  ND2   . ASN A 1 254 ? 11.847  -26.023 2.373   1.00 51.24 ? 254  ASN A ND2   1 
ATOM   2015 N  N     . SER A 1 255 ? 17.143  -26.826 0.919   1.00 48.27 ? 255  SER A N     1 
ATOM   2016 C  CA    . SER A 1 255 ? 18.255  -27.752 0.849   1.00 48.22 ? 255  SER A CA    1 
ATOM   2017 C  C     . SER A 1 255 ? 19.264  -27.524 1.952   1.00 48.13 ? 255  SER A C     1 
ATOM   2018 O  O     . SER A 1 255 ? 19.312  -26.459 2.539   1.00 48.62 ? 255  SER A O     1 
ATOM   2019 C  CB    . SER A 1 255 ? 18.965  -27.609 -0.492  1.00 48.25 ? 255  SER A CB    1 
ATOM   2020 O  OG    . SER A 1 255 ? 20.029  -28.538 -0.597  1.00 48.07 ? 255  SER A OG    1 
ATOM   2021 N  N     . ARG A 1 256 ? 20.053  -28.553 2.228   1.00 48.11 ? 256  ARG A N     1 
ATOM   2022 C  CA    . ARG A 1 256 ? 21.270  -28.432 3.022   1.00 48.22 ? 256  ARG A CA    1 
ATOM   2023 C  C     . ARG A 1 256 ? 22.466  -28.891 2.194   1.00 47.97 ? 256  ARG A C     1 
ATOM   2024 O  O     . ARG A 1 256 ? 23.528  -29.143 2.738   1.00 47.79 ? 256  ARG A O     1 
ATOM   2025 C  CB    . ARG A 1 256 ? 21.191  -29.302 4.274   1.00 48.16 ? 256  ARG A CB    1 
ATOM   2026 C  CG    . ARG A 1 256 ? 19.914  -29.159 5.063   1.00 48.75 ? 256  ARG A CG    1 
ATOM   2027 C  CD    . ARG A 1 256 ? 19.918  -30.017 6.321   1.00 48.78 ? 256  ARG A CD    1 
ATOM   2028 N  NE    . ARG A 1 256 ? 21.208  -29.981 7.011   1.00 50.41 ? 256  ARG A NE    1 
ATOM   2029 C  CZ    . ARG A 1 256 ? 21.691  -28.943 7.701   1.00 50.75 ? 256  ARG A CZ    1 
ATOM   2030 N  NH1   . ARG A 1 256 ? 20.993  -27.819 7.823   1.00 51.15 ? 256  ARG A NH1   1 
ATOM   2031 N  NH2   . ARG A 1 256 ? 22.882  -29.037 8.284   1.00 50.36 ? 256  ARG A NH2   1 
ATOM   2032 N  N     . ASN A 1 257 ? 22.280  -28.996 0.883   1.00 48.14 ? 257  ASN A N     1 
ATOM   2033 C  CA    . ASN A 1 257 ? 23.272  -29.561 -0.018  1.00 48.41 ? 257  ASN A CA    1 
ATOM   2034 C  C     . ASN A 1 257 ? 24.077  -28.435 -0.642  1.00 48.27 ? 257  ASN A C     1 
ATOM   2035 O  O     . ASN A 1 257 ? 23.568  -27.685 -1.479  1.00 48.05 ? 257  ASN A O     1 
ATOM   2036 C  CB    . ASN A 1 257 ? 22.584  -30.417 -1.098  1.00 48.57 ? 257  ASN A CB    1 
ATOM   2037 C  CG    . ASN A 1 257 ? 23.572  -31.192 -1.970  1.00 49.50 ? 257  ASN A CG    1 
ATOM   2038 O  OD1   . ASN A 1 257 ? 24.362  -30.612 -2.717  1.00 49.13 ? 257  ASN A OD1   1 
ATOM   2039 N  ND2   . ASN A 1 257 ? 23.511  -32.521 -1.884  1.00 52.29 ? 257  ASN A ND2   1 
ATOM   2040 N  N     . LEU A 1 258 ? 25.339  -28.336 -0.232  1.00 48.42 ? 258  LEU A N     1 
ATOM   2041 C  CA    . LEU A 1 258 ? 26.223  -27.264 -0.660  1.00 48.45 ? 258  LEU A CA    1 
ATOM   2042 C  C     . LEU A 1 258 ? 26.250  -27.089 -2.180  1.00 48.94 ? 258  LEU A C     1 
ATOM   2043 O  O     . LEU A 1 258 ? 26.112  -25.961 -2.679  1.00 49.52 ? 258  LEU A O     1 
ATOM   2044 C  CB    . LEU A 1 258 ? 27.633  -27.510 -0.148  1.00 48.42 ? 258  LEU A CB    1 
ATOM   2045 C  CG    . LEU A 1 258 ? 28.555  -26.294 -0.198  1.00 48.09 ? 258  LEU A CG    1 
ATOM   2046 C  CD1   . LEU A 1 258 ? 28.180  -25.306 0.893   1.00 46.93 ? 258  LEU A CD1   1 
ATOM   2047 C  CD2   . LEU A 1 258 ? 30.009  -26.741 -0.055  1.00 48.01 ? 258  LEU A CD2   1 
ATOM   2048 N  N     . GLU A 1 259 ? 26.402  -28.189 -2.914  1.00 49.12 ? 259  GLU A N     1 
ATOM   2049 C  CA    . GLU A 1 259 ? 26.446  -28.123 -4.381  1.00 49.39 ? 259  GLU A CA    1 
ATOM   2050 C  C     . GLU A 1 259 ? 25.099  -27.655 -4.959  1.00 49.29 ? 259  GLU A C     1 
ATOM   2051 O  O     . GLU A 1 259 ? 25.050  -27.044 -6.033  1.00 49.29 ? 259  GLU A O     1 
ATOM   2052 C  CB    . GLU A 1 259 ? 26.841  -29.472 -4.993  1.00 49.51 ? 259  GLU A CB    1 
ATOM   2053 C  CG    . GLU A 1 259 ? 28.000  -30.189 -4.312  1.00 51.26 ? 259  GLU A CG    1 
ATOM   2054 C  CD    . GLU A 1 259 ? 29.297  -29.367 -4.236  1.00 54.14 ? 259  GLU A CD    1 
ATOM   2055 O  OE1   . GLU A 1 259 ? 29.417  -28.332 -4.937  1.00 56.29 ? 259  GLU A OE1   1 
ATOM   2056 O  OE2   . GLU A 1 259 ? 30.215  -29.773 -3.477  1.00 55.39 ? 259  GLU A OE2   1 
ATOM   2057 N  N     . GLU A 1 260 ? 24.014  -27.948 -4.246  1.00 49.09 ? 260  GLU A N     1 
ATOM   2058 C  CA    . GLU A 1 260 ? 22.694  -27.483 -4.638  1.00 49.35 ? 260  GLU A CA    1 
ATOM   2059 C  C     . GLU A 1 260 ? 22.508  -25.984 -4.328  1.00 48.39 ? 260  GLU A C     1 
ATOM   2060 O  O     . GLU A 1 260 ? 21.846  -25.277 -5.079  1.00 47.51 ? 260  GLU A O     1 
ATOM   2061 C  CB    . GLU A 1 260 ? 21.600  -28.322 -3.966  1.00 49.29 ? 260  GLU A CB    1 
ATOM   2062 C  CG    . GLU A 1 260 ? 20.200  -28.003 -4.495  1.00 50.97 ? 260  GLU A CG    1 
ATOM   2063 C  CD    . GLU A 1 260 ? 19.119  -28.987 -4.053  1.00 51.54 ? 260  GLU A CD    1 
ATOM   2064 O  OE1   . GLU A 1 260 ? 19.355  -29.807 -3.131  1.00 55.32 ? 260  GLU A OE1   1 
ATOM   2065 O  OE2   . GLU A 1 260 ? 18.015  -28.923 -4.636  1.00 54.27 ? 260  GLU A OE2   1 
ATOM   2066 N  N     . ILE A 1 261 ? 23.114  -25.509 -3.242  1.00 48.14 ? 261  ILE A N     1 
ATOM   2067 C  CA    . ILE A 1 261 ? 22.987  -24.104 -2.831  1.00 48.01 ? 261  ILE A CA    1 
ATOM   2068 C  C     . ILE A 1 261 ? 23.969  -23.180 -3.569  1.00 48.25 ? 261  ILE A C     1 
ATOM   2069 O  O     . ILE A 1 261 ? 23.598  -22.093 -4.002  1.00 47.65 ? 261  ILE A O     1 
ATOM   2070 C  CB    . ILE A 1 261 ? 23.177  -23.936 -1.304  1.00 47.88 ? 261  ILE A CB    1 
ATOM   2071 C  CG1   . ILE A 1 261 ? 22.214  -24.841 -0.531  1.00 47.78 ? 261  ILE A CG1   1 
ATOM   2072 C  CG2   . ILE A 1 261 ? 22.918  -22.495 -0.906  1.00 46.71 ? 261  ILE A CG2   1 
ATOM   2073 C  CD1   . ILE A 1 261 ? 22.417  -24.820 0.960   1.00 47.71 ? 261  ILE A CD1   1 
ATOM   2074 N  N     . LYS A 1 262 ? 25.215  -23.630 -3.719  1.00 48.66 ? 262  LYS A N     1 
ATOM   2075 C  CA    . LYS A 1 262 ? 26.276  -22.826 -4.345  1.00 48.91 ? 262  LYS A CA    1 
ATOM   2076 C  C     . LYS A 1 262 ? 25.832  -21.959 -5.534  1.00 48.73 ? 262  LYS A C     1 
ATOM   2077 O  O     . LYS A 1 262 ? 26.050  -20.758 -5.509  1.00 48.94 ? 262  LYS A O     1 
ATOM   2078 C  CB    . LYS A 1 262 ? 27.465  -23.715 -4.752  1.00 49.26 ? 262  LYS A CB    1 
ATOM   2079 C  CG    . LYS A 1 262 ? 28.557  -23.809 -3.697  1.00 50.20 ? 262  LYS A CG    1 
ATOM   2080 C  CD    . LYS A 1 262 ? 29.352  -25.106 -3.796  1.00 51.71 ? 262  LYS A CD    1 
ATOM   2081 C  CE    . LYS A 1 262 ? 30.383  -25.080 -4.909  1.00 52.58 ? 262  LYS A CE    1 
ATOM   2082 N  NZ    . LYS A 1 262 ? 31.276  -26.285 -4.852  1.00 51.67 ? 262  LYS A NZ    1 
ATOM   2083 N  N     . PRO A 1 263 ? 25.231  -22.562 -6.582  1.00 48.60 ? 263  PRO A N     1 
ATOM   2084 C  CA    . PRO A 1 263 ? 24.750  -21.782 -7.752  1.00 48.53 ? 263  PRO A CA    1 
ATOM   2085 C  C     . PRO A 1 263 ? 23.956  -20.522 -7.419  1.00 48.29 ? 263  PRO A C     1 
ATOM   2086 O  O     . PRO A 1 263 ? 24.149  -19.465 -8.047  1.00 47.95 ? 263  PRO A O     1 
ATOM   2087 C  CB    . PRO A 1 263 ? 23.850  -22.773 -8.485  1.00 48.65 ? 263  PRO A CB    1 
ATOM   2088 C  CG    . PRO A 1 263 ? 24.483  -24.117 -8.187  1.00 48.69 ? 263  PRO A CG    1 
ATOM   2089 C  CD    . PRO A 1 263 ? 24.994  -24.010 -6.760  1.00 48.49 ? 263  PRO A CD    1 
ATOM   2090 N  N     . TYR A 1 264 ? 23.078  -20.634 -6.427  1.00 48.07 ? 264  TYR A N     1 
ATOM   2091 C  CA    . TYR A 1 264 ? 22.277  -19.492 -5.991  1.00 47.61 ? 264  TYR A CA    1 
ATOM   2092 C  C     . TYR A 1 264 ? 23.165  -18.453 -5.326  1.00 47.46 ? 264  TYR A C     1 
ATOM   2093 O  O     . TYR A 1 264 ? 23.063  -17.260 -5.605  1.00 47.37 ? 264  TYR A O     1 
ATOM   2094 C  CB    . TYR A 1 264 ? 21.186  -19.936 -5.025  1.00 47.50 ? 264  TYR A CB    1 
ATOM   2095 C  CG    . TYR A 1 264 ? 20.145  -20.850 -5.627  1.00 47.31 ? 264  TYR A CG    1 
ATOM   2096 C  CD1   . TYR A 1 264 ? 19.045  -20.337 -6.310  1.00 46.49 ? 264  TYR A CD1   1 
ATOM   2097 C  CD2   . TYR A 1 264 ? 20.251  -22.232 -5.494  1.00 47.77 ? 264  TYR A CD2   1 
ATOM   2098 C  CE1   . TYR A 1 264 ? 18.084  -21.174 -6.849  1.00 47.60 ? 264  TYR A CE1   1 
ATOM   2099 C  CE2   . TYR A 1 264 ? 19.300  -23.085 -6.037  1.00 47.42 ? 264  TYR A CE2   1 
ATOM   2100 C  CZ    . TYR A 1 264 ? 18.220  -22.552 -6.707  1.00 48.21 ? 264  TYR A CZ    1 
ATOM   2101 O  OH    . TYR A 1 264 ? 17.290  -23.408 -7.228  1.00 48.42 ? 264  TYR A OH    1 
ATOM   2102 N  N     . LEU A 1 265 ? 24.044  -18.912 -4.449  1.00 47.29 ? 265  LEU A N     1 
ATOM   2103 C  CA    . LEU A 1 265 ? 24.967  -18.023 -3.777  1.00 47.44 ? 265  LEU A CA    1 
ATOM   2104 C  C     . LEU A 1 265 ? 25.885  -17.304 -4.749  1.00 47.88 ? 265  LEU A C     1 
ATOM   2105 O  O     . LEU A 1 265 ? 26.126  -16.123 -4.602  1.00 47.64 ? 265  LEU A O     1 
ATOM   2106 C  CB    . LEU A 1 265 ? 25.803  -18.799 -2.767  1.00 47.05 ? 265  LEU A CB    1 
ATOM   2107 C  CG    . LEU A 1 265 ? 26.853  -17.983 -2.038  1.00 46.51 ? 265  LEU A CG    1 
ATOM   2108 C  CD1   . LEU A 1 265 ? 26.290  -16.661 -1.493  1.00 45.46 ? 265  LEU A CD1   1 
ATOM   2109 C  CD2   . LEU A 1 265 ? 27.437  -18.828 -0.938  1.00 47.29 ? 265  LEU A CD2   1 
ATOM   2110 N  N     . PHE A 1 266 ? 26.397  -18.012 -5.744  1.00 49.03 ? 266  PHE A N     1 
ATOM   2111 C  CA    . PHE A 1 266 ? 27.312  -17.397 -6.702  1.00 50.00 ? 266  PHE A CA    1 
ATOM   2112 C  C     . PHE A 1 266 ? 26.626  -16.393 -7.603  1.00 50.59 ? 266  PHE A C     1 
ATOM   2113 O  O     . PHE A 1 266 ? 27.257  -15.454 -8.074  1.00 50.94 ? 266  PHE A O     1 
ATOM   2114 C  CB    . PHE A 1 266 ? 28.025  -18.451 -7.538  1.00 50.35 ? 266  PHE A CB    1 
ATOM   2115 C  CG    . PHE A 1 266 ? 29.014  -19.278 -6.760  1.00 50.97 ? 266  PHE A CG    1 
ATOM   2116 C  CD1   . PHE A 1 266 ? 29.433  -18.904 -5.482  1.00 51.52 ? 266  PHE A CD1   1 
ATOM   2117 C  CD2   . PHE A 1 266 ? 29.566  -20.412 -7.324  1.00 51.36 ? 266  PHE A CD2   1 
ATOM   2118 C  CE1   . PHE A 1 266 ? 30.356  -19.674 -4.780  1.00 51.81 ? 266  PHE A CE1   1 
ATOM   2119 C  CE2   . PHE A 1 266 ? 30.498  -21.174 -6.623  1.00 51.61 ? 266  PHE A CE2   1 
ATOM   2120 C  CZ    . PHE A 1 266 ? 30.888  -20.801 -5.350  1.00 50.96 ? 266  PHE A CZ    1 
ATOM   2121 N  N     . ARG A 1 267 ? 25.336  -16.572 -7.835  1.00 51.23 ? 267  ARG A N     1 
ATOM   2122 C  CA    . ARG A 1 267 ? 24.586  -15.564 -8.555  1.00 51.89 ? 267  ARG A CA    1 
ATOM   2123 C  C     . ARG A 1 267 ? 24.487  -14.316 -7.698  1.00 52.14 ? 267  ARG A C     1 
ATOM   2124 O  O     . ARG A 1 267 ? 24.650  -13.200 -8.198  1.00 52.32 ? 267  ARG A O     1 
ATOM   2125 C  CB    . ARG A 1 267 ? 23.186  -16.052 -8.918  1.00 52.16 ? 267  ARG A CB    1 
ATOM   2126 C  CG    . ARG A 1 267 ? 22.606  -15.365 -10.144 1.00 53.79 ? 267  ARG A CG    1 
ATOM   2127 C  CD    . ARG A 1 267 ? 21.090  -15.195 -10.062 1.00 56.51 ? 267  ARG A CD    1 
ATOM   2128 N  NE    . ARG A 1 267 ? 20.405  -16.405 -9.614  1.00 58.04 ? 267  ARG A NE    1 
ATOM   2129 C  CZ    . ARG A 1 267 ? 19.096  -16.474 -9.384  1.00 59.27 ? 267  ARG A CZ    1 
ATOM   2130 N  NH1   . ARG A 1 267 ? 18.325  -15.404 -9.599  1.00 60.37 ? 267  ARG A NH1   1 
ATOM   2131 N  NH2   . ARG A 1 267 ? 18.548  -17.614 -8.956  1.00 58.50 ? 267  ARG A NH2   1 
ATOM   2132 N  N     . ALA A 1 268 ? 24.219  -14.509 -6.410  1.00 52.40 ? 268  ALA A N     1 
ATOM   2133 C  CA    . ALA A 1 268 ? 24.045  -13.388 -5.492  1.00 52.81 ? 268  ALA A CA    1 
ATOM   2134 C  C     . ALA A 1 268 ? 25.324  -12.571 -5.404  1.00 53.05 ? 268  ALA A C     1 
ATOM   2135 O  O     . ALA A 1 268 ? 25.281  -11.348 -5.335  1.00 52.95 ? 268  ALA A O     1 
ATOM   2136 C  CB    . ALA A 1 268 ? 23.615  -13.883 -4.110  1.00 52.82 ? 268  ALA A CB    1 
ATOM   2137 N  N     . ILE A 1 269 ? 26.460  -13.256 -5.445  1.00 53.73 ? 269  ILE A N     1 
ATOM   2138 C  CA    . ILE A 1 269 ? 27.751  -12.595 -5.447  1.00 54.39 ? 269  ILE A CA    1 
ATOM   2139 C  C     . ILE A 1 269 ? 27.988  -11.787 -6.723  1.00 55.16 ? 269  ILE A C     1 
ATOM   2140 O  O     . ILE A 1 269 ? 28.355  -10.628 -6.630  1.00 55.18 ? 269  ILE A O     1 
ATOM   2141 C  CB    . ILE A 1 269 ? 28.902  -13.601 -5.253  1.00 54.46 ? 269  ILE A CB    1 
ATOM   2142 C  CG1   . ILE A 1 269 ? 28.868  -14.176 -3.842  1.00 53.92 ? 269  ILE A CG1   1 
ATOM   2143 C  CG2   . ILE A 1 269 ? 30.256  -12.928 -5.475  1.00 54.79 ? 269  ILE A CG2   1 
ATOM   2144 C  CD1   . ILE A 1 269 ? 29.767  -15.346 -3.656  1.00 52.96 ? 269  ILE A CD1   1 
ATOM   2145 N  N     . GLU A 1 270 ? 27.793  -12.371 -7.908  1.00 56.19 ? 270  GLU A N     1 
ATOM   2146 C  CA    . GLU A 1 270 ? 28.042  -11.610 -9.136  1.00 57.38 ? 270  GLU A CA    1 
ATOM   2147 C  C     . GLU A 1 270 ? 27.219  -10.338 -9.174  1.00 57.98 ? 270  GLU A C     1 
ATOM   2148 O  O     . GLU A 1 270 ? 27.766  -9.251  -9.376  1.00 58.45 ? 270  GLU A O     1 
ATOM   2149 C  CB    . GLU A 1 270 ? 27.750  -12.414 -10.397 1.00 57.88 ? 270  GLU A CB    1 
ATOM   2150 C  CG    . GLU A 1 270 ? 28.793  -13.463 -10.750 1.00 59.55 ? 270  GLU A CG    1 
ATOM   2151 C  CD    . GLU A 1 270 ? 30.171  -12.875 -11.043 1.00 61.51 ? 270  GLU A CD    1 
ATOM   2152 O  OE1   . GLU A 1 270 ? 30.433  -12.466 -12.195 1.00 63.38 ? 270  GLU A OE1   1 
ATOM   2153 O  OE2   . GLU A 1 270 ? 31.004  -12.843 -10.117 1.00 62.71 ? 270  GLU A OE2   1 
ATOM   2154 N  N     . GLU A 1 271 ? 25.912  -10.472 -8.969  1.00 58.58 ? 271  GLU A N     1 
ATOM   2155 C  CA    . GLU A 1 271 ? 24.999  -9.327  -9.034  1.00 59.33 ? 271  GLU A CA    1 
ATOM   2156 C  C     . GLU A 1 271 ? 25.284  -8.311  -7.939  1.00 59.21 ? 271  GLU A C     1 
ATOM   2157 O  O     . GLU A 1 271 ? 25.051  -7.118  -8.128  1.00 59.34 ? 271  GLU A O     1 
ATOM   2158 C  CB    . GLU A 1 271 ? 23.528  -9.775  -8.978  1.00 59.13 ? 271  GLU A CB    1 
ATOM   2159 C  CG    . GLU A 1 271 ? 23.095  -10.613 -10.189 1.00 60.63 ? 271  GLU A CG    1 
ATOM   2160 C  CD    . GLU A 1 271 ? 21.669  -11.166 -10.084 1.00 61.43 ? 271  GLU A CD    1 
ATOM   2161 O  OE1   . GLU A 1 271 ? 20.827  -10.479 -9.455  1.00 66.11 ? 271  GLU A OE1   1 
ATOM   2162 O  OE2   . GLU A 1 271 ? 21.384  -12.270 -10.640 1.00 62.08 ? 271  GLU A OE2   1 
ATOM   2163 N  N     . SER A 1 272 ? 25.782  -8.769  -6.794  1.00 59.31 ? 272  SER A N     1 
ATOM   2164 C  CA    . SER A 1 272 ? 26.204  -7.842  -5.754  1.00 59.45 ? 272  SER A CA    1 
ATOM   2165 C  C     . SER A 1 272 ? 27.399  -7.017  -6.202  1.00 60.26 ? 272  SER A C     1 
ATOM   2166 O  O     . SER A 1 272 ? 27.411  -5.788  -6.094  1.00 59.47 ? 272  SER A O     1 
ATOM   2167 C  CB    . SER A 1 272 ? 26.562  -8.587  -4.495  1.00 59.03 ? 272  SER A CB    1 
ATOM   2168 O  OG    . SER A 1 272 ? 25.404  -9.024  -3.860  1.00 58.39 ? 272  SER A OG    1 
ATOM   2169 N  N     . TYR A 1 273 ? 28.414  -7.706  -6.698  1.00 61.75 ? 273  TYR A N     1 
ATOM   2170 C  CA    . TYR A 1 273 ? 29.608  -7.027  -7.176  1.00 63.27 ? 273  TYR A CA    1 
ATOM   2171 C  C     . TYR A 1 273 ? 29.320  -6.046  -8.312  1.00 63.91 ? 273  TYR A C     1 
ATOM   2172 O  O     . TYR A 1 273 ? 29.955  -5.012  -8.409  1.00 63.80 ? 273  TYR A O     1 
ATOM   2173 C  CB    . TYR A 1 273 ? 30.687  -8.027  -7.574  1.00 63.78 ? 273  TYR A CB    1 
ATOM   2174 C  CG    . TYR A 1 273 ? 31.795  -8.078  -6.555  1.00 64.51 ? 273  TYR A CG    1 
ATOM   2175 C  CD1   . TYR A 1 273 ? 32.999  -7.437  -6.782  1.00 65.10 ? 273  TYR A CD1   1 
ATOM   2176 C  CD2   . TYR A 1 273 ? 31.626  -8.738  -5.352  1.00 65.35 ? 273  TYR A CD2   1 
ATOM   2177 C  CE1   . TYR A 1 273 ? 34.010  -7.468  -5.846  1.00 65.73 ? 273  TYR A CE1   1 
ATOM   2178 C  CE2   . TYR A 1 273 ? 32.635  -8.775  -4.410  1.00 65.19 ? 273  TYR A CE2   1 
ATOM   2179 C  CZ    . TYR A 1 273 ? 33.818  -8.136  -4.663  1.00 65.18 ? 273  TYR A CZ    1 
ATOM   2180 O  OH    . TYR A 1 273 ? 34.826  -8.169  -3.732  1.00 66.30 ? 273  TYR A OH    1 
ATOM   2181 N  N     . TYR A 1 274 ? 28.354  -6.365  -9.158  1.00 64.95 ? 274  TYR A N     1 
ATOM   2182 C  CA    . TYR A 1 274 ? 27.934  -5.426  -10.175 1.00 65.75 ? 274  TYR A CA    1 
ATOM   2183 C  C     . TYR A 1 274 ? 27.352  -4.167  -9.510  1.00 65.48 ? 274  TYR A C     1 
ATOM   2184 O  O     . TYR A 1 274 ? 27.766  -3.056  -9.820  1.00 65.37 ? 274  TYR A O     1 
ATOM   2185 C  CB    . TYR A 1 274 ? 26.941  -6.084  -11.141 1.00 66.89 ? 274  TYR A CB    1 
ATOM   2186 C  CG    . TYR A 1 274 ? 26.560  -5.177  -12.277 1.00 68.02 ? 274  TYR A CG    1 
ATOM   2187 C  CD1   . TYR A 1 274 ? 27.374  -5.057  -13.402 1.00 69.36 ? 274  TYR A CD1   1 
ATOM   2188 C  CD2   . TYR A 1 274 ? 25.401  -4.407  -12.209 1.00 69.46 ? 274  TYR A CD2   1 
ATOM   2189 C  CE1   . TYR A 1 274 ? 27.033  -4.197  -14.445 1.00 70.37 ? 274  TYR A CE1   1 
ATOM   2190 C  CE2   . TYR A 1 274 ? 25.044  -3.548  -13.233 1.00 70.37 ? 274  TYR A CE2   1 
ATOM   2191 C  CZ    . TYR A 1 274 ? 25.857  -3.440  -14.353 1.00 70.57 ? 274  TYR A CZ    1 
ATOM   2192 O  OH    . TYR A 1 274 ? 25.485  -2.572  -15.370 1.00 70.20 ? 274  TYR A OH    1 
ATOM   2193 N  N     . LYS A 1 275 ? 26.432  -4.350  -8.566  1.00 65.41 ? 275  LYS A N     1 
ATOM   2194 C  CA    . LYS A 1 275 ? 25.862  -3.232  -7.797  1.00 65.52 ? 275  LYS A CA    1 
ATOM   2195 C  C     . LYS A 1 275 ? 26.888  -2.434  -6.963  1.00 65.27 ? 275  LYS A C     1 
ATOM   2196 O  O     . LYS A 1 275 ? 26.653  -1.269  -6.671  1.00 65.35 ? 275  LYS A O     1 
ATOM   2197 C  CB    . LYS A 1 275 ? 24.761  -3.724  -6.857  1.00 65.65 ? 275  LYS A CB    1 
ATOM   2198 C  CG    . LYS A 1 275 ? 23.505  -4.304  -7.519  1.00 66.41 ? 275  LYS A CG    1 
ATOM   2199 C  CD    . LYS A 1 275 ? 22.587  -4.953  -6.460  1.00 66.71 ? 275  LYS A CD    1 
ATOM   2200 C  CE    . LYS A 1 275 ? 21.273  -5.503  -7.050  1.00 67.87 ? 275  LYS A CE    1 
ATOM   2201 N  NZ    . LYS A 1 275 ? 20.465  -6.209  -5.992  1.00 67.61 ? 275  LYS A NZ    1 
ATOM   2202 N  N     . LEU A 1 276 ? 28.002  -3.049  -6.564  1.00 65.00 ? 276  LEU A N     1 
ATOM   2203 C  CA    . LEU A 1 276 ? 29.037  -2.330  -5.811  1.00 64.85 ? 276  LEU A CA    1 
ATOM   2204 C  C     . LEU A 1 276 ? 29.601  -1.195  -6.641  1.00 64.91 ? 276  LEU A C     1 
ATOM   2205 O  O     . LEU A 1 276 ? 29.609  -0.031  -6.211  1.00 64.64 ? 276  LEU A O     1 
ATOM   2206 C  CB    . LEU A 1 276 ? 30.187  -3.256  -5.400  1.00 64.71 ? 276  LEU A CB    1 
ATOM   2207 C  CG    . LEU A 1 276 ? 30.003  -4.000  -4.080  1.00 64.35 ? 276  LEU A CG    1 
ATOM   2208 C  CD1   . LEU A 1 276 ? 31.055  -5.081  -3.936  1.00 64.25 ? 276  LEU A CD1   1 
ATOM   2209 C  CD2   . LEU A 1 276 ? 30.058  -3.029  -2.926  1.00 63.37 ? 276  LEU A CD2   1 
ATOM   2210 N  N     . ASP A 1 277 ? 30.100  -1.562  -7.823  1.00 64.96 ? 277  ASP A N     1 
ATOM   2211 C  CA    . ASP A 1 277 ? 30.467  -0.604  -8.862  1.00 64.81 ? 277  ASP A CA    1 
ATOM   2212 C  C     . ASP A 1 277 ? 31.463  0.443   -8.342  1.00 64.14 ? 277  ASP A C     1 
ATOM   2213 O  O     . ASP A 1 277 ? 31.072  1.541   -7.939  1.00 64.52 ? 277  ASP A O     1 
ATOM   2214 C  CB    . ASP A 1 277 ? 29.162  0.003   -9.440  1.00 65.02 ? 277  ASP A CB    1 
ATOM   2215 C  CG    . ASP A 1 277 ? 29.274  1.477   -9.772  1.00 65.70 ? 277  ASP A CG    1 
ATOM   2216 O  OD1   . ASP A 1 277 ? 28.554  2.276   -9.131  1.00 64.83 ? 277  ASP A OD1   1 
ATOM   2217 O  OD2   . ASP A 1 277 ? 30.084  1.833   -10.664 1.00 69.13 ? 277  ASP A OD2   1 
ATOM   2218 N  N     . LYS A 1 278 ? 32.747  0.086   -8.337  1.00 63.27 ? 278  LYS A N     1 
ATOM   2219 C  CA    . LYS A 1 278 ? 33.842  0.975   -7.867  1.00 62.76 ? 278  LYS A CA    1 
ATOM   2220 C  C     . LYS A 1 278 ? 34.135  0.840   -6.377  1.00 61.47 ? 278  LYS A C     1 
ATOM   2221 O  O     . LYS A 1 278 ? 35.292  0.909   -5.972  1.00 61.91 ? 278  LYS A O     1 
ATOM   2222 C  CB    . LYS A 1 278 ? 33.595  2.471   -8.167  1.00 63.23 ? 278  LYS A CB    1 
ATOM   2223 C  CG    . LYS A 1 278 ? 33.454  2.838   -9.647  1.00 64.86 ? 278  LYS A CG    1 
ATOM   2224 C  CD    . LYS A 1 278 ? 34.734  2.525   -10.443 1.00 65.55 ? 278  LYS A CD    1 
ATOM   2225 C  CE    . LYS A 1 278 ? 34.738  3.198   -11.830 1.00 65.77 ? 278  LYS A CE    1 
ATOM   2226 N  NZ    . LYS A 1 278 ? 36.126  3.270   -12.432 1.00 66.24 ? 278  LYS A NZ    1 
ATOM   2227 N  N     . ARG A 1 279 ? 33.100  0.689   -5.562  1.00 59.62 ? 279  ARG A N     1 
ATOM   2228 C  CA    . ARG A 1 279 ? 33.277  0.525   -4.128  1.00 58.43 ? 279  ARG A CA    1 
ATOM   2229 C  C     . ARG A 1 279 ? 34.025  -0.757  -3.780  1.00 56.97 ? 279  ARG A C     1 
ATOM   2230 O  O     . ARG A 1 279 ? 33.782  -1.792  -4.408  1.00 56.73 ? 279  ARG A O     1 
ATOM   2231 C  CB    . ARG A 1 279 ? 31.919  0.491   -3.444  1.00 58.74 ? 279  ARG A CB    1 
ATOM   2232 C  CG    . ARG A 1 279 ? 31.262  1.840   -3.319  1.00 59.79 ? 279  ARG A CG    1 
ATOM   2233 C  CD    . ARG A 1 279 ? 29.841  1.678   -2.824  1.00 62.01 ? 279  ARG A CD    1 
ATOM   2234 N  NE    . ARG A 1 279 ? 28.938  1.535   -3.955  1.00 63.24 ? 279  ARG A NE    1 
ATOM   2235 C  CZ    . ARG A 1 279 ? 27.878  2.302   -4.182  1.00 63.70 ? 279  ARG A CZ    1 
ATOM   2236 N  NH1   . ARG A 1 279 ? 27.507  3.254   -3.329  1.00 64.22 ? 279  ARG A NH1   1 
ATOM   2237 N  NH2   . ARG A 1 279 ? 27.166  2.084   -5.275  1.00 64.25 ? 279  ARG A NH2   1 
ATOM   2238 N  N     . ILE A 1 280 ? 34.923  -0.675  -2.782  1.00 55.14 ? 280  ILE A N     1 
ATOM   2239 C  CA    . ILE A 1 280 ? 35.648  -1.839  -2.252  1.00 53.38 ? 280  ILE A CA    1 
ATOM   2240 C  C     . ILE A 1 280 ? 35.202  -2.154  -0.813  1.00 52.02 ? 280  ILE A C     1 
ATOM   2241 O  O     . ILE A 1 280 ? 35.421  -1.362  0.101   1.00 51.77 ? 280  ILE A O     1 
ATOM   2242 C  CB    . ILE A 1 280 ? 37.174  -1.641  -2.221  1.00 53.36 ? 280  ILE A CB    1 
ATOM   2243 C  CG1   . ILE A 1 280 ? 37.676  -0.756  -3.369  1.00 53.79 ? 280  ILE A CG1   1 
ATOM   2244 C  CG2   . ILE A 1 280 ? 37.864  -3.001  -2.242  1.00 52.76 ? 280  ILE A CG2   1 
ATOM   2245 C  CD1   . ILE A 1 280 ? 37.590  -1.386  -4.734  1.00 54.40 ? 280  ILE A CD1   1 
ATOM   2246 N  N     . PRO A 1 281 ? 34.592  -3.325  -0.596  1.00 50.55 ? 281  PRO A N     1 
ATOM   2247 C  CA    . PRO A 1 281 ? 34.151  -3.641  0.761   1.00 49.57 ? 281  PRO A CA    1 
ATOM   2248 C  C     . PRO A 1 281 ? 35.232  -4.333  1.587   1.00 48.48 ? 281  PRO A C     1 
ATOM   2249 O  O     . PRO A 1 281 ? 36.086  -5.030  1.024   1.00 47.84 ? 281  PRO A O     1 
ATOM   2250 C  CB    . PRO A 1 281 ? 32.985  -4.593  0.515   1.00 49.57 ? 281  PRO A CB    1 
ATOM   2251 C  CG    . PRO A 1 281 ? 33.391  -5.343  -0.717  1.00 50.10 ? 281  PRO A CG    1 
ATOM   2252 C  CD    . PRO A 1 281 ? 34.253  -4.405  -1.542  1.00 50.42 ? 281  PRO A CD    1 
ATOM   2253 N  N     . LYS A 1 282 ? 35.186  -4.138  2.905   1.00 47.28 ? 282  LYS A N     1 
ATOM   2254 C  CA    . LYS A 1 282 ? 36.068  -4.859  3.822   1.00 47.06 ? 282  LYS A CA    1 
ATOM   2255 C  C     . LYS A 1 282 ? 35.326  -5.934  4.635   1.00 46.01 ? 282  LYS A C     1 
ATOM   2256 O  O     . LYS A 1 282 ? 35.956  -6.727  5.346   1.00 45.31 ? 282  LYS A O     1 
ATOM   2257 C  CB    . LYS A 1 282 ? 36.806  -3.893  4.760   1.00 46.84 ? 282  LYS A CB    1 
ATOM   2258 C  CG    . LYS A 1 282 ? 37.648  -2.866  4.020   1.00 47.81 ? 282  LYS A CG    1 
ATOM   2259 C  CD    . LYS A 1 282 ? 38.500  -1.995  4.949   1.00 48.17 ? 282  LYS A CD    1 
ATOM   2260 C  CE    . LYS A 1 282 ? 37.656  -0.998  5.735   1.00 49.63 ? 282  LYS A CE    1 
ATOM   2261 N  NZ    . LYS A 1 282 ? 38.530  -0.070  6.518   1.00 51.51 ? 282  LYS A NZ    1 
ATOM   2262 N  N     . ALA A 1 283 ? 34.002  -5.965  4.528   1.00 45.07 ? 283  ALA A N     1 
ATOM   2263 C  CA    . ALA A 1 283 ? 33.209  -6.941  5.263   1.00 44.58 ? 283  ALA A CA    1 
ATOM   2264 C  C     . ALA A 1 283 ? 32.241  -7.641  4.330   1.00 44.15 ? 283  ALA A C     1 
ATOM   2265 O  O     . ALA A 1 283 ? 31.626  -7.002  3.478   1.00 43.47 ? 283  ALA A O     1 
ATOM   2266 C  CB    . ALA A 1 283 ? 32.464  -6.266  6.391   1.00 44.39 ? 283  ALA A CB    1 
ATOM   2267 N  N     . ILE A 1 284 ? 32.136  -8.960  4.494   1.00 43.92 ? 284  ILE A N     1 
ATOM   2268 C  CA    . ILE A 1 284 ? 31.181  -9.792  3.759   1.00 44.02 ? 284  ILE A CA    1 
ATOM   2269 C  C     . ILE A 1 284 ? 30.384  -10.602 4.768   1.00 44.33 ? 284  ILE A C     1 
ATOM   2270 O  O     . ILE A 1 284 ? 30.919  -11.026 5.768   1.00 44.96 ? 284  ILE A O     1 
ATOM   2271 C  CB    . ILE A 1 284 ? 31.899  -10.761 2.806   1.00 43.77 ? 284  ILE A CB    1 
ATOM   2272 C  CG1   . ILE A 1 284 ? 30.899  -11.528 1.941   1.00 44.19 ? 284  ILE A CG1   1 
ATOM   2273 C  CG2   . ILE A 1 284 ? 32.767  -11.739 3.581   1.00 43.48 ? 284  ILE A CG2   1 
ATOM   2274 C  CD1   . ILE A 1 284 ? 31.555  -12.363 0.836   1.00 44.57 ? 284  ILE A CD1   1 
ATOM   2275 N  N     . HIS A 1 285 ? 29.101  -10.797 4.516   1.00 44.99 ? 285  HIS A N     1 
ATOM   2276 C  CA    . HIS A 1 285 ? 28.259  -11.644 5.358   1.00 45.46 ? 285  HIS A CA    1 
ATOM   2277 C  C     . HIS A 1 285 ? 27.401  -12.510 4.466   1.00 45.24 ? 285  HIS A C     1 
ATOM   2278 O  O     . HIS A 1 285 ? 26.876  -12.027 3.474   1.00 45.71 ? 285  HIS A O     1 
ATOM   2279 C  CB    . HIS A 1 285 ? 27.352  -10.783 6.229   1.00 45.88 ? 285  HIS A CB    1 
ATOM   2280 C  CG    . HIS A 1 285 ? 28.099  -9.938  7.204   1.00 47.64 ? 285  HIS A CG    1 
ATOM   2281 N  ND1   . HIS A 1 285 ? 28.282  -10.314 8.518   1.00 49.35 ? 285  HIS A ND1   1 
ATOM   2282 C  CD2   . HIS A 1 285 ? 28.751  -8.759  7.051   1.00 48.77 ? 285  HIS A CD2   1 
ATOM   2283 C  CE1   . HIS A 1 285 ? 29.003  -9.397  9.136   1.00 49.19 ? 285  HIS A CE1   1 
ATOM   2284 N  NE2   . HIS A 1 285 ? 29.302  -8.445  8.269   1.00 49.22 ? 285  HIS A NE2   1 
ATOM   2285 N  N     . VAL A 1 286 ? 27.262  -13.780 4.803   1.00 44.79 ? 286  VAL A N     1 
ATOM   2286 C  CA    . VAL A 1 286 ? 26.329  -14.636 4.098   1.00 44.67 ? 286  VAL A CA    1 
ATOM   2287 C  C     . VAL A 1 286 ? 25.075  -14.724 4.946   1.00 44.52 ? 286  VAL A C     1 
ATOM   2288 O  O     . VAL A 1 286 ? 25.148  -14.984 6.152   1.00 44.28 ? 286  VAL A O     1 
ATOM   2289 C  CB    . VAL A 1 286 ? 26.890  -16.043 3.867   1.00 44.68 ? 286  VAL A CB    1 
ATOM   2290 C  CG1   . VAL A 1 286 ? 25.879  -16.885 3.110   1.00 45.01 ? 286  VAL A CG1   1 
ATOM   2291 C  CG2   . VAL A 1 286 ? 28.203  -15.976 3.094   1.00 44.52 ? 286  VAL A CG2   1 
ATOM   2292 N  N     . VAL A 1 287 ? 23.933  -14.493 4.310   1.00 44.47 ? 287  VAL A N     1 
ATOM   2293 C  CA    . VAL A 1 287 ? 22.663  -14.451 4.998   1.00 44.58 ? 287  VAL A CA    1 
ATOM   2294 C  C     . VAL A 1 287 ? 21.809  -15.581 4.478   1.00 45.33 ? 287  VAL A C     1 
ATOM   2295 O  O     . VAL A 1 287 ? 21.678  -15.736 3.276   1.00 46.01 ? 287  VAL A O     1 
ATOM   2296 C  CB    . VAL A 1 287 ? 21.944  -13.121 4.748   1.00 44.17 ? 287  VAL A CB    1 
ATOM   2297 C  CG1   . VAL A 1 287 ? 20.609  -13.090 5.485   1.00 43.73 ? 287  VAL A CG1   1 
ATOM   2298 C  CG2   . VAL A 1 287 ? 22.804  -11.984 5.210   1.00 43.26 ? 287  VAL A CG2   1 
ATOM   2299 N  N     . ALA A 1 288 ? 21.237  -16.362 5.387   1.00 46.03 ? 288  ALA A N     1 
ATOM   2300 C  CA    . ALA A 1 288 ? 20.399  -17.504 5.042   1.00 46.50 ? 288  ALA A CA    1 
ATOM   2301 C  C     . ALA A 1 288 ? 19.047  -17.385 5.758   1.00 47.14 ? 288  ALA A C     1 
ATOM   2302 O  O     . ALA A 1 288 ? 18.987  -17.034 6.947   1.00 46.63 ? 288  ALA A O     1 
ATOM   2303 C  CB    . ALA A 1 288 ? 21.092  -18.795 5.421   1.00 46.03 ? 288  ALA A CB    1 
ATOM   2304 N  N     . VAL A 1 289 ? 17.969  -17.645 5.018   1.00 47.76 ? 289  VAL A N     1 
ATOM   2305 C  CA    . VAL A 1 289 ? 16.639  -17.692 5.590   1.00 48.61 ? 289  VAL A CA    1 
ATOM   2306 C  C     . VAL A 1 289 ? 16.300  -19.157 5.681   1.00 49.67 ? 289  VAL A C     1 
ATOM   2307 O  O     . VAL A 1 289 ? 16.267  -19.850 4.672   1.00 50.28 ? 289  VAL A O     1 
ATOM   2308 C  CB    . VAL A 1 289 ? 15.598  -16.949 4.726   1.00 48.52 ? 289  VAL A CB    1 
ATOM   2309 C  CG1   . VAL A 1 289 ? 14.210  -17.234 5.222   1.00 48.12 ? 289  VAL A CG1   1 
ATOM   2310 C  CG2   . VAL A 1 289 ? 15.861  -15.467 4.756   1.00 47.34 ? 289  VAL A CG2   1 
ATOM   2311 N  N     . THR A 1 290 ? 16.081  -19.641 6.894   1.00 50.82 ? 290  THR A N     1 
ATOM   2312 C  CA    . THR A 1 290 ? 15.887  -21.069 7.121   1.00 51.58 ? 290  THR A CA    1 
ATOM   2313 C  C     . THR A 1 290 ? 14.464  -21.496 6.757   1.00 52.55 ? 290  THR A C     1 
ATOM   2314 O  O     . THR A 1 290 ? 13.622  -20.670 6.391   1.00 52.47 ? 290  THR A O     1 
ATOM   2315 C  CB    . THR A 1 290 ? 16.156  -21.402 8.578   1.00 51.50 ? 290  THR A CB    1 
ATOM   2316 O  OG1   . THR A 1 290 ? 15.395  -20.508 9.397   1.00 52.19 ? 290  THR A OG1   1 
ATOM   2317 C  CG2   . THR A 1 290 ? 17.614  -21.223 8.888   1.00 51.08 ? 290  THR A CG2   1 
ATOM   2318 N  N     . GLU A 1 291 ? 14.203  -22.794 6.862   1.00 53.70 ? 291  GLU A N     1 
ATOM   2319 C  CA    . GLU A 1 291 ? 12.918  -23.362 6.454   1.00 54.93 ? 291  GLU A CA    1 
ATOM   2320 C  C     . GLU A 1 291 ? 11.707  -22.759 7.170   1.00 54.84 ? 291  GLU A C     1 
ATOM   2321 O  O     . GLU A 1 291 ? 10.633  -22.666 6.575   1.00 54.33 ? 291  GLU A O     1 
ATOM   2322 C  CB    . GLU A 1 291 ? 12.917  -24.888 6.638   1.00 54.98 ? 291  GLU A CB    1 
ATOM   2323 C  CG    . GLU A 1 291 ? 11.574  -25.549 6.273   1.00 55.87 ? 291  GLU A CG    1 
ATOM   2324 C  CD    . GLU A 1 291 ? 11.658  -27.065 6.187   1.00 56.82 ? 291  GLU A CD    1 
ATOM   2325 O  OE1   . GLU A 1 291 ? 12.748  -27.627 6.478   1.00 58.31 ? 291  GLU A OE1   1 
ATOM   2326 O  OE2   . GLU A 1 291 ? 10.624  -27.691 5.838   1.00 59.30 ? 291  GLU A OE2   1 
ATOM   2327 N  N     . ASP A 1 292 ? 11.883  -22.380 8.439   1.00 55.38 ? 292  ASP A N     1 
ATOM   2328 C  CA    . ASP A 1 292 ? 10.818  -21.727 9.223   1.00 55.88 ? 292  ASP A CA    1 
ATOM   2329 C  C     . ASP A 1 292 ? 10.918  -20.192 9.202   1.00 56.08 ? 292  ASP A C     1 
ATOM   2330 O  O     . ASP A 1 292 ? 10.382  -19.518 10.083  1.00 56.25 ? 292  ASP A O     1 
ATOM   2331 C  CB    . ASP A 1 292 ? 10.790  -22.256 10.667  1.00 56.13 ? 292  ASP A CB    1 
ATOM   2332 C  CG    . ASP A 1 292 ? 12.117  -22.091 11.401  1.00 56.90 ? 292  ASP A CG    1 
ATOM   2333 O  OD1   . ASP A 1 292 ? 12.228  -22.605 12.533  1.00 58.90 ? 292  ASP A OD1   1 
ATOM   2334 O  OD2   . ASP A 1 292 ? 13.046  -21.462 10.862  1.00 58.51 ? 292  ASP A OD2   1 
ATOM   2335 N  N     . LEU A 1 293 ? 11.609  -19.658 8.192   1.00 56.05 ? 293  LEU A N     1 
ATOM   2336 C  CA    . LEU A 1 293 ? 11.696  -18.222 7.939   1.00 56.00 ? 293  LEU A CA    1 
ATOM   2337 C  C     . LEU A 1 293 ? 12.504  -17.429 8.965   1.00 55.39 ? 293  LEU A C     1 
ATOM   2338 O  O     . LEU A 1 293 ? 12.425  -16.212 9.006   1.00 54.69 ? 293  LEU A O     1 
ATOM   2339 C  CB    . LEU A 1 293 ? 10.297  -17.620 7.743   1.00 56.54 ? 293  LEU A CB    1 
ATOM   2340 C  CG    . LEU A 1 293 ? 9.723   -17.778 6.328   1.00 57.93 ? 293  LEU A CG    1 
ATOM   2341 C  CD1   . LEU A 1 293 ? 8.321   -17.249 6.312   1.00 58.19 ? 293  LEU A CD1   1 
ATOM   2342 C  CD2   . LEU A 1 293 ? 10.581  -17.034 5.278   1.00 59.48 ? 293  LEU A CD2   1 
ATOM   2343 N  N     . ASP A 1 294 ? 13.320  -18.107 9.763   1.00 55.36 ? 294  ASP A N     1 
ATOM   2344 C  CA    . ASP A 1 294 ? 14.276  -17.397 10.612  1.00 55.36 ? 294  ASP A CA    1 
ATOM   2345 C  C     . ASP A 1 294 ? 15.513  -17.015 9.782   1.00 54.55 ? 294  ASP A C     1 
ATOM   2346 O  O     . ASP A 1 294 ? 15.947  -17.779 8.914   1.00 54.18 ? 294  ASP A O     1 
ATOM   2347 C  CB    . ASP A 1 294 ? 14.662  -18.243 11.834  1.00 55.82 ? 294  ASP A CB    1 
ATOM   2348 C  CG    . ASP A 1 294 ? 15.208  -17.399 12.993  1.00 57.96 ? 294  ASP A CG    1 
ATOM   2349 O  OD1   . ASP A 1 294 ? 15.323  -16.150 12.828  1.00 61.18 ? 294  ASP A OD1   1 
ATOM   2350 O  OD2   . ASP A 1 294 ? 15.525  -17.981 14.070  1.00 58.37 ? 294  ASP A OD2   1 
ATOM   2351 N  N     . ILE A 1 295 ? 16.043  -15.817 10.033  1.00 53.78 ? 295  ILE A N     1 
ATOM   2352 C  CA    . ILE A 1 295 ? 17.224  -15.306 9.339   1.00 53.12 ? 295  ILE A CA    1 
ATOM   2353 C  C     . ILE A 1 295 ? 18.484  -15.556 10.174  1.00 52.97 ? 295  ILE A C     1 
ATOM   2354 O  O     . ILE A 1 295 ? 18.600  -15.066 11.297  1.00 53.46 ? 295  ILE A O     1 
ATOM   2355 C  CB    . ILE A 1 295 ? 17.113  -13.798 9.104   1.00 53.09 ? 295  ILE A CB    1 
ATOM   2356 C  CG1   . ILE A 1 295 ? 15.910  -13.477 8.215   1.00 53.33 ? 295  ILE A CG1   1 
ATOM   2357 C  CG2   . ILE A 1 295 ? 18.398  -13.244 8.486   1.00 52.22 ? 295  ILE A CG2   1 
ATOM   2358 C  CD1   . ILE A 1 295 ? 15.888  -12.026 7.731   1.00 52.83 ? 295  ILE A CD1   1 
ATOM   2359 N  N     . VAL A 1 296 ? 19.425  -16.311 9.623   1.00 52.34 ? 296  VAL A N     1 
ATOM   2360 C  CA    . VAL A 1 296 ? 20.686  -16.639 10.299  1.00 51.77 ? 296  VAL A CA    1 
ATOM   2361 C  C     . VAL A 1 296 ? 21.813  -16.066 9.440   1.00 51.23 ? 296  VAL A C     1 
ATOM   2362 O  O     . VAL A 1 296 ? 21.631  -15.865 8.250   1.00 52.08 ? 296  VAL A O     1 
ATOM   2363 C  CB    . VAL A 1 296 ? 20.832  -18.171 10.445  1.00 51.67 ? 296  VAL A CB    1 
ATOM   2364 C  CG1   . VAL A 1 296 ? 21.117  -18.811 9.108   1.00 51.30 ? 296  VAL A CG1   1 
ATOM   2365 C  CG2   . VAL A 1 296 ? 21.922  -18.515 11.430  1.00 52.34 ? 296  VAL A CG2   1 
ATOM   2366 N  N     . SER A 1 297 ? 22.970  -15.766 10.002  1.00 50.47 ? 297  SER A N     1 
ATOM   2367 C  CA    . SER A 1 297 ? 24.007  -15.141 9.177   1.00 49.91 ? 297  SER A CA    1 
ATOM   2368 C  C     . SER A 1 297 ? 25.409  -15.300 9.715   1.00 49.23 ? 297  SER A C     1 
ATOM   2369 O  O     . SER A 1 297 ? 25.626  -15.238 10.918  1.00 48.73 ? 297  SER A O     1 
ATOM   2370 C  CB    . SER A 1 297 ? 23.727  -13.647 9.010   1.00 50.07 ? 297  SER A CB    1 
ATOM   2371 O  OG    . SER A 1 297 ? 24.277  -12.913 10.089  1.00 50.33 ? 297  SER A OG    1 
ATOM   2372 N  N     . ARG A 1 298 ? 26.355  -15.460 8.795   1.00 48.74 ? 298  ARG A N     1 
ATOM   2373 C  CA    . ARG A 1 298 ? 27.761  -15.572 9.141   1.00 48.75 ? 298  ARG A CA    1 
ATOM   2374 C  C     . ARG A 1 298 ? 28.560  -14.635 8.273   1.00 48.53 ? 298  ARG A C     1 
ATOM   2375 O  O     . ARG A 1 298 ? 28.373  -14.597 7.061   1.00 48.91 ? 298  ARG A O     1 
ATOM   2376 C  CB    . ARG A 1 298 ? 28.253  -17.013 8.956   1.00 48.84 ? 298  ARG A CB    1 
ATOM   2377 C  CG    . ARG A 1 298 ? 27.612  -18.005 9.918   1.00 49.27 ? 298  ARG A CG    1 
ATOM   2378 C  CD    . ARG A 1 298 ? 27.886  -17.624 11.375  1.00 49.84 ? 298  ARG A CD    1 
ATOM   2379 N  NE    . ARG A 1 298 ? 27.537  -18.697 12.296  1.00 49.83 ? 298  ARG A NE    1 
ATOM   2380 C  CZ    . ARG A 1 298 ? 26.299  -18.991 12.669  1.00 50.08 ? 298  ARG A CZ    1 
ATOM   2381 N  NH1   . ARG A 1 298 ? 25.268  -18.287 12.224  1.00 51.06 ? 298  ARG A NH1   1 
ATOM   2382 N  NH2   . ARG A 1 298 ? 26.087  -20.000 13.497  1.00 50.78 ? 298  ARG A NH2   1 
ATOM   2383 N  N     . GLY A 1 299 ? 29.450  -13.874 8.899   1.00 48.44 ? 299  GLY A N     1 
ATOM   2384 C  CA    . GLY A 1 299 ? 30.295  -12.944 8.183   1.00 48.15 ? 299  GLY A CA    1 
ATOM   2385 C  C     . GLY A 1 299 ? 31.729  -12.877 8.657   1.00 48.21 ? 299  GLY A C     1 
ATOM   2386 O  O     . GLY A 1 299 ? 32.152  -13.598 9.575   1.00 47.93 ? 299  GLY A O     1 
ATOM   2387 N  N     . ARG A 1 300 ? 32.482  -12.005 7.989   1.00 48.23 ? 300  ARG A N     1 
ATOM   2388 C  CA    . ARG A 1 300 ? 33.862  -11.746 8.339   1.00 48.35 ? 300  ARG A CA    1 
ATOM   2389 C  C     . ARG A 1 300 ? 34.262  -10.383 7.813   1.00 48.14 ? 300  ARG A C     1 
ATOM   2390 O  O     . ARG A 1 300 ? 33.817  -9.972  6.738   1.00 48.29 ? 300  ARG A O     1 
ATOM   2391 C  CB    . ARG A 1 300 ? 34.793  -12.821 7.780   1.00 48.45 ? 300  ARG A CB    1 
ATOM   2392 C  CG    . ARG A 1 300 ? 36.249  -12.571 8.109   1.00 49.15 ? 300  ARG A CG    1 
ATOM   2393 C  CD    . ARG A 1 300 ? 37.149  -13.584 7.478   1.00 50.97 ? 300  ARG A CD    1 
ATOM   2394 N  NE    . ARG A 1 300 ? 38.550  -13.355 7.822   1.00 52.27 ? 300  ARG A NE    1 
ATOM   2395 C  CZ    . ARG A 1 300 ? 39.569  -14.057 7.320   1.00 54.45 ? 300  ARG A CZ    1 
ATOM   2396 N  NH1   . ARG A 1 300 ? 39.344  -15.043 6.449   1.00 55.99 ? 300  ARG A NH1   1 
ATOM   2397 N  NH2   . ARG A 1 300 ? 40.824  -13.786 7.682   1.00 53.73 ? 300  ARG A NH2   1 
ATOM   2398 N  N     . THR A 1 301 ? 35.089  -9.691  8.598   1.00 47.77 ? 301  THR A N     1 
ATOM   2399 C  CA    . THR A 1 301 ? 35.642  -8.405  8.230   1.00 47.50 ? 301  THR A CA    1 
ATOM   2400 C  C     . THR A 1 301 ? 37.125  -8.581  8.022   1.00 47.39 ? 301  THR A C     1 
ATOM   2401 O  O     . THR A 1 301 ? 37.791  -9.203  8.837   1.00 47.47 ? 301  THR A O     1 
ATOM   2402 C  CB    . THR A 1 301 ? 35.418  -7.366  9.325   1.00 47.45 ? 301  THR A CB    1 
ATOM   2403 O  OG1   . THR A 1 301 ? 34.014  -7.133  9.465   1.00 47.83 ? 301  THR A OG1   1 
ATOM   2404 C  CG2   . THR A 1 301 ? 36.111  -6.050  8.984   1.00 46.88 ? 301  THR A CG2   1 
ATOM   2405 N  N     . PHE A 1 302 ? 37.635  -8.038  6.923   1.00 47.38 ? 302  PHE A N     1 
ATOM   2406 C  CA    . PHE A 1 302 ? 39.058  -8.101  6.618   1.00 47.32 ? 302  PHE A CA    1 
ATOM   2407 C  C     . PHE A 1 302 ? 39.710  -6.764  6.938   1.00 47.48 ? 302  PHE A C     1 
ATOM   2408 O  O     . PHE A 1 302 ? 39.048  -5.728  6.949   1.00 47.76 ? 302  PHE A O     1 
ATOM   2409 C  CB    . PHE A 1 302 ? 39.267  -8.436  5.142   1.00 47.09 ? 302  PHE A CB    1 
ATOM   2410 C  CG    . PHE A 1 302 ? 38.808  -9.814  4.761   1.00 46.17 ? 302  PHE A CG    1 
ATOM   2411 C  CD1   . PHE A 1 302 ? 37.459  -10.083 4.579   1.00 45.48 ? 302  PHE A CD1   1 
ATOM   2412 C  CD2   . PHE A 1 302 ? 39.724  -10.838 4.574   1.00 45.91 ? 302  PHE A CD2   1 
ATOM   2413 C  CE1   . PHE A 1 302 ? 37.018  -11.357 4.220   1.00 45.75 ? 302  PHE A CE1   1 
ATOM   2414 C  CE2   . PHE A 1 302 ? 39.299  -12.120 4.213   1.00 46.51 ? 302  PHE A CE2   1 
ATOM   2415 C  CZ    . PHE A 1 302 ? 37.940  -12.379 4.032   1.00 46.38 ? 302  PHE A CZ    1 
ATOM   2416 N  N     . PRO A 1 303 ? 41.021  -6.774  7.193   1.00 47.70 ? 303  PRO A N     1 
ATOM   2417 C  CA    . PRO A 1 303 ? 41.707  -5.494  7.392   1.00 47.89 ? 303  PRO A CA    1 
ATOM   2418 C  C     . PRO A 1 303 ? 41.919  -4.718  6.087   1.00 48.04 ? 303  PRO A C     1 
ATOM   2419 O  O     . PRO A 1 303 ? 42.337  -3.574  6.122   1.00 48.86 ? 303  PRO A O     1 
ATOM   2420 C  CB    . PRO A 1 303 ? 43.058  -5.907  7.999   1.00 47.59 ? 303  PRO A CB    1 
ATOM   2421 C  CG    . PRO A 1 303 ? 43.287  -7.295  7.551   1.00 47.27 ? 303  PRO A CG    1 
ATOM   2422 C  CD    . PRO A 1 303 ? 41.937  -7.925  7.294   1.00 47.60 ? 303  PRO A CD    1 
ATOM   2423 N  N     . HIS A 1 304 ? 41.655  -5.357  4.955   1.00 48.06 ? 304  HIS A N     1 
ATOM   2424 C  CA    . HIS A 1 304 ? 41.850  -4.766  3.643   1.00 47.85 ? 304  HIS A CA    1 
ATOM   2425 C  C     . HIS A 1 304 ? 40.572  -5.006  2.836   1.00 47.30 ? 304  HIS A C     1 
ATOM   2426 O  O     . HIS A 1 304 ? 39.669  -5.696  3.308   1.00 46.75 ? 304  HIS A O     1 
ATOM   2427 C  CB    . HIS A 1 304 ? 43.070  -5.404  2.961   1.00 47.72 ? 304  HIS A CB    1 
ATOM   2428 C  CG    . HIS A 1 304 ? 42.959  -6.892  2.771   1.00 49.58 ? 304  HIS A CG    1 
ATOM   2429 N  ND1   . HIS A 1 304 ? 43.824  -7.790  3.368   1.00 51.14 ? 304  HIS A ND1   1 
ATOM   2430 C  CD2   . HIS A 1 304 ? 42.088  -7.641  2.048   1.00 50.13 ? 304  HIS A CD2   1 
ATOM   2431 C  CE1   . HIS A 1 304 ? 43.489  -9.023  3.025   1.00 50.35 ? 304  HIS A CE1   1 
ATOM   2432 N  NE2   . HIS A 1 304 ? 42.437  -8.961  2.226   1.00 50.88 ? 304  HIS A NE2   1 
ATOM   2433 N  N     . GLY A 1 305 ? 40.518  -4.450  1.626   1.00 46.82 ? 305  GLY A N     1 
ATOM   2434 C  CA    . GLY A 1 305 ? 39.404  -4.666  0.695   1.00 46.88 ? 305  GLY A CA    1 
ATOM   2435 C  C     . GLY A 1 305 ? 39.225  -6.087  0.150   1.00 46.82 ? 305  GLY A C     1 
ATOM   2436 O  O     . GLY A 1 305 ? 40.169  -6.844  0.030   1.00 46.50 ? 305  GLY A O     1 
ATOM   2437 N  N     . ILE A 1 306 ? 37.993  -6.451  -0.180  1.00 47.21 ? 306  ILE A N     1 
ATOM   2438 C  CA    . ILE A 1 306 ? 37.705  -7.794  -0.677  1.00 47.41 ? 306  ILE A CA    1 
ATOM   2439 C  C     . ILE A 1 306 ? 37.611  -7.764  -2.204  1.00 47.27 ? 306  ILE A C     1 
ATOM   2440 O  O     . ILE A 1 306 ? 36.880  -6.961  -2.791  1.00 47.08 ? 306  ILE A O     1 
ATOM   2441 C  CB    . ILE A 1 306 ? 36.385  -8.342  -0.091  1.00 47.62 ? 306  ILE A CB    1 
ATOM   2442 C  CG1   . ILE A 1 306 ? 36.474  -8.444  1.432   1.00 47.94 ? 306  ILE A CG1   1 
ATOM   2443 C  CG2   . ILE A 1 306 ? 36.054  -9.713  -0.676  1.00 47.45 ? 306  ILE A CG2   1 
ATOM   2444 C  CD1   . ILE A 1 306 ? 35.132  -8.778  2.108   1.00 47.48 ? 306  ILE A CD1   1 
ATOM   2445 N  N     . SER A 1 307 ? 38.371  -8.638  -2.840  1.00 47.09 ? 307  SER A N     1 
ATOM   2446 C  CA    . SER A 1 307 ? 38.321  -8.784  -4.274  1.00 47.12 ? 307  SER A CA    1 
ATOM   2447 C  C     . SER A 1 307 ? 37.284  -9.854  -4.572  1.00 47.42 ? 307  SER A C     1 
ATOM   2448 O  O     . SER A 1 307 ? 37.028  -10.699 -3.729  1.00 47.49 ? 307  SER A O     1 
ATOM   2449 C  CB    . SER A 1 307 ? 39.684  -9.208  -4.804  1.00 46.69 ? 307  SER A CB    1 
ATOM   2450 O  OG    . SER A 1 307 ? 40.037  -10.469 -4.276  1.00 45.76 ? 307  SER A OG    1 
ATOM   2451 N  N     . LYS A 1 308 ? 36.699  -9.799  -5.766  1.00 47.86 ? 308  LYS A N     1 
ATOM   2452 C  CA    . LYS A 1 308 ? 35.707  -10.770 -6.211  1.00 48.64 ? 308  LYS A CA    1 
ATOM   2453 C  C     . LYS A 1 308 ? 36.105  -12.205 -5.847  1.00 48.95 ? 308  LYS A C     1 
ATOM   2454 O  O     . LYS A 1 308 ? 35.330  -12.956 -5.239  1.00 48.19 ? 308  LYS A O     1 
ATOM   2455 C  CB    . LYS A 1 308 ? 35.514  -10.652 -7.731  1.00 49.12 ? 308  LYS A CB    1 
ATOM   2456 C  CG    . LYS A 1 308 ? 34.224  -11.304 -8.261  1.00 50.77 ? 308  LYS A CG    1 
ATOM   2457 C  CD    . LYS A 1 308 ? 33.546  -10.514 -9.412  1.00 53.35 ? 308  LYS A CD    1 
ATOM   2458 C  CE    . LYS A 1 308 ? 33.979  -10.979 -10.813 1.00 55.50 ? 308  LYS A CE    1 
ATOM   2459 N  NZ    . LYS A 1 308 ? 32.885  -10.765 -11.825 1.00 56.92 ? 308  LYS A NZ    1 
ATOM   2460 N  N     . GLU A 1 309 ? 37.339  -12.556 -6.190  1.00 49.37 ? 309  GLU A N     1 
ATOM   2461 C  CA    . GLU A 1 309 ? 37.852  -13.909 -5.972  1.00 49.89 ? 309  GLU A CA    1 
ATOM   2462 C  C     . GLU A 1 309 ? 37.826  -14.293 -4.489  1.00 49.23 ? 309  GLU A C     1 
ATOM   2463 O  O     . GLU A 1 309 ? 37.532  -15.437 -4.157  1.00 49.18 ? 309  GLU A O     1 
ATOM   2464 C  CB    . GLU A 1 309 ? 39.271  -14.060 -6.553  1.00 50.38 ? 309  GLU A CB    1 
ATOM   2465 C  CG    . GLU A 1 309 ? 39.339  -13.951 -8.103  1.00 53.00 ? 309  GLU A CG    1 
ATOM   2466 C  CD    . GLU A 1 309 ? 39.057  -12.529 -8.663  1.00 56.85 ? 309  GLU A CD    1 
ATOM   2467 O  OE1   . GLU A 1 309 ? 39.388  -11.492 -8.012  1.00 56.72 ? 309  GLU A OE1   1 
ATOM   2468 O  OE2   . GLU A 1 309 ? 38.481  -12.460 -9.778  1.00 60.20 ? 309  GLU A OE2   1 
ATOM   2469 N  N     . THR A 1 310 ? 38.117  -13.344 -3.603  1.00 48.82 ? 310  THR A N     1 
ATOM   2470 C  CA    . THR A 1 310 ? 38.025  -13.607 -2.172  1.00 48.58 ? 310  THR A CA    1 
ATOM   2471 C  C     . THR A 1 310 ? 36.553  -13.717 -1.765  1.00 48.64 ? 310  THR A C     1 
ATOM   2472 O  O     . THR A 1 310 ? 36.202  -14.526 -0.903  1.00 48.74 ? 310  THR A O     1 
ATOM   2473 C  CB    . THR A 1 310 ? 38.747  -12.536 -1.319  1.00 48.44 ? 310  THR A CB    1 
ATOM   2474 O  OG1   . THR A 1 310 ? 40.133  -12.476 -1.683  1.00 48.25 ? 310  THR A OG1   1 
ATOM   2475 C  CG2   . THR A 1 310 ? 38.647  -12.881 0.169   1.00 48.06 ? 310  THR A CG2   1 
ATOM   2476 N  N     . ALA A 1 311 ? 35.694  -12.936 -2.407  1.00 48.49 ? 311  ALA A N     1 
ATOM   2477 C  CA    . ALA A 1 311 ? 34.269  -12.996 -2.115  1.00 48.98 ? 311  ALA A CA    1 
ATOM   2478 C  C     . ALA A 1 311 ? 33.717  -14.392 -2.430  1.00 49.25 ? 311  ALA A C     1 
ATOM   2479 O  O     . ALA A 1 311 ? 32.898  -14.915 -1.691  1.00 49.79 ? 311  ALA A O     1 
ATOM   2480 C  CB    . ALA A 1 311 ? 33.486  -11.892 -2.867  1.00 48.27 ? 311  ALA A CB    1 
ATOM   2481 N  N     . TYR A 1 312 ? 34.175  -15.005 -3.508  1.00 49.70 ? 312  TYR A N     1 
ATOM   2482 C  CA    . TYR A 1 312 ? 33.733  -16.357 -3.843  1.00 49.98 ? 312  TYR A CA    1 
ATOM   2483 C  C     . TYR A 1 312 ? 34.218  -17.345 -2.808  1.00 50.29 ? 312  TYR A C     1 
ATOM   2484 O  O     . TYR A 1 312 ? 33.425  -18.133 -2.278  1.00 50.59 ? 312  TYR A O     1 
ATOM   2485 C  CB    . TYR A 1 312 ? 34.237  -16.782 -5.219  1.00 50.28 ? 312  TYR A CB    1 
ATOM   2486 C  CG    . TYR A 1 312 ? 33.306  -16.378 -6.325  1.00 50.75 ? 312  TYR A CG    1 
ATOM   2487 C  CD1   . TYR A 1 312 ? 32.397  -17.282 -6.852  1.00 51.89 ? 312  TYR A CD1   1 
ATOM   2488 C  CD2   . TYR A 1 312 ? 33.314  -15.084 -6.831  1.00 52.10 ? 312  TYR A CD2   1 
ATOM   2489 C  CE1   . TYR A 1 312 ? 31.524  -16.917 -7.865  1.00 52.32 ? 312  TYR A CE1   1 
ATOM   2490 C  CE2   . TYR A 1 312 ? 32.444  -14.703 -7.851  1.00 52.25 ? 312  TYR A CE2   1 
ATOM   2491 C  CZ    . TYR A 1 312 ? 31.551  -15.627 -8.359  1.00 51.86 ? 312  TYR A CZ    1 
ATOM   2492 O  OH    . TYR A 1 312 ? 30.689  -15.280 -9.364  1.00 51.51 ? 312  TYR A OH    1 
ATOM   2493 N  N     . SER A 1 313 ? 35.516  -17.297 -2.515  1.00 50.05 ? 313  SER A N     1 
ATOM   2494 C  CA    . SER A 1 313 ? 36.104  -18.231 -1.577  1.00 50.04 ? 313  SER A CA    1 
ATOM   2495 C  C     . SER A 1 313 ? 35.519  -18.112 -0.187  1.00 49.79 ? 313  SER A C     1 
ATOM   2496 O  O     . SER A 1 313 ? 35.119  -19.113 0.394   1.00 50.11 ? 313  SER A O     1 
ATOM   2497 C  CB    . SER A 1 313 ? 37.609  -18.052 -1.507  1.00 49.90 ? 313  SER A CB    1 
ATOM   2498 O  OG    . SER A 1 313 ? 38.133  -18.203 -2.801  1.00 51.23 ? 313  SER A OG    1 
ATOM   2499 N  N     . GLU A 1 314 ? 35.462  -16.906 0.355   1.00 49.50 ? 314  GLU A N     1 
ATOM   2500 C  CA    . GLU A 1 314 ? 35.049  -16.770 1.745   1.00 49.75 ? 314  GLU A CA    1 
ATOM   2501 C  C     . GLU A 1 314 ? 33.566  -17.068 1.910   1.00 49.23 ? 314  GLU A C     1 
ATOM   2502 O  O     . GLU A 1 314 ? 33.160  -17.695 2.878   1.00 48.99 ? 314  GLU A O     1 
ATOM   2503 C  CB    . GLU A 1 314 ? 35.382  -15.386 2.302   1.00 50.08 ? 314  GLU A CB    1 
ATOM   2504 C  CG    . GLU A 1 314 ? 35.207  -15.268 3.826   1.00 51.96 ? 314  GLU A CG    1 
ATOM   2505 C  CD    . GLU A 1 314 ? 36.267  -16.022 4.628   1.00 54.76 ? 314  GLU A CD    1 
ATOM   2506 O  OE1   . GLU A 1 314 ? 35.986  -16.407 5.790   1.00 56.17 ? 314  GLU A OE1   1 
ATOM   2507 O  OE2   . GLU A 1 314 ? 37.385  -16.226 4.104   1.00 57.36 ? 314  GLU A OE2   1 
ATOM   2508 N  N     . SER A 1 315 ? 32.755  -16.647 0.958   1.00 48.84 ? 315  SER A N     1 
ATOM   2509 C  CA    . SER A 1 315 ? 31.333  -16.839 1.096   1.00 49.08 ? 315  SER A CA    1 
ATOM   2510 C  C     . SER A 1 315 ? 31.051  -18.324 1.224   1.00 48.81 ? 315  SER A C     1 
ATOM   2511 O  O     . SER A 1 315 ? 30.202  -18.733 2.022   1.00 49.16 ? 315  SER A O     1 
ATOM   2512 C  CB    . SER A 1 315 ? 30.611  -16.279 -0.105  1.00 49.13 ? 315  SER A CB    1 
ATOM   2513 O  OG    . SER A 1 315 ? 31.068  -16.966 -1.252  1.00 51.61 ? 315  SER A OG    1 
ATOM   2514 N  N     . VAL A 1 316 ? 31.766  -19.134 0.447   1.00 48.31 ? 316  VAL A N     1 
ATOM   2515 C  CA    . VAL A 1 316 ? 31.634  -20.585 0.551   1.00 47.86 ? 316  VAL A CA    1 
ATOM   2516 C  C     . VAL A 1 316 ? 32.056  -21.077 1.933   1.00 47.91 ? 316  VAL A C     1 
ATOM   2517 O  O     . VAL A 1 316 ? 31.401  -21.939 2.503   1.00 48.26 ? 316  VAL A O     1 
ATOM   2518 C  CB    . VAL A 1 316 ? 32.453  -21.322 -0.530  1.00 47.89 ? 316  VAL A CB    1 
ATOM   2519 C  CG1   . VAL A 1 316 ? 32.612  -22.804 -0.179  1.00 47.22 ? 316  VAL A CG1   1 
ATOM   2520 C  CG2   . VAL A 1 316 ? 31.805  -21.145 -1.893  1.00 47.24 ? 316  VAL A CG2   1 
ATOM   2521 N  N     . LYS A 1 317 ? 33.142  -20.539 2.476   1.00 47.65 ? 317  LYS A N     1 
ATOM   2522 C  CA    . LYS A 1 317 ? 33.551  -20.920 3.817   1.00 47.88 ? 317  LYS A CA    1 
ATOM   2523 C  C     . LYS A 1 317 ? 32.444  -20.559 4.812   1.00 48.01 ? 317  LYS A C     1 
ATOM   2524 O  O     . LYS A 1 317 ? 32.064  -21.377 5.645   1.00 47.64 ? 317  LYS A O     1 
ATOM   2525 C  CB    . LYS A 1 317 ? 34.880  -20.257 4.204   1.00 47.99 ? 317  LYS A CB    1 
ATOM   2526 C  CG    . LYS A 1 317 ? 36.083  -20.811 3.451   1.00 48.97 ? 317  LYS A CG    1 
ATOM   2527 C  CD    . LYS A 1 317 ? 37.395  -20.687 4.234   1.00 51.07 ? 317  LYS A CD    1 
ATOM   2528 C  CE    . LYS A 1 317 ? 38.308  -19.558 3.715   1.00 52.65 ? 317  LYS A CE    1 
ATOM   2529 N  NZ    . LYS A 1 317 ? 39.245  -20.053 2.659   1.00 52.62 ? 317  LYS A NZ    1 
ATOM   2530 N  N     . LEU A 1 318 ? 31.918  -19.337 4.690   1.00 48.31 ? 318  LEU A N     1 
ATOM   2531 C  CA    . LEU A 1 318 ? 30.869  -18.836 5.575   1.00 48.42 ? 318  LEU A CA    1 
ATOM   2532 C  C     . LEU A 1 318 ? 29.593  -19.662 5.459   1.00 48.97 ? 318  LEU A C     1 
ATOM   2533 O  O     . LEU A 1 318 ? 28.927  -19.927 6.462   1.00 48.76 ? 318  LEU A O     1 
ATOM   2534 C  CB    . LEU A 1 318 ? 30.545  -17.374 5.263   1.00 48.13 ? 318  LEU A CB    1 
ATOM   2535 C  CG    . LEU A 1 318 ? 31.638  -16.342 5.526   1.00 47.59 ? 318  LEU A CG    1 
ATOM   2536 C  CD1   . LEU A 1 318 ? 31.169  -14.958 5.043   1.00 44.76 ? 318  LEU A CD1   1 
ATOM   2537 C  CD2   . LEU A 1 318 ? 32.039  -16.345 7.012   1.00 46.40 ? 318  LEU A CD2   1 
ATOM   2538 N  N     . LEU A 1 319 ? 29.243  -20.044 4.236   1.00 49.61 ? 319  LEU A N     1 
ATOM   2539 C  CA    . LEU A 1 319 ? 28.070  -20.886 4.018   1.00 50.29 ? 319  LEU A CA    1 
ATOM   2540 C  C     . LEU A 1 319 ? 28.306  -22.275 4.604   1.00 50.87 ? 319  LEU A C     1 
ATOM   2541 O  O     . LEU A 1 319 ? 27.398  -22.869 5.170   1.00 51.21 ? 319  LEU A O     1 
ATOM   2542 C  CB    . LEU A 1 319 ? 27.716  -20.969 2.528   1.00 50.42 ? 319  LEU A CB    1 
ATOM   2543 C  CG    . LEU A 1 319 ? 26.683  -22.020 2.093   1.00 50.06 ? 319  LEU A CG    1 
ATOM   2544 C  CD1   . LEU A 1 319 ? 25.389  -21.944 2.899   1.00 48.74 ? 319  LEU A CD1   1 
ATOM   2545 C  CD2   . LEU A 1 319 ? 26.416  -21.874 0.607   1.00 49.56 ? 319  LEU A CD2   1 
ATOM   2546 N  N     . GLN A 1 320 ? 29.523  -22.789 4.484   1.00 51.70 ? 320  GLN A N     1 
ATOM   2547 C  CA    . GLN A 1 320 ? 29.864  -24.055 5.145   1.00 52.28 ? 320  GLN A CA    1 
ATOM   2548 C  C     . GLN A 1 320 ? 29.629  -23.923 6.638   1.00 52.03 ? 320  GLN A C     1 
ATOM   2549 O  O     . GLN A 1 320 ? 29.137  -24.847 7.271   1.00 52.14 ? 320  GLN A O     1 
ATOM   2550 C  CB    . GLN A 1 320 ? 31.318  -24.482 4.879   1.00 52.58 ? 320  GLN A CB    1 
ATOM   2551 C  CG    . GLN A 1 320 ? 31.457  -25.727 3.994   1.00 55.07 ? 320  GLN A CG    1 
ATOM   2552 C  CD    . GLN A 1 320 ? 30.864  -27.004 4.626   1.00 57.91 ? 320  GLN A CD    1 
ATOM   2553 O  OE1   . GLN A 1 320 ? 30.949  -27.221 5.844   1.00 59.73 ? 320  GLN A OE1   1 
ATOM   2554 N  NE2   . GLN A 1 320 ? 30.264  -27.852 3.788   1.00 58.54 ? 320  GLN A NE2   1 
ATOM   2555 N  N     . LYS A 1 321 ? 29.984  -22.768 7.187   1.00 51.98 ? 321  LYS A N     1 
ATOM   2556 C  CA    . LYS A 1 321 ? 29.891  -22.534 8.618   1.00 52.21 ? 321  LYS A CA    1 
ATOM   2557 C  C     . LYS A 1 321 ? 28.421  -22.517 9.088   1.00 52.15 ? 321  LYS A C     1 
ATOM   2558 O  O     . LYS A 1 321 ? 28.098  -23.069 10.149  1.00 51.89 ? 321  LYS A O     1 
ATOM   2559 C  CB    . LYS A 1 321 ? 30.632  -21.239 8.976   1.00 52.30 ? 321  LYS A CB    1 
ATOM   2560 C  CG    . LYS A 1 321 ? 30.636  -20.894 10.454  1.00 52.97 ? 321  LYS A CG    1 
ATOM   2561 C  CD    . LYS A 1 321 ? 31.683  -19.826 10.817  1.00 52.84 ? 321  LYS A CD    1 
ATOM   2562 C  CE    . LYS A 1 321 ? 31.698  -19.604 12.344  1.00 53.85 ? 321  LYS A CE    1 
ATOM   2563 N  NZ    . LYS A 1 321 ? 32.887  -18.846 12.848  1.00 54.61 ? 321  LYS A NZ    1 
ATOM   2564 N  N     . ILE A 1 322 ? 27.540  -21.912 8.289   1.00 52.02 ? 322  ILE A N     1 
ATOM   2565 C  CA    . ILE A 1 322 ? 26.112  -21.888 8.596   1.00 52.14 ? 322  ILE A CA    1 
ATOM   2566 C  C     . ILE A 1 322 ? 25.555  -23.303 8.655   1.00 52.47 ? 322  ILE A C     1 
ATOM   2567 O  O     . ILE A 1 322 ? 24.839  -23.648 9.591   1.00 52.62 ? 322  ILE A O     1 
ATOM   2568 C  CB    . ILE A 1 322 ? 25.291  -21.084 7.553   1.00 52.24 ? 322  ILE A CB    1 
ATOM   2569 C  CG1   . ILE A 1 322 ? 25.578  -19.590 7.675   1.00 52.16 ? 322  ILE A CG1   1 
ATOM   2570 C  CG2   . ILE A 1 322 ? 23.788  -21.311 7.745   1.00 51.56 ? 322  ILE A CG2   1 
ATOM   2571 C  CD1   . ILE A 1 322 ? 24.904  -18.763 6.601   1.00 51.87 ? 322  ILE A CD1   1 
ATOM   2572 N  N     . LEU A 1 323 ? 25.881  -24.113 7.652   1.00 52.78 ? 323  LEU A N     1 
ATOM   2573 C  CA    . LEU A 1 323 ? 25.414  -25.501 7.599   1.00 53.14 ? 323  LEU A CA    1 
ATOM   2574 C  C     . LEU A 1 323 ? 25.929  -26.319 8.776   1.00 53.87 ? 323  LEU A C     1 
ATOM   2575 O  O     . LEU A 1 323 ? 25.196  -27.106 9.335   1.00 54.15 ? 323  LEU A O     1 
ATOM   2576 C  CB    . LEU A 1 323 ? 25.832  -26.161 6.285   1.00 52.90 ? 323  LEU A CB    1 
ATOM   2577 C  CG    . LEU A 1 323 ? 24.855  -26.182 5.108   1.00 52.40 ? 323  LEU A CG    1 
ATOM   2578 C  CD1   . LEU A 1 323 ? 23.681  -25.255 5.291   1.00 52.58 ? 323  LEU A CD1   1 
ATOM   2579 C  CD2   . LEU A 1 323 ? 25.579  -25.894 3.795   1.00 51.63 ? 323  LEU A CD2   1 
ATOM   2580 N  N     . GLU A 1 324 ? 27.187  -26.129 9.147   1.00 54.94 ? 324  GLU A N     1 
ATOM   2581 C  CA    . GLU A 1 324 ? 27.754  -26.805 10.309  1.00 56.06 ? 324  GLU A CA    1 
ATOM   2582 C  C     . GLU A 1 324 ? 27.027  -26.440 11.599  1.00 56.42 ? 324  GLU A C     1 
ATOM   2583 O  O     . GLU A 1 324 ? 26.667  -27.308 12.376  1.00 56.69 ? 324  GLU A O     1 
ATOM   2584 C  CB    . GLU A 1 324 ? 29.239  -26.458 10.460  1.00 56.14 ? 324  GLU A CB    1 
ATOM   2585 C  CG    . GLU A 1 324 ? 30.151  -27.137 9.434   1.00 57.30 ? 324  GLU A CG    1 
ATOM   2586 C  CD    . GLU A 1 324 ? 31.554  -26.527 9.358   1.00 57.53 ? 324  GLU A CD    1 
ATOM   2587 O  OE1   . GLU A 1 324 ? 32.449  -27.177 8.767   1.00 59.42 ? 324  GLU A OE1   1 
ATOM   2588 O  OE2   . GLU A 1 324 ? 31.766  -25.407 9.879   1.00 59.85 ? 324  GLU A OE2   1 
ATOM   2589 N  N     . GLU A 1 325 ? 26.807  -25.151 11.817  1.00 57.17 ? 325  GLU A N     1 
ATOM   2590 C  CA    . GLU A 1 325 ? 26.349  -24.661 13.116  1.00 57.65 ? 325  GLU A CA    1 
ATOM   2591 C  C     . GLU A 1 325 ? 24.826  -24.503 13.224  1.00 57.76 ? 325  GLU A C     1 
ATOM   2592 O  O     . GLU A 1 325 ? 24.323  -24.093 14.272  1.00 57.85 ? 325  GLU A O     1 
ATOM   2593 C  CB    . GLU A 1 325 ? 27.061  -23.338 13.441  1.00 57.71 ? 325  GLU A CB    1 
ATOM   2594 C  CG    . GLU A 1 325 ? 28.575  -23.502 13.586  1.00 57.91 ? 325  GLU A CG    1 
ATOM   2595 C  CD    . GLU A 1 325 ? 29.308  -22.205 13.907  1.00 58.35 ? 325  GLU A CD    1 
ATOM   2596 O  OE1   . GLU A 1 325 ? 28.862  -21.133 13.454  1.00 57.91 ? 325  GLU A OE1   1 
ATOM   2597 O  OE2   . GLU A 1 325 ? 30.351  -22.265 14.604  1.00 59.87 ? 325  GLU A OE2   1 
ATOM   2598 N  N     . ASP A 1 326 ? 24.098  -24.832 12.156  1.00 57.80 ? 326  ASP A N     1 
ATOM   2599 C  CA    . ASP A 1 326 ? 22.632  -24.788 12.164  1.00 57.86 ? 326  ASP A CA    1 
ATOM   2600 C  C     . ASP A 1 326 ? 22.085  -25.958 11.353  1.00 57.69 ? 326  ASP A C     1 
ATOM   2601 O  O     . ASP A 1 326 ? 22.548  -26.225 10.246  1.00 57.88 ? 326  ASP A O     1 
ATOM   2602 C  CB    . ASP A 1 326 ? 22.134  -23.462 11.590  1.00 58.09 ? 326  ASP A CB    1 
ATOM   2603 C  CG    . ASP A 1 326 ? 20.610  -23.312 11.667  1.00 59.53 ? 326  ASP A CG    1 
ATOM   2604 O  OD1   . ASP A 1 326 ? 19.870  -24.280 11.356  1.00 61.79 ? 326  ASP A OD1   1 
ATOM   2605 O  OD2   . ASP A 1 326 ? 20.150  -22.209 12.032  1.00 60.10 ? 326  ASP A OD2   1 
ATOM   2606 N  N     . GLU A 1 327 ? 21.075  -26.628 11.897  1.00 57.34 ? 327  GLU A N     1 
ATOM   2607 C  CA    . GLU A 1 327 ? 20.618  -27.920 11.364  1.00 57.22 ? 327  GLU A CA    1 
ATOM   2608 C  C     . GLU A 1 327 ? 19.381  -27.832 10.467  1.00 56.35 ? 327  GLU A C     1 
ATOM   2609 O  O     . GLU A 1 327 ? 19.050  -28.796 9.786   1.00 56.16 ? 327  GLU A O     1 
ATOM   2610 C  CB    . GLU A 1 327 ? 20.382  -28.929 12.508  1.00 57.55 ? 327  GLU A CB    1 
ATOM   2611 C  CG    . GLU A 1 327 ? 19.526  -28.416 13.695  1.00 59.26 ? 327  GLU A CG    1 
ATOM   2612 C  CD    . GLU A 1 327 ? 18.068  -28.879 13.658  1.00 61.49 ? 327  GLU A CD    1 
ATOM   2613 O  OE1   . GLU A 1 327 ? 17.810  -30.075 13.976  1.00 62.50 ? 327  GLU A OE1   1 
ATOM   2614 O  OE2   . GLU A 1 327 ? 17.184  -28.040 13.343  1.00 62.19 ? 327  GLU A OE2   1 
ATOM   2615 N  N     . ARG A 1 328 ? 18.711  -26.683 10.445  1.00 55.48 ? 328  ARG A N     1 
ATOM   2616 C  CA    . ARG A 1 328 ? 17.471  -26.544 9.673   1.00 54.65 ? 328  ARG A CA    1 
ATOM   2617 C  C     . ARG A 1 328 ? 17.807  -26.397 8.194   1.00 53.61 ? 328  ARG A C     1 
ATOM   2618 O  O     . ARG A 1 328 ? 18.909  -25.987 7.852   1.00 53.43 ? 328  ARG A O     1 
ATOM   2619 C  CB    . ARG A 1 328 ? 16.673  -25.335 10.157  1.00 54.72 ? 328  ARG A CB    1 
ATOM   2620 C  CG    . ARG A 1 328 ? 16.325  -25.364 11.643  1.00 54.72 ? 328  ARG A CG    1 
ATOM   2621 C  CD    . ARG A 1 328 ? 15.788  -24.012 12.108  1.00 54.98 ? 328  ARG A CD    1 
ATOM   2622 N  NE    . ARG A 1 328 ? 16.841  -23.046 12.438  1.00 54.92 ? 328  ARG A NE    1 
ATOM   2623 C  CZ    . ARG A 1 328 ? 16.607  -21.798 12.845  1.00 55.21 ? 328  ARG A CZ    1 
ATOM   2624 N  NH1   . ARG A 1 328 ? 15.364  -21.343 12.970  1.00 55.25 ? 328  ARG A NH1   1 
ATOM   2625 N  NH2   . ARG A 1 328 ? 17.618  -20.990 13.131  1.00 55.27 ? 328  ARG A NH2   1 
ATOM   2626 N  N     . LYS A 1 329 ? 16.871  -26.754 7.318   1.00 52.41 ? 329  LYS A N     1 
ATOM   2627 C  CA    . LYS A 1 329 ? 17.075  -26.574 5.873   1.00 51.54 ? 329  LYS A CA    1 
ATOM   2628 C  C     . LYS A 1 329 ? 17.098  -25.080 5.485   1.00 50.36 ? 329  LYS A C     1 
ATOM   2629 O  O     . LYS A 1 329 ? 16.440  -24.258 6.117   1.00 50.53 ? 329  LYS A O     1 
ATOM   2630 C  CB    . LYS A 1 329 ? 15.989  -27.304 5.076   1.00 51.48 ? 329  LYS A CB    1 
ATOM   2631 C  CG    . LYS A 1 329 ? 16.030  -28.809 5.207   1.00 51.85 ? 329  LYS A CG    1 
ATOM   2632 C  CD    . LYS A 1 329 ? 15.081  -29.501 4.225   1.00 51.89 ? 329  LYS A CD    1 
ATOM   2633 C  CE    . LYS A 1 329 ? 14.905  -30.982 4.575   1.00 52.34 ? 329  LYS A CE    1 
ATOM   2634 N  NZ    . LYS A 1 329 ? 14.615  -31.809 3.369   1.00 52.35 ? 329  LYS A NZ    1 
ATOM   2635 N  N     . ILE A 1 330 ? 17.860  -24.731 4.457   1.00 48.83 ? 330  ILE A N     1 
ATOM   2636 C  CA    . ILE A 1 330 ? 17.932  -23.353 4.027   1.00 48.08 ? 330  ILE A CA    1 
ATOM   2637 C  C     . ILE A 1 330 ? 16.905  -23.167 2.945   1.00 47.50 ? 330  ILE A C     1 
ATOM   2638 O  O     . ILE A 1 330 ? 16.625  -24.096 2.207   1.00 47.64 ? 330  ILE A O     1 
ATOM   2639 C  CB    . ILE A 1 330 ? 19.315  -22.977 3.499   1.00 47.96 ? 330  ILE A CB    1 
ATOM   2640 C  CG1   . ILE A 1 330 ? 20.329  -23.047 4.630   1.00 47.97 ? 330  ILE A CG1   1 
ATOM   2641 C  CG2   . ILE A 1 330 ? 19.301  -21.574 2.921   1.00 46.70 ? 330  ILE A CG2   1 
ATOM   2642 C  CD1   . ILE A 1 330 ? 21.683  -22.514 4.252   1.00 48.96 ? 330  ILE A CD1   1 
ATOM   2643 N  N     . ARG A 1 331 ? 16.360  -21.962 2.858   1.00 46.34 ? 331  ARG A N     1 
ATOM   2644 C  CA    . ARG A 1 331 ? 15.292  -21.657 1.927   1.00 46.05 ? 331  ARG A CA    1 
ATOM   2645 C  C     . ARG A 1 331 ? 15.662  -20.517 0.972   1.00 45.59 ? 331  ARG A C     1 
ATOM   2646 O  O     . ARG A 1 331 ? 15.351  -20.573 -0.213  1.00 45.38 ? 331  ARG A O     1 
ATOM   2647 C  CB    . ARG A 1 331 ? 14.052  -21.286 2.739   1.00 46.37 ? 331  ARG A CB    1 
ATOM   2648 C  CG    . ARG A 1 331 ? 12.881  -20.753 1.961   1.00 46.14 ? 331  ARG A CG    1 
ATOM   2649 C  CD    . ARG A 1 331 ? 11.853  -20.213 2.947   1.00 47.22 ? 331  ARG A CD    1 
ATOM   2650 N  NE    . ARG A 1 331 ? 10.823  -19.401 2.295   1.00 47.63 ? 331  ARG A NE    1 
ATOM   2651 C  CZ    . ARG A 1 331 ? 9.644   -19.856 1.884   1.00 46.21 ? 331  ARG A CZ    1 
ATOM   2652 N  NH1   . ARG A 1 331 ? 9.317   -21.129 2.054   1.00 45.52 ? 331  ARG A NH1   1 
ATOM   2653 N  NH2   . ARG A 1 331 ? 8.785   -19.025 1.300   1.00 46.66 ? 331  ARG A NH2   1 
ATOM   2654 N  N     . ARG A 1 332 ? 16.286  -19.465 1.502   1.00 45.05 ? 332  ARG A N     1 
ATOM   2655 C  CA    . ARG A 1 332 ? 16.843  -18.397 0.677   1.00 44.26 ? 332  ARG A CA    1 
ATOM   2656 C  C     . ARG A 1 332 ? 18.280  -18.166 1.084   1.00 43.61 ? 332  ARG A C     1 
ATOM   2657 O  O     . ARG A 1 332 ? 18.639  -18.391 2.232   1.00 42.78 ? 332  ARG A O     1 
ATOM   2658 C  CB    . ARG A 1 332 ? 16.066  -17.105 0.834   1.00 44.20 ? 332  ARG A CB    1 
ATOM   2659 C  CG    . ARG A 1 332 ? 14.573  -17.250 0.746   1.00 44.68 ? 332  ARG A CG    1 
ATOM   2660 C  CD    . ARG A 1 332 ? 13.906  -15.995 1.247   1.00 44.75 ? 332  ARG A CD    1 
ATOM   2661 N  NE    . ARG A 1 332 ? 14.129  -14.878 0.348   1.00 45.12 ? 332  ARG A NE    1 
ATOM   2662 C  CZ    . ARG A 1 332 ? 14.097  -13.592 0.699   1.00 45.95 ? 332  ARG A CZ    1 
ATOM   2663 N  NH1   . ARG A 1 332 ? 14.296  -12.660 -0.230  1.00 45.85 ? 332  ARG A NH1   1 
ATOM   2664 N  NH2   . ARG A 1 332 ? 13.862  -13.228 1.958   1.00 45.76 ? 332  ARG A NH2   1 
ATOM   2665 N  N     . ILE A 1 333 ? 19.087  -17.717 0.125   1.00 43.38 ? 333  ILE A N     1 
ATOM   2666 C  CA    . ILE A 1 333 ? 20.504  -17.523 0.338   1.00 43.32 ? 333  ILE A CA    1 
ATOM   2667 C  C     . ILE A 1 333 ? 20.937  -16.207 -0.293  1.00 43.72 ? 333  ILE A C     1 
ATOM   2668 O  O     . ILE A 1 333 ? 20.487  -15.849 -1.384  1.00 44.01 ? 333  ILE A O     1 
ATOM   2669 C  CB    . ILE A 1 333 ? 21.332  -18.721 -0.202  1.00 43.21 ? 333  ILE A CB    1 
ATOM   2670 C  CG1   . ILE A 1 333 ? 22.766  -18.662 0.316   1.00 43.07 ? 333  ILE A CG1   1 
ATOM   2671 C  CG2   . ILE A 1 333 ? 21.325  -18.772 -1.713  1.00 42.76 ? 333  ILE A CG2   1 
ATOM   2672 C  CD1   . ILE A 1 333 ? 22.871  -18.801 1.809   1.00 43.13 ? 333  ILE A CD1   1 
ATOM   2673 N  N     . GLY A 1 334 ? 21.800  -15.482 0.415   1.00 43.63 ? 334  GLY A N     1 
ATOM   2674 C  CA    . GLY A 1 334 ? 22.230  -14.173 -0.014  1.00 43.54 ? 334  GLY A CA    1 
ATOM   2675 C  C     . GLY A 1 334 ? 23.586  -13.797 0.549   1.00 43.76 ? 334  GLY A C     1 
ATOM   2676 O  O     . GLY A 1 334 ? 24.217  -14.545 1.296   1.00 43.81 ? 334  GLY A O     1 
ATOM   2677 N  N     . VAL A 1 335 ? 24.024  -12.609 0.185   1.00 43.65 ? 335  VAL A N     1 
ATOM   2678 C  CA    . VAL A 1 335 ? 25.323  -12.153 0.527   1.00 43.96 ? 335  VAL A CA    1 
ATOM   2679 C  C     . VAL A 1 335 ? 25.200  -10.654 0.654   1.00 44.35 ? 335  VAL A C     1 
ATOM   2680 O  O     . VAL A 1 335 ? 24.280  -10.054 0.088   1.00 44.63 ? 335  VAL A O     1 
ATOM   2681 C  CB    . VAL A 1 335 ? 26.318  -12.570 -0.567  1.00 44.04 ? 335  VAL A CB    1 
ATOM   2682 C  CG1   . VAL A 1 335 ? 26.050  -11.794 -1.846  1.00 45.07 ? 335  VAL A CG1   1 
ATOM   2683 C  CG2   . VAL A 1 335 ? 27.740  -12.390 -0.104  1.00 44.05 ? 335  VAL A CG2   1 
ATOM   2684 N  N     . ARG A 1 336 ? 26.101  -10.047 1.417   1.00 44.99 ? 336  ARG A N     1 
ATOM   2685 C  CA    . ARG A 1 336 ? 26.001  -8.626  1.736   1.00 45.49 ? 336  ARG A CA    1 
ATOM   2686 C  C     . ARG A 1 336 ? 27.372  -8.073  2.044   1.00 45.25 ? 336  ARG A C     1 
ATOM   2687 O  O     . ARG A 1 336 ? 28.109  -8.663  2.817   1.00 45.11 ? 336  ARG A O     1 
ATOM   2688 C  CB    . ARG A 1 336 ? 25.092  -8.457  2.934   1.00 46.12 ? 336  ARG A CB    1 
ATOM   2689 C  CG    . ARG A 1 336 ? 24.943  -7.049  3.470   1.00 48.78 ? 336  ARG A CG    1 
ATOM   2690 C  CD    . ARG A 1 336 ? 23.552  -6.880  4.039   1.00 53.61 ? 336  ARG A CD    1 
ATOM   2691 N  NE    . ARG A 1 336 ? 22.554  -6.782  2.958   1.00 56.78 ? 336  ARG A NE    1 
ATOM   2692 C  CZ    . ARG A 1 336 ? 21.943  -5.658  2.572   1.00 58.99 ? 336  ARG A CZ    1 
ATOM   2693 N  NH1   . ARG A 1 336 ? 22.189  -4.495  3.191   1.00 61.15 ? 336  ARG A NH1   1 
ATOM   2694 N  NH2   . ARG A 1 336 ? 21.066  -5.689  1.567   1.00 57.29 ? 336  ARG A NH2   1 
ATOM   2695 N  N     . PHE A 1 337 ? 27.683  -6.932  1.430   1.00 45.31 ? 337  PHE A N     1 
ATOM   2696 C  CA    . PHE A 1 337 ? 28.992  -6.295  1.491   1.00 45.04 ? 337  PHE A CA    1 
ATOM   2697 C  C     . PHE A 1 337 ? 28.887  -4.992  2.256   1.00 45.20 ? 337  PHE A C     1 
ATOM   2698 O  O     . PHE A 1 337 ? 27.931  -4.246  2.099   1.00 44.94 ? 337  PHE A O     1 
ATOM   2699 C  CB    . PHE A 1 337 ? 29.523  -6.047  0.075   1.00 44.99 ? 337  PHE A CB    1 
ATOM   2700 C  CG    . PHE A 1 337 ? 29.799  -7.321  -0.683  1.00 45.30 ? 337  PHE A CG    1 
ATOM   2701 C  CD1   . PHE A 1 337 ? 30.900  -8.104  -0.367  1.00 45.51 ? 337  PHE A CD1   1 
ATOM   2702 C  CD2   . PHE A 1 337 ? 28.946  -7.764  -1.670  1.00 45.48 ? 337  PHE A CD2   1 
ATOM   2703 C  CE1   . PHE A 1 337 ? 31.143  -9.296  -1.010  1.00 44.98 ? 337  PHE A CE1   1 
ATOM   2704 C  CE2   . PHE A 1 337 ? 29.196  -8.957  -2.324  1.00 46.32 ? 337  PHE A CE2   1 
ATOM   2705 C  CZ    . PHE A 1 337 ? 30.301  -9.722  -1.989  1.00 45.24 ? 337  PHE A CZ    1 
ATOM   2706 N  N     . SER A 1 338 ? 29.875  -4.717  3.098   1.00 45.34 ? 338  SER A N     1 
ATOM   2707 C  CA    . SER A 1 338 ? 29.839  -3.508  3.906   1.00 45.23 ? 338  SER A CA    1 
ATOM   2708 C  C     . SER A 1 338 ? 31.262  -3.045  4.197   1.00 45.20 ? 338  SER A C     1 
ATOM   2709 O  O     . SER A 1 338 ? 32.211  -3.668  3.753   1.00 44.96 ? 338  SER A O     1 
ATOM   2710 C  CB    . SER A 1 338 ? 29.030  -3.742  5.199   1.00 45.24 ? 338  SER A CB    1 
ATOM   2711 O  OG    . SER A 1 338 ? 29.638  -4.718  6.051   1.00 45.05 ? 338  SER A OG    1 
ATOM   2712 N  N     . LYS A 1 339 ? 31.371  -1.925  4.910   1.00 45.55 ? 339  LYS A N     1 
ATOM   2713 C  CA    . LYS A 1 339 ? 32.626  -1.300  5.276   1.00 45.83 ? 339  LYS A CA    1 
ATOM   2714 C  C     . LYS A 1 339 ? 33.429  -0.946  4.042   1.00 45.67 ? 339  LYS A C     1 
ATOM   2715 O  O     . LYS A 1 339 ? 34.540  -1.432  3.825   1.00 45.92 ? 339  LYS A O     1 
ATOM   2716 C  CB    . LYS A 1 339 ? 33.393  -2.183  6.258   1.00 45.84 ? 339  LYS A CB    1 
ATOM   2717 C  CG    . LYS A 1 339 ? 32.672  -2.331  7.589   1.00 46.33 ? 339  LYS A CG    1 
ATOM   2718 C  CD    . LYS A 1 339 ? 33.440  -3.257  8.544   1.00 47.50 ? 339  LYS A CD    1 
ATOM   2719 C  CE    . LYS A 1 339 ? 32.535  -3.835  9.652   1.00 48.58 ? 339  LYS A CE    1 
ATOM   2720 N  NZ    . LYS A 1 339 ? 33.308  -4.650  10.627  1.00 49.99 ? 339  LYS A NZ    1 
ATOM   2721 N  N     . PHE A 1 340 ? 32.844  -0.083  3.232   1.00 45.99 ? 340  PHE A N     1 
ATOM   2722 C  CA    . PHE A 1 340 ? 33.473  0.342   1.994   1.00 46.53 ? 340  PHE A CA    1 
ATOM   2723 C  C     . PHE A 1 340 ? 34.623  1.268   2.350   1.00 46.92 ? 340  PHE A C     1 
ATOM   2724 O  O     . PHE A 1 340 ? 34.541  2.022   3.315   1.00 46.46 ? 340  PHE A O     1 
ATOM   2725 C  CB    . PHE A 1 340 ? 32.475  1.064   1.056   1.00 46.88 ? 340  PHE A CB    1 
ATOM   2726 C  CG    . PHE A 1 340 ? 31.207  0.287   0.783   1.00 46.68 ? 340  PHE A CG    1 
ATOM   2727 C  CD1   . PHE A 1 340 ? 31.258  -1.003  0.278   1.00 47.92 ? 340  PHE A CD1   1 
ATOM   2728 C  CD2   . PHE A 1 340 ? 29.974  0.839   1.036   1.00 47.62 ? 340  PHE A CD2   1 
ATOM   2729 C  CE1   . PHE A 1 340 ? 30.087  -1.738  0.045   1.00 48.32 ? 340  PHE A CE1   1 
ATOM   2730 C  CE2   . PHE A 1 340 ? 28.799  0.116   0.799   1.00 48.56 ? 340  PHE A CE2   1 
ATOM   2731 C  CZ    . PHE A 1 340 ? 28.861  -1.177  0.309   1.00 48.14 ? 340  PHE A CZ    1 
ATOM   2732 N  N     . ILE A 1 341 ? 35.704  1.179   1.580   1.00 47.53 ? 341  ILE A N     1 
ATOM   2733 C  CA    . ILE A 1 341 ? 36.824  2.101   1.714   1.00 48.13 ? 341  ILE A CA    1 
ATOM   2734 C  C     . ILE A 1 341 ? 36.430  3.451   1.100   1.00 49.08 ? 341  ILE A C     1 
ATOM   2735 O  O     . ILE A 1 341 ? 35.931  3.468   -0.034  1.00 49.61 ? 341  ILE A O     1 
ATOM   2736 C  CB    . ILE A 1 341 ? 38.089  1.590   0.998   1.00 47.89 ? 341  ILE A CB    1 
ATOM   2737 C  CG1   . ILE A 1 341 ? 38.547  0.248   1.587   1.00 47.57 ? 341  ILE A CG1   1 
ATOM   2738 C  CG2   . ILE A 1 341 ? 39.195  2.629   1.113   1.00 47.50 ? 341  ILE A CG2   1 
ATOM   2739 C  CD1   . ILE A 1 341 ? 39.478  -0.529  0.704   1.00 45.35 ? 341  ILE A CD1   1 
ATOM   2740 O  OXT   . ILE A 1 341 ? 36.603  4.530   1.700   1.00 49.84 ? 341  ILE A OXT   1 
ATOM   2741 N  N     . GLY B 1 1   ? -7.951  75.876  60.400  1.00 43.68 ? 1001 GLY B N     1 
ATOM   2742 C  CA    . GLY B 1 1   ? -7.444  74.982  59.312  1.00 43.99 ? 1001 GLY B CA    1 
ATOM   2743 C  C     . GLY B 1 1   ? -8.516  74.691  58.274  1.00 44.02 ? 1001 GLY B C     1 
ATOM   2744 O  O     . GLY B 1 1   ? -9.606  74.229  58.624  1.00 44.24 ? 1001 GLY B O     1 
ATOM   2745 N  N     . ILE B 1 2   ? -8.217  74.968  57.001  1.00 43.95 ? 1002 ILE B N     1 
ATOM   2746 C  CA    . ILE B 1 2   ? -9.208  74.845  55.923  1.00 43.90 ? 1002 ILE B CA    1 
ATOM   2747 C  C     . ILE B 1 2   ? -8.595  74.354  54.603  1.00 43.93 ? 1002 ILE B C     1 
ATOM   2748 O  O     . ILE B 1 2   ? -7.651  74.950  54.084  1.00 43.87 ? 1002 ILE B O     1 
ATOM   2749 C  CB    . ILE B 1 2   ? -9.947  76.189  55.670  1.00 43.95 ? 1002 ILE B CB    1 
ATOM   2750 C  CG1   . ILE B 1 2   ? -10.730 76.619  56.917  1.00 43.77 ? 1002 ILE B CG1   1 
ATOM   2751 C  CG2   . ILE B 1 2   ? -10.889 76.070  54.468  1.00 43.83 ? 1002 ILE B CG2   1 
ATOM   2752 C  CD1   . ILE B 1 2   ? -11.703 77.755  56.686  1.00 43.83 ? 1002 ILE B CD1   1 
ATOM   2753 N  N     . VAL B 1 3   ? -9.153  73.263  54.077  1.00 43.92 ? 1003 VAL B N     1 
ATOM   2754 C  CA    . VAL B 1 3   ? -8.727  72.677  52.816  1.00 43.87 ? 1003 VAL B CA    1 
ATOM   2755 C  C     . VAL B 1 3   ? -9.849  72.802  51.793  1.00 44.14 ? 1003 VAL B C     1 
ATOM   2756 O  O     . VAL B 1 3   ? -10.995 72.453  52.079  1.00 44.28 ? 1003 VAL B O     1 
ATOM   2757 C  CB    . VAL B 1 3   ? -8.404  71.179  52.969  1.00 43.80 ? 1003 VAL B CB    1 
ATOM   2758 C  CG1   . VAL B 1 3   ? -7.960  70.591  51.640  1.00 43.54 ? 1003 VAL B CG1   1 
ATOM   2759 C  CG2   . VAL B 1 3   ? -7.340  70.962  54.023  1.00 43.75 ? 1003 VAL B CG2   1 
ATOM   2760 N  N     . LEU B 1 4   ? -9.518  73.311  50.609  1.00 44.27 ? 1004 LEU B N     1 
ATOM   2761 C  CA    . LEU B 1 4   ? -10.459 73.382  49.498  1.00 44.25 ? 1004 LEU B CA    1 
ATOM   2762 C  C     . LEU B 1 4   ? -10.022 72.339  48.496  1.00 44.21 ? 1004 LEU B C     1 
ATOM   2763 O  O     . LEU B 1 4   ? -8.843  72.245  48.190  1.00 44.43 ? 1004 LEU B O     1 
ATOM   2764 C  CB    . LEU B 1 4   ? -10.448 74.777  48.864  1.00 44.32 ? 1004 LEU B CB    1 
ATOM   2765 C  CG    . LEU B 1 4   ? -11.408 75.021  47.689  1.00 44.50 ? 1004 LEU B CG    1 
ATOM   2766 C  CD1   . LEU B 1 4   ? -11.631 76.510  47.460  1.00 44.11 ? 1004 LEU B CD1   1 
ATOM   2767 C  CD2   . LEU B 1 4   ? -10.905 74.350  46.409  1.00 44.89 ? 1004 LEU B CD2   1 
ATOM   2768 N  N     . PHE B 1 5   ? -10.967 71.560  47.987  1.00 44.22 ? 1005 PHE B N     1 
ATOM   2769 C  CA    . PHE B 1 5   ? -10.650 70.450  47.106  1.00 44.26 ? 1005 PHE B CA    1 
ATOM   2770 C  C     . PHE B 1 5   ? -11.393 70.585  45.789  1.00 44.34 ? 1005 PHE B C     1 
ATOM   2771 O  O     . PHE B 1 5   ? -12.614 70.728  45.780  1.00 44.52 ? 1005 PHE B O     1 
ATOM   2772 C  CB    . PHE B 1 5   ? -11.036 69.141  47.781  1.00 44.46 ? 1005 PHE B CB    1 
ATOM   2773 C  CG    . PHE B 1 5   ? -10.859 67.928  46.908  1.00 44.66 ? 1005 PHE B CG    1 
ATOM   2774 C  CD1   . PHE B 1 5   ? -9.597  67.505  46.539  1.00 44.76 ? 1005 PHE B CD1   1 
ATOM   2775 C  CD2   . PHE B 1 5   ? -11.952 67.205  46.470  1.00 44.99 ? 1005 PHE B CD2   1 
ATOM   2776 C  CE1   . PHE B 1 5   ? -9.426  66.388  45.752  1.00 44.75 ? 1005 PHE B CE1   1 
ATOM   2777 C  CE2   . PHE B 1 5   ? -11.783 66.080  45.679  1.00 45.10 ? 1005 PHE B CE2   1 
ATOM   2778 C  CZ    . PHE B 1 5   ? -10.518 65.675  45.320  1.00 44.78 ? 1005 PHE B CZ    1 
ATOM   2779 N  N     . VAL B 1 6   ? -10.653 70.524  44.682  1.00 44.28 ? 1006 VAL B N     1 
ATOM   2780 C  CA    . VAL B 1 6   ? -11.225 70.683  43.349  1.00 43.89 ? 1006 VAL B CA    1 
ATOM   2781 C  C     . VAL B 1 6   ? -11.186 69.350  42.616  1.00 43.75 ? 1006 VAL B C     1 
ATOM   2782 O  O     . VAL B 1 6   ? -10.154 68.682  42.605  1.00 43.93 ? 1006 VAL B O     1 
ATOM   2783 C  CB    . VAL B 1 6   ? -10.453 71.725  42.512  1.00 43.81 ? 1006 VAL B CB    1 
ATOM   2784 C  CG1   . VAL B 1 6   ? -11.320 72.192  41.354  1.00 43.95 ? 1006 VAL B CG1   1 
ATOM   2785 C  CG2   . VAL B 1 6   ? -10.023 72.916  43.366  1.00 43.84 ? 1006 VAL B CG2   1 
ATOM   2786 N  N     . ASP B 1 7   ? -12.313 68.983  42.005  1.00 43.37 ? 1007 ASP B N     1 
ATOM   2787 C  CA    . ASP B 1 7   ? -12.451 67.739  41.263  1.00 43.12 ? 1007 ASP B CA    1 
ATOM   2788 C  C     . ASP B 1 7   ? -13.342 67.976  40.037  1.00 42.98 ? 1007 ASP B C     1 
ATOM   2789 O  O     . ASP B 1 7   ? -14.507 68.343  40.163  1.00 42.61 ? 1007 ASP B O     1 
ATOM   2790 C  CB    . ASP B 1 7   ? -13.022 66.640  42.170  1.00 43.28 ? 1007 ASP B CB    1 
ATOM   2791 C  CG    . ASP B 1 7   ? -13.148 65.285  41.467  1.00 43.85 ? 1007 ASP B CG    1 
ATOM   2792 O  OD1   . ASP B 1 7   ? -13.649 65.254  40.336  1.00 42.10 ? 1007 ASP B OD1   1 
ATOM   2793 O  OD2   . ASP B 1 7   ? -12.772 64.245  42.051  1.00 46.65 ? 1007 ASP B OD2   1 
ATOM   2794 N  N     . PHE B 1 8   ? -12.788 67.720  38.852  1.00 43.04 ? 1008 PHE B N     1 
ATOM   2795 C  CA    . PHE B 1 8   ? -13.421 68.129  37.605  1.00 42.85 ? 1008 PHE B CA    1 
ATOM   2796 C  C     . PHE B 1 8   ? -14.504 67.135  37.205  1.00 42.55 ? 1008 PHE B C     1 
ATOM   2797 O  O     . PHE B 1 8   ? -14.367 65.933  37.423  1.00 41.43 ? 1008 PHE B O     1 
ATOM   2798 C  CB    . PHE B 1 8   ? -12.397 68.270  36.477  1.00 43.31 ? 1008 PHE B CB    1 
ATOM   2799 C  CG    . PHE B 1 8   ? -11.115 68.972  36.873  1.00 43.64 ? 1008 PHE B CG    1 
ATOM   2800 C  CD1   . PHE B 1 8   ? -11.079 69.905  37.899  1.00 45.73 ? 1008 PHE B CD1   1 
ATOM   2801 C  CD2   . PHE B 1 8   ? -9.942  68.719  36.175  1.00 44.58 ? 1008 PHE B CD2   1 
ATOM   2802 C  CE1   . PHE B 1 8   ? -9.885  70.551  38.236  1.00 46.01 ? 1008 PHE B CE1   1 
ATOM   2803 C  CE2   . PHE B 1 8   ? -8.758  69.358  36.493  1.00 44.45 ? 1008 PHE B CE2   1 
ATOM   2804 C  CZ    . PHE B 1 8   ? -8.723  70.272  37.522  1.00 45.24 ? 1008 PHE B CZ    1 
ATOM   2805 N  N     . ASP B 1 9   ? -15.573 67.660  36.613  1.00 42.47 ? 1009 ASP B N     1 
ATOM   2806 C  CA    . ASP B 1 9   ? -16.765 66.880  36.308  1.00 42.70 ? 1009 ASP B CA    1 
ATOM   2807 C  C     . ASP B 1 9   ? -16.589 66.025  35.060  1.00 42.58 ? 1009 ASP B C     1 
ATOM   2808 O  O     . ASP B 1 9   ? -16.154 66.528  34.019  1.00 42.45 ? 1009 ASP B O     1 
ATOM   2809 C  CB    . ASP B 1 9   ? -17.963 67.804  36.084  1.00 42.79 ? 1009 ASP B CB    1 
ATOM   2810 C  CG    . ASP B 1 9   ? -18.394 68.524  37.331  1.00 43.69 ? 1009 ASP B CG    1 
ATOM   2811 O  OD1   . ASP B 1 9   ? -17.967 68.153  38.450  1.00 44.76 ? 1009 ASP B OD1   1 
ATOM   2812 O  OD2   . ASP B 1 9   ? -19.192 69.472  37.185  1.00 45.59 ? 1009 ASP B OD2   1 
ATOM   2813 N  N     . TYR B 1 10  ? -16.986 64.753  35.177  1.00 42.49 ? 1010 TYR B N     1 
ATOM   2814 C  CA    . TYR B 1 10  ? -16.889 63.739  34.121  1.00 42.45 ? 1010 TYR B CA    1 
ATOM   2815 C  C     . TYR B 1 10  ? -15.786 64.039  33.113  1.00 42.21 ? 1010 TYR B C     1 
ATOM   2816 O  O     . TYR B 1 10  ? -15.990 64.052  31.902  1.00 42.41 ? 1010 TYR B O     1 
ATOM   2817 C  CB    . TYR B 1 10  ? -18.253 63.489  33.473  1.00 42.84 ? 1010 TYR B CB    1 
ATOM   2818 C  CG    . TYR B 1 10  ? -18.922 64.670  32.798  1.00 43.45 ? 1010 TYR B CG    1 
ATOM   2819 C  CD1   . TYR B 1 10  ? -18.955 64.765  31.399  1.00 44.62 ? 1010 TYR B CD1   1 
ATOM   2820 C  CD2   . TYR B 1 10  ? -19.576 65.657  33.535  1.00 44.20 ? 1010 TYR B CD2   1 
ATOM   2821 C  CE1   . TYR B 1 10  ? -19.586 65.826  30.751  1.00 44.56 ? 1010 TYR B CE1   1 
ATOM   2822 C  CE2   . TYR B 1 10  ? -20.217 66.735  32.894  1.00 45.08 ? 1010 TYR B CE2   1 
ATOM   2823 C  CZ    . TYR B 1 10  ? -20.215 66.808  31.496  1.00 44.89 ? 1010 TYR B CZ    1 
ATOM   2824 O  OH    . TYR B 1 10  ? -20.827 67.853  30.834  1.00 44.87 ? 1010 TYR B OH    1 
ATOM   2825 N  N     . PHE B 1 11  ? -14.589 64.218  33.659  1.00 41.78 ? 1011 PHE B N     1 
ATOM   2826 C  CA    . PHE B 1 11  ? -13.555 65.026  33.033  1.00 41.44 ? 1011 PHE B CA    1 
ATOM   2827 C  C     . PHE B 1 11  ? -13.258 64.720  31.578  1.00 41.23 ? 1011 PHE B C     1 
ATOM   2828 O  O     . PHE B 1 11  ? -13.216 65.631  30.758  1.00 41.78 ? 1011 PHE B O     1 
ATOM   2829 C  CB    . PHE B 1 11  ? -12.256 64.965  33.842  1.00 41.35 ? 1011 PHE B CB    1 
ATOM   2830 C  CG    . PHE B 1 11  ? -11.193 65.879  33.319  1.00 41.13 ? 1011 PHE B CG    1 
ATOM   2831 C  CD1   . PHE B 1 11  ? -11.449 67.241  33.172  1.00 40.53 ? 1011 PHE B CD1   1 
ATOM   2832 C  CD2   . PHE B 1 11  ? -9.949  65.391  32.968  1.00 40.68 ? 1011 PHE B CD2   1 
ATOM   2833 C  CE1   . PHE B 1 11  ? -10.489 68.091  32.690  1.00 40.24 ? 1011 PHE B CE1   1 
ATOM   2834 C  CE2   . PHE B 1 11  ? -8.970  66.247  32.483  1.00 41.24 ? 1011 PHE B CE2   1 
ATOM   2835 C  CZ    . PHE B 1 11  ? -9.242  67.596  32.338  1.00 41.10 ? 1011 PHE B CZ    1 
ATOM   2836 N  N     . TYR B 1 12  ? -13.029 63.455  31.258  1.00 40.78 ? 1012 TYR B N     1 
ATOM   2837 C  CA    . TYR B 1 12  ? -12.604 63.103  29.917  1.00 40.46 ? 1012 TYR B CA    1 
ATOM   2838 C  C     . TYR B 1 12  ? -13.747 63.350  28.961  1.00 40.43 ? 1012 TYR B C     1 
ATOM   2839 O  O     . TYR B 1 12  ? -13.558 63.929  27.904  1.00 40.98 ? 1012 TYR B O     1 
ATOM   2840 C  CB    . TYR B 1 12  ? -12.189 61.643  29.842  1.00 40.58 ? 1012 TYR B CB    1 
ATOM   2841 C  CG    . TYR B 1 12  ? -10.884 61.283  30.518  1.00 40.22 ? 1012 TYR B CG    1 
ATOM   2842 C  CD1   . TYR B 1 12  ? -10.153 62.206  31.269  1.00 39.92 ? 1012 TYR B CD1   1 
ATOM   2843 C  CD2   . TYR B 1 12  ? -10.401 59.987  30.427  1.00 39.81 ? 1012 TYR B CD2   1 
ATOM   2844 C  CE1   . TYR B 1 12  ? -8.953  61.832  31.887  1.00 40.59 ? 1012 TYR B CE1   1 
ATOM   2845 C  CE2   . TYR B 1 12  ? -9.233  59.612  31.036  1.00 40.42 ? 1012 TYR B CE2   1 
ATOM   2846 C  CZ    . TYR B 1 12  ? -8.508  60.525  31.760  1.00 40.11 ? 1012 TYR B CZ    1 
ATOM   2847 O  OH    . TYR B 1 12  ? -7.348  60.101  32.342  1.00 39.48 ? 1012 TYR B OH    1 
ATOM   2848 N  N     . ALA B 1 13  ? -14.944 62.923  29.336  1.00 40.24 ? 1013 ALA B N     1 
ATOM   2849 C  CA    . ALA B 1 13  ? -16.118 63.195  28.518  1.00 39.78 ? 1013 ALA B CA    1 
ATOM   2850 C  C     . ALA B 1 13  ? -16.377 64.694  28.440  1.00 39.47 ? 1013 ALA B C     1 
ATOM   2851 O  O     . ALA B 1 13  ? -16.619 65.216  27.363  1.00 39.21 ? 1013 ALA B O     1 
ATOM   2852 C  CB    . ALA B 1 13  ? -17.310 62.477  29.053  1.00 39.55 ? 1013 ALA B CB    1 
ATOM   2853 N  N     . GLN B 1 14  ? -16.303 65.400  29.559  1.00 39.37 ? 1014 GLN B N     1 
ATOM   2854 C  CA    . GLN B 1 14  ? -16.499 66.847  29.489  1.00 39.74 ? 1014 GLN B CA    1 
ATOM   2855 C  C     . GLN B 1 14  ? -15.542 67.508  28.479  1.00 40.05 ? 1014 GLN B C     1 
ATOM   2856 O  O     . GLN B 1 14  ? -15.960 68.385  27.726  1.00 39.99 ? 1014 GLN B O     1 
ATOM   2857 C  CB    . GLN B 1 14  ? -16.386 67.540  30.856  1.00 39.79 ? 1014 GLN B CB    1 
ATOM   2858 C  CG    . GLN B 1 14  ? -17.207 68.842  30.890  1.00 39.45 ? 1014 GLN B CG    1 
ATOM   2859 C  CD    . GLN B 1 14  ? -16.899 69.788  32.049  1.00 39.36 ? 1014 GLN B CD    1 
ATOM   2860 O  OE1   . GLN B 1 14  ? -16.402 69.404  33.107  1.00 37.52 ? 1014 GLN B OE1   1 
ATOM   2861 N  NE2   . GLN B 1 14  ? -17.219 71.047  31.840  1.00 40.00 ? 1014 GLN B NE2   1 
ATOM   2862 N  N     . VAL B 1 15  ? -14.275 67.094  28.444  1.00 40.04 ? 1015 VAL B N     1 
ATOM   2863 C  CA    . VAL B 1 15  ? -13.326 67.737  27.534  1.00 40.13 ? 1015 VAL B CA    1 
ATOM   2864 C  C     . VAL B 1 15  ? -13.731 67.481  26.078  1.00 40.43 ? 1015 VAL B C     1 
ATOM   2865 O  O     . VAL B 1 15  ? -13.737 68.402  25.258  1.00 40.50 ? 1015 VAL B O     1 
ATOM   2866 C  CB    . VAL B 1 15  ? -11.874 67.276  27.768  1.00 39.98 ? 1015 VAL B CB    1 
ATOM   2867 C  CG1   . VAL B 1 15  ? -10.944 67.838  26.676  1.00 39.10 ? 1015 VAL B CG1   1 
ATOM   2868 C  CG2   . VAL B 1 15  ? -11.412 67.700  29.140  1.00 39.55 ? 1015 VAL B CG2   1 
ATOM   2869 N  N     . GLU B 1 16  ? -14.086 66.234  25.778  1.00 40.49 ? 1016 GLU B N     1 
ATOM   2870 C  CA    . GLU B 1 16  ? -14.579 65.865  24.460  1.00 40.77 ? 1016 GLU B CA    1 
ATOM   2871 C  C     . GLU B 1 16  ? -15.796 66.708  24.055  1.00 40.99 ? 1016 GLU B C     1 
ATOM   2872 O  O     . GLU B 1 16  ? -15.873 67.151  22.924  1.00 41.18 ? 1016 GLU B O     1 
ATOM   2873 C  CB    . GLU B 1 16  ? -14.917 64.373  24.412  1.00 40.96 ? 1016 GLU B CB    1 
ATOM   2874 C  CG    . GLU B 1 16  ? -13.716 63.429  24.560  1.00 41.59 ? 1016 GLU B CG    1 
ATOM   2875 C  CD    . GLU B 1 16  ? -12.789 63.423  23.347  1.00 43.95 ? 1016 GLU B CD    1 
ATOM   2876 O  OE1   . GLU B 1 16  ? -13.235 63.816  22.240  1.00 45.41 ? 1016 GLU B OE1   1 
ATOM   2877 O  OE2   . GLU B 1 16  ? -11.606 63.019  23.503  1.00 44.20 ? 1016 GLU B OE2   1 
ATOM   2878 N  N     . GLU B 1 17  ? -16.734 66.940  24.972  1.00 41.65 ? 1017 GLU B N     1 
ATOM   2879 C  CA    . GLU B 1 17  ? -17.857 67.862  24.722  1.00 42.18 ? 1017 GLU B CA    1 
ATOM   2880 C  C     . GLU B 1 17  ? -17.389 69.295  24.444  1.00 42.32 ? 1017 GLU B C     1 
ATOM   2881 O  O     . GLU B 1 17  ? -17.986 69.974  23.630  1.00 42.71 ? 1017 GLU B O     1 
ATOM   2882 C  CB    . GLU B 1 17  ? -18.837 67.893  25.903  1.00 42.21 ? 1017 GLU B CB    1 
ATOM   2883 C  CG    . GLU B 1 17  ? -19.585 66.586  26.171  1.00 43.07 ? 1017 GLU B CG    1 
ATOM   2884 C  CD    . GLU B 1 17  ? -20.568 66.665  27.364  1.00 43.27 ? 1017 GLU B CD    1 
ATOM   2885 O  OE1   . GLU B 1 17  ? -20.580 67.671  28.124  1.00 43.78 ? 1017 GLU B OE1   1 
ATOM   2886 O  OE2   . GLU B 1 17  ? -21.340 65.699  27.535  1.00 44.51 ? 1017 GLU B OE2   1 
ATOM   2887 N  N     . VAL B 1 18  ? -16.347 69.761  25.133  1.00 42.64 ? 1018 VAL B N     1 
ATOM   2888 C  CA    . VAL B 1 18  ? -15.796 71.100  24.891  1.00 42.92 ? 1018 VAL B CA    1 
ATOM   2889 C  C     . VAL B 1 18  ? -15.094 71.145  23.540  1.00 43.13 ? 1018 VAL B C     1 
ATOM   2890 O  O     . VAL B 1 18  ? -15.133 72.166  22.847  1.00 43.23 ? 1018 VAL B O     1 
ATOM   2891 C  CB    . VAL B 1 18  ? -14.794 71.545  26.008  1.00 43.34 ? 1018 VAL B CB    1 
ATOM   2892 C  CG1   . VAL B 1 18  ? -14.005 72.811  25.591  1.00 42.66 ? 1018 VAL B CG1   1 
ATOM   2893 C  CG2   . VAL B 1 18  ? -15.523 71.771  27.342  1.00 43.15 ? 1018 VAL B CG2   1 
ATOM   2894 N  N     . LEU B 1 19  ? -14.454 70.038  23.169  1.00 43.32 ? 1019 LEU B N     1 
ATOM   2895 C  CA    . LEU B 1 19  ? -13.775 69.940  21.875  1.00 43.32 ? 1019 LEU B CA    1 
ATOM   2896 C  C     . LEU B 1 19  ? -14.743 69.771  20.713  1.00 43.78 ? 1019 LEU B C     1 
ATOM   2897 O  O     . LEU B 1 19  ? -14.395 70.100  19.584  1.00 43.64 ? 1019 LEU B O     1 
ATOM   2898 C  CB    . LEU B 1 19  ? -12.737 68.820  21.895  1.00 43.10 ? 1019 LEU B CB    1 
ATOM   2899 C  CG    . LEU B 1 19  ? -11.315 69.271  22.264  1.00 43.07 ? 1019 LEU B CG    1 
ATOM   2900 C  CD1   . LEU B 1 19  ? -11.280 70.573  23.053  1.00 41.34 ? 1019 LEU B CD1   1 
ATOM   2901 C  CD2   . LEU B 1 19  ? -10.571 68.169  23.012  1.00 43.29 ? 1019 LEU B CD2   1 
ATOM   2902 N  N     . ASN B 1 20  ? -15.947 69.267  20.988  1.00 44.50 ? 1020 ASN B N     1 
ATOM   2903 C  CA    . ASN B 1 20  ? -16.996 69.156  19.976  1.00 45.19 ? 1020 ASN B CA    1 
ATOM   2904 C  C     . ASN B 1 20  ? -18.381 69.397  20.577  1.00 45.98 ? 1020 ASN B C     1 
ATOM   2905 O  O     . ASN B 1 20  ? -19.000 68.469  21.090  1.00 46.29 ? 1020 ASN B O     1 
ATOM   2906 C  CB    . ASN B 1 20  ? -16.951 67.785  19.314  1.00 45.20 ? 1020 ASN B CB    1 
ATOM   2907 C  CG    . ASN B 1 20  ? -17.876 67.701  18.136  1.00 45.57 ? 1020 ASN B CG    1 
ATOM   2908 O  OD1   . ASN B 1 20  ? -19.085 67.701  18.298  1.00 45.71 ? 1020 ASN B OD1   1 
ATOM   2909 N  ND2   . ASN B 1 20  ? -17.314 67.683  16.933  1.00 47.47 ? 1020 ASN B ND2   1 
ATOM   2910 N  N     . PRO B 1 21  ? -18.881 70.645  20.523  1.00 46.77 ? 1021 PRO B N     1 
ATOM   2911 C  CA    . PRO B 1 21  ? -20.118 70.978  21.247  1.00 47.18 ? 1021 PRO B CA    1 
ATOM   2912 C  C     . PRO B 1 21  ? -21.382 70.238  20.787  1.00 47.73 ? 1021 PRO B C     1 
ATOM   2913 O  O     . PRO B 1 21  ? -22.346 70.142  21.555  1.00 48.01 ? 1021 PRO B O     1 
ATOM   2914 C  CB    . PRO B 1 21  ? -20.270 72.486  21.011  1.00 47.21 ? 1021 PRO B CB    1 
ATOM   2915 C  CG    . PRO B 1 21  ? -18.919 72.953  20.585  1.00 46.94 ? 1021 PRO B CG    1 
ATOM   2916 C  CD    . PRO B 1 21  ? -18.332 71.818  19.823  1.00 46.82 ? 1021 PRO B CD    1 
ATOM   2917 N  N     . SER B 1 22  ? -21.380 69.716  19.561  1.00 48.13 ? 1022 SER B N     1 
ATOM   2918 C  CA    . SER B 1 22  ? -22.520 68.941  19.060  1.00 48.45 ? 1022 SER B CA    1 
ATOM   2919 C  C     . SER B 1 22  ? -22.779 67.684  19.887  1.00 48.73 ? 1022 SER B C     1 
ATOM   2920 O  O     . SER B 1 22  ? -23.905 67.200  19.942  1.00 49.47 ? 1022 SER B O     1 
ATOM   2921 C  CB    . SER B 1 22  ? -22.332 68.567  17.589  1.00 48.39 ? 1022 SER B CB    1 
ATOM   2922 O  OG    . SER B 1 22  ? -21.050 68.034  17.360  1.00 48.37 ? 1022 SER B OG    1 
ATOM   2923 N  N     . LEU B 1 23  ? -21.746 67.166  20.535  1.00 48.73 ? 1023 LEU B N     1 
ATOM   2924 C  CA    . LEU B 1 23  ? -21.910 66.043  21.453  1.00 48.86 ? 1023 LEU B CA    1 
ATOM   2925 C  C     . LEU B 1 23  ? -22.748 66.368  22.706  1.00 48.97 ? 1023 LEU B C     1 
ATOM   2926 O  O     . LEU B 1 23  ? -23.325 65.463  23.306  1.00 48.92 ? 1023 LEU B O     1 
ATOM   2927 C  CB    . LEU B 1 23  ? -20.535 65.502  21.875  1.00 48.80 ? 1023 LEU B CB    1 
ATOM   2928 C  CG    . LEU B 1 23  ? -19.942 64.293  21.139  1.00 48.99 ? 1023 LEU B CG    1 
ATOM   2929 C  CD1   . LEU B 1 23  ? -20.383 64.178  19.680  1.00 48.78 ? 1023 LEU B CD1   1 
ATOM   2930 C  CD2   . LEU B 1 23  ? -18.418 64.338  21.266  1.00 48.63 ? 1023 LEU B CD2   1 
ATOM   2931 N  N     . LYS B 1 24  ? -22.816 67.636  23.108  1.00 49.30 ? 1024 LYS B N     1 
ATOM   2932 C  CA    . LYS B 1 24  ? -23.482 67.990  24.383  1.00 49.75 ? 1024 LYS B CA    1 
ATOM   2933 C  C     . LYS B 1 24  ? -24.999 67.794  24.322  1.00 49.26 ? 1024 LYS B C     1 
ATOM   2934 O  O     . LYS B 1 24  ? -25.649 68.180  23.350  1.00 49.04 ? 1024 LYS B O     1 
ATOM   2935 C  CB    . LYS B 1 24  ? -23.169 69.434  24.806  1.00 49.96 ? 1024 LYS B CB    1 
ATOM   2936 C  CG    . LYS B 1 24  ? -23.651 69.778  26.220  1.00 50.21 ? 1024 LYS B CG    1 
ATOM   2937 C  CD    . LYS B 1 24  ? -23.104 71.125  26.698  1.00 50.47 ? 1024 LYS B CD    1 
ATOM   2938 C  CE    . LYS B 1 24  ? -23.393 71.358  28.189  1.00 51.03 ? 1024 LYS B CE    1 
ATOM   2939 N  NZ    . LYS B 1 24  ? -22.575 70.462  29.080  1.00 51.58 ? 1024 LYS B NZ    1 
ATOM   2940 N  N     . GLY B 1 25  ? -25.545 67.196  25.375  1.00 48.91 ? 1025 GLY B N     1 
ATOM   2941 C  CA    . GLY B 1 25  ? -26.961 66.849  25.419  1.00 48.78 ? 1025 GLY B CA    1 
ATOM   2942 C  C     . GLY B 1 25  ? -27.214 65.398  25.051  1.00 48.53 ? 1025 GLY B C     1 
ATOM   2943 O  O     . GLY B 1 25  ? -28.287 64.859  25.321  1.00 48.73 ? 1025 GLY B O     1 
ATOM   2944 N  N     . LYS B 1 26  ? -26.222 64.770  24.431  1.00 48.13 ? 1026 LYS B N     1 
ATOM   2945 C  CA    . LYS B 1 26  ? -26.284 63.368  24.054  1.00 47.83 ? 1026 LYS B CA    1 
ATOM   2946 C  C     . LYS B 1 26  ? -25.367 62.613  24.995  1.00 46.90 ? 1026 LYS B C     1 
ATOM   2947 O  O     . LYS B 1 26  ? -24.492 63.215  25.603  1.00 47.10 ? 1026 LYS B O     1 
ATOM   2948 C  CB    . LYS B 1 26  ? -25.785 63.182  22.613  1.00 48.17 ? 1026 LYS B CB    1 
ATOM   2949 C  CG    . LYS B 1 26  ? -26.508 64.041  21.564  1.00 48.60 ? 1026 LYS B CG    1 
ATOM   2950 C  CD    . LYS B 1 26  ? -25.636 64.281  20.325  1.00 48.56 ? 1026 LYS B CD    1 
ATOM   2951 C  CE    . LYS B 1 26  ? -26.386 65.138  19.294  1.00 49.41 ? 1026 LYS B CE    1 
ATOM   2952 N  NZ    . LYS B 1 26  ? -25.700 65.190  17.965  1.00 49.50 ? 1026 LYS B NZ    1 
ATOM   2953 N  N     . PRO B 1 27  ? -25.561 61.295  25.122  1.00 45.87 ? 1027 PRO B N     1 
ATOM   2954 C  CA    . PRO B 1 27  ? -24.624 60.473  25.888  1.00 45.23 ? 1027 PRO B CA    1 
ATOM   2955 C  C     . PRO B 1 27  ? -23.274 60.239  25.201  1.00 44.35 ? 1027 PRO B C     1 
ATOM   2956 O  O     . PRO B 1 27  ? -23.231 59.772  24.072  1.00 44.31 ? 1027 PRO B O     1 
ATOM   2957 C  CB    . PRO B 1 27  ? -25.378 59.149  26.057  1.00 45.42 ? 1027 PRO B CB    1 
ATOM   2958 C  CG    . PRO B 1 27  ? -26.351 59.103  24.948  1.00 45.45 ? 1027 PRO B CG    1 
ATOM   2959 C  CD    . PRO B 1 27  ? -26.694 60.512  24.598  1.00 45.71 ? 1027 PRO B CD    1 
ATOM   2960 N  N     . VAL B 1 28  ? -22.195 60.548  25.917  1.00 43.59 ? 1028 VAL B N     1 
ATOM   2961 C  CA    . VAL B 1 28  ? -20.819 60.350  25.474  1.00 42.98 ? 1028 VAL B CA    1 
ATOM   2962 C  C     . VAL B 1 28  ? -20.088 59.360  26.386  1.00 42.56 ? 1028 VAL B C     1 
ATOM   2963 O  O     . VAL B 1 28  ? -20.140 59.481  27.601  1.00 41.97 ? 1028 VAL B O     1 
ATOM   2964 C  CB    . VAL B 1 28  ? -20.029 61.670  25.523  1.00 42.96 ? 1028 VAL B CB    1 
ATOM   2965 C  CG1   . VAL B 1 28  ? -18.616 61.477  24.964  1.00 42.46 ? 1028 VAL B CG1   1 
ATOM   2966 C  CG2   . VAL B 1 28  ? -20.763 62.741  24.762  1.00 42.99 ? 1028 VAL B CG2   1 
ATOM   2967 N  N     . VAL B 1 29  ? -19.381 58.407  25.787  1.00 42.38 ? 1029 VAL B N     1 
ATOM   2968 C  CA    . VAL B 1 29  ? -18.658 57.378  26.533  1.00 42.41 ? 1029 VAL B CA    1 
ATOM   2969 C  C     . VAL B 1 29  ? -17.200 57.289  26.053  1.00 42.59 ? 1029 VAL B C     1 
ATOM   2970 O  O     . VAL B 1 29  ? -16.935 56.897  24.915  1.00 42.74 ? 1029 VAL B O     1 
ATOM   2971 C  CB    . VAL B 1 29  ? -19.341 55.994  26.367  1.00 42.35 ? 1029 VAL B CB    1 
ATOM   2972 C  CG1   . VAL B 1 29  ? -18.676 54.955  27.263  1.00 42.14 ? 1029 VAL B CG1   1 
ATOM   2973 C  CG2   . VAL B 1 29  ? -20.839 56.090  26.661  1.00 41.37 ? 1029 VAL B CG2   1 
ATOM   2974 N  N     . VAL B 1 30  ? -16.257 57.649  26.920  1.00 42.48 ? 1030 VAL B N     1 
ATOM   2975 C  CA    . VAL B 1 30  ? -14.841 57.576  26.580  1.00 42.38 ? 1030 VAL B CA    1 
ATOM   2976 C  C     . VAL B 1 30  ? -14.233 56.225  26.997  1.00 42.84 ? 1030 VAL B C     1 
ATOM   2977 O  O     . VAL B 1 30  ? -14.356 55.815  28.143  1.00 42.69 ? 1030 VAL B O     1 
ATOM   2978 C  CB    . VAL B 1 30  ? -14.081 58.721  27.226  1.00 42.36 ? 1030 VAL B CB    1 
ATOM   2979 C  CG1   . VAL B 1 30  ? -12.607 58.655  26.841  1.00 41.79 ? 1030 VAL B CG1   1 
ATOM   2980 C  CG2   . VAL B 1 30  ? -14.711 60.044  26.823  1.00 40.90 ? 1030 VAL B CG2   1 
ATOM   2981 N  N     . CYS B 1 31  ? -13.554 55.569  26.055  1.00 43.52 ? 1031 CYS B N     1 
ATOM   2982 C  CA    . CYS B 1 31  ? -13.210 54.143  26.136  1.00 44.09 ? 1031 CYS B CA    1 
ATOM   2983 C  C     . CYS B 1 31  ? -11.720 53.838  26.085  1.00 44.16 ? 1031 CYS B C     1 
ATOM   2984 O  O     . CYS B 1 31  ? -10.960 54.522  25.407  1.00 44.51 ? 1031 CYS B O     1 
ATOM   2985 C  CB    . CYS B 1 31  ? -13.824 53.412  24.947  1.00 44.13 ? 1031 CYS B CB    1 
ATOM   2986 S  SG    . CYS B 1 31  ? -15.593 53.531  24.860  1.00 46.61 ? 1031 CYS B SG    1 
ATOM   2987 N  N     . VAL B 1 32  ? -11.321 52.771  26.770  1.00 44.25 ? 1032 VAL B N     1 
ATOM   2988 C  CA    . VAL B 1 32  ? -9.984  52.234  26.635  1.00 44.31 ? 1032 VAL B CA    1 
ATOM   2989 C  C     . VAL B 1 32  ? -10.150 50.988  25.789  1.00 45.03 ? 1032 VAL B C     1 
ATOM   2990 O  O     . VAL B 1 32  ? -10.776 50.024  26.218  1.00 44.94 ? 1032 VAL B O     1 
ATOM   2991 C  CB    . VAL B 1 32  ? -9.358  51.885  27.997  1.00 44.37 ? 1032 VAL B CB    1 
ATOM   2992 C  CG1   . VAL B 1 32  ? -7.877  51.580  27.844  1.00 42.96 ? 1032 VAL B CG1   1 
ATOM   2993 C  CG2   . VAL B 1 32  ? -9.583  53.017  28.996  1.00 43.85 ? 1032 VAL B CG2   1 
ATOM   2994 N  N     . PHE B 1 33  ? -9.631  51.024  24.564  1.00 45.63 ? 1033 PHE B N     1 
ATOM   2995 C  CA    . PHE B 1 33  ? -9.765  49.902  23.673  1.00 46.12 ? 1033 PHE B CA    1 
ATOM   2996 C  C     . PHE B 1 33  ? -8.534  49.049  23.862  1.00 47.37 ? 1033 PHE B C     1 
ATOM   2997 O  O     . PHE B 1 33  ? -7.412  49.546  23.759  1.00 47.23 ? 1033 PHE B O     1 
ATOM   2998 C  CB    . PHE B 1 33  ? -9.913  50.373  22.243  1.00 45.85 ? 1033 PHE B CB    1 
ATOM   2999 C  CG    . PHE B 1 33  ? -11.208 51.061  21.977  1.00 44.96 ? 1033 PHE B CG    1 
ATOM   3000 C  CD1   . PHE B 1 33  ? -12.381 50.334  21.895  1.00 44.52 ? 1033 PHE B CD1   1 
ATOM   3001 C  CD2   . PHE B 1 33  ? -11.258 52.435  21.795  1.00 45.00 ? 1033 PHE B CD2   1 
ATOM   3002 C  CE1   . PHE B 1 33  ? -13.588 50.964  21.650  1.00 44.96 ? 1033 PHE B CE1   1 
ATOM   3003 C  CE2   . PHE B 1 33  ? -12.463 53.078  21.541  1.00 44.81 ? 1033 PHE B CE2   1 
ATOM   3004 C  CZ    . PHE B 1 33  ? -13.628 52.345  21.475  1.00 45.14 ? 1033 PHE B CZ    1 
ATOM   3005 N  N     . SER B 1 34  ? -8.759  47.767  24.164  1.00 48.74 ? 1034 SER B N     1 
ATOM   3006 C  CA    . SER B 1 34  ? -7.712  46.889  24.679  1.00 49.62 ? 1034 SER B CA    1 
ATOM   3007 C  C     . SER B 1 34  ? -6.914  46.230  23.561  1.00 50.90 ? 1034 SER B C     1 
ATOM   3008 O  O     . SER B 1 34  ? -5.686  46.178  23.637  1.00 51.29 ? 1034 SER B O     1 
ATOM   3009 C  CB    . SER B 1 34  ? -8.306  45.829  25.624  1.00 49.64 ? 1034 SER B CB    1 
ATOM   3010 O  OG    . SER B 1 34  ? -8.976  44.787  24.935  1.00 48.86 ? 1034 SER B OG    1 
ATOM   3011 N  N     . GLY B 1 35  ? -7.605  45.724  22.537  1.00 52.09 ? 1035 GLY B N     1 
ATOM   3012 C  CA    . GLY B 1 35  ? -6.946  45.103  21.385  1.00 52.94 ? 1035 GLY B CA    1 
ATOM   3013 C  C     . GLY B 1 35  ? -7.544  43.776  20.948  1.00 53.82 ? 1035 GLY B C     1 
ATOM   3014 O  O     . GLY B 1 35  ? -7.771  43.567  19.760  1.00 53.84 ? 1035 GLY B O     1 
ATOM   3015 N  N     . ARG B 1 36  ? -7.786  42.878  21.901  1.00 55.01 ? 1036 ARG B N     1 
ATOM   3016 C  CA    . ARG B 1 36  ? -8.312  41.527  21.611  1.00 56.12 ? 1036 ARG B CA    1 
ATOM   3017 C  C     . ARG B 1 36  ? -9.203  41.505  20.375  1.00 56.80 ? 1036 ARG B C     1 
ATOM   3018 O  O     . ARG B 1 36  ? -8.872  40.868  19.379  1.00 56.88 ? 1036 ARG B O     1 
ATOM   3019 C  CB    . ARG B 1 36  ? -9.106  40.978  22.807  1.00 56.30 ? 1036 ARG B CB    1 
ATOM   3020 C  CG    . ARG B 1 36  ? -8.261  40.542  23.995  1.00 56.81 ? 1036 ARG B CG    1 
ATOM   3021 C  CD    . ARG B 1 36  ? -8.207  39.024  24.149  1.00 57.51 ? 1036 ARG B CD    1 
ATOM   3022 N  NE    . ARG B 1 36  ? -7.096  38.620  25.009  1.00 57.81 ? 1036 ARG B NE    1 
ATOM   3023 C  CZ    . ARG B 1 36  ? -6.951  37.420  25.562  1.00 58.00 ? 1036 ARG B CZ    1 
ATOM   3024 N  NH1   . ARG B 1 36  ? -7.857  36.464  25.374  1.00 58.37 ? 1036 ARG B NH1   1 
ATOM   3025 N  NH2   . ARG B 1 36  ? -5.885  37.180  26.316  1.00 58.30 ? 1036 ARG B NH2   1 
ATOM   3026 N  N     . PHE B 1 37  ? -10.331 42.209  20.464  1.00 57.65 ? 1037 PHE B N     1 
ATOM   3027 C  CA    . PHE B 1 37  ? -11.252 42.395  19.345  1.00 58.35 ? 1037 PHE B CA    1 
ATOM   3028 C  C     . PHE B 1 37  ? -11.679 43.858  19.244  1.00 58.87 ? 1037 PHE B C     1 
ATOM   3029 O  O     . PHE B 1 37  ? -11.399 44.672  20.137  1.00 59.06 ? 1037 PHE B O     1 
ATOM   3030 C  CB    . PHE B 1 37  ? -12.483 41.473  19.455  1.00 58.58 ? 1037 PHE B CB    1 
ATOM   3031 C  CG    . PHE B 1 37  ? -12.953 41.223  20.867  1.00 59.15 ? 1037 PHE B CG    1 
ATOM   3032 C  CD1   . PHE B 1 37  ? -13.987 41.974  21.418  1.00 59.83 ? 1037 PHE B CD1   1 
ATOM   3033 C  CD2   . PHE B 1 37  ? -12.381 40.212  21.640  1.00 59.40 ? 1037 PHE B CD2   1 
ATOM   3034 C  CE1   . PHE B 1 37  ? -14.431 41.731  22.730  1.00 59.44 ? 1037 PHE B CE1   1 
ATOM   3035 C  CE2   . PHE B 1 37  ? -12.815 39.968  22.949  1.00 59.08 ? 1037 PHE B CE2   1 
ATOM   3036 C  CZ    . PHE B 1 37  ? -13.838 40.729  23.491  1.00 58.97 ? 1037 PHE B CZ    1 
ATOM   3037 N  N     . GLU B 1 38  ? -12.324 44.200  18.131  1.00 59.32 ? 1038 GLU B N     1 
ATOM   3038 C  CA    . GLU B 1 38  ? -12.936 45.520  17.989  1.00 59.45 ? 1038 GLU B CA    1 
ATOM   3039 C  C     . GLU B 1 38  ? -13.992 45.555  19.099  1.00 58.88 ? 1038 GLU B C     1 
ATOM   3040 O  O     . GLU B 1 38  ? -14.834 44.656  19.164  1.00 59.20 ? 1038 GLU B O     1 
ATOM   3041 C  CB    . GLU B 1 38  ? -13.571 45.700  16.586  1.00 59.79 ? 1038 GLU B CB    1 
ATOM   3042 C  CG    . GLU B 1 38  ? -13.146 46.989  15.819  1.00 61.01 ? 1038 GLU B CG    1 
ATOM   3043 C  CD    . GLU B 1 38  ? -12.030 46.748  14.777  1.00 62.37 ? 1038 GLU B CD    1 
ATOM   3044 O  OE1   . GLU B 1 38  ? -12.149 45.788  13.975  1.00 62.92 ? 1038 GLU B OE1   1 
ATOM   3045 O  OE2   . GLU B 1 38  ? -11.045 47.526  14.748  1.00 61.99 ? 1038 GLU B OE2   1 
ATOM   3046 N  N     . ASP B 1 39  ? -13.899 46.545  19.987  1.00 57.98 ? 1039 ASP B N     1 
ATOM   3047 C  CA    . ASP B 1 39  ? -14.789 46.714  21.165  1.00 57.29 ? 1039 ASP B CA    1 
ATOM   3048 C  C     . ASP B 1 39  ? -14.294 46.097  22.473  1.00 56.55 ? 1039 ASP B C     1 
ATOM   3049 O  O     . ASP B 1 39  ? -14.913 46.312  23.513  1.00 56.85 ? 1039 ASP B O     1 
ATOM   3050 C  CB    . ASP B 1 39  ? -16.237 46.262  20.911  1.00 57.19 ? 1039 ASP B CB    1 
ATOM   3051 C  CG    . ASP B 1 39  ? -16.980 47.186  19.969  1.00 57.97 ? 1039 ASP B CG    1 
ATOM   3052 O  OD1   . ASP B 1 39  ? -16.756 48.417  20.038  1.00 58.94 ? 1039 ASP B OD1   1 
ATOM   3053 O  OD2   . ASP B 1 39  ? -17.799 46.684  19.167  1.00 58.77 ? 1039 ASP B OD2   1 
ATOM   3054 N  N     . SER B 1 40  ? -13.195 45.347  22.455  1.00 55.45 ? 1040 SER B N     1 
ATOM   3055 C  CA    . SER B 1 40  ? -12.637 44.834  23.711  1.00 54.43 ? 1040 SER B CA    1 
ATOM   3056 C  C     . SER B 1 40  ? -12.037 45.981  24.532  1.00 53.32 ? 1040 SER B C     1 
ATOM   3057 O  O     . SER B 1 40  ? -11.248 46.783  23.998  1.00 53.16 ? 1040 SER B O     1 
ATOM   3058 C  CB    . SER B 1 40  ? -11.573 43.764  23.457  1.00 54.48 ? 1040 SER B CB    1 
ATOM   3059 O  OG    . SER B 1 40  ? -10.397 44.312  22.881  1.00 55.08 ? 1040 SER B OG    1 
ATOM   3060 N  N     . GLY B 1 41  ? -12.420 46.052  25.812  1.00 51.75 ? 1041 GLY B N     1 
ATOM   3061 C  CA    . GLY B 1 41  ? -11.905 47.069  26.727  1.00 50.78 ? 1041 GLY B CA    1 
ATOM   3062 C  C     . GLY B 1 41  ? -12.892 47.522  27.789  1.00 49.89 ? 1041 GLY B C     1 
ATOM   3063 O  O     . GLY B 1 41  ? -13.829 46.808  28.111  1.00 50.12 ? 1041 GLY B O     1 
ATOM   3064 N  N     . ALA B 1 42  ? -12.690 48.724  28.322  1.00 48.81 ? 1042 ALA B N     1 
ATOM   3065 C  CA    . ALA B 1 42  ? -13.491 49.219  29.433  1.00 48.10 ? 1042 ALA B CA    1 
ATOM   3066 C  C     . ALA B 1 42  ? -13.763 50.705  29.314  1.00 47.43 ? 1042 ALA B C     1 
ATOM   3067 O  O     . ALA B 1 42  ? -12.953 51.436  28.775  1.00 47.37 ? 1042 ALA B O     1 
ATOM   3068 C  CB    . ALA B 1 42  ? -12.782 48.943  30.724  1.00 48.15 ? 1042 ALA B CB    1 
ATOM   3069 N  N     . VAL B 1 43  ? -14.905 51.146  29.840  1.00 46.75 ? 1043 VAL B N     1 
ATOM   3070 C  CA    . VAL B 1 43  ? -15.256 52.561  29.847  1.00 46.00 ? 1043 VAL B CA    1 
ATOM   3071 C  C     . VAL B 1 43  ? -14.301 53.306  30.766  1.00 46.03 ? 1043 VAL B C     1 
ATOM   3072 O  O     . VAL B 1 43  ? -14.046 52.868  31.884  1.00 46.12 ? 1043 VAL B O     1 
ATOM   3073 C  CB    . VAL B 1 43  ? -16.691 52.803  30.360  1.00 45.73 ? 1043 VAL B CB    1 
ATOM   3074 C  CG1   . VAL B 1 43  ? -16.989 54.296  30.436  1.00 44.98 ? 1043 VAL B CG1   1 
ATOM   3075 C  CG2   . VAL B 1 43  ? -17.711 52.095  29.484  1.00 45.24 ? 1043 VAL B CG2   1 
ATOM   3076 N  N     . ALA B 1 44  ? -13.775 54.432  30.300  1.00 45.89 ? 1044 ALA B N     1 
ATOM   3077 C  CA    . ALA B 1 44  ? -12.948 55.294  31.138  1.00 45.65 ? 1044 ALA B CA    1 
ATOM   3078 C  C     . ALA B 1 44  ? -13.852 56.194  31.959  1.00 45.63 ? 1044 ALA B C     1 
ATOM   3079 O  O     . ALA B 1 44  ? -13.656 56.361  33.154  1.00 46.20 ? 1044 ALA B O     1 
ATOM   3080 C  CB    . ALA B 1 44  ? -12.002 56.111  30.288  1.00 45.33 ? 1044 ALA B CB    1 
ATOM   3081 N  N     . THR B 1 45  ? -14.838 56.788  31.308  1.00 45.71 ? 1045 THR B N     1 
ATOM   3082 C  CA    . THR B 1 45  ? -15.869 57.553  32.003  1.00 45.79 ? 1045 THR B CA    1 
ATOM   3083 C  C     . THR B 1 45  ? -16.997 57.852  31.038  1.00 45.43 ? 1045 THR B C     1 
ATOM   3084 O  O     . THR B 1 45  ? -16.860 57.617  29.843  1.00 45.79 ? 1045 THR B O     1 
ATOM   3085 C  CB    . THR B 1 45  ? -15.336 58.886  32.556  1.00 46.00 ? 1045 THR B CB    1 
ATOM   3086 O  OG1   . THR B 1 45  ? -16.229 59.366  33.572  1.00 46.60 ? 1045 THR B OG1   1 
ATOM   3087 C  CG2   . THR B 1 45  ? -15.206 59.928  31.442  1.00 45.94 ? 1045 THR B CG2   1 
ATOM   3088 N  N     . ALA B 1 46  ? -18.105 58.368  31.548  1.00 45.13 ? 1046 ALA B N     1 
ATOM   3089 C  CA    . ALA B 1 46  ? -19.231 58.718  30.690  1.00 45.10 ? 1046 ALA B CA    1 
ATOM   3090 C  C     . ALA B 1 46  ? -19.890 60.031  31.080  1.00 45.29 ? 1046 ALA B C     1 
ATOM   3091 O  O     . ALA B 1 46  ? -19.628 60.603  32.135  1.00 45.02 ? 1046 ALA B O     1 
ATOM   3092 C  CB    . ALA B 1 46  ? -20.265 57.605  30.686  1.00 44.63 ? 1046 ALA B CB    1 
ATOM   3093 N  N     . ASN B 1 47  ? -20.734 60.502  30.176  1.00 45.84 ? 1047 ASN B N     1 
ATOM   3094 C  CA    . ASN B 1 47  ? -21.714 61.531  30.460  1.00 46.08 ? 1047 ASN B CA    1 
ATOM   3095 C  C     . ASN B 1 47  ? -22.603 61.163  31.611  1.00 46.53 ? 1047 ASN B C     1 
ATOM   3096 O  O     . ASN B 1 47  ? -22.858 59.982  31.857  1.00 46.47 ? 1047 ASN B O     1 
ATOM   3097 C  CB    . ASN B 1 47  ? -22.631 61.707  29.251  1.00 45.85 ? 1047 ASN B CB    1 
ATOM   3098 C  CG    . ASN B 1 47  ? -22.226 62.841  28.409  1.00 45.64 ? 1047 ASN B CG    1 
ATOM   3099 O  OD1   . ASN B 1 47  ? -21.209 63.463  28.668  1.00 47.05 ? 1047 ASN B OD1   1 
ATOM   3100 N  ND2   . ASN B 1 47  ? -23.014 63.146  27.401  1.00 45.72 ? 1047 ASN B ND2   1 
ATOM   3101 N  N     . TYR B 1 48  ? -23.124 62.178  32.281  1.00 47.19 ? 1048 TYR B N     1 
ATOM   3102 C  CA    . TYR B 1 48  ? -24.212 61.946  33.218  1.00 48.00 ? 1048 TYR B CA    1 
ATOM   3103 C  C     . TYR B 1 48  ? -25.456 61.466  32.478  1.00 48.01 ? 1048 TYR B C     1 
ATOM   3104 O  O     . TYR B 1 48  ? -26.296 60.801  33.074  1.00 48.21 ? 1048 TYR B O     1 
ATOM   3105 C  CB    . TYR B 1 48  ? -24.477 63.185  34.079  1.00 48.64 ? 1048 TYR B CB    1 
ATOM   3106 C  CG    . TYR B 1 48  ? -23.477 63.271  35.209  1.00 49.61 ? 1048 TYR B CG    1 
ATOM   3107 C  CD1   . TYR B 1 48  ? -22.241 63.890  35.033  1.00 49.98 ? 1048 TYR B CD1   1 
ATOM   3108 C  CD2   . TYR B 1 48  ? -23.742 62.665  36.437  1.00 50.83 ? 1048 TYR B CD2   1 
ATOM   3109 C  CE1   . TYR B 1 48  ? -21.311 63.935  36.061  1.00 50.61 ? 1048 TYR B CE1   1 
ATOM   3110 C  CE2   . TYR B 1 48  ? -22.819 62.705  37.476  1.00 51.26 ? 1048 TYR B CE2   1 
ATOM   3111 C  CZ    . TYR B 1 48  ? -21.604 63.345  37.286  1.00 50.95 ? 1048 TYR B CZ    1 
ATOM   3112 O  OH    . TYR B 1 48  ? -20.690 63.389  38.327  1.00 50.54 ? 1048 TYR B OH    1 
ATOM   3113 N  N     . GLU B 1 49  ? -25.551 61.774  31.183  1.00 47.97 ? 1049 GLU B N     1 
ATOM   3114 C  CA    . GLU B 1 49  ? -26.580 61.192  30.316  1.00 48.23 ? 1049 GLU B CA    1 
ATOM   3115 C  C     . GLU B 1 49  ? -26.384 59.698  30.119  1.00 47.94 ? 1049 GLU B C     1 
ATOM   3116 O  O     . GLU B 1 49  ? -27.339 58.988  29.843  1.00 48.57 ? 1049 GLU B O     1 
ATOM   3117 C  CB    . GLU B 1 49  ? -26.614 61.857  28.937  1.00 48.39 ? 1049 GLU B CB    1 
ATOM   3118 C  CG    . GLU B 1 49  ? -27.252 63.235  28.912  1.00 50.20 ? 1049 GLU B CG    1 
ATOM   3119 C  CD    . GLU B 1 49  ? -26.448 64.267  29.694  1.00 52.80 ? 1049 GLU B CD    1 
ATOM   3120 O  OE1   . GLU B 1 49  ? -25.190 64.173  29.689  1.00 52.42 ? 1049 GLU B OE1   1 
ATOM   3121 O  OE2   . GLU B 1 49  ? -27.082 65.161  30.323  1.00 54.65 ? 1049 GLU B OE2   1 
ATOM   3122 N  N     . ALA B 1 50  ? -25.153 59.220  30.221  1.00 47.55 ? 1050 ALA B N     1 
ATOM   3123 C  CA    . ALA B 1 50  ? -24.884 57.803  30.046  1.00 47.17 ? 1050 ALA B CA    1 
ATOM   3124 C  C     . ALA B 1 50  ? -25.006 57.096  31.380  1.00 46.81 ? 1050 ALA B C     1 
ATOM   3125 O  O     . ALA B 1 50  ? -25.490 55.968  31.445  1.00 46.78 ? 1050 ALA B O     1 
ATOM   3126 C  CB    . ALA B 1 50  ? -23.503 57.587  29.439  1.00 47.15 ? 1050 ALA B CB    1 
ATOM   3127 N  N     . ARG B 1 51  ? -24.572 57.764  32.445  1.00 46.45 ? 1051 ARG B N     1 
ATOM   3128 C  CA    . ARG B 1 51  ? -24.641 57.193  33.797  1.00 46.38 ? 1051 ARG B CA    1 
ATOM   3129 C  C     . ARG B 1 51  ? -26.059 56.987  34.276  1.00 46.17 ? 1051 ARG B C     1 
ATOM   3130 O  O     . ARG B 1 51  ? -26.349 56.001  34.948  1.00 46.11 ? 1051 ARG B O     1 
ATOM   3131 C  CB    . ARG B 1 51  ? -23.890 58.061  34.802  1.00 46.43 ? 1051 ARG B CB    1 
ATOM   3132 C  CG    . ARG B 1 51  ? -22.418 57.893  34.698  1.00 46.06 ? 1051 ARG B CG    1 
ATOM   3133 C  CD    . ARG B 1 51  ? -21.692 58.688  35.712  1.00 46.13 ? 1051 ARG B CD    1 
ATOM   3134 N  NE    . ARG B 1 51  ? -20.460 59.188  35.127  1.00 46.88 ? 1051 ARG B NE    1 
ATOM   3135 C  CZ    . ARG B 1 51  ? -19.546 59.888  35.784  1.00 46.74 ? 1051 ARG B CZ    1 
ATOM   3136 N  NH1   . ARG B 1 51  ? -19.705 60.165  37.071  1.00 45.87 ? 1051 ARG B NH1   1 
ATOM   3137 N  NH2   . ARG B 1 51  ? -18.465 60.306  35.136  1.00 46.74 ? 1051 ARG B NH2   1 
ATOM   3138 N  N     . LYS B 1 52  ? -26.934 57.920  33.926  1.00 46.05 ? 1052 LYS B N     1 
ATOM   3139 C  CA    . LYS B 1 52  ? -28.356 57.736  34.129  1.00 45.93 ? 1052 LYS B CA    1 
ATOM   3140 C  C     . LYS B 1 52  ? -28.784 56.329  33.766  1.00 45.50 ? 1052 LYS B C     1 
ATOM   3141 O  O     . LYS B 1 52  ? -29.665 55.807  34.404  1.00 46.05 ? 1052 LYS B O     1 
ATOM   3142 C  CB    . LYS B 1 52  ? -29.176 58.746  33.320  1.00 45.90 ? 1052 LYS B CB    1 
ATOM   3143 C  CG    . LYS B 1 52  ? -29.397 60.071  34.032  1.00 46.25 ? 1052 LYS B CG    1 
ATOM   3144 C  CD    . LYS B 1 52  ? -30.497 60.894  33.379  1.00 46.67 ? 1052 LYS B CD    1 
ATOM   3145 C  CE    . LYS B 1 52  ? -30.082 61.464  32.015  1.00 47.80 ? 1052 LYS B CE    1 
ATOM   3146 N  NZ    . LYS B 1 52  ? -31.229 62.156  31.326  1.00 47.65 ? 1052 LYS B NZ    1 
ATOM   3147 N  N     . PHE B 1 53  ? -28.178 55.706  32.762  1.00 45.13 ? 1053 PHE B N     1 
ATOM   3148 C  CA    . PHE B 1 53  ? -28.571 54.340  32.385  1.00 44.97 ? 1053 PHE B CA    1 
ATOM   3149 C  C     . PHE B 1 53  ? -27.541 53.247  32.751  1.00 44.74 ? 1053 PHE B C     1 
ATOM   3150 O  O     . PHE B 1 53  ? -27.596 52.136  32.212  1.00 44.71 ? 1053 PHE B O     1 
ATOM   3151 C  CB    . PHE B 1 53  ? -28.916 54.277  30.890  1.00 44.97 ? 1053 PHE B CB    1 
ATOM   3152 C  CG    . PHE B 1 53  ? -29.905 55.326  30.452  1.00 45.26 ? 1053 PHE B CG    1 
ATOM   3153 C  CD1   . PHE B 1 53  ? -31.276 55.091  30.528  1.00 45.79 ? 1053 PHE B CD1   1 
ATOM   3154 C  CD2   . PHE B 1 53  ? -29.468 56.549  29.965  1.00 45.26 ? 1053 PHE B CD2   1 
ATOM   3155 C  CE1   . PHE B 1 53  ? -32.194 56.061  30.121  1.00 45.30 ? 1053 PHE B CE1   1 
ATOM   3156 C  CE2   . PHE B 1 53  ? -30.378 57.523  29.562  1.00 45.36 ? 1053 PHE B CE2   1 
ATOM   3157 C  CZ    . PHE B 1 53  ? -31.745 57.275  29.639  1.00 45.19 ? 1053 PHE B CZ    1 
ATOM   3158 N  N     . GLY B 1 54  ? -26.622 53.544  33.668  1.00 44.33 ? 1054 GLY B N     1 
ATOM   3159 C  CA    . GLY B 1 54  ? -25.725 52.517  34.210  1.00 44.26 ? 1054 GLY B CA    1 
ATOM   3160 C  C     . GLY B 1 54  ? -24.356 52.420  33.564  1.00 44.35 ? 1054 GLY B C     1 
ATOM   3161 O  O     . GLY B 1 54  ? -23.513 51.644  34.011  1.00 44.15 ? 1054 GLY B O     1 
ATOM   3162 N  N     . VAL B 1 55  ? -24.132 53.210  32.519  1.00 44.50 ? 1055 VAL B N     1 
ATOM   3163 C  CA    . VAL B 1 55  ? -22.841 53.259  31.851  1.00 44.68 ? 1055 VAL B CA    1 
ATOM   3164 C  C     . VAL B 1 55  ? -21.915 54.166  32.655  1.00 44.92 ? 1055 VAL B C     1 
ATOM   3165 O  O     . VAL B 1 55  ? -22.167 55.363  32.769  1.00 44.95 ? 1055 VAL B O     1 
ATOM   3166 C  CB    . VAL B 1 55  ? -22.966 53.816  30.413  1.00 44.85 ? 1055 VAL B CB    1 
ATOM   3167 C  CG1   . VAL B 1 55  ? -21.601 53.847  29.729  1.00 44.28 ? 1055 VAL B CG1   1 
ATOM   3168 C  CG2   . VAL B 1 55  ? -23.962 52.992  29.609  1.00 44.63 ? 1055 VAL B CG2   1 
ATOM   3169 N  N     . LYS B 1 56  ? -20.838 53.597  33.194  1.00 44.93 ? 1056 LYS B N     1 
ATOM   3170 C  CA    . LYS B 1 56  ? -19.951 54.320  34.097  1.00 44.75 ? 1056 LYS B CA    1 
ATOM   3171 C  C     . LYS B 1 56  ? -18.533 53.779  34.014  1.00 44.57 ? 1056 LYS B C     1 
ATOM   3172 O  O     . LYS B 1 56  ? -18.291 52.707  33.454  1.00 44.29 ? 1056 LYS B O     1 
ATOM   3173 C  CB    . LYS B 1 56  ? -20.463 54.198  35.533  1.00 44.61 ? 1056 LYS B CB    1 
ATOM   3174 C  CG    . LYS B 1 56  ? -20.310 52.799  36.118  1.00 44.95 ? 1056 LYS B CG    1 
ATOM   3175 C  CD    . LYS B 1 56  ? -21.247 52.544  37.297  1.00 45.29 ? 1056 LYS B CD    1 
ATOM   3176 C  CE    . LYS B 1 56  ? -20.802 51.308  38.073  1.00 45.97 ? 1056 LYS B CE    1 
ATOM   3177 N  NZ    . LYS B 1 56  ? -21.811 50.823  39.048  1.00 46.61 ? 1056 LYS B NZ    1 
ATOM   3178 N  N     . ALA B 1 57  ? -17.599 54.523  34.601  1.00 44.55 ? 1057 ALA B N     1 
ATOM   3179 C  CA    . ALA B 1 57  ? -16.197 54.138  34.600  1.00 44.40 ? 1057 ALA B CA    1 
ATOM   3180 C  C     . ALA B 1 57  ? -16.059 52.698  35.065  1.00 44.51 ? 1057 ALA B C     1 
ATOM   3181 O  O     . ALA B 1 57  ? -16.664 52.288  36.061  1.00 44.66 ? 1057 ALA B O     1 
ATOM   3182 C  CB    . ALA B 1 57  ? -15.402 55.051  35.496  1.00 44.08 ? 1057 ALA B CB    1 
ATOM   3183 N  N     . GLY B 1 58  ? -15.284 51.923  34.328  1.00 44.53 ? 1058 GLY B N     1 
ATOM   3184 C  CA    . GLY B 1 58  ? -14.890 50.608  34.792  1.00 44.79 ? 1058 GLY B CA    1 
ATOM   3185 C  C     . GLY B 1 58  ? -15.658 49.456  34.177  1.00 45.01 ? 1058 GLY B C     1 
ATOM   3186 O  O     . GLY B 1 58  ? -15.136 48.338  34.118  1.00 45.40 ? 1058 GLY B O     1 
ATOM   3187 N  N     . ILE B 1 59  ? -16.884 49.691  33.707  1.00 44.66 ? 1059 ILE B N     1 
ATOM   3188 C  CA    . ILE B 1 59  ? -17.611 48.593  33.093  1.00 44.28 ? 1059 ILE B CA    1 
ATOM   3189 C  C     . ILE B 1 59  ? -17.036 48.283  31.715  1.00 43.99 ? 1059 ILE B C     1 
ATOM   3190 O  O     . ILE B 1 59  ? -16.299 49.091  31.146  1.00 43.34 ? 1059 ILE B O     1 
ATOM   3191 C  CB    . ILE B 1 59  ? -19.144 48.803  33.057  1.00 44.49 ? 1059 ILE B CB    1 
ATOM   3192 C  CG1   . ILE B 1 59  ? -19.555 49.825  31.999  1.00 44.35 ? 1059 ILE B CG1   1 
ATOM   3193 C  CG2   . ILE B 1 59  ? -19.665 49.175  34.464  1.00 44.46 ? 1059 ILE B CG2   1 
ATOM   3194 C  CD1   . ILE B 1 59  ? -21.036 49.746  31.678  1.00 44.22 ? 1059 ILE B CD1   1 
ATOM   3195 N  N     . PRO B 1 60  ? -17.313 47.075  31.204  1.00 44.01 ? 1060 PRO B N     1 
ATOM   3196 C  CA    . PRO B 1 60  ? -16.823 46.719  29.881  1.00 44.05 ? 1060 PRO B CA    1 
ATOM   3197 C  C     . PRO B 1 60  ? -17.526 47.482  28.763  1.00 44.17 ? 1060 PRO B C     1 
ATOM   3198 O  O     . PRO B 1 60  ? -18.705 47.843  28.895  1.00 43.97 ? 1060 PRO B O     1 
ATOM   3199 C  CB    . PRO B 1 60  ? -17.143 45.227  29.787  1.00 43.98 ? 1060 PRO B CB    1 
ATOM   3200 C  CG    . PRO B 1 60  ? -17.363 44.795  31.203  1.00 43.96 ? 1060 PRO B CG    1 
ATOM   3201 C  CD    . PRO B 1 60  ? -18.026 45.949  31.824  1.00 43.76 ? 1060 PRO B CD    1 
ATOM   3202 N  N     . ILE B 1 61  ? -16.804 47.704  27.667  1.00 44.29 ? 1061 ILE B N     1 
ATOM   3203 C  CA    . ILE B 1 61  ? -17.357 48.420  26.528  1.00 44.43 ? 1061 ILE B CA    1 
ATOM   3204 C  C     . ILE B 1 61  ? -18.521 47.624  25.943  1.00 44.82 ? 1061 ILE B C     1 
ATOM   3205 O  O     . ILE B 1 61  ? -19.584 48.186  25.687  1.00 44.98 ? 1061 ILE B O     1 
ATOM   3206 C  CB    . ILE B 1 61  ? -16.296 48.712  25.433  1.00 44.34 ? 1061 ILE B CB    1 
ATOM   3207 C  CG1   . ILE B 1 61  ? -15.160 49.577  25.986  1.00 44.36 ? 1061 ILE B CG1   1 
ATOM   3208 C  CG2   . ILE B 1 61  ? -16.936 49.442  24.273  1.00 43.89 ? 1061 ILE B CG2   1 
ATOM   3209 C  CD1   . ILE B 1 61  ? -13.974 49.692  25.073  1.00 44.08 ? 1061 ILE B CD1   1 
ATOM   3210 N  N     . VAL B 1 62  ? -18.333 46.318  25.766  1.00 45.12 ? 1062 VAL B N     1 
ATOM   3211 C  CA    . VAL B 1 62  ? -19.385 45.485  25.191  1.00 45.55 ? 1062 VAL B CA    1 
ATOM   3212 C  C     . VAL B 1 62  ? -20.702 45.604  25.959  1.00 45.78 ? 1062 VAL B C     1 
ATOM   3213 O  O     . VAL B 1 62  ? -21.763 45.563  25.350  1.00 45.85 ? 1062 VAL B O     1 
ATOM   3214 C  CB    . VAL B 1 62  ? -18.986 43.986  25.093  1.00 45.76 ? 1062 VAL B CB    1 
ATOM   3215 C  CG1   . VAL B 1 62  ? -17.691 43.808  24.286  1.00 45.64 ? 1062 VAL B CG1   1 
ATOM   3216 C  CG2   . VAL B 1 62  ? -18.863 43.356  26.482  1.00 46.17 ? 1062 VAL B CG2   1 
ATOM   3217 N  N     . GLU B 1 63  ? -20.645 45.759  27.282  1.00 46.20 ? 1063 GLU B N     1 
ATOM   3218 C  CA    . GLU B 1 63  ? -21.877 45.875  28.085  1.00 46.72 ? 1063 GLU B CA    1 
ATOM   3219 C  C     . GLU B 1 63  ? -22.541 47.240  27.914  1.00 46.45 ? 1063 GLU B C     1 
ATOM   3220 O  O     . GLU B 1 63  ? -23.757 47.320  27.708  1.00 46.24 ? 1063 GLU B O     1 
ATOM   3221 C  CB    . GLU B 1 63  ? -21.636 45.560  29.576  1.00 46.76 ? 1063 GLU B CB    1 
ATOM   3222 C  CG    . GLU B 1 63  ? -21.928 44.083  29.951  1.00 47.80 ? 1063 GLU B CG    1 
ATOM   3223 C  CD    . GLU B 1 63  ? -21.855 43.802  31.457  1.00 48.28 ? 1063 GLU B CD    1 
ATOM   3224 O  OE1   . GLU B 1 63  ? -21.036 44.438  32.169  1.00 50.44 ? 1063 GLU B OE1   1 
ATOM   3225 O  OE2   . GLU B 1 63  ? -22.618 42.931  31.931  1.00 49.80 ? 1063 GLU B OE2   1 
ATOM   3226 N  N     . ALA B 1 64  ? -21.746 48.306  27.979  1.00 46.42 ? 1064 ALA B N     1 
ATOM   3227 C  CA    . ALA B 1 64  ? -22.257 49.659  27.727  1.00 46.40 ? 1064 ALA B CA    1 
ATOM   3228 C  C     . ALA B 1 64  ? -23.054 49.741  26.413  1.00 46.56 ? 1064 ALA B C     1 
ATOM   3229 O  O     . ALA B 1 64  ? -24.126 50.369  26.362  1.00 46.66 ? 1064 ALA B O     1 
ATOM   3230 C  CB    . ALA B 1 64  ? -21.124 50.660  27.721  1.00 46.15 ? 1064 ALA B CB    1 
ATOM   3231 N  N     . LYS B 1 65  ? -22.544 49.094  25.362  1.00 46.48 ? 1065 LYS B N     1 
ATOM   3232 C  CA    . LYS B 1 65  ? -23.213 49.106  24.060  1.00 46.45 ? 1065 LYS B CA    1 
ATOM   3233 C  C     . LYS B 1 65  ? -24.579 48.432  24.071  1.00 46.43 ? 1065 LYS B C     1 
ATOM   3234 O  O     . LYS B 1 65  ? -25.437 48.795  23.272  1.00 46.51 ? 1065 LYS B O     1 
ATOM   3235 C  CB    . LYS B 1 65  ? -22.322 48.494  22.971  1.00 46.57 ? 1065 LYS B CB    1 
ATOM   3236 C  CG    . LYS B 1 65  ? -21.112 49.367  22.619  1.00 46.90 ? 1065 LYS B CG    1 
ATOM   3237 C  CD    . LYS B 1 65  ? -20.677 49.238  21.160  1.00 46.77 ? 1065 LYS B CD    1 
ATOM   3238 C  CE    . LYS B 1 65  ? -19.392 50.042  20.924  1.00 46.85 ? 1065 LYS B CE    1 
ATOM   3239 N  NZ    . LYS B 1 65  ? -19.037 50.167  19.484  1.00 46.31 ? 1065 LYS B NZ    1 
ATOM   3240 N  N     . LYS B 1 66  ? -24.784 47.456  24.961  1.00 46.36 ? 1066 LYS B N     1 
ATOM   3241 C  CA    . LYS B 1 66  ? -26.088 46.799  25.082  1.00 46.34 ? 1066 LYS B CA    1 
ATOM   3242 C  C     . LYS B 1 66  ? -27.084 47.767  25.685  1.00 45.82 ? 1066 LYS B C     1 
ATOM   3243 O  O     . LYS B 1 66  ? -28.256 47.771  25.324  1.00 46.51 ? 1066 LYS B O     1 
ATOM   3244 C  CB    . LYS B 1 66  ? -26.024 45.555  25.974  1.00 46.31 ? 1066 LYS B CB    1 
ATOM   3245 C  CG    . LYS B 1 66  ? -25.143 44.439  25.459  1.00 46.93 ? 1066 LYS B CG    1 
ATOM   3246 C  CD    . LYS B 1 66  ? -24.957 43.345  26.516  1.00 47.47 ? 1066 LYS B CD    1 
ATOM   3247 C  CE    . LYS B 1 66  ? -23.797 42.408  26.150  1.00 48.85 ? 1066 LYS B CE    1 
ATOM   3248 N  NZ    . LYS B 1 66  ? -23.699 41.208  27.040  1.00 49.48 ? 1066 LYS B NZ    1 
ATOM   3249 N  N     . ILE B 1 67  ? -26.603 48.585  26.608  1.00 45.17 ? 1067 ILE B N     1 
ATOM   3250 C  CA    . ILE B 1 67  ? -27.452 49.474  27.377  1.00 44.74 ? 1067 ILE B CA    1 
ATOM   3251 C  C     . ILE B 1 67  ? -27.724 50.755  26.595  1.00 44.38 ? 1067 ILE B C     1 
ATOM   3252 O  O     . ILE B 1 67  ? -28.869 51.208  26.525  1.00 44.67 ? 1067 ILE B O     1 
ATOM   3253 C  CB    . ILE B 1 67  ? -26.783 49.827  28.721  1.00 44.73 ? 1067 ILE B CB    1 
ATOM   3254 C  CG1   . ILE B 1 67  ? -26.511 48.559  29.543  1.00 44.59 ? 1067 ILE B CG1   1 
ATOM   3255 C  CG2   . ILE B 1 67  ? -27.643 50.804  29.501  1.00 44.86 ? 1067 ILE B CG2   1 
ATOM   3256 C  CD1   . ILE B 1 67  ? -25.526 48.764  30.674  1.00 44.79 ? 1067 ILE B CD1   1 
ATOM   3257 N  N     . LEU B 1 68  ? -26.669 51.340  26.031  1.00 43.74 ? 1068 LEU B N     1 
ATOM   3258 C  CA    . LEU B 1 68  ? -26.782 52.533  25.189  1.00 43.40 ? 1068 LEU B CA    1 
ATOM   3259 C  C     . LEU B 1 68  ? -26.105 52.279  23.840  1.00 42.97 ? 1068 LEU B C     1 
ATOM   3260 O  O     . LEU B 1 68  ? -24.934 52.622  23.651  1.00 43.18 ? 1068 LEU B O     1 
ATOM   3261 C  CB    . LEU B 1 68  ? -26.124 53.733  25.868  1.00 43.25 ? 1068 LEU B CB    1 
ATOM   3262 C  CG    . LEU B 1 68  ? -26.864 54.363  27.037  1.00 43.35 ? 1068 LEU B CG    1 
ATOM   3263 C  CD1   . LEU B 1 68  ? -25.952 55.388  27.688  1.00 43.53 ? 1068 LEU B CD1   1 
ATOM   3264 C  CD2   . LEU B 1 68  ? -28.176 55.000  26.604  1.00 43.43 ? 1068 LEU B CD2   1 
ATOM   3265 N  N     . PRO B 1 69  ? -26.834 51.672  22.894  1.00 42.07 ? 1069 PRO B N     1 
ATOM   3266 C  CA    . PRO B 1 69  ? -26.214 51.288  21.629  1.00 41.51 ? 1069 PRO B CA    1 
ATOM   3267 C  C     . PRO B 1 69  ? -26.014 52.449  20.670  1.00 40.86 ? 1069 PRO B C     1 
ATOM   3268 O  O     . PRO B 1 69  ? -25.228 52.328  19.735  1.00 40.88 ? 1069 PRO B O     1 
ATOM   3269 C  CB    . PRO B 1 69  ? -27.204 50.274  21.048  1.00 41.51 ? 1069 PRO B CB    1 
ATOM   3270 C  CG    . PRO B 1 69  ? -28.503 50.658  21.609  1.00 41.67 ? 1069 PRO B CG    1 
ATOM   3271 C  CD    . PRO B 1 69  ? -28.257 51.306  22.946  1.00 42.00 ? 1069 PRO B CD    1 
ATOM   3272 N  N     . ASN B 1 70  ? -26.724 53.552  20.895  1.00 40.17 ? 1070 ASN B N     1 
ATOM   3273 C  CA    . ASN B 1 70  ? -26.616 54.734  20.047  1.00 39.60 ? 1070 ASN B CA    1 
ATOM   3274 C  C     . ASN B 1 70  ? -25.814 55.864  20.711  1.00 39.12 ? 1070 ASN B C     1 
ATOM   3275 O  O     . ASN B 1 70  ? -25.826 57.000  20.246  1.00 39.42 ? 1070 ASN B O     1 
ATOM   3276 C  CB    . ASN B 1 70  ? -28.018 55.211  19.638  1.00 39.50 ? 1070 ASN B CB    1 
ATOM   3277 C  CG    . ASN B 1 70  ? -28.752 54.195  18.752  1.00 39.35 ? 1070 ASN B CG    1 
ATOM   3278 O  OD1   . ASN B 1 70  ? -28.170 53.614  17.829  1.00 38.46 ? 1070 ASN B OD1   1 
ATOM   3279 N  ND2   . ASN B 1 70  ? -30.040 53.989  19.029  1.00 38.75 ? 1070 ASN B ND2   1 
ATOM   3280 N  N     . ALA B 1 71  ? -25.093 55.552  21.782  1.00 38.38 ? 1071 ALA B N     1 
ATOM   3281 C  CA    . ALA B 1 71  ? -24.217 56.537  22.411  1.00 38.05 ? 1071 ALA B CA    1 
ATOM   3282 C  C     . ALA B 1 71  ? -22.966 56.783  21.547  1.00 37.64 ? 1071 ALA B C     1 
ATOM   3283 O  O     . ALA B 1 71  ? -22.652 56.000  20.653  1.00 37.52 ? 1071 ALA B O     1 
ATOM   3284 C  CB    . ALA B 1 71  ? -23.819 56.076  23.809  1.00 37.86 ? 1071 ALA B CB    1 
ATOM   3285 N  N     . VAL B 1 72  ? -22.271 57.882  21.813  1.00 37.10 ? 1072 VAL B N     1 
ATOM   3286 C  CA    . VAL B 1 72  ? -21.002 58.156  21.160  1.00 36.74 ? 1072 VAL B CA    1 
ATOM   3287 C  C     . VAL B 1 72  ? -19.884 57.525  21.970  1.00 36.69 ? 1072 VAL B C     1 
ATOM   3288 O  O     . VAL B 1 72  ? -19.720 57.818  23.148  1.00 36.75 ? 1072 VAL B O     1 
ATOM   3289 C  CB    . VAL B 1 72  ? -20.719 59.661  21.054  1.00 36.57 ? 1072 VAL B CB    1 
ATOM   3290 C  CG1   . VAL B 1 72  ? -19.354 59.885  20.453  1.00 35.50 ? 1072 VAL B CG1   1 
ATOM   3291 C  CG2   . VAL B 1 72  ? -21.798 60.352  20.235  1.00 36.22 ? 1072 VAL B CG2   1 
ATOM   3292 N  N     . TYR B 1 73  ? -19.108 56.667  21.331  1.00 36.52 ? 1073 TYR B N     1 
ATOM   3293 C  CA    . TYR B 1 73  ? -18.012 56.007  21.990  1.00 36.40 ? 1073 TYR B CA    1 
ATOM   3294 C  C     . TYR B 1 73  ? -16.726 56.527  21.431  1.00 36.45 ? 1073 TYR B C     1 
ATOM   3295 O  O     . TYR B 1 73  ? -16.436 56.332  20.258  1.00 36.62 ? 1073 TYR B O     1 
ATOM   3296 C  CB    . TYR B 1 73  ? -18.126 54.507  21.783  1.00 36.73 ? 1073 TYR B CB    1 
ATOM   3297 C  CG    . TYR B 1 73  ? -19.313 53.942  22.509  1.00 36.64 ? 1073 TYR B CG    1 
ATOM   3298 C  CD1   . TYR B 1 73  ? -19.209 53.549  23.838  1.00 37.28 ? 1073 TYR B CD1   1 
ATOM   3299 C  CD2   . TYR B 1 73  ? -20.546 53.851  21.890  1.00 35.94 ? 1073 TYR B CD2   1 
ATOM   3300 C  CE1   . TYR B 1 73  ? -20.309 53.054  24.525  1.00 37.89 ? 1073 TYR B CE1   1 
ATOM   3301 C  CE2   . TYR B 1 73  ? -21.643 53.356  22.559  1.00 36.90 ? 1073 TYR B CE2   1 
ATOM   3302 C  CZ    . TYR B 1 73  ? -21.522 52.954  23.873  1.00 36.95 ? 1073 TYR B CZ    1 
ATOM   3303 O  OH    . TYR B 1 73  ? -22.608 52.457  24.535  1.00 36.48 ? 1073 TYR B OH    1 
ATOM   3304 N  N     . LEU B 1 74  ? -15.954 57.194  22.275  1.00 36.90 ? 1074 LEU B N     1 
ATOM   3305 C  CA    . LEU B 1 74  ? -14.739 57.856  21.837  1.00 37.40 ? 1074 LEU B CA    1 
ATOM   3306 C  C     . LEU B 1 74  ? -13.472 57.216  22.404  1.00 38.26 ? 1074 LEU B C     1 
ATOM   3307 O  O     . LEU B 1 74  ? -13.422 56.832  23.570  1.00 37.99 ? 1074 LEU B O     1 
ATOM   3308 C  CB    . LEU B 1 74  ? -14.793 59.334  22.229  1.00 37.34 ? 1074 LEU B CB    1 
ATOM   3309 C  CG    . LEU B 1 74  ? -15.810 60.170  21.449  1.00 36.14 ? 1074 LEU B CG    1 
ATOM   3310 C  CD1   . LEU B 1 74  ? -15.875 61.544  22.032  1.00 34.80 ? 1074 LEU B CD1   1 
ATOM   3311 C  CD2   . LEU B 1 74  ? -15.421 60.234  19.981  1.00 36.10 ? 1074 LEU B CD2   1 
ATOM   3312 N  N     . PRO B 1 75  ? -12.425 57.124  21.581  1.00 39.44 ? 1075 PRO B N     1 
ATOM   3313 C  CA    . PRO B 1 75  ? -11.175 56.605  22.106  1.00 40.41 ? 1075 PRO B CA    1 
ATOM   3314 C  C     . PRO B 1 75  ? -10.542 57.595  23.079  1.00 41.50 ? 1075 PRO B C     1 
ATOM   3315 O  O     . PRO B 1 75  ? -10.627 58.809  22.866  1.00 41.71 ? 1075 PRO B O     1 
ATOM   3316 C  CB    . PRO B 1 75  ? -10.308 56.446  20.853  1.00 40.33 ? 1075 PRO B CB    1 
ATOM   3317 C  CG    . PRO B 1 75  ? -10.849 57.464  19.889  1.00 40.26 ? 1075 PRO B CG    1 
ATOM   3318 C  CD    . PRO B 1 75  ? -12.323 57.508  20.160  1.00 39.76 ? 1075 PRO B CD    1 
ATOM   3319 N  N     . MET B 1 76  ? -9.915  57.083  24.130  1.00 42.59 ? 1076 MET B N     1 
ATOM   3320 C  CA    . MET B 1 76  ? -9.254  57.935  25.106  1.00 44.28 ? 1076 MET B CA    1 
ATOM   3321 C  C     . MET B 1 76  ? -8.062  58.686  24.472  1.00 44.27 ? 1076 MET B C     1 
ATOM   3322 O  O     . MET B 1 76  ? -7.217  58.085  23.807  1.00 44.43 ? 1076 MET B O     1 
ATOM   3323 C  CB    . MET B 1 76  ? -8.795  57.098  26.308  1.00 44.25 ? 1076 MET B CB    1 
ATOM   3324 C  CG    . MET B 1 76  ? -8.383  57.902  27.534  1.00 45.21 ? 1076 MET B CG    1 
ATOM   3325 S  SD    . MET B 1 76  ? -7.935  56.831  28.939  1.00 47.63 ? 1076 MET B SD    1 
ATOM   3326 C  CE    . MET B 1 76  ? -6.487  55.954  28.315  1.00 47.06 ? 1076 MET B CE    1 
ATOM   3327 N  N     . ARG B 1 77  ? -8.042  60.002  24.658  1.00 44.59 ? 1077 ARG B N     1 
ATOM   3328 C  CA    . ARG B 1 77  ? -6.924  60.867  24.279  1.00 44.92 ? 1077 ARG B CA    1 
ATOM   3329 C  C     . ARG B 1 77  ? -6.318  61.496  25.524  1.00 45.15 ? 1077 ARG B C     1 
ATOM   3330 O  O     . ARG B 1 77  ? -6.501  62.673  25.774  1.00 44.83 ? 1077 ARG B O     1 
ATOM   3331 C  CB    . ARG B 1 77  ? -7.391  61.979  23.338  1.00 44.68 ? 1077 ARG B CB    1 
ATOM   3332 C  CG    . ARG B 1 77  ? -7.931  61.473  22.036  1.00 44.77 ? 1077 ARG B CG    1 
ATOM   3333 C  CD    . ARG B 1 77  ? -8.105  62.600  21.050  1.00 45.45 ? 1077 ARG B CD    1 
ATOM   3334 N  NE    . ARG B 1 77  ? -9.340  63.328  21.278  1.00 45.63 ? 1077 ARG B NE    1 
ATOM   3335 C  CZ    . ARG B 1 77  ? -9.681  64.456  20.664  1.00 45.07 ? 1077 ARG B CZ    1 
ATOM   3336 N  NH1   . ARG B 1 77  ? -8.883  65.017  19.769  1.00 44.34 ? 1077 ARG B NH1   1 
ATOM   3337 N  NH2   . ARG B 1 77  ? -10.843 65.025  20.950  1.00 46.41 ? 1077 ARG B NH2   1 
ATOM   3338 N  N     . LYS B 1 78  ? -5.580  60.703  26.291  1.00 45.89 ? 1078 LYS B N     1 
ATOM   3339 C  CA    . LYS B 1 78  ? -5.034  61.149  27.573  1.00 46.48 ? 1078 LYS B CA    1 
ATOM   3340 C  C     . LYS B 1 78  ? -4.155  62.392  27.445  1.00 46.79 ? 1078 LYS B C     1 
ATOM   3341 O  O     . LYS B 1 78  ? -4.119  63.237  28.344  1.00 47.01 ? 1078 LYS B O     1 
ATOM   3342 C  CB    . LYS B 1 78  ? -4.243  60.017  28.235  1.00 46.56 ? 1078 LYS B CB    1 
ATOM   3343 C  CG    . LYS B 1 78  ? -4.284  60.050  29.750  1.00 47.39 ? 1078 LYS B CG    1 
ATOM   3344 C  CD    . LYS B 1 78  ? -3.824  58.720  30.318  1.00 49.66 ? 1078 LYS B CD    1 
ATOM   3345 C  CE    . LYS B 1 78  ? -3.848  58.696  31.848  1.00 50.14 ? 1078 LYS B CE    1 
ATOM   3346 N  NZ    . LYS B 1 78  ? -2.994  59.763  32.433  1.00 51.93 ? 1078 LYS B NZ    1 
ATOM   3347 N  N     . GLU B 1 79  ? -3.468  62.500  26.313  1.00 47.05 ? 1079 GLU B N     1 
ATOM   3348 C  CA    . GLU B 1 79  ? -2.562  63.617  26.038  1.00 47.41 ? 1079 GLU B CA    1 
ATOM   3349 C  C     . GLU B 1 79  ? -3.333  64.935  25.979  1.00 46.91 ? 1079 GLU B C     1 
ATOM   3350 O  O     . GLU B 1 79  ? -2.846  65.993  26.384  1.00 47.13 ? 1079 GLU B O     1 
ATOM   3351 C  CB    . GLU B 1 79  ? -1.823  63.386  24.709  1.00 47.84 ? 1079 GLU B CB    1 
ATOM   3352 C  CG    . GLU B 1 79  ? -1.060  62.015  24.582  1.00 50.24 ? 1079 GLU B CG    1 
ATOM   3353 C  CD    . GLU B 1 79  ? -1.971  60.795  24.227  1.00 53.48 ? 1079 GLU B CD    1 
ATOM   3354 O  OE1   . GLU B 1 79  ? -3.072  60.985  23.623  1.00 54.66 ? 1079 GLU B OE1   1 
ATOM   3355 O  OE2   . GLU B 1 79  ? -1.571  59.645  24.561  1.00 54.48 ? 1079 GLU B OE2   1 
ATOM   3356 N  N     . VAL B 1 80  ? -4.556  64.858  25.477  1.00 46.35 ? 1080 VAL B N     1 
ATOM   3357 C  CA    . VAL B 1 80  ? -5.385  66.032  25.311  1.00 45.66 ? 1080 VAL B CA    1 
ATOM   3358 C  C     . VAL B 1 80  ? -5.947  66.453  26.653  1.00 45.22 ? 1080 VAL B C     1 
ATOM   3359 O  O     . VAL B 1 80  ? -5.942  67.641  26.990  1.00 45.62 ? 1080 VAL B O     1 
ATOM   3360 C  CB    . VAL B 1 80  ? -6.502  65.771  24.289  1.00 45.50 ? 1080 VAL B CB    1 
ATOM   3361 C  CG1   . VAL B 1 80  ? -7.564  66.871  24.336  1.00 45.75 ? 1080 VAL B CG1   1 
ATOM   3362 C  CG2   . VAL B 1 80  ? -5.890  65.652  22.901  1.00 44.24 ? 1080 VAL B CG2   1 
ATOM   3363 N  N     . TYR B 1 81  ? -6.402  65.489  27.435  1.00 44.40 ? 1081 TYR B N     1 
ATOM   3364 C  CA    . TYR B 1 81  ? -7.007  65.817  28.713  1.00 44.06 ? 1081 TYR B CA    1 
ATOM   3365 C  C     . TYR B 1 81  ? -5.921  66.381  29.599  1.00 44.60 ? 1081 TYR B C     1 
ATOM   3366 O  O     . TYR B 1 81  ? -6.144  67.367  30.288  1.00 44.79 ? 1081 TYR B O     1 
ATOM   3367 C  CB    . TYR B 1 81  ? -7.692  64.601  29.346  1.00 43.26 ? 1081 TYR B CB    1 
ATOM   3368 C  CG    . TYR B 1 81  ? -8.480  63.785  28.350  1.00 41.90 ? 1081 TYR B CG    1 
ATOM   3369 C  CD1   . TYR B 1 81  ? -9.311  64.400  27.417  1.00 40.78 ? 1081 TYR B CD1   1 
ATOM   3370 C  CD2   . TYR B 1 81  ? -8.378  62.406  28.322  1.00 41.51 ? 1081 TYR B CD2   1 
ATOM   3371 C  CE1   . TYR B 1 81  ? -10.010 63.669  26.488  1.00 40.75 ? 1081 TYR B CE1   1 
ATOM   3372 C  CE2   . TYR B 1 81  ? -9.083  61.662  27.400  1.00 41.54 ? 1081 TYR B CE2   1 
ATOM   3373 C  CZ    . TYR B 1 81  ? -9.890  62.295  26.478  1.00 41.40 ? 1081 TYR B CZ    1 
ATOM   3374 O  OH    . TYR B 1 81  ? -10.585 61.543  25.557  1.00 41.36 ? 1081 TYR B OH    1 
ATOM   3375 N  N     . GLN B 1 82  ? -4.732  65.783  29.530  1.00 45.44 ? 1082 GLN B N     1 
ATOM   3376 C  CA    . GLN B 1 82  ? -3.563  66.260  30.277  1.00 45.89 ? 1082 GLN B CA    1 
ATOM   3377 C  C     . GLN B 1 82  ? -3.195  67.712  29.947  1.00 46.65 ? 1082 GLN B C     1 
ATOM   3378 O  O     . GLN B 1 82  ? -2.950  68.510  30.853  1.00 46.84 ? 1082 GLN B O     1 
ATOM   3379 C  CB    . GLN B 1 82  ? -2.369  65.330  30.058  1.00 45.71 ? 1082 GLN B CB    1 
ATOM   3380 C  CG    . GLN B 1 82  ? -1.156  65.632  30.935  1.00 45.89 ? 1082 GLN B CG    1 
ATOM   3381 C  CD    . GLN B 1 82  ? -1.431  65.510  32.427  1.00 46.34 ? 1082 GLN B CD    1 
ATOM   3382 O  OE1   . GLN B 1 82  ? -1.707  64.420  32.936  1.00 48.11 ? 1082 GLN B OE1   1 
ATOM   3383 N  NE2   . GLN B 1 82  ? -1.353  66.630  33.135  1.00 45.28 ? 1082 GLN B NE2   1 
ATOM   3384 N  N     . GLN B 1 83  ? -3.172  68.070  28.669  1.00 47.64 ? 1083 GLN B N     1 
ATOM   3385 C  CA    . GLN B 1 83  ? -2.973  69.478  28.297  1.00 48.65 ? 1083 GLN B CA    1 
ATOM   3386 C  C     . GLN B 1 83  ? -3.976  70.389  29.004  1.00 48.74 ? 1083 GLN B C     1 
ATOM   3387 O  O     . GLN B 1 83  ? -3.626  71.486  29.455  1.00 49.05 ? 1083 GLN B O     1 
ATOM   3388 C  CB    . GLN B 1 83  ? -3.089  69.684  26.784  1.00 48.68 ? 1083 GLN B CB    1 
ATOM   3389 C  CG    . GLN B 1 83  ? -1.872  69.217  26.007  1.00 49.92 ? 1083 GLN B CG    1 
ATOM   3390 C  CD    . GLN B 1 83  ? -1.874  69.698  24.558  1.00 50.08 ? 1083 GLN B CD    1 
ATOM   3391 O  OE1   . GLN B 1 83  ? -2.857  69.526  23.827  1.00 51.30 ? 1083 GLN B OE1   1 
ATOM   3392 N  NE2   . GLN B 1 83  ? -0.761  70.294  24.137  1.00 51.82 ? 1083 GLN B NE2   1 
ATOM   3393 N  N     . VAL B 1 84  ? -5.223  69.937  29.096  1.00 48.79 ? 1084 VAL B N     1 
ATOM   3394 C  CA    . VAL B 1 84  ? -6.259  70.726  29.743  1.00 48.86 ? 1084 VAL B CA    1 
ATOM   3395 C  C     . VAL B 1 84  ? -6.019  70.744  31.253  1.00 48.94 ? 1084 VAL B C     1 
ATOM   3396 O  O     . VAL B 1 84  ? -6.010  71.807  31.864  1.00 49.20 ? 1084 VAL B O     1 
ATOM   3397 C  CB    . VAL B 1 84  ? -7.678  70.208  29.391  1.00 49.06 ? 1084 VAL B CB    1 
ATOM   3398 C  CG1   . VAL B 1 84  ? -8.758  70.966  30.180  1.00 49.02 ? 1084 VAL B CG1   1 
ATOM   3399 C  CG2   . VAL B 1 84  ? -7.920  70.321  27.891  1.00 47.84 ? 1084 VAL B CG2   1 
ATOM   3400 N  N     . SER B 1 85  ? -5.778  69.579  31.841  1.00 48.94 ? 1085 SER B N     1 
ATOM   3401 C  CA    . SER B 1 85  ? -5.525  69.485  33.286  1.00 49.06 ? 1085 SER B CA    1 
ATOM   3402 C  C     . SER B 1 85  ? -4.397  70.396  33.797  1.00 49.20 ? 1085 SER B C     1 
ATOM   3403 O  O     . SER B 1 85  ? -4.536  71.030  34.844  1.00 49.08 ? 1085 SER B O     1 
ATOM   3404 C  CB    . SER B 1 85  ? -5.209  68.047  33.683  1.00 48.91 ? 1085 SER B CB    1 
ATOM   3405 O  OG    . SER B 1 85  ? -4.933  67.978  35.069  1.00 49.15 ? 1085 SER B OG    1 
ATOM   3406 N  N     . SER B 1 86  ? -3.284  70.450  33.072  1.00 49.32 ? 1086 SER B N     1 
ATOM   3407 C  CA    . SER B 1 86  ? -2.138  71.250  33.512  1.00 49.44 ? 1086 SER B CA    1 
ATOM   3408 C  C     . SER B 1 86  ? -2.436  72.751  33.472  1.00 49.64 ? 1086 SER B C     1 
ATOM   3409 O  O     . SER B 1 86  ? -1.963  73.503  34.333  1.00 49.85 ? 1086 SER B O     1 
ATOM   3410 C  CB    . SER B 1 86  ? -0.885  70.928  32.690  1.00 49.35 ? 1086 SER B CB    1 
ATOM   3411 O  OG    . SER B 1 86  ? -0.288  69.725  33.146  1.00 49.07 ? 1086 SER B OG    1 
ATOM   3412 N  N     . ARG B 1 87  ? -3.217  73.185  32.485  1.00 49.68 ? 1087 ARG B N     1 
ATOM   3413 C  CA    . ARG B 1 87  ? -3.638  74.584  32.417  1.00 49.68 ? 1087 ARG B CA    1 
ATOM   3414 C  C     . ARG B 1 87  ? -4.581  74.929  33.564  1.00 49.84 ? 1087 ARG B C     1 
ATOM   3415 O  O     . ARG B 1 87  ? -4.488  76.020  34.128  1.00 49.90 ? 1087 ARG B O     1 
ATOM   3416 C  CB    . ARG B 1 87  ? -4.302  74.915  31.076  1.00 49.61 ? 1087 ARG B CB    1 
ATOM   3417 C  CG    . ARG B 1 87  ? -3.326  75.013  29.914  1.00 49.37 ? 1087 ARG B CG    1 
ATOM   3418 C  CD    . ARG B 1 87  ? -3.859  75.908  28.797  1.00 49.26 ? 1087 ARG B CD    1 
ATOM   3419 N  NE    . ARG B 1 87  ? -5.180  75.502  28.302  1.00 49.29 ? 1087 ARG B NE    1 
ATOM   3420 C  CZ    . ARG B 1 87  ? -5.409  74.464  27.494  1.00 48.72 ? 1087 ARG B CZ    1 
ATOM   3421 N  NH1   . ARG B 1 87  ? -4.415  73.689  27.060  1.00 48.03 ? 1087 ARG B NH1   1 
ATOM   3422 N  NH2   . ARG B 1 87  ? -6.652  74.197  27.116  1.00 48.46 ? 1087 ARG B NH2   1 
ATOM   3423 N  N     . ILE B 1 88  ? -5.480  74.006  33.906  1.00 50.06 ? 1088 ILE B N     1 
ATOM   3424 C  CA    . ILE B 1 88  ? -6.395  74.209  35.032  1.00 50.17 ? 1088 ILE B CA    1 
ATOM   3425 C  C     . ILE B 1 88  ? -5.670  74.192  36.376  1.00 50.22 ? 1088 ILE B C     1 
ATOM   3426 O  O     . ILE B 1 88  ? -6.008  74.968  37.258  1.00 50.41 ? 1088 ILE B O     1 
ATOM   3427 C  CB    . ILE B 1 88  ? -7.509  73.155  35.087  1.00 50.15 ? 1088 ILE B CB    1 
ATOM   3428 C  CG1   . ILE B 1 88  ? -8.447  73.288  33.894  1.00 50.10 ? 1088 ILE B CG1   1 
ATOM   3429 C  CG2   . ILE B 1 88  ? -8.327  73.325  36.357  1.00 50.72 ? 1088 ILE B CG2   1 
ATOM   3430 C  CD1   . ILE B 1 88  ? -9.511  72.182  33.820  1.00 50.03 ? 1088 ILE B CD1   1 
ATOM   3431 N  N     . MET B 1 89  ? -4.690  73.310  36.542  1.00 50.36 ? 1089 MET B N     1 
ATOM   3432 C  CA    . MET B 1 89  ? -3.929  73.263  37.794  1.00 50.51 ? 1089 MET B CA    1 
ATOM   3433 C  C     . MET B 1 89  ? -3.171  74.572  38.035  1.00 50.87 ? 1089 MET B C     1 
ATOM   3434 O  O     . MET B 1 89  ? -3.083  75.037  39.163  1.00 50.97 ? 1089 MET B O     1 
ATOM   3435 C  CB    . MET B 1 89  ? -2.961  72.072  37.812  1.00 50.44 ? 1089 MET B CB    1 
ATOM   3436 C  CG    . MET B 1 89  ? -3.634  70.694  37.859  1.00 50.05 ? 1089 MET B CG    1 
ATOM   3437 S  SD    . MET B 1 89  ? -4.935  70.519  39.100  1.00 49.76 ? 1089 MET B SD    1 
ATOM   3438 C  CE    . MET B 1 89  ? -5.393  68.796  38.882  1.00 50.43 ? 1089 MET B CE    1 
ATOM   3439 N  N     . ASN B 1 90  ? -2.637  75.166  36.974  1.00 51.35 ? 1090 ASN B N     1 
ATOM   3440 C  CA    . ASN B 1 90  ? -2.003  76.483  37.061  1.00 51.57 ? 1090 ASN B CA    1 
ATOM   3441 C  C     . ASN B 1 90  ? -2.943  77.581  37.518  1.00 51.84 ? 1090 ASN B C     1 
ATOM   3442 O  O     . ASN B 1 90  ? -2.531  78.481  38.245  1.00 51.97 ? 1090 ASN B O     1 
ATOM   3443 C  CB    . ASN B 1 90  ? -1.416  76.888  35.712  1.00 51.60 ? 1090 ASN B CB    1 
ATOM   3444 C  CG    . ASN B 1 90  ? -0.154  76.142  35.386  1.00 51.68 ? 1090 ASN B CG    1 
ATOM   3445 O  OD1   . ASN B 1 90  ? 0.527   75.633  36.272  1.00 51.92 ? 1090 ASN B OD1   1 
ATOM   3446 N  ND2   . ASN B 1 90  ? 0.179   76.085  34.106  1.00 51.93 ? 1090 ASN B ND2   1 
ATOM   3447 N  N     . LEU B 1 91  ? -4.196  77.524  37.081  1.00 52.18 ? 1091 LEU B N     1 
ATOM   3448 C  CA    . LEU B 1 91  ? -5.192  78.494  37.530  1.00 52.63 ? 1091 LEU B CA    1 
ATOM   3449 C  C     . LEU B 1 91  ? -5.481  78.325  39.028  1.00 53.13 ? 1091 LEU B C     1 
ATOM   3450 O  O     . LEU B 1 91  ? -5.676  79.317  39.739  1.00 53.12 ? 1091 LEU B O     1 
ATOM   3451 C  CB    . LEU B 1 91  ? -6.472  78.384  36.702  1.00 52.52 ? 1091 LEU B CB    1 
ATOM   3452 C  CG    . LEU B 1 91  ? -6.301  78.789  35.232  1.00 52.62 ? 1091 LEU B CG    1 
ATOM   3453 C  CD1   . LEU B 1 91  ? -7.532  78.413  34.424  1.00 52.29 ? 1091 LEU B CD1   1 
ATOM   3454 C  CD2   . LEU B 1 91  ? -5.999  80.285  35.095  1.00 52.38 ? 1091 LEU B CD2   1 
ATOM   3455 N  N     . LEU B 1 92  ? -5.483  77.077  39.501  1.00 53.62 ? 1092 LEU B N     1 
ATOM   3456 C  CA    . LEU B 1 92  ? -5.570  76.790  40.933  1.00 54.02 ? 1092 LEU B CA    1 
ATOM   3457 C  C     . LEU B 1 92  ? -4.393  77.404  41.696  1.00 54.63 ? 1092 LEU B C     1 
ATOM   3458 O  O     . LEU B 1 92  ? -4.580  77.932  42.799  1.00 54.83 ? 1092 LEU B O     1 
ATOM   3459 C  CB    . LEU B 1 92  ? -5.638  75.278  41.204  1.00 53.87 ? 1092 LEU B CB    1 
ATOM   3460 C  CG    . LEU B 1 92  ? -6.870  74.537  40.678  1.00 53.67 ? 1092 LEU B CG    1 
ATOM   3461 C  CD1   . LEU B 1 92  ? -6.808  73.051  41.008  1.00 52.99 ? 1092 LEU B CD1   1 
ATOM   3462 C  CD2   . LEU B 1 92  ? -8.129  75.150  41.251  1.00 53.95 ? 1092 LEU B CD2   1 
ATOM   3463 N  N     . ARG B 1 93  ? -3.195  77.355  41.108  1.00 55.22 ? 1093 ARG B N     1 
ATOM   3464 C  CA    . ARG B 1 93  ? -1.984  77.891  41.763  1.00 55.86 ? 1093 ARG B CA    1 
ATOM   3465 C  C     . ARG B 1 93  ? -2.041  79.396  42.058  1.00 56.03 ? 1093 ARG B C     1 
ATOM   3466 O  O     . ARG B 1 93  ? -1.389  79.856  42.990  1.00 55.91 ? 1093 ARG B O     1 
ATOM   3467 C  CB    . ARG B 1 93  ? -0.711  77.561  40.958  1.00 55.95 ? 1093 ARG B CB    1 
ATOM   3468 C  CG    . ARG B 1 93  ? 0.087   76.362  41.496  1.00 56.30 ? 1093 ARG B CG    1 
ATOM   3469 C  CD    . ARG B 1 93  ? 1.349   76.086  40.673  1.00 56.42 ? 1093 ARG B CD    1 
ATOM   3470 N  NE    . ARG B 1 93  ? 1.079   75.188  39.545  1.00 57.47 ? 1093 ARG B NE    1 
ATOM   3471 C  CZ    . ARG B 1 93  ? 1.114   73.855  39.602  1.00 57.78 ? 1093 ARG B CZ    1 
ATOM   3472 N  NH1   . ARG B 1 93  ? 1.410   73.230  40.740  1.00 58.82 ? 1093 ARG B NH1   1 
ATOM   3473 N  NH2   . ARG B 1 93  ? 0.848   73.134  38.515  1.00 57.05 ? 1093 ARG B NH2   1 
ATOM   3474 N  N     . GLU B 1 94  ? -2.818  80.140  41.266  1.00 56.61 ? 1094 GLU B N     1 
ATOM   3475 C  CA    . GLU B 1 94  ? -2.983  81.596  41.433  1.00 57.01 ? 1094 GLU B CA    1 
ATOM   3476 C  C     . GLU B 1 94  ? -3.623  81.929  42.778  1.00 57.19 ? 1094 GLU B C     1 
ATOM   3477 O  O     . GLU B 1 94  ? -3.308  82.956  43.384  1.00 57.33 ? 1094 GLU B O     1 
ATOM   3478 C  CB    . GLU B 1 94  ? -3.874  82.201  40.332  1.00 57.15 ? 1094 GLU B CB    1 
ATOM   3479 C  CG    . GLU B 1 94  ? -3.506  81.864  38.872  1.00 58.01 ? 1094 GLU B CG    1 
ATOM   3480 C  CD    . GLU B 1 94  ? -2.293  82.623  38.336  1.00 59.08 ? 1094 GLU B CD    1 
ATOM   3481 O  OE1   . GLU B 1 94  ? -1.885  83.648  38.939  1.00 59.46 ? 1094 GLU B OE1   1 
ATOM   3482 O  OE2   . GLU B 1 94  ? -1.759  82.187  37.289  1.00 58.96 ? 1094 GLU B OE2   1 
ATOM   3483 N  N     . TYR B 1 95  ? -4.534  81.064  43.224  1.00 57.43 ? 1095 TYR B N     1 
ATOM   3484 C  CA    . TYR B 1 95  ? -5.288  81.277  44.459  1.00 57.66 ? 1095 TYR B CA    1 
ATOM   3485 C  C     . TYR B 1 95  ? -4.473  80.888  45.689  1.00 57.86 ? 1095 TYR B C     1 
ATOM   3486 O  O     . TYR B 1 95  ? -4.338  81.686  46.631  1.00 58.13 ? 1095 TYR B O     1 
ATOM   3487 C  CB    . TYR B 1 95  ? -6.616  80.518  44.408  1.00 57.75 ? 1095 TYR B CB    1 
ATOM   3488 C  CG    . TYR B 1 95  ? -7.554  81.113  43.389  1.00 57.76 ? 1095 TYR B CG    1 
ATOM   3489 C  CD1   . TYR B 1 95  ? -8.260  82.273  43.674  1.00 58.21 ? 1095 TYR B CD1   1 
ATOM   3490 C  CD2   . TYR B 1 95  ? -7.706  80.546  42.129  1.00 57.91 ? 1095 TYR B CD2   1 
ATOM   3491 C  CE1   . TYR B 1 95  ? -9.114  82.849  42.741  1.00 58.28 ? 1095 TYR B CE1   1 
ATOM   3492 C  CE2   . TYR B 1 95  ? -8.560  81.116  41.183  1.00 58.12 ? 1095 TYR B CE2   1 
ATOM   3493 C  CZ    . TYR B 1 95  ? -9.260  82.270  41.501  1.00 58.06 ? 1095 TYR B CZ    1 
ATOM   3494 O  OH    . TYR B 1 95  ? -10.111 82.855  40.597  1.00 57.96 ? 1095 TYR B OH    1 
ATOM   3495 N  N     . SER B 1 96  ? -3.929  79.673  45.673  1.00 57.86 ? 1096 SER B N     1 
ATOM   3496 C  CA    . SER B 1 96  ? -2.976  79.236  46.691  1.00 57.89 ? 1096 SER B CA    1 
ATOM   3497 C  C     . SER B 1 96  ? -1.745  78.606  46.043  1.00 57.90 ? 1096 SER B C     1 
ATOM   3498 O  O     . SER B 1 96  ? -1.856  77.853  45.072  1.00 58.07 ? 1096 SER B O     1 
ATOM   3499 C  CB    . SER B 1 96  ? -3.625  78.238  47.649  1.00 57.91 ? 1096 SER B CB    1 
ATOM   3500 O  OG    . SER B 1 96  ? -2.674  77.737  48.576  1.00 58.06 ? 1096 SER B OG    1 
ATOM   3501 N  N     . GLU B 1 97  ? -0.576  78.921  46.589  1.00 57.84 ? 1097 GLU B N     1 
ATOM   3502 C  CA    . GLU B 1 97  ? 0.676   78.318  46.147  1.00 57.85 ? 1097 GLU B CA    1 
ATOM   3503 C  C     . GLU B 1 97  ? 0.782   76.895  46.688  1.00 57.54 ? 1097 GLU B C     1 
ATOM   3504 O  O     . GLU B 1 97  ? 1.262   76.003  45.989  1.00 57.81 ? 1097 GLU B O     1 
ATOM   3505 C  CB    . GLU B 1 97  ? 1.873   79.164  46.594  1.00 57.92 ? 1097 GLU B CB    1 
ATOM   3506 C  CG    . GLU B 1 97  ? 1.872   80.583  45.993  1.00 58.31 ? 1097 GLU B CG    1 
ATOM   3507 C  CD    . GLU B 1 97  ? 3.055   81.440  46.431  1.00 58.29 ? 1097 GLU B CD    1 
ATOM   3508 O  OE1   . GLU B 1 97  ? 3.381   82.415  45.716  1.00 58.86 ? 1097 GLU B OE1   1 
ATOM   3509 O  OE2   . GLU B 1 97  ? 3.656   81.147  47.487  1.00 58.89 ? 1097 GLU B OE2   1 
ATOM   3510 N  N     . LYS B 1 98  ? 0.308   76.683  47.915  1.00 57.05 ? 1098 LYS B N     1 
ATOM   3511 C  CA    . LYS B 1 98  ? 0.278   75.344  48.508  1.00 56.79 ? 1098 LYS B CA    1 
ATOM   3512 C  C     . LYS B 1 98  ? -0.804  74.489  47.833  1.00 56.47 ? 1098 LYS B C     1 
ATOM   3513 O  O     . LYS B 1 98  ? -2.005  74.711  48.037  1.00 56.55 ? 1098 LYS B O     1 
ATOM   3514 C  CB    . LYS B 1 98  ? 0.047   75.423  50.022  1.00 56.82 ? 1098 LYS B CB    1 
ATOM   3515 C  CG    . LYS B 1 98  ? 0.985   76.401  50.722  1.00 57.02 ? 1098 LYS B CG    1 
ATOM   3516 C  CD    . LYS B 1 98  ? 1.315   75.998  52.153  1.00 57.23 ? 1098 LYS B CD    1 
ATOM   3517 C  CE    . LYS B 1 98  ? 2.365   76.937  52.745  1.00 57.36 ? 1098 LYS B CE    1 
ATOM   3518 N  NZ    . LYS B 1 98  ? 2.936   76.456  54.039  1.00 57.67 ? 1098 LYS B NZ    1 
ATOM   3519 N  N     . ILE B 1 99  ? -0.366  73.513  47.033  1.00 55.90 ? 1099 ILE B N     1 
ATOM   3520 C  CA    . ILE B 1 99  ? -1.263  72.729  46.181  1.00 55.41 ? 1099 ILE B CA    1 
ATOM   3521 C  C     . ILE B 1 99  ? -0.772  71.273  45.976  1.00 54.95 ? 1099 ILE B C     1 
ATOM   3522 O  O     . ILE B 1 99  ? 0.369   71.041  45.580  1.00 54.82 ? 1099 ILE B O     1 
ATOM   3523 C  CB    . ILE B 1 99  ? -1.451  73.452  44.815  1.00 55.39 ? 1099 ILE B CB    1 
ATOM   3524 C  CG1   . ILE B 1 99  ? -2.526  72.776  43.964  1.00 55.42 ? 1099 ILE B CG1   1 
ATOM   3525 C  CG2   . ILE B 1 99  ? -0.137  73.522  44.049  1.00 55.40 ? 1099 ILE B CG2   1 
ATOM   3526 C  CD1   . ILE B 1 99  ? -2.883  73.562  42.714  1.00 55.43 ? 1099 ILE B CD1   1 
ATOM   3527 N  N     . GLU B 1 100 ? -1.649  70.306  46.254  1.00 54.42 ? 1100 GLU B N     1 
ATOM   3528 C  CA    . GLU B 1 100 ? -1.352  68.880  46.075  1.00 54.09 ? 1100 GLU B CA    1 
ATOM   3529 C  C     . GLU B 1 100 ? -2.175  68.314  44.908  1.00 53.79 ? 1100 GLU B C     1 
ATOM   3530 O  O     . GLU B 1 100 ? -3.402  68.236  44.988  1.00 53.49 ? 1100 GLU B O     1 
ATOM   3531 C  CB    . GLU B 1 100 ? -1.648  68.108  47.372  1.00 54.02 ? 1100 GLU B CB    1 
ATOM   3532 C  CG    . GLU B 1 100 ? -1.399  66.583  47.312  1.00 54.20 ? 1100 GLU B CG    1 
ATOM   3533 C  CD    . GLU B 1 100 ? -1.392  65.892  48.691  1.00 54.23 ? 1100 GLU B CD    1 
ATOM   3534 O  OE1   . GLU B 1 100 ? -1.557  66.574  49.727  1.00 54.56 ? 1100 GLU B OE1   1 
ATOM   3535 O  OE2   . GLU B 1 100 ? -1.217  64.655  48.740  1.00 53.87 ? 1100 GLU B OE2   1 
ATOM   3536 N  N     . ILE B 1 101 ? -1.485  67.920  43.837  1.00 53.42 ? 1101 ILE B N     1 
ATOM   3537 C  CA    . ILE B 1 101 ? -2.123  67.340  42.654  1.00 53.20 ? 1101 ILE B CA    1 
ATOM   3538 C  C     . ILE B 1 101 ? -2.320  65.830  42.863  1.00 52.94 ? 1101 ILE B C     1 
ATOM   3539 O  O     . ILE B 1 101 ? -1.398  65.028  42.683  1.00 53.21 ? 1101 ILE B O     1 
ATOM   3540 C  CB    . ILE B 1 101 ? -1.292  67.568  41.365  1.00 53.24 ? 1101 ILE B CB    1 
ATOM   3541 C  CG1   . ILE B 1 101 ? -0.773  69.013  41.263  1.00 53.12 ? 1101 ILE B CG1   1 
ATOM   3542 C  CG2   . ILE B 1 101 ? -2.127  67.230  40.158  1.00 53.27 ? 1101 ILE B CG2   1 
ATOM   3543 C  CD1   . ILE B 1 101 ? -1.850  70.059  41.333  1.00 53.05 ? 1101 ILE B CD1   1 
ATOM   3544 N  N     . ALA B 1 102 ? -3.534  65.450  43.242  1.00 52.53 ? 1102 ALA B N     1 
ATOM   3545 C  CA    . ALA B 1 102 ? -3.814  64.084  43.679  1.00 51.90 ? 1102 ALA B CA    1 
ATOM   3546 C  C     . ALA B 1 102 ? -3.996  63.136  42.507  1.00 51.32 ? 1102 ALA B C     1 
ATOM   3547 O  O     . ALA B 1 102 ? -3.655  61.970  42.619  1.00 51.64 ? 1102 ALA B O     1 
ATOM   3548 C  CB    . ALA B 1 102 ? -5.046  64.061  44.576  1.00 51.81 ? 1102 ALA B CB    1 
ATOM   3549 N  N     . SER B 1 103 ? -4.564  63.628  41.406  1.00 50.56 ? 1103 SER B N     1 
ATOM   3550 C  CA    . SER B 1 103 ? -4.692  62.854  40.165  1.00 49.88 ? 1103 SER B CA    1 
ATOM   3551 C  C     . SER B 1 103 ? -4.902  63.809  38.992  1.00 49.37 ? 1103 SER B C     1 
ATOM   3552 O  O     . SER B 1 103 ? -4.900  65.032  39.172  1.00 49.25 ? 1103 SER B O     1 
ATOM   3553 C  CB    . SER B 1 103 ? -5.848  61.854  40.249  1.00 49.76 ? 1103 SER B CB    1 
ATOM   3554 O  OG    . SER B 1 103 ? -7.099  62.510  40.145  1.00 49.92 ? 1103 SER B OG    1 
ATOM   3555 N  N     . ILE B 1 104 ? -5.101  63.258  37.799  1.00 48.71 ? 1104 ILE B N     1 
ATOM   3556 C  CA    . ILE B 1 104 ? -5.196  64.077  36.596  1.00 48.30 ? 1104 ILE B CA    1 
ATOM   3557 C  C     . ILE B 1 104 ? -6.312  65.130  36.627  1.00 48.31 ? 1104 ILE B C     1 
ATOM   3558 O  O     . ILE B 1 104 ? -6.209  66.113  35.904  1.00 48.09 ? 1104 ILE B O     1 
ATOM   3559 C  CB    . ILE B 1 104 ? -5.344  63.212  35.315  1.00 48.48 ? 1104 ILE B CB    1 
ATOM   3560 C  CG1   . ILE B 1 104 ? -5.168  64.083  34.069  1.00 48.67 ? 1104 ILE B CG1   1 
ATOM   3561 C  CG2   . ILE B 1 104 ? -6.675  62.490  35.283  1.00 47.17 ? 1104 ILE B CG2   1 
ATOM   3562 C  CD1   . ILE B 1 104 ? -4.959  63.302  32.830  1.00 49.74 ? 1104 ILE B CD1   1 
ATOM   3563 N  N     . ASP B 1 105 ? -7.357  64.930  37.447  1.00 48.24 ? 1105 ASP B N     1 
ATOM   3564 C  CA    . ASP B 1 105 ? -8.474  65.893  37.561  1.00 47.97 ? 1105 ASP B CA    1 
ATOM   3565 C  C     . ASP B 1 105 ? -8.792  66.366  38.987  1.00 48.02 ? 1105 ASP B C     1 
ATOM   3566 O  O     . ASP B 1 105 ? -9.826  67.003  39.192  1.00 47.64 ? 1105 ASP B O     1 
ATOM   3567 C  CB    . ASP B 1 105 ? -9.756  65.318  36.929  1.00 47.98 ? 1105 ASP B CB    1 
ATOM   3568 C  CG    . ASP B 1 105 ? -10.596 64.483  37.917  1.00 47.36 ? 1105 ASP B CG    1 
ATOM   3569 O  OD1   . ASP B 1 105 ? -10.002 63.712  38.707  1.00 45.87 ? 1105 ASP B OD1   1 
ATOM   3570 O  OD2   . ASP B 1 105 ? -11.853 64.599  37.902  1.00 43.54 ? 1105 ASP B OD2   1 
ATOM   3571 N  N     . GLU B 1 106 ? -7.914  66.069  39.950  1.00 48.23 ? 1106 GLU B N     1 
ATOM   3572 C  CA    . GLU B 1 106 ? -8.115  66.460  41.362  1.00 48.50 ? 1106 GLU B CA    1 
ATOM   3573 C  C     . GLU B 1 106 ? -6.973  67.286  41.920  1.00 48.37 ? 1106 GLU B C     1 
ATOM   3574 O  O     . GLU B 1 106 ? -5.803  67.031  41.623  1.00 48.44 ? 1106 GLU B O     1 
ATOM   3575 C  CB    . GLU B 1 106 ? -8.207  65.224  42.249  1.00 48.75 ? 1106 GLU B CB    1 
ATOM   3576 C  CG    . GLU B 1 106 ? -9.472  64.473  42.107  1.00 49.93 ? 1106 GLU B CG    1 
ATOM   3577 C  CD    . GLU B 1 106 ? -9.420  63.094  42.750  1.00 51.40 ? 1106 GLU B CD    1 
ATOM   3578 O  OE1   . GLU B 1 106 ? -8.731  62.932  43.793  1.00 51.02 ? 1106 GLU B OE1   1 
ATOM   3579 O  OE2   . GLU B 1 106 ? -10.089 62.174  42.201  1.00 50.16 ? 1106 GLU B OE2   1 
ATOM   3580 N  N     . ALA B 1 107 ? -7.305  68.227  42.791  1.00 48.33 ? 1107 ALA B N     1 
ATOM   3581 C  CA    . ALA B 1 107 ? -6.286  68.980  43.505  1.00 48.24 ? 1107 ALA B CA    1 
ATOM   3582 C  C     . ALA B 1 107 ? -6.815  69.442  44.858  1.00 48.31 ? 1107 ALA B C     1 
ATOM   3583 O  O     . ALA B 1 107 ? -8.013  69.660  45.014  1.00 48.09 ? 1107 ALA B O     1 
ATOM   3584 C  CB    . ALA B 1 107 ? -5.830  70.159  42.671  1.00 48.18 ? 1107 ALA B CB    1 
ATOM   3585 N  N     . TYR B 1 108 ? -5.907  69.561  45.828  1.00 48.58 ? 1108 TYR B N     1 
ATOM   3586 C  CA    . TYR B 1 108 ? -6.206  70.106  47.147  1.00 48.74 ? 1108 TYR B CA    1 
ATOM   3587 C  C     . TYR B 1 108 ? -5.552  71.476  47.303  1.00 49.17 ? 1108 TYR B C     1 
ATOM   3588 O  O     . TYR B 1 108 ? -4.439  71.681  46.827  1.00 49.47 ? 1108 TYR B O     1 
ATOM   3589 C  CB    . TYR B 1 108 ? -5.637  69.200  48.230  1.00 48.68 ? 1108 TYR B CB    1 
ATOM   3590 C  CG    . TYR B 1 108 ? -6.253  67.835  48.300  1.00 48.54 ? 1108 TYR B CG    1 
ATOM   3591 C  CD1   . TYR B 1 108 ? -7.386  67.605  49.063  1.00 48.67 ? 1108 TYR B CD1   1 
ATOM   3592 C  CD2   . TYR B 1 108 ? -5.685  66.760  47.629  1.00 48.56 ? 1108 TYR B CD2   1 
ATOM   3593 C  CE1   . TYR B 1 108 ? -7.952  66.342  49.138  1.00 48.98 ? 1108 TYR B CE1   1 
ATOM   3594 C  CE2   . TYR B 1 108 ? -6.246  65.490  47.698  1.00 48.31 ? 1108 TYR B CE2   1 
ATOM   3595 C  CZ    . TYR B 1 108 ? -7.377  65.291  48.451  1.00 48.59 ? 1108 TYR B CZ    1 
ATOM   3596 O  OH    . TYR B 1 108 ? -7.942  64.043  48.527  1.00 49.07 ? 1108 TYR B OH    1 
ATOM   3597 N  N     . LEU B 1 109 ? -6.220  72.397  47.997  1.00 49.62 ? 1109 LEU B N     1 
ATOM   3598 C  CA    . LEU B 1 109 ? -5.650  73.712  48.309  1.00 49.85 ? 1109 LEU B CA    1 
ATOM   3599 C  C     . LEU B 1 109 ? -5.750  74.010  49.805  1.00 50.39 ? 1109 LEU B C     1 
ATOM   3600 O  O     . LEU B 1 109 ? -6.829  73.903  50.390  1.00 50.39 ? 1109 LEU B O     1 
ATOM   3601 C  CB    . LEU B 1 109 ? -6.387  74.814  47.545  1.00 49.85 ? 1109 LEU B CB    1 
ATOM   3602 C  CG    . LEU B 1 109 ? -6.234  74.898  46.024  1.00 49.80 ? 1109 LEU B CG    1 
ATOM   3603 C  CD1   . LEU B 1 109 ? -6.993  73.769  45.314  1.00 50.58 ? 1109 LEU B CD1   1 
ATOM   3604 C  CD2   . LEU B 1 109 ? -6.730  76.248  45.538  1.00 49.56 ? 1109 LEU B CD2   1 
ATOM   3605 N  N     . ASP B 1 110 ? -4.628  74.389  50.418  1.00 50.94 ? 1110 ASP B N     1 
ATOM   3606 C  CA    . ASP B 1 110 ? -4.644  74.929  51.779  1.00 51.42 ? 1110 ASP B CA    1 
ATOM   3607 C  C     . ASP B 1 110 ? -5.056  76.403  51.753  1.00 51.73 ? 1110 ASP B C     1 
ATOM   3608 O  O     . ASP B 1 110 ? -4.795  77.131  50.798  1.00 51.54 ? 1110 ASP B O     1 
ATOM   3609 C  CB    . ASP B 1 110 ? -3.266  74.786  52.453  1.00 51.57 ? 1110 ASP B CB    1 
ATOM   3610 C  CG    . ASP B 1 110 ? -3.323  74.963  53.978  1.00 51.72 ? 1110 ASP B CG    1 
ATOM   3611 O  OD1   . ASP B 1 110 ? -3.485  76.108  54.461  1.00 52.77 ? 1110 ASP B OD1   1 
ATOM   3612 O  OD2   . ASP B 1 110 ? -3.187  73.952  54.702  1.00 51.47 ? 1110 ASP B OD2   1 
ATOM   3613 N  N     . ILE B 1 111 ? -5.716  76.829  52.819  1.00 52.46 ? 1111 ILE B N     1 
ATOM   3614 C  CA    . ILE B 1 111 ? -6.052  78.233  53.014  1.00 52.81 ? 1111 ILE B CA    1 
ATOM   3615 C  C     . ILE B 1 111 ? -5.773  78.620  54.470  1.00 53.24 ? 1111 ILE B C     1 
ATOM   3616 O  O     . ILE B 1 111 ? -6.064  77.855  55.391  1.00 53.13 ? 1111 ILE B O     1 
ATOM   3617 C  CB    . ILE B 1 111 ? -7.528  78.504  52.669  1.00 52.97 ? 1111 ILE B CB    1 
ATOM   3618 C  CG1   . ILE B 1 111 ? -7.838  78.103  51.218  1.00 52.28 ? 1111 ILE B CG1   1 
ATOM   3619 C  CG2   . ILE B 1 111 ? -7.867  79.970  52.916  1.00 52.87 ? 1111 ILE B CG2   1 
ATOM   3620 C  CD1   . ILE B 1 111 ? -9.319  78.073  50.908  1.00 52.32 ? 1111 ILE B CD1   1 
ATOM   3621 N  N     . SER B 1 112 ? -5.200  79.808  54.646  1.00 53.86 ? 1112 SER B N     1 
ATOM   3622 C  CA    . SER B 1 112 ? -4.813  80.364  55.957  1.00 54.38 ? 1112 SER B CA    1 
ATOM   3623 C  C     . SER B 1 112 ? -4.032  81.656  55.721  1.00 54.75 ? 1112 SER B C     1 
ATOM   3624 O  O     . SER B 1 112 ? -4.200  82.647  56.438  1.00 54.93 ? 1112 SER B O     1 
ATOM   3625 C  CB    . SER B 1 112 ? -3.954  79.393  56.779  1.00 54.50 ? 1112 SER B CB    1 
ATOM   3626 O  OG    . SER B 1 112 ? -3.458  80.016  57.967  1.00 54.69 ? 1112 SER B OG    1 
ATOM   3627 N  N     . ASP B 1 113 ? -3.147  81.615  54.729  1.00 55.20 ? 1113 ASP B N     1 
ATOM   3628 C  CA    . ASP B 1 113 ? -2.583  82.829  54.139  1.00 55.57 ? 1113 ASP B CA    1 
ATOM   3629 C  C     . ASP B 1 113 ? -3.744  83.627  53.532  1.00 55.73 ? 1113 ASP B C     1 
ATOM   3630 O  O     . ASP B 1 113 ? -3.778  84.859  53.629  1.00 55.76 ? 1113 ASP B O     1 
ATOM   3631 C  CB    . ASP B 1 113 ? -1.553  82.491  53.046  1.00 55.66 ? 1113 ASP B CB    1 
ATOM   3632 C  CG    . ASP B 1 113 ? -0.588  81.379  53.459  1.00 55.78 ? 1113 ASP B CG    1 
ATOM   3633 O  OD1   . ASP B 1 113 ? -0.006  81.475  54.565  1.00 55.71 ? 1113 ASP B OD1   1 
ATOM   3634 O  OD2   . ASP B 1 113 ? -0.421  80.413  52.673  1.00 55.05 ? 1113 ASP B OD2   1 
ATOM   3635 N  N     . LYS B 1 114 ? -4.683  82.900  52.913  1.00 55.77 ? 1114 LYS B N     1 
ATOM   3636 C  CA    . LYS B 1 114 ? -5.930  83.458  52.383  1.00 55.78 ? 1114 LYS B CA    1 
ATOM   3637 C  C     . LYS B 1 114 ? -7.016  83.250  53.433  1.00 55.66 ? 1114 LYS B C     1 
ATOM   3638 O  O     . LYS B 1 114 ? -7.223  82.129  53.887  1.00 55.50 ? 1114 LYS B O     1 
ATOM   3639 C  CB    . LYS B 1 114 ? -6.302  82.772  51.068  1.00 56.00 ? 1114 LYS B CB    1 
ATOM   3640 C  CG    . LYS B 1 114 ? -5.106  82.448  50.148  1.00 56.41 ? 1114 LYS B CG    1 
ATOM   3641 C  CD    . LYS B 1 114 ? -4.230  83.674  49.870  1.00 56.75 ? 1114 LYS B CD    1 
ATOM   3642 C  CE    . LYS B 1 114 ? -2.905  83.282  49.236  1.00 56.75 ? 1114 LYS B CE    1 
ATOM   3643 N  NZ    . LYS B 1 114 ? -2.135  84.484  48.820  1.00 57.09 ? 1114 LYS B NZ    1 
ATOM   3644 N  N     . VAL B 1 115 ? -7.715  84.329  53.792  1.00 55.65 ? 1115 VAL B N     1 
ATOM   3645 C  CA    . VAL B 1 115 ? -8.353  84.460  55.127  1.00 55.59 ? 1115 VAL B CA    1 
ATOM   3646 C  C     . VAL B 1 115 ? -9.411  83.385  55.476  1.00 55.50 ? 1115 VAL B C     1 
ATOM   3647 O  O     . VAL B 1 115 ? -10.176 82.936  54.613  1.00 55.40 ? 1115 VAL B O     1 
ATOM   3648 C  CB    . VAL B 1 115 ? -8.935  85.908  55.368  1.00 55.57 ? 1115 VAL B CB    1 
ATOM   3649 C  CG1   . VAL B 1 115 ? -9.356  86.091  56.823  1.00 55.20 ? 1115 VAL B CG1   1 
ATOM   3650 C  CG2   . VAL B 1 115 ? -7.915  86.987  54.991  1.00 55.30 ? 1115 VAL B CG2   1 
ATOM   3651 N  N     . ARG B 1 116 ? -9.421  82.995  56.758  1.00 55.43 ? 1116 ARG B N     1 
ATOM   3652 C  CA    . ARG B 1 116 ? -10.222 81.872  57.279  1.00 55.30 ? 1116 ARG B CA    1 
ATOM   3653 C  C     . ARG B 1 116 ? -11.654 82.286  57.654  1.00 54.87 ? 1116 ARG B C     1 
ATOM   3654 O  O     . ARG B 1 116 ? -11.950 83.475  57.813  1.00 54.68 ? 1116 ARG B O     1 
ATOM   3655 C  CB    . ARG B 1 116 ? -9.563  81.237  58.530  1.00 55.52 ? 1116 ARG B CB    1 
ATOM   3656 C  CG    . ARG B 1 116 ? -8.127  80.667  58.376  1.00 55.83 ? 1116 ARG B CG    1 
ATOM   3657 C  CD    . ARG B 1 116 ? -7.079  81.480  59.179  1.00 55.82 ? 1116 ARG B CD    1 
ATOM   3658 N  NE    . ARG B 1 116 ? -6.675  82.695  58.465  1.00 55.94 ? 1116 ARG B NE    1 
ATOM   3659 C  CZ    . ARG B 1 116 ? -6.076  83.756  59.005  1.00 55.93 ? 1116 ARG B CZ    1 
ATOM   3660 N  NH1   . ARG B 1 116 ? -5.786  83.800  60.306  1.00 55.91 ? 1116 ARG B NH1   1 
ATOM   3661 N  NH2   . ARG B 1 116 ? -5.768  84.793  58.229  1.00 55.90 ? 1116 ARG B NH2   1 
ATOM   3662 N  N     . ASP B 1 117 ? -12.491 81.262  57.856  1.00 54.36 ? 1117 ASP B N     1 
ATOM   3663 C  CA    . ASP B 1 117 ? -13.960 81.338  57.962  1.00 53.81 ? 1117 ASP B CA    1 
ATOM   3664 C  C     . ASP B 1 117 ? -14.506 80.602  56.722  1.00 53.27 ? 1117 ASP B C     1 
ATOM   3665 O  O     . ASP B 1 117 ? -14.015 80.818  55.613  1.00 53.05 ? 1117 ASP B O     1 
ATOM   3666 C  CB    . ASP B 1 117 ? -14.480 82.784  58.050  1.00 53.75 ? 1117 ASP B CB    1 
ATOM   3667 C  CG    . ASP B 1 117 ? -15.929 82.868  58.506  1.00 53.82 ? 1117 ASP B CG    1 
ATOM   3668 O  OD1   . ASP B 1 117 ? -16.789 82.180  57.922  1.00 53.82 ? 1117 ASP B OD1   1 
ATOM   3669 O  OD2   . ASP B 1 117 ? -16.210 83.646  59.446  1.00 53.99 ? 1117 ASP B OD2   1 
ATOM   3670 N  N     . TYR B 1 118 ? -15.489 79.717  56.916  1.00 52.68 ? 1118 TYR B N     1 
ATOM   3671 C  CA    . TYR B 1 118 ? -16.053 78.906  55.812  1.00 52.18 ? 1118 TYR B CA    1 
ATOM   3672 C  C     . TYR B 1 118 ? -16.947 79.716  54.861  1.00 51.72 ? 1118 TYR B C     1 
ATOM   3673 O  O     . TYR B 1 118 ? -17.180 79.305  53.721  1.00 51.71 ? 1118 TYR B O     1 
ATOM   3674 C  CB    . TYR B 1 118 ? -16.865 77.715  56.352  1.00 52.14 ? 1118 TYR B CB    1 
ATOM   3675 C  CG    . TYR B 1 118 ? -16.054 76.563  56.917  1.00 51.96 ? 1118 TYR B CG    1 
ATOM   3676 C  CD1   . TYR B 1 118 ? -16.346 76.024  58.172  1.00 52.03 ? 1118 TYR B CD1   1 
ATOM   3677 C  CD2   . TYR B 1 118 ? -15.011 75.998  56.193  1.00 51.95 ? 1118 TYR B CD2   1 
ATOM   3678 C  CE1   . TYR B 1 118 ? -15.610 74.954  58.691  1.00 52.13 ? 1118 TYR B CE1   1 
ATOM   3679 C  CE2   . TYR B 1 118 ? -14.270 74.931  56.702  1.00 52.21 ? 1118 TYR B CE2   1 
ATOM   3680 C  CZ    . TYR B 1 118 ? -14.572 74.411  57.948  1.00 52.24 ? 1118 TYR B CZ    1 
ATOM   3681 O  OH    . TYR B 1 118 ? -13.833 73.353  58.439  1.00 52.06 ? 1118 TYR B OH    1 
ATOM   3682 N  N     . ARG B 1 119 ? -17.463 80.841  55.350  1.00 51.10 ? 1119 ARG B N     1 
ATOM   3683 C  CA    . ARG B 1 119 ? -18.266 81.773  54.549  1.00 50.61 ? 1119 ARG B CA    1 
ATOM   3684 C  C     . ARG B 1 119 ? -17.395 82.382  53.440  1.00 50.12 ? 1119 ARG B C     1 
ATOM   3685 O  O     . ARG B 1 119 ? -17.829 82.499  52.294  1.00 49.91 ? 1119 ARG B O     1 
ATOM   3686 C  CB    . ARG B 1 119 ? -18.833 82.871  55.468  1.00 50.64 ? 1119 ARG B CB    1 
ATOM   3687 C  CG    . ARG B 1 119 ? -20.173 83.491  55.060  1.00 50.65 ? 1119 ARG B CG    1 
ATOM   3688 C  CD    . ARG B 1 119 ? -20.886 84.052  56.305  1.00 50.50 ? 1119 ARG B CD    1 
ATOM   3689 N  NE    . ARG B 1 119 ? -21.813 85.149  56.022  1.00 50.40 ? 1119 ARG B NE    1 
ATOM   3690 C  CZ    . ARG B 1 119 ? -22.531 85.795  56.948  1.00 50.68 ? 1119 ARG B CZ    1 
ATOM   3691 N  NH1   . ARG B 1 119 ? -22.450 85.460  58.235  1.00 50.40 ? 1119 ARG B NH1   1 
ATOM   3692 N  NH2   . ARG B 1 119 ? -23.344 86.785  56.590  1.00 50.38 ? 1119 ARG B NH2   1 
ATOM   3693 N  N     . GLU B 1 120 ? -16.164 82.750  53.802  1.00 49.64 ? 1120 GLU B N     1 
ATOM   3694 C  CA    . GLU B 1 120 ? -15.162 83.261  52.860  1.00 49.27 ? 1120 GLU B CA    1 
ATOM   3695 C  C     . GLU B 1 120 ? -14.804 82.182  51.847  1.00 48.89 ? 1120 GLU B C     1 
ATOM   3696 O  O     . GLU B 1 120 ? -14.838 82.421  50.642  1.00 48.75 ? 1120 GLU B O     1 
ATOM   3697 C  CB    . GLU B 1 120 ? -13.876 83.682  53.593  1.00 49.27 ? 1120 GLU B CB    1 
ATOM   3698 C  CG    . GLU B 1 120 ? -14.035 84.800  54.644  1.00 49.58 ? 1120 GLU B CG    1 
ATOM   3699 C  CD    . GLU B 1 120 ? -13.536 86.174  54.185  1.00 49.58 ? 1120 GLU B CD    1 
ATOM   3700 O  OE1   . GLU B 1 120 ? -12.847 86.246  53.140  1.00 49.69 ? 1120 GLU B OE1   1 
ATOM   3701 O  OE2   . GLU B 1 120 ? -13.827 87.179  54.885  1.00 47.70 ? 1120 GLU B OE2   1 
ATOM   3702 N  N     . ALA B 1 121 ? -14.456 81.001  52.357  1.00 48.50 ? 1121 ALA B N     1 
ATOM   3703 C  CA    . ALA B 1 121 ? -14.061 79.860  51.527  1.00 48.27 ? 1121 ALA B CA    1 
ATOM   3704 C  C     . ALA B 1 121 ? -15.095 79.540  50.458  1.00 48.00 ? 1121 ALA B C     1 
ATOM   3705 O  O     . ALA B 1 121 ? -14.751 79.420  49.292  1.00 48.16 ? 1121 ALA B O     1 
ATOM   3706 C  CB    . ALA B 1 121 ? -13.812 78.632  52.390  1.00 48.18 ? 1121 ALA B CB    1 
ATOM   3707 N  N     . TYR B 1 122 ? -16.353 79.411  50.860  1.00 47.77 ? 1122 TYR B N     1 
ATOM   3708 C  CA    . TYR B 1 122 ? -17.440 79.100  49.932  1.00 47.78 ? 1122 TYR B CA    1 
ATOM   3709 C  C     . TYR B 1 122 ? -17.507 80.054  48.729  1.00 47.86 ? 1122 TYR B C     1 
ATOM   3710 O  O     . TYR B 1 122 ? -17.740 79.604  47.603  1.00 48.16 ? 1122 TYR B O     1 
ATOM   3711 C  CB    . TYR B 1 122 ? -18.775 79.093  50.678  1.00 47.91 ? 1122 TYR B CB    1 
ATOM   3712 C  CG    . TYR B 1 122 ? -19.968 78.730  49.828  1.00 47.78 ? 1122 TYR B CG    1 
ATOM   3713 C  CD1   . TYR B 1 122 ? -20.344 77.407  49.652  1.00 47.68 ? 1122 TYR B CD1   1 
ATOM   3714 C  CD2   . TYR B 1 122 ? -20.733 79.716  49.216  1.00 48.13 ? 1122 TYR B CD2   1 
ATOM   3715 C  CE1   . TYR B 1 122 ? -21.444 77.074  48.879  1.00 48.05 ? 1122 TYR B CE1   1 
ATOM   3716 C  CE2   . TYR B 1 122 ? -21.830 79.395  48.438  1.00 48.26 ? 1122 TYR B CE2   1 
ATOM   3717 C  CZ    . TYR B 1 122 ? -22.181 78.074  48.272  1.00 48.22 ? 1122 TYR B CZ    1 
ATOM   3718 O  OH    . TYR B 1 122 ? -23.270 77.758  47.494  1.00 48.44 ? 1122 TYR B OH    1 
ATOM   3719 N  N     . ASN B 1 123 ? -17.304 81.353  48.964  1.00 47.90 ? 1123 ASN B N     1 
ATOM   3720 C  CA    . ASN B 1 123 ? -17.302 82.367  47.887  1.00 47.91 ? 1123 ASN B CA    1 
ATOM   3721 C  C     . ASN B 1 123 ? -16.092 82.231  46.951  1.00 48.13 ? 1123 ASN B C     1 
ATOM   3722 O  O     . ASN B 1 123 ? -16.225 82.286  45.724  1.00 48.12 ? 1123 ASN B O     1 
ATOM   3723 C  CB    . ASN B 1 123 ? -17.323 83.787  48.472  1.00 47.82 ? 1123 ASN B CB    1 
ATOM   3724 C  CG    . ASN B 1 123 ? -18.619 84.115  49.211  1.00 47.42 ? 1123 ASN B CG    1 
ATOM   3725 O  OD1   . ASN B 1 123 ? -19.599 83.376  49.149  1.00 47.25 ? 1123 ASN B OD1   1 
ATOM   3726 N  ND2   . ASN B 1 123 ? -18.621 85.240  49.911  1.00 45.99 ? 1123 ASN B ND2   1 
ATOM   3727 N  N     . LEU B 1 124 ? -14.914 82.061  47.548  1.00 48.30 ? 1124 LEU B N     1 
ATOM   3728 C  CA    . LEU B 1 124 ? -13.679 81.779  46.814  1.00 48.48 ? 1124 LEU B CA    1 
ATOM   3729 C  C     . LEU B 1 124 ? -13.824 80.519  45.954  1.00 48.86 ? 1124 LEU B C     1 
ATOM   3730 O  O     . LEU B 1 124 ? -13.227 80.411  44.878  1.00 48.71 ? 1124 LEU B O     1 
ATOM   3731 C  CB    . LEU B 1 124 ? -12.529 81.606  47.809  1.00 48.43 ? 1124 LEU B CB    1 
ATOM   3732 C  CG    . LEU B 1 124 ? -11.123 81.297  47.297  1.00 48.41 ? 1124 LEU B CG    1 
ATOM   3733 C  CD1   . LEU B 1 124 ? -10.613 82.405  46.399  1.00 48.35 ? 1124 LEU B CD1   1 
ATOM   3734 C  CD2   . LEU B 1 124 ? -10.188 81.100  48.483  1.00 48.43 ? 1124 LEU B CD2   1 
ATOM   3735 N  N     . GLY B 1 125 ? -14.610 79.567  46.451  1.00 49.34 ? 1125 GLY B N     1 
ATOM   3736 C  CA    . GLY B 1 125 ? -14.977 78.382  45.692  1.00 49.67 ? 1125 GLY B CA    1 
ATOM   3737 C  C     . GLY B 1 125 ? -15.758 78.769  44.453  1.00 50.01 ? 1125 GLY B C     1 
ATOM   3738 O  O     . GLY B 1 125 ? -15.426 78.332  43.347  1.00 50.10 ? 1125 GLY B O     1 
ATOM   3739 N  N     . LEU B 1 126 ? -16.787 79.601  44.632  1.00 50.17 ? 1126 LEU B N     1 
ATOM   3740 C  CA    . LEU B 1 126 ? -17.564 80.107  43.494  1.00 50.39 ? 1126 LEU B CA    1 
ATOM   3741 C  C     . LEU B 1 126 ? -16.669 80.877  42.514  1.00 50.53 ? 1126 LEU B C     1 
ATOM   3742 O  O     . LEU B 1 126 ? -16.846 80.790  41.292  1.00 50.36 ? 1126 LEU B O     1 
ATOM   3743 C  CB    . LEU B 1 126 ? -18.731 80.987  43.967  1.00 50.31 ? 1126 LEU B CB    1 
ATOM   3744 C  CG    . LEU B 1 126 ? -19.957 80.228  44.483  1.00 50.34 ? 1126 LEU B CG    1 
ATOM   3745 C  CD1   . LEU B 1 126 ? -20.940 81.171  45.168  1.00 50.03 ? 1126 LEU B CD1   1 
ATOM   3746 C  CD2   . LEU B 1 126 ? -20.639 79.467  43.344  1.00 50.45 ? 1126 LEU B CD2   1 
ATOM   3747 N  N     . GLU B 1 127 ? -15.703 81.611  43.066  1.00 50.63 ? 1127 GLU B N     1 
ATOM   3748 C  CA    . GLU B 1 127 ? -14.728 82.356  42.273  1.00 50.77 ? 1127 GLU B CA    1 
ATOM   3749 C  C     . GLU B 1 127 ? -13.846 81.416  41.443  1.00 50.59 ? 1127 GLU B C     1 
ATOM   3750 O  O     . GLU B 1 127 ? -13.507 81.727  40.305  1.00 50.82 ? 1127 GLU B O     1 
ATOM   3751 C  CB    . GLU B 1 127 ? -13.864 83.222  43.197  1.00 50.80 ? 1127 GLU B CB    1 
ATOM   3752 C  CG    . GLU B 1 127 ? -13.224 84.433  42.529  1.00 51.24 ? 1127 GLU B CG    1 
ATOM   3753 C  CD    . GLU B 1 127 ? -12.499 85.344  43.524  1.00 51.43 ? 1127 GLU B CD    1 
ATOM   3754 O  OE1   . GLU B 1 127 ? -13.035 85.602  44.628  1.00 51.76 ? 1127 GLU B OE1   1 
ATOM   3755 O  OE2   . GLU B 1 127 ? -11.386 85.810  43.197  1.00 52.83 ? 1127 GLU B OE2   1 
ATOM   3756 N  N     . ILE B 1 128 ? -13.486 80.268  42.013  1.00 50.39 ? 1128 ILE B N     1 
ATOM   3757 C  CA    . ILE B 1 128 ? -12.672 79.270  41.310  1.00 50.29 ? 1128 ILE B CA    1 
ATOM   3758 C  C     . ILE B 1 128 ? -13.456 78.557  40.206  1.00 50.11 ? 1128 ILE B C     1 
ATOM   3759 O  O     . ILE B 1 128 ? -12.969 78.422  39.080  1.00 50.08 ? 1128 ILE B O     1 
ATOM   3760 C  CB    . ILE B 1 128 ? -12.093 78.216  42.282  1.00 50.26 ? 1128 ILE B CB    1 
ATOM   3761 C  CG1   . ILE B 1 128 ? -10.825 78.758  42.952  1.00 50.60 ? 1128 ILE B CG1   1 
ATOM   3762 C  CG2   . ILE B 1 128 ? -11.771 76.932  41.551  1.00 50.04 ? 1128 ILE B CG2   1 
ATOM   3763 C  CD1   . ILE B 1 128 ? -10.098 77.744  43.815  1.00 50.53 ? 1128 ILE B CD1   1 
ATOM   3764 N  N     . LYS B 1 129 ? -14.660 78.097  40.535  1.00 49.91 ? 1129 LYS B N     1 
ATOM   3765 C  CA    . LYS B 1 129 ? -15.567 77.528  39.538  1.00 49.75 ? 1129 LYS B CA    1 
ATOM   3766 C  C     . LYS B 1 129 ? -15.768 78.473  38.348  1.00 49.91 ? 1129 LYS B C     1 
ATOM   3767 O  O     . LYS B 1 129 ? -15.900 78.012  37.217  1.00 50.13 ? 1129 LYS B O     1 
ATOM   3768 C  CB    . LYS B 1 129 ? -16.931 77.188  40.160  1.00 49.76 ? 1129 LYS B CB    1 
ATOM   3769 C  CG    . LYS B 1 129 ? -16.965 75.889  40.967  1.00 49.53 ? 1129 LYS B CG    1 
ATOM   3770 C  CD    . LYS B 1 129 ? -18.170 75.822  41.910  1.00 49.43 ? 1129 LYS B CD    1 
ATOM   3771 C  CE    . LYS B 1 129 ? -19.479 75.540  41.186  1.00 48.85 ? 1129 LYS B CE    1 
ATOM   3772 N  NZ    . LYS B 1 129 ? -19.592 74.115  40.796  1.00 48.87 ? 1129 LYS B NZ    1 
ATOM   3773 N  N     . ASN B 1 130 ? -15.780 79.782  38.605  1.00 49.89 ? 1130 ASN B N     1 
ATOM   3774 C  CA    . ASN B 1 130 ? -16.009 80.780  37.553  1.00 49.94 ? 1130 ASN B CA    1 
ATOM   3775 C  C     . ASN B 1 130 ? -14.834 80.987  36.601  1.00 49.88 ? 1130 ASN B C     1 
ATOM   3776 O  O     . ASN B 1 130 ? -15.039 81.114  35.392  1.00 49.74 ? 1130 ASN B O     1 
ATOM   3777 C  CB    . ASN B 1 130 ? -16.409 82.135  38.157  1.00 50.01 ? 1130 ASN B CB    1 
ATOM   3778 C  CG    . ASN B 1 130 ? -17.905 82.264  38.375  1.00 50.31 ? 1130 ASN B CG    1 
ATOM   3779 O  OD1   . ASN B 1 130 ? -18.689 81.410  37.959  1.00 50.63 ? 1130 ASN B OD1   1 
ATOM   3780 N  ND2   . ASN B 1 130 ? -18.310 83.348  39.023  1.00 51.17 ? 1130 ASN B ND2   1 
ATOM   3781 N  N     . LYS B 1 131 ? -13.617 81.051  37.135  1.00 49.90 ? 1131 LYS B N     1 
ATOM   3782 C  CA    . LYS B 1 131 ? -12.451 81.321  36.294  1.00 50.02 ? 1131 LYS B CA    1 
ATOM   3783 C  C     . LYS B 1 131 ? -12.193 80.111  35.408  1.00 50.21 ? 1131 LYS B C     1 
ATOM   3784 O  O     . LYS B 1 131 ? -11.973 80.250  34.205  1.00 50.29 ? 1131 LYS B O     1 
ATOM   3785 C  CB    . LYS B 1 131 ? -11.214 81.683  37.134  1.00 49.99 ? 1131 LYS B CB    1 
ATOM   3786 C  CG    . LYS B 1 131 ? -10.129 82.463  36.356  1.00 50.26 ? 1131 LYS B CG    1 
ATOM   3787 C  CD    . LYS B 1 131 ? -9.617  83.727  37.101  1.00 50.98 ? 1131 LYS B CD    1 
ATOM   3788 C  CE    . LYS B 1 131 ? -8.373  83.451  37.969  1.00 51.43 ? 1131 LYS B CE    1 
ATOM   3789 N  NZ    . LYS B 1 131 ? -8.033  84.560  38.924  1.00 50.51 ? 1131 LYS B NZ    1 
ATOM   3790 N  N     . ILE B 1 132 ? -12.257 78.924  36.000  1.00 50.36 ? 1132 ILE B N     1 
ATOM   3791 C  CA    . ILE B 1 132 ? -12.117 77.690  35.243  1.00 50.57 ? 1132 ILE B CA    1 
ATOM   3792 C  C     . ILE B 1 132 ? -13.210 77.605  34.188  1.00 50.85 ? 1132 ILE B C     1 
ATOM   3793 O  O     . ILE B 1 132 ? -12.936 77.315  33.029  1.00 50.85 ? 1132 ILE B O     1 
ATOM   3794 C  CB    . ILE B 1 132 ? -12.162 76.453  36.163  1.00 50.51 ? 1132 ILE B CB    1 
ATOM   3795 C  CG1   . ILE B 1 132 ? -10.884 76.393  37.002  1.00 50.53 ? 1132 ILE B CG1   1 
ATOM   3796 C  CG2   . ILE B 1 132 ? -12.315 75.179  35.358  1.00 49.92 ? 1132 ILE B CG2   1 
ATOM   3797 C  CD1   . ILE B 1 132 ? -10.796 75.185  37.899  1.00 50.76 ? 1132 ILE B CD1   1 
ATOM   3798 N  N     . LEU B 1 133 ? -14.445 77.889  34.581  1.00 51.31 ? 1133 LEU B N     1 
ATOM   3799 C  CA    . LEU B 1 133 ? -15.555 77.849  33.635  1.00 51.59 ? 1133 LEU B CA    1 
ATOM   3800 C  C     . LEU B 1 133 ? -15.371 78.861  32.505  1.00 51.90 ? 1133 LEU B C     1 
ATOM   3801 O  O     . LEU B 1 133 ? -15.824 78.624  31.389  1.00 52.05 ? 1133 LEU B O     1 
ATOM   3802 C  CB    . LEU B 1 133 ? -16.891 78.082  34.351  1.00 51.63 ? 1133 LEU B CB    1 
ATOM   3803 C  CG    . LEU B 1 133 ? -18.189 78.025  33.533  1.00 51.63 ? 1133 LEU B CG    1 
ATOM   3804 C  CD1   . LEU B 1 133 ? -18.245 76.790  32.645  1.00 52.21 ? 1133 LEU B CD1   1 
ATOM   3805 C  CD2   . LEU B 1 133 ? -19.398 78.056  34.466  1.00 51.64 ? 1133 LEU B CD2   1 
ATOM   3806 N  N     . GLU B 1 134 ? -14.698 79.976  32.779  1.00 52.22 ? 1134 GLU B N     1 
ATOM   3807 C  CA    . GLU B 1 134 ? -14.498 81.000  31.754  1.00 52.57 ? 1134 GLU B CA    1 
ATOM   3808 C  C     . GLU B 1 134 ? -13.282 80.696  30.869  1.00 52.56 ? 1134 GLU B C     1 
ATOM   3809 O  O     . GLU B 1 134 ? -13.364 80.816  29.645  1.00 52.47 ? 1134 GLU B O     1 
ATOM   3810 C  CB    . GLU B 1 134 ? -14.392 82.409  32.371  1.00 52.47 ? 1134 GLU B CB    1 
ATOM   3811 C  CG    . GLU B 1 134 ? -14.828 83.516  31.405  1.00 52.73 ? 1134 GLU B CG    1 
ATOM   3812 C  CD    . GLU B 1 134 ? -14.202 84.879  31.696  1.00 53.17 ? 1134 GLU B CD    1 
ATOM   3813 O  OE1   . GLU B 1 134 ? -13.939 85.625  30.723  1.00 53.68 ? 1134 GLU B OE1   1 
ATOM   3814 O  OE2   . GLU B 1 134 ? -13.979 85.209  32.885  1.00 53.67 ? 1134 GLU B OE2   1 
ATOM   3815 N  N     . LYS B 1 135 ? -12.163 80.309  31.482  1.00 52.67 ? 1135 LYS B N     1 
ATOM   3816 C  CA    . LYS B 1 135 ? -10.923 80.073  30.728  1.00 52.81 ? 1135 LYS B CA    1 
ATOM   3817 C  C     . LYS B 1 135 ? -10.933 78.754  29.972  1.00 52.93 ? 1135 LYS B C     1 
ATOM   3818 O  O     . LYS B 1 135 ? -10.313 78.646  28.910  1.00 53.15 ? 1135 LYS B O     1 
ATOM   3819 C  CB    . LYS B 1 135 ? -9.693  80.118  31.640  1.00 52.74 ? 1135 LYS B CB    1 
ATOM   3820 C  CG    . LYS B 1 135 ? -9.361  81.506  32.156  1.00 53.01 ? 1135 LYS B CG    1 
ATOM   3821 C  CD    . LYS B 1 135 ? -8.657  82.361  31.102  1.00 53.19 ? 1135 LYS B CD    1 
ATOM   3822 C  CE    . LYS B 1 135 ? -8.851  83.854  31.377  1.00 53.11 ? 1135 LYS B CE    1 
ATOM   3823 N  NZ    . LYS B 1 135 ? -8.747  84.177  32.834  1.00 52.49 ? 1135 LYS B NZ    1 
ATOM   3824 N  N     . GLU B 1 136 ? -11.639 77.760  30.509  1.00 52.92 ? 1136 GLU B N     1 
ATOM   3825 C  CA    . GLU B 1 136 ? -11.570 76.401  29.979  1.00 52.98 ? 1136 GLU B CA    1 
ATOM   3826 C  C     . GLU B 1 136 ? -12.896 75.804  29.521  1.00 52.75 ? 1136 GLU B C     1 
ATOM   3827 O  O     . GLU B 1 136 ? -12.896 74.792  28.818  1.00 52.89 ? 1136 GLU B O     1 
ATOM   3828 C  CB    . GLU B 1 136 ? -10.957 75.487  31.037  1.00 53.16 ? 1136 GLU B CB    1 
ATOM   3829 C  CG    . GLU B 1 136 ? -9.515  75.819  31.373  1.00 54.27 ? 1136 GLU B CG    1 
ATOM   3830 C  CD    . GLU B 1 136 ? -8.554  75.485  30.247  1.00 56.18 ? 1136 GLU B CD    1 
ATOM   3831 O  OE1   . GLU B 1 136 ? -8.853  74.566  29.447  1.00 58.12 ? 1136 GLU B OE1   1 
ATOM   3832 O  OE2   . GLU B 1 136 ? -7.494  76.143  30.169  1.00 57.02 ? 1136 GLU B OE2   1 
ATOM   3833 N  N     . LYS B 1 137 ? -14.015 76.413  29.901  1.00 52.43 ? 1137 LYS B N     1 
ATOM   3834 C  CA    . LYS B 1 137 ? -15.330 75.821  29.650  1.00 52.32 ? 1137 LYS B CA    1 
ATOM   3835 C  C     . LYS B 1 137 ? -15.479 74.483  30.393  1.00 51.55 ? 1137 LYS B C     1 
ATOM   3836 O  O     . LYS B 1 137 ? -16.102 73.556  29.890  1.00 51.60 ? 1137 LYS B O     1 
ATOM   3837 C  CB    . LYS B 1 137 ? -15.575 75.617  28.142  1.00 52.58 ? 1137 LYS B CB    1 
ATOM   3838 C  CG    . LYS B 1 137 ? -15.154 76.783  27.224  1.00 52.94 ? 1137 LYS B CG    1 
ATOM   3839 C  CD    . LYS B 1 137 ? -15.278 76.382  25.737  1.00 53.38 ? 1137 LYS B CD    1 
ATOM   3840 C  CE    . LYS B 1 137 ? -14.562 77.362  24.796  1.00 54.10 ? 1137 LYS B CE    1 
ATOM   3841 N  NZ    . LYS B 1 137 ? -14.945 78.793  25.091  1.00 55.26 ? 1137 LYS B NZ    1 
ATOM   3842 N  N     . ILE B 1 138 ? -14.903 74.391  31.589  1.00 50.82 ? 1138 ILE B N     1 
ATOM   3843 C  CA    . ILE B 1 138 ? -14.994 73.184  32.406  1.00 50.08 ? 1138 ILE B CA    1 
ATOM   3844 C  C     . ILE B 1 138 ? -15.693 73.499  33.724  1.00 49.56 ? 1138 ILE B C     1 
ATOM   3845 O  O     . ILE B 1 138 ? -15.338 74.455  34.406  1.00 49.65 ? 1138 ILE B O     1 
ATOM   3846 C  CB    . ILE B 1 138 ? -13.598 72.587  32.714  1.00 50.16 ? 1138 ILE B CB    1 
ATOM   3847 C  CG1   . ILE B 1 138 ? -12.822 72.325  31.421  1.00 50.12 ? 1138 ILE B CG1   1 
ATOM   3848 C  CG2   . ILE B 1 138 ? -13.728 71.284  33.494  1.00 49.17 ? 1138 ILE B CG2   1 
ATOM   3849 C  CD1   . ILE B 1 138 ? -13.427 71.241  30.563  1.00 50.24 ? 1138 ILE B CD1   1 
ATOM   3850 N  N     . THR B 1 139 ? -16.695 72.693  34.061  1.00 48.84 ? 1139 THR B N     1 
ATOM   3851 C  CA    . THR B 1 139 ? -17.349 72.728  35.358  1.00 48.46 ? 1139 THR B CA    1 
ATOM   3852 C  C     . THR B 1 139 ? -16.651 71.747  36.306  1.00 47.94 ? 1139 THR B C     1 
ATOM   3853 O  O     . THR B 1 139 ? -16.184 70.686  35.890  1.00 48.32 ? 1139 THR B O     1 
ATOM   3854 C  CB    . THR B 1 139 ? -18.835 72.326  35.240  1.00 48.54 ? 1139 THR B CB    1 
ATOM   3855 O  OG1   . THR B 1 139 ? -18.934 70.961  34.804  1.00 48.99 ? 1139 THR B OG1   1 
ATOM   3856 C  CG2   . THR B 1 139 ? -19.567 73.224  34.248  1.00 48.38 ? 1139 THR B CG2   1 
ATOM   3857 N  N     . VAL B 1 140 ? -16.589 72.106  37.579  1.00 47.21 ? 1140 VAL B N     1 
ATOM   3858 C  CA    . VAL B 1 140 ? -15.923 71.296  38.592  1.00 46.52 ? 1140 VAL B CA    1 
ATOM   3859 C  C     . VAL B 1 140 ? -16.756 71.301  39.872  1.00 46.14 ? 1140 VAL B C     1 
ATOM   3860 O  O     . VAL B 1 140 ? -17.581 72.198  40.089  1.00 46.23 ? 1140 VAL B O     1 
ATOM   3861 C  CB    . VAL B 1 140 ? -14.511 71.846  38.921  1.00 46.54 ? 1140 VAL B CB    1 
ATOM   3862 C  CG1   . VAL B 1 140 ? -13.686 72.042  37.649  1.00 45.82 ? 1140 VAL B CG1   1 
ATOM   3863 C  CG2   . VAL B 1 140 ? -14.614 73.161  39.707  1.00 46.05 ? 1140 VAL B CG2   1 
ATOM   3864 N  N     . THR B 1 141 ? -16.539 70.292  40.709  1.00 45.43 ? 1141 THR B N     1 
ATOM   3865 C  CA    . THR B 1 141 ? -17.136 70.252  42.033  1.00 44.90 ? 1141 THR B CA    1 
ATOM   3866 C  C     . THR B 1 141 ? -16.082 70.657  43.048  1.00 44.57 ? 1141 THR B C     1 
ATOM   3867 O  O     . THR B 1 141 ? -14.919 70.267  42.935  1.00 44.31 ? 1141 THR B O     1 
ATOM   3868 C  CB    . THR B 1 141 ? -17.686 68.860  42.368  1.00 44.85 ? 1141 THR B CB    1 
ATOM   3869 O  OG1   . THR B 1 141 ? -18.558 68.431  41.315  1.00 45.03 ? 1141 THR B OG1   1 
ATOM   3870 C  CG2   . THR B 1 141 ? -18.457 68.893  43.675  1.00 44.17 ? 1141 THR B CG2   1 
ATOM   3871 N  N     . VAL B 1 142 ? -16.494 71.455  44.028  1.00 44.28 ? 1142 VAL B N     1 
ATOM   3872 C  CA    . VAL B 1 142 ? -15.596 71.940  45.060  1.00 44.19 ? 1142 VAL B CA    1 
ATOM   3873 C  C     . VAL B 1 142 ? -16.048 71.408  46.417  1.00 44.32 ? 1142 VAL B C     1 
ATOM   3874 O  O     . VAL B 1 142 ? -17.236 71.444  46.742  1.00 44.46 ? 1142 VAL B O     1 
ATOM   3875 C  CB    . VAL B 1 142 ? -15.551 73.492  45.071  1.00 44.40 ? 1142 VAL B CB    1 
ATOM   3876 C  CG1   . VAL B 1 142 ? -15.048 74.036  46.423  1.00 43.70 ? 1142 VAL B CG1   1 
ATOM   3877 C  CG2   . VAL B 1 142 ? -14.696 74.000  43.924  1.00 43.67 ? 1142 VAL B CG2   1 
ATOM   3878 N  N     . GLY B 1 143 ? -15.096 70.908  47.200  1.00 44.30 ? 1143 GLY B N     1 
ATOM   3879 C  CA    . GLY B 1 143 ? -15.368 70.487  48.569  1.00 44.55 ? 1143 GLY B CA    1 
ATOM   3880 C  C     . GLY B 1 143 ? -14.492 71.272  49.527  1.00 44.72 ? 1143 GLY B C     1 
ATOM   3881 O  O     . GLY B 1 143 ? -13.296 71.451  49.267  1.00 44.86 ? 1143 GLY B O     1 
ATOM   3882 N  N     . ILE B 1 144 ? -15.084 71.746  50.624  1.00 44.70 ? 1144 ILE B N     1 
ATOM   3883 C  CA    . ILE B 1 144 ? -14.358 72.515  51.642  1.00 44.76 ? 1144 ILE B CA    1 
ATOM   3884 C  C     . ILE B 1 144 ? -14.609 71.968  53.042  1.00 44.75 ? 1144 ILE B C     1 
ATOM   3885 O  O     . ILE B 1 144 ? -15.758 71.855  53.467  1.00 44.55 ? 1144 ILE B O     1 
ATOM   3886 C  CB    . ILE B 1 144 ? -14.781 73.997  51.637  1.00 44.94 ? 1144 ILE B CB    1 
ATOM   3887 C  CG1   . ILE B 1 144 ? -14.381 74.660  50.312  1.00 44.97 ? 1144 ILE B CG1   1 
ATOM   3888 C  CG2   . ILE B 1 144 ? -14.159 74.739  52.828  1.00 44.38 ? 1144 ILE B CG2   1 
ATOM   3889 C  CD1   . ILE B 1 144 ? -14.901 76.067  50.148  1.00 44.89 ? 1144 ILE B CD1   1 
ATOM   3890 N  N     . SER B 1 145 ? -13.530 71.636  53.750  1.00 44.88 ? 1145 SER B N     1 
ATOM   3891 C  CA    . SER B 1 145 ? -13.603 71.223  55.156  1.00 44.99 ? 1145 SER B CA    1 
ATOM   3892 C  C     . SER B 1 145 ? -12.226 71.375  55.819  1.00 45.12 ? 1145 SER B C     1 
ATOM   3893 O  O     . SER B 1 145 ? -11.357 72.058  55.281  1.00 44.89 ? 1145 SER B O     1 
ATOM   3894 C  CB    . SER B 1 145 ? -14.136 69.789  55.279  1.00 45.07 ? 1145 SER B CB    1 
ATOM   3895 O  OG    . SER B 1 145 ? -14.828 69.608  56.508  1.00 44.72 ? 1145 SER B OG    1 
ATOM   3896 N  N     . LYS B 1 146 ? -12.025 70.739  56.973  1.00 45.51 ? 1146 LYS B N     1 
ATOM   3897 C  CA    . LYS B 1 146 ? -10.852 71.023  57.821  1.00 45.86 ? 1146 LYS B CA    1 
ATOM   3898 C  C     . LYS B 1 146 ? -9.596  70.202  57.487  1.00 46.07 ? 1146 LYS B C     1 
ATOM   3899 O  O     . LYS B 1 146 ? -8.498  70.526  57.932  1.00 45.81 ? 1146 LYS B O     1 
ATOM   3900 C  CB    . LYS B 1 146 ? -11.209 70.901  59.315  1.00 45.75 ? 1146 LYS B CB    1 
ATOM   3901 C  CG    . LYS B 1 146 ? -11.911 69.607  59.739  1.00 45.88 ? 1146 LYS B CG    1 
ATOM   3902 C  CD    . LYS B 1 146 ? -11.786 69.357  61.250  1.00 46.20 ? 1146 LYS B CD    1 
ATOM   3903 C  CE    . LYS B 1 146 ? -10.445 68.703  61.613  1.00 46.61 ? 1146 LYS B CE    1 
ATOM   3904 N  NZ    . LYS B 1 146 ? -10.085 68.944  63.036  1.00 46.70 ? 1146 LYS B NZ    1 
ATOM   3905 N  N     . ASN B 1 147 ? -9.752  69.146  56.702  1.00 46.58 ? 1147 ASN B N     1 
ATOM   3906 C  CA    . ASN B 1 147 ? -8.601  68.362  56.257  1.00 47.12 ? 1147 ASN B CA    1 
ATOM   3907 C  C     . ASN B 1 147 ? -8.834  67.778  54.867  1.00 47.33 ? 1147 ASN B C     1 
ATOM   3908 O  O     . ASN B 1 147 ? -9.940  67.845  54.330  1.00 47.49 ? 1147 ASN B O     1 
ATOM   3909 C  CB    . ASN B 1 147 ? -8.276  67.256  57.269  1.00 47.15 ? 1147 ASN B CB    1 
ATOM   3910 C  CG    . ASN B 1 147 ? -9.467  66.354  57.555  1.00 47.53 ? 1147 ASN B CG    1 
ATOM   3911 O  OD1   . ASN B 1 147 ? -10.162 65.918  56.641  1.00 48.56 ? 1147 ASN B OD1   1 
ATOM   3912 N  ND2   . ASN B 1 147 ? -9.701  66.066  58.830  1.00 47.75 ? 1147 ASN B ND2   1 
ATOM   3913 N  N     . LYS B 1 148 ? -7.792  67.205  54.287  1.00 47.60 ? 1148 LYS B N     1 
ATOM   3914 C  CA    . LYS B 1 148 ? -7.885  66.672  52.937  1.00 47.82 ? 1148 LYS B CA    1 
ATOM   3915 C  C     . LYS B 1 148 ? -9.071  65.715  52.772  1.00 47.87 ? 1148 LYS B C     1 
ATOM   3916 O  O     . LYS B 1 148 ? -9.856  65.845  51.820  1.00 48.17 ? 1148 LYS B O     1 
ATOM   3917 C  CB    . LYS B 1 148 ? -6.581  65.969  52.550  1.00 47.89 ? 1148 LYS B CB    1 
ATOM   3918 C  CG    . LYS B 1 148 ? -5.374  66.901  52.452  1.00 48.08 ? 1148 LYS B CG    1 
ATOM   3919 C  CD    . LYS B 1 148 ? -4.230  66.281  51.657  1.00 48.22 ? 1148 LYS B CD    1 
ATOM   3920 C  CE    . LYS B 1 148 ? -3.508  65.179  52.431  1.00 49.02 ? 1148 LYS B CE    1 
ATOM   3921 N  NZ    . LYS B 1 148 ? -2.683  64.316  51.521  1.00 49.64 ? 1148 LYS B NZ    1 
ATOM   3922 N  N     . VAL B 1 149 ? -9.210  64.772  53.702  1.00 47.69 ? 1149 VAL B N     1 
ATOM   3923 C  CA    . VAL B 1 149 ? -10.184 63.685  53.550  1.00 47.49 ? 1149 VAL B CA    1 
ATOM   3924 C  C     . VAL B 1 149 ? -11.613 64.185  53.563  1.00 47.46 ? 1149 VAL B C     1 
ATOM   3925 O  O     . VAL B 1 149 ? -12.422 63.770  52.737  1.00 47.63 ? 1149 VAL B O     1 
ATOM   3926 C  CB    . VAL B 1 149 ? -10.041 62.626  54.650  1.00 47.53 ? 1149 VAL B CB    1 
ATOM   3927 C  CG1   . VAL B 1 149 ? -11.204 61.641  54.591  1.00 47.17 ? 1149 VAL B CG1   1 
ATOM   3928 C  CG2   . VAL B 1 149 ? -8.709  61.905  54.513  1.00 47.25 ? 1149 VAL B CG2   1 
ATOM   3929 N  N     . PHE B 1 150 ? -11.922 65.075  54.497  1.00 47.43 ? 1150 PHE B N     1 
ATOM   3930 C  CA    . PHE B 1 150 ? -13.283 65.599  54.615  1.00 47.51 ? 1150 PHE B CA    1 
ATOM   3931 C  C     . PHE B 1 150 ? -13.612 66.610  53.522  1.00 47.35 ? 1150 PHE B C     1 
ATOM   3932 O  O     . PHE B 1 150 ? -14.773 66.744  53.140  1.00 47.45 ? 1150 PHE B O     1 
ATOM   3933 C  CB    . PHE B 1 150 ? -13.536 66.170  56.013  1.00 47.61 ? 1150 PHE B CB    1 
ATOM   3934 C  CG    . PHE B 1 150 ? -13.843 65.116  57.031  1.00 47.75 ? 1150 PHE B CG    1 
ATOM   3935 C  CD1   . PHE B 1 150 ? -15.118 64.575  57.116  1.00 48.47 ? 1150 PHE B CD1   1 
ATOM   3936 C  CD2   . PHE B 1 150 ? -12.860 64.636  57.880  1.00 48.13 ? 1150 PHE B CD2   1 
ATOM   3937 C  CE1   . PHE B 1 150 ? -15.416 63.585  58.045  1.00 48.27 ? 1150 PHE B CE1   1 
ATOM   3938 C  CE2   . PHE B 1 150 ? -13.147 63.647  58.815  1.00 48.48 ? 1150 PHE B CE2   1 
ATOM   3939 C  CZ    . PHE B 1 150 ? -14.427 63.119  58.895  1.00 48.29 ? 1150 PHE B CZ    1 
ATOM   3940 N  N     . ALA B 1 151 ? -12.597 67.304  53.012  1.00 47.19 ? 1151 ALA B N     1 
ATOM   3941 C  CA    . ALA B 1 151 ? -12.759 68.116  51.801  1.00 47.04 ? 1151 ALA B CA    1 
ATOM   3942 C  C     . ALA B 1 151 ? -13.292 67.250  50.668  1.00 46.74 ? 1151 ALA B C     1 
ATOM   3943 O  O     . ALA B 1 151 ? -14.280 67.599  50.020  1.00 46.44 ? 1151 ALA B O     1 
ATOM   3944 C  CB    . ALA B 1 151 ? -11.438 68.751  51.398  1.00 47.02 ? 1151 ALA B CB    1 
ATOM   3945 N  N     . LYS B 1 152 ? -12.646 66.104  50.466  1.00 46.61 ? 1152 LYS B N     1 
ATOM   3946 C  CA    . LYS B 1 152 ? -12.979 65.200  49.360  1.00 46.63 ? 1152 LYS B CA    1 
ATOM   3947 C  C     . LYS B 1 152 ? -14.383 64.610  49.462  1.00 46.68 ? 1152 LYS B C     1 
ATOM   3948 O  O     . LYS B 1 152 ? -15.034 64.369  48.442  1.00 46.64 ? 1152 LYS B O     1 
ATOM   3949 C  CB    . LYS B 1 152 ? -11.952 64.069  49.265  1.00 46.51 ? 1152 LYS B CB    1 
ATOM   3950 C  CG    . LYS B 1 152 ? -12.098 63.220  48.024  1.00 46.36 ? 1152 LYS B CG    1 
ATOM   3951 C  CD    . LYS B 1 152 ? -10.914 62.315  47.827  1.00 46.76 ? 1152 LYS B CD    1 
ATOM   3952 C  CE    . LYS B 1 152 ? -11.054 61.500  46.558  1.00 47.26 ? 1152 LYS B CE    1 
ATOM   3953 N  NZ    . LYS B 1 152 ? -10.933 62.354  45.341  1.00 48.29 ? 1152 LYS B NZ    1 
ATOM   3954 N  N     . ILE B 1 153 ? -14.835 64.363  50.688  1.00 46.81 ? 1153 ILE B N     1 
ATOM   3955 C  CA    . ILE B 1 153 ? -16.171 63.822  50.924  1.00 46.76 ? 1153 ILE B CA    1 
ATOM   3956 C  C     . ILE B 1 153 ? -17.204 64.877  50.547  1.00 46.71 ? 1153 ILE B C     1 
ATOM   3957 O  O     . ILE B 1 153 ? -18.236 64.554  49.961  1.00 46.48 ? 1153 ILE B O     1 
ATOM   3958 C  CB    . ILE B 1 153 ? -16.361 63.397  52.398  1.00 46.91 ? 1153 ILE B CB    1 
ATOM   3959 C  CG1   . ILE B 1 153 ? -15.359 62.304  52.782  1.00 47.36 ? 1153 ILE B CG1   1 
ATOM   3960 C  CG2   . ILE B 1 153 ? -17.768 62.861  52.637  1.00 46.65 ? 1153 ILE B CG2   1 
ATOM   3961 C  CD1   . ILE B 1 153 ? -15.071 62.249  54.268  1.00 47.60 ? 1153 ILE B CD1   1 
ATOM   3962 N  N     . ALA B 1 154 ? -16.907 66.137  50.868  1.00 46.86 ? 1154 ALA B N     1 
ATOM   3963 C  CA    . ALA B 1 154 ? -17.798 67.251  50.545  1.00 47.19 ? 1154 ALA B CA    1 
ATOM   3964 C  C     . ALA B 1 154 ? -18.072 67.287  49.053  1.00 47.51 ? 1154 ALA B C     1 
ATOM   3965 O  O     . ALA B 1 154 ? -19.229 67.319  48.631  1.00 47.31 ? 1154 ALA B O     1 
ATOM   3966 C  CB    . ALA B 1 154 ? -17.197 68.568  50.994  1.00 47.21 ? 1154 ALA B CB    1 
ATOM   3967 N  N     . ALA B 1 155 ? -16.996 67.277  48.268  1.00 47.96 ? 1155 ALA B N     1 
ATOM   3968 C  CA    . ALA B 1 155 ? -17.091 67.195  46.814  1.00 48.34 ? 1155 ALA B CA    1 
ATOM   3969 C  C     . ALA B 1 155 ? -17.975 66.030  46.411  1.00 48.84 ? 1155 ALA B C     1 
ATOM   3970 O  O     . ALA B 1 155 ? -18.922 66.217  45.651  1.00 48.97 ? 1155 ALA B O     1 
ATOM   3971 C  CB    . ALA B 1 155 ? -15.713 67.043  46.185  1.00 48.18 ? 1155 ALA B CB    1 
ATOM   3972 N  N     . ASP B 1 156 ? -17.683 64.838  46.933  1.00 49.37 ? 1156 ASP B N     1 
ATOM   3973 C  CA    . ASP B 1 156 ? -18.440 63.635  46.560  1.00 50.01 ? 1156 ASP B CA    1 
ATOM   3974 C  C     . ASP B 1 156 ? -19.944 63.841  46.733  1.00 50.25 ? 1156 ASP B C     1 
ATOM   3975 O  O     . ASP B 1 156 ? -20.724 63.543  45.835  1.00 50.33 ? 1156 ASP B O     1 
ATOM   3976 C  CB    . ASP B 1 156 ? -17.974 62.405  47.357  1.00 50.12 ? 1156 ASP B CB    1 
ATOM   3977 C  CG    . ASP B 1 156 ? -16.643 61.836  46.852  1.00 51.33 ? 1156 ASP B CG    1 
ATOM   3978 O  OD1   . ASP B 1 156 ? -16.061 62.390  45.893  1.00 52.45 ? 1156 ASP B OD1   1 
ATOM   3979 O  OD2   . ASP B 1 156 ? -16.175 60.820  47.415  1.00 52.85 ? 1156 ASP B OD2   1 
ATOM   3980 N  N     . MET B 1 157 ? -20.346 64.380  47.876  1.00 50.61 ? 1157 MET B N     1 
ATOM   3981 C  CA    . MET B 1 157 ? -21.761 64.594  48.154  1.00 50.86 ? 1157 MET B CA    1 
ATOM   3982 C  C     . MET B 1 157 ? -22.394 65.672  47.265  1.00 51.13 ? 1157 MET B C     1 
ATOM   3983 O  O     . MET B 1 157 ? -23.596 65.628  46.977  1.00 51.17 ? 1157 MET B O     1 
ATOM   3984 C  CB    . MET B 1 157 ? -21.943 64.975  49.613  1.00 50.78 ? 1157 MET B CB    1 
ATOM   3985 C  CG    . MET B 1 157 ? -21.546 63.881  50.562  1.00 50.92 ? 1157 MET B CG    1 
ATOM   3986 S  SD    . MET B 1 157 ? -21.920 64.326  52.261  1.00 51.09 ? 1157 MET B SD    1 
ATOM   3987 C  CE    . MET B 1 157 ? -21.489 62.781  53.065  1.00 50.84 ? 1157 MET B CE    1 
ATOM   3988 N  N     . ALA B 1 158 ? -21.581 66.632  46.835  1.00 51.35 ? 1158 ALA B N     1 
ATOM   3989 C  CA    . ALA B 1 158 ? -22.076 67.808  46.135  1.00 51.45 ? 1158 ALA B CA    1 
ATOM   3990 C  C     . ALA B 1 158 ? -21.875 67.725  44.640  1.00 51.79 ? 1158 ALA B C     1 
ATOM   3991 O  O     . ALA B 1 158 ? -21.971 68.756  43.978  1.00 51.92 ? 1158 ALA B O     1 
ATOM   3992 C  CB    . ALA B 1 158 ? -21.377 69.044  46.651  1.00 51.26 ? 1158 ALA B CB    1 
ATOM   3993 N  N     . LYS B 1 159 ? -21.607 66.532  44.096  1.00 52.13 ? 1159 LYS B N     1 
ATOM   3994 C  CA    . LYS B 1 159 ? -21.189 66.432  42.691  1.00 52.38 ? 1159 LYS B CA    1 
ATOM   3995 C  C     . LYS B 1 159 ? -22.270 66.962  41.752  1.00 52.61 ? 1159 LYS B C     1 
ATOM   3996 O  O     . LYS B 1 159 ? -23.218 67.594  42.203  1.00 53.50 ? 1159 LYS B O     1 
ATOM   3997 C  CB    . LYS B 1 159 ? -20.626 65.048  42.326  1.00 52.28 ? 1159 LYS B CB    1 
ATOM   3998 C  CG    . LYS B 1 159 ? -19.149 64.962  42.662  1.00 52.43 ? 1159 LYS B CG    1 
ATOM   3999 C  CD    . LYS B 1 159 ? -18.432 63.735  42.135  1.00 52.77 ? 1159 LYS B CD    1 
ATOM   4000 C  CE    . LYS B 1 159 ? -16.958 63.804  42.575  1.00 53.69 ? 1159 LYS B CE    1 
ATOM   4001 N  NZ    . LYS B 1 159 ? -16.069 62.779  41.973  1.00 54.27 ? 1159 LYS B NZ    1 
ATOM   4002 N  N     . PRO B 1 160 ? -22.229 66.591  40.481  1.00 52.50 ? 1160 PRO B N     1 
ATOM   4003 C  CA    . PRO B 1 160 ? -22.138 67.423  39.304  1.00 52.08 ? 1160 PRO B CA    1 
ATOM   4004 C  C     . PRO B 1 160 ? -22.137 68.930  39.586  1.00 51.76 ? 1160 PRO B C     1 
ATOM   4005 O  O     . PRO B 1 160 ? -23.103 69.459  40.129  1.00 51.63 ? 1160 PRO B O     1 
ATOM   4006 C  CB    . PRO B 1 160 ? -23.371 66.999  38.506  1.00 52.19 ? 1160 PRO B CB    1 
ATOM   4007 C  CG    . PRO B 1 160 ? -23.796 65.631  39.116  1.00 52.78 ? 1160 PRO B CG    1 
ATOM   4008 C  CD    . PRO B 1 160 ? -22.727 65.266  40.114  1.00 52.85 ? 1160 PRO B CD    1 
ATOM   4009 N  N     . ASN B 1 161 ? -21.046 69.604  39.223  1.00 51.38 ? 1161 ASN B N     1 
ATOM   4010 C  CA    . ASN B 1 161 ? -20.980 71.071  39.233  1.00 50.90 ? 1161 ASN B CA    1 
ATOM   4011 C  C     . ASN B 1 161 ? -21.587 71.671  40.505  1.00 50.37 ? 1161 ASN B C     1 
ATOM   4012 O  O     . ASN B 1 161 ? -22.470 72.534  40.456  1.00 50.37 ? 1161 ASN B O     1 
ATOM   4013 C  CB    . ASN B 1 161 ? -21.662 71.633  37.976  1.00 50.93 ? 1161 ASN B CB    1 
ATOM   4014 C  CG    . ASN B 1 161 ? -21.670 73.162  37.934  1.00 51.52 ? 1161 ASN B CG    1 
ATOM   4015 O  OD1   . ASN B 1 161 ? -20.633 73.819  38.090  1.00 52.52 ? 1161 ASN B OD1   1 
ATOM   4016 N  ND2   . ASN B 1 161 ? -22.850 73.733  37.724  1.00 52.01 ? 1161 ASN B ND2   1 
ATOM   4017 N  N     . GLY B 1 162 ? -21.104 71.198  41.647  1.00 49.66 ? 1162 GLY B N     1 
ATOM   4018 C  CA    . GLY B 1 162 ? -21.572 71.683  42.927  1.00 49.06 ? 1162 GLY B CA    1 
ATOM   4019 C  C     . GLY B 1 162 ? -20.483 72.342  43.738  1.00 48.60 ? 1162 GLY B C     1 
ATOM   4020 O  O     . GLY B 1 162 ? -19.366 72.557  43.266  1.00 48.02 ? 1162 GLY B O     1 
ATOM   4021 N  N     . ILE B 1 163 ? -20.854 72.686  44.967  1.00 48.31 ? 1163 ILE B N     1 
ATOM   4022 C  CA    . ILE B 1 163 ? -19.942 73.228  45.962  1.00 47.98 ? 1163 ILE B CA    1 
ATOM   4023 C  C     . ILE B 1 163 ? -20.532 72.885  47.330  1.00 47.83 ? 1163 ILE B C     1 
ATOM   4024 O  O     . ILE B 1 163 ? -21.753 72.950  47.515  1.00 47.84 ? 1163 ILE B O     1 
ATOM   4025 C  CB    . ILE B 1 163 ? -19.745 74.755  45.796  1.00 47.85 ? 1163 ILE B CB    1 
ATOM   4026 C  CG1   . ILE B 1 163 ? -18.818 75.296  46.893  1.00 47.51 ? 1163 ILE B CG1   1 
ATOM   4027 C  CG2   . ILE B 1 163 ? -21.091 75.463  45.790  1.00 47.61 ? 1163 ILE B CG2   1 
ATOM   4028 C  CD1   . ILE B 1 163 ? -18.146 76.602  46.543  1.00 47.27 ? 1163 ILE B CD1   1 
ATOM   4029 N  N     . LYS B 1 164 ? -19.672 72.506  48.272  1.00 47.46 ? 1164 LYS B N     1 
ATOM   4030 C  CA    . LYS B 1 164 ? -20.125 71.955  49.549  1.00 47.23 ? 1164 LYS B CA    1 
ATOM   4031 C  C     . LYS B 1 164 ? -19.144 72.266  50.670  1.00 46.92 ? 1164 LYS B C     1 
ATOM   4032 O  O     . LYS B 1 164 ? -17.936 72.044  50.531  1.00 46.88 ? 1164 LYS B O     1 
ATOM   4033 C  CB    . LYS B 1 164 ? -20.308 70.438  49.411  1.00 47.35 ? 1164 LYS B CB    1 
ATOM   4034 C  CG    . LYS B 1 164 ? -20.578 69.658  50.693  1.00 47.32 ? 1164 LYS B CG    1 
ATOM   4035 C  CD    . LYS B 1 164 ? -21.964 69.923  51.235  1.00 47.56 ? 1164 LYS B CD    1 
ATOM   4036 C  CE    . LYS B 1 164 ? -22.224 69.113  52.506  1.00 48.03 ? 1164 LYS B CE    1 
ATOM   4037 N  NZ    . LYS B 1 164 ? -23.128 69.832  53.474  1.00 48.25 ? 1164 LYS B NZ    1 
ATOM   4038 N  N     . VAL B 1 165 ? -19.679 72.784  51.774  1.00 46.54 ? 1165 VAL B N     1 
ATOM   4039 C  CA    . VAL B 1 165 ? -18.919 72.954  53.006  1.00 46.22 ? 1165 VAL B CA    1 
ATOM   4040 C  C     . VAL B 1 165 ? -19.380 71.904  54.012  1.00 46.01 ? 1165 VAL B C     1 
ATOM   4041 O  O     . VAL B 1 165 ? -20.575 71.663  54.165  1.00 45.82 ? 1165 VAL B O     1 
ATOM   4042 C  CB    . VAL B 1 165 ? -19.115 74.352  53.622  1.00 46.13 ? 1165 VAL B CB    1 
ATOM   4043 C  CG1   . VAL B 1 165 ? -18.206 74.525  54.820  1.00 45.79 ? 1165 VAL B CG1   1 
ATOM   4044 C  CG2   . VAL B 1 165 ? -18.843 75.436  52.590  1.00 46.21 ? 1165 VAL B CG2   1 
ATOM   4045 N  N     . ILE B 1 166 ? -18.420 71.265  54.669  1.00 45.98 ? 1166 ILE B N     1 
ATOM   4046 C  CA    . ILE B 1 166 ? -18.696 70.392  55.799  1.00 45.96 ? 1166 ILE B CA    1 
ATOM   4047 C  C     . ILE B 1 166 ? -18.073 71.058  57.016  1.00 46.13 ? 1166 ILE B C     1 
ATOM   4048 O  O     . ILE B 1 166 ? -16.862 70.969  57.219  1.00 46.04 ? 1166 ILE B O     1 
ATOM   4049 C  CB    . ILE B 1 166 ? -18.109 68.982  55.581  1.00 46.00 ? 1166 ILE B CB    1 
ATOM   4050 C  CG1   . ILE B 1 166 ? -18.873 68.268  54.465  1.00 45.67 ? 1166 ILE B CG1   1 
ATOM   4051 C  CG2   . ILE B 1 166 ? -18.169 68.162  56.861  1.00 45.76 ? 1166 ILE B CG2   1 
ATOM   4052 C  CD1   . ILE B 1 166 ? -18.360 66.887  54.166  1.00 45.69 ? 1166 ILE B CD1   1 
ATOM   4053 N  N     . ASP B 1 167 ? -18.899 71.749  57.803  1.00 46.37 ? 1167 ASP B N     1 
ATOM   4054 C  CA    . ASP B 1 167 ? -18.415 72.451  58.988  1.00 46.70 ? 1167 ASP B CA    1 
ATOM   4055 C  C     . ASP B 1 167 ? -18.216 71.462  60.132  1.00 46.98 ? 1167 ASP B C     1 
ATOM   4056 O  O     . ASP B 1 167 ? -18.547 70.285  60.000  1.00 46.92 ? 1167 ASP B O     1 
ATOM   4057 C  CB    . ASP B 1 167 ? -19.366 73.590  59.390  1.00 46.82 ? 1167 ASP B CB    1 
ATOM   4058 C  CG    . ASP B 1 167 ? -20.517 73.126  60.274  1.00 47.12 ? 1167 ASP B CG    1 
ATOM   4059 O  OD1   . ASP B 1 167 ? -20.529 73.493  61.471  1.00 48.08 ? 1167 ASP B OD1   1 
ATOM   4060 O  OD2   . ASP B 1 167 ? -21.404 72.398  59.783  1.00 47.54 ? 1167 ASP B OD2   1 
ATOM   4061 N  N     . ASP B 1 168 ? -17.686 71.949  61.254  1.00 47.44 ? 1168 ASP B N     1 
ATOM   4062 C  CA    . ASP B 1 168 ? -17.344 71.094  62.402  1.00 47.70 ? 1168 ASP B CA    1 
ATOM   4063 C  C     . ASP B 1 168 ? -18.538 70.294  62.959  1.00 47.89 ? 1168 ASP B C     1 
ATOM   4064 O  O     . ASP B 1 168 ? -18.357 69.188  63.468  1.00 47.83 ? 1168 ASP B O     1 
ATOM   4065 C  CB    . ASP B 1 168 ? -16.702 71.924  63.524  1.00 47.74 ? 1168 ASP B CB    1 
ATOM   4066 C  CG    . ASP B 1 168 ? -15.334 72.501  63.142  1.00 47.95 ? 1168 ASP B CG    1 
ATOM   4067 O  OD1   . ASP B 1 168 ? -14.624 71.925  62.290  1.00 47.20 ? 1168 ASP B OD1   1 
ATOM   4068 O  OD2   . ASP B 1 168 ? -14.963 73.542  63.726  1.00 49.09 ? 1168 ASP B OD2   1 
ATOM   4069 N  N     . GLU B 1 169 ? -19.744 70.851  62.858  1.00 48.21 ? 1169 GLU B N     1 
ATOM   4070 C  CA    . GLU B 1 169 ? -20.968 70.136  63.233  1.00 48.46 ? 1169 GLU B CA    1 
ATOM   4071 C  C     . GLU B 1 169 ? -21.224 68.927  62.320  1.00 48.60 ? 1169 GLU B C     1 
ATOM   4072 O  O     . GLU B 1 169 ? -21.418 67.810  62.805  1.00 48.66 ? 1169 GLU B O     1 
ATOM   4073 C  CB    . GLU B 1 169 ? -22.179 71.073  63.181  1.00 48.54 ? 1169 GLU B CB    1 
ATOM   4074 C  CG    . GLU B 1 169 ? -22.143 72.236  64.159  1.00 49.09 ? 1169 GLU B CG    1 
ATOM   4075 C  CD    . GLU B 1 169 ? -22.477 71.820  65.584  1.00 50.06 ? 1169 GLU B CD    1 
ATOM   4076 O  OE1   . GLU B 1 169 ? -23.315 72.497  66.227  1.00 50.33 ? 1169 GLU B OE1   1 
ATOM   4077 O  OE2   . GLU B 1 169 ? -21.905 70.817  66.064  1.00 50.58 ? 1169 GLU B OE2   1 
ATOM   4078 N  N     . GLU B 1 170 ? -21.222 69.158  61.004  1.00 48.61 ? 1170 GLU B N     1 
ATOM   4079 C  CA    . GLU B 1 170 ? -21.449 68.085  60.020  1.00 48.84 ? 1170 GLU B CA    1 
ATOM   4080 C  C     . GLU B 1 170 ? -20.345 67.021  59.986  1.00 48.60 ? 1170 GLU B C     1 
ATOM   4081 O  O     . GLU B 1 170 ? -20.575 65.914  59.504  1.00 48.28 ? 1170 GLU B O     1 
ATOM   4082 C  CB    . GLU B 1 170 ? -21.635 68.656  58.604  1.00 48.84 ? 1170 GLU B CB    1 
ATOM   4083 C  CG    . GLU B 1 170 ? -22.947 69.417  58.408  1.00 49.42 ? 1170 GLU B CG    1 
ATOM   4084 C  CD    . GLU B 1 170 ? -23.207 69.825  56.955  1.00 49.46 ? 1170 GLU B CD    1 
ATOM   4085 O  OE1   . GLU B 1 170 ? -22.887 69.034  56.030  1.00 49.56 ? 1170 GLU B OE1   1 
ATOM   4086 O  OE2   . GLU B 1 170 ? -23.754 70.936  56.748  1.00 49.63 ? 1170 GLU B OE2   1 
ATOM   4087 N  N     . VAL B 1 171 ? -19.155 67.356  60.477  1.00 48.70 ? 1171 VAL B N     1 
ATOM   4088 C  CA    . VAL B 1 171 ? -18.064 66.385  60.553  1.00 48.89 ? 1171 VAL B CA    1 
ATOM   4089 C  C     . VAL B 1 171 ? -18.379 65.337  61.612  1.00 49.21 ? 1171 VAL B C     1 
ATOM   4090 O  O     . VAL B 1 171 ? -18.179 64.139  61.389  1.00 48.98 ? 1171 VAL B O     1 
ATOM   4091 C  CB    . VAL B 1 171 ? -16.714 67.039  60.909  1.00 48.87 ? 1171 VAL B CB    1 
ATOM   4092 C  CG1   . VAL B 1 171 ? -15.602 65.997  60.871  1.00 48.51 ? 1171 VAL B CG1   1 
ATOM   4093 C  CG2   . VAL B 1 171 ? -16.404 68.186  59.964  1.00 48.72 ? 1171 VAL B CG2   1 
ATOM   4094 N  N     . LYS B 1 172 ? -18.867 65.808  62.762  1.00 49.52 ? 1172 LYS B N     1 
ATOM   4095 C  CA    . LYS B 1 172 ? -19.262 64.936  63.861  1.00 49.92 ? 1172 LYS B CA    1 
ATOM   4096 C  C     . LYS B 1 172 ? -20.413 64.034  63.426  1.00 50.03 ? 1172 LYS B C     1 
ATOM   4097 O  O     . LYS B 1 172 ? -20.379 62.825  63.649  1.00 50.04 ? 1172 LYS B O     1 
ATOM   4098 C  CB    . LYS B 1 172 ? -19.673 65.762  65.088  1.00 50.25 ? 1172 LYS B CB    1 
ATOM   4099 C  CG    . LYS B 1 172 ? -18.545 66.616  65.714  1.00 50.71 ? 1172 LYS B CG    1 
ATOM   4100 C  CD    . LYS B 1 172 ? -18.104 66.109  67.096  1.00 51.00 ? 1172 LYS B CD    1 
ATOM   4101 C  CE    . LYS B 1 172 ? -17.222 67.127  67.833  1.00 50.88 ? 1172 LYS B CE    1 
ATOM   4102 N  NZ    . LYS B 1 172 ? -17.251 66.948  69.322  1.00 50.65 ? 1172 LYS B NZ    1 
ATOM   4103 N  N     . ARG B 1 173 ? -21.426 64.628  62.802  1.00 50.25 ? 1173 ARG B N     1 
ATOM   4104 C  CA    . ARG B 1 173 ? -22.545 63.868  62.241  1.00 50.54 ? 1173 ARG B CA    1 
ATOM   4105 C  C     . ARG B 1 173 ? -22.019 62.763  61.331  1.00 50.74 ? 1173 ARG B C     1 
ATOM   4106 O  O     . ARG B 1 173 ? -22.394 61.600  61.469  1.00 50.70 ? 1173 ARG B O     1 
ATOM   4107 C  CB    . ARG B 1 173 ? -23.482 64.800  61.462  1.00 50.48 ? 1173 ARG B CB    1 
ATOM   4108 C  CG    . ARG B 1 173 ? -24.766 64.151  60.921  1.00 50.62 ? 1173 ARG B CG    1 
ATOM   4109 C  CD    . ARG B 1 173 ? -25.641 65.168  60.160  1.00 51.01 ? 1173 ARG B CD    1 
ATOM   4110 N  NE    . ARG B 1 173 ? -24.900 65.834  59.081  1.00 51.96 ? 1173 ARG B NE    1 
ATOM   4111 C  CZ    . ARG B 1 173 ? -24.771 65.387  57.825  1.00 51.96 ? 1173 ARG B CZ    1 
ATOM   4112 N  NH1   . ARG B 1 173 ? -25.353 64.258  57.430  1.00 51.86 ? 1173 ARG B NH1   1 
ATOM   4113 N  NH2   . ARG B 1 173 ? -24.051 66.087  56.948  1.00 51.80 ? 1173 ARG B NH2   1 
ATOM   4114 N  N     . LEU B 1 174 ? -21.128 63.137  60.418  1.00 51.16 ? 1174 LEU B N     1 
ATOM   4115 C  CA    . LEU B 1 174 ? -20.557 62.204  59.454  1.00 51.45 ? 1174 LEU B CA    1 
ATOM   4116 C  C     . LEU B 1 174 ? -19.779 61.068  60.107  1.00 52.00 ? 1174 LEU B C     1 
ATOM   4117 O  O     . LEU B 1 174 ? -19.826 59.936  59.633  1.00 51.97 ? 1174 LEU B O     1 
ATOM   4118 C  CB    . LEU B 1 174 ? -19.658 62.946  58.466  1.00 51.47 ? 1174 LEU B CB    1 
ATOM   4119 C  CG    . LEU B 1 174 ? -20.405 63.651  57.332  1.00 51.11 ? 1174 LEU B CG    1 
ATOM   4120 C  CD1   . LEU B 1 174 ? -19.576 64.774  56.734  1.00 50.05 ? 1174 LEU B CD1   1 
ATOM   4121 C  CD2   . LEU B 1 174 ? -20.795 62.633  56.274  1.00 51.18 ? 1174 LEU B CD2   1 
ATOM   4122 N  N     . ILE B 1 175 ? -19.064 61.358  61.192  1.00 52.65 ? 1175 ILE B N     1 
ATOM   4123 C  CA    . ILE B 1 175 ? -18.333 60.306  61.902  1.00 53.02 ? 1175 ILE B CA    1 
ATOM   4124 C  C     . ILE B 1 175 ? -19.296 59.213  62.374  1.00 53.71 ? 1175 ILE B C     1 
ATOM   4125 O  O     . ILE B 1 175 ? -18.971 58.025  62.310  1.00 53.61 ? 1175 ILE B O     1 
ATOM   4126 C  CB    . ILE B 1 175 ? -17.534 60.860  63.095  1.00 52.90 ? 1175 ILE B CB    1 
ATOM   4127 C  CG1   . ILE B 1 175 ? -16.336 61.668  62.605  1.00 52.55 ? 1175 ILE B CG1   1 
ATOM   4128 C  CG2   . ILE B 1 175 ? -17.037 59.730  63.980  1.00 52.68 ? 1175 ILE B CG2   1 
ATOM   4129 C  CD1   . ILE B 1 175 ? -15.626 62.415  63.712  1.00 52.59 ? 1175 ILE B CD1   1 
ATOM   4130 N  N     . ARG B 1 176 ? -20.478 59.621  62.833  1.00 54.62 ? 1176 ARG B N     1 
ATOM   4131 C  CA    . ARG B 1 176 ? -21.506 58.679  63.274  1.00 55.33 ? 1176 ARG B CA    1 
ATOM   4132 C  C     . ARG B 1 176 ? -22.254 58.076  62.088  1.00 56.19 ? 1176 ARG B C     1 
ATOM   4133 O  O     . ARG B 1 176 ? -22.372 56.859  61.985  1.00 56.34 ? 1176 ARG B O     1 
ATOM   4134 C  CB    . ARG B 1 176 ? -22.500 59.357  64.221  1.00 55.35 ? 1176 ARG B CB    1 
ATOM   4135 C  CG    . ARG B 1 176 ? -22.021 59.456  65.659  1.00 55.38 ? 1176 ARG B CG    1 
ATOM   4136 C  CD    . ARG B 1 176 ? -23.070 60.073  66.580  1.00 55.07 ? 1176 ARG B CD    1 
ATOM   4137 N  NE    . ARG B 1 176 ? -22.940 61.529  66.677  1.00 54.94 ? 1176 ARG B NE    1 
ATOM   4138 C  CZ    . ARG B 1 176 ? -23.566 62.417  65.901  1.00 54.89 ? 1176 ARG B CZ    1 
ATOM   4139 N  NH1   . ARG B 1 176 ? -24.396 62.031  64.936  1.00 54.72 ? 1176 ARG B NH1   1 
ATOM   4140 N  NH2   . ARG B 1 176 ? -23.359 63.715  66.093  1.00 54.70 ? 1176 ARG B NH2   1 
ATOM   4141 N  N     . GLU B 1 177 ? -22.752 58.928  61.197  1.00 57.18 ? 1177 GLU B N     1 
ATOM   4142 C  CA    . GLU B 1 177 ? -23.618 58.475  60.104  1.00 58.07 ? 1177 GLU B CA    1 
ATOM   4143 C  C     . GLU B 1 177 ? -22.871 57.785  58.969  1.00 58.74 ? 1177 GLU B C     1 
ATOM   4144 O  O     . GLU B 1 177 ? -23.337 56.767  58.455  1.00 58.82 ? 1177 GLU B O     1 
ATOM   4145 C  CB    . GLU B 1 177 ? -24.415 59.641  59.521  1.00 58.01 ? 1177 GLU B CB    1 
ATOM   4146 C  CG    . GLU B 1 177 ? -25.568 60.117  60.398  1.00 58.58 ? 1177 GLU B CG    1 
ATOM   4147 C  CD    . GLU B 1 177 ? -26.426 61.169  59.705  1.00 58.60 ? 1177 GLU B CD    1 
ATOM   4148 O  OE1   . GLU B 1 177 ? -26.057 61.589  58.584  1.00 59.05 ? 1177 GLU B OE1   1 
ATOM   4149 O  OE2   . GLU B 1 177 ? -27.464 61.572  60.278  1.00 58.82 ? 1177 GLU B OE2   1 
ATOM   4150 N  N     . LEU B 1 178 ? -21.727 58.345  58.576  1.00 59.69 ? 1178 LEU B N     1 
ATOM   4151 C  CA    . LEU B 1 178 ? -21.042 57.931  57.347  1.00 60.17 ? 1178 LEU B CA    1 
ATOM   4152 C  C     . LEU B 1 178 ? -20.719 56.444  57.311  1.00 60.92 ? 1178 LEU B C     1 
ATOM   4153 O  O     . LEU B 1 178 ? -20.021 55.910  58.179  1.00 60.75 ? 1178 LEU B O     1 
ATOM   4154 C  CB    . LEU B 1 178 ? -19.754 58.728  57.123  1.00 60.22 ? 1178 LEU B CB    1 
ATOM   4155 C  CG    . LEU B 1 178 ? -19.030 58.497  55.796  1.00 59.80 ? 1178 LEU B CG    1 
ATOM   4156 C  CD1   . LEU B 1 178 ? -19.943 58.799  54.627  1.00 59.37 ? 1178 LEU B CD1   1 
ATOM   4157 C  CD2   . LEU B 1 178 ? -17.775 59.343  55.732  1.00 59.88 ? 1178 LEU B CD2   1 
ATOM   4158 N  N     . ASP B 1 179 ? -21.247 55.801  56.277  1.00 61.88 ? 1179 ASP B N     1 
ATOM   4159 C  CA    . ASP B 1 179 ? -20.949 54.417  55.949  1.00 62.73 ? 1179 ASP B CA    1 
ATOM   4160 C  C     . ASP B 1 179 ? -19.430 54.208  55.906  1.00 62.95 ? 1179 ASP B C     1 
ATOM   4161 O  O     . ASP B 1 179 ? -18.688 55.059  55.405  1.00 62.93 ? 1179 ASP B O     1 
ATOM   4162 C  CB    . ASP B 1 179 ? -21.580 54.080  54.581  1.00 63.09 ? 1179 ASP B CB    1 
ATOM   4163 C  CG    . ASP B 1 179 ? -21.904 52.600  54.419  1.00 64.32 ? 1179 ASP B CG    1 
ATOM   4164 O  OD1   . ASP B 1 179 ? -21.140 51.755  54.953  1.00 65.60 ? 1179 ASP B OD1   1 
ATOM   4165 O  OD2   . ASP B 1 179 ? -22.923 52.291  53.748  1.00 65.49 ? 1179 ASP B OD2   1 
ATOM   4166 N  N     . ILE B 1 180 ? -18.974 53.077  56.434  1.00 63.26 ? 1180 ILE B N     1 
ATOM   4167 C  CA    . ILE B 1 180 ? -17.546 52.765  56.465  1.00 63.52 ? 1180 ILE B CA    1 
ATOM   4168 C  C     . ILE B 1 180 ? -16.971 52.661  55.050  1.00 63.61 ? 1180 ILE B C     1 
ATOM   4169 O  O     . ILE B 1 180 ? -15.825 53.059  54.807  1.00 63.91 ? 1180 ILE B O     1 
ATOM   4170 C  CB    . ILE B 1 180 ? -17.275 51.448  57.246  1.00 63.68 ? 1180 ILE B CB    1 
ATOM   4171 C  CG1   . ILE B 1 180 ? -15.795 51.319  57.615  1.00 63.88 ? 1180 ILE B CG1   1 
ATOM   4172 C  CG2   . ILE B 1 180 ? -17.778 50.224  56.459  1.00 63.96 ? 1180 ILE B CG2   1 
ATOM   4173 C  CD1   . ILE B 1 180 ? -15.347 52.288  58.703  1.00 64.10 ? 1180 ILE B CD1   1 
ATOM   4174 N  N     . ALA B 1 181 ? -17.773 52.141  54.121  1.00 63.47 ? 1181 ALA B N     1 
ATOM   4175 C  CA    . ALA B 1 181 ? -17.353 51.989  52.734  1.00 63.29 ? 1181 ALA B CA    1 
ATOM   4176 C  C     . ALA B 1 181 ? -17.088 53.338  52.061  1.00 63.30 ? 1181 ALA B C     1 
ATOM   4177 O  O     . ALA B 1 181 ? -16.240 53.427  51.174  1.00 63.53 ? 1181 ALA B O     1 
ATOM   4178 C  CB    . ALA B 1 181 ? -18.395 51.200  51.954  1.00 63.34 ? 1181 ALA B CB    1 
ATOM   4179 N  N     . ASP B 1 182 ? -17.791 54.386  52.490  1.00 63.13 ? 1182 ASP B N     1 
ATOM   4180 C  CA    . ASP B 1 182 ? -17.681 55.708  51.850  1.00 63.04 ? 1182 ASP B CA    1 
ATOM   4181 C  C     . ASP B 1 182 ? -16.453 56.522  52.285  1.00 62.64 ? 1182 ASP B C     1 
ATOM   4182 O  O     . ASP B 1 182 ? -16.271 57.642  51.809  1.00 62.50 ? 1182 ASP B O     1 
ATOM   4183 C  CB    . ASP B 1 182 ? -18.958 56.544  52.090  1.00 63.27 ? 1182 ASP B CB    1 
ATOM   4184 C  CG    . ASP B 1 182 ? -20.052 56.297  51.045  1.00 63.75 ? 1182 ASP B CG    1 
ATOM   4185 O  OD1   . ASP B 1 182 ? -19.773 56.432  49.837  1.00 64.87 ? 1182 ASP B OD1   1 
ATOM   4186 O  OD2   . ASP B 1 182 ? -21.208 56.007  51.436  1.00 64.39 ? 1182 ASP B OD2   1 
ATOM   4187 N  N     . VAL B 1 183 ? -15.620 55.982  53.175  1.00 62.31 ? 1183 VAL B N     1 
ATOM   4188 C  CA    . VAL B 1 183 ? -14.404 56.688  53.612  1.00 62.29 ? 1183 VAL B CA    1 
ATOM   4189 C  C     . VAL B 1 183 ? -13.223 56.453  52.649  1.00 62.35 ? 1183 VAL B C     1 
ATOM   4190 O  O     . VAL B 1 183 ? -12.810 55.306  52.455  1.00 62.36 ? 1183 VAL B O     1 
ATOM   4191 C  CB    . VAL B 1 183 ? -13.971 56.248  55.024  1.00 62.20 ? 1183 VAL B CB    1 
ATOM   4192 C  CG1   . VAL B 1 183 ? -12.689 56.944  55.423  1.00 62.19 ? 1183 VAL B CG1   1 
ATOM   4193 C  CG2   . VAL B 1 183 ? -15.061 56.539  56.034  1.00 62.06 ? 1183 VAL B CG2   1 
ATOM   4194 N  N     . PRO B 1 184 ? -12.668 57.533  52.051  1.00 62.33 ? 1184 PRO B N     1 
ATOM   4195 C  CA    . PRO B 1 184 ? -11.516 57.382  51.160  1.00 62.54 ? 1184 PRO B CA    1 
ATOM   4196 C  C     . PRO B 1 184 ? -10.488 56.409  51.707  1.00 62.83 ? 1184 PRO B C     1 
ATOM   4197 O  O     . PRO B 1 184 ? -10.161 56.464  52.888  1.00 63.08 ? 1184 PRO B O     1 
ATOM   4198 C  CB    . PRO B 1 184 ? -10.931 58.794  51.103  1.00 62.39 ? 1184 PRO B CB    1 
ATOM   4199 C  CG    . PRO B 1 184 ? -12.109 59.673  51.238  1.00 62.42 ? 1184 PRO B CG    1 
ATOM   4200 C  CD    . PRO B 1 184 ? -13.081 58.944  52.152  1.00 62.31 ? 1184 PRO B CD    1 
ATOM   4201 N  N     . GLY B 1 185 ? -10.009 55.507  50.859  1.00 63.21 ? 1185 GLY B N     1 
ATOM   4202 C  CA    . GLY B 1 185 ? -9.031  54.509  51.270  1.00 63.30 ? 1185 GLY B CA    1 
ATOM   4203 C  C     . GLY B 1 185 ? -9.629  53.211  51.771  1.00 63.54 ? 1185 GLY B C     1 
ATOM   4204 O  O     . GLY B 1 185 ? -8.896  52.266  52.039  1.00 63.55 ? 1185 GLY B O     1 
ATOM   4205 N  N     . ILE B 1 186 ? -10.950 53.151  51.905  1.00 63.99 ? 1186 ILE B N     1 
ATOM   4206 C  CA    . ILE B 1 186 ? -11.618 51.914  52.292  1.00 64.43 ? 1186 ILE B CA    1 
ATOM   4207 C  C     . ILE B 1 186 ? -12.297 51.306  51.079  1.00 65.01 ? 1186 ILE B C     1 
ATOM   4208 O  O     . ILE B 1 186 ? -13.228 51.892  50.516  1.00 65.12 ? 1186 ILE B O     1 
ATOM   4209 C  CB    . ILE B 1 186 ? -12.680 52.147  53.365  1.00 64.41 ? 1186 ILE B CB    1 
ATOM   4210 C  CG1   . ILE B 1 186 ? -12.080 52.875  54.565  1.00 64.50 ? 1186 ILE B CG1   1 
ATOM   4211 C  CG2   . ILE B 1 186 ? -13.271 50.817  53.795  1.00 64.44 ? 1186 ILE B CG2   1 
ATOM   4212 C  CD1   . ILE B 1 186 ? -10.952 52.115  55.231  1.00 64.83 ? 1186 ILE B CD1   1 
ATOM   4213 N  N     . GLY B 1 187 ? -11.829 50.131  50.676  1.00 65.66 ? 1187 GLY B N     1 
ATOM   4214 C  CA    . GLY B 1 187 ? -12.398 49.420  49.530  1.00 66.03 ? 1187 GLY B CA    1 
ATOM   4215 C  C     . GLY B 1 187 ? -13.186 48.219  50.001  1.00 66.37 ? 1187 GLY B C     1 
ATOM   4216 O  O     . GLY B 1 187 ? -13.462 48.073  51.194  1.00 66.48 ? 1187 GLY B O     1 
ATOM   4217 N  N     . ASN B 1 188 ? -13.529 47.343  49.069  1.00 66.75 ? 1188 ASN B N     1 
ATOM   4218 C  CA    . ASN B 1 188 ? -14.429 46.237  49.371  1.00 67.10 ? 1188 ASN B CA    1 
ATOM   4219 C  C     . ASN B 1 188 ? -13.811 45.111  50.192  1.00 67.19 ? 1188 ASN B C     1 
ATOM   4220 O  O     . ASN B 1 188 ? -14.526 44.406  50.898  1.00 67.28 ? 1188 ASN B O     1 
ATOM   4221 C  CB    . ASN B 1 188 ? -15.037 45.689  48.080  1.00 67.29 ? 1188 ASN B CB    1 
ATOM   4222 C  CG    . ASN B 1 188 ? -16.088 46.618  47.502  1.00 67.66 ? 1188 ASN B CG    1 
ATOM   4223 O  OD1   . ASN B 1 188 ? -15.900 47.201  46.434  1.00 68.13 ? 1188 ASN B OD1   1 
ATOM   4224 N  ND2   . ASN B 1 188 ? -17.196 46.777  48.223  1.00 67.91 ? 1188 ASN B ND2   1 
ATOM   4225 N  N     . ILE B 1 189 ? -12.496 44.940  50.107  1.00 67.37 ? 1189 ILE B N     1 
ATOM   4226 C  CA    . ILE B 1 189 ? -11.825 43.908  50.898  1.00 67.52 ? 1189 ILE B CA    1 
ATOM   4227 C  C     . ILE B 1 189 ? -11.729 44.371  52.354  1.00 67.55 ? 1189 ILE B C     1 
ATOM   4228 O  O     . ILE B 1 189 ? -11.931 43.573  53.276  1.00 67.36 ? 1189 ILE B O     1 
ATOM   4229 C  CB    . ILE B 1 189 ? -10.411 43.565  50.365  1.00 67.67 ? 1189 ILE B CB    1 
ATOM   4230 C  CG1   . ILE B 1 189 ? -10.435 43.264  48.855  1.00 67.82 ? 1189 ILE B CG1   1 
ATOM   4231 C  CG2   . ILE B 1 189 ? -9.831  42.371  51.139  1.00 67.51 ? 1189 ILE B CG2   1 
ATOM   4232 C  CD1   . ILE B 1 189 ? -11.276 42.056  48.466  1.00 68.31 ? 1189 ILE B CD1   1 
ATOM   4233 N  N     . THR B 1 190 ? -11.426 45.660  52.543  1.00 67.59 ? 1190 THR B N     1 
ATOM   4234 C  CA    . THR B 1 190 ? -11.396 46.282  53.872  1.00 67.63 ? 1190 THR B CA    1 
ATOM   4235 C  C     . THR B 1 190 ? -12.794 46.394  54.463  1.00 67.73 ? 1190 THR B C     1 
ATOM   4236 O  O     . THR B 1 190 ? -13.003 46.068  55.633  1.00 67.77 ? 1190 THR B O     1 
ATOM   4237 C  CB    . THR B 1 190 ? -10.778 47.697  53.839  1.00 67.66 ? 1190 THR B CB    1 
ATOM   4238 O  OG1   . THR B 1 190 ? -9.394  47.612  53.487  1.00 67.48 ? 1190 THR B OG1   1 
ATOM   4239 C  CG2   . THR B 1 190 ? -10.895 48.372  55.197  1.00 67.60 ? 1190 THR B CG2   1 
ATOM   4240 N  N     . ALA B 1 191 ? -13.744 46.865  53.657  1.00 67.84 ? 1191 ALA B N     1 
ATOM   4241 C  CA    . ALA B 1 191 ? -15.147 46.907  54.068  1.00 67.95 ? 1191 ALA B CA    1 
ATOM   4242 C  C     . ALA B 1 191 ? -15.622 45.522  54.516  1.00 68.20 ? 1191 ALA B C     1 
ATOM   4243 O  O     . ALA B 1 191 ? -16.159 45.381  55.618  1.00 68.06 ? 1191 ALA B O     1 
ATOM   4244 C  CB    . ALA B 1 191 ? -16.019 47.427  52.943  1.00 67.90 ? 1191 ALA B CB    1 
ATOM   4245 N  N     . GLU B 1 192 ? -15.388 44.504  53.683  1.00 68.47 ? 1192 GLU B N     1 
ATOM   4246 C  CA    . GLU B 1 192 ? -15.815 43.133  54.002  1.00 68.83 ? 1192 GLU B CA    1 
ATOM   4247 C  C     . GLU B 1 192 ? -14.859 42.389  54.944  1.00 68.98 ? 1192 GLU B C     1 
ATOM   4248 O  O     . GLU B 1 192 ? -14.895 41.162  55.024  1.00 69.21 ? 1192 GLU B O     1 
ATOM   4249 C  CB    . GLU B 1 192 ? -16.078 42.307  52.725  1.00 68.97 ? 1192 GLU B CB    1 
ATOM   4250 C  CG    . GLU B 1 192 ? -17.518 42.422  52.170  1.00 69.27 ? 1192 GLU B CG    1 
ATOM   4251 C  CD    . GLU B 1 192 ? -18.570 41.643  52.991  1.00 69.78 ? 1192 GLU B CD    1 
ATOM   4252 O  OE1   . GLU B 1 192 ? -19.747 41.627  52.570  1.00 70.04 ? 1192 GLU B OE1   1 
ATOM   4253 O  OE2   . GLU B 1 192 ? -18.235 41.049  54.046  1.00 69.22 ? 1192 GLU B OE2   1 
ATOM   4254 N  N     . LYS B 1 193 ? -14.001 43.129  55.644  1.00 69.08 ? 1193 LYS B N     1 
ATOM   4255 C  CA    . LYS B 1 193 ? -13.308 42.617  56.833  1.00 69.20 ? 1193 LYS B CA    1 
ATOM   4256 C  C     . LYS B 1 193 ? -13.864 43.287  58.091  1.00 68.95 ? 1193 LYS B C     1 
ATOM   4257 O  O     . LYS B 1 193 ? -13.971 42.653  59.139  1.00 68.82 ? 1193 LYS B O     1 
ATOM   4258 C  CB    . LYS B 1 193 ? -11.800 42.871  56.736  1.00 69.24 ? 1193 LYS B CB    1 
ATOM   4259 C  CG    . LYS B 1 193 ? -11.035 41.869  55.875  1.00 69.71 ? 1193 LYS B CG    1 
ATOM   4260 C  CD    . LYS B 1 193 ? -9.613  42.368  55.562  1.00 69.74 ? 1193 LYS B CD    1 
ATOM   4261 C  CE    . LYS B 1 193 ? -8.636  41.221  55.283  1.00 69.95 ? 1193 LYS B CE    1 
ATOM   4262 N  NZ    . LYS B 1 193 ? -7.219  41.619  55.542  1.00 69.79 ? 1193 LYS B NZ    1 
ATOM   4263 N  N     . LEU B 1 194 ? -14.202 44.572  57.972  1.00 68.80 ? 1194 LEU B N     1 
ATOM   4264 C  CA    . LEU B 1 194 ? -14.755 45.361  59.076  1.00 68.57 ? 1194 LEU B CA    1 
ATOM   4265 C  C     . LEU B 1 194 ? -16.175 44.935  59.444  1.00 68.65 ? 1194 LEU B C     1 
ATOM   4266 O  O     . LEU B 1 194 ? -16.548 44.963  60.619  1.00 68.77 ? 1194 LEU B O     1 
ATOM   4267 C  CB    . LEU B 1 194 ? -14.734 46.860  58.731  1.00 68.41 ? 1194 LEU B CB    1 
ATOM   4268 C  CG    . LEU B 1 194 ? -13.363 47.542  58.729  1.00 67.72 ? 1194 LEU B CG    1 
ATOM   4269 C  CD1   . LEU B 1 194 ? -13.477 49.009  58.367  1.00 66.43 ? 1194 LEU B CD1   1 
ATOM   4270 C  CD2   . LEU B 1 194 ? -12.687 47.386  60.082  1.00 67.22 ? 1194 LEU B CD2   1 
ATOM   4271 N  N     . LYS B 1 195 ? -16.965 44.548  58.447  1.00 68.73 ? 1195 LYS B N     1 
ATOM   4272 C  CA    . LYS B 1 195 ? -18.306 44.027  58.700  1.00 68.86 ? 1195 LYS B CA    1 
ATOM   4273 C  C     . LYS B 1 195 ? -18.253 42.714  59.487  1.00 69.07 ? 1195 LYS B C     1 
ATOM   4274 O  O     . LYS B 1 195 ? -19.112 42.474  60.334  1.00 69.10 ? 1195 LYS B O     1 
ATOM   4275 C  CB    . LYS B 1 195 ? -19.085 43.859  57.395  1.00 68.78 ? 1195 LYS B CB    1 
ATOM   4276 C  CG    . LYS B 1 195 ? -19.509 45.192  56.785  1.00 68.88 ? 1195 LYS B CG    1 
ATOM   4277 C  CD    . LYS B 1 195 ? -20.098 45.034  55.385  1.00 69.08 ? 1195 LYS B CD    1 
ATOM   4278 C  CE    . LYS B 1 195 ? -21.464 44.348  55.403  1.00 69.14 ? 1195 LYS B CE    1 
ATOM   4279 N  NZ    . LYS B 1 195 ? -22.101 44.329  54.052  1.00 68.56 ? 1195 LYS B NZ    1 
ATOM   4280 N  N     . LYS B 1 196 ? -17.230 41.893  59.241  1.00 69.32 ? 1196 LYS B N     1 
ATOM   4281 C  CA    . LYS B 1 196 ? -17.020 40.652  60.014  1.00 69.44 ? 1196 LYS B CA    1 
ATOM   4282 C  C     . LYS B 1 196 ? -16.708 40.948  61.484  1.00 69.29 ? 1196 LYS B C     1 
ATOM   4283 O  O     . LYS B 1 196 ? -16.874 40.077  62.341  1.00 69.40 ? 1196 LYS B O     1 
ATOM   4284 C  CB    . LYS B 1 196 ? -15.880 39.793  59.439  1.00 69.64 ? 1196 LYS B CB    1 
ATOM   4285 C  CG    . LYS B 1 196 ? -15.911 39.545  57.927  1.00 70.22 ? 1196 LYS B CG    1 
ATOM   4286 C  CD    . LYS B 1 196 ? -17.227 38.937  57.434  1.00 70.71 ? 1196 LYS B CD    1 
ATOM   4287 C  CE    . LYS B 1 196 ? -17.141 38.614  55.936  1.00 70.82 ? 1196 LYS B CE    1 
ATOM   4288 N  NZ    . LYS B 1 196 ? -18.471 38.467  55.285  1.00 71.25 ? 1196 LYS B NZ    1 
ATOM   4289 N  N     . LEU B 1 197 ? -16.223 42.159  61.760  1.00 69.08 ? 1197 LEU B N     1 
ATOM   4290 C  CA    . LEU B 1 197 ? -16.029 42.641  63.134  1.00 68.95 ? 1197 LEU B CA    1 
ATOM   4291 C  C     . LEU B 1 197 ? -17.242 43.436  63.636  1.00 68.68 ? 1197 LEU B C     1 
ATOM   4292 O  O     . LEU B 1 197 ? -17.432 43.577  64.845  1.00 68.57 ? 1197 LEU B O     1 
ATOM   4293 C  CB    . LEU B 1 197 ? -14.757 43.494  63.234  1.00 69.00 ? 1197 LEU B CB    1 
ATOM   4294 C  CG    . LEU B 1 197 ? -13.450 42.714  63.402  1.00 69.10 ? 1197 LEU B CG    1 
ATOM   4295 C  CD1   . LEU B 1 197 ? -12.242 43.570  63.034  1.00 69.08 ? 1197 LEU B CD1   1 
ATOM   4296 C  CD2   . LEU B 1 197 ? -13.324 42.185  64.826  1.00 69.01 ? 1197 LEU B CD2   1 
ATOM   4297 N  N     . GLY B 1 198 ? -18.047 43.953  62.707  1.00 68.32 ? 1198 GLY B N     1 
ATOM   4298 C  CA    . GLY B 1 198 ? -19.285 44.666  63.040  1.00 68.03 ? 1198 GLY B CA    1 
ATOM   4299 C  C     . GLY B 1 198 ? -19.253 46.110  62.572  1.00 67.70 ? 1198 GLY B C     1 
ATOM   4300 O  O     . GLY B 1 198 ? -20.294 46.689  62.245  1.00 67.73 ? 1198 GLY B O     1 
ATOM   4301 N  N     . ILE B 1 199 ? -18.048 46.676  62.520  1.00 67.20 ? 1199 ILE B N     1 
ATOM   4302 C  CA    . ILE B 1 199 ? -17.852 48.094  62.232  1.00 66.75 ? 1199 ILE B CA    1 
ATOM   4303 C  C     . ILE B 1 199 ? -18.492 48.477  60.905  1.00 66.61 ? 1199 ILE B C     1 
ATOM   4304 O  O     . ILE B 1 199 ? -17.969 48.155  59.835  1.00 66.71 ? 1199 ILE B O     1 
ATOM   4305 C  CB    . ILE B 1 199 ? -16.354 48.462  62.191  1.00 66.62 ? 1199 ILE B CB    1 
ATOM   4306 C  CG1   . ILE B 1 199 ? -15.708 48.232  63.556  1.00 66.49 ? 1199 ILE B CG1   1 
ATOM   4307 C  CG2   . ILE B 1 199 ? -16.163 49.917  61.777  1.00 66.19 ? 1199 ILE B CG2   1 
ATOM   4308 C  CD1   . ILE B 1 199 ? -14.214 48.307  63.519  1.00 66.13 ? 1199 ILE B CD1   1 
ATOM   4309 N  N     . ASN B 1 200 ? -19.640 49.145  60.989  1.00 66.37 ? 1200 ASN B N     1 
ATOM   4310 C  CA    . ASN B 1 200 ? -20.323 49.691  59.811  1.00 66.17 ? 1200 ASN B CA    1 
ATOM   4311 C  C     . ASN B 1 200 ? -20.078 51.190  59.627  1.00 65.60 ? 1200 ASN B C     1 
ATOM   4312 O  O     . ASN B 1 200 ? -20.123 51.695  58.501  1.00 65.39 ? 1200 ASN B O     1 
ATOM   4313 C  CB    . ASN B 1 200 ? -21.839 49.424  59.890  1.00 66.36 ? 1200 ASN B CB    1 
ATOM   4314 C  CG    . ASN B 1 200 ? -22.326 48.465  58.812  1.00 66.79 ? 1200 ASN B CG    1 
ATOM   4315 O  OD1   . ASN B 1 200 ? -22.107 48.687  57.615  1.00 67.15 ? 1200 ASN B OD1   1 
ATOM   4316 N  ND2   . ASN B 1 200 ? -23.004 47.401  59.232  1.00 67.52 ? 1200 ASN B ND2   1 
ATOM   4317 N  N     . LYS B 1 201 ? -19.838 51.893  60.735  1.00 64.95 ? 1201 LYS B N     1 
ATOM   4318 C  CA    . LYS B 1 201 ? -19.678 53.343  60.719  1.00 64.41 ? 1201 LYS B CA    1 
ATOM   4319 C  C     . LYS B 1 201 ? -18.263 53.734  61.117  1.00 63.85 ? 1201 LYS B C     1 
ATOM   4320 O  O     . LYS B 1 201 ? -17.504 52.920  61.648  1.00 63.84 ? 1201 LYS B O     1 
ATOM   4321 C  CB    . LYS B 1 201 ? -20.677 54.002  61.674  1.00 64.46 ? 1201 LYS B CB    1 
ATOM   4322 C  CG    . LYS B 1 201 ? -22.141 53.605  61.461  1.00 64.55 ? 1201 LYS B CG    1 
ATOM   4323 C  CD    . LYS B 1 201 ? -22.634 53.960  60.061  1.00 64.61 ? 1201 LYS B CD    1 
ATOM   4324 C  CE    . LYS B 1 201 ? -24.157 53.894  59.964  1.00 64.47 ? 1201 LYS B CE    1 
ATOM   4325 N  NZ    . LYS B 1 201 ? -24.641 54.045  58.562  1.00 64.01 ? 1201 LYS B NZ    1 
ATOM   4326 N  N     . LEU B 1 202 ? -17.925 54.993  60.863  1.00 63.17 ? 1202 LEU B N     1 
ATOM   4327 C  CA    . LEU B 1 202 ? -16.599 55.518  61.168  1.00 62.59 ? 1202 LEU B CA    1 
ATOM   4328 C  C     . LEU B 1 202 ? -16.359 55.524  62.675  1.00 62.36 ? 1202 LEU B C     1 
ATOM   4329 O  O     . LEU B 1 202 ? -15.298 55.111  63.133  1.00 62.20 ? 1202 LEU B O     1 
ATOM   4330 C  CB    . LEU B 1 202 ? -16.442 56.937  60.613  1.00 62.38 ? 1202 LEU B CB    1 
ATOM   4331 C  CG    . LEU B 1 202 ? -15.106 57.317  59.982  1.00 61.83 ? 1202 LEU B CG    1 
ATOM   4332 C  CD1   . LEU B 1 202 ? -14.992 58.825  59.954  1.00 61.23 ? 1202 LEU B CD1   1 
ATOM   4333 C  CD2   . LEU B 1 202 ? -13.914 56.711  60.704  1.00 61.85 ? 1202 LEU B CD2   1 
ATOM   4334 N  N     . VAL B 1 203 ? -17.355 55.988  63.433  1.00 62.26 ? 1203 VAL B N     1 
ATOM   4335 C  CA    . VAL B 1 203 ? -17.268 56.083  64.901  1.00 62.23 ? 1203 VAL B CA    1 
ATOM   4336 C  C     . VAL B 1 203 ? -17.091 54.728  65.597  1.00 62.27 ? 1203 VAL B C     1 
ATOM   4337 O  O     . VAL B 1 203 ? -16.531 54.658  66.691  1.00 62.12 ? 1203 VAL B O     1 
ATOM   4338 C  CB    . VAL B 1 203 ? -18.522 56.770  65.493  1.00 62.20 ? 1203 VAL B CB    1 
ATOM   4339 C  CG1   . VAL B 1 203 ? -19.750 55.901  65.299  1.00 62.03 ? 1203 VAL B CG1   1 
ATOM   4340 C  CG2   . VAL B 1 203 ? -18.318 57.082  66.967  1.00 62.04 ? 1203 VAL B CG2   1 
ATOM   4341 N  N     . ASP B 1 204 ? -17.569 53.662  64.955  1.00 62.41 ? 1204 ASP B N     1 
ATOM   4342 C  CA    . ASP B 1 204 ? -17.489 52.304  65.504  1.00 62.57 ? 1204 ASP B CA    1 
ATOM   4343 C  C     . ASP B 1 204 ? -16.054 51.860  65.792  1.00 62.58 ? 1204 ASP B C     1 
ATOM   4344 O  O     . ASP B 1 204 ? -15.818 51.003  66.648  1.00 62.55 ? 1204 ASP B O     1 
ATOM   4345 C  CB    . ASP B 1 204 ? -18.145 51.299  64.547  1.00 62.67 ? 1204 ASP B CB    1 
ATOM   4346 C  CG    . ASP B 1 204 ? -19.642 51.535  64.373  1.00 63.04 ? 1204 ASP B CG    1 
ATOM   4347 O  OD1   . ASP B 1 204 ? -20.163 52.553  64.877  1.00 63.38 ? 1204 ASP B OD1   1 
ATOM   4348 O  OD2   . ASP B 1 204 ? -20.298 50.696  63.721  1.00 63.89 ? 1204 ASP B OD2   1 
ATOM   4349 N  N     . THR B 1 205 ? -15.098 52.446  65.077  1.00 62.65 ? 1205 THR B N     1 
ATOM   4350 C  CA    . THR B 1 205 ? -13.688 52.138  65.288  1.00 62.72 ? 1205 THR B CA    1 
ATOM   4351 C  C     . THR B 1 205 ? -13.214 52.460  66.708  1.00 62.77 ? 1205 THR B C     1 
ATOM   4352 O  O     . THR B 1 205 ? -12.250 51.867  67.189  1.00 62.76 ? 1205 THR B O     1 
ATOM   4353 C  CB    . THR B 1 205 ? -12.799 52.875  64.267  1.00 62.72 ? 1205 THR B CB    1 
ATOM   4354 O  OG1   . THR B 1 205 ? -13.077 54.281  64.306  1.00 62.71 ? 1205 THR B OG1   1 
ATOM   4355 C  CG2   . THR B 1 205 ? -13.064 52.344  62.868  1.00 62.53 ? 1205 THR B CG2   1 
ATOM   4356 N  N     . LEU B 1 206 ? -13.910 53.371  67.384  1.00 62.93 ? 1206 LEU B N     1 
ATOM   4357 C  CA    . LEU B 1 206 ? -13.539 53.791  68.735  1.00 63.09 ? 1206 LEU B CA    1 
ATOM   4358 C  C     . LEU B 1 206 ? -13.942 52.783  69.832  1.00 63.40 ? 1206 LEU B C     1 
ATOM   4359 O  O     . LEU B 1 206 ? -13.978 53.139  71.011  1.00 63.35 ? 1206 LEU B O     1 
ATOM   4360 C  CB    . LEU B 1 206 ? -14.150 55.171  69.032  1.00 63.03 ? 1206 LEU B CB    1 
ATOM   4361 C  CG    . LEU B 1 206 ? -13.777 56.317  68.079  1.00 62.70 ? 1206 LEU B CG    1 
ATOM   4362 C  CD1   . LEU B 1 206 ? -14.722 57.508  68.244  1.00 62.24 ? 1206 LEU B CD1   1 
ATOM   4363 C  CD2   . LEU B 1 206 ? -12.327 56.744  68.272  1.00 62.00 ? 1206 LEU B CD2   1 
ATOM   4364 N  N     . SER B 1 207 ? -14.237 51.535  69.454  1.00 63.81 ? 1207 SER B N     1 
ATOM   4365 C  CA    . SER B 1 207 ? -14.611 50.493  70.421  1.00 64.09 ? 1207 SER B CA    1 
ATOM   4366 C  C     . SER B 1 207 ? -14.229 49.067  69.970  1.00 64.30 ? 1207 SER B C     1 
ATOM   4367 O  O     . SER B 1 207 ? -15.058 48.155  69.977  1.00 64.27 ? 1207 SER B O     1 
ATOM   4368 C  CB    . SER B 1 207 ? -16.111 50.585  70.738  1.00 64.11 ? 1207 SER B CB    1 
ATOM   4369 O  OG    . SER B 1 207 ? -16.386 51.705  71.565  1.00 64.34 ? 1207 SER B OG    1 
ATOM   4370 N  N     . ILE B 1 208 ? -12.967 48.891  69.583  1.00 64.58 ? 1208 ILE B N     1 
ATOM   4371 C  CA    . ILE B 1 208 ? -12.392 47.570  69.303  1.00 64.81 ? 1208 ILE B CA    1 
ATOM   4372 C  C     . ILE B 1 208 ? -10.914 47.591  69.670  1.00 65.07 ? 1208 ILE B C     1 
ATOM   4373 O  O     . ILE B 1 208 ? -10.179 48.456  69.194  1.00 65.11 ? 1208 ILE B O     1 
ATOM   4374 C  CB    . ILE B 1 208 ? -12.522 47.181  67.816  1.00 64.81 ? 1208 ILE B CB    1 
ATOM   4375 C  CG1   . ILE B 1 208 ? -13.887 46.544  67.528  1.00 65.20 ? 1208 ILE B CG1   1 
ATOM   4376 C  CG2   . ILE B 1 208 ? -11.426 46.209  67.419  1.00 64.57 ? 1208 ILE B CG2   1 
ATOM   4377 C  CD1   . ILE B 1 208 ? -14.960 47.533  67.120  1.00 65.71 ? 1208 ILE B CD1   1 
ATOM   4378 N  N     . GLU B 1 209 ? -10.478 46.638  70.495  1.00 65.38 ? 1209 GLU B N     1 
ATOM   4379 C  CA    . GLU B 1 209 ? -9.103  46.640  71.019  1.00 65.73 ? 1209 GLU B CA    1 
ATOM   4380 C  C     . GLU B 1 209 ? -8.046  46.665  69.896  1.00 65.97 ? 1209 GLU B C     1 
ATOM   4381 O  O     . GLU B 1 209 ? -7.679  45.626  69.346  1.00 66.23 ? 1209 GLU B O     1 
ATOM   4382 C  CB    . GLU B 1 209 ? -8.872  45.464  71.988  1.00 65.71 ? 1209 GLU B CB    1 
ATOM   4383 C  CG    . GLU B 1 209 ? -9.531  45.666  73.369  1.00 65.82 ? 1209 GLU B CG    1 
ATOM   4384 C  CD    . GLU B 1 209 ? -9.207  44.561  74.384  1.00 65.93 ? 1209 GLU B CD    1 
ATOM   4385 O  OE1   . GLU B 1 209 ? -9.128  44.857  75.602  1.00 65.65 ? 1209 GLU B OE1   1 
ATOM   4386 O  OE2   . GLU B 1 209 ? -9.038  43.395  73.968  1.00 66.11 ? 1209 GLU B OE2   1 
ATOM   4387 N  N     . PHE B 1 210 ? -7.587  47.878  69.574  1.00 66.04 ? 1210 PHE B N     1 
ATOM   4388 C  CA    . PHE B 1 210 ? -6.590  48.162  68.531  1.00 66.03 ? 1210 PHE B CA    1 
ATOM   4389 C  C     . PHE B 1 210 ? -5.931  46.950  67.853  1.00 66.12 ? 1210 PHE B C     1 
ATOM   4390 O  O     . PHE B 1 210 ? -6.050  46.792  66.639  1.00 66.23 ? 1210 PHE B O     1 
ATOM   4391 C  CB    . PHE B 1 210 ? -5.508  49.097  69.090  1.00 66.10 ? 1210 PHE B CB    1 
ATOM   4392 C  CG    . PHE B 1 210 ? -4.712  49.800  68.028  1.00 66.25 ? 1210 PHE B CG    1 
ATOM   4393 C  CD1   . PHE B 1 210 ? -5.055  51.083  67.620  1.00 66.53 ? 1210 PHE B CD1   1 
ATOM   4394 C  CD2   . PHE B 1 210 ? -3.622  49.176  67.426  1.00 66.49 ? 1210 PHE B CD2   1 
ATOM   4395 C  CE1   . PHE B 1 210 ? -4.323  51.734  66.627  1.00 66.75 ? 1210 PHE B CE1   1 
ATOM   4396 C  CE2   . PHE B 1 210 ? -2.882  49.820  66.433  1.00 66.54 ? 1210 PHE B CE2   1 
ATOM   4397 C  CZ    . PHE B 1 210 ? -3.234  51.100  66.033  1.00 66.56 ? 1210 PHE B CZ    1 
ATOM   4398 N  N     . ASP B 1 211 ? -5.230  46.114  68.621  1.00 66.21 ? 1211 ASP B N     1 
ATOM   4399 C  CA    . ASP B 1 211 ? -4.548  44.923  68.066  1.00 66.24 ? 1211 ASP B CA    1 
ATOM   4400 C  C     . ASP B 1 211 ? -5.469  44.032  67.227  1.00 66.10 ? 1211 ASP B C     1 
ATOM   4401 O  O     . ASP B 1 211 ? -5.018  43.391  66.274  1.00 66.12 ? 1211 ASP B O     1 
ATOM   4402 C  CB    . ASP B 1 211 ? -3.893  44.077  69.176  1.00 66.35 ? 1211 ASP B CB    1 
ATOM   4403 C  CG    . ASP B 1 211 ? -2.366  44.126  69.143  1.00 66.75 ? 1211 ASP B CG    1 
ATOM   4404 O  OD1   . ASP B 1 211 ? -1.778  44.331  68.052  1.00 67.07 ? 1211 ASP B OD1   1 
ATOM   4405 O  OD2   . ASP B 1 211 ? -1.753  43.932  70.216  1.00 66.86 ? 1211 ASP B OD2   1 
ATOM   4406 N  N     . LYS B 1 212 ? -6.746  43.988  67.600  1.00 65.83 ? 1212 LYS B N     1 
ATOM   4407 C  CA    . LYS B 1 212 ? -7.783  43.331  66.804  1.00 65.66 ? 1212 LYS B CA    1 
ATOM   4408 C  C     . LYS B 1 212 ? -7.836  43.981  65.416  1.00 65.43 ? 1212 LYS B C     1 
ATOM   4409 O  O     . LYS B 1 212 ? -7.839  43.289  64.398  1.00 65.52 ? 1212 LYS B O     1 
ATOM   4410 C  CB    . LYS B 1 212 ? -9.141  43.464  67.511  1.00 65.69 ? 1212 LYS B CB    1 
ATOM   4411 C  CG    . LYS B 1 212 ? -10.141 42.333  67.288  1.00 65.74 ? 1212 LYS B CG    1 
ATOM   4412 C  CD    . LYS B 1 212 ? -11.459 42.650  68.022  1.00 65.71 ? 1212 LYS B CD    1 
ATOM   4413 C  CE    . LYS B 1 212 ? -12.448 41.481  68.043  1.00 65.58 ? 1212 LYS B CE    1 
ATOM   4414 N  NZ    . LYS B 1 212 ? -12.328 40.638  69.265  1.00 65.16 ? 1212 LYS B NZ    1 
ATOM   4415 N  N     . LEU B 1 213 ? -7.850  45.314  65.396  1.00 65.11 ? 1213 LEU B N     1 
ATOM   4416 C  CA    . LEU B 1 213 ? -7.956  46.105  64.164  1.00 64.84 ? 1213 LEU B CA    1 
ATOM   4417 C  C     . LEU B 1 213 ? -6.648  46.102  63.363  1.00 64.80 ? 1213 LEU B C     1 
ATOM   4418 O  O     . LEU B 1 213 ? -6.659  45.976  62.138  1.00 64.80 ? 1213 LEU B O     1 
ATOM   4419 C  CB    . LEU B 1 213 ? -8.358  47.545  64.518  1.00 64.77 ? 1213 LEU B CB    1 
ATOM   4420 C  CG    . LEU B 1 213 ? -8.753  48.523  63.409  1.00 64.90 ? 1213 LEU B CG    1 
ATOM   4421 C  CD1   . LEU B 1 213 ? -9.989  48.043  62.685  1.00 64.71 ? 1213 LEU B CD1   1 
ATOM   4422 C  CD2   . LEU B 1 213 ? -8.985  49.910  63.991  1.00 64.58 ? 1213 LEU B CD2   1 
ATOM   4423 N  N     . LYS B 1 214 ? -5.525  46.248  64.061  1.00 64.64 ? 1214 LYS B N     1 
ATOM   4424 C  CA    . LYS B 1 214 ? -4.202  46.179  63.438  1.00 64.55 ? 1214 LYS B CA    1 
ATOM   4425 C  C     . LYS B 1 214 ? -4.028  44.840  62.722  1.00 64.43 ? 1214 LYS B C     1 
ATOM   4426 O  O     . LYS B 1 214 ? -3.509  44.784  61.606  1.00 64.39 ? 1214 LYS B O     1 
ATOM   4427 C  CB    . LYS B 1 214 ? -3.120  46.375  64.509  1.00 64.61 ? 1214 LYS B CB    1 
ATOM   4428 C  CG    . LYS B 1 214 ? -1.659  46.214  64.066  1.00 64.69 ? 1214 LYS B CG    1 
ATOM   4429 C  CD    . LYS B 1 214 ? -0.714  46.522  65.250  1.00 64.84 ? 1214 LYS B CD    1 
ATOM   4430 C  CE    . LYS B 1 214 ? 0.740   46.126  64.983  1.00 64.89 ? 1214 LYS B CE    1 
ATOM   4431 N  NZ    . LYS B 1 214 ? 1.019   44.703  65.315  1.00 64.91 ? 1214 LYS B NZ    1 
ATOM   4432 N  N     . GLY B 1 215 ? -4.490  43.768  63.364  1.00 64.30 ? 1215 GLY B N     1 
ATOM   4433 C  CA    . GLY B 1 215 ? -4.387  42.417  62.810  1.00 64.12 ? 1215 GLY B CA    1 
ATOM   4434 C  C     . GLY B 1 215 ? -5.258  42.146  61.592  1.00 63.89 ? 1215 GLY B C     1 
ATOM   4435 O  O     . GLY B 1 215 ? -4.998  41.208  60.838  1.00 63.91 ? 1215 GLY B O     1 
ATOM   4436 N  N     . MET B 1 216 ? -6.289  42.962  61.392  1.00 63.55 ? 1216 MET B N     1 
ATOM   4437 C  CA    . MET B 1 216 ? -7.237  42.742  60.306  1.00 63.40 ? 1216 MET B CA    1 
ATOM   4438 C  C     . MET B 1 216 ? -6.909  43.615  59.100  1.00 62.82 ? 1216 MET B C     1 
ATOM   4439 O  O     . MET B 1 216 ? -6.806  43.107  57.982  1.00 62.87 ? 1216 MET B O     1 
ATOM   4440 C  CB    . MET B 1 216 ? -8.668  43.021  60.789  1.00 63.72 ? 1216 MET B CB    1 
ATOM   4441 C  CG    . MET B 1 216 ? -9.730  42.093  60.202  1.00 64.66 ? 1216 MET B CG    1 
ATOM   4442 S  SD    . MET B 1 216 ? -9.609  40.385  60.812  1.00 67.14 ? 1216 MET B SD    1 
ATOM   4443 C  CE    . MET B 1 216 ? -10.106 40.527  62.541  1.00 66.44 ? 1216 MET B CE    1 
ATOM   4444 N  N     . ILE B 1 217 ? -6.742  44.919  59.329  1.00 62.14 ? 1217 ILE B N     1 
ATOM   4445 C  CA    . ILE B 1 217 ? -6.537  45.887  58.239  1.00 61.55 ? 1217 ILE B CA    1 
ATOM   4446 C  C     . ILE B 1 217 ? -5.139  46.511  58.210  1.00 61.11 ? 1217 ILE B C     1 
ATOM   4447 O  O     . ILE B 1 217 ? -4.862  47.370  57.376  1.00 60.94 ? 1217 ILE B O     1 
ATOM   4448 C  CB    . ILE B 1 217 ? -7.591  47.016  58.280  1.00 61.51 ? 1217 ILE B CB    1 
ATOM   4449 C  CG1   . ILE B 1 217 ? -7.401  47.918  59.501  1.00 61.54 ? 1217 ILE B CG1   1 
ATOM   4450 C  CG2   . ILE B 1 217 ? -8.987  46.432  58.296  1.00 61.41 ? 1217 ILE B CG2   1 
ATOM   4451 C  CD1   . ILE B 1 217 ? -8.268  49.151  59.468  1.00 61.46 ? 1217 ILE B CD1   1 
ATOM   4452 N  N     . GLY B 1 218 ? -4.263  46.087  59.117  1.00 60.66 ? 1218 GLY B N     1 
ATOM   4453 C  CA    . GLY B 1 218 ? -2.892  46.596  59.151  1.00 60.24 ? 1218 GLY B CA    1 
ATOM   4454 C  C     . GLY B 1 218 ? -2.735  47.832  60.019  1.00 59.74 ? 1218 GLY B C     1 
ATOM   4455 O  O     . GLY B 1 218 ? -3.718  48.461  60.418  1.00 59.62 ? 1218 GLY B O     1 
ATOM   4456 N  N     . GLU B 1 219 ? -1.481  48.181  60.295  1.00 59.15 ? 1219 GLU B N     1 
ATOM   4457 C  CA    . GLU B 1 219 ? -1.153  49.300  61.177  1.00 58.65 ? 1219 GLU B CA    1 
ATOM   4458 C  C     . GLU B 1 219 ? -1.577  50.616  60.519  1.00 57.98 ? 1219 GLU B C     1 
ATOM   4459 O  O     . GLU B 1 219 ? -2.328  51.392  61.109  1.00 58.03 ? 1219 GLU B O     1 
ATOM   4460 C  CB    . GLU B 1 219 ? 0.357   49.308  61.510  1.00 58.80 ? 1219 GLU B CB    1 
ATOM   4461 C  CG    . GLU B 1 219 ? 0.713   49.524  63.002  1.00 58.75 ? 1219 GLU B CG    1 
ATOM   4462 C  CD    . GLU B 1 219 ? 2.229   49.412  63.290  1.00 58.71 ? 1219 GLU B CD    1 
ATOM   4463 O  OE1   . GLU B 1 219 ? 3.013   50.250  62.787  1.00 58.13 ? 1219 GLU B OE1   1 
ATOM   4464 O  OE2   . GLU B 1 219 ? 2.635   48.493  64.034  1.00 58.73 ? 1219 GLU B OE2   1 
ATOM   4465 N  N     . ALA B 1 220 ? -1.128  50.835  59.283  1.00 57.14 ? 1220 ALA B N     1 
ATOM   4466 C  CA    . ALA B 1 220 ? -1.349  52.107  58.576  1.00 56.56 ? 1220 ALA B CA    1 
ATOM   4467 C  C     . ALA B 1 220 ? -2.809  52.543  58.550  1.00 55.90 ? 1220 ALA B C     1 
ATOM   4468 O  O     . ALA B 1 220 ? -3.104  53.703  58.828  1.00 55.85 ? 1220 ALA B O     1 
ATOM   4469 C  CB    . ALA B 1 220 ? -0.795  52.041  57.143  1.00 56.35 ? 1220 ALA B CB    1 
ATOM   4470 N  N     . LYS B 1 221 ? -3.711  51.618  58.225  1.00 55.20 ? 1221 LYS B N     1 
ATOM   4471 C  CA    . LYS B 1 221 ? -5.143  51.936  58.120  1.00 54.72 ? 1221 LYS B CA    1 
ATOM   4472 C  C     . LYS B 1 221 ? -5.839  52.119  59.468  1.00 54.21 ? 1221 LYS B C     1 
ATOM   4473 O  O     . LYS B 1 221 ? -6.781  52.904  59.575  1.00 53.95 ? 1221 LYS B O     1 
ATOM   4474 C  CB    . LYS B 1 221 ? -5.886  50.873  57.307  1.00 54.72 ? 1221 LYS B CB    1 
ATOM   4475 C  CG    . LYS B 1 221 ? -5.873  51.140  55.825  1.00 54.81 ? 1221 LYS B CG    1 
ATOM   4476 C  CD    . LYS B 1 221 ? -6.481  49.998  55.045  1.00 55.03 ? 1221 LYS B CD    1 
ATOM   4477 C  CE    . LYS B 1 221 ? -6.097  50.075  53.586  1.00 54.83 ? 1221 LYS B CE    1 
ATOM   4478 N  NZ    . LYS B 1 221 ? -4.631  49.866  53.416  1.00 55.76 ? 1221 LYS B NZ    1 
ATOM   4479 N  N     . ALA B 1 222 ? -5.388  51.392  60.485  1.00 53.80 ? 1222 ALA B N     1 
ATOM   4480 C  CA    . ALA B 1 222 ? -5.952  51.535  61.826  1.00 53.49 ? 1222 ALA B CA    1 
ATOM   4481 C  C     . ALA B 1 222 ? -5.723  52.956  62.320  1.00 53.17 ? 1222 ALA B C     1 
ATOM   4482 O  O     . ALA B 1 222 ? -6.661  53.617  62.741  1.00 53.00 ? 1222 ALA B O     1 
ATOM   4483 C  CB    . ALA B 1 222 ? -5.348  50.520  62.790  1.00 53.35 ? 1222 ALA B CB    1 
ATOM   4484 N  N     . LYS B 1 223 ? -4.482  53.431  62.241  1.00 52.94 ? 1223 LYS B N     1 
ATOM   4485 C  CA    . LYS B 1 223 ? -4.163  54.799  62.657  1.00 52.95 ? 1223 LYS B CA    1 
ATOM   4486 C  C     . LYS B 1 223 ? -5.018  55.796  61.894  1.00 52.66 ? 1223 LYS B C     1 
ATOM   4487 O  O     . LYS B 1 223 ? -5.522  56.759  62.468  1.00 52.68 ? 1223 LYS B O     1 
ATOM   4488 C  CB    . LYS B 1 223 ? -2.697  55.150  62.386  1.00 52.98 ? 1223 LYS B CB    1 
ATOM   4489 C  CG    . LYS B 1 223 ? -1.649  54.331  63.121  1.00 53.22 ? 1223 LYS B CG    1 
ATOM   4490 C  CD    . LYS B 1 223 ? -0.259  54.949  62.901  1.00 53.60 ? 1223 LYS B CD    1 
ATOM   4491 C  CE    . LYS B 1 223 ? 0.865   53.916  62.925  1.00 54.27 ? 1223 LYS B CE    1 
ATOM   4492 N  NZ    . LYS B 1 223 ? 0.875   53.111  64.178  1.00 54.32 ? 1223 LYS B NZ    1 
ATOM   4493 N  N     . TYR B 1 224 ? -5.154  55.552  60.592  1.00 52.37 ? 1224 TYR B N     1 
ATOM   4494 C  CA    . TYR B 1 224 ? -5.849  56.450  59.675  1.00 52.12 ? 1224 TYR B CA    1 
ATOM   4495 C  C     . TYR B 1 224 ? -7.311  56.589  60.032  1.00 51.79 ? 1224 TYR B C     1 
ATOM   4496 O  O     . TYR B 1 224 ? -7.817  57.698  60.164  1.00 51.81 ? 1224 TYR B O     1 
ATOM   4497 C  CB    . TYR B 1 224 ? -5.708  55.930  58.240  1.00 52.34 ? 1224 TYR B CB    1 
ATOM   4498 C  CG    . TYR B 1 224 ? -6.563  56.631  57.200  1.00 52.38 ? 1224 TYR B CG    1 
ATOM   4499 C  CD1   . TYR B 1 224 ? -6.323  57.950  56.846  1.00 52.58 ? 1224 TYR B CD1   1 
ATOM   4500 C  CD2   . TYR B 1 224 ? -7.594  55.954  56.549  1.00 52.75 ? 1224 TYR B CD2   1 
ATOM   4501 C  CE1   . TYR B 1 224 ? -7.097  58.584  55.883  1.00 52.90 ? 1224 TYR B CE1   1 
ATOM   4502 C  CE2   . TYR B 1 224 ? -8.374  56.577  55.587  1.00 52.51 ? 1224 TYR B CE2   1 
ATOM   4503 C  CZ    . TYR B 1 224 ? -8.123  57.891  55.257  1.00 52.67 ? 1224 TYR B CZ    1 
ATOM   4504 O  OH    . TYR B 1 224 ? -8.890  58.517  54.303  1.00 52.45 ? 1224 TYR B OH    1 
ATOM   4505 N  N     . LEU B 1 225 ? -7.985  55.460  60.188  1.00 51.48 ? 1225 LEU B N     1 
ATOM   4506 C  CA    . LEU B 1 225 ? -9.403  55.466  60.520  1.00 51.43 ? 1225 LEU B CA    1 
ATOM   4507 C  C     . LEU B 1 225 ? -9.667  55.985  61.937  1.00 51.29 ? 1225 LEU B C     1 
ATOM   4508 O  O     . LEU B 1 225 ? -10.638 56.705  62.172  1.00 51.40 ? 1225 LEU B O     1 
ATOM   4509 C  CB    . LEU B 1 225 ? -9.991  54.063  60.362  1.00 51.47 ? 1225 LEU B CB    1 
ATOM   4510 C  CG    . LEU B 1 225 ? -10.158 53.545  58.929  1.00 51.87 ? 1225 LEU B CG    1 
ATOM   4511 C  CD1   . LEU B 1 225 ? -10.718 52.120  58.950  1.00 52.12 ? 1225 LEU B CD1   1 
ATOM   4512 C  CD2   . LEU B 1 225 ? -11.056 54.459  58.091  1.00 51.65 ? 1225 LEU B CD2   1 
ATOM   4513 N  N     . ILE B 1 226 ? -8.803  55.611  62.873  1.00 51.15 ? 1226 ILE B N     1 
ATOM   4514 C  CA    . ILE B 1 226 ? -8.930  56.029  64.271  1.00 50.91 ? 1226 ILE B CA    1 
ATOM   4515 C  C     . ILE B 1 226 ? -8.747  57.537  64.415  1.00 50.77 ? 1226 ILE B C     1 
ATOM   4516 O  O     . ILE B 1 226 ? -9.556  58.203  65.052  1.00 50.65 ? 1226 ILE B O     1 
ATOM   4517 C  CB    . ILE B 1 226 ? -7.916  55.280  65.169  1.00 50.85 ? 1226 ILE B CB    1 
ATOM   4518 C  CG1   . ILE B 1 226 ? -8.386  53.841  65.400  1.00 50.49 ? 1226 ILE B CG1   1 
ATOM   4519 C  CG2   . ILE B 1 226 ? -7.756  55.974  66.496  1.00 51.11 ? 1226 ILE B CG2   1 
ATOM   4520 C  CD1   . ILE B 1 226 ? -7.324  52.943  65.968  1.00 50.17 ? 1226 ILE B CD1   1 
ATOM   4521 N  N     . SER B 1 227 ? -7.690  58.066  63.809  1.00 50.75 ? 1227 SER B N     1 
ATOM   4522 C  CA    . SER B 1 227 ? -7.446  59.509  63.787  1.00 50.80 ? 1227 SER B CA    1 
ATOM   4523 C  C     . SER B 1 227 ? -8.637  60.283  63.219  1.00 50.80 ? 1227 SER B C     1 
ATOM   4524 O  O     . SER B 1 227 ? -9.019  61.327  63.749  1.00 50.64 ? 1227 SER B O     1 
ATOM   4525 C  CB    . SER B 1 227 ? -6.196  59.826  62.963  1.00 50.80 ? 1227 SER B CB    1 
ATOM   4526 O  OG    . SER B 1 227 ? -5.815  61.175  63.137  1.00 50.85 ? 1227 SER B OG    1 
ATOM   4527 N  N     . LEU B 1 228 ? -9.210  59.770  62.134  1.00 50.89 ? 1228 LEU B N     1 
ATOM   4528 C  CA    . LEU B 1 228 ? -10.393 60.376  61.539  1.00 51.05 ? 1228 LEU B CA    1 
ATOM   4529 C  C     . LEU B 1 228 ? -11.525 60.383  62.547  1.00 51.20 ? 1228 LEU B C     1 
ATOM   4530 O  O     . LEU B 1 228 ? -12.079 61.434  62.859  1.00 51.25 ? 1228 LEU B O     1 
ATOM   4531 C  CB    . LEU B 1 228 ? -10.840 59.613  60.288  1.00 51.08 ? 1228 LEU B CB    1 
ATOM   4532 C  CG    . LEU B 1 228 ? -10.162 59.937  58.959  1.00 51.03 ? 1228 LEU B CG    1 
ATOM   4533 C  CD1   . LEU B 1 228 ? -10.599 58.933  57.898  1.00 50.64 ? 1228 LEU B CD1   1 
ATOM   4534 C  CD2   . LEU B 1 228 ? -10.482 61.353  58.519  1.00 50.89 ? 1228 LEU B CD2   1 
ATOM   4535 N  N     . ALA B 1 229 ? -11.853 59.201  63.057  1.00 51.45 ? 1229 ALA B N     1 
ATOM   4536 C  CA    . ALA B 1 229 ? -12.922 59.039  64.042  1.00 51.72 ? 1229 ALA B CA    1 
ATOM   4537 C  C     . ALA B 1 229 ? -12.753 59.968  65.246  1.00 52.05 ? 1229 ALA B C     1 
ATOM   4538 O  O     . ALA B 1 229 ? -13.730 60.497  65.772  1.00 52.00 ? 1229 ALA B O     1 
ATOM   4539 C  CB    . ALA B 1 229 ? -12.988 57.591  64.499  1.00 51.67 ? 1229 ALA B CB    1 
ATOM   4540 N  N     . ARG B 1 230 ? -11.506 60.161  65.667  1.00 52.64 ? 1230 ARG B N     1 
ATOM   4541 C  CA    . ARG B 1 230 ? -11.180 61.052  66.777  1.00 53.06 ? 1230 ARG B CA    1 
ATOM   4542 C  C     . ARG B 1 230 ? -11.261 62.538  66.417  1.00 53.39 ? 1230 ARG B C     1 
ATOM   4543 O  O     . ARG B 1 230 ? -11.173 63.386  67.305  1.00 53.57 ? 1230 ARG B O     1 
ATOM   4544 C  CB    . ARG B 1 230 ? -9.779  60.745  67.316  1.00 53.15 ? 1230 ARG B CB    1 
ATOM   4545 C  CG    . ARG B 1 230 ? -9.696  59.489  68.172  1.00 53.65 ? 1230 ARG B CG    1 
ATOM   4546 C  CD    . ARG B 1 230 ? -8.495  59.546  69.111  1.00 54.52 ? 1230 ARG B CD    1 
ATOM   4547 N  NE    . ARG B 1 230 ? -8.528  58.468  70.102  1.00 55.07 ? 1230 ARG B NE    1 
ATOM   4548 C  CZ    . ARG B 1 230 ? -7.780  57.363  70.074  1.00 55.38 ? 1230 ARG B CZ    1 
ATOM   4549 N  NH1   . ARG B 1 230 ? -6.897  57.147  69.102  1.00 55.05 ? 1230 ARG B NH1   1 
ATOM   4550 N  NH2   . ARG B 1 230 ? -7.911  56.462  71.043  1.00 55.55 ? 1230 ARG B NH2   1 
ATOM   4551 N  N     . ASP B 1 231 ? -11.420 62.858  65.133  1.00 53.76 ? 1231 ASP B N     1 
ATOM   4552 C  CA    . ASP B 1 231 ? -11.511 64.247  64.679  1.00 54.09 ? 1231 ASP B CA    1 
ATOM   4553 C  C     . ASP B 1 231 ? -10.151 64.946  64.833  1.00 54.28 ? 1231 ASP B C     1 
ATOM   4554 O  O     . ASP B 1 231 ? -10.077 66.157  65.037  1.00 54.23 ? 1231 ASP B O     1 
ATOM   4555 C  CB    . ASP B 1 231 ? -12.614 64.985  65.464  1.00 54.19 ? 1231 ASP B CB    1 
ATOM   4556 C  CG    . ASP B 1 231 ? -13.177 66.199  64.730  1.00 54.52 ? 1231 ASP B CG    1 
ATOM   4557 O  OD1   . ASP B 1 231 ? -12.640 66.613  63.676  1.00 55.38 ? 1231 ASP B OD1   1 
ATOM   4558 O  OD2   . ASP B 1 231 ? -14.179 66.751  65.234  1.00 55.00 ? 1231 ASP B OD2   1 
ATOM   4559 N  N     . GLU B 1 232 ? -9.078  64.168  64.737  1.00 54.55 ? 1232 GLU B N     1 
ATOM   4560 C  CA    . GLU B 1 232 ? -7.731  64.701  64.851  1.00 54.98 ? 1232 GLU B CA    1 
ATOM   4561 C  C     . GLU B 1 232 ? -6.954  64.628  63.537  1.00 55.24 ? 1232 GLU B C     1 
ATOM   4562 O  O     . GLU B 1 232 ? -6.001  65.374  63.352  1.00 55.22 ? 1232 GLU B O     1 
ATOM   4563 C  CB    . GLU B 1 232 ? -6.974  63.964  65.955  1.00 54.94 ? 1232 GLU B CB    1 
ATOM   4564 C  CG    . GLU B 1 232 ? -7.519  64.237  67.357  1.00 55.21 ? 1232 GLU B CG    1 
ATOM   4565 C  CD    . GLU B 1 232 ? -6.792  63.460  68.452  1.00 55.38 ? 1232 GLU B CD    1 
ATOM   4566 O  OE1   . GLU B 1 232 ? -5.961  62.583  68.120  1.00 56.48 ? 1232 GLU B OE1   1 
ATOM   4567 O  OE2   . GLU B 1 232 ? -7.055  63.724  69.648  1.00 54.60 ? 1232 GLU B OE2   1 
ATOM   4568 N  N     . TYR B 1 233 ? -7.357  63.746  62.624  1.00 55.79 ? 1233 TYR B N     1 
ATOM   4569 C  CA    . TYR B 1 233 ? -6.635  63.555  61.362  1.00 56.28 ? 1233 TYR B CA    1 
ATOM   4570 C  C     . TYR B 1 233 ? -6.213  64.884  60.736  1.00 56.78 ? 1233 TYR B C     1 
ATOM   4571 O  O     . TYR B 1 233 ? -7.033  65.787  60.564  1.00 56.87 ? 1233 TYR B O     1 
ATOM   4572 C  CB    . TYR B 1 233 ? -7.480  62.752  60.365  1.00 56.16 ? 1233 TYR B CB    1 
ATOM   4573 C  CG    . TYR B 1 233 ? -6.862  62.655  58.982  1.00 56.15 ? 1233 TYR B CG    1 
ATOM   4574 C  CD1   . TYR B 1 233 ? -6.017  61.596  58.641  1.00 56.15 ? 1233 TYR B CD1   1 
ATOM   4575 C  CD2   . TYR B 1 233 ? -7.119  63.624  58.017  1.00 56.06 ? 1233 TYR B CD2   1 
ATOM   4576 C  CE1   . TYR B 1 233 ? -5.450  61.506  57.375  1.00 55.39 ? 1233 TYR B CE1   1 
ATOM   4577 C  CE2   . TYR B 1 233 ? -6.553  63.548  56.752  1.00 55.93 ? 1233 TYR B CE2   1 
ATOM   4578 C  CZ    . TYR B 1 233 ? -5.723  62.489  56.436  1.00 55.70 ? 1233 TYR B CZ    1 
ATOM   4579 O  OH    . TYR B 1 233 ? -5.169  62.428  55.179  1.00 56.09 ? 1233 TYR B OH    1 
ATOM   4580 N  N     . ASN B 1 234 ? -4.929  64.990  60.405  1.00 57.29 ? 1234 ASN B N     1 
ATOM   4581 C  CA    . ASN B 1 234 ? -4.381  66.194  59.787  1.00 57.77 ? 1234 ASN B CA    1 
ATOM   4582 C  C     . ASN B 1 234 ? -3.080  65.902  59.047  1.00 58.00 ? 1234 ASN B C     1 
ATOM   4583 O  O     . ASN B 1 234 ? -1.996  65.986  59.626  1.00 57.95 ? 1234 ASN B O     1 
ATOM   4584 C  CB    . ASN B 1 234 ? -4.151  67.288  60.849  1.00 57.98 ? 1234 ASN B CB    1 
ATOM   4585 C  CG    . ASN B 1 234 ? -5.177  68.413  60.778  1.00 58.45 ? 1234 ASN B CG    1 
ATOM   4586 O  OD1   . ASN B 1 234 ? -5.673  68.752  59.700  1.00 59.37 ? 1234 ASN B OD1   1 
ATOM   4587 N  ND2   . ASN B 1 234 ? -5.480  69.015  61.929  1.00 58.26 ? 1234 ASN B ND2   1 
ATOM   4588 N  N     . GLU B 1 235 ? -3.193  65.528  57.776  1.00 58.29 ? 1235 GLU B N     1 
ATOM   4589 C  CA    . GLU B 1 235 ? -2.025  65.421  56.906  1.00 58.53 ? 1235 GLU B CA    1 
ATOM   4590 C  C     . GLU B 1 235 ? -2.021  66.656  56.019  1.00 58.64 ? 1235 GLU B C     1 
ATOM   4591 O  O     . GLU B 1 235 ? -3.065  67.045  55.489  1.00 58.51 ? 1235 GLU B O     1 
ATOM   4592 C  CB    . GLU B 1 235 ? -2.044  64.136  56.069  1.00 58.54 ? 1235 GLU B CB    1 
ATOM   4593 C  CG    . GLU B 1 235 ? -2.195  62.850  56.888  1.00 59.10 ? 1235 GLU B CG    1 
ATOM   4594 C  CD    . GLU B 1 235 ? -1.184  62.727  58.023  1.00 59.84 ? 1235 GLU B CD    1 
ATOM   4595 O  OE1   . GLU B 1 235 ? -1.587  62.861  59.203  1.00 59.75 ? 1235 GLU B OE1   1 
ATOM   4596 O  OE2   . GLU B 1 235 ? 0.011   62.504  57.736  1.00 60.36 ? 1235 GLU B OE2   1 
ATOM   4597 N  N     . PRO B 1 236 ? -0.848  67.286  55.864  1.00 58.93 ? 1236 PRO B N     1 
ATOM   4598 C  CA    . PRO B 1 236 ? -0.800  68.586  55.218  1.00 59.08 ? 1236 PRO B CA    1 
ATOM   4599 C  C     . PRO B 1 236 ? -0.755  68.482  53.702  1.00 59.13 ? 1236 PRO B C     1 
ATOM   4600 O  O     . PRO B 1 236 ? -0.210  67.516  53.165  1.00 59.06 ? 1236 PRO B O     1 
ATOM   4601 C  CB    . PRO B 1 236 ? 0.508   69.173  55.745  1.00 59.10 ? 1236 PRO B CB    1 
ATOM   4602 C  CG    . PRO B 1 236 ? 1.399   67.982  55.890  1.00 59.09 ? 1236 PRO B CG    1 
ATOM   4603 C  CD    . PRO B 1 236 ? 0.496   66.826  56.263  1.00 59.02 ? 1236 PRO B CD    1 
ATOM   4604 N  N     . ILE B 1 237 ? -1.327  69.482  53.033  1.00 59.32 ? 1237 ILE B N     1 
ATOM   4605 C  CA    . ILE B 1 237 ? -1.215  69.623  51.584  1.00 59.53 ? 1237 ILE B CA    1 
ATOM   4606 C  C     . ILE B 1 237 ? 0.268   69.690  51.235  1.00 59.81 ? 1237 ILE B C     1 
ATOM   4607 O  O     . ILE B 1 237 ? 0.982   70.565  51.720  1.00 59.79 ? 1237 ILE B O     1 
ATOM   4608 C  CB    . ILE B 1 237 ? -1.930  70.905  51.071  1.00 59.41 ? 1237 ILE B CB    1 
ATOM   4609 C  CG1   . ILE B 1 237 ? -3.438  70.684  50.968  1.00 59.46 ? 1237 ILE B CG1   1 
ATOM   4610 C  CG2   . ILE B 1 237 ? -1.409  71.317  49.709  1.00 59.25 ? 1237 ILE B CG2   1 
ATOM   4611 C  CD1   . ILE B 1 237 ? -4.154  70.636  52.297  1.00 59.33 ? 1237 ILE B CD1   1 
ATOM   4612 N  N     . ARG B 1 238 ? 0.722   68.746  50.413  1.00 60.23 ? 1238 ARG B N     1 
ATOM   4613 C  CA    . ARG B 1 238 ? 2.140   68.617  50.076  1.00 60.57 ? 1238 ARG B CA    1 
ATOM   4614 C  C     . ARG B 1 238 ? 2.339   68.193  48.614  1.00 60.33 ? 1238 ARG B C     1 
ATOM   4615 O  O     . ARG B 1 238 ? 1.522   67.451  48.063  1.00 60.46 ? 1238 ARG B O     1 
ATOM   4616 C  CB    . ARG B 1 238 ? 2.789   67.623  51.046  1.00 60.93 ? 1238 ARG B CB    1 
ATOM   4617 C  CG    . ARG B 1 238 ? 2.386   66.154  50.862  1.00 62.04 ? 1238 ARG B CG    1 
ATOM   4618 C  CD    . ARG B 1 238 ? 3.570   65.339  50.352  1.00 64.17 ? 1238 ARG B CD    1 
ATOM   4619 N  NE    . ARG B 1 238 ? 3.181   64.055  49.773  1.00 65.64 ? 1238 ARG B NE    1 
ATOM   4620 C  CZ    . ARG B 1 238 ? 4.040   63.134  49.334  1.00 65.79 ? 1238 ARG B CZ    1 
ATOM   4621 N  NH1   . ARG B 1 238 ? 3.583   61.999  48.812  1.00 65.79 ? 1238 ARG B NH1   1 
ATOM   4622 N  NH2   . ARG B 1 238 ? 5.353   63.337  49.417  1.00 65.65 ? 1238 ARG B NH2   1 
ATOM   4623 N  N     . THR B 1 239 ? 3.413   68.670  47.989  1.00 60.11 ? 1239 THR B N     1 
ATOM   4624 C  CA    . THR B 1 239 ? 3.670   68.385  46.569  1.00 59.98 ? 1239 THR B CA    1 
ATOM   4625 C  C     . THR B 1 239 ? 3.975   66.903  46.318  1.00 60.10 ? 1239 THR B C     1 
ATOM   4626 O  O     . THR B 1 239 ? 4.675   66.264  47.099  1.00 60.23 ? 1239 THR B O     1 
ATOM   4627 C  CB    . THR B 1 239 ? 4.820   69.252  46.023  1.00 59.82 ? 1239 THR B CB    1 
ATOM   4628 O  OG1   . THR B 1 239 ? 4.372   70.604  45.919  1.00 59.53 ? 1239 THR B OG1   1 
ATOM   4629 C  CG2   . THR B 1 239 ? 5.273   68.777  44.651  1.00 59.60 ? 1239 THR B CG2   1 
ATOM   4630 N  N     . ARG B 1 240 ? 3.427   66.366  45.232  1.00 60.19 ? 1240 ARG B N     1 
ATOM   4631 C  CA    . ARG B 1 240 ? 3.655   64.979  44.840  1.00 60.41 ? 1240 ARG B CA    1 
ATOM   4632 C  C     . ARG B 1 240 ? 4.462   64.912  43.549  1.00 59.82 ? 1240 ARG B C     1 
ATOM   4633 O  O     . ARG B 1 240 ? 4.390   65.825  42.720  1.00 59.69 ? 1240 ARG B O     1 
ATOM   4634 C  CB    . ARG B 1 240 ? 2.319   64.268  44.652  1.00 60.41 ? 1240 ARG B CB    1 
ATOM   4635 C  CG    . ARG B 1 240 ? 1.609   63.974  45.959  1.00 61.27 ? 1240 ARG B CG    1 
ATOM   4636 C  CD    . ARG B 1 240 ? 0.288   63.257  45.723  1.00 61.99 ? 1240 ARG B CD    1 
ATOM   4637 N  NE    . ARG B 1 240 ? 0.135   62.102  46.609  1.00 63.93 ? 1240 ARG B NE    1 
ATOM   4638 C  CZ    . ARG B 1 240 ? -0.823  61.178  46.500  1.00 65.04 ? 1240 ARG B CZ    1 
ATOM   4639 N  NH1   . ARG B 1 240 ? -1.749  61.262  45.542  1.00 65.10 ? 1240 ARG B NH1   1 
ATOM   4640 N  NH2   . ARG B 1 240 ? -0.855  60.159  47.365  1.00 65.21 ? 1240 ARG B NH2   1 
ATOM   4641 N  N     . VAL B 1 241 ? 5.230   63.833  43.387  1.00 59.36 ? 1241 VAL B N     1 
ATOM   4642 C  CA    . VAL B 1 241 ? 6.031   63.624  42.172  1.00 58.95 ? 1241 VAL B CA    1 
ATOM   4643 C  C     . VAL B 1 241 ? 6.073   62.167  41.708  1.00 58.56 ? 1241 VAL B C     1 
ATOM   4644 O  O     . VAL B 1 241 ? 5.994   61.221  42.509  1.00 58.24 ? 1241 VAL B O     1 
ATOM   4645 C  CB    . VAL B 1 241 ? 7.481   64.151  42.313  1.00 58.98 ? 1241 VAL B CB    1 
ATOM   4646 C  CG1   . VAL B 1 241 ? 7.525   65.658  42.050  1.00 59.11 ? 1241 VAL B CG1   1 
ATOM   4647 C  CG2   . VAL B 1 241 ? 8.059   63.794  43.679  1.00 58.48 ? 1241 VAL B CG2   1 
ATOM   4648 N  N     . ARG B 1 242 ? 6.214   62.029  40.391  1.00 58.00 ? 1242 ARG B N     1 
ATOM   4649 C  CA    . ARG B 1 242 ? 6.115   60.762  39.688  1.00 57.74 ? 1242 ARG B CA    1 
ATOM   4650 C  C     . ARG B 1 242 ? 7.252   59.842  40.118  1.00 56.71 ? 1242 ARG B C     1 
ATOM   4651 O  O     . ARG B 1 242 ? 8.416   60.123  39.878  1.00 56.82 ? 1242 ARG B O     1 
ATOM   4652 C  CB    . ARG B 1 242 ? 6.139   61.026  38.173  1.00 58.21 ? 1242 ARG B CB    1 
ATOM   4653 C  CG    . ARG B 1 242 ? 5.927   59.827  37.251  1.00 59.95 ? 1242 ARG B CG    1 
ATOM   4654 C  CD    . ARG B 1 242 ? 4.502   59.260  37.295  1.00 63.25 ? 1242 ARG B CD    1 
ATOM   4655 N  NE    . ARG B 1 242 ? 3.447   60.186  36.865  1.00 64.56 ? 1242 ARG B NE    1 
ATOM   4656 C  CZ    . ARG B 1 242 ? 2.551   60.770  37.672  1.00 65.88 ? 1242 ARG B CZ    1 
ATOM   4657 N  NH1   . ARG B 1 242 ? 2.560   60.571  38.994  1.00 66.72 ? 1242 ARG B NH1   1 
ATOM   4658 N  NH2   . ARG B 1 242 ? 1.629   61.578  37.153  1.00 65.69 ? 1242 ARG B NH2   1 
ATOM   4659 N  N     . LYS B 1 243 ? 6.896   58.750  40.774  1.00 55.61 ? 1243 LYS B N     1 
ATOM   4660 C  CA    . LYS B 1 243 ? 7.862   57.783  41.252  1.00 54.83 ? 1243 LYS B CA    1 
ATOM   4661 C  C     . LYS B 1 243 ? 8.072   56.627  40.283  1.00 54.03 ? 1243 LYS B C     1 
ATOM   4662 O  O     . LYS B 1 243 ? 9.142   56.053  40.249  1.00 54.18 ? 1243 LYS B O     1 
ATOM   4663 C  CB    . LYS B 1 243 ? 7.432   57.263  42.621  1.00 54.90 ? 1243 LYS B CB    1 
ATOM   4664 C  CG    . LYS B 1 243 ? 7.687   58.273  43.720  1.00 55.33 ? 1243 LYS B CG    1 
ATOM   4665 C  CD    . LYS B 1 243 ? 6.731   58.125  44.887  1.00 56.19 ? 1243 LYS B CD    1 
ATOM   4666 C  CE    . LYS B 1 243 ? 7.158   59.018  46.049  1.00 56.68 ? 1243 LYS B CE    1 
ATOM   4667 N  NZ    . LYS B 1 243 ? 7.622   60.368  45.598  1.00 56.99 ? 1243 LYS B NZ    1 
ATOM   4668 N  N     . SER B 1 244 ? 7.063   56.283  39.493  1.00 53.29 ? 1244 SER B N     1 
ATOM   4669 C  CA    . SER B 1 244 ? 7.198   55.194  38.529  1.00 52.52 ? 1244 SER B CA    1 
ATOM   4670 C  C     . SER B 1 244 ? 6.557   55.581  37.201  1.00 51.86 ? 1244 SER B C     1 
ATOM   4671 O  O     . SER B 1 244 ? 5.661   56.409  37.170  1.00 52.08 ? 1244 SER B O     1 
ATOM   4672 C  CB    . SER B 1 244 ? 6.563   53.913  39.085  1.00 52.55 ? 1244 SER B CB    1 
ATOM   4673 O  OG    . SER B 1 244 ? 5.155   53.908  38.906  1.00 52.08 ? 1244 SER B OG    1 
ATOM   4674 N  N     . ILE B 1 245 ? 7.030   54.992  36.108  1.00 50.97 ? 1245 ILE B N     1 
ATOM   4675 C  CA    . ILE B 1 245 ? 6.420   55.177  34.794  1.00 50.35 ? 1245 ILE B CA    1 
ATOM   4676 C  C     . ILE B 1 245 ? 6.443   53.831  34.081  1.00 49.79 ? 1245 ILE B C     1 
ATOM   4677 O  O     . ILE B 1 245 ? 7.476   53.188  34.025  1.00 49.57 ? 1245 ILE B O     1 
ATOM   4678 C  CB    . ILE B 1 245 ? 7.190   56.220  33.943  1.00 50.47 ? 1245 ILE B CB    1 
ATOM   4679 C  CG1   . ILE B 1 245 ? 6.971   57.643  34.468  1.00 50.56 ? 1245 ILE B CG1   1 
ATOM   4680 C  CG2   . ILE B 1 245 ? 6.763   56.159  32.485  1.00 50.57 ? 1245 ILE B CG2   1 
ATOM   4681 C  CD1   . ILE B 1 245 ? 5.606   58.210  34.176  1.00 51.66 ? 1245 ILE B CD1   1 
ATOM   4682 N  N     . GLY B 1 246 ? 5.313   53.409  33.529  1.00 49.36 ? 1246 GLY B N     1 
ATOM   4683 C  CA    . GLY B 1 246 ? 5.223   52.090  32.924  1.00 49.05 ? 1246 GLY B CA    1 
ATOM   4684 C  C     . GLY B 1 246 ? 4.212   51.989  31.800  1.00 49.01 ? 1246 GLY B C     1 
ATOM   4685 O  O     . GLY B 1 246 ? 3.557   52.965  31.443  1.00 48.63 ? 1246 GLY B O     1 
ATOM   4686 N  N     . ARG B 1 247 ? 4.102   50.782  31.253  1.00 49.06 ? 1247 ARG B N     1 
ATOM   4687 C  CA    . ARG B 1 247 ? 3.169   50.467  30.183  1.00 49.27 ? 1247 ARG B CA    1 
ATOM   4688 C  C     . ARG B 1 247 ? 2.808   48.977  30.257  1.00 49.68 ? 1247 ARG B C     1 
ATOM   4689 O  O     . ARG B 1 247 ? 3.624   48.134  30.626  1.00 49.23 ? 1247 ARG B O     1 
ATOM   4690 C  CB    . ARG B 1 247 ? 3.794   50.805  28.827  1.00 49.28 ? 1247 ARG B CB    1 
ATOM   4691 C  CG    . ARG B 1 247 ? 2.856   50.729  27.621  1.00 49.22 ? 1247 ARG B CG    1 
ATOM   4692 C  CD    . ARG B 1 247 ? 1.963   51.949  27.500  1.00 49.15 ? 1247 ARG B CD    1 
ATOM   4693 N  NE    . ARG B 1 247 ? 1.199   51.935  26.255  1.00 49.47 ? 1247 ARG B NE    1 
ATOM   4694 C  CZ    . ARG B 1 247 ? 0.087   51.231  26.039  1.00 50.28 ? 1247 ARG B CZ    1 
ATOM   4695 N  NH1   . ARG B 1 247 ? -0.454  50.475  26.986  1.00 51.20 ? 1247 ARG B NH1   1 
ATOM   4696 N  NH2   . ARG B 1 247 ? -0.511  51.296  24.857  1.00 50.50 ? 1247 ARG B NH2   1 
ATOM   4697 N  N     . ILE B 1 248 ? 1.577   48.662  29.892  1.00 50.40 ? 1248 ILE B N     1 
ATOM   4698 C  CA    . ILE B 1 248 ? 1.045   47.319  30.050  1.00 51.09 ? 1248 ILE B CA    1 
ATOM   4699 C  C     . ILE B 1 248 ? 0.045   47.127  28.917  1.00 51.50 ? 1248 ILE B C     1 
ATOM   4700 O  O     . ILE B 1 248 ? -0.723  48.035  28.612  1.00 51.79 ? 1248 ILE B O     1 
ATOM   4701 C  CB    . ILE B 1 248 ? 0.392   47.196  31.443  1.00 51.33 ? 1248 ILE B CB    1 
ATOM   4702 C  CG1   . ILE B 1 248 ? -0.418  45.906  31.605  1.00 51.72 ? 1248 ILE B CG1   1 
ATOM   4703 C  CG2   . ILE B 1 248 ? -0.491  48.397  31.692  1.00 51.26 ? 1248 ILE B CG2   1 
ATOM   4704 C  CD1   . ILE B 1 248 ? 0.410   44.667  31.578  1.00 52.91 ? 1248 ILE B CD1   1 
ATOM   4705 N  N     . VAL B 1 249 ? 0.067   45.963  28.277  1.00 51.93 ? 1249 VAL B N     1 
ATOM   4706 C  CA    . VAL B 1 249 ? -0.704  45.754  27.052  1.00 52.12 ? 1249 VAL B CA    1 
ATOM   4707 C  C     . VAL B 1 249 ? -1.394  44.392  27.037  1.00 52.38 ? 1249 VAL B C     1 
ATOM   4708 O  O     . VAL B 1 249 ? -0.811  43.394  27.469  1.00 52.25 ? 1249 VAL B O     1 
ATOM   4709 C  CB    . VAL B 1 249 ? 0.215   45.849  25.833  1.00 52.14 ? 1249 VAL B CB    1 
ATOM   4710 C  CG1   . VAL B 1 249 ? -0.593  45.778  24.539  1.00 52.65 ? 1249 VAL B CG1   1 
ATOM   4711 C  CG2   . VAL B 1 249 ? 1.035   47.136  25.891  1.00 52.31 ? 1249 VAL B CG2   1 
ATOM   4712 N  N     . THR B 1 250 ? -2.634  44.359  26.542  1.00 52.69 ? 1250 THR B N     1 
ATOM   4713 C  CA    . THR B 1 250 ? -3.368  43.102  26.377  1.00 52.92 ? 1250 THR B CA    1 
ATOM   4714 C  C     . THR B 1 250 ? -2.924  42.433  25.079  1.00 53.19 ? 1250 THR B C     1 
ATOM   4715 O  O     . THR B 1 250 ? -2.727  43.109  24.076  1.00 53.07 ? 1250 THR B O     1 
ATOM   4716 C  CB    . THR B 1 250 ? -4.902  43.315  26.351  1.00 52.96 ? 1250 THR B CB    1 
ATOM   4717 O  OG1   . THR B 1 250 ? -5.323  43.999  27.535  1.00 52.37 ? 1250 THR B OG1   1 
ATOM   4718 C  CG2   . THR B 1 250 ? -5.629  41.976  26.276  1.00 52.76 ? 1250 THR B CG2   1 
ATOM   4719 N  N     . MET B 1 251 ? -2.766  41.107  25.113  1.00 53.81 ? 1251 MET B N     1 
ATOM   4720 C  CA    . MET B 1 251 ? -2.279  40.332  23.958  1.00 54.20 ? 1251 MET B CA    1 
ATOM   4721 C  C     . MET B 1 251 ? -3.413  39.703  23.160  1.00 54.50 ? 1251 MET B C     1 
ATOM   4722 O  O     . MET B 1 251 ? -4.462  39.375  23.712  1.00 54.62 ? 1251 MET B O     1 
ATOM   4723 C  CB    . MET B 1 251 ? -1.334  39.221  24.416  1.00 54.07 ? 1251 MET B CB    1 
ATOM   4724 C  CG    . MET B 1 251 ? -0.055  39.718  25.053  1.00 54.05 ? 1251 MET B CG    1 
ATOM   4725 S  SD    . MET B 1 251 ? 1.148   38.393  25.266  1.00 54.49 ? 1251 MET B SD    1 
ATOM   4726 C  CE    . MET B 1 251 ? 0.305   37.338  26.449  1.00 53.90 ? 1251 MET B CE    1 
ATOM   4727 N  N     . LYS B 1 252 ? -3.179  39.516  21.862  1.00 54.90 ? 1252 LYS B N     1 
ATOM   4728 C  CA    . LYS B 1 252 ? -4.158  38.892  20.969  1.00 55.28 ? 1252 LYS B CA    1 
ATOM   4729 C  C     . LYS B 1 252 ? -4.683  37.585  21.573  1.00 55.38 ? 1252 LYS B C     1 
ATOM   4730 O  O     . LYS B 1 252 ? -5.877  37.293  21.507  1.00 55.33 ? 1252 LYS B O     1 
ATOM   4731 C  CB    . LYS B 1 252 ? -3.529  38.618  19.594  1.00 55.49 ? 1252 LYS B CB    1 
ATOM   4732 C  CG    . LYS B 1 252 ? -4.389  39.014  18.388  1.00 56.45 ? 1252 LYS B CG    1 
ATOM   4733 C  CD    . LYS B 1 252 ? -4.648  40.549  18.328  1.00 57.27 ? 1252 LYS B CD    1 
ATOM   4734 C  CE    . LYS B 1 252 ? -4.232  41.175  16.975  1.00 57.63 ? 1252 LYS B CE    1 
ATOM   4735 N  NZ    . LYS B 1 252 ? -4.570  40.351  15.769  1.00 56.98 ? 1252 LYS B NZ    1 
ATOM   4736 N  N     . ARG B 1 253 ? -3.782  36.813  22.175  1.00 55.53 ? 1253 ARG B N     1 
ATOM   4737 C  CA    . ARG B 1 253 ? -4.137  35.530  22.777  1.00 55.72 ? 1253 ARG B CA    1 
ATOM   4738 C  C     . ARG B 1 253 ? -3.223  35.179  23.949  1.00 55.57 ? 1253 ARG B C     1 
ATOM   4739 O  O     . ARG B 1 253 ? -2.131  35.735  24.098  1.00 55.59 ? 1253 ARG B O     1 
ATOM   4740 C  CB    . ARG B 1 253 ? -4.107  34.419  21.718  1.00 55.69 ? 1253 ARG B CB    1 
ATOM   4741 C  CG    . ARG B 1 253 ? -3.193  34.712  20.533  1.00 55.89 ? 1253 ARG B CG    1 
ATOM   4742 C  CD    . ARG B 1 253 ? -3.164  33.561  19.553  1.00 56.20 ? 1253 ARG B CD    1 
ATOM   4743 N  NE    . ARG B 1 253 ? -2.523  32.386  20.130  1.00 56.60 ? 1253 ARG B NE    1 
ATOM   4744 C  CZ    . ARG B 1 253 ? -2.386  31.218  19.510  1.00 56.92 ? 1253 ARG B CZ    1 
ATOM   4745 N  NH1   . ARG B 1 253 ? -2.843  31.049  18.274  1.00 57.29 ? 1253 ARG B NH1   1 
ATOM   4746 N  NH2   . ARG B 1 253 ? -1.785  30.211  20.132  1.00 56.76 ? 1253 ARG B NH2   1 
ATOM   4747 N  N     . ASN B 1 254 ? -3.684  34.248  24.776  1.00 55.47 ? 1254 ASN B N     1 
ATOM   4748 C  CA    . ASN B 1 254 ? -2.933  33.830  25.955  1.00 55.47 ? 1254 ASN B CA    1 
ATOM   4749 C  C     . ASN B 1 254 ? -1.722  33.025  25.492  1.00 55.30 ? 1254 ASN B C     1 
ATOM   4750 O  O     . ASN B 1 254 ? -1.821  32.277  24.517  1.00 55.39 ? 1254 ASN B O     1 
ATOM   4751 C  CB    . ASN B 1 254 ? -3.805  32.981  26.897  1.00 55.66 ? 1254 ASN B CB    1 
ATOM   4752 C  CG    . ASN B 1 254 ? -5.065  33.709  27.376  1.00 55.83 ? 1254 ASN B CG    1 
ATOM   4753 O  OD1   . ASN B 1 254 ? -5.233  33.955  28.569  1.00 56.29 ? 1254 ASN B OD1   1 
ATOM   4754 N  ND2   . ASN B 1 254 ? -5.963  34.028  26.447  1.00 56.00 ? 1254 ASN B ND2   1 
ATOM   4755 N  N     . SER B 1 255 ? -0.582  33.168  26.166  1.00 55.02 ? 1255 SER B N     1 
ATOM   4756 C  CA    . SER B 1 255 ? 0.636   32.496  25.704  1.00 54.83 ? 1255 SER B CA    1 
ATOM   4757 C  C     . SER B 1 255 ? 1.722   32.335  26.765  1.00 54.57 ? 1255 SER B C     1 
ATOM   4758 O  O     . SER B 1 255 ? 1.955   33.228  27.577  1.00 54.57 ? 1255 SER B O     1 
ATOM   4759 C  CB    . SER B 1 255 ? 1.218   33.245  24.496  1.00 54.94 ? 1255 SER B CB    1 
ATOM   4760 O  OG    . SER B 1 255 ? 2.420   32.644  24.042  1.00 54.88 ? 1255 SER B OG    1 
ATOM   4761 N  N     . ARG B 1 256 ? 2.377   31.177  26.732  1.00 54.32 ? 1256 ARG B N     1 
ATOM   4762 C  CA    . ARG B 1 256 ? 3.600   30.928  27.492  1.00 54.12 ? 1256 ARG B CA    1 
ATOM   4763 C  C     . ARG B 1 256 ? 4.817   30.955  26.568  1.00 53.72 ? 1256 ARG B C     1 
ATOM   4764 O  O     . ARG B 1 256 ? 5.936   30.697  27.008  1.00 53.79 ? 1256 ARG B O     1 
ATOM   4765 C  CB    . ARG B 1 256 ? 3.533   29.567  28.176  1.00 54.08 ? 1256 ARG B CB    1 
ATOM   4766 C  CG    . ARG B 1 256 ? 2.289   29.372  29.011  1.00 54.36 ? 1256 ARG B CG    1 
ATOM   4767 C  CD    . ARG B 1 256 ? 2.319   28.066  29.801  1.00 54.49 ? 1256 ARG B CD    1 
ATOM   4768 N  NE    . ARG B 1 256 ? 3.581   27.815  30.504  1.00 55.00 ? 1256 ARG B NE    1 
ATOM   4769 C  CZ    . ARG B 1 256 ? 4.059   28.541  31.518  1.00 55.05 ? 1256 ARG B CZ    1 
ATOM   4770 N  NH1   . ARG B 1 256 ? 3.407   29.609  31.960  1.00 54.98 ? 1256 ARG B NH1   1 
ATOM   4771 N  NH2   . ARG B 1 256 ? 5.211   28.204  32.088  1.00 54.95 ? 1256 ARG B NH2   1 
ATOM   4772 N  N     . ASN B 1 257 ? 4.596   31.258  25.290  1.00 53.11 ? 1257 ASN B N     1 
ATOM   4773 C  CA    . ASN B 1 257 ? 5.661   31.254  24.303  1.00 52.65 ? 1257 ASN B CA    1 
ATOM   4774 C  C     . ASN B 1 257 ? 6.484   32.539  24.400  1.00 52.39 ? 1257 ASN B C     1 
ATOM   4775 O  O     . ASN B 1 257 ? 5.997   33.622  24.073  1.00 52.48 ? 1257 ASN B O     1 
ATOM   4776 C  CB    . ASN B 1 257 ? 5.058   31.085  22.904  1.00 52.59 ? 1257 ASN B CB    1 
ATOM   4777 C  CG    . ASN B 1 257 ? 6.107   30.942  21.816  1.00 52.48 ? 1257 ASN B CG    1 
ATOM   4778 O  OD1   . ASN B 1 257 ? 5.890   31.364  20.680  1.00 52.24 ? 1257 ASN B OD1   1 
ATOM   4779 N  ND2   . ASN B 1 257 ? 7.241   30.333  22.151  1.00 52.21 ? 1257 ASN B ND2   1 
ATOM   4780 N  N     . LEU B 1 258 ? 7.731   32.403  24.852  1.00 51.92 ? 1258 LEU B N     1 
ATOM   4781 C  CA    . LEU B 1 258 ? 8.639   33.539  25.065  1.00 51.66 ? 1258 LEU B CA    1 
ATOM   4782 C  C     . LEU B 1 258 ? 8.786   34.441  23.831  1.00 51.44 ? 1258 LEU B C     1 
ATOM   4783 O  O     . LEU B 1 258 ? 8.637   35.658  23.923  1.00 51.51 ? 1258 LEU B O     1 
ATOM   4784 C  CB    . LEU B 1 258 ? 10.018  33.025  25.503  1.00 51.57 ? 1258 LEU B CB    1 
ATOM   4785 C  CG    . LEU B 1 258 ? 11.129  34.049  25.763  1.00 51.68 ? 1258 LEU B CG    1 
ATOM   4786 C  CD1   . LEU B 1 258 ? 10.655  35.148  26.697  1.00 52.22 ? 1258 LEU B CD1   1 
ATOM   4787 C  CD2   . LEU B 1 258 ? 12.354  33.364  26.336  1.00 51.60 ? 1258 LEU B CD2   1 
ATOM   4788 N  N     . GLU B 1 259 ? 9.069   33.840  22.680  1.00 51.10 ? 1259 GLU B N     1 
ATOM   4789 C  CA    . GLU B 1 259 ? 9.211   34.599  21.436  1.00 50.93 ? 1259 GLU B CA    1 
ATOM   4790 C  C     . GLU B 1 259 ? 7.875   35.174  20.926  1.00 50.74 ? 1259 GLU B C     1 
ATOM   4791 O  O     . GLU B 1 259 ? 7.866   36.046  20.055  1.00 50.48 ? 1259 GLU B O     1 
ATOM   4792 C  CB    . GLU B 1 259 ? 9.902   33.754  20.349  1.00 50.98 ? 1259 GLU B CB    1 
ATOM   4793 C  CG    . GLU B 1 259 ? 11.367  34.138  20.092  1.00 51.10 ? 1259 GLU B CG    1 
ATOM   4794 C  CD    . GLU B 1 259 ? 11.523  35.407  19.232  1.00 51.78 ? 1259 GLU B CD    1 
ATOM   4795 O  OE1   . GLU B 1 259 ? 10.588  36.242  19.175  1.00 51.70 ? 1259 GLU B OE1   1 
ATOM   4796 O  OE2   . GLU B 1 259 ? 12.594  35.573  18.608  1.00 51.56 ? 1259 GLU B OE2   1 
ATOM   4797 N  N     . GLU B 1 260 ? 6.760   34.687  21.468  1.00 50.54 ? 1260 GLU B N     1 
ATOM   4798 C  CA    . GLU B 1 260 ? 5.440   35.228  21.141  1.00 50.52 ? 1260 GLU B CA    1 
ATOM   4799 C  C     . GLU B 1 260 ? 5.105   36.452  21.999  1.00 50.22 ? 1260 GLU B C     1 
ATOM   4800 O  O     . GLU B 1 260 ? 4.380   37.346  21.556  1.00 50.18 ? 1260 GLU B O     1 
ATOM   4801 C  CB    . GLU B 1 260 ? 4.371   34.152  21.335  1.00 50.52 ? 1260 GLU B CB    1 
ATOM   4802 C  CG    . GLU B 1 260 ? 3.073   34.389  20.577  1.00 50.74 ? 1260 GLU B CG    1 
ATOM   4803 C  CD    . GLU B 1 260 ? 2.090   33.234  20.731  1.00 50.95 ? 1260 GLU B CD    1 
ATOM   4804 O  OE1   . GLU B 1 260 ? 2.513   32.057  20.608  1.00 52.26 ? 1260 GLU B OE1   1 
ATOM   4805 O  OE2   . GLU B 1 260 ? 0.893   33.503  20.974  1.00 51.01 ? 1260 GLU B OE2   1 
ATOM   4806 N  N     . ILE B 1 261 ? 5.632   36.479  23.224  1.00 49.84 ? 1261 ILE B N     1 
ATOM   4807 C  CA    . ILE B 1 261 ? 5.369   37.562  24.168  1.00 49.49 ? 1261 ILE B CA    1 
ATOM   4808 C  C     . ILE B 1 261 ? 6.335   38.736  23.971  1.00 49.43 ? 1261 ILE B C     1 
ATOM   4809 O  O     . ILE B 1 261 ? 5.934   39.900  24.108  1.00 49.34 ? 1261 ILE B O     1 
ATOM   4810 C  CB    . ILE B 1 261 ? 5.439   37.051  25.618  1.00 49.41 ? 1261 ILE B CB    1 
ATOM   4811 C  CG1   . ILE B 1 261 ? 4.316   36.041  25.865  1.00 49.45 ? 1261 ILE B CG1   1 
ATOM   4812 C  CG2   . ILE B 1 261 ? 5.311   38.198  26.605  1.00 49.38 ? 1261 ILE B CG2   1 
ATOM   4813 C  CD1   . ILE B 1 261 ? 4.334   35.429  27.242  1.00 49.43 ? 1261 ILE B CD1   1 
ATOM   4814 N  N     . LYS B 1 262 ? 7.593   38.426  23.642  1.00 49.05 ? 1262 LYS B N     1 
ATOM   4815 C  CA    . LYS B 1 262 ? 8.637   39.446  23.389  1.00 48.90 ? 1262 LYS B CA    1 
ATOM   4816 C  C     . LYS B 1 262 ? 8.196   40.712  22.625  1.00 48.34 ? 1262 LYS B C     1 
ATOM   4817 O  O     . LYS B 1 262 ? 8.459   41.817  23.087  1.00 48.28 ? 1262 LYS B O     1 
ATOM   4818 C  CB    . LYS B 1 262 ? 9.843   38.820  22.674  1.00 48.90 ? 1262 LYS B CB    1 
ATOM   4819 C  CG    . LYS B 1 262 ? 10.834  38.152  23.614  1.00 49.34 ? 1262 LYS B CG    1 
ATOM   4820 C  CD    . LYS B 1 262 ? 11.859  37.289  22.864  1.00 49.38 ? 1262 LYS B CD    1 
ATOM   4821 C  CE    . LYS B 1 262 ? 12.840  38.127  22.052  1.00 49.51 ? 1262 LYS B CE    1 
ATOM   4822 N  NZ    . LYS B 1 262 ? 13.967  37.301  21.518  1.00 49.05 ? 1262 LYS B NZ    1 
ATOM   4823 N  N     . PRO B 1 263 ? 7.564   40.562  21.445  1.00 47.93 ? 1263 PRO B N     1 
ATOM   4824 C  CA    . PRO B 1 263 ? 7.141   41.764  20.706  1.00 47.74 ? 1263 PRO B CA    1 
ATOM   4825 C  C     . PRO B 1 263 ? 6.242   42.717  21.504  1.00 47.45 ? 1263 PRO B C     1 
ATOM   4826 O  O     . PRO B 1 263 ? 6.421   43.933  21.424  1.00 47.37 ? 1263 PRO B O     1 
ATOM   4827 C  CB    . PRO B 1 263 ? 6.391   41.203  19.486  1.00 47.71 ? 1263 PRO B CB    1 
ATOM   4828 C  CG    . PRO B 1 263 ? 6.178   39.751  19.763  1.00 47.93 ? 1263 PRO B CG    1 
ATOM   4829 C  CD    . PRO B 1 263 ? 7.251   39.326  20.707  1.00 48.02 ? 1263 PRO B CD    1 
ATOM   4830 N  N     . TYR B 1 264 ? 5.295   42.166  22.265  1.00 47.09 ? 1264 TYR B N     1 
ATOM   4831 C  CA    . TYR B 1 264 ? 4.424   42.969  23.134  1.00 46.57 ? 1264 TYR B CA    1 
ATOM   4832 C  C     . TYR B 1 264 ? 5.232   43.669  24.240  1.00 46.33 ? 1264 TYR B C     1 
ATOM   4833 O  O     . TYR B 1 264 ? 5.008   44.838  24.532  1.00 46.37 ? 1264 TYR B O     1 
ATOM   4834 C  CB    . TYR B 1 264 ? 3.312   42.106  23.758  1.00 46.42 ? 1264 TYR B CB    1 
ATOM   4835 C  CG    . TYR B 1 264 ? 2.242   41.583  22.797  1.00 46.28 ? 1264 TYR B CG    1 
ATOM   4836 C  CD1   . TYR B 1 264 ? 1.195   42.408  22.361  1.00 45.94 ? 1264 TYR B CD1   1 
ATOM   4837 C  CD2   . TYR B 1 264 ? 2.250   40.248  22.360  1.00 45.88 ? 1264 TYR B CD2   1 
ATOM   4838 C  CE1   . TYR B 1 264 ? 0.204   41.929  21.496  1.00 45.63 ? 1264 TYR B CE1   1 
ATOM   4839 C  CE2   . TYR B 1 264 ? 1.259   39.759  21.500  1.00 45.48 ? 1264 TYR B CE2   1 
ATOM   4840 C  CZ    . TYR B 1 264 ? 0.242   40.604  21.073  1.00 46.06 ? 1264 TYR B CZ    1 
ATOM   4841 O  OH    . TYR B 1 264 ? -0.732  40.133  20.222  1.00 45.89 ? 1264 TYR B OH    1 
ATOM   4842 N  N     . LEU B 1 265 ? 6.175   42.954  24.845  1.00 46.25 ? 1265 LEU B N     1 
ATOM   4843 C  CA    . LEU B 1 265 ? 7.053   43.541  25.856  1.00 46.13 ? 1265 LEU B CA    1 
ATOM   4844 C  C     . LEU B 1 265 ? 7.882   44.695  25.292  1.00 46.28 ? 1265 LEU B C     1 
ATOM   4845 O  O     . LEU B 1 265 ? 7.986   45.748  25.920  1.00 46.28 ? 1265 LEU B O     1 
ATOM   4846 C  CB    . LEU B 1 265 ? 7.976   42.475  26.444  1.00 46.09 ? 1265 LEU B CB    1 
ATOM   4847 C  CG    . LEU B 1 265 ? 8.872   42.914  27.607  1.00 46.05 ? 1265 LEU B CG    1 
ATOM   4848 C  CD1   . LEU B 1 265 ? 8.051   43.463  28.761  1.00 45.45 ? 1265 LEU B CD1   1 
ATOM   4849 C  CD2   . LEU B 1 265 ? 9.746   41.759  28.072  1.00 45.87 ? 1265 LEU B CD2   1 
ATOM   4850 N  N     . PHE B 1 266 ? 8.462   44.502  24.107  1.00 46.47 ? 1266 PHE B N     1 
ATOM   4851 C  CA    . PHE B 1 266 ? 9.241   45.562  23.459  1.00 46.60 ? 1266 PHE B CA    1 
ATOM   4852 C  C     . PHE B 1 266 ? 8.379   46.784  23.135  1.00 46.43 ? 1266 PHE B C     1 
ATOM   4853 O  O     . PHE B 1 266 ? 8.815   47.921  23.328  1.00 46.38 ? 1266 PHE B O     1 
ATOM   4854 C  CB    . PHE B 1 266 ? 9.921   45.060  22.181  1.00 46.87 ? 1266 PHE B CB    1 
ATOM   4855 C  CG    . PHE B 1 266 ? 10.908  43.943  22.404  1.00 47.58 ? 1266 PHE B CG    1 
ATOM   4856 C  CD1   . PHE B 1 266 ? 11.777  43.951  23.500  1.00 48.36 ? 1266 PHE B CD1   1 
ATOM   4857 C  CD2   . PHE B 1 266 ? 10.990  42.887  21.497  1.00 48.11 ? 1266 PHE B CD2   1 
ATOM   4858 C  CE1   . PHE B 1 266 ? 12.696  42.916  23.692  1.00 48.09 ? 1266 PHE B CE1   1 
ATOM   4859 C  CE2   . PHE B 1 266 ? 11.908  41.851  21.683  1.00 47.94 ? 1266 PHE B CE2   1 
ATOM   4860 C  CZ    . PHE B 1 266 ? 12.760  41.867  22.779  1.00 47.66 ? 1266 PHE B CZ    1 
ATOM   4861 N  N     . ARG B 1 267 ? 7.165   46.538  22.641  1.00 46.24 ? 1267 ARG B N     1 
ATOM   4862 C  CA    . ARG B 1 267 ? 6.175   47.594  22.412  1.00 46.28 ? 1267 ARG B CA    1 
ATOM   4863 C  C     . ARG B 1 267 ? 6.021   48.416  23.691  1.00 45.72 ? 1267 ARG B C     1 
ATOM   4864 O  O     . ARG B 1 267 ? 6.065   49.645  23.650  1.00 45.48 ? 1267 ARG B O     1 
ATOM   4865 C  CB    . ARG B 1 267 ? 4.817   46.991  21.996  1.00 46.30 ? 1267 ARG B CB    1 
ATOM   4866 C  CG    . ARG B 1 267 ? 3.850   47.950  21.263  1.00 47.11 ? 1267 ARG B CG    1 
ATOM   4867 C  CD    . ARG B 1 267 ? 2.429   47.330  20.967  1.00 47.73 ? 1267 ARG B CD    1 
ATOM   4868 N  NE    . ARG B 1 267 ? 2.447   45.883  20.689  1.00 49.65 ? 1267 ARG B NE    1 
ATOM   4869 C  CZ    . ARG B 1 267 ? 2.909   45.299  19.570  1.00 50.57 ? 1267 ARG B CZ    1 
ATOM   4870 N  NH1   . ARG B 1 267 ? 3.399   46.021  18.562  1.00 51.46 ? 1267 ARG B NH1   1 
ATOM   4871 N  NH2   . ARG B 1 267 ? 2.877   43.971  19.450  1.00 49.34 ? 1267 ARG B NH2   1 
ATOM   4872 N  N     . ALA B 1 268 ? 5.877   47.726  24.825  1.00 45.11 ? 1268 ALA B N     1 
ATOM   4873 C  CA    . ALA B 1 268 ? 5.672   48.392  26.114  1.00 44.86 ? 1268 ALA B CA    1 
ATOM   4874 C  C     . ALA B 1 268 ? 6.885   49.217  26.537  1.00 44.53 ? 1268 ALA B C     1 
ATOM   4875 O  O     . ALA B 1 268 ? 6.733   50.315  27.081  1.00 43.91 ? 1268 ALA B O     1 
ATOM   4876 C  CB    . ALA B 1 268 ? 5.303   47.374  27.199  1.00 44.90 ? 1268 ALA B CB    1 
ATOM   4877 N  N     . ILE B 1 269 ? 8.080   48.687  26.267  1.00 44.49 ? 1269 ILE B N     1 
ATOM   4878 C  CA    . ILE B 1 269 ? 9.331   49.375  26.580  1.00 44.38 ? 1269 ILE B CA    1 
ATOM   4879 C  C     . ILE B 1 269 ? 9.511   50.654  25.756  1.00 44.65 ? 1269 ILE B C     1 
ATOM   4880 O  O     . ILE B 1 269 ? 9.762   51.716  26.326  1.00 44.56 ? 1269 ILE B O     1 
ATOM   4881 C  CB    . ILE B 1 269 ? 10.547  48.444  26.394  1.00 44.27 ? 1269 ILE B CB    1 
ATOM   4882 C  CG1   . ILE B 1 269 ? 10.532  47.363  27.471  1.00 43.83 ? 1269 ILE B CG1   1 
ATOM   4883 C  CG2   . ILE B 1 269 ? 11.857  49.229  26.474  1.00 43.63 ? 1269 ILE B CG2   1 
ATOM   4884 C  CD1   . ILE B 1 269 ? 11.530  46.281  27.254  1.00 43.20 ? 1269 ILE B CD1   1 
ATOM   4885 N  N     . GLU B 1 270 ? 9.378   50.563  24.434  1.00 44.93 ? 1270 GLU B N     1 
ATOM   4886 C  CA    . GLU B 1 270 ? 9.474   51.758  23.578  1.00 45.67 ? 1270 GLU B CA    1 
ATOM   4887 C  C     . GLU B 1 270 ? 8.502   52.825  24.058  1.00 45.74 ? 1270 GLU B C     1 
ATOM   4888 O  O     . GLU B 1 270 ? 8.863   53.988  24.235  1.00 45.70 ? 1270 GLU B O     1 
ATOM   4889 C  CB    . GLU B 1 270 ? 9.164   51.443  22.102  1.00 45.82 ? 1270 GLU B CB    1 
ATOM   4890 C  CG    . GLU B 1 270 ? 10.274  50.745  21.358  1.00 47.33 ? 1270 GLU B CG    1 
ATOM   4891 C  CD    . GLU B 1 270 ? 11.435  51.669  21.021  1.00 49.63 ? 1270 GLU B CD    1 
ATOM   4892 O  OE1   . GLU B 1 270 ? 11.231  52.615  20.227  1.00 51.34 ? 1270 GLU B OE1   1 
ATOM   4893 O  OE2   . GLU B 1 270 ? 12.554  51.444  21.540  1.00 50.78 ? 1270 GLU B OE2   1 
ATOM   4894 N  N     . GLU B 1 271 ? 7.260   52.421  24.268  1.00 45.94 ? 1271 GLU B N     1 
ATOM   4895 C  CA    . GLU B 1 271 ? 6.250   53.374  24.660  1.00 46.56 ? 1271 GLU B CA    1 
ATOM   4896 C  C     . GLU B 1 271 ? 6.559   53.918  26.040  1.00 46.46 ? 1271 GLU B C     1 
ATOM   4897 O  O     . GLU B 1 271 ? 6.354   55.104  26.282  1.00 46.99 ? 1271 GLU B O     1 
ATOM   4898 C  CB    . GLU B 1 271 ? 4.845   52.776  24.543  1.00 46.48 ? 1271 GLU B CB    1 
ATOM   4899 C  CG    . GLU B 1 271 ? 4.528   52.432  23.076  1.00 47.56 ? 1271 GLU B CG    1 
ATOM   4900 C  CD    . GLU B 1 271 ? 3.068   52.121  22.797  1.00 47.56 ? 1271 GLU B CD    1 
ATOM   4901 O  OE1   . GLU B 1 271 ? 2.284   52.013  23.767  1.00 47.45 ? 1271 GLU B OE1   1 
ATOM   4902 O  OE2   . GLU B 1 271 ? 2.723   51.974  21.592  1.00 49.04 ? 1271 GLU B OE2   1 
ATOM   4903 N  N     . SER B 1 272 ? 7.098   53.077  26.923  1.00 46.13 ? 1272 SER B N     1 
ATOM   4904 C  CA    . SER B 1 272 ? 7.553   53.549  28.228  1.00 45.72 ? 1272 SER B CA    1 
ATOM   4905 C  C     . SER B 1 272 ? 8.636   54.601  28.081  1.00 45.70 ? 1272 SER B C     1 
ATOM   4906 O  O     . SER B 1 272 ? 8.524   55.685  28.646  1.00 45.14 ? 1272 SER B O     1 
ATOM   4907 C  CB    . SER B 1 272 ? 8.067   52.398  29.087  1.00 45.62 ? 1272 SER B CB    1 
ATOM   4908 O  OG    . SER B 1 272 ? 6.996   51.801  29.786  1.00 44.89 ? 1272 SER B OG    1 
ATOM   4909 N  N     . TYR B 1 273 ? 9.666   54.285  27.303  1.00 46.01 ? 1273 TYR B N     1 
ATOM   4910 C  CA    . TYR B 1 273 ? 10.795  55.195  27.145  1.00 46.52 ? 1273 TYR B CA    1 
ATOM   4911 C  C     . TYR B 1 273 ? 10.427  56.486  26.421  1.00 47.22 ? 1273 TYR B C     1 
ATOM   4912 O  O     . TYR B 1 273 ? 11.138  57.473  26.542  1.00 47.50 ? 1273 TYR B O     1 
ATOM   4913 C  CB    . TYR B 1 273 ? 11.987  54.510  26.470  1.00 46.51 ? 1273 TYR B CB    1 
ATOM   4914 C  CG    . TYR B 1 273 ? 12.951  53.871  27.463  1.00 46.85 ? 1273 TYR B CG    1 
ATOM   4915 C  CD1   . TYR B 1 273 ? 14.129  54.517  27.849  1.00 46.77 ? 1273 TYR B CD1   1 
ATOM   4916 C  CD2   . TYR B 1 273 ? 12.675  52.630  28.027  1.00 46.79 ? 1273 TYR B CD2   1 
ATOM   4917 C  CE1   . TYR B 1 273 ? 15.005  53.933  28.760  1.00 46.65 ? 1273 TYR B CE1   1 
ATOM   4918 C  CE2   . TYR B 1 273 ? 13.538  52.044  28.937  1.00 46.67 ? 1273 TYR B CE2   1 
ATOM   4919 C  CZ    . TYR B 1 273 ? 14.699  52.691  29.307  1.00 46.91 ? 1273 TYR B CZ    1 
ATOM   4920 O  OH    . TYR B 1 273 ? 15.541  52.076  30.225  1.00 46.77 ? 1273 TYR B OH    1 
ATOM   4921 N  N     . TYR B 1 274 ? 9.325   56.498  25.681  1.00 47.92 ? 1274 TYR B N     1 
ATOM   4922 C  CA    . TYR B 1 274 ? 8.813   57.757  25.148  1.00 48.38 ? 1274 TYR B CA    1 
ATOM   4923 C  C     . TYR B 1 274 ? 8.198   58.595  26.272  1.00 48.84 ? 1274 TYR B C     1 
ATOM   4924 O  O     . TYR B 1 274 ? 8.314   59.814  26.273  1.00 48.91 ? 1274 TYR B O     1 
ATOM   4925 C  CB    . TYR B 1 274 ? 7.792   57.504  24.036  1.00 48.58 ? 1274 TYR B CB    1 
ATOM   4926 C  CG    . TYR B 1 274 ? 7.097   58.752  23.548  1.00 48.36 ? 1274 TYR B CG    1 
ATOM   4927 C  CD1   . TYR B 1 274 ? 7.650   59.537  22.540  1.00 48.42 ? 1274 TYR B CD1   1 
ATOM   4928 C  CD2   . TYR B 1 274 ? 5.884   59.148  24.105  1.00 48.07 ? 1274 TYR B CD2   1 
ATOM   4929 C  CE1   . TYR B 1 274 ? 7.003   60.690  22.093  1.00 48.81 ? 1274 TYR B CE1   1 
ATOM   4930 C  CE2   . TYR B 1 274 ? 5.237   60.293  23.680  1.00 48.40 ? 1274 TYR B CE2   1 
ATOM   4931 C  CZ    . TYR B 1 274 ? 5.794   61.061  22.673  1.00 48.95 ? 1274 TYR B CZ    1 
ATOM   4932 O  OH    . TYR B 1 274 ? 5.130   62.202  22.258  1.00 49.47 ? 1274 TYR B OH    1 
ATOM   4933 N  N     . LYS B 1 275 ? 7.542   57.932  27.221  1.00 49.60 ? 1275 LYS B N     1 
ATOM   4934 C  CA    . LYS B 1 275 ? 6.907   58.614  28.357  1.00 50.28 ? 1275 LYS B CA    1 
ATOM   4935 C  C     . LYS B 1 275 ? 7.943   59.160  29.345  1.00 50.02 ? 1275 LYS B C     1 
ATOM   4936 O  O     . LYS B 1 275 ? 7.804   60.271  29.841  1.00 49.79 ? 1275 LYS B O     1 
ATOM   4937 C  CB    . LYS B 1 275 ? 5.945   57.667  29.092  1.00 50.73 ? 1275 LYS B CB    1 
ATOM   4938 C  CG    . LYS B 1 275 ? 4.774   58.393  29.762  1.00 53.13 ? 1275 LYS B CG    1 
ATOM   4939 C  CD    . LYS B 1 275 ? 3.683   58.751  28.719  1.00 56.37 ? 1275 LYS B CD    1 
ATOM   4940 C  CE    . LYS B 1 275 ? 3.072   60.169  28.910  1.00 57.63 ? 1275 LYS B CE    1 
ATOM   4941 N  NZ    . LYS B 1 275 ? 2.993   60.904  27.584  1.00 57.83 ? 1275 LYS B NZ    1 
ATOM   4942 N  N     . LEU B 1 276 ? 8.969   58.358  29.628  1.00 50.02 ? 1276 LEU B N     1 
ATOM   4943 C  CA    . LEU B 1 276 ? 10.091  58.768  30.482  1.00 49.77 ? 1276 LEU B CA    1 
ATOM   4944 C  C     . LEU B 1 276 ? 10.655  60.115  30.055  1.00 49.89 ? 1276 LEU B C     1 
ATOM   4945 O  O     . LEU B 1 276 ? 10.707  61.044  30.853  1.00 49.52 ? 1276 LEU B O     1 
ATOM   4946 C  CB    . LEU B 1 276 ? 11.204  57.713  30.452  1.00 49.39 ? 1276 LEU B CB    1 
ATOM   4947 C  CG    . LEU B 1 276 ? 10.918  56.460  31.281  1.00 48.90 ? 1276 LEU B CG    1 
ATOM   4948 C  CD1   . LEU B 1 276 ? 11.795  55.288  30.859  1.00 48.03 ? 1276 LEU B CD1   1 
ATOM   4949 C  CD2   . LEU B 1 276 ? 11.083  56.765  32.764  1.00 47.75 ? 1276 LEU B CD2   1 
ATOM   4950 N  N     . ASP B 1 277 ? 11.074  60.189  28.792  1.00 50.43 ? 1277 ASP B N     1 
ATOM   4951 C  CA    . ASP B 1 277 ? 11.602  61.408  28.164  1.00 50.73 ? 1277 ASP B CA    1 
ATOM   4952 C  C     . ASP B 1 277 ? 12.406  62.281  29.125  1.00 50.55 ? 1277 ASP B C     1 
ATOM   4953 O  O     . ASP B 1 277 ? 11.825  63.039  29.909  1.00 50.80 ? 1277 ASP B O     1 
ATOM   4954 C  CB    . ASP B 1 277 ? 10.439  62.206  27.562  1.00 50.91 ? 1277 ASP B CB    1 
ATOM   4955 C  CG    . ASP B 1 277 ? 10.819  63.636  27.208  1.00 52.42 ? 1277 ASP B CG    1 
ATOM   4956 O  OD1   . ASP B 1 277 ? 10.016  64.543  27.535  1.00 53.66 ? 1277 ASP B OD1   1 
ATOM   4957 O  OD2   . ASP B 1 277 ? 11.915  63.855  26.622  1.00 53.48 ? 1277 ASP B OD2   1 
ATOM   4958 N  N     . LYS B 1 278 ? 13.732  62.175  29.052  1.00 50.15 ? 1278 LYS B N     1 
ATOM   4959 C  CA    . LYS B 1 278 ? 14.668  62.922  29.927  1.00 49.99 ? 1278 LYS B CA    1 
ATOM   4960 C  C     . LYS B 1 278 ? 14.955  62.169  31.224  1.00 49.41 ? 1278 LYS B C     1 
ATOM   4961 O  O     . LYS B 1 278 ? 16.114  62.047  31.632  1.00 49.59 ? 1278 LYS B O     1 
ATOM   4962 C  CB    . LYS B 1 278 ? 14.188  64.348  30.270  1.00 50.17 ? 1278 LYS B CB    1 
ATOM   4963 C  CG    . LYS B 1 278 ? 13.788  65.229  29.075  1.00 50.66 ? 1278 LYS B CG    1 
ATOM   4964 C  CD    . LYS B 1 278 ? 14.874  66.201  28.649  1.00 51.01 ? 1278 LYS B CD    1 
ATOM   4965 C  CE    . LYS B 1 278 ? 14.332  67.171  27.607  1.00 51.36 ? 1278 LYS B CE    1 
ATOM   4966 N  NZ    . LYS B 1 278 ? 15.329  68.216  27.245  1.00 52.49 ? 1278 LYS B NZ    1 
ATOM   4967 N  N     . ARG B 1 279 ? 13.905  61.684  31.879  1.00 48.68 ? 1279 ARG B N     1 
ATOM   4968 C  CA    . ARG B 1 279 ? 14.069  60.888  33.098  1.00 48.22 ? 1279 ARG B CA    1 
ATOM   4969 C  C     . ARG B 1 279 ? 14.728  59.541  32.795  1.00 47.30 ? 1279 ARG B C     1 
ATOM   4970 O  O     . ARG B 1 279 ? 14.455  58.920  31.758  1.00 47.25 ? 1279 ARG B O     1 
ATOM   4971 C  CB    . ARG B 1 279 ? 12.731  60.696  33.811  1.00 48.29 ? 1279 ARG B CB    1 
ATOM   4972 C  CG    . ARG B 1 279 ? 12.354  61.879  34.701  1.00 49.59 ? 1279 ARG B CG    1 
ATOM   4973 C  CD    . ARG B 1 279 ? 10.889  61.833  35.103  1.00 51.61 ? 1279 ARG B CD    1 
ATOM   4974 N  NE    . ARG B 1 279 ? 10.044  62.060  33.938  1.00 52.27 ? 1279 ARG B NE    1 
ATOM   4975 C  CZ    . ARG B 1 279 ? 8.728   61.891  33.902  1.00 52.78 ? 1279 ARG B CZ    1 
ATOM   4976 N  NH1   . ARG B 1 279 ? 8.062   61.485  34.974  1.00 53.21 ? 1279 ARG B NH1   1 
ATOM   4977 N  NH2   . ARG B 1 279 ? 8.075   62.128  32.770  1.00 53.37 ? 1279 ARG B NH2   1 
ATOM   4978 N  N     . ILE B 1 280 ? 15.617  59.119  33.695  1.00 46.08 ? 1280 ILE B N     1 
ATOM   4979 C  CA    . ILE B 1 280 ? 16.424  57.920  33.496  1.00 45.08 ? 1280 ILE B CA    1 
ATOM   4980 C  C     . ILE B 1 280 ? 16.270  57.008  34.699  1.00 44.36 ? 1280 ILE B C     1 
ATOM   4981 O  O     . ILE B 1 280 ? 16.614  57.402  35.808  1.00 44.29 ? 1280 ILE B O     1 
ATOM   4982 C  CB    . ILE B 1 280 ? 17.914  58.267  33.309  1.00 44.95 ? 1280 ILE B CB    1 
ATOM   4983 C  CG1   . ILE B 1 280 ? 18.075  59.270  32.163  1.00 44.44 ? 1280 ILE B CG1   1 
ATOM   4984 C  CG2   . ILE B 1 280 ? 18.721  56.997  33.062  1.00 44.63 ? 1280 ILE B CG2   1 
ATOM   4985 C  CD1   . ILE B 1 280 ? 19.467  59.356  31.593  1.00 43.98 ? 1280 ILE B CD1   1 
ATOM   4986 N  N     . PRO B 1 281 ? 15.747  55.790  34.487  1.00 43.61 ? 1281 PRO B N     1 
ATOM   4987 C  CA    . PRO B 1 281 ? 15.426  54.890  35.588  1.00 43.28 ? 1281 PRO B CA    1 
ATOM   4988 C  C     . PRO B 1 281 ? 16.556  53.961  36.021  1.00 42.79 ? 1281 PRO B C     1 
ATOM   4989 O  O     . PRO B 1 281 ? 17.323  53.496  35.173  1.00 42.49 ? 1281 PRO B O     1 
ATOM   4990 C  CB    . PRO B 1 281 ? 14.285  54.057  35.005  1.00 43.32 ? 1281 PRO B CB    1 
ATOM   4991 C  CG    . PRO B 1 281 ? 14.631  53.930  33.580  1.00 43.50 ? 1281 PRO B CG    1 
ATOM   4992 C  CD    . PRO B 1 281 ? 15.375  55.195  33.191  1.00 43.61 ? 1281 PRO B CD    1 
ATOM   4993 N  N     . LYS B 1 282 ? 16.620  53.688  37.330  1.00 42.20 ? 1282 LYS B N     1 
ATOM   4994 C  CA    . LYS B 1 282 ? 17.546  52.703  37.901  1.00 42.00 ? 1282 LYS B CA    1 
ATOM   4995 C  C     . LYS B 1 282 ? 16.926  51.304  38.063  1.00 41.37 ? 1282 LYS B C     1 
ATOM   4996 O  O     . LYS B 1 282 ? 17.658  50.335  38.231  1.00 41.23 ? 1282 LYS B O     1 
ATOM   4997 C  CB    . LYS B 1 282 ? 18.044  53.163  39.280  1.00 42.28 ? 1282 LYS B CB    1 
ATOM   4998 C  CG    . LYS B 1 282 ? 19.132  54.258  39.300  1.00 42.66 ? 1282 LYS B CG    1 
ATOM   4999 C  CD    . LYS B 1 282 ? 19.216  54.905  40.702  1.00 42.65 ? 1282 LYS B CD    1 
ATOM   5000 C  CE    . LYS B 1 282 ? 20.215  56.054  40.768  1.00 42.76 ? 1282 LYS B CE    1 
ATOM   5001 N  NZ    . LYS B 1 282 ? 21.610  55.584  41.008  1.00 43.65 ? 1282 LYS B NZ    1 
ATOM   5002 N  N     . ALA B 1 283 ? 15.597  51.195  38.036  1.00 40.83 ? 1283 ALA B N     1 
ATOM   5003 C  CA    . ALA B 1 283 ? 14.921  49.920  38.314  1.00 40.49 ? 1283 ALA B CA    1 
ATOM   5004 C  C     . ALA B 1 283 ? 13.878  49.556  37.254  1.00 40.32 ? 1283 ALA B C     1 
ATOM   5005 O  O     . ALA B 1 283 ? 13.111  50.410  36.811  1.00 39.98 ? 1283 ALA B O     1 
ATOM   5006 C  CB    . ALA B 1 283 ? 14.270  49.969  39.689  1.00 40.29 ? 1283 ALA B CB    1 
ATOM   5007 N  N     . ILE B 1 284 ? 13.861  48.279  36.866  1.00 40.39 ? 1284 ILE B N     1 
ATOM   5008 C  CA    . ILE B 1 284 ? 12.918  47.751  35.877  1.00 40.64 ? 1284 ILE B CA    1 
ATOM   5009 C  C     . ILE B 1 284 ? 12.176  46.561  36.450  1.00 41.14 ? 1284 ILE B C     1 
ATOM   5010 O  O     . ILE B 1 284 ? 12.792  45.642  36.981  1.00 41.15 ? 1284 ILE B O     1 
ATOM   5011 C  CB    . ILE B 1 284 ? 13.621  47.290  34.559  1.00 40.64 ? 1284 ILE B CB    1 
ATOM   5012 C  CG1   . ILE B 1 284 ? 12.582  46.864  33.515  1.00 40.29 ? 1284 ILE B CG1   1 
ATOM   5013 C  CG2   . ILE B 1 284 ? 14.598  46.143  34.816  1.00 40.54 ? 1284 ILE B CG2   1 
ATOM   5014 C  CD1   . ILE B 1 284 ? 13.163  46.302  32.257  1.00 40.38 ? 1284 ILE B CD1   1 
ATOM   5015 N  N     . HIS B 1 285 ? 10.854  46.579  36.332  1.00 41.87 ? 1285 HIS B N     1 
ATOM   5016 C  CA    . HIS B 1 285 ? 10.033  45.444  36.736  1.00 42.48 ? 1285 HIS B CA    1 
ATOM   5017 C  C     . HIS B 1 285 ? 9.186   45.025  35.563  1.00 42.73 ? 1285 HIS B C     1 
ATOM   5018 O  O     . HIS B 1 285 ? 8.600   45.871  34.904  1.00 42.69 ? 1285 HIS B O     1 
ATOM   5019 C  CB    . HIS B 1 285 ? 9.122   45.815  37.898  1.00 42.67 ? 1285 HIS B CB    1 
ATOM   5020 C  CG    . HIS B 1 285 ? 9.858   46.242  39.124  1.00 43.17 ? 1285 HIS B CG    1 
ATOM   5021 N  ND1   . HIS B 1 285 ? 9.928   45.464  40.259  1.00 43.75 ? 1285 HIS B ND1   1 
ATOM   5022 C  CD2   . HIS B 1 285 ? 10.562  47.367  39.393  1.00 43.93 ? 1285 HIS B CD2   1 
ATOM   5023 C  CE1   . HIS B 1 285 ? 10.641  46.093  41.176  1.00 44.31 ? 1285 HIS B CE1   1 
ATOM   5024 N  NE2   . HIS B 1 285 ? 11.037  47.250  40.675  1.00 44.02 ? 1285 HIS B NE2   1 
ATOM   5025 N  N     . VAL B 1 286 ? 9.139   43.724  35.304  1.00 43.25 ? 1286 VAL B N     1 
ATOM   5026 C  CA    . VAL B 1 286 ? 8.263   43.169  34.288  1.00 43.71 ? 1286 VAL B CA    1 
ATOM   5027 C  C     . VAL B 1 286 ? 7.015   42.626  34.971  1.00 44.23 ? 1286 VAL B C     1 
ATOM   5028 O  O     . VAL B 1 286 ? 7.103   41.767  35.850  1.00 44.11 ? 1286 VAL B O     1 
ATOM   5029 C  CB    . VAL B 1 286 ? 8.940   42.039  33.495  1.00 43.80 ? 1286 VAL B CB    1 
ATOM   5030 C  CG1   . VAL B 1 286 ? 7.946   41.408  32.518  1.00 43.67 ? 1286 VAL B CG1   1 
ATOM   5031 C  CG2   . VAL B 1 286 ? 10.172  42.564  32.756  1.00 43.58 ? 1286 VAL B CG2   1 
ATOM   5032 N  N     . VAL B 1 287 ? 5.861   43.138  34.546  1.00 44.92 ? 1287 VAL B N     1 
ATOM   5033 C  CA    . VAL B 1 287 ? 4.568   42.809  35.136  1.00 45.33 ? 1287 VAL B CA    1 
ATOM   5034 C  C     . VAL B 1 287 ? 3.750   41.955  34.160  1.00 45.95 ? 1287 VAL B C     1 
ATOM   5035 O  O     . VAL B 1 287 ? 3.703   42.237  32.964  1.00 45.98 ? 1287 VAL B O     1 
ATOM   5036 C  CB    . VAL B 1 287 ? 3.804   44.108  35.494  1.00 45.36 ? 1287 VAL B CB    1 
ATOM   5037 C  CG1   . VAL B 1 287 ? 2.369   43.813  35.861  1.00 45.33 ? 1287 VAL B CG1   1 
ATOM   5038 C  CG2   . VAL B 1 287 ? 4.516   44.855  36.620  1.00 44.59 ? 1287 VAL B CG2   1 
ATOM   5039 N  N     . ALA B 1 288 ? 3.113   40.913  34.685  1.00 46.91 ? 1288 ALA B N     1 
ATOM   5040 C  CA    . ALA B 1 288 ? 2.320   39.977  33.887  1.00 47.74 ? 1288 ALA B CA    1 
ATOM   5041 C  C     . ALA B 1 288 ? 0.952   39.744  34.523  1.00 48.52 ? 1288 ALA B C     1 
ATOM   5042 O  O     . ALA B 1 288 ? 0.870   39.460  35.714  1.00 48.70 ? 1288 ALA B O     1 
ATOM   5043 C  CB    . ALA B 1 288 ? 3.055   38.655  33.770  1.00 47.67 ? 1288 ALA B CB    1 
ATOM   5044 N  N     . VAL B 1 289 ? -0.115  39.872  33.739  1.00 49.57 ? 1289 VAL B N     1 
ATOM   5045 C  CA    . VAL B 1 289 ? -1.449  39.498  34.199  1.00 50.45 ? 1289 VAL B CA    1 
ATOM   5046 C  C     . VAL B 1 289 ? -1.751  38.107  33.671  1.00 51.49 ? 1289 VAL B C     1 
ATOM   5047 O  O     . VAL B 1 289 ? -1.898  37.921  32.461  1.00 51.57 ? 1289 VAL B O     1 
ATOM   5048 C  CB    . VAL B 1 289 ? -2.533  40.465  33.693  1.00 50.49 ? 1289 VAL B CB    1 
ATOM   5049 C  CG1   . VAL B 1 289 ? -3.923  39.889  33.943  1.00 50.50 ? 1289 VAL B CG1   1 
ATOM   5050 C  CG2   . VAL B 1 289 ? -2.388  41.829  34.355  1.00 50.00 ? 1289 VAL B CG2   1 
ATOM   5051 N  N     . THR B 1 290 ? -1.841  37.132  34.575  1.00 52.67 ? 1290 THR B N     1 
ATOM   5052 C  CA    . THR B 1 290 ? -2.094  35.743  34.185  1.00 53.62 ? 1290 THR B CA    1 
ATOM   5053 C  C     . THR B 1 290 ? -3.526  35.560  33.687  1.00 54.47 ? 1290 THR B C     1 
ATOM   5054 O  O     . THR B 1 290 ? -4.345  36.478  33.767  1.00 54.55 ? 1290 THR B O     1 
ATOM   5055 C  CB    . THR B 1 290 ? -1.832  34.762  35.347  1.00 53.68 ? 1290 THR B CB    1 
ATOM   5056 O  OG1   . THR B 1 290 ? -2.655  35.107  36.471  1.00 53.90 ? 1290 THR B OG1   1 
ATOM   5057 C  CG2   . THR B 1 290 ? -0.366  34.802  35.754  1.00 53.61 ? 1290 THR B CG2   1 
ATOM   5058 N  N     . GLU B 1 291 ? -3.815  34.370  33.167  1.00 55.52 ? 1291 GLU B N     1 
ATOM   5059 C  CA    . GLU B 1 291 ? -5.139  34.052  32.623  1.00 56.30 ? 1291 GLU B CA    1 
ATOM   5060 C  C     . GLU B 1 291 ? -6.262  34.395  33.608  1.00 56.81 ? 1291 GLU B C     1 
ATOM   5061 O  O     . GLU B 1 291 ? -7.331  34.852  33.205  1.00 56.84 ? 1291 GLU B O     1 
ATOM   5062 C  CB    . GLU B 1 291 ? -5.215  32.565  32.265  1.00 56.45 ? 1291 GLU B CB    1 
ATOM   5063 C  CG    . GLU B 1 291 ? -6.453  32.178  31.461  1.00 56.80 ? 1291 GLU B CG    1 
ATOM   5064 C  CD    . GLU B 1 291 ? -6.614  30.681  31.324  1.00 56.58 ? 1291 GLU B CD    1 
ATOM   5065 O  OE1   . GLU B 1 291 ? -6.691  29.995  32.368  1.00 57.10 ? 1291 GLU B OE1   1 
ATOM   5066 O  OE2   . GLU B 1 291 ? -6.674  30.197  30.171  1.00 56.75 ? 1291 GLU B OE2   1 
ATOM   5067 N  N     . ASP B 1 292 ? -6.002  34.174  34.895  1.00 57.41 ? 1292 ASP B N     1 
ATOM   5068 C  CA    . ASP B 1 292 ? -6.973  34.448  35.958  1.00 57.85 ? 1292 ASP B CA    1 
ATOM   5069 C  C     . ASP B 1 292 ? -6.764  35.827  36.586  1.00 58.13 ? 1292 ASP B C     1 
ATOM   5070 O  O     . ASP B 1 292 ? -6.954  36.010  37.789  1.00 58.14 ? 1292 ASP B O     1 
ATOM   5071 C  CB    . ASP B 1 292 ? -6.893  33.358  37.033  1.00 57.96 ? 1292 ASP B CB    1 
ATOM   5072 C  CG    . ASP B 1 292 ? -5.469  33.090  37.487  1.00 58.41 ? 1292 ASP B CG    1 
ATOM   5073 O  OD1   . ASP B 1 292 ? -5.123  31.903  37.673  1.00 59.72 ? 1292 ASP B OD1   1 
ATOM   5074 O  OD2   . ASP B 1 292 ? -4.689  34.057  37.628  1.00 58.78 ? 1292 ASP B OD2   1 
ATOM   5075 N  N     . LEU B 1 293 ? -6.341  36.788  35.769  1.00 58.58 ? 1293 LEU B N     1 
ATOM   5076 C  CA    . LEU B 1 293 ? -6.257  38.194  36.177  1.00 58.84 ? 1293 LEU B CA    1 
ATOM   5077 C  C     . LEU B 1 293 ? -5.399  38.460  37.436  1.00 58.87 ? 1293 LEU B C     1 
ATOM   5078 O  O     . LEU B 1 293 ? -5.538  39.511  38.061  1.00 59.16 ? 1293 LEU B O     1 
ATOM   5079 C  CB    . LEU B 1 293 ? -7.675  38.758  36.367  1.00 58.92 ? 1293 LEU B CB    1 
ATOM   5080 C  CG    . LEU B 1 293 ? -8.708  38.341  35.307  1.00 59.29 ? 1293 LEU B CG    1 
ATOM   5081 C  CD1   . LEU B 1 293 ? -10.088 38.894  35.625  1.00 59.63 ? 1293 LEU B CD1   1 
ATOM   5082 C  CD2   . LEU B 1 293 ? -8.265  38.777  33.915  1.00 59.78 ? 1293 LEU B CD2   1 
ATOM   5083 N  N     . ASP B 1 294 ? -4.513  37.527  37.796  1.00 58.70 ? 1294 ASP B N     1 
ATOM   5084 C  CA    . ASP B 1 294 ? -3.595  37.727  38.922  1.00 58.61 ? 1294 ASP B CA    1 
ATOM   5085 C  C     . ASP B 1 294 ? -2.301  38.397  38.425  1.00 58.18 ? 1294 ASP B C     1 
ATOM   5086 O  O     . ASP B 1 294 ? -1.609  37.854  37.563  1.00 58.35 ? 1294 ASP B O     1 
ATOM   5087 C  CB    . ASP B 1 294 ? -3.284  36.384  39.610  1.00 58.76 ? 1294 ASP B CB    1 
ATOM   5088 C  CG    . ASP B 1 294 ? -2.910  36.536  41.098  1.00 59.64 ? 1294 ASP B CG    1 
ATOM   5089 O  OD1   . ASP B 1 294 ? -3.226  37.583  41.711  1.00 61.43 ? 1294 ASP B OD1   1 
ATOM   5090 O  OD2   . ASP B 1 294 ? -2.310  35.591  41.668  1.00 60.28 ? 1294 ASP B OD2   1 
ATOM   5091 N  N     . ILE B 1 295 ? -1.985  39.575  38.961  1.00 57.53 ? 1295 ILE B N     1 
ATOM   5092 C  CA    . ILE B 1 295 ? -0.754  40.288  38.603  1.00 57.00 ? 1295 ILE B CA    1 
ATOM   5093 C  C     . ILE B 1 295 ? 0.467   39.589  39.210  1.00 56.38 ? 1295 ILE B C     1 
ATOM   5094 O  O     . ILE B 1 295 ? 0.424   39.145  40.353  1.00 56.30 ? 1295 ILE B O     1 
ATOM   5095 C  CB    . ILE B 1 295 ? -0.773  41.752  39.109  1.00 56.97 ? 1295 ILE B CB    1 
ATOM   5096 C  CG1   . ILE B 1 295 ? -1.968  42.511  38.532  1.00 57.24 ? 1295 ILE B CG1   1 
ATOM   5097 C  CG2   . ILE B 1 295 ? 0.528   42.471  38.753  1.00 56.81 ? 1295 ILE B CG2   1 
ATOM   5098 C  CD1   . ILE B 1 295 ? -1.848  44.034  38.643  1.00 57.56 ? 1295 ILE B CD1   1 
ATOM   5099 N  N     . VAL B 1 296 ? 1.548   39.492  38.442  1.00 55.59 ? 1296 VAL B N     1 
ATOM   5100 C  CA    . VAL B 1 296 ? 2.814   38.957  38.945  1.00 55.07 ? 1296 VAL B CA    1 
ATOM   5101 C  C     . VAL B 1 296 ? 3.968   39.774  38.364  1.00 54.41 ? 1296 VAL B C     1 
ATOM   5102 O  O     . VAL B 1 296 ? 3.893   40.210  37.217  1.00 54.42 ? 1296 VAL B O     1 
ATOM   5103 C  CB    . VAL B 1 296 ? 2.968   37.448  38.599  1.00 55.17 ? 1296 VAL B CB    1 
ATOM   5104 C  CG1   . VAL B 1 296 ? 4.430   37.007  38.654  1.00 54.90 ? 1296 VAL B CG1   1 
ATOM   5105 C  CG2   . VAL B 1 296 ? 2.117   36.596  39.545  1.00 55.29 ? 1296 VAL B CG2   1 
ATOM   5106 N  N     . SER B 1 297 ? 5.024   39.985  39.155  1.00 53.56 ? 1297 SER B N     1 
ATOM   5107 C  CA    . SER B 1 297 ? 6.141   40.839  38.736  1.00 52.81 ? 1297 SER B CA    1 
ATOM   5108 C  C     . SER B 1 297 ? 7.524   40.357  39.189  1.00 52.20 ? 1297 SER B C     1 
ATOM   5109 O  O     . SER B 1 297 ? 7.693   39.800  40.273  1.00 52.07 ? 1297 SER B O     1 
ATOM   5110 C  CB    . SER B 1 297 ? 5.925   42.272  39.229  1.00 52.67 ? 1297 SER B CB    1 
ATOM   5111 O  OG    . SER B 1 297 ? 5.925   42.323  40.642  1.00 52.56 ? 1297 SER B OG    1 
ATOM   5112 N  N     . ARG B 1 298 ? 8.510   40.596  38.332  1.00 51.53 ? 1298 ARG B N     1 
ATOM   5113 C  CA    . ARG B 1 298 ? 9.903   40.366  38.651  1.00 51.00 ? 1298 ARG B CA    1 
ATOM   5114 C  C     . ARG B 1 298 ? 10.687  41.582  38.192  1.00 50.53 ? 1298 ARG B C     1 
ATOM   5115 O  O     . ARG B 1 298 ? 10.423  42.115  37.118  1.00 50.35 ? 1298 ARG B O     1 
ATOM   5116 C  CB    . ARG B 1 298 ? 10.410  39.118  37.936  1.00 51.04 ? 1298 ARG B CB    1 
ATOM   5117 C  CG    . ARG B 1 298 ? 9.719   37.822  38.354  1.00 51.26 ? 1298 ARG B CG    1 
ATOM   5118 C  CD    . ARG B 1 298 ? 10.087  37.405  39.768  1.00 51.27 ? 1298 ARG B CD    1 
ATOM   5119 N  NE    . ARG B 1 298 ? 9.643   36.044  40.074  1.00 51.43 ? 1298 ARG B NE    1 
ATOM   5120 C  CZ    . ARG B 1 298 ? 8.403   35.698  40.421  1.00 51.25 ? 1298 ARG B CZ    1 
ATOM   5121 N  NH1   . ARG B 1 298 ? 7.434   36.605  40.512  1.00 51.00 ? 1298 ARG B NH1   1 
ATOM   5122 N  NH2   . ARG B 1 298 ? 8.124   34.422  40.677  1.00 51.19 ? 1298 ARG B NH2   1 
ATOM   5123 N  N     . GLY B 1 299 ? 11.646  42.020  39.002  1.00 50.14 ? 1299 GLY B N     1 
ATOM   5124 C  CA    . GLY B 1 299 ? 12.443  43.198  38.674  1.00 49.88 ? 1299 GLY B CA    1 
ATOM   5125 C  C     . GLY B 1 299 ? 13.898  43.139  39.107  1.00 49.62 ? 1299 GLY B C     1 
ATOM   5126 O  O     . GLY B 1 299 ? 14.381  42.112  39.585  1.00 49.50 ? 1299 GLY B O     1 
ATOM   5127 N  N     . ARG B 1 300 ? 14.596  44.255  38.904  1.00 49.31 ? 1300 ARG B N     1 
ATOM   5128 C  CA    . ARG B 1 300 ? 15.977  44.422  39.340  1.00 49.12 ? 1300 ARG B CA    1 
ATOM   5129 C  C     . ARG B 1 300 ? 16.310  45.906  39.424  1.00 48.59 ? 1300 ARG B C     1 
ATOM   5130 O  O     . ARG B 1 300 ? 15.861  46.696  38.599  1.00 48.31 ? 1300 ARG B O     1 
ATOM   5131 C  CB    . ARG B 1 300 ? 16.938  43.737  38.371  1.00 49.12 ? 1300 ARG B CB    1 
ATOM   5132 C  CG    . ARG B 1 300 ? 18.401  43.729  38.830  1.00 49.76 ? 1300 ARG B CG    1 
ATOM   5133 C  CD    . ARG B 1 300 ? 19.329  43.171  37.752  1.00 50.04 ? 1300 ARG B CD    1 
ATOM   5134 N  NE    . ARG B 1 300 ? 20.720  43.092  38.206  1.00 51.11 ? 1300 ARG B NE    1 
ATOM   5135 C  CZ    . ARG B 1 300 ? 21.768  42.813  37.425  1.00 51.33 ? 1300 ARG B CZ    1 
ATOM   5136 N  NH1   . ARG B 1 300 ? 21.615  42.580  36.125  1.00 51.08 ? 1300 ARG B NH1   1 
ATOM   5137 N  NH2   . ARG B 1 300 ? 22.988  42.766  37.953  1.00 51.41 ? 1300 ARG B NH2   1 
ATOM   5138 N  N     . THR B 1 301 ? 17.086  46.275  40.435  1.00 48.35 ? 1301 THR B N     1 
ATOM   5139 C  CA    . THR B 1 301 ? 17.575  47.639  40.585  1.00 48.18 ? 1301 THR B CA    1 
ATOM   5140 C  C     . THR B 1 301 ? 19.040  47.657  40.186  1.00 48.21 ? 1301 THR B C     1 
ATOM   5141 O  O     . THR B 1 301 ? 19.770  46.716  40.483  1.00 48.44 ? 1301 THR B O     1 
ATOM   5142 C  CB    . THR B 1 301 ? 17.462  48.128  42.047  1.00 48.09 ? 1301 THR B CB    1 
ATOM   5143 O  OG1   . THR B 1 301 ? 16.140  47.885  42.543  1.00 47.75 ? 1301 THR B OG1   1 
ATOM   5144 C  CG2   . THR B 1 301 ? 17.785  49.617  42.152  1.00 47.60 ? 1301 THR B CG2   1 
ATOM   5145 N  N     . PHE B 1 302 ? 19.467  48.721  39.517  1.00 48.04 ? 1302 PHE B N     1 
ATOM   5146 C  CA    . PHE B 1 302 ? 20.868  48.913  39.203  1.00 48.17 ? 1302 PHE B CA    1 
ATOM   5147 C  C     . PHE B 1 302 ? 21.395  50.140  39.942  1.00 48.07 ? 1302 PHE B C     1 
ATOM   5148 O  O     . PHE B 1 302 ? 20.610  51.003  40.334  1.00 47.93 ? 1302 PHE B O     1 
ATOM   5149 C  CB    . PHE B 1 302 ? 21.050  49.123  37.708  1.00 48.52 ? 1302 PHE B CB    1 
ATOM   5150 C  CG    . PHE B 1 302 ? 20.606  47.963  36.863  1.00 48.89 ? 1302 PHE B CG    1 
ATOM   5151 C  CD1   . PHE B 1 302 ? 19.273  47.807  36.510  1.00 48.93 ? 1302 PHE B CD1   1 
ATOM   5152 C  CD2   . PHE B 1 302 ? 21.529  47.048  36.385  1.00 49.27 ? 1302 PHE B CD2   1 
ATOM   5153 C  CE1   . PHE B 1 302 ? 18.868  46.748  35.713  1.00 48.73 ? 1302 PHE B CE1   1 
ATOM   5154 C  CE2   . PHE B 1 302 ? 21.127  45.989  35.585  1.00 49.39 ? 1302 PHE B CE2   1 
ATOM   5155 C  CZ    . PHE B 1 302 ? 19.794  45.841  35.251  1.00 48.96 ? 1302 PHE B CZ    1 
ATOM   5156 N  N     . PRO B 1 303 ? 22.728  50.224  40.137  1.00 48.01 ? 1303 PRO B N     1 
ATOM   5157 C  CA    . PRO B 1 303 ? 23.379  51.433  40.649  1.00 47.97 ? 1303 PRO B CA    1 
ATOM   5158 C  C     . PRO B 1 303 ? 23.841  52.440  39.573  1.00 48.02 ? 1303 PRO B C     1 
ATOM   5159 O  O     . PRO B 1 303 ? 24.794  53.178  39.790  1.00 48.48 ? 1303 PRO B O     1 
ATOM   5160 C  CB    . PRO B 1 303 ? 24.571  50.867  41.428  1.00 47.93 ? 1303 PRO B CB    1 
ATOM   5161 C  CG    . PRO B 1 303 ? 24.918  49.596  40.715  1.00 47.88 ? 1303 PRO B CG    1 
ATOM   5162 C  CD    . PRO B 1 303 ? 23.704  49.137  39.938  1.00 48.01 ? 1303 PRO B CD    1 
ATOM   5163 N  N     A HIS B 1 304 ? 23.058  52.623  38.518  0.50 48.02 ? 1304 HIS B N     1 
ATOM   5164 N  N     B HIS B 1 304 ? 23.299  52.209  38.366  0.50 47.81 ? 1304 HIS B N     1 
ATOM   5165 C  CA    A HIS B 1 304 ? 22.917  53.949  37.864  0.50 48.02 ? 1304 HIS B CA    1 
ATOM   5166 C  CA    B HIS B 1 304 ? 23.539  52.976  37.142  0.50 47.63 ? 1304 HIS B CA    1 
ATOM   5167 C  C     A HIS B 1 304 ? 21.894  53.671  36.743  0.50 48.14 ? 1304 HIS B C     1 
ATOM   5168 C  C     B HIS B 1 304 ? 22.192  53.168  36.396  0.50 47.91 ? 1304 HIS B C     1 
ATOM   5169 O  O     A HIS B 1 304 ? 20.901  52.972  36.996  0.50 48.19 ? 1304 HIS B O     1 
ATOM   5170 O  O     B HIS B 1 304 ? 21.260  52.386  36.600  0.50 47.84 ? 1304 HIS B O     1 
ATOM   5171 C  CB    A HIS B 1 304 ? 24.263  54.631  37.419  0.50 47.93 ? 1304 HIS B CB    1 
ATOM   5172 C  CB    B HIS B 1 304 ? 24.623  52.311  36.227  0.50 47.32 ? 1304 HIS B CB    1 
ATOM   5173 C  CG    A HIS B 1 304 ? 24.412  56.091  37.820  0.50 47.79 ? 1304 HIS B CG    1 
ATOM   5174 C  CG    B HIS B 1 304 ? 24.419  50.849  35.902  0.50 46.65 ? 1304 HIS B CG    1 
ATOM   5175 N  ND1   A HIS B 1 304 ? 23.423  57.039  37.642  0.50 47.69 ? 1304 HIS B ND1   1 
ATOM   5176 N  ND1   B HIS B 1 304 ? 25.155  49.844  36.497  0.50 46.26 ? 1304 HIS B ND1   1 
ATOM   5177 C  CD2   A HIS B 1 304 ? 25.468  56.762  38.348  0.50 47.75 ? 1304 HIS B CD2   1 
ATOM   5178 C  CD2   B HIS B 1 304 ? 23.652  50.237  34.966  0.50 46.17 ? 1304 HIS B CD2   1 
ATOM   5179 C  CE1   A HIS B 1 304 ? 23.853  58.218  38.064  0.50 47.39 ? 1304 HIS B CE1   1 
ATOM   5180 C  CE1   B HIS B 1 304 ? 24.810  48.676  35.984  0.50 46.31 ? 1304 HIS B CE1   1 
ATOM   5181 N  NE2   A HIS B 1 304 ? 25.092  58.076  38.497  0.50 47.58 ? 1304 HIS B NE2   1 
ATOM   5182 N  NE2   B HIS B 1 304 ? 23.899  48.887  35.052  0.50 46.22 ? 1304 HIS B NE2   1 
ATOM   5183 N  N     . GLY B 1 305 ? 22.094  54.180  35.527  1.00 48.18 ? 1305 GLY B N     1 
ATOM   5184 C  CA    . GLY B 1 305 ? 20.949  54.286  34.614  1.00 48.44 ? 1305 GLY B CA    1 
ATOM   5185 C  C     . GLY B 1 305 ? 20.747  53.101  33.684  1.00 48.77 ? 1305 GLY B C     1 
ATOM   5186 O  O     . GLY B 1 305 ? 21.704  52.429  33.306  1.00 49.08 ? 1305 GLY B O     1 
ATOM   5187 N  N     . ILE B 1 306 ? 19.497  52.852  33.308  1.00 49.03 ? 1306 ILE B N     1 
ATOM   5188 C  CA    . ILE B 1 306 ? 19.174  51.798  32.352  1.00 49.34 ? 1306 ILE B CA    1 
ATOM   5189 C  C     . ILE B 1 306 ? 18.916  52.439  30.988  1.00 49.79 ? 1306 ILE B C     1 
ATOM   5190 O  O     . ILE B 1 306 ? 17.915  53.143  30.804  1.00 49.39 ? 1306 ILE B O     1 
ATOM   5191 C  CB    . ILE B 1 306 ? 17.917  50.999  32.772  1.00 49.36 ? 1306 ILE B CB    1 
ATOM   5192 C  CG1   . ILE B 1 306 ? 17.996  50.566  34.233  1.00 49.50 ? 1306 ILE B CG1   1 
ATOM   5193 C  CG2   . ILE B 1 306 ? 17.746  49.764  31.902  1.00 49.12 ? 1306 ILE B CG2   1 
ATOM   5194 C  CD1   . ILE B 1 306 ? 16.674  50.127  34.785  1.00 49.60 ? 1306 ILE B CD1   1 
ATOM   5195 N  N     . SER B 1 307 ? 19.826  52.202  30.042  1.00 50.35 ? 1307 SER B N     1 
ATOM   5196 C  CA    . SER B 1 307 ? 19.643  52.658  28.664  1.00 50.88 ? 1307 SER B CA    1 
ATOM   5197 C  C     . SER B 1 307 ? 18.511  51.870  28.007  1.00 51.37 ? 1307 SER B C     1 
ATOM   5198 O  O     . SER B 1 307 ? 18.022  50.894  28.574  1.00 51.48 ? 1307 SER B O     1 
ATOM   5199 C  CB    . SER B 1 307 ? 20.948  52.541  27.865  1.00 50.92 ? 1307 SER B CB    1 
ATOM   5200 O  OG    . SER B 1 307 ? 21.782  51.506  28.358  1.00 51.05 ? 1307 SER B OG    1 
ATOM   5201 N  N     . LYS B 1 308 ? 18.074  52.302  26.829  1.00 51.89 ? 1308 LYS B N     1 
ATOM   5202 C  CA    . LYS B 1 308 ? 16.938  51.653  26.177  1.00 52.40 ? 1308 LYS B CA    1 
ATOM   5203 C  C     . LYS B 1 308 ? 17.258  50.194  25.823  1.00 52.61 ? 1308 LYS B C     1 
ATOM   5204 O  O     . LYS B 1 308 ? 16.442  49.309  26.055  1.00 52.66 ? 1308 LYS B O     1 
ATOM   5205 C  CB    . LYS B 1 308 ? 16.480  52.451  24.943  1.00 52.62 ? 1308 LYS B CB    1 
ATOM   5206 C  CG    . LYS B 1 308 ? 15.193  51.924  24.279  1.00 53.14 ? 1308 LYS B CG    1 
ATOM   5207 C  CD    . LYS B 1 308 ? 14.172  53.038  23.977  1.00 54.38 ? 1308 LYS B CD    1 
ATOM   5208 C  CE    . LYS B 1 308 ? 14.580  53.968  22.817  1.00 55.14 ? 1308 LYS B CE    1 
ATOM   5209 N  NZ    . LYS B 1 308 ? 14.276  53.421  21.461  1.00 55.08 ? 1308 LYS B NZ    1 
ATOM   5210 N  N     . GLU B 1 309 ? 18.453  49.940  25.297  1.00 52.89 ? 1309 GLU B N     1 
ATOM   5211 C  CA    . GLU B 1 309 ? 18.846  48.579  24.907  1.00 53.14 ? 1309 GLU B CA    1 
ATOM   5212 C  C     . GLU B 1 309 ? 19.068  47.674  26.118  1.00 53.05 ? 1309 GLU B C     1 
ATOM   5213 O  O     . GLU B 1 309 ? 18.786  46.478  26.058  1.00 53.19 ? 1309 GLU B O     1 
ATOM   5214 C  CB    . GLU B 1 309 ? 20.127  48.595  24.074  1.00 53.25 ? 1309 GLU B CB    1 
ATOM   5215 C  CG    . GLU B 1 309 ? 20.053  49.402  22.778  1.00 53.66 ? 1309 GLU B CG    1 
ATOM   5216 C  CD    . GLU B 1 309 ? 21.418  49.933  22.364  1.00 54.18 ? 1309 GLU B CD    1 
ATOM   5217 O  OE1   . GLU B 1 309 ? 22.269  50.102  23.265  1.00 54.93 ? 1309 GLU B OE1   1 
ATOM   5218 O  OE2   . GLU B 1 309 ? 21.640  50.180  21.157  1.00 53.41 ? 1309 GLU B OE2   1 
ATOM   5219 N  N     . THR B 1 310 ? 19.606  48.238  27.198  1.00 52.92 ? 1310 THR B N     1 
ATOM   5220 C  CA    . THR B 1 310 ? 19.731  47.517  28.473  1.00 52.81 ? 1310 THR B CA    1 
ATOM   5221 C  C     . THR B 1 310 ? 18.359  47.081  29.012  1.00 52.64 ? 1310 THR B C     1 
ATOM   5222 O  O     . THR B 1 310 ? 18.225  45.999  29.579  1.00 52.63 ? 1310 THR B O     1 
ATOM   5223 C  CB    . THR B 1 310 ? 20.427  48.374  29.548  1.00 52.76 ? 1310 THR B CB    1 
ATOM   5224 O  OG1   . THR B 1 310 ? 21.606  48.976  29.001  1.00 52.79 ? 1310 THR B OG1   1 
ATOM   5225 C  CG2   . THR B 1 310 ? 20.808  47.518  30.740  1.00 52.77 ? 1310 THR B CG2   1 
ATOM   5226 N  N     . ALA B 1 311 ? 17.350  47.926  28.827  1.00 52.42 ? 1311 ALA B N     1 
ATOM   5227 C  CA    . ALA B 1 311 ? 15.979  47.573  29.171  1.00 52.42 ? 1311 ALA B CA    1 
ATOM   5228 C  C     . ALA B 1 311 ? 15.500  46.399  28.322  1.00 52.49 ? 1311 ALA B C     1 
ATOM   5229 O  O     . ALA B 1 311 ? 14.844  45.497  28.828  1.00 52.29 ? 1311 ALA B O     1 
ATOM   5230 C  CB    . ALA B 1 311 ? 15.064  48.771  28.990  1.00 52.24 ? 1311 ALA B CB    1 
ATOM   5231 N  N     . TYR B 1 312 ? 15.837  46.424  27.033  1.00 52.83 ? 1312 TYR B N     1 
ATOM   5232 C  CA    . TYR B 1 312 ? 15.502  45.336  26.097  1.00 53.09 ? 1312 TYR B CA    1 
ATOM   5233 C  C     . TYR B 1 312 ? 16.031  43.969  26.571  1.00 52.92 ? 1312 TYR B C     1 
ATOM   5234 O  O     . TYR B 1 312 ? 15.289  42.983  26.588  1.00 52.95 ? 1312 TYR B O     1 
ATOM   5235 C  CB    . TYR B 1 312 ? 16.056  45.643  24.689  1.00 53.51 ? 1312 TYR B CB    1 
ATOM   5236 C  CG    . TYR B 1 312 ? 15.124  46.423  23.762  1.00 54.11 ? 1312 TYR B CG    1 
ATOM   5237 C  CD1   . TYR B 1 312 ? 14.864  45.973  22.467  1.00 54.61 ? 1312 TYR B CD1   1 
ATOM   5238 C  CD2   . TYR B 1 312 ? 14.517  47.610  24.170  1.00 54.23 ? 1312 TYR B CD2   1 
ATOM   5239 C  CE1   . TYR B 1 312 ? 14.023  46.680  21.608  1.00 54.96 ? 1312 TYR B CE1   1 
ATOM   5240 C  CE2   . TYR B 1 312 ? 13.667  48.325  23.317  1.00 54.33 ? 1312 TYR B CE2   1 
ATOM   5241 C  CZ    . TYR B 1 312 ? 13.424  47.854  22.039  1.00 54.73 ? 1312 TYR B CZ    1 
ATOM   5242 O  OH    . TYR B 1 312 ? 12.590  48.547  21.181  1.00 54.65 ? 1312 TYR B OH    1 
ATOM   5243 N  N     . SER B 1 313 ? 17.308  43.920  26.951  1.00 52.55 ? 1313 SER B N     1 
ATOM   5244 C  CA    . SER B 1 313 ? 17.962  42.667  27.347  1.00 52.30 ? 1313 SER B CA    1 
ATOM   5245 C  C     . SER B 1 313 ? 17.504  42.167  28.713  1.00 52.01 ? 1313 SER B C     1 
ATOM   5246 O  O     . SER B 1 313 ? 17.195  40.985  28.882  1.00 52.08 ? 1313 SER B O     1 
ATOM   5247 C  CB    . SER B 1 313 ? 19.482  42.834  27.371  1.00 52.23 ? 1313 SER B CB    1 
ATOM   5248 O  OG    . SER B 1 313 ? 20.017  42.778  26.063  1.00 52.78 ? 1313 SER B OG    1 
ATOM   5249 N  N     . GLU B 1 314 ? 17.474  43.072  29.685  1.00 51.46 ? 1314 GLU B N     1 
ATOM   5250 C  CA    . GLU B 1 314 ? 17.183  42.702  31.063  1.00 50.98 ? 1314 GLU B CA    1 
ATOM   5251 C  C     . GLU B 1 314 ? 15.741  42.234  31.235  1.00 50.58 ? 1314 GLU B C     1 
ATOM   5252 O  O     . GLU B 1 314 ? 15.468  41.326  32.017  1.00 50.56 ? 1314 GLU B O     1 
ATOM   5253 C  CB    . GLU B 1 314 ? 17.486  43.874  31.999  1.00 50.87 ? 1314 GLU B CB    1 
ATOM   5254 C  CG    . GLU B 1 314 ? 17.478  43.518  33.484  1.00 51.04 ? 1314 GLU B CG    1 
ATOM   5255 C  CD    . GLU B 1 314 ? 18.590  42.556  33.901  1.00 51.12 ? 1314 GLU B CD    1 
ATOM   5256 O  OE1   . GLU B 1 314 ? 18.502  42.044  35.040  1.00 51.16 ? 1314 GLU B OE1   1 
ATOM   5257 O  OE2   . GLU B 1 314 ? 19.542  42.312  33.115  1.00 50.04 ? 1314 GLU B OE2   1 
ATOM   5258 N  N     . SER B 1 315 ? 14.827  42.850  30.497  1.00 50.24 ? 1315 SER B N     1 
ATOM   5259 C  CA    . SER B 1 315 ? 13.421  42.458  30.516  1.00 49.98 ? 1315 SER B CA    1 
ATOM   5260 C  C     . SER B 1 315 ? 13.217  41.015  30.055  1.00 49.77 ? 1315 SER B C     1 
ATOM   5261 O  O     . SER B 1 315 ? 12.382  40.300  30.599  1.00 49.86 ? 1315 SER B O     1 
ATOM   5262 C  CB    . SER B 1 315 ? 12.603  43.393  29.628  1.00 50.05 ? 1315 SER B CB    1 
ATOM   5263 O  OG    . SER B 1 315 ? 13.087  43.382  28.294  1.00 49.93 ? 1315 SER B OG    1 
ATOM   5264 N  N     . VAL B 1 316 ? 13.973  40.591  29.050  1.00 49.59 ? 1316 VAL B N     1 
ATOM   5265 C  CA    . VAL B 1 316 ? 13.872  39.221  28.555  1.00 49.35 ? 1316 VAL B CA    1 
ATOM   5266 C  C     . VAL B 1 316 ? 14.270  38.213  29.629  1.00 49.25 ? 1316 VAL B C     1 
ATOM   5267 O  O     . VAL B 1 316 ? 13.660  37.153  29.743  1.00 49.23 ? 1316 VAL B O     1 
ATOM   5268 C  CB    . VAL B 1 316 ? 14.739  39.013  27.317  1.00 49.30 ? 1316 VAL B CB    1 
ATOM   5269 C  CG1   . VAL B 1 316 ? 14.824  37.528  26.963  1.00 49.14 ? 1316 VAL B CG1   1 
ATOM   5270 C  CG2   . VAL B 1 316 ? 14.181  39.830  26.159  1.00 49.09 ? 1316 VAL B CG2   1 
ATOM   5271 N  N     . LYS B 1 317 ? 15.285  38.555  30.415  1.00 49.06 ? 1317 LYS B N     1 
ATOM   5272 C  CA    . LYS B 1 317 ? 15.717  37.706  31.522  1.00 49.13 ? 1317 LYS B CA    1 
ATOM   5273 C  C     . LYS B 1 317 ? 14.643  37.647  32.617  1.00 49.02 ? 1317 LYS B C     1 
ATOM   5274 O  O     . LYS B 1 317 ? 14.413  36.595  33.213  1.00 49.05 ? 1317 LYS B O     1 
ATOM   5275 C  CB    . LYS B 1 317 ? 17.028  38.223  32.118  1.00 49.08 ? 1317 LYS B CB    1 
ATOM   5276 C  CG    . LYS B 1 317 ? 18.202  38.276  31.148  1.00 49.14 ? 1317 LYS B CG    1 
ATOM   5277 C  CD    . LYS B 1 317 ? 19.385  38.989  31.797  1.00 49.32 ? 1317 LYS B CD    1 
ATOM   5278 C  CE    . LYS B 1 317 ? 20.678  38.823  31.013  1.00 49.43 ? 1317 LYS B CE    1 
ATOM   5279 N  NZ    . LYS B 1 317 ? 21.863  38.968  31.910  1.00 49.66 ? 1317 LYS B NZ    1 
ATOM   5280 N  N     . LEU B 1 318 ? 13.996  38.782  32.872  1.00 48.82 ? 1318 LEU B N     1 
ATOM   5281 C  CA    . LEU B 1 318 ? 12.933  38.869  33.866  1.00 48.63 ? 1318 LEU B CA    1 
ATOM   5282 C  C     . LEU B 1 318 ? 11.680  38.113  33.434  1.00 49.00 ? 1318 LEU B C     1 
ATOM   5283 O  O     . LEU B 1 318 ? 11.068  37.420  34.242  1.00 49.19 ? 1318 LEU B O     1 
ATOM   5284 C  CB    . LEU B 1 318 ? 12.579  40.329  34.136  1.00 48.34 ? 1318 LEU B CB    1 
ATOM   5285 C  CG    . LEU B 1 318 ? 13.667  41.156  34.811  1.00 47.59 ? 1318 LEU B CG    1 
ATOM   5286 C  CD1   . LEU B 1 318 ? 13.308  42.635  34.774  1.00 46.77 ? 1318 LEU B CD1   1 
ATOM   5287 C  CD2   . LEU B 1 318 ? 13.879  40.689  36.236  1.00 46.25 ? 1318 LEU B CD2   1 
ATOM   5288 N  N     . LEU B 1 319 ? 11.293  38.248  32.169  1.00 49.34 ? 1319 LEU B N     1 
ATOM   5289 C  CA    . LEU B 1 319 ? 10.128  37.532  31.648  1.00 49.68 ? 1319 LEU B CA    1 
ATOM   5290 C  C     . LEU B 1 319 ? 10.310  36.023  31.750  1.00 50.16 ? 1319 LEU B C     1 
ATOM   5291 O  O     . LEU B 1 319 ? 9.356   35.306  32.044  1.00 50.25 ? 1319 LEU B O     1 
ATOM   5292 C  CB    . LEU B 1 319 ? 9.851   37.918  30.194  1.00 49.77 ? 1319 LEU B CB    1 
ATOM   5293 C  CG    . LEU B 1 319 ? 8.743   37.147  29.461  1.00 49.67 ? 1319 LEU B CG    1 
ATOM   5294 C  CD1   . LEU B 1 319 ? 7.419   37.252  30.188  1.00 48.97 ? 1319 LEU B CD1   1 
ATOM   5295 C  CD2   . LEU B 1 319 ? 8.610   37.643  28.027  1.00 49.59 ? 1319 LEU B CD2   1 
ATOM   5296 N  N     . GLN B 1 320 ? 11.526  35.542  31.496  1.00 50.71 ? 1320 GLN B N     1 
ATOM   5297 C  CA    . GLN B 1 320 ? 11.844  34.119  31.683  1.00 51.12 ? 1320 GLN B CA    1 
ATOM   5298 C  C     . GLN B 1 320 ? 11.623  33.714  33.135  1.00 51.44 ? 1320 GLN B C     1 
ATOM   5299 O  O     . GLN B 1 320 ? 10.968  32.709  33.415  1.00 51.61 ? 1320 GLN B O     1 
ATOM   5300 C  CB    . GLN B 1 320 ? 13.293  33.811  31.291  1.00 51.09 ? 1320 GLN B CB    1 
ATOM   5301 C  CG    . GLN B 1 320 ? 13.568  33.834  29.797  1.00 51.13 ? 1320 GLN B CG    1 
ATOM   5302 C  CD    . GLN B 1 320 ? 15.050  33.784  29.492  1.00 51.05 ? 1320 GLN B CD    1 
ATOM   5303 O  OE1   . GLN B 1 320 ? 15.823  33.200  30.247  1.00 51.84 ? 1320 GLN B OE1   1 
ATOM   5304 N  NE2   . GLN B 1 320 ? 15.455  34.399  28.388  1.00 50.77 ? 1320 GLN B NE2   1 
ATOM   5305 N  N     . LYS B 1 321 ? 12.169  34.514  34.050  1.00 51.73 ? 1321 LYS B N     1 
ATOM   5306 C  CA    . LYS B 1 321 ? 12.065  34.252  35.485  1.00 51.97 ? 1321 LYS B CA    1 
ATOM   5307 C  C     . LYS B 1 321 ? 10.603  34.035  35.893  1.00 51.93 ? 1321 LYS B C     1 
ATOM   5308 O  O     . LYS B 1 321 ? 10.311  33.153  36.702  1.00 52.02 ? 1321 LYS B O     1 
ATOM   5309 C  CB    . LYS B 1 321 ? 12.702  35.401  36.288  1.00 52.09 ? 1321 LYS B CB    1 
ATOM   5310 C  CG    . LYS B 1 321 ? 12.998  35.085  37.759  1.00 52.29 ? 1321 LYS B CG    1 
ATOM   5311 C  CD    . LYS B 1 321 ? 13.695  36.257  38.458  1.00 52.30 ? 1321 LYS B CD    1 
ATOM   5312 C  CE    . LYS B 1 321 ? 13.757  36.074  39.975  1.00 52.71 ? 1321 LYS B CE    1 
ATOM   5313 N  NZ    . LYS B 1 321 ? 14.650  34.954  40.390  1.00 53.12 ? 1321 LYS B NZ    1 
ATOM   5314 N  N     . ILE B 1 322 ? 9.693   34.824  35.320  1.00 51.85 ? 1322 ILE B N     1 
ATOM   5315 C  CA    . ILE B 1 322 ? 8.262   34.617  35.536  1.00 51.80 ? 1322 ILE B CA    1 
ATOM   5316 C  C     . ILE B 1 322 ? 7.843   33.255  34.970  1.00 52.19 ? 1322 ILE B C     1 
ATOM   5317 O  O     . ILE B 1 322 ? 7.224   32.448  35.668  1.00 52.19 ? 1322 ILE B O     1 
ATOM   5318 C  CB    . ILE B 1 322 ? 7.393   35.738  34.902  1.00 51.65 ? 1322 ILE B CB    1 
ATOM   5319 C  CG1   . ILE B 1 322 ? 7.680   37.084  35.567  1.00 51.41 ? 1322 ILE B CG1   1 
ATOM   5320 C  CG2   . ILE B 1 322 ? 5.921   35.412  35.045  1.00 51.14 ? 1322 ILE B CG2   1 
ATOM   5321 C  CD1   . ILE B 1 322 ? 6.670   38.163  35.249  1.00 51.36 ? 1322 ILE B CD1   1 
ATOM   5322 N  N     . LEU B 1 323 ? 8.197   33.003  33.712  1.00 52.57 ? 1323 LEU B N     1 
ATOM   5323 C  CA    . LEU B 1 323 ? 7.836   31.749  33.042  1.00 52.92 ? 1323 LEU B CA    1 
ATOM   5324 C  C     . LEU B 1 323 ? 8.377   30.515  33.765  1.00 53.40 ? 1323 LEU B C     1 
ATOM   5325 O  O     . LEU B 1 323 ? 7.656   29.534  33.927  1.00 53.39 ? 1323 LEU B O     1 
ATOM   5326 C  CB    . LEU B 1 323 ? 8.313   31.753  31.584  1.00 52.94 ? 1323 LEU B CB    1 
ATOM   5327 C  CG    . LEU B 1 323 ? 7.310   32.232  30.526  1.00 52.85 ? 1323 LEU B CG    1 
ATOM   5328 C  CD1   . LEU B 1 323 ? 6.445   33.363  31.038  1.00 53.07 ? 1323 LEU B CD1   1 
ATOM   5329 C  CD2   . LEU B 1 323 ? 8.037   32.649  29.255  1.00 52.61 ? 1323 LEU B CD2   1 
ATOM   5330 N  N     . GLU B 1 324 ? 9.633   30.574  34.201  1.00 53.98 ? 1324 GLU B N     1 
ATOM   5331 C  CA    . GLU B 1 324 ? 10.261  29.457  34.912  1.00 54.51 ? 1324 GLU B CA    1 
ATOM   5332 C  C     . GLU B 1 324 ? 9.536   29.110  36.215  1.00 54.96 ? 1324 GLU B C     1 
ATOM   5333 O  O     . GLU B 1 324 ? 9.473   27.941  36.589  1.00 55.01 ? 1324 GLU B O     1 
ATOM   5334 C  CB    . GLU B 1 324 ? 11.732  29.765  35.225  1.00 54.44 ? 1324 GLU B CB    1 
ATOM   5335 C  CG    . GLU B 1 324 ? 12.643  29.869  33.997  1.00 54.78 ? 1324 GLU B CG    1 
ATOM   5336 C  CD    . GLU B 1 324 ? 14.136  29.856  34.343  1.00 54.94 ? 1324 GLU B CD    1 
ATOM   5337 O  OE1   . GLU B 1 324 ? 14.967  29.792  33.405  1.00 54.60 ? 1324 GLU B OE1   1 
ATOM   5338 O  OE2   . GLU B 1 324 ? 14.480  29.902  35.547  1.00 55.54 ? 1324 GLU B OE2   1 
ATOM   5339 N  N     . GLU B 1 325 ? 8.981   30.126  36.885  1.00 55.54 ? 1325 GLU B N     1 
ATOM   5340 C  CA    . GLU B 1 325 ? 8.448   29.993  38.253  1.00 55.96 ? 1325 GLU B CA    1 
ATOM   5341 C  C     . GLU B 1 325 ? 6.924   30.141  38.379  1.00 56.07 ? 1325 GLU B C     1 
ATOM   5342 O  O     . GLU B 1 325 ? 6.418   30.410  39.470  1.00 56.05 ? 1325 GLU B O     1 
ATOM   5343 C  CB    . GLU B 1 325 ? 9.117   31.033  39.161  1.00 56.14 ? 1325 GLU B CB    1 
ATOM   5344 C  CG    . GLU B 1 325 ? 10.612  30.830  39.339  1.00 56.91 ? 1325 GLU B CG    1 
ATOM   5345 C  CD    . GLU B 1 325 ? 11.342  32.124  39.643  1.00 57.91 ? 1325 GLU B CD    1 
ATOM   5346 O  OE1   . GLU B 1 325 ? 10.846  32.915  40.479  1.00 57.98 ? 1325 GLU B OE1   1 
ATOM   5347 O  OE2   . GLU B 1 325 ? 12.416  32.342  39.039  1.00 58.67 ? 1325 GLU B OE2   1 
ATOM   5348 N  N     . ASP B 1 326 ? 6.195   29.966  37.279  1.00 56.23 ? 1326 ASP B N     1 
ATOM   5349 C  CA    . ASP B 1 326 ? 4.733   30.016  37.313  1.00 56.28 ? 1326 ASP B CA    1 
ATOM   5350 C  C     . ASP B 1 326 ? 4.148   29.425  36.033  1.00 56.23 ? 1326 ASP B C     1 
ATOM   5351 O  O     . ASP B 1 326 ? 4.393   29.940  34.945  1.00 56.19 ? 1326 ASP B O     1 
ATOM   5352 C  CB    . ASP B 1 326 ? 4.255   31.454  37.486  1.00 56.34 ? 1326 ASP B CB    1 
ATOM   5353 C  CG    . ASP B 1 326 ? 2.795   31.536  37.866  1.00 57.07 ? 1326 ASP B CG    1 
ATOM   5354 O  OD1   . ASP B 1 326 ? 2.483   31.432  39.076  1.00 57.74 ? 1326 ASP B OD1   1 
ATOM   5355 O  OD2   . ASP B 1 326 ? 1.961   31.714  36.953  1.00 57.92 ? 1326 ASP B OD2   1 
ATOM   5356 N  N     . GLU B 1 327 ? 3.374   28.348  36.169  1.00 56.23 ? 1327 GLU B N     1 
ATOM   5357 C  CA    . GLU B 1 327 ? 2.870   27.602  35.007  1.00 56.19 ? 1327 GLU B CA    1 
ATOM   5358 C  C     . GLU B 1 327 ? 1.568   28.163  34.409  1.00 56.00 ? 1327 GLU B C     1 
ATOM   5359 O  O     . GLU B 1 327 ? 1.058   27.615  33.432  1.00 55.99 ? 1327 GLU B O     1 
ATOM   5360 C  CB    . GLU B 1 327 ? 2.696   26.108  35.346  1.00 56.21 ? 1327 GLU B CB    1 
ATOM   5361 C  CG    . GLU B 1 327 ? 3.930   25.227  35.054  1.00 56.65 ? 1327 GLU B CG    1 
ATOM   5362 C  CD    . GLU B 1 327 ? 4.871   25.058  36.250  1.00 57.13 ? 1327 GLU B CD    1 
ATOM   5363 O  OE1   . GLU B 1 327 ? 5.548   24.007  36.331  1.00 56.25 ? 1327 GLU B OE1   1 
ATOM   5364 O  OE2   . GLU B 1 327 ? 4.936   25.969  37.105  1.00 57.76 ? 1327 GLU B OE2   1 
ATOM   5365 N  N     . ARG B 1 328 ? 1.033   29.244  34.970  1.00 55.75 ? 1328 ARG B N     1 
ATOM   5366 C  CA    . ARG B 1 328 ? -0.181  29.844  34.417  1.00 55.65 ? 1328 ARG B CA    1 
ATOM   5367 C  C     . ARG B 1 328 ? 0.121   30.508  33.085  1.00 55.48 ? 1328 ARG B C     1 
ATOM   5368 O  O     . ARG B 1 328 ? 1.267   30.835  32.797  1.00 55.40 ? 1328 ARG B O     1 
ATOM   5369 C  CB    . ARG B 1 328 ? -0.790  30.864  35.380  1.00 55.66 ? 1328 ARG B CB    1 
ATOM   5370 C  CG    . ARG B 1 328 ? -1.399  30.237  36.621  1.00 55.92 ? 1328 ARG B CG    1 
ATOM   5371 C  CD    . ARG B 1 328 ? -1.975  31.277  37.569  1.00 55.97 ? 1328 ARG B CD    1 
ATOM   5372 N  NE    . ARG B 1 328 ? -0.947  31.955  38.359  1.00 56.29 ? 1328 ARG B NE    1 
ATOM   5373 C  CZ    . ARG B 1 328 ? -1.201  32.863  39.301  1.00 56.62 ? 1328 ARG B CZ    1 
ATOM   5374 N  NH1   . ARG B 1 328 ? -2.453  33.206  39.584  1.00 56.72 ? 1328 ARG B NH1   1 
ATOM   5375 N  NH2   . ARG B 1 328 ? -0.200  33.432  39.967  1.00 56.54 ? 1328 ARG B NH2   1 
ATOM   5376 N  N     . LYS B 1 329 ? -0.919  30.711  32.285  1.00 55.31 ? 1329 LYS B N     1 
ATOM   5377 C  CA    . LYS B 1 329 ? -0.790  31.364  30.985  1.00 55.16 ? 1329 LYS B CA    1 
ATOM   5378 C  C     . LYS B 1 329 ? -0.844  32.884  31.186  1.00 54.93 ? 1329 LYS B C     1 
ATOM   5379 O  O     . LYS B 1 329 ? -1.427  33.354  32.168  1.00 55.01 ? 1329 LYS B O     1 
ATOM   5380 C  CB    . LYS B 1 329 ? -1.914  30.902  30.050  1.00 55.19 ? 1329 LYS B CB    1 
ATOM   5381 C  CG    . LYS B 1 329 ? -2.114  29.387  30.015  1.00 55.25 ? 1329 LYS B CG    1 
ATOM   5382 C  CD    . LYS B 1 329 ? -3.333  28.981  29.197  1.00 55.41 ? 1329 LYS B CD    1 
ATOM   5383 C  CE    . LYS B 1 329 ? -3.136  29.223  27.707  1.00 55.57 ? 1329 LYS B CE    1 
ATOM   5384 N  NZ    . LYS B 1 329 ? -3.922  28.250  26.897  1.00 55.59 ? 1329 LYS B NZ    1 
ATOM   5385 N  N     . ILE B 1 330 ? -0.236  33.643  30.269  1.00 54.59 ? 1330 ILE B N     1 
ATOM   5386 C  CA    . ILE B 1 330 ? -0.211  35.114  30.355  1.00 54.28 ? 1330 ILE B CA    1 
ATOM   5387 C  C     . ILE B 1 330 ? -1.235  35.760  29.430  1.00 53.98 ? 1330 ILE B C     1 
ATOM   5388 O  O     . ILE B 1 330 ? -1.303  35.441  28.250  1.00 54.13 ? 1330 ILE B O     1 
ATOM   5389 C  CB    . ILE B 1 330 ? 1.174   35.696  30.000  1.00 54.26 ? 1330 ILE B CB    1 
ATOM   5390 C  CG1   . ILE B 1 330 ? 2.235   35.180  30.971  1.00 54.21 ? 1330 ILE B CG1   1 
ATOM   5391 C  CG2   . ILE B 1 330 ? 1.144   37.225  30.037  1.00 53.98 ? 1330 ILE B CG2   1 
ATOM   5392 C  CD1   . ILE B 1 330 ? 3.519   35.983  30.937  1.00 54.09 ? 1330 ILE B CD1   1 
ATOM   5393 N  N     . ARG B 1 331 ? -2.011  36.688  29.978  1.00 53.68 ? 1331 ARG B N     1 
ATOM   5394 C  CA    . ARG B 1 331 ? -3.039  37.417  29.230  1.00 53.42 ? 1331 ARG B CA    1 
ATOM   5395 C  C     . ARG B 1 331 ? -2.526  38.796  28.813  1.00 52.69 ? 1331 ARG B C     1 
ATOM   5396 O  O     . ARG B 1 331 ? -2.763  39.243  27.689  1.00 52.75 ? 1331 ARG B O     1 
ATOM   5397 C  CB    . ARG B 1 331 ? -4.291  37.579  30.108  1.00 53.57 ? 1331 ARG B CB    1 
ATOM   5398 C  CG    . ARG B 1 331 ? -5.532  38.111  29.396  1.00 53.78 ? 1331 ARG B CG    1 
ATOM   5399 C  CD    . ARG B 1 331 ? -6.706  38.290  30.360  1.00 54.26 ? 1331 ARG B CD    1 
ATOM   5400 N  NE    . ARG B 1 331 ? -7.679  39.266  29.854  1.00 55.36 ? 1331 ARG B NE    1 
ATOM   5401 C  CZ    . ARG B 1 331 ? -8.701  38.994  29.037  1.00 55.60 ? 1331 ARG B CZ    1 
ATOM   5402 N  NH1   . ARG B 1 331 ? -8.928  37.757  28.603  1.00 55.68 ? 1331 ARG B NH1   1 
ATOM   5403 N  NH2   . ARG B 1 331 ? -9.509  39.979  28.646  1.00 55.69 ? 1331 ARG B NH2   1 
ATOM   5404 N  N     . ARG B 1 332 ? -1.841  39.470  29.734  1.00 51.87 ? 1332 ARG B N     1 
ATOM   5405 C  CA    . ARG B 1 332 ? -1.338  40.815  29.497  1.00 51.20 ? 1332 ARG B CA    1 
ATOM   5406 C  C     . ARG B 1 332 ? 0.070   40.949  30.032  1.00 50.50 ? 1332 ARG B C     1 
ATOM   5407 O  O     . ARG B 1 332 ? 0.374   40.471  31.121  1.00 50.54 ? 1332 ARG B O     1 
ATOM   5408 C  CB    . ARG B 1 332 ? -2.216  41.854  30.189  1.00 51.24 ? 1332 ARG B CB    1 
ATOM   5409 C  CG    . ARG B 1 332 ? -3.712  41.667  29.991  1.00 51.46 ? 1332 ARG B CG    1 
ATOM   5410 C  CD    . ARG B 1 332 ? -4.458  42.977  30.215  1.00 51.58 ? 1332 ARG B CD    1 
ATOM   5411 N  NE    . ARG B 1 332 ? -4.507  43.366  31.626  1.00 51.26 ? 1332 ARG B NE    1 
ATOM   5412 C  CZ    . ARG B 1 332 ? -4.370  44.611  32.085  1.00 50.67 ? 1332 ARG B CZ    1 
ATOM   5413 N  NH1   . ARG B 1 332 ? -4.137  45.628  31.255  1.00 49.86 ? 1332 ARG B NH1   1 
ATOM   5414 N  NH2   . ARG B 1 332 ? -4.448  44.835  33.394  1.00 50.67 ? 1332 ARG B NH2   1 
ATOM   5415 N  N     . ILE B 1 333 ? 0.916   41.625  29.264  1.00 49.75 ? 1333 ILE B N     1 
ATOM   5416 C  CA    . ILE B 1 333 ? 2.312   41.827  29.622  1.00 49.05 ? 1333 ILE B CA    1 
ATOM   5417 C  C     . ILE B 1 333 ? 2.661   43.319  29.655  1.00 48.54 ? 1333 ILE B C     1 
ATOM   5418 O  O     . ILE B 1 333 ? 2.109   44.125  28.887  1.00 48.50 ? 1333 ILE B O     1 
ATOM   5419 C  CB    . ILE B 1 333 ? 3.247   41.105  28.624  1.00 48.99 ? 1333 ILE B CB    1 
ATOM   5420 C  CG1   . ILE B 1 333 ? 4.658   40.961  29.209  1.00 48.52 ? 1333 ILE B CG1   1 
ATOM   5421 C  CG2   . ILE B 1 333 ? 3.260   41.842  27.272  1.00 48.41 ? 1333 ILE B CG2   1 
ATOM   5422 C  CD1   . ILE B 1 333 ? 4.692   40.352  30.594  1.00 48.21 ? 1333 ILE B CD1   1 
ATOM   5423 N  N     . GLY B 1 334 ? 3.584   43.675  30.546  1.00 47.64 ? 1334 GLY B N     1 
ATOM   5424 C  CA    . GLY B 1 334 ? 3.972   45.059  30.723  1.00 47.07 ? 1334 GLY B CA    1 
ATOM   5425 C  C     . GLY B 1 334 ? 5.256   45.253  31.493  1.00 46.38 ? 1334 GLY B C     1 
ATOM   5426 O  O     . GLY B 1 334 ? 5.979   44.297  31.775  1.00 46.37 ? 1334 GLY B O     1 
ATOM   5427 N  N     . VAL B 1 335 ? 5.512   46.510  31.847  1.00 45.66 ? 1335 VAL B N     1 
ATOM   5428 C  CA    . VAL B 1 335 ? 6.768   46.924  32.459  1.00 45.13 ? 1335 VAL B CA    1 
ATOM   5429 C  C     . VAL B 1 335 ? 6.584   48.254  33.223  1.00 44.81 ? 1335 VAL B C     1 
ATOM   5430 O  O     . VAL B 1 335 ? 5.724   49.067  32.865  1.00 44.79 ? 1335 VAL B O     1 
ATOM   5431 C  CB    . VAL B 1 335 ? 7.852   47.065  31.359  1.00 45.07 ? 1335 VAL B CB    1 
ATOM   5432 C  CG1   . VAL B 1 335 ? 7.442   48.136  30.353  1.00 44.87 ? 1335 VAL B CG1   1 
ATOM   5433 C  CG2   . VAL B 1 335 ? 9.211   47.359  31.954  1.00 44.48 ? 1335 VAL B CG2   1 
ATOM   5434 N  N     . ARG B 1 336 ? 7.353   48.459  34.292  1.00 44.27 ? 1336 ARG B N     1 
ATOM   5435 C  CA    . ARG B 1 336 ? 7.390   49.766  34.948  1.00 44.19 ? 1336 ARG B CA    1 
ATOM   5436 C  C     . ARG B 1 336 ? 8.795   50.133  35.396  1.00 43.44 ? 1336 ARG B C     1 
ATOM   5437 O  O     . ARG B 1 336 ? 9.562   49.281  35.860  1.00 43.74 ? 1336 ARG B O     1 
ATOM   5438 C  CB    . ARG B 1 336 ? 6.388   49.859  36.113  1.00 44.18 ? 1336 ARG B CB    1 
ATOM   5439 C  CG    . ARG B 1 336 ? 6.849   49.270  37.410  1.00 45.35 ? 1336 ARG B CG    1 
ATOM   5440 C  CD    . ARG B 1 336 ? 6.038   49.748  38.611  1.00 45.80 ? 1336 ARG B CD    1 
ATOM   5441 N  NE    . ARG B 1 336 ? 6.623   49.194  39.838  1.00 47.10 ? 1336 ARG B NE    1 
ATOM   5442 C  CZ    . ARG B 1 336 ? 6.455   47.937  40.262  1.00 47.65 ? 1336 ARG B CZ    1 
ATOM   5443 N  NH1   . ARG B 1 336 ? 5.698   47.074  39.580  1.00 47.61 ? 1336 ARG B NH1   1 
ATOM   5444 N  NH2   . ARG B 1 336 ? 7.047   47.535  41.386  1.00 48.28 ? 1336 ARG B NH2   1 
ATOM   5445 N  N     . PHE B 1 337 ? 9.114   51.413  35.244  1.00 42.70 ? 1337 PHE B N     1 
ATOM   5446 C  CA    . PHE B 1 337 ? 10.433  51.944  35.517  1.00 42.24 ? 1337 PHE B CA    1 
ATOM   5447 C  C     . PHE B 1 337 ? 10.345  52.894  36.681  1.00 42.24 ? 1337 PHE B C     1 
ATOM   5448 O  O     . PHE B 1 337 ? 9.442   53.724  36.739  1.00 42.32 ? 1337 PHE B O     1 
ATOM   5449 C  CB    . PHE B 1 337 ? 10.970  52.673  34.292  1.00 42.01 ? 1337 PHE B CB    1 
ATOM   5450 C  CG    . PHE B 1 337 ? 11.219  51.771  33.143  1.00 41.73 ? 1337 PHE B CG    1 
ATOM   5451 C  CD1   . PHE B 1 337 ? 12.391  51.042  33.068  1.00 41.60 ? 1337 PHE B CD1   1 
ATOM   5452 C  CD2   . PHE B 1 337 ? 10.260  51.599  32.166  1.00 41.23 ? 1337 PHE B CD2   1 
ATOM   5453 C  CE1   . PHE B 1 337 ? 12.617  50.178  32.023  1.00 41.45 ? 1337 PHE B CE1   1 
ATOM   5454 C  CE2   . PHE B 1 337 ? 10.476  50.737  31.120  1.00 41.74 ? 1337 PHE B CE2   1 
ATOM   5455 C  CZ    . PHE B 1 337 ? 11.662  50.024  31.044  1.00 41.62 ? 1337 PHE B CZ    1 
ATOM   5456 N  N     . SER B 1 338 ? 11.294  52.770  37.600  1.00 42.20 ? 1338 SER B N     1 
ATOM   5457 C  CA    . SER B 1 338 ? 11.264  53.514  38.858  1.00 42.14 ? 1338 SER B CA    1 
ATOM   5458 C  C     . SER B 1 338 ? 12.669  54.008  39.215  1.00 42.52 ? 1338 SER B C     1 
ATOM   5459 O  O     . SER B 1 338 ? 13.634  53.761  38.465  1.00 42.37 ? 1338 SER B O     1 
ATOM   5460 C  CB    . SER B 1 338 ? 10.671  52.642  39.989  1.00 41.89 ? 1338 SER B CB    1 
ATOM   5461 O  OG    . SER B 1 338 ? 11.011  51.267  39.857  1.00 40.38 ? 1338 SER B OG    1 
ATOM   5462 N  N     . LYS B 1 339 ? 12.763  54.720  40.342  1.00 42.55 ? 1339 LYS B N     1 
ATOM   5463 C  CA    . LYS B 1 339 ? 14.037  55.204  40.875  1.00 42.55 ? 1339 LYS B CA    1 
ATOM   5464 C  C     . LYS B 1 339 ? 14.809  55.993  39.823  1.00 42.65 ? 1339 LYS B C     1 
ATOM   5465 O  O     . LYS B 1 339 ? 15.781  55.514  39.236  1.00 42.62 ? 1339 LYS B O     1 
ATOM   5466 C  CB    . LYS B 1 339 ? 14.857  54.036  41.422  1.00 42.55 ? 1339 LYS B CB    1 
ATOM   5467 C  CG    . LYS B 1 339 ? 14.210  53.357  42.623  1.00 42.75 ? 1339 LYS B CG    1 
ATOM   5468 C  CD    . LYS B 1 339 ? 14.819  51.994  42.895  1.00 43.30 ? 1339 LYS B CD    1 
ATOM   5469 C  CE    . LYS B 1 339 ? 14.224  51.350  44.143  1.00 43.65 ? 1339 LYS B CE    1 
ATOM   5470 N  NZ    . LYS B 1 339 ? 15.039  50.189  44.623  1.00 43.50 ? 1339 LYS B NZ    1 
ATOM   5471 N  N     . PHE B 1 340 ? 14.347  57.214  39.591  1.00 42.83 ? 1340 PHE B N     1 
ATOM   5472 C  CA    . PHE B 1 340 ? 14.914  58.071  38.568  1.00 42.97 ? 1340 PHE B CA    1 
ATOM   5473 C  C     . PHE B 1 340 ? 16.079  58.870  39.141  1.00 43.17 ? 1340 PHE B C     1 
ATOM   5474 O  O     . PHE B 1 340 ? 16.125  59.135  40.339  1.00 42.85 ? 1340 PHE B O     1 
ATOM   5475 C  CB    . PHE B 1 340 ? 13.849  59.027  38.032  1.00 43.04 ? 1340 PHE B CB    1 
ATOM   5476 C  CG    . PHE B 1 340 ? 12.579  58.345  37.604  1.00 43.39 ? 1340 PHE B CG    1 
ATOM   5477 C  CD1   . PHE B 1 340 ? 12.595  57.380  36.612  1.00 43.67 ? 1340 PHE B CD1   1 
ATOM   5478 C  CD2   . PHE B 1 340 ? 11.361  58.673  38.192  1.00 43.85 ? 1340 PHE B CD2   1 
ATOM   5479 C  CE1   . PHE B 1 340 ? 11.413  56.751  36.210  1.00 43.99 ? 1340 PHE B CE1   1 
ATOM   5480 C  CE2   . PHE B 1 340 ? 10.185  58.050  37.796  1.00 43.53 ? 1340 PHE B CE2   1 
ATOM   5481 C  CZ    . PHE B 1 340 ? 10.211  57.089  36.803  1.00 43.42 ? 1340 PHE B CZ    1 
ATOM   5482 N  N     . ILE B 1 341 ? 17.012  59.256  38.272  1.00 43.58 ? 1341 ILE B N     1 
ATOM   5483 C  CA    . ILE B 1 341 ? 18.162  60.072  38.668  1.00 43.90 ? 1341 ILE B CA    1 
ATOM   5484 C  C     . ILE B 1 341 ? 17.749  61.519  38.953  1.00 44.15 ? 1341 ILE B C     1 
ATOM   5485 O  O     . ILE B 1 341 ? 16.992  62.111  38.175  1.00 44.19 ? 1341 ILE B O     1 
ATOM   5486 C  CB    . ILE B 1 341 ? 19.250  60.067  37.574  1.00 43.97 ? 1341 ILE B CB    1 
ATOM   5487 C  CG1   . ILE B 1 341 ? 19.967  58.714  37.551  1.00 43.78 ? 1341 ILE B CG1   1 
ATOM   5488 C  CG2   . ILE B 1 341 ? 20.243  61.208  37.789  1.00 43.70 ? 1341 ILE B CG2   1 
ATOM   5489 C  CD1   . ILE B 1 341 ? 20.828  58.512  36.322  1.00 43.92 ? 1341 ILE B CD1   1 
ATOM   5490 O  OXT   . ILE B 1 341 ? 18.174  62.113  39.957  1.00 44.18 ? 1341 ILE B OXT   1 
ATOM   5491 O  "O5'" . DG  C 2 1   ? 33.515  0.574   36.620  1.00 77.59 ? 802  DG  D "O5'" 1 
ATOM   5492 C  "C5'" . DG  C 2 1   ? 33.235  0.120   35.289  1.00 77.66 ? 802  DG  D "C5'" 1 
ATOM   5493 C  "C4'" . DG  C 2 1   ? 34.508  -0.074  34.479  1.00 77.57 ? 802  DG  D "C4'" 1 
ATOM   5494 O  "O4'" . DG  C 2 1   ? 34.997  -1.427  34.615  1.00 77.24 ? 802  DG  D "O4'" 1 
ATOM   5495 C  "C3'" . DG  C 2 1   ? 34.388  0.044   32.967  1.00 77.66 ? 802  DG  D "C3'" 1 
ATOM   5496 O  "O3'" . DG  C 2 1   ? 34.328  1.404   32.521  1.00 78.02 ? 802  DG  D "O3'" 1 
ATOM   5497 C  "C2'" . DG  C 2 1   ? 35.667  -0.650  32.506  1.00 77.36 ? 802  DG  D "C2'" 1 
ATOM   5498 C  "C1'" . DG  C 2 1   ? 36.047  -1.556  33.677  1.00 77.05 ? 802  DG  D "C1'" 1 
ATOM   5499 N  N9    . DG  C 2 1   ? 36.244  -2.963  33.325  1.00 76.97 ? 802  DG  D N9    1 
ATOM   5500 C  C8    . DG  C 2 1   ? 35.764  -4.071  33.989  1.00 76.84 ? 802  DG  D C8    1 
ATOM   5501 N  N7    . DG  C 2 1   ? 36.115  -5.198  33.433  1.00 76.96 ? 802  DG  D N7    1 
ATOM   5502 C  C5    . DG  C 2 1   ? 36.879  -4.820  32.331  1.00 77.03 ? 802  DG  D C5    1 
ATOM   5503 C  C6    . DG  C 2 1   ? 37.536  -5.608  31.344  1.00 77.04 ? 802  DG  D C6    1 
ATOM   5504 O  O6    . DG  C 2 1   ? 37.568  -6.847  31.254  1.00 76.77 ? 802  DG  D O6    1 
ATOM   5505 N  N1    . DG  C 2 1   ? 38.207  -4.818  30.397  1.00 76.98 ? 802  DG  D N1    1 
ATOM   5506 C  C2    . DG  C 2 1   ? 38.241  -3.436  30.401  1.00 76.87 ? 802  DG  D C2    1 
ATOM   5507 N  N2    . DG  C 2 1   ? 38.932  -2.835  29.419  1.00 76.67 ? 802  DG  D N2    1 
ATOM   5508 N  N3    . DG  C 2 1   ? 37.631  -2.695  31.321  1.00 76.90 ? 802  DG  D N3    1 
ATOM   5509 C  C4    . DG  C 2 1   ? 36.972  -3.444  32.253  1.00 77.07 ? 802  DG  D C4    1 
ATOM   5510 P  P     . DT  C 2 2   ? 33.464  1.830   31.237  1.00 78.74 ? 803  DT  D P     1 
ATOM   5511 O  OP1   . DT  C 2 2   ? 33.213  3.283   31.365  1.00 78.62 ? 803  DT  D OP1   1 
ATOM   5512 O  OP2   . DT  C 2 2   ? 32.327  0.890   31.087  1.00 77.89 ? 803  DT  D OP2   1 
ATOM   5513 O  "O5'" . DT  C 2 2   ? 34.450  1.571   29.999  1.00 78.98 ? 803  DT  D "O5'" 1 
ATOM   5514 C  "C5'" . DT  C 2 2   ? 35.829  1.980   30.009  1.00 79.03 ? 803  DT  D "C5'" 1 
ATOM   5515 C  "C4'" . DT  C 2 2   ? 36.509  1.709   28.669  1.00 78.92 ? 803  DT  D "C4'" 1 
ATOM   5516 O  "O4'" . DT  C 2 2   ? 36.923  0.317   28.569  1.00 79.23 ? 803  DT  D "O4'" 1 
ATOM   5517 C  "C3'" . DT  C 2 2   ? 35.650  1.952   27.434  1.00 78.48 ? 803  DT  D "C3'" 1 
ATOM   5518 O  "O3'" . DT  C 2 2   ? 36.450  2.448   26.371  1.00 77.79 ? 803  DT  D "O3'" 1 
ATOM   5519 C  "C2'" . DT  C 2 2   ? 35.082  0.570   27.121  1.00 78.86 ? 803  DT  D "C2'" 1 
ATOM   5520 C  "C1'" . DT  C 2 2   ? 36.234  -0.351  27.520  1.00 79.04 ? 803  DT  D "C1'" 1 
ATOM   5521 N  N1    . DT  C 2 2   ? 35.839  -1.735  28.014  1.00 79.20 ? 803  DT  D N1    1 
ATOM   5522 C  C2    . DT  C 2 2   ? 36.418  -2.881  27.475  1.00 79.06 ? 803  DT  D C2    1 
ATOM   5523 O  O2    . DT  C 2 2   ? 37.254  -2.877  26.583  1.00 78.86 ? 803  DT  D O2    1 
ATOM   5524 N  N3    . DT  C 2 2   ? 35.977  -4.064  28.029  1.00 78.85 ? 803  DT  D N3    1 
ATOM   5525 C  C4    . DT  C 2 2   ? 35.038  -4.217  29.037  1.00 78.92 ? 803  DT  D C4    1 
ATOM   5526 O  O4    . DT  C 2 2   ? 34.714  -5.322  29.456  1.00 78.73 ? 803  DT  D O4    1 
ATOM   5527 C  C5    . DT  C 2 2   ? 34.474  -2.994  29.558  1.00 79.05 ? 803  DT  D C5    1 
ATOM   5528 C  C7    . DT  C 2 2   ? 33.448  -3.031  30.656  1.00 78.92 ? 803  DT  D C7    1 
ATOM   5529 C  C6    . DT  C 2 2   ? 34.898  -1.834  29.032  1.00 79.25 ? 803  DT  D C6    1 
ATOM   5530 P  P     . DT  C 2 3   ? 35.776  3.256   25.164  1.00 77.64 ? 804  DT  D P     1 
ATOM   5531 O  OP1   . DT  C 2 3   ? 36.159  4.676   25.323  1.00 78.04 ? 804  DT  D OP1   1 
ATOM   5532 O  OP2   . DT  C 2 3   ? 34.343  2.887   25.069  1.00 76.78 ? 804  DT  D OP2   1 
ATOM   5533 O  "O5'" . DT  C 2 3   ? 36.531  2.651   23.891  1.00 76.60 ? 804  DT  D "O5'" 1 
ATOM   5534 C  "C5'" . DT  C 2 3   ? 36.194  1.338   23.483  1.00 75.79 ? 804  DT  D "C5'" 1 
ATOM   5535 C  "C4'" . DT  C 2 3   ? 37.157  0.787   22.449  1.00 75.04 ? 804  DT  D "C4'" 1 
ATOM   5536 O  "O4'" . DT  C 2 3   ? 37.451  -0.597  22.765  1.00 74.47 ? 804  DT  D "O4'" 1 
ATOM   5537 C  "C3'" . DT  C 2 3   ? 36.607  0.730   21.034  1.00 74.26 ? 804  DT  D "C3'" 1 
ATOM   5538 O  "O3'" . DT  C 2 3   ? 37.665  0.618   20.087  1.00 73.96 ? 804  DT  D "O3'" 1 
ATOM   5539 C  "C2'" . DT  C 2 3   ? 35.750  -0.529  21.106  1.00 74.18 ? 804  DT  D "C2'" 1 
ATOM   5540 C  "C1'" . DT  C 2 3   ? 36.564  -1.435  22.038  1.00 73.72 ? 804  DT  D "C1'" 1 
ATOM   5541 N  N1    . DT  C 2 3   ? 35.755  -2.260  23.020  1.00 73.30 ? 804  DT  D N1    1 
ATOM   5542 C  C2    . DT  C 2 3   ? 36.047  -3.605  23.181  1.00 72.71 ? 804  DT  D C2    1 
ATOM   5543 O  O2    . DT  C 2 3   ? 36.930  -4.183  22.572  1.00 72.51 ? 804  DT  D O2    1 
ATOM   5544 N  N3    . DT  C 2 3   ? 35.269  -4.267  24.099  1.00 72.34 ? 804  DT  D N3    1 
ATOM   5545 C  C4    . DT  C 2 3   ? 34.238  -3.730  24.849  1.00 72.87 ? 804  DT  D C4    1 
ATOM   5546 O  O4    . DT  C 2 3   ? 33.592  -4.406  25.641  1.00 72.91 ? 804  DT  D O4    1 
ATOM   5547 C  C5    . DT  C 2 3   ? 33.976  -2.327  24.640  1.00 73.05 ? 804  DT  D C5    1 
ATOM   5548 C  C7    . DT  C 2 3   ? 32.886  -1.628  25.397  1.00 73.06 ? 804  DT  D C7    1 
ATOM   5549 C  C6    . DT  C 2 3   ? 34.734  -1.671  23.753  1.00 73.25 ? 804  DT  D C6    1 
ATOM   5550 P  P     . DG  C 2 4   ? 37.404  0.812   18.516  1.00 74.35 ? 805  DG  D P     1 
ATOM   5551 O  OP1   . DG  C 2 4   ? 38.733  0.924   17.872  1.00 74.18 ? 805  DG  D OP1   1 
ATOM   5552 O  OP2   . DG  C 2 4   ? 36.390  1.881   18.344  1.00 74.01 ? 805  DG  D OP2   1 
ATOM   5553 O  "O5'" . DG  C 2 4   ? 36.727  -0.565  18.031  1.00 72.95 ? 805  DG  D "O5'" 1 
ATOM   5554 C  "C5'" . DG  C 2 4   ? 37.439  -1.514  17.213  1.00 70.39 ? 805  DG  D "C5'" 1 
ATOM   5555 C  "C4'" . DG  C 2 4   ? 36.573  -2.720  16.888  1.00 68.03 ? 805  DG  D "C4'" 1 
ATOM   5556 O  "O4'" . DG  C 2 4   ? 35.973  -3.203  18.122  1.00 67.38 ? 805  DG  D "O4'" 1 
ATOM   5557 C  "C3'" . DG  C 2 4   ? 35.421  -2.429  15.930  1.00 66.34 ? 805  DG  D "C3'" 1 
ATOM   5558 O  "O3'" . DG  C 2 4   ? 35.169  -3.499  15.033  1.00 63.54 ? 805  DG  D "O3'" 1 
ATOM   5559 C  "C2'" . DG  C 2 4   ? 34.248  -2.270  16.882  1.00 66.92 ? 805  DG  D "C2'" 1 
ATOM   5560 C  "C1'" . DG  C 2 4   ? 34.585  -3.339  17.915  1.00 66.87 ? 805  DG  D "C1'" 1 
ATOM   5561 N  N9    . DG  C 2 4   ? 33.831  -3.268  19.174  1.00 66.79 ? 805  DG  D N9    1 
ATOM   5562 C  C8    . DG  C 2 4   ? 33.158  -2.202  19.732  1.00 66.74 ? 805  DG  D C8    1 
ATOM   5563 N  N7    . DG  C 2 4   ? 32.571  -2.488  20.866  1.00 66.74 ? 805  DG  D N7    1 
ATOM   5564 C  C5    . DG  C 2 4   ? 32.864  -3.830  21.074  1.00 66.72 ? 805  DG  D C5    1 
ATOM   5565 C  C6    . DG  C 2 4   ? 32.507  -4.712  22.134  1.00 66.80 ? 805  DG  D C6    1 
ATOM   5566 O  O6    . DG  C 2 4   ? 31.831  -4.475  23.149  1.00 66.53 ? 805  DG  D O6    1 
ATOM   5567 N  N1    . DG  C 2 4   ? 33.023  -6.002  21.948  1.00 66.74 ? 805  DG  D N1    1 
ATOM   5568 C  C2    . DG  C 2 4   ? 33.781  -6.385  20.859  1.00 66.67 ? 805  DG  D C2    1 
ATOM   5569 N  N2    . DG  C 2 4   ? 34.196  -7.659  20.832  1.00 66.76 ? 805  DG  D N2    1 
ATOM   5570 N  N3    . DG  C 2 4   ? 34.124  -5.574  19.866  1.00 66.56 ? 805  DG  D N3    1 
ATOM   5571 C  C4    . DG  C 2 4   ? 33.635  -4.318  20.038  1.00 66.72 ? 805  DG  D C4    1 
ATOM   5572 P  P     . DG  C 2 5   ? 35.921  -3.609  13.623  1.00 61.73 ? 806  DG  D P     1 
ATOM   5573 O  OP1   . DG  C 2 5   ? 37.363  -3.328  13.857  1.00 59.52 ? 806  DG  D OP1   1 
ATOM   5574 O  OP2   . DG  C 2 5   ? 35.137  -2.865  12.602  1.00 60.14 ? 806  DG  D OP2   1 
ATOM   5575 O  "O5'" . DG  C 2 5   ? 35.735  -5.161  13.291  1.00 57.58 ? 806  DG  D "O5'" 1 
ATOM   5576 C  "C5'" . DG  C 2 5   ? 36.538  -6.115  13.963  1.00 53.91 ? 806  DG  D "C5'" 1 
ATOM   5577 C  "C4'" . DG  C 2 5   ? 35.740  -7.353  14.310  1.00 51.03 ? 806  DG  D "C4'" 1 
ATOM   5578 O  "O4'" . DG  C 2 5   ? 34.935  -7.105  15.486  1.00 49.60 ? 806  DG  D "O4'" 1 
ATOM   5579 C  "C3'" . DG  C 2 5   ? 34.764  -7.807  13.239  1.00 49.37 ? 806  DG  D "C3'" 1 
ATOM   5580 O  "O3'" . DG  C 2 5   ? 34.771  -9.206  13.227  1.00 46.52 ? 806  DG  D "O3'" 1 
ATOM   5581 C  "C2'" . DG  C 2 5   ? 33.430  -7.228  13.705  1.00 49.11 ? 806  DG  D "C2'" 1 
ATOM   5582 C  "C1'" . DG  C 2 5   ? 33.587  -7.413  15.208  1.00 48.94 ? 806  DG  D "C1'" 1 
ATOM   5583 N  N9    . DG  C 2 5   ? 32.804  -6.553  16.082  1.00 48.46 ? 806  DG  D N9    1 
ATOM   5584 C  C8    . DG  C 2 5   ? 32.582  -5.206  15.959  1.00 48.49 ? 806  DG  D C8    1 
ATOM   5585 N  N7    . DG  C 2 5   ? 31.859  -4.718  16.923  1.00 48.50 ? 806  DG  D N7    1 
ATOM   5586 C  C5    . DG  C 2 5   ? 31.585  -5.811  17.731  1.00 48.52 ? 806  DG  D C5    1 
ATOM   5587 C  C6    . DG  C 2 5   ? 30.835  -5.904  18.929  1.00 48.60 ? 806  DG  D C6    1 
ATOM   5588 O  O6    . DG  C 2 5   ? 30.245  -5.004  19.539  1.00 48.63 ? 806  DG  D O6    1 
ATOM   5589 N  N1    . DG  C 2 5   ? 30.818  -7.198  19.443  1.00 48.76 ? 806  DG  D N1    1 
ATOM   5590 C  C2    . DG  C 2 5   ? 31.432  -8.277  18.850  1.00 48.70 ? 806  DG  D C2    1 
ATOM   5591 N  N2    . DG  C 2 5   ? 31.304  -9.449  19.480  1.00 48.34 ? 806  DG  D N2    1 
ATOM   5592 N  N3    . DG  C 2 5   ? 32.133  -8.209  17.727  1.00 49.04 ? 806  DG  D N3    1 
ATOM   5593 C  C4    . DG  C 2 5   ? 32.166  -6.947  17.227  1.00 48.61 ? 806  DG  D C4    1 
ATOM   5594 P  P     . DA  C 2 6   ? 34.032  -9.992  12.058  1.00 46.07 ? 807  DA  D P     1 
ATOM   5595 O  OP1   . DA  C 2 6   ? 35.026  -10.966 11.553  1.00 45.69 ? 807  DA  D OP1   1 
ATOM   5596 O  OP2   . DA  C 2 6   ? 33.366  -9.043  11.145  1.00 43.36 ? 807  DA  D OP2   1 
ATOM   5597 O  "O5'" . DA  C 2 6   ? 32.894  -10.786 12.847  1.00 46.12 ? 807  DA  D "O5'" 1 
ATOM   5598 C  "C5'" . DA  C 2 6   ? 33.256  -11.669 13.894  1.00 45.60 ? 807  DA  D "C5'" 1 
ATOM   5599 C  "C4'" . DA  C 2 6   ? 32.032  -12.269 14.561  1.00 45.84 ? 807  DA  D "C4'" 1 
ATOM   5600 O  "O4'" . DA  C 2 6   ? 31.349  -11.272 15.355  1.00 46.29 ? 807  DA  D "O4'" 1 
ATOM   5601 C  "C3'" . DA  C 2 6   ? 30.978  -12.801 13.614  1.00 46.15 ? 807  DA  D "C3'" 1 
ATOM   5602 O  "O3'" . DA  C 2 6   ? 30.475  -13.996 14.139  1.00 46.47 ? 807  DA  D "O3'" 1 
ATOM   5603 C  "C2'" . DA  C 2 6   ? 29.930  -11.691 13.576  1.00 46.18 ? 807  DA  D "C2'" 1 
ATOM   5604 C  "C1'" . DA  C 2 6   ? 29.989  -11.186 15.003  1.00 45.88 ? 807  DA  D "C1'" 1 
ATOM   5605 N  N9    . DA  C 2 6   ? 29.630  -9.794  15.252  1.00 46.21 ? 807  DA  D N9    1 
ATOM   5606 C  C8    . DA  C 2 6   ? 29.939  -8.680  14.516  1.00 46.23 ? 807  DA  D C8    1 
ATOM   5607 N  N7    . DA  C 2 6   ? 29.481  -7.554  15.023  1.00 45.84 ? 807  DA  D N7    1 
ATOM   5608 C  C5    . DA  C 2 6   ? 28.837  -7.955  16.176  1.00 46.48 ? 807  DA  D C5    1 
ATOM   5609 C  C6    . DA  C 2 6   ? 28.141  -7.258  17.183  1.00 45.99 ? 807  DA  D C6    1 
ATOM   5610 N  N6    . DA  C 2 6   ? 27.969  -5.941  17.193  1.00 46.12 ? 807  DA  D N6    1 
ATOM   5611 N  N1    . DA  C 2 6   ? 27.618  -7.975  18.201  1.00 46.10 ? 807  DA  D N1    1 
ATOM   5612 C  C2    . DA  C 2 6   ? 27.774  -9.301  18.219  1.00 46.17 ? 807  DA  D C2    1 
ATOM   5613 N  N3    . DA  C 2 6   ? 28.410  -10.070 17.337  1.00 47.05 ? 807  DA  D N3    1 
ATOM   5614 C  C4    . DA  C 2 6   ? 28.925  -9.331  16.334  1.00 47.11 ? 807  DA  D C4    1 
ATOM   5615 P  P     . DT  C 2 7   ? 29.561  -14.954 13.241  1.00 49.05 ? 808  DT  D P     1 
ATOM   5616 O  OP1   . DT  C 2 7   ? 29.877  -16.330 13.727  1.00 47.80 ? 808  DT  D OP1   1 
ATOM   5617 O  OP2   . DT  C 2 7   ? 29.684  -14.586 11.810  1.00 46.28 ? 808  DT  D OP2   1 
ATOM   5618 O  "O5'" . DT  C 2 7   ? 28.074  -14.518 13.654  1.00 48.18 ? 808  DT  D "O5'" 1 
ATOM   5619 C  "C5'" . DT  C 2 7   ? 27.585  -14.833 14.951  1.00 48.94 ? 808  DT  D "C5'" 1 
ATOM   5620 C  "C4'" . DT  C 2 7   ? 26.306  -14.081 15.308  1.00 49.27 ? 808  DT  D "C4'" 1 
ATOM   5621 O  "O4'" . DT  C 2 7   ? 26.544  -12.649 15.411  1.00 49.98 ? 808  DT  D "O4'" 1 
ATOM   5622 C  "C3'" . DT  C 2 7   ? 25.141  -14.240 14.328  1.00 49.44 ? 808  DT  D "C3'" 1 
ATOM   5623 O  "O3'" . DT  C 2 7   ? 24.179  -15.111 14.920  1.00 49.17 ? 808  DT  D "O3'" 1 
ATOM   5624 C  "C2'" . DT  C 2 7   ? 24.638  -12.806 14.087  1.00 49.74 ? 808  DT  D "C2'" 1 
ATOM   5625 C  "C1'" . DT  C 2 7   ? 25.309  -12.007 15.207  1.00 49.74 ? 808  DT  D "C1'" 1 
ATOM   5626 N  N1    . DT  C 2 7   ? 25.561  -10.559 14.928  1.00 50.21 ? 808  DT  D N1    1 
ATOM   5627 C  C2    . DT  C 2 7   ? 25.199  -9.620  15.883  1.00 51.11 ? 808  DT  D C2    1 
ATOM   5628 O  O2    . DT  C 2 7   ? 24.688  -9.901  16.947  1.00 51.31 ? 808  DT  D O2    1 
ATOM   5629 N  N3    . DT  C 2 7   ? 25.455  -8.307  15.563  1.00 51.15 ? 808  DT  D N3    1 
ATOM   5630 C  C4    . DT  C 2 7   ? 26.034  -7.856  14.394  1.00 49.90 ? 808  DT  D C4    1 
ATOM   5631 O  O4    . DT  C 2 7   ? 26.217  -6.664  14.225  1.00 49.62 ? 808  DT  D O4    1 
ATOM   5632 C  C5    . DT  C 2 7   ? 26.392  -8.871  13.420  1.00 50.26 ? 808  DT  D C5    1 
ATOM   5633 C  C7    . DT  C 2 7   ? 27.030  -8.484  12.114  1.00 49.69 ? 808  DT  D C7    1 
ATOM   5634 C  C6    . DT  C 2 7   ? 26.144  -10.163 13.729  1.00 49.99 ? 808  DT  D C6    1 
ATOM   5635 P  P     . DG  C 2 8   ? 22.772  -15.447 14.250  1.00 50.06 ? 809  DG  D P     1 
ATOM   5636 O  OP1   . DG  C 2 8   ? 22.326  -16.768 14.737  1.00 51.33 ? 809  DG  D OP1   1 
ATOM   5637 O  OP2   . DG  C 2 8   ? 22.889  -15.209 12.799  1.00 49.61 ? 809  DG  D OP2   1 
ATOM   5638 O  "O5'" . DG  C 2 8   ? 21.769  -14.375 14.896  1.00 49.94 ? 809  DG  D "O5'" 1 
ATOM   5639 C  "C5'" . DG  C 2 8   ? 21.762  -14.126 16.308  1.00 50.77 ? 809  DG  D "C5'" 1 
ATOM   5640 C  "C4'" . DG  C 2 8   ? 20.903  -12.920 16.671  1.00 51.49 ? 809  DG  D "C4'" 1 
ATOM   5641 O  "O4'" . DG  C 2 8   ? 21.607  -11.683 16.341  1.00 51.74 ? 809  DG  D "O4'" 1 
ATOM   5642 C  "C3'" . DG  C 2 8   ? 19.561  -12.828 15.937  1.00 52.17 ? 809  DG  D "C3'" 1 
ATOM   5643 O  "O3'" . DG  C 2 8   ? 18.589  -12.320 16.839  1.00 52.98 ? 809  DG  D "O3'" 1 
ATOM   5644 C  "C2'" . DG  C 2 8   ? 19.839  -11.830 14.814  1.00 51.36 ? 809  DG  D "C2'" 1 
ATOM   5645 C  "C1'" . DG  C 2 8   ? 20.754  -10.863 15.556  1.00 50.87 ? 809  DG  D "C1'" 1 
ATOM   5646 N  N9    . DG  C 2 8   ? 21.517  -9.945  14.706  1.00 51.00 ? 809  DG  D N9    1 
ATOM   5647 C  C8    . DG  C 2 8   ? 22.251  -10.207 13.563  1.00 50.80 ? 809  DG  D C8    1 
ATOM   5648 N  N7    . DG  C 2 8   ? 22.806  -9.143  13.031  1.00 50.14 ? 809  DG  D N7    1 
ATOM   5649 C  C5    . DG  C 2 8   ? 22.405  -8.108  13.875  1.00 50.35 ? 809  DG  D C5    1 
ATOM   5650 C  C6    . DG  C 2 8   ? 22.670  -6.719  13.825  1.00 49.72 ? 809  DG  D C6    1 
ATOM   5651 O  O6    . DG  C 2 8   ? 23.343  -6.098  13.007  1.00 50.22 ? 809  DG  D O6    1 
ATOM   5652 N  N1    . DG  C 2 8   ? 22.088  -6.010  14.867  1.00 50.19 ? 809  DG  D N1    1 
ATOM   5653 C  C2    . DG  C 2 8   ? 21.301  -6.581  15.843  1.00 50.51 ? 809  DG  D C2    1 
ATOM   5654 N  N2    . DG  C 2 8   ? 20.815  -5.738  16.765  1.00 50.15 ? 809  DG  D N2    1 
ATOM   5655 N  N3    . DG  C 2 8   ? 21.024  -7.883  15.912  1.00 50.29 ? 809  DG  D N3    1 
ATOM   5656 C  C4    . DG  C 2 8   ? 21.608  -8.582  14.900  1.00 51.01 ? 809  DG  D C4    1 
ATOM   5657 P  P     . DG  C 2 9   ? 17.043  -12.723 16.826  1.00 51.84 ? 810  DG  D P     1 
ATOM   5658 O  OP1   . DG  C 2 9   ? 16.876  -13.692 17.928  1.00 51.78 ? 810  DG  D OP1   1 
ATOM   5659 O  OP2   . DG  C 2 9   ? 16.590  -13.028 15.454  1.00 51.52 ? 810  DG  D OP2   1 
ATOM   5660 O  "O5'" . DG  C 2 9   ? 16.376  -11.337 17.245  1.00 50.28 ? 810  DG  D "O5'" 1 
ATOM   5661 C  "C5'" . DG  C 2 9   ? 16.774  -10.713 18.442  1.00 49.58 ? 810  DG  D "C5'" 1 
ATOM   5662 C  "C4'" . DG  C 2 9   ? 16.421  -9.244  18.403  1.00 49.81 ? 810  DG  D "C4'" 1 
ATOM   5663 O  "O4'" . DG  C 2 9   ? 17.304  -8.543  17.488  1.00 49.34 ? 810  DG  D "O4'" 1 
ATOM   5664 C  "C3'" . DG  C 2 9   ? 14.998  -8.943  17.928  1.00 49.76 ? 810  DG  D "C3'" 1 
ATOM   5665 O  "O3'" . DG  C 2 9   ? 14.426  -7.952  18.794  1.00 49.57 ? 810  DG  D "O3'" 1 
ATOM   5666 C  "C2'" . DG  C 2 9   ? 15.201  -8.480  16.483  1.00 48.53 ? 810  DG  D "C2'" 1 
ATOM   5667 C  "C1'" . DG  C 2 9   ? 16.532  -7.754  16.598  1.00 48.04 ? 810  DG  D "C1'" 1 
ATOM   5668 N  N9    . DG  C 2 9   ? 17.322  -7.602  15.380  1.00 47.48 ? 810  DG  D N9    1 
ATOM   5669 C  C8    . DG  C 2 9   ? 17.784  -8.587  14.535  1.00 47.74 ? 810  DG  D C8    1 
ATOM   5670 N  N7    . DG  C 2 9   ? 18.489  -8.148  13.525  1.00 47.34 ? 810  DG  D N7    1 
ATOM   5671 C  C5    . DG  C 2 9   ? 18.506  -6.771  13.721  1.00 47.85 ? 810  DG  D C5    1 
ATOM   5672 C  C6    . DG  C 2 9   ? 19.117  -5.738  12.959  1.00 47.77 ? 810  DG  D C6    1 
ATOM   5673 O  O6    . DG  C 2 9   ? 19.795  -5.830  11.924  1.00 46.98 ? 810  DG  D O6    1 
ATOM   5674 N  N1    . DG  C 2 9   ? 18.881  -4.471  13.506  1.00 48.40 ? 810  DG  D N1    1 
ATOM   5675 C  C2    . DG  C 2 9   ? 18.156  -4.241  14.660  1.00 47.95 ? 810  DG  D C2    1 
ATOM   5676 N  N2    . DG  C 2 9   ? 18.039  -2.956  15.033  1.00 47.49 ? 810  DG  D N2    1 
ATOM   5677 N  N3    . DG  C 2 9   ? 17.580  -5.195  15.381  1.00 46.95 ? 810  DG  D N3    1 
ATOM   5678 C  C4    . DG  C 2 9   ? 17.797  -6.424  14.862  1.00 47.51 ? 810  DG  D C4    1 
ATOM   5679 P  P     . DT  C 2 10  ? 12.847  -7.685  18.847  1.00 50.54 ? 811  DT  D P     1 
ATOM   5680 O  OP1   . DT  C 2 10  ? 12.520  -7.391  20.262  1.00 48.85 ? 811  DT  D OP1   1 
ATOM   5681 O  OP2   . DT  C 2 10  ? 12.085  -8.707  18.085  1.00 49.30 ? 811  DT  D OP2   1 
ATOM   5682 O  "O5'" . DT  C 2 10  ? 12.791  -6.358  17.952  1.00 49.09 ? 811  DT  D "O5'" 1 
ATOM   5683 C  "C5'" . DT  C 2 10  ? 13.314  -5.135  18.471  1.00 47.95 ? 811  DT  D "C5'" 1 
ATOM   5684 C  "C4'" . DT  C 2 10  ? 13.233  -4.060  17.419  1.00 46.62 ? 811  DT  D "C4'" 1 
ATOM   5685 O  "O4'" . DT  C 2 10  ? 14.128  -4.379  16.330  1.00 46.89 ? 811  DT  D "O4'" 1 
ATOM   5686 C  "C3'" . DT  C 2 10  ? 11.863  -3.926  16.768  1.00 46.31 ? 811  DT  D "C3'" 1 
ATOM   5687 O  "O3'" . DT  C 2 10  ? 11.433  -2.616  16.997  1.00 44.13 ? 811  DT  D "O3'" 1 
ATOM   5688 C  "C2'" . DT  C 2 10  ? 12.103  -4.273  15.292  1.00 46.59 ? 811  DT  D "C2'" 1 
ATOM   5689 C  "C1'" . DT  C 2 10  ? 13.570  -3.894  15.133  1.00 46.83 ? 811  DT  D "C1'" 1 
ATOM   5690 N  N1    . DT  C 2 10  ? 14.357  -4.482  13.979  1.00 47.17 ? 811  DT  D N1    1 
ATOM   5691 C  C2    . DT  C 2 10  ? 15.088  -3.658  13.149  1.00 47.02 ? 811  DT  D C2    1 
ATOM   5692 O  O2    . DT  C 2 10  ? 15.155  -2.448  13.238  1.00 47.42 ? 811  DT  D O2    1 
ATOM   5693 N  N3    . DT  C 2 10  ? 15.754  -4.291  12.150  1.00 47.27 ? 811  DT  D N3    1 
ATOM   5694 C  C4    . DT  C 2 10  ? 15.799  -5.643  11.912  1.00 47.40 ? 811  DT  D C4    1 
ATOM   5695 O  O4    . DT  C 2 10  ? 16.459  -6.096  10.979  1.00 48.05 ? 811  DT  D O4    1 
ATOM   5696 C  C5    . DT  C 2 10  ? 15.020  -6.464  12.801  1.00 46.70 ? 811  DT  D C5    1 
ATOM   5697 C  C7    . DT  C 2 10  ? 14.987  -7.951  12.619  1.00 46.18 ? 811  DT  D C7    1 
ATOM   5698 C  C6    . DT  C 2 10  ? 14.350  -5.852  13.783  1.00 46.62 ? 811  DT  D C6    1 
ATOM   5699 P  P     . DA  C 2 11  ? 10.022  -2.125  16.488  1.00 41.59 ? 812  DA  D P     1 
ATOM   5700 O  OP1   . DA  C 2 11  ? 9.676   -1.030  17.410  1.00 42.75 ? 812  DA  D OP1   1 
ATOM   5701 O  OP2   . DA  C 2 11  ? 9.095   -3.248  16.256  1.00 42.40 ? 812  DA  D OP2   1 
ATOM   5702 O  "O5'" . DA  C 2 11  ? 10.398  -1.501  15.082  1.00 39.89 ? 812  DA  D "O5'" 1 
ATOM   5703 C  "C5'" . DA  C 2 11  ? 11.120  -0.302  15.137  1.00 38.65 ? 812  DA  D "C5'" 1 
ATOM   5704 C  "C4'" . DA  C 2 11  ? 11.348  0.222   13.749  1.00 37.78 ? 812  DA  D "C4'" 1 
ATOM   5705 O  "O4'" . DA  C 2 11  ? 12.270  -0.665  13.102  1.00 36.13 ? 812  DA  D "O4'" 1 
ATOM   5706 C  "C3'" . DA  C 2 11  ? 10.095  0.286   12.897  1.00 38.25 ? 812  DA  D "C3'" 1 
ATOM   5707 O  "O3'" . DA  C 2 11  ? 9.761   1.638   12.663  1.00 39.77 ? 812  DA  D "O3'" 1 
ATOM   5708 C  "C2'" . DA  C 2 11  ? 10.487  -0.476  11.632  1.00 38.36 ? 812  DA  D "C2'" 1 
ATOM   5709 C  "C1'" . DA  C 2 11  ? 11.999  -0.636  11.733  1.00 37.14 ? 812  DA  D "C1'" 1 
ATOM   5710 N  N9    . DA  C 2 11  ? 12.472  -1.874  11.114  1.00 37.66 ? 812  DA  D N9    1 
ATOM   5711 C  C8    . DA  C 2 11  ? 12.169  -3.163  11.477  1.00 37.61 ? 812  DA  D C8    1 
ATOM   5712 N  N7    . DA  C 2 11  ? 12.745  -4.083  10.741  1.00 38.63 ? 812  DA  D N7    1 
ATOM   5713 C  C5    . DA  C 2 11  ? 13.477  -3.348  9.824   1.00 38.60 ? 812  DA  D C5    1 
ATOM   5714 C  C6    . DA  C 2 11  ? 14.309  -3.725  8.750   1.00 37.87 ? 812  DA  D C6    1 
ATOM   5715 N  N6    . DA  C 2 11  ? 14.567  -4.995  8.413   1.00 35.65 ? 812  DA  D N6    1 
ATOM   5716 N  N1    . DA  C 2 11  ? 14.878  -2.721  8.047   1.00 37.29 ? 812  DA  D N1    1 
ATOM   5717 C  C2    . DA  C 2 11  ? 14.658  -1.453  8.395   1.00 36.94 ? 812  DA  D C2    1 
ATOM   5718 N  N3    . DA  C 2 11  ? 13.901  -0.971  9.369   1.00 36.21 ? 812  DA  D N3    1 
ATOM   5719 C  C4    . DA  C 2 11  ? 13.330  -1.982  10.048  1.00 38.30 ? 812  DA  D C4    1 
ATOM   5720 P  P     . DG  C 2 12  ? 8.444   2.030   11.838  1.00 42.93 ? 813  DG  D P     1 
ATOM   5721 O  OP1   . DG  C 2 12  ? 8.092   3.422   12.251  1.00 42.38 ? 813  DG  D OP1   1 
ATOM   5722 O  OP2   . DG  C 2 12  ? 7.458   0.930   11.943  1.00 41.60 ? 813  DG  D OP2   1 
ATOM   5723 O  "O5'" . DG  C 2 12  ? 8.946   2.052   10.324  1.00 40.61 ? 813  DG  D "O5'" 1 
ATOM   5724 C  "C5'" . DG  C 2 12  ? 9.983   2.947   9.976   1.00 41.52 ? 813  DG  D "C5'" 1 
ATOM   5725 C  "C4'" . DG  C 2 12  ? 10.328  2.788   8.521   1.00 42.01 ? 813  DG  D "C4'" 1 
ATOM   5726 O  "O4'" . DG  C 2 12  ? 10.960  1.504   8.416   1.00 42.96 ? 813  DG  D "O4'" 1 
ATOM   5727 C  "C3'" . DG  C 2 12  ? 9.125   2.703   7.603   1.00 43.47 ? 813  DG  D "C3'" 1 
ATOM   5728 O  "O3'" . DG  C 2 12  ? 9.357   3.371   6.364   1.00 45.37 ? 813  DG  D "O3'" 1 
ATOM   5729 C  "C2'" . DG  C 2 12  ? 8.950   1.205   7.412   1.00 42.36 ? 813  DG  D "C2'" 1 
ATOM   5730 C  "C1'" . DG  C 2 12  ? 10.409  0.817   7.327   1.00 41.85 ? 813  DG  D "C1'" 1 
ATOM   5731 N  N9    . DG  C 2 12  ? 10.628  -0.629  7.381   1.00 41.38 ? 813  DG  D N9    1 
ATOM   5732 C  C8    . DG  C 2 12  ? 10.001  -1.531  8.201   1.00 41.46 ? 813  DG  D C8    1 
ATOM   5733 N  N7    . DG  C 2 12  ? 10.397  -2.756  8.003   1.00 41.81 ? 813  DG  D N7    1 
ATOM   5734 C  C5    . DG  C 2 12  ? 11.320  -2.667  6.973   1.00 40.86 ? 813  DG  D C5    1 
ATOM   5735 C  C6    . DG  C 2 12  ? 12.060  -3.687  6.324   1.00 42.35 ? 813  DG  D C6    1 
ATOM   5736 O  O6    . DG  C 2 12  ? 12.038  -4.910  6.559   1.00 41.92 ? 813  DG  D O6    1 
ATOM   5737 N  N1    . DG  C 2 12  ? 12.904  -3.183  5.317   1.00 42.78 ? 813  DG  D N1    1 
ATOM   5738 C  C2    . DG  C 2 12  ? 12.975  -1.836  4.990   1.00 41.78 ? 813  DG  D C2    1 
ATOM   5739 N  N2    . DG  C 2 12  ? 13.826  -1.521  4.008   1.00 40.67 ? 813  DG  D N2    1 
ATOM   5740 N  N3    . DG  C 2 12  ? 12.280  -0.876  5.600   1.00 39.91 ? 813  DG  D N3    1 
ATOM   5741 C  C4    . DG  C 2 12  ? 11.476  -1.363  6.576   1.00 40.10 ? 813  DG  D C4    1 
HETATM 5742 P  P     . 2DT C 2 13  ? 8.110   4.117   5.686   1.00 44.75 ? 814  2DT D P     1 
HETATM 5743 O  OP1   . 2DT C 2 13  ? 8.685   5.321   5.083   1.00 44.10 ? 814  2DT D OP1   1 
HETATM 5744 O  OP2   . 2DT C 2 13  ? 7.018   4.118   6.686   1.00 43.29 ? 814  2DT D OP2   1 
HETATM 5745 O  "O5'" . 2DT C 2 13  ? 7.568   3.308   4.415   1.00 45.96 ? 814  2DT D "O5'" 1 
HETATM 5746 N  N1    . 2DT C 2 13  ? 9.178   -1.883  4.173   1.00 46.38 ? 814  2DT D N1    1 
HETATM 5747 C  C6    . 2DT C 2 13  ? 8.261   -1.945  5.206   1.00 45.43 ? 814  2DT D C6    1 
HETATM 5748 C  C2    . 2DT C 2 13  ? 9.759   -2.999  3.645   1.00 46.75 ? 814  2DT D C2    1 
HETATM 5749 O  O2    . 2DT C 2 13  ? 10.556  -2.927  2.722   1.00 46.34 ? 814  2DT D O2    1 
HETATM 5750 N  N3    . 2DT C 2 13  ? 9.363   -4.190  4.204   1.00 47.55 ? 814  2DT D N3    1 
HETATM 5751 C  C4    . 2DT C 2 13  ? 8.480   -4.338  5.255   1.00 47.24 ? 814  2DT D C4    1 
HETATM 5752 O  O4    . 2DT C 2 13  ? 8.213   -5.458  5.699   1.00 47.79 ? 814  2DT D O4    1 
HETATM 5753 C  C5    . 2DT C 2 13  ? 7.883   -3.117  5.761   1.00 46.38 ? 814  2DT D C5    1 
HETATM 5754 C  C5M   . 2DT C 2 13  ? 6.893   -3.214  6.889   1.00 45.66 ? 814  2DT D C5M   1 
HETATM 5755 C  "C2'" . 2DT C 2 13  ? 8.818   -0.244  2.307   1.00 48.51 ? 814  2DT D "C2'" 1 
HETATM 5756 C  "C5'" . 2DT C 2 13  ? 7.665   1.950   4.190   1.00 47.26 ? 814  2DT D "C5'" 1 
HETATM 5757 C  "C4'" . 2DT C 2 13  ? 9.070   1.625   3.725   1.00 48.81 ? 814  2DT D "C4'" 1 
HETATM 5758 O  "O4'" . 2DT C 2 13  ? 9.514   0.442   4.419   1.00 48.32 ? 814  2DT D "O4'" 1 
HETATM 5759 C  "C1'" . 2DT C 2 13  ? 9.626   -0.635  3.525   1.00 47.18 ? 814  2DT D "C1'" 1 
HETATM 5760 C  "C3'" . 2DT C 2 13  ? 9.218   1.219   2.272   1.00 50.31 ? 814  2DT D "C3'" 1 
ATOM   5761 O  "O5'" . DC  D 3 1   ? 9.628   -27.677 -3.705  1.00 61.02 ? 901  DC  E "O5'" 1 
ATOM   5762 C  "C5'" . DC  D 3 1   ? 9.349   -26.427 -4.337  1.00 59.53 ? 901  DC  E "C5'" 1 
ATOM   5763 C  "C4'" . DC  D 3 1   ? 7.883   -26.025 -4.243  1.00 57.70 ? 901  DC  E "C4'" 1 
ATOM   5764 O  "O4'" . DC  D 3 1   ? 7.108   -26.703 -5.250  1.00 57.90 ? 901  DC  E "O4'" 1 
ATOM   5765 C  "C3'" . DC  D 3 1   ? 7.183   -26.343 -2.932  1.00 56.66 ? 901  DC  E "C3'" 1 
ATOM   5766 O  "O3'" . DC  D 3 1   ? 7.138   -25.146 -2.197  1.00 55.28 ? 901  DC  E "O3'" 1 
ATOM   5767 C  "C2'" . DC  D 3 1   ? 5.806   -26.867 -3.354  1.00 57.30 ? 901  DC  E "C2'" 1 
ATOM   5768 C  "C1'" . DC  D 3 1   ? 5.772   -26.584 -4.848  1.00 58.11 ? 901  DC  E "C1'" 1 
ATOM   5769 N  N1    . DC  D 3 1   ? 4.929   -27.522 -5.639  1.00 58.52 ? 901  DC  E N1    1 
ATOM   5770 C  C2    . DC  D 3 1   ? 3.755   -27.046 -6.233  1.00 58.67 ? 901  DC  E C2    1 
ATOM   5771 O  O2    . DC  D 3 1   ? 3.435   -25.861 -6.095  1.00 59.67 ? 901  DC  E O2    1 
ATOM   5772 N  N3    . DC  D 3 1   ? 2.985   -27.899 -6.944  1.00 58.94 ? 901  DC  E N3    1 
ATOM   5773 C  C4    . DC  D 3 1   ? 3.347   -29.180 -7.070  1.00 59.08 ? 901  DC  E C4    1 
ATOM   5774 N  N4    . DC  D 3 1   ? 2.532   -29.966 -7.783  1.00 59.27 ? 901  DC  E N4    1 
ATOM   5775 C  C5    . DC  D 3 1   ? 4.541   -29.701 -6.475  1.00 58.73 ? 901  DC  E C5    1 
ATOM   5776 C  C6    . DC  D 3 1   ? 5.296   -28.839 -5.775  1.00 59.06 ? 901  DC  E C6    1 
ATOM   5777 P  P     . DT  D 3 2   ? 6.640   -25.090 -0.679  1.00 54.60 ? 902  DT  E P     1 
ATOM   5778 O  OP1   . DT  D 3 2   ? 6.966   -23.718 -0.200  1.00 54.22 ? 902  DT  E OP1   1 
ATOM   5779 O  OP2   . DT  D 3 2   ? 6.977   -26.347 0.008   1.00 53.07 ? 902  DT  E OP2   1 
ATOM   5780 O  "O5'" . DT  D 3 2   ? 5.058   -25.097 -0.798  1.00 53.87 ? 902  DT  E "O5'" 1 
ATOM   5781 C  "C5'" . DT  D 3 2   ? 4.392   -23.926 -1.278  1.00 52.86 ? 902  DT  E "C5'" 1 
ATOM   5782 C  "C4'" . DT  D 3 2   ? 2.916   -24.211 -1.275  1.00 51.39 ? 902  DT  E "C4'" 1 
ATOM   5783 O  "O4'" . DT  D 3 2   ? 2.722   -25.181 -2.310  1.00 50.01 ? 902  DT  E "O4'" 1 
ATOM   5784 C  "C3'" . DT  D 3 2   ? 2.446   -24.900 -0.006  1.00 51.06 ? 902  DT  E "C3'" 1 
ATOM   5785 O  "O3'" . DT  D 3 2   ? 2.137   -23.966 1.084   1.00 51.84 ? 902  DT  E "O3'" 1 
ATOM   5786 C  "C2'" . DT  D 3 2   ? 1.356   -25.848 -0.506  1.00 49.80 ? 902  DT  E "C2'" 1 
ATOM   5787 C  "C1'" . DT  D 3 2   ? 1.563   -25.895 -2.024  1.00 49.39 ? 902  DT  E "C1'" 1 
ATOM   5788 N  N1    . DT  D 3 2   ? 1.683   -27.261 -2.654  1.00 48.70 ? 902  DT  E N1    1 
ATOM   5789 C  C2    . DT  D 3 2   ? 0.733   -27.592 -3.600  1.00 48.50 ? 902  DT  E C2    1 
ATOM   5790 O  O2    . DT  D 3 2   ? -0.160  -26.843 -3.929  1.00 49.43 ? 902  DT  E O2    1 
ATOM   5791 N  N3    . DT  D 3 2   ? 0.842   -28.836 -4.159  1.00 48.55 ? 902  DT  E N3    1 
ATOM   5792 C  C4    . DT  D 3 2   ? 1.807   -29.778 -3.876  1.00 49.57 ? 902  DT  E C4    1 
ATOM   5793 O  O4    . DT  D 3 2   ? 1.801   -30.872 -4.439  1.00 50.23 ? 902  DT  E O4    1 
ATOM   5794 C  C5    . DT  D 3 2   ? 2.795   -29.386 -2.883  1.00 49.37 ? 902  DT  E C5    1 
ATOM   5795 C  C7    . DT  D 3 2   ? 3.879   -30.364 -2.513  1.00 48.65 ? 902  DT  E C7    1 
ATOM   5796 C  C6    . DT  D 3 2   ? 2.690   -28.155 -2.320  1.00 48.50 ? 902  DT  E C6    1 
ATOM   5797 P  P     . DA  D 3 3   ? 1.067   -22.804 1.057   1.00 52.24 ? 903  DA  E P     1 
ATOM   5798 O  OP1   . DA  D 3 3   ? 0.344   -22.669 2.334   1.00 52.00 ? 903  DA  E OP1   1 
ATOM   5799 O  OP2   . DA  D 3 3   ? 0.237   -23.074 -0.108  1.00 54.52 ? 903  DA  E OP2   1 
ATOM   5800 O  "O5'" . DA  D 3 3   ? 1.939   -21.498 0.768   1.00 53.25 ? 903  DA  E "O5'" 1 
ATOM   5801 C  "C5'" . DA  D 3 3   ? 1.150   -20.307 0.819   1.00 54.40 ? 903  DA  E "C5'" 1 
ATOM   5802 C  "C4'" . DA  D 3 3   ? 1.874   -19.045 0.432   1.00 54.80 ? 903  DA  E "C4'" 1 
ATOM   5803 O  "O4'" . DA  D 3 3   ? 1.610   -18.058 1.454   1.00 57.04 ? 903  DA  E "O4'" 1 
ATOM   5804 C  "C3'" . DA  D 3 3   ? 3.382   -19.131 0.386   1.00 54.06 ? 903  DA  E "C3'" 1 
ATOM   5805 O  "O3'" . DA  D 3 3   ? 3.904   -18.047 -0.304  1.00 48.78 ? 903  DA  E "O3'" 1 
ATOM   5806 C  "C2'" . DA  D 3 3   ? 3.729   -19.070 1.864   1.00 56.31 ? 903  DA  E "C2'" 1 
ATOM   5807 C  "C1'" . DA  D 3 3   ? 2.663   -18.122 2.405   1.00 59.43 ? 903  DA  E "C1'" 1 
ATOM   5808 N  N9    . DA  D 3 3   ? 2.161   -18.518 3.726   1.00 60.17 ? 903  DA  E N9    1 
ATOM   5809 C  C8    . DA  D 3 3   ? 2.018   -19.764 4.249   1.00 60.15 ? 903  DA  E C8    1 
ATOM   5810 N  N7    . DA  D 3 3   ? 1.576   -19.744 5.476   1.00 60.66 ? 903  DA  E N7    1 
ATOM   5811 C  C5    . DA  D 3 3   ? 1.417   -18.412 5.786   1.00 60.60 ? 903  DA  E C5    1 
ATOM   5812 C  C6    . DA  D 3 3   ? 0.959   -17.717 6.936   1.00 61.38 ? 903  DA  E C6    1 
ATOM   5813 N  N6    . DA  D 3 3   ? 0.538   -18.305 8.065   1.00 61.00 ? 903  DA  E N6    1 
ATOM   5814 N  N1    . DA  D 3 3   ? 0.934   -16.360 6.886   1.00 61.35 ? 903  DA  E N1    1 
ATOM   5815 C  C2    . DA  D 3 3   ? 1.335   -15.747 5.761   1.00 60.96 ? 903  DA  E C2    1 
ATOM   5816 N  N3    . DA  D 3 3   ? 1.779   -16.297 4.627   1.00 61.04 ? 903  DA  E N3    1 
ATOM   5817 C  C4    . DA  D 3 3   ? 1.786   -17.641 4.709   1.00 60.69 ? 903  DA  E C4    1 
ATOM   5818 P  P     . DA  D 3 4   ? 5.473   -17.956 -0.443  1.00 46.39 ? 904  DA  E P     1 
ATOM   5819 O  OP1   . DA  D 3 4   ? 5.721   -17.383 -1.788  1.00 47.61 ? 904  DA  E OP1   1 
ATOM   5820 O  OP2   . DA  D 3 4   ? 6.137   -19.211 -0.040  1.00 45.57 ? 904  DA  E OP2   1 
ATOM   5821 O  "O5'" . DA  D 3 4   ? 5.858   -16.924 0.705   1.00 46.87 ? 904  DA  E "O5'" 1 
ATOM   5822 C  "C5'" . DA  D 3 4   ? 5.535   -15.543 0.600   1.00 47.02 ? 904  DA  E "C5'" 1 
ATOM   5823 C  "C4'" . DA  D 3 4   ? 5.726   -14.819 1.920   1.00 47.99 ? 904  DA  E "C4'" 1 
ATOM   5824 O  "O4'" . DA  D 3 4   ? 4.896   -15.363 2.965   1.00 49.00 ? 904  DA  E "O4'" 1 
ATOM   5825 C  "C3'" . DA  D 3 4   ? 7.129   -14.915 2.481   1.00 49.10 ? 904  DA  E "C3'" 1 
ATOM   5826 O  "O3'" . DA  D 3 4   ? 7.932   -13.928 1.879   1.00 48.34 ? 904  DA  E "O3'" 1 
ATOM   5827 C  "C2'" . DA  D 3 4   ? 6.926   -14.664 3.964   1.00 50.49 ? 904  DA  E "C2'" 1 
ATOM   5828 C  "C1'" . DA  D 3 4   ? 5.533   -15.212 4.224   1.00 52.60 ? 904  DA  E "C1'" 1 
ATOM   5829 N  N9    . DA  D 3 4   ? 5.503   -16.521 4.851   1.00 53.42 ? 904  DA  E N9    1 
ATOM   5830 C  C8    . DA  D 3 4   ? 6.006   -17.678 4.327   1.00 54.50 ? 904  DA  E C8    1 
ATOM   5831 N  N7    . DA  D 3 4   ? 5.838   -18.730 5.086   1.00 54.07 ? 904  DA  E N7    1 
ATOM   5832 C  C5    . DA  D 3 4   ? 5.191   -18.223 6.181   1.00 54.46 ? 904  DA  E C5    1 
ATOM   5833 C  C6    . DA  D 3 4   ? 4.711   -18.854 7.340   1.00 55.85 ? 904  DA  E C6    1 
ATOM   5834 N  N6    . DA  D 3 4   ? 4.882   -20.170 7.529   1.00 55.42 ? 904  DA  E N6    1 
ATOM   5835 N  N1    . DA  D 3 4   ? 4.045   -18.087 8.259   1.00 55.50 ? 904  DA  E N1    1 
ATOM   5836 C  C2    . DA  D 3 4   ? 3.915   -16.767 8.004   1.00 55.34 ? 904  DA  E C2    1 
ATOM   5837 N  N3    . DA  D 3 4   ? 4.341   -16.068 6.935   1.00 55.48 ? 904  DA  E N3    1 
ATOM   5838 C  C4    . DA  D 3 4   ? 4.965   -16.863 6.055   1.00 54.18 ? 904  DA  E C4    1 
ATOM   5839 P  P     . DC  D 3 5   ? 9.473   -14.208 1.671   1.00 50.90 ? 905  DC  E P     1 
ATOM   5840 O  OP1   . DC  D 3 5   ? 9.648   -15.666 1.385   1.00 51.76 ? 905  DC  E OP1   1 
ATOM   5841 O  OP2   . DC  D 3 5   ? 10.172  -13.592 2.822   1.00 49.11 ? 905  DC  E OP2   1 
ATOM   5842 O  "O5'" . DC  D 3 5   ? 9.799   -13.400 0.339   1.00 46.05 ? 905  DC  E "O5'" 1 
ATOM   5843 C  "C5'" . DC  D 3 5   ? 9.226   -13.773 -0.862  1.00 43.80 ? 905  DC  E "C5'" 1 
ATOM   5844 C  "C4'" . DC  D 3 5   ? 9.754   -12.897 -1.968  1.00 43.82 ? 905  DC  E "C4'" 1 
ATOM   5845 O  "O4'" . DC  D 3 5   ? 9.221   -11.549 -1.809  1.00 45.09 ? 905  DC  E "O4'" 1 
ATOM   5846 C  "C3'" . DC  D 3 5   ? 11.266  -12.719 -2.002  1.00 43.95 ? 905  DC  E "C3'" 1 
ATOM   5847 O  "O3'" . DC  D 3 5   ? 11.664  -12.695 -3.365  1.00 44.03 ? 905  DC  E "O3'" 1 
ATOM   5848 C  "C2'" . DC  D 3 5   ? 11.493  -11.380 -1.279  1.00 44.08 ? 905  DC  E "C2'" 1 
ATOM   5849 C  "C1'" . DC  D 3 5   ? 10.241  -10.591 -1.615  1.00 42.83 ? 905  DC  E "C1'" 1 
ATOM   5850 N  N1    . DC  D 3 5   ? 9.673   -9.698  -0.583  1.00 43.53 ? 905  DC  E N1    1 
ATOM   5851 C  C2    . DC  D 3 5   ? 9.576   -8.314  -0.838  1.00 43.46 ? 905  DC  E C2    1 
ATOM   5852 O  O2    . DC  D 3 5   ? 9.983   -7.845  -1.902  1.00 42.71 ? 905  DC  E O2    1 
ATOM   5853 N  N3    . DC  D 3 5   ? 9.021   -7.502  0.092   1.00 41.81 ? 905  DC  E N3    1 
ATOM   5854 C  C4    . DC  D 3 5   ? 8.562   -8.001  1.235   1.00 41.71 ? 905  DC  E C4    1 
ATOM   5855 N  N4    . DC  D 3 5   ? 8.030   -7.118  2.082   1.00 42.61 ? 905  DC  E N4    1 
ATOM   5856 C  C5    . DC  D 3 5   ? 8.633   -9.401  1.528   1.00 41.67 ? 905  DC  E C5    1 
ATOM   5857 C  C6    . DC  D 3 5   ? 9.183   -10.214 0.602   1.00 42.75 ? 905  DC  E C6    1 
HETATM 5858 P  P     . 8OG D 3 6   ? 13.170  -12.964 -3.735  1.00 42.49 ? 906  8OG E P     1 
HETATM 5859 O  OP1   . 8OG D 3 6   ? 13.406  -13.090 -5.222  1.00 41.83 ? 906  8OG E OP1   1 
HETATM 5860 O  OP2   . 8OG D 3 6   ? 13.574  -14.041 -2.785  1.00 43.27 ? 906  8OG E OP2   1 
HETATM 5861 O  "O5'" . 8OG D 3 6   ? 13.774  -11.557 -3.293  1.00 45.51 ? 906  8OG E "O5'" 1 
HETATM 5862 C  "C5'" . 8OG D 3 6   ? 13.721  -10.393 -4.132  1.00 45.64 ? 906  8OG E "C5'" 1 
HETATM 5863 C  "C4'" . 8OG D 3 6   ? 14.212  -9.235  -3.308  1.00 47.73 ? 906  8OG E "C4'" 1 
HETATM 5864 O  "O4'" . 8OG D 3 6   ? 13.285  -8.567  -2.431  1.00 49.44 ? 906  8OG E "O4'" 1 
HETATM 5865 C  "C3'" . 8OG D 3 6   ? 15.462  -8.989  -2.957  1.00 47.99 ? 906  8OG E "C3'" 1 
HETATM 5866 O  "O3'" . 8OG D 3 6   ? 16.113  -8.208  -3.619  1.00 48.50 ? 906  8OG E "O3'" 1 
HETATM 5867 C  "C2'" . 8OG D 3 6   ? 15.488  -8.901  -1.447  1.00 48.61 ? 906  8OG E "C2'" 1 
HETATM 5868 C  "C1'" . 8OG D 3 6   ? 14.063  -8.510  -1.214  1.00 48.04 ? 906  8OG E "C1'" 1 
HETATM 5869 N  N9    . 8OG D 3 6   ? 13.403  -8.294  -0.061  1.00 48.41 ? 906  8OG E N9    1 
HETATM 5870 C  C8    . 8OG D 3 6   ? 13.090  -9.194  0.855   1.00 48.53 ? 906  8OG E C8    1 
HETATM 5871 N  N7    . 8OG D 3 6   ? 12.340  -8.664  1.840   1.00 48.11 ? 906  8OG E N7    1 
HETATM 5872 C  C5    . 8OG D 3 6   ? 12.144  -7.369  1.474   1.00 47.51 ? 906  8OG E C5    1 
HETATM 5873 C  C6    . 8OG D 3 6   ? 11.432  -6.192  2.017   1.00 47.96 ? 906  8OG E C6    1 
HETATM 5874 O  O6    . 8OG D 3 6   ? 10.796  -6.275  3.105   1.00 47.89 ? 906  8OG E O6    1 
HETATM 5875 N  N1    . 8OG D 3 6   ? 11.470  -5.050  1.303   1.00 48.13 ? 906  8OG E N1    1 
HETATM 5876 C  C2    . 8OG D 3 6   ? 12.119  -4.932  0.135   1.00 48.25 ? 906  8OG E C2    1 
HETATM 5877 N  N2    . 8OG D 3 6   ? 12.112  -3.762  -0.538  1.00 47.60 ? 906  8OG E N2    1 
HETATM 5878 N  N3    . 8OG D 3 6   ? 12.775  -5.953  -0.410  1.00 48.99 ? 906  8OG E N3    1 
HETATM 5879 C  C4    . 8OG D 3 6   ? 12.813  -7.142  0.187   1.00 48.26 ? 906  8OG E C4    1 
HETATM 5880 O  O8    . 8OG D 3 6   ? 13.534  -10.400 0.849   1.00 47.88 ? 906  8OG E O8    1 
ATOM   5881 P  P     . DC  D 3 7   ? 17.700  -8.016  -3.487  1.00 51.68 ? 907  DC  E P     1 
ATOM   5882 O  OP1   . DC  D 3 7   ? 18.171  -7.150  -4.600  1.00 48.53 ? 907  DC  E OP1   1 
ATOM   5883 O  OP2   . DC  D 3 7   ? 18.281  -9.338  -3.196  1.00 53.49 ? 907  DC  E OP2   1 
ATOM   5884 O  "O5'" . DC  D 3 7   ? 17.922  -7.140  -2.202  1.00 52.67 ? 907  DC  E "O5'" 1 
ATOM   5885 C  "C5'" . DC  D 3 7   ? 17.792  -5.755  -2.514  1.00 53.87 ? 907  DC  E "C5'" 1 
ATOM   5886 C  "C4'" . DC  D 3 7   ? 17.326  -4.970  -1.319  1.00 53.20 ? 907  DC  E "C4'" 1 
ATOM   5887 O  "O4'" . DC  D 3 7   ? 16.573  -5.742  -0.360  1.00 52.75 ? 907  DC  E "O4'" 1 
ATOM   5888 C  "C3'" . DC  D 3 7   ? 18.443  -4.506  -0.446  1.00 53.10 ? 907  DC  E "C3'" 1 
ATOM   5889 O  "O3'" . DC  D 3 7   ? 19.124  -3.530  -1.210  1.00 54.47 ? 907  DC  E "O3'" 1 
ATOM   5890 C  "C2'" . DC  D 3 7   ? 17.607  -4.055  0.762   1.00 53.12 ? 907  DC  E "C2'" 1 
ATOM   5891 C  "C1'" . DC  D 3 7   ? 16.256  -4.767  0.591   1.00 51.15 ? 907  DC  E "C1'" 1 
ATOM   5892 N  N1    . DC  D 3 7   ? 15.611  -5.397  1.793   1.00 49.84 ? 907  DC  E N1    1 
ATOM   5893 C  C2    . DC  D 3 7   ? 14.793  -4.594  2.587   1.00 50.46 ? 907  DC  E C2    1 
ATOM   5894 O  O2    . DC  D 3 7   ? 14.684  -3.418  2.261   1.00 51.20 ? 907  DC  E O2    1 
ATOM   5895 N  N3    . DC  D 3 7   ? 14.159  -5.093  3.688   1.00 50.55 ? 907  DC  E N3    1 
ATOM   5896 C  C4    . DC  D 3 7   ? 14.323  -6.379  4.006   1.00 49.78 ? 907  DC  E C4    1 
ATOM   5897 N  N4    . DC  D 3 7   ? 13.694  -6.829  5.089   1.00 48.73 ? 907  DC  E N4    1 
ATOM   5898 C  C5    . DC  D 3 7   ? 15.142  -7.235  3.200   1.00 49.68 ? 907  DC  E C5    1 
ATOM   5899 C  C6    . DC  D 3 7   ? 15.764  -6.714  2.119   1.00 49.23 ? 907  DC  E C6    1 
ATOM   5900 P  P     . DT  D 3 8   ? 20.654  -3.154  -0.924  1.00 56.07 ? 908  DT  E P     1 
ATOM   5901 O  OP1   . DT  D 3 8   ? 21.072  -2.332  -2.082  1.00 54.52 ? 908  DT  E OP1   1 
ATOM   5902 O  OP2   . DT  D 3 8   ? 21.454  -4.341  -0.545  1.00 55.19 ? 908  DT  E OP2   1 
ATOM   5903 O  "O5'" . DT  D 3 8   ? 20.443  -2.258  0.392   1.00 52.08 ? 908  DT  E "O5'" 1 
ATOM   5904 C  "C5'" . DT  D 3 8   ? 19.623  -1.097  0.255   1.00 48.51 ? 908  DT  E "C5'" 1 
ATOM   5905 C  "C4'" . DT  D 3 8   ? 19.346  -0.440  1.584   1.00 47.00 ? 908  DT  E "C4'" 1 
ATOM   5906 O  "O4'" . DT  D 3 8   ? 18.504  -1.346  2.288   1.00 45.59 ? 908  DT  E "O4'" 1 
ATOM   5907 C  "C3'" . DT  D 3 8   ? 20.539  -0.200  2.511   1.00 47.21 ? 908  DT  E "C3'" 1 
ATOM   5908 O  "O3'" . DT  D 3 8   ? 20.748  1.192   2.666   1.00 48.91 ? 908  DT  E "O3'" 1 
ATOM   5909 C  "C2'" . DT  D 3 8   ? 20.167  -0.895  3.818   1.00 45.88 ? 908  DT  E "C2'" 1 
ATOM   5910 C  "C1'" . DT  D 3 8   ? 18.673  -1.126  3.659   1.00 43.35 ? 908  DT  E "C1'" 1 
ATOM   5911 N  N1    . DT  D 3 8   ? 18.126  -2.337  4.342   1.00 42.08 ? 908  DT  E N1    1 
ATOM   5912 C  C2    . DT  D 3 8   ? 17.202  -2.184  5.344   1.00 41.78 ? 908  DT  E C2    1 
ATOM   5913 O  O2    . DT  D 3 8   ? 16.809  -1.091  5.708   1.00 40.57 ? 908  DT  E O2    1 
ATOM   5914 N  N3    . DT  D 3 8   ? 16.762  -3.365  5.905   1.00 41.82 ? 908  DT  E N3    1 
ATOM   5915 C  C4    . DT  D 3 8   ? 17.145  -4.648  5.565   1.00 41.72 ? 908  DT  E C4    1 
ATOM   5916 O  O4    . DT  D 3 8   ? 16.675  -5.637  6.131   1.00 41.68 ? 908  DT  E O4    1 
ATOM   5917 C  C5    . DT  D 3 8   ? 18.114  -4.741  4.497   1.00 41.33 ? 908  DT  E C5    1 
ATOM   5918 C  C7    . DT  D 3 8   ? 18.633  -6.081  4.031   1.00 40.40 ? 908  DT  E C7    1 
ATOM   5919 C  C6    . DT  D 3 8   ? 18.545  -3.592  3.950   1.00 41.16 ? 908  DT  E C6    1 
ATOM   5920 P  P     . DA  D 3 9   ? 21.995  1.750   3.495   1.00 52.33 ? 909  DA  E P     1 
ATOM   5921 O  OP1   . DA  D 3 9   ? 22.272  3.089   2.924   1.00 53.62 ? 909  DA  E OP1   1 
ATOM   5922 O  OP2   . DA  D 3 9   ? 23.072  0.747   3.660   1.00 50.53 ? 909  DA  E OP2   1 
ATOM   5923 O  "O5'" . DA  D 3 9   ? 21.345  1.935   4.936   1.00 50.38 ? 909  DA  E "O5'" 1 
ATOM   5924 C  "C5'" . DA  D 3 9   ? 20.160  2.710   5.053   1.00 47.81 ? 909  DA  E "C5'" 1 
ATOM   5925 C  "C4'" . DA  D 3 9   ? 19.814  2.828   6.516   1.00 46.50 ? 909  DA  E "C4'" 1 
ATOM   5926 O  "O4'" . DA  D 3 9   ? 19.176  1.584   6.890   1.00 44.37 ? 909  DA  E "O4'" 1 
ATOM   5927 C  "C3'" . DA  D 3 9   ? 21.023  3.031   7.434   1.00 46.17 ? 909  DA  E "C3'" 1 
ATOM   5928 O  "O3'" . DA  D 3 9   ? 20.862  4.223   8.204   1.00 47.05 ? 909  DA  E "O3'" 1 
ATOM   5929 C  "C2'" . DA  D 3 9   ? 21.062  1.737   8.252   1.00 45.72 ? 909  DA  E "C2'" 1 
ATOM   5930 C  "C1'" . DA  D 3 9   ? 19.651  1.175   8.139   1.00 43.43 ? 909  DA  E "C1'" 1 
ATOM   5931 N  N9    . DA  D 3 9   ? 19.554  -0.275  8.164   1.00 43.07 ? 909  DA  E N9    1 
ATOM   5932 C  C8    . DA  D 3 9   ? 20.206  -1.187  7.379   1.00 42.82 ? 909  DA  E C8    1 
ATOM   5933 N  N7    . DA  D 3 9   ? 19.901  -2.444  7.637   1.00 42.58 ? 909  DA  E N7    1 
ATOM   5934 C  C5    . DA  D 3 9   ? 18.983  -2.354  8.668   1.00 42.90 ? 909  DA  E C5    1 
ATOM   5935 C  C6    . DA  D 3 9   ? 18.262  -3.327  9.401   1.00 42.52 ? 909  DA  E C6    1 
ATOM   5936 N  N6    . DA  D 3 9   ? 18.344  -4.653  9.231   1.00 41.81 ? 909  DA  E N6    1 
ATOM   5937 N  N1    . DA  D 3 9   ? 17.429  -2.862  10.346  1.00 42.54 ? 909  DA  E N1    1 
ATOM   5938 C  C2    . DA  D 3 9   ? 17.316  -1.540  10.551  1.00 42.99 ? 909  DA  E C2    1 
ATOM   5939 N  N3    . DA  D 3 9   ? 17.933  -0.528  9.942   1.00 42.22 ? 909  DA  E N3    1 
ATOM   5940 C  C4    . DA  D 3 9   ? 18.756  -1.016  8.997   1.00 43.36 ? 909  DA  E C4    1 
ATOM   5941 P  P     . DC  D 3 10  ? 22.001  4.796   9.181   1.00 48.48 ? 910  DC  E P     1 
ATOM   5942 O  OP1   . DC  D 3 10  ? 21.871  6.267   9.302   1.00 48.66 ? 910  DC  E OP1   1 
ATOM   5943 O  OP2   . DC  D 3 10  ? 23.299  4.137   8.933   1.00 48.31 ? 910  DC  E OP2   1 
ATOM   5944 O  "O5'" . DC  D 3 10  ? 21.484  4.189   10.542  1.00 49.75 ? 910  DC  E "O5'" 1 
ATOM   5945 C  "C5'" . DC  D 3 10  ? 20.216  4.526   11.074  1.00 48.84 ? 910  DC  E "C5'" 1 
ATOM   5946 C  "C4'" . DC  D 3 10  ? 20.054  3.640   12.288  1.00 48.86 ? 910  DC  E "C4'" 1 
ATOM   5947 O  "O4'" . DC  D 3 10  ? 19.951  2.258   11.859  1.00 48.14 ? 910  DC  E "O4'" 1 
ATOM   5948 C  "C3'" . DC  D 3 10  ? 21.258  3.685   13.224  1.00 48.50 ? 910  DC  E "C3'" 1 
ATOM   5949 O  "O3'" . DC  D 3 10  ? 20.855  4.306   14.417  1.00 50.56 ? 910  DC  E "O3'" 1 
ATOM   5950 C  "C2'" . DC  D 3 10  ? 21.676  2.225   13.386  1.00 48.00 ? 910  DC  E "C2'" 1 
ATOM   5951 C  "C1'" . DC  D 3 10  ? 20.462  1.459   12.883  1.00 47.00 ? 910  DC  E "C1'" 1 
ATOM   5952 N  N1    . DC  D 3 10  ? 20.741  0.107   12.333  1.00 46.50 ? 910  DC  E N1    1 
ATOM   5953 C  C2    . DC  D 3 10  ? 20.047  -1.009  12.834  1.00 46.30 ? 910  DC  E C2    1 
ATOM   5954 O  O2    . DC  D 3 10  ? 19.215  -0.860  13.724  1.00 47.49 ? 910  DC  E O2    1 
ATOM   5955 N  N3    . DC  D 3 10  ? 20.297  -2.247  12.349  1.00 45.57 ? 910  DC  E N3    1 
ATOM   5956 C  C4    . DC  D 3 10  ? 21.198  -2.395  11.382  1.00 46.67 ? 910  DC  E C4    1 
ATOM   5957 N  N4    . DC  D 3 10  ? 21.402  -3.638  10.950  1.00 46.42 ? 910  DC  E N4    1 
ATOM   5958 C  C5    . DC  D 3 10  ? 21.929  -1.279  10.844  1.00 46.71 ? 910  DC  E C5    1 
ATOM   5959 C  C6    . DC  D 3 10  ? 21.671  -0.058  11.344  1.00 46.46 ? 910  DC  E C6    1 
ATOM   5960 P  P     . DC  D 3 11  ? 21.870  4.499   15.635  1.00 52.34 ? 911  DC  E P     1 
ATOM   5961 O  OP1   . DC  D 3 11  ? 21.374  5.669   16.383  1.00 51.98 ? 911  DC  E OP1   1 
ATOM   5962 O  OP2   . DC  D 3 11  ? 23.274  4.439   15.150  1.00 52.10 ? 911  DC  E OP2   1 
ATOM   5963 O  "O5'" . DC  D 3 11  ? 21.556  3.168   16.474  1.00 50.76 ? 911  DC  E "O5'" 1 
ATOM   5964 C  "C5'" . DC  D 3 11  ? 20.195  2.869   16.774  1.00 49.53 ? 911  DC  E "C5'" 1 
ATOM   5965 C  "C4'" . DC  D 3 11  ? 20.088  1.638   17.651  1.00 49.05 ? 911  DC  E "C4'" 1 
ATOM   5966 O  "O4'" . DC  D 3 11  ? 20.262  0.442   16.854  1.00 47.24 ? 911  DC  E "O4'" 1 
ATOM   5967 C  "C3'" . DC  D 3 11  ? 21.130  1.541   18.761  1.00 48.47 ? 911  DC  E "C3'" 1 
ATOM   5968 O  "O3'" . DC  D 3 11  ? 20.514  0.951   19.915  1.00 49.19 ? 911  DC  E "O3'" 1 
ATOM   5969 C  "C2'" . DC  D 3 11  ? 22.207  0.682   18.110  1.00 46.94 ? 911  DC  E "C2'" 1 
ATOM   5970 C  "C1'" . DC  D 3 11  ? 21.331  -0.304  17.367  1.00 46.39 ? 911  DC  E "C1'" 1 
ATOM   5971 N  N1    . DC  D 3 11  ? 21.968  -1.050  16.233  1.00 46.36 ? 911  DC  E N1    1 
ATOM   5972 C  C2    . DC  D 3 11  ? 21.616  -2.394  16.050  1.00 46.09 ? 911  DC  E C2    1 
ATOM   5973 O  O2    . DC  D 3 11  ? 20.798  -2.935  16.807  1.00 45.96 ? 911  DC  E O2    1 
ATOM   5974 N  N3    . DC  D 3 11  ? 22.175  -3.079  15.024  1.00 46.16 ? 911  DC  E N3    1 
ATOM   5975 C  C4    . DC  D 3 11  ? 23.047  -2.504  14.208  1.00 45.55 ? 911  DC  E C4    1 
ATOM   5976 N  N4    . DC  D 3 11  ? 23.548  -3.270  13.239  1.00 45.25 ? 911  DC  E N4    1 
ATOM   5977 C  C5    . DC  D 3 11  ? 23.421  -1.136  14.366  1.00 45.86 ? 911  DC  E C5    1 
ATOM   5978 C  C6    . DC  D 3 11  ? 22.862  -0.455  15.379  1.00 46.33 ? 911  DC  E C6    1 
ATOM   5979 P  P     . DA  D 3 12  ? 21.087  1.120   21.400  1.00 49.10 ? 912  DA  E P     1 
ATOM   5980 O  OP1   . DA  D 3 12  ? 20.369  2.264   22.005  1.00 48.65 ? 912  DA  E OP1   1 
ATOM   5981 O  OP2   . DA  D 3 12  ? 22.565  1.137   21.305  1.00 48.50 ? 912  DA  E OP2   1 
ATOM   5982 O  "O5'" . DA  D 3 12  ? 20.661  -0.252  22.123  1.00 48.23 ? 912  DA  E "O5'" 1 
ATOM   5983 C  "C5'" . DA  D 3 12  ? 19.810  -1.170  21.435  1.00 48.61 ? 912  DA  E "C5'" 1 
ATOM   5984 C  "C4'" . DA  D 3 12  ? 19.853  -2.591  21.962  1.00 48.85 ? 912  DA  E "C4'" 1 
ATOM   5985 O  "O4'" . DA  D 3 12  ? 20.414  -3.447  20.930  1.00 48.56 ? 912  DA  E "O4'" 1 
ATOM   5986 C  "C3'" . DA  D 3 12  ? 20.696  -2.852  23.195  1.00 49.22 ? 912  DA  E "C3'" 1 
ATOM   5987 O  "O3'" . DA  D 3 12  ? 20.160  -3.950  23.926  1.00 50.99 ? 912  DA  E "O3'" 1 
ATOM   5988 C  "C2'" . DA  D 3 12  ? 22.052  -3.145  22.557  1.00 49.46 ? 912  DA  E "C2'" 1 
ATOM   5989 C  "C1'" . DA  D 3 12  ? 21.682  -3.943  21.307  1.00 48.55 ? 912  DA  E "C1'" 1 
ATOM   5990 N  N9    . DA  D 3 12  ? 22.590  -3.828  20.154  1.00 48.11 ? 912  DA  E N9    1 
ATOM   5991 C  C8    . DA  D 3 12  ? 23.122  -2.679  19.645  1.00 48.35 ? 912  DA  E C8    1 
ATOM   5992 N  N7    . DA  D 3 12  ? 23.892  -2.851  18.592  1.00 48.61 ? 912  DA  E N7    1 
ATOM   5993 C  C5    . DA  D 3 12  ? 23.878  -4.221  18.388  1.00 48.73 ? 912  DA  E C5    1 
ATOM   5994 C  C6    . DA  D 3 12  ? 24.514  -5.050  17.425  1.00 48.37 ? 912  DA  E C6    1 
ATOM   5995 N  N6    . DA  D 3 12  ? 25.305  -4.577  16.459  1.00 47.08 ? 912  DA  E N6    1 
ATOM   5996 N  N1    . DA  D 3 12  ? 24.284  -6.388  17.491  1.00 48.58 ? 912  DA  E N1    1 
ATOM   5997 C  C2    . DA  D 3 12  ? 23.487  -6.858  18.469  1.00 48.54 ? 912  DA  E C2    1 
ATOM   5998 N  N3    . DA  D 3 12  ? 22.842  -6.175  19.429  1.00 48.49 ? 912  DA  E N3    1 
ATOM   5999 C  C4    . DA  D 3 12  ? 23.074  -4.843  19.341  1.00 48.61 ? 912  DA  E C4    1 
ATOM   6000 P  P     . DT  D 3 13  ? 20.684  -4.294  25.411  1.00 55.75 ? 913  DT  E P     1 
ATOM   6001 O  OP1   . DT  D 3 13  ? 19.473  -4.570  26.221  1.00 55.61 ? 913  DT  E OP1   1 
ATOM   6002 O  OP2   . DT  D 3 13  ? 21.691  -3.290  25.855  1.00 54.59 ? 913  DT  E OP2   1 
ATOM   6003 O  "O5'" . DT  D 3 13  ? 21.499  -5.663  25.227  1.00 54.34 ? 913  DT  E "O5'" 1 
ATOM   6004 C  "C5'" . DT  D 3 13  ? 20.859  -6.826  24.706  1.00 54.11 ? 913  DT  E "C5'" 1 
ATOM   6005 C  "C4'" . DT  D 3 13  ? 21.905  -7.825  24.283  1.00 54.10 ? 913  DT  E "C4'" 1 
ATOM   6006 O  "O4'" . DT  D 3 13  ? 22.589  -7.322  23.100  1.00 53.26 ? 913  DT  E "O4'" 1 
ATOM   6007 C  "C3'" . DT  D 3 13  ? 22.973  -8.064  25.358  1.00 54.59 ? 913  DT  E "C3'" 1 
ATOM   6008 O  "O3'" . DT  D 3 13  ? 22.963  -9.426  25.799  1.00 56.17 ? 913  DT  E "O3'" 1 
ATOM   6009 C  "C2'" . DT  D 3 13  ? 24.283  -7.634  24.686  1.00 53.70 ? 913  DT  E "C2'" 1 
ATOM   6010 C  "C1'" . DT  D 3 13  ? 23.949  -7.700  23.196  1.00 52.67 ? 913  DT  E "C1'" 1 
ATOM   6011 N  N1    . DT  D 3 13  ? 24.788  -6.831  22.296  1.00 51.87 ? 913  DT  E N1    1 
ATOM   6012 C  C2    . DT  D 3 13  ? 25.413  -7.393  21.198  1.00 51.17 ? 913  DT  E C2    1 
ATOM   6013 O  O2    . DT  D 3 13  ? 25.335  -8.569  20.896  1.00 50.96 ? 913  DT  E O2    1 
ATOM   6014 N  N3    . DT  D 3 13  ? 26.136  -6.518  20.434  1.00 50.92 ? 913  DT  E N3    1 
ATOM   6015 C  C4    . DT  D 3 13  ? 26.327  -5.172  20.673  1.00 51.54 ? 913  DT  E C4    1 
ATOM   6016 O  O4    . DT  D 3 13  ? 27.009  -4.472  19.936  1.00 51.90 ? 913  DT  E O4    1 
ATOM   6017 C  C5    . DT  D 3 13  ? 25.665  -4.639  21.834  1.00 51.51 ? 913  DT  E C5    1 
ATOM   6018 C  C7    . DT  D 3 13  ? 25.807  -3.182  22.167  1.00 51.30 ? 913  DT  E C7    1 
ATOM   6019 C  C6    . DT  D 3 13  ? 24.932  -5.483  22.578  1.00 51.96 ? 913  DT  E C6    1 
ATOM   6020 P  P     . DC  D 3 14  ? 23.986  -9.923  26.928  1.00 58.81 ? 914  DC  E P     1 
ATOM   6021 O  OP1   . DC  D 3 14  ? 23.295  -10.924 27.761  1.00 59.51 ? 914  DC  E OP1   1 
ATOM   6022 O  OP2   . DC  D 3 14  ? 24.679  -8.771  27.557  1.00 57.51 ? 914  DC  E OP2   1 
ATOM   6023 O  "O5'" . DC  D 3 14  ? 25.050  -10.692 26.030  1.00 59.59 ? 914  DC  E "O5'" 1 
ATOM   6024 C  "C5'" . DC  D 3 14  ? 24.643  -11.569 24.973  1.00 59.90 ? 914  DC  E "C5'" 1 
ATOM   6025 C  "C4'" . DC  D 3 14  ? 25.887  -12.081 24.271  1.00 60.17 ? 914  DC  E "C4'" 1 
ATOM   6026 O  "O4'" . DC  D 3 14  ? 26.393  -11.023 23.412  1.00 59.22 ? 914  DC  E "O4'" 1 
ATOM   6027 C  "C3'" . DC  D 3 14  ? 27.031  -12.472 25.218  1.00 60.16 ? 914  DC  E "C3'" 1 
ATOM   6028 O  "O3'" . DC  D 3 14  ? 27.602  -13.706 24.829  1.00 62.27 ? 914  DC  E "O3'" 1 
ATOM   6029 C  "C2'" . DC  D 3 14  ? 28.022  -11.316 25.103  1.00 59.07 ? 914  DC  E "C2'" 1 
ATOM   6030 C  "C1'" . DC  D 3 14  ? 27.775  -10.843 23.668  1.00 58.04 ? 914  DC  E "C1'" 1 
ATOM   6031 N  N1    . DC  D 3 14  ? 28.096  -9.410  23.354  1.00 56.73 ? 914  DC  E N1    1 
ATOM   6032 C  C2    . DC  D 3 14  ? 28.809  -9.105  22.189  1.00 55.59 ? 914  DC  E C2    1 
ATOM   6033 O  O2    . DC  D 3 14  ? 29.176  -10.010 21.443  1.00 55.56 ? 914  DC  E O2    1 
ATOM   6034 N  N3    . DC  D 3 14  ? 29.090  -7.815  21.901  1.00 55.44 ? 914  DC  E N3    1 
ATOM   6035 C  C4    . DC  D 3 14  ? 28.686  -6.842  22.709  1.00 56.45 ? 914  DC  E C4    1 
ATOM   6036 N  N4    . DC  D 3 14  ? 28.992  -5.588  22.368  1.00 56.68 ? 914  DC  E N4    1 
ATOM   6037 C  C5    . DC  D 3 14  ? 27.952  -7.119  23.901  1.00 56.35 ? 914  DC  E C5    1 
ATOM   6038 C  C6    . DC  D 3 14  ? 27.684  -8.403  24.181  1.00 56.51 ? 914  DC  E C6    1 
ATOM   6039 P  P     . DC  D 3 15  ? 28.468  -14.592 25.853  1.00 65.57 ? 915  DC  E P     1 
ATOM   6040 O  OP1   . DC  D 3 15  ? 28.153  -16.007 25.559  1.00 65.39 ? 915  DC  E OP1   1 
ATOM   6041 O  OP2   . DC  D 3 15  ? 28.356  -14.065 27.237  1.00 65.28 ? 915  DC  E OP2   1 
ATOM   6042 O  "O5'" . DC  D 3 15  ? 29.973  -14.313 25.405  1.00 66.28 ? 915  DC  E "O5'" 1 
ATOM   6043 C  "C5'" . DC  D 3 15  ? 30.386  -14.300 24.039  1.00 66.97 ? 915  DC  E "C5'" 1 
ATOM   6044 C  "C4'" . DC  D 3 15  ? 31.758  -13.660 23.938  1.00 67.37 ? 915  DC  E "C4'" 1 
ATOM   6045 O  "O4'" . DC  D 3 15  ? 31.584  -12.229 23.773  1.00 67.15 ? 915  DC  E "O4'" 1 
ATOM   6046 C  "C3'" . DC  D 3 15  ? 32.642  -13.845 25.177  1.00 67.62 ? 915  DC  E "C3'" 1 
ATOM   6047 O  "O3'" . DC  D 3 15  ? 34.018  -14.045 24.820  1.00 68.08 ? 915  DC  E "O3'" 1 
ATOM   6048 C  "C2'" . DC  D 3 15  ? 32.398  -12.541 25.931  1.00 67.55 ? 915  DC  E "C2'" 1 
ATOM   6049 C  "C1'" . DC  D 3 15  ? 32.374  -11.581 24.746  1.00 67.61 ? 915  DC  E "C1'" 1 
ATOM   6050 N  N1    . DC  D 3 15  ? 31.848  -10.197 24.961  1.00 67.45 ? 915  DC  E N1    1 
ATOM   6051 C  C2    . DC  D 3 15  ? 32.045  -9.284  23.920  1.00 67.67 ? 915  DC  E C2    1 
ATOM   6052 O  O2    . DC  D 3 15  ? 32.622  -9.667  22.894  1.00 67.65 ? 915  DC  E O2    1 
ATOM   6053 N  N3    . DC  D 3 15  ? 31.594  -8.008  24.058  1.00 68.22 ? 915  DC  E N3    1 
ATOM   6054 C  C4    . DC  D 3 15  ? 30.981  -7.630  25.183  1.00 68.12 ? 915  DC  E C4    1 
ATOM   6055 N  N4    . DC  D 3 15  ? 30.566  -6.362  25.258  1.00 67.75 ? 915  DC  E N4    1 
ATOM   6056 C  C5    . DC  D 3 15  ? 30.770  -8.542  26.267  1.00 68.14 ? 915  DC  E C5    1 
ATOM   6057 C  C6    . DC  D 3 15  ? 31.216  -9.802  26.115  1.00 68.09 ? 915  DC  E C6    1 
ATOM   6058 P  P     . DA  D 3 16  ? 34.845  -15.270 25.447  1.00 68.62 ? 916  DA  E P     1 
ATOM   6059 O  OP1   . DA  D 3 16  ? 34.058  -16.487 25.143  1.00 68.73 ? 916  DA  E OP1   1 
ATOM   6060 O  OP2   . DA  D 3 16  ? 35.216  -14.929 26.841  1.00 67.84 ? 916  DA  E OP2   1 
ATOM   6061 O  "O5'" . DA  D 3 16  ? 36.197  -15.310 24.589  1.00 68.44 ? 916  DA  E "O5'" 1 
ATOM   6062 C  "C5'" . DA  D 3 16  ? 36.162  -15.428 23.167  1.00 68.53 ? 916  DA  E "C5'" 1 
ATOM   6063 C  "C4'" . DA  D 3 16  ? 36.914  -14.290 22.492  1.00 68.49 ? 916  DA  E "C4'" 1 
ATOM   6064 O  "O4'" . DA  D 3 16  ? 36.303  -13.018 22.828  1.00 68.36 ? 916  DA  E "O4'" 1 
ATOM   6065 C  "C3'" . DA  D 3 16  ? 38.379  -14.113 22.887  1.00 68.48 ? 916  DA  E "C3'" 1 
ATOM   6066 O  "O3'" . DA  D 3 16  ? 39.096  -13.602 21.755  1.00 67.84 ? 916  DA  E "O3'" 1 
ATOM   6067 C  "C2'" . DA  D 3 16  ? 38.299  -13.103 24.032  1.00 68.47 ? 916  DA  E "C2'" 1 
ATOM   6068 C  "C1'" . DA  D 3 16  ? 37.258  -12.162 23.438  1.00 68.34 ? 916  DA  E "C1'" 1 
ATOM   6069 N  N9    . DA  D 3 16  ? 36.503  -11.299 24.341  1.00 68.25 ? 916  DA  E N9    1 
ATOM   6070 C  C8    . DA  D 3 16  ? 35.864  -11.649 25.498  1.00 68.31 ? 916  DA  E C8    1 
ATOM   6071 N  N7    . DA  D 3 16  ? 35.241  -10.647 26.074  1.00 68.43 ? 916  DA  E N7    1 
ATOM   6072 C  C5    . DA  D 3 16  ? 35.478  -9.569  25.233  1.00 68.26 ? 916  DA  E C5    1 
ATOM   6073 C  C6    . DA  D 3 16  ? 35.089  -8.207  25.273  1.00 68.29 ? 916  DA  E C6    1 
ATOM   6074 N  N6    . DA  D 3 16  ? 34.343  -7.666  26.243  1.00 68.09 ? 916  DA  E N6    1 
ATOM   6075 N  N1    . DA  D 3 16  ? 35.512  -7.409  24.267  1.00 68.43 ? 916  DA  E N1    1 
ATOM   6076 C  C2    . DA  D 3 16  ? 36.266  -7.931  23.286  1.00 68.28 ? 916  DA  E C2    1 
ATOM   6077 N  N3    . DA  D 3 16  ? 36.688  -9.187  23.142  1.00 67.97 ? 916  DA  E N3    1 
ATOM   6078 C  C4    . DA  D 3 16  ? 36.254  -9.960  24.155  1.00 68.02 ? 916  DA  E C4    1 
ATOM   6079 P  P     . DA  D 3 17  ? 40.690  -13.578 21.698  1.00 67.55 ? 917  DA  E P     1 
ATOM   6080 O  OP1   . DA  D 3 17  ? 41.064  -14.093 20.362  1.00 67.20 ? 917  DA  E OP1   1 
ATOM   6081 O  OP2   . DA  D 3 17  ? 41.200  -14.187 22.953  1.00 67.29 ? 917  DA  E OP2   1 
ATOM   6082 O  "O5'" . DA  D 3 17  ? 41.078  -12.030 21.748  1.00 67.20 ? 917  DA  E "O5'" 1 
ATOM   6083 C  "C5'" . DA  D 3 17  ? 40.583  -11.126 20.765  1.00 67.12 ? 917  DA  E "C5'" 1 
ATOM   6084 C  "C4'" . DA  D 3 17  ? 41.118  -9.718  20.985  1.00 66.87 ? 917  DA  E "C4'" 1 
ATOM   6085 O  "O4'" . DA  D 3 17  ? 40.245  -8.981  21.888  1.00 66.56 ? 917  DA  E "O4'" 1 
ATOM   6086 C  "C3'" . DA  D 3 17  ? 42.502  -9.637  21.619  1.00 66.68 ? 917  DA  E "C3'" 1 
ATOM   6087 O  "O3'" . DA  D 3 17  ? 43.196  -8.512  21.098  1.00 66.72 ? 917  DA  E "O3'" 1 
ATOM   6088 C  "C2'" . DA  D 3 17  ? 42.166  -9.509  23.106  1.00 66.41 ? 917  DA  E "C2'" 1 
ATOM   6089 C  "C1'" . DA  D 3 17  ? 40.952  -8.588  23.053  1.00 65.78 ? 917  DA  E "C1'" 1 
ATOM   6090 N  N9    . DA  D 3 17  ? 40.056  -8.635  24.217  1.00 65.47 ? 917  DA  E N9    1 
ATOM   6091 C  C8    . DA  D 3 17  ? 39.727  -9.710  25.006  1.00 65.19 ? 917  DA  E C8    1 
ATOM   6092 N  N7    . DA  D 3 17  ? 38.890  -9.426  25.979  1.00 64.97 ? 917  DA  E N7    1 
ATOM   6093 C  C5    . DA  D 3 17  ? 38.648  -8.069  25.820  1.00 65.16 ? 917  DA  E C5    1 
ATOM   6094 C  C6    . DA  D 3 17  ? 37.845  -7.143  26.528  1.00 65.16 ? 917  DA  E C6    1 
ATOM   6095 N  N6    . DA  D 3 17  ? 37.099  -7.477  27.586  1.00 65.21 ? 917  DA  E N6    1 
ATOM   6096 N  N1    . DA  D 3 17  ? 37.828  -5.856  26.106  1.00 65.11 ? 917  DA  E N1    1 
ATOM   6097 C  C2    . DA  D 3 17  ? 38.572  -5.512  25.046  1.00 65.28 ? 917  DA  E C2    1 
ATOM   6098 N  N3    . DA  D 3 17  ? 39.364  -6.290  24.302  1.00 65.45 ? 917  DA  E N3    1 
ATOM   6099 C  C4    . DA  D 3 17  ? 39.359  -7.567  24.742  1.00 65.41 ? 917  DA  E C4    1 
ATOM   6100 P  P     . DC  D 3 18  ? 44.685  -8.169  21.573  1.00 67.58 ? 918  DC  E P     1 
ATOM   6101 O  OP1   . DC  D 3 18  ? 45.422  -7.750  20.359  1.00 67.84 ? 918  DC  E OP1   1 
ATOM   6102 O  OP2   . DC  D 3 18  ? 45.207  -9.269  22.426  1.00 66.65 ? 918  DC  E OP2   1 
ATOM   6103 O  "O5'" . DC  D 3 18  ? 44.461  -6.881  22.500  1.00 66.94 ? 918  DC  E "O5'" 1 
ATOM   6104 C  "C5'" . DC  D 3 18  ? 43.970  -5.664  21.930  1.00 65.95 ? 918  DC  E "C5'" 1 
ATOM   6105 C  "C4'" . DC  D 3 18  ? 43.642  -4.639  23.001  1.00 65.23 ? 918  DC  E "C4'" 1 
ATOM   6106 O  "O4'" . DC  D 3 18  ? 42.442  -5.019  23.718  1.00 65.02 ? 918  DC  E "O4'" 1 
ATOM   6107 C  "C3'" . DC  D 3 18  ? 44.668  -4.491  24.109  1.00 65.00 ? 918  DC  E "C3'" 1 
ATOM   6108 O  "O3'" . DC  D 3 18  ? 45.761  -3.696  23.672  1.00 65.33 ? 918  DC  E "O3'" 1 
ATOM   6109 C  "C2'" . DC  D 3 18  ? 43.840  -3.829  25.206  1.00 64.70 ? 918  DC  E "C2'" 1 
ATOM   6110 C  "C1'" . DC  D 3 18  ? 42.451  -4.428  25.007  1.00 64.12 ? 918  DC  E "C1'" 1 
ATOM   6111 N  N1    . DC  D 3 18  ? 42.097  -5.465  26.037  1.00 63.65 ? 918  DC  E N1    1 
ATOM   6112 C  C2    . DC  D 3 18  ? 41.202  -5.170  27.084  1.00 63.26 ? 918  DC  E C2    1 
ATOM   6113 O  O2    . DC  D 3 18  ? 40.688  -4.047  27.165  1.00 63.26 ? 918  DC  E O2    1 
ATOM   6114 N  N3    . DC  D 3 18  ? 40.913  -6.140  27.994  1.00 63.16 ? 918  DC  E N3    1 
ATOM   6115 C  C4    . DC  D 3 18  ? 41.474  -7.351  27.896  1.00 63.47 ? 918  DC  E C4    1 
ATOM   6116 N  N4    . DC  D 3 18  ? 41.161  -8.269  28.816  1.00 63.56 ? 918  DC  E N4    1 
ATOM   6117 C  C5    . DC  D 3 18  ? 42.386  -7.671  26.846  1.00 63.43 ? 918  DC  E C5    1 
ATOM   6118 C  C6    . DC  D 3 18  ? 42.666  -6.710  25.954  1.00 63.60 ? 918  DC  E C6    1 
ATOM   6119 O  "O5'" . DG  E 2 1   ? 11.799  46.951  67.735  1.00 84.83 ? 1802 DG  H "O5'" 1 
ATOM   6120 C  "C5'" . DG  E 2 1   ? 11.991  47.683  66.526  1.00 84.93 ? 1802 DG  H "C5'" 1 
ATOM   6121 C  "C4'" . DG  E 2 1   ? 13.164  48.646  66.631  1.00 85.05 ? 1802 DG  H "C4'" 1 
ATOM   6122 O  "O4'" . DG  E 2 1   ? 14.149  48.117  67.562  1.00 84.86 ? 1802 DG  H "O4'" 1 
ATOM   6123 C  "C3'" . DG  E 2 1   ? 13.919  48.895  65.324  1.00 85.21 ? 1802 DG  H "C3'" 1 
ATOM   6124 O  "O3'" . DG  E 2 1   ? 14.372  50.259  65.247  1.00 85.75 ? 1802 DG  H "O3'" 1 
ATOM   6125 C  "C2'" . DG  E 2 1   ? 15.063  47.892  65.431  1.00 84.99 ? 1802 DG  H "C2'" 1 
ATOM   6126 C  "C1'" . DG  E 2 1   ? 15.402  47.996  66.913  1.00 84.59 ? 1802 DG  H "C1'" 1 
ATOM   6127 N  N9    . DG  E 2 1   ? 16.135  46.866  67.488  1.00 84.46 ? 1802 DG  H N9    1 
ATOM   6128 C  C8    . DG  E 2 1   ? 16.098  46.466  68.806  1.00 84.33 ? 1802 DG  H C8    1 
ATOM   6129 N  N7    . DG  E 2 1   ? 16.851  45.434  69.062  1.00 84.29 ? 1802 DG  H N7    1 
ATOM   6130 C  C5    . DG  E 2 1   ? 17.433  45.128  67.837  1.00 84.43 ? 1802 DG  H C5    1 
ATOM   6131 C  C6    . DG  E 2 1   ? 18.349  44.100  67.498  1.00 84.44 ? 1802 DG  H C6    1 
ATOM   6132 O  O6    . DG  E 2 1   ? 18.833  43.236  68.244  1.00 84.34 ? 1802 DG  H O6    1 
ATOM   6133 N  N1    . DG  E 2 1   ? 18.698  44.128  66.144  1.00 84.39 ? 1802 DG  H N1    1 
ATOM   6134 C  C2    . DG  E 2 1   ? 18.221  45.041  65.229  1.00 84.26 ? 1802 DG  H C2    1 
ATOM   6135 N  N2    . DG  E 2 1   ? 18.672  44.911  63.974  1.00 84.24 ? 1802 DG  H N2    1 
ATOM   6136 N  N3    . DG  E 2 1   ? 17.363  46.011  65.536  1.00 84.21 ? 1802 DG  H N3    1 
ATOM   6137 C  C4    . DG  E 2 1   ? 17.007  46.000  66.852  1.00 84.44 ? 1802 DG  H C4    1 
ATOM   6138 P  P     . DT  E 2 2   ? 15.054  50.889  63.935  1.00 86.03 ? 1803 DT  H P     1 
ATOM   6139 O  OP1   . DT  E 2 2   ? 14.807  52.349  63.971  1.00 85.86 ? 1803 DT  H OP1   1 
ATOM   6140 O  OP2   . DT  E 2 2   ? 14.601  50.112  62.759  1.00 85.92 ? 1803 DT  H OP2   1 
ATOM   6141 O  "O5'" . DT  E 2 2   ? 16.618  50.591  64.169  1.00 86.32 ? 1803 DT  H "O5'" 1 
ATOM   6142 C  "C5'" . DT  E 2 2   ? 17.660  51.486  63.749  1.00 86.61 ? 1803 DT  H "C5'" 1 
ATOM   6143 C  "C4'" . DT  E 2 2   ? 18.230  51.119  62.384  1.00 86.89 ? 1803 DT  H "C4'" 1 
ATOM   6144 O  "O4'" . DT  E 2 2   ? 18.439  49.682  62.299  1.00 87.30 ? 1803 DT  H "O4'" 1 
ATOM   6145 C  "C3'" . DT  E 2 2   ? 17.349  51.501  61.182  1.00 86.92 ? 1803 DT  H "C3'" 1 
ATOM   6146 O  "O3'" . DT  E 2 2   ? 17.976  52.501  60.338  1.00 86.25 ? 1803 DT  H "O3'" 1 
ATOM   6147 C  "C2'" . DT  E 2 2   ? 17.115  50.174  60.451  1.00 87.30 ? 1803 DT  H "C2'" 1 
ATOM   6148 C  "C1'" . DT  E 2 2   ? 18.245  49.284  60.954  1.00 87.74 ? 1803 DT  H "C1'" 1 
ATOM   6149 N  N1    . DT  E 2 2   ? 17.950  47.801  60.856  1.00 88.03 ? 1803 DT  H N1    1 
ATOM   6150 C  C2    . DT  E 2 2   ? 18.533  47.037  59.852  1.00 88.02 ? 1803 DT  H C2    1 
ATOM   6151 O  O2    . DT  E 2 2   ? 19.296  47.473  59.006  1.00 87.94 ? 1803 DT  H O2    1 
ATOM   6152 N  N3    . DT  E 2 2   ? 18.188  45.706  59.867  1.00 88.14 ? 1803 DT  H N3    1 
ATOM   6153 C  C4    . DT  E 2 2   ? 17.339  45.072  60.760  1.00 88.17 ? 1803 DT  H C4    1 
ATOM   6154 O  O4    . DT  E 2 2   ? 17.097  43.871  60.685  1.00 88.17 ? 1803 DT  H O4    1 
ATOM   6155 C  C5    . DT  E 2 2   ? 16.760  45.918  61.779  1.00 88.16 ? 1803 DT  H C5    1 
ATOM   6156 C  C7    . DT  E 2 2   ? 15.824  45.340  62.802  1.00 87.94 ? 1803 DT  H C7    1 
ATOM   6157 C  C6    . DT  E 2 2   ? 17.088  47.222  61.778  1.00 88.20 ? 1803 DT  H C6    1 
ATOM   6158 P  P     . DT  E 2 3   ? 17.211  53.211  59.110  1.00 85.45 ? 1804 DT  H P     1 
ATOM   6159 O  OP1   . DT  E 2 3   ? 17.748  54.583  58.954  1.00 85.39 ? 1804 DT  H OP1   1 
ATOM   6160 O  OP2   . DT  E 2 3   ? 15.756  53.011  59.287  1.00 85.32 ? 1804 DT  H OP2   1 
ATOM   6161 O  "O5'" . DT  E 2 3   ? 17.674  52.342  57.847  1.00 84.37 ? 1804 DT  H "O5'" 1 
ATOM   6162 C  "C5'" . DT  E 2 3   ? 19.062  52.180  57.549  1.00 83.08 ? 1804 DT  H "C5'" 1 
ATOM   6163 C  "C4'" . DT  E 2 3   ? 19.272  51.278  56.344  1.00 82.10 ? 1804 DT  H "C4'" 1 
ATOM   6164 O  "O4'" . DT  E 2 3   ? 19.051  49.892  56.720  1.00 82.00 ? 1804 DT  H "O4'" 1 
ATOM   6165 C  "C3'" . DT  E 2 3   ? 18.340  51.559  55.166  1.00 81.20 ? 1804 DT  H "C3'" 1 
ATOM   6166 O  "O3'" . DT  E 2 3   ? 19.098  51.713  53.964  1.00 79.71 ? 1804 DT  H "O3'" 1 
ATOM   6167 C  "C2'" . DT  E 2 3   ? 17.432  50.334  55.116  1.00 81.56 ? 1804 DT  H "C2'" 1 
ATOM   6168 C  "C1'" . DT  E 2 3   ? 18.330  49.245  55.692  1.00 81.99 ? 1804 DT  H "C1'" 1 
ATOM   6169 N  N1    . DT  E 2 3   ? 17.619  48.033  56.255  1.00 82.26 ? 1804 DT  H N1    1 
ATOM   6170 C  C2    . DT  E 2 3   ? 18.083  46.760  55.954  1.00 82.36 ? 1804 DT  H C2    1 
ATOM   6171 O  O2    . DT  E 2 3   ? 19.049  46.537  55.245  1.00 82.30 ? 1804 DT  H O2    1 
ATOM   6172 N  N3    . DT  E 2 3   ? 17.363  45.732  56.521  1.00 82.51 ? 1804 DT  H N3    1 
ATOM   6173 C  C4    . DT  E 2 3   ? 16.248  45.839  57.340  1.00 82.41 ? 1804 DT  H C4    1 
ATOM   6174 O  O4    . DT  E 2 3   ? 15.676  44.853  57.795  1.00 82.29 ? 1804 DT  H O4    1 
ATOM   6175 C  C5    . DT  E 2 3   ? 15.814  47.190  57.619  1.00 82.42 ? 1804 DT  H C5    1 
ATOM   6176 C  C7    . DT  E 2 3   ? 14.621  47.437  58.496  1.00 82.21 ? 1804 DT  H C7    1 
ATOM   6177 C  C6    . DT  E 2 3   ? 16.511  48.206  57.076  1.00 82.42 ? 1804 DT  H C6    1 
ATOM   6178 P  P     . DG  E 2 4   ? 19.094  53.061  53.088  1.00 77.95 ? 1805 DG  H P     1 
ATOM   6179 O  OP1   . DG  E 2 4   ? 20.502  53.492  52.914  1.00 77.76 ? 1805 DG  H OP1   1 
ATOM   6180 O  OP2   . DG  E 2 4   ? 18.098  54.007  53.639  1.00 78.15 ? 1805 DG  H OP2   1 
ATOM   6181 O  "O5'" . DG  E 2 4   ? 18.515  52.551  51.685  1.00 75.15 ? 1805 DG  H "O5'" 1 
ATOM   6182 C  "C5'" . DG  E 2 4   ? 19.170  51.516  50.957  1.00 72.30 ? 1805 DG  H "C5'" 1 
ATOM   6183 C  "C4'" . DG  E 2 4   ? 18.198  50.422  50.556  1.00 70.18 ? 1805 DG  H "C4'" 1 
ATOM   6184 O  "O4'" . DG  E 2 4   ? 17.693  49.703  51.711  1.00 69.53 ? 1805 DG  H "O4'" 1 
ATOM   6185 C  "C3'" . DG  E 2 4   ? 16.943  50.913  49.836  1.00 68.61 ? 1805 DG  H "C3'" 1 
ATOM   6186 O  "O3'" . DG  E 2 4   ? 17.229  50.997  48.412  1.00 65.98 ? 1805 DG  H "O3'" 1 
ATOM   6187 C  "C2'" . DG  E 2 4   ? 15.855  49.934  50.313  1.00 68.79 ? 1805 DG  H "C2'" 1 
ATOM   6188 C  "C1'" . DG  E 2 4   ? 16.615  48.945  51.204  1.00 68.85 ? 1805 DG  H "C1'" 1 
ATOM   6189 N  N9    . DG  E 2 4   ? 15.830  48.311  52.275  1.00 68.70 ? 1805 DG  H N9    1 
ATOM   6190 C  C8    . DG  E 2 4   ? 14.932  48.888  53.145  1.00 68.56 ? 1805 DG  H C8    1 
ATOM   6191 N  N7    . DG  E 2 4   ? 14.389  48.036  53.975  1.00 68.61 ? 1805 DG  H N7    1 
ATOM   6192 C  C5    . DG  E 2 4   ? 14.953  46.808  53.640  1.00 68.66 ? 1805 DG  H C5    1 
ATOM   6193 C  C6    . DG  E 2 4   ? 14.759  45.503  54.187  1.00 68.62 ? 1805 DG  H C6    1 
ATOM   6194 O  O6    . DG  E 2 4   ? 14.019  45.151  55.120  1.00 68.53 ? 1805 DG  H O6    1 
ATOM   6195 N  N1    . DG  E 2 4   ? 15.539  44.540  53.539  1.00 68.59 ? 1805 DG  H N1    1 
ATOM   6196 C  C2    . DG  E 2 4   ? 16.401  44.804  52.492  1.00 68.64 ? 1805 DG  H C2    1 
ATOM   6197 N  N2    . DG  E 2 4   ? 17.077  43.765  51.981  1.00 68.64 ? 1805 DG  H N2    1 
ATOM   6198 N  N3    . DG  E 2 4   ? 16.590  46.014  51.976  1.00 68.60 ? 1805 DG  H N3    1 
ATOM   6199 C  C4    . DG  E 2 4   ? 15.840  46.967  52.592  1.00 68.70 ? 1805 DG  H C4    1 
ATOM   6200 P  P     . DG  E 2 5   ? 16.730  50.023  47.232  1.00 63.60 ? 1806 DG  H P     1 
ATOM   6201 O  OP1   . DG  E 2 5   ? 17.518  50.397  46.036  1.00 63.37 ? 1806 DG  H OP1   1 
ATOM   6202 O  OP2   . DG  E 2 5   ? 15.251  50.129  47.168  1.00 63.24 ? 1806 DG  H OP2   1 
ATOM   6203 O  "O5'" . DG  E 2 5   ? 17.127  48.528  47.697  1.00 60.29 ? 1806 DG  H "O5'" 1 
ATOM   6204 C  "C5'" . DG  E 2 5   ? 18.018  47.677  46.940  1.00 56.95 ? 1806 DG  H "C5'" 1 
ATOM   6205 C  "C4'" . DG  E 2 5   ? 17.492  46.261  46.708  1.00 54.67 ? 1806 DG  H "C4'" 1 
ATOM   6206 O  "O4'" . DG  E 2 5   ? 16.740  45.774  47.853  1.00 54.04 ? 1806 DG  H "O4'" 1 
ATOM   6207 C  "C3'" . DG  E 2 5   ? 16.551  46.090  45.515  1.00 53.15 ? 1806 DG  H "C3'" 1 
ATOM   6208 O  "O3'" . DG  E 2 5   ? 16.753  44.820  44.900  1.00 50.32 ? 1806 DG  H "O3'" 1 
ATOM   6209 C  "C2'" . DG  E 2 5   ? 15.171  46.197  46.154  1.00 53.47 ? 1806 DG  H "C2'" 1 
ATOM   6210 C  "C1'" . DG  E 2 5   ? 15.410  45.457  47.467  1.00 53.70 ? 1806 DG  H "C1'" 1 
ATOM   6211 N  N9    . DG  E 2 5   ? 14.514  45.842  48.557  1.00 53.63 ? 1806 DG  H N9    1 
ATOM   6212 C  C8    . DG  E 2 5   ? 14.147  47.121  48.911  1.00 53.63 ? 1806 DG  H C8    1 
ATOM   6213 N  N7    . DG  E 2 5   ? 13.342  47.171  49.933  1.00 53.64 ? 1806 DG  H N7    1 
ATOM   6214 C  C5    . DG  E 2 5   ? 13.161  45.839  50.280  1.00 53.63 ? 1806 DG  H C5    1 
ATOM   6215 C  C6    . DG  E 2 5   ? 12.384  45.269  51.319  1.00 53.74 ? 1806 DG  H C6    1 
ATOM   6216 O  O6    . DG  E 2 5   ? 11.681  45.846  52.164  1.00 53.69 ? 1806 DG  H O6    1 
ATOM   6217 N  N1    . DG  E 2 5   ? 12.472  43.878  51.322  1.00 53.62 ? 1806 DG  H N1    1 
ATOM   6218 C  C2    . DG  E 2 5   ? 13.213  43.126  50.440  1.00 53.42 ? 1806 DG  H C2    1 
ATOM   6219 N  N2    . DG  E 2 5   ? 13.166  41.798  50.613  1.00 53.51 ? 1806 DG  H N2    1 
ATOM   6220 N  N3    . DG  E 2 5   ? 13.947  43.649  49.464  1.00 53.32 ? 1806 DG  H N3    1 
ATOM   6221 C  C4    . DG  E 2 5   ? 13.876  45.005  49.443  1.00 53.40 ? 1806 DG  H C4    1 
ATOM   6222 P  P     . DA  E 2 6   ? 15.978  44.410  43.560  1.00 47.89 ? 1807 DA  H P     1 
ATOM   6223 O  OP1   . DA  E 2 6   ? 16.952  43.725  42.682  1.00 48.37 ? 1807 DA  H OP1   1 
ATOM   6224 O  OP2   . DA  E 2 6   ? 15.221  45.577  43.058  1.00 47.49 ? 1807 DA  H OP2   1 
ATOM   6225 O  "O5'" . DA  E 2 6   ? 14.921  43.336  44.081  1.00 45.39 ? 1807 DA  H "O5'" 1 
ATOM   6226 C  "C5'" . DA  E 2 6   ? 15.343  42.100  44.633  1.00 42.95 ? 1807 DA  H "C5'" 1 
ATOM   6227 C  "C4'" . DA  E 2 6   ? 14.145  41.203  44.890  1.00 41.65 ? 1807 DA  H "C4'" 1 
ATOM   6228 O  "O4'" . DA  E 2 6   ? 13.405  41.665  46.051  1.00 40.33 ? 1807 DA  H "O4'" 1 
ATOM   6229 C  "C3'" . DA  E 2 6   ? 13.107  41.158  43.772  1.00 40.82 ? 1807 DA  H "C3'" 1 
ATOM   6230 O  "O3'" . DA  E 2 6   ? 12.499  39.887  43.758  1.00 41.28 ? 1807 DA  H "O3'" 1 
ATOM   6231 C  "C2'" . DA  E 2 6   ? 12.091  42.213  44.172  1.00 39.98 ? 1807 DA  H "C2'" 1 
ATOM   6232 C  "C1'" . DA  E 2 6   ? 12.065  41.959  45.673  1.00 38.91 ? 1807 DA  H "C1'" 1 
ATOM   6233 N  N9    . DA  E 2 6   ? 11.590  43.072  46.488  1.00 38.22 ? 1807 DA  H N9    1 
ATOM   6234 C  C8    . DA  E 2 6   ? 11.794  44.413  46.299  1.00 37.87 ? 1807 DA  H C8    1 
ATOM   6235 N  N7    . DA  E 2 6   ? 11.249  45.171  47.218  1.00 37.48 ? 1807 DA  H N7    1 
ATOM   6236 C  C5    . DA  E 2 6   ? 10.650  44.260  48.067  1.00 37.75 ? 1807 DA  H C5    1 
ATOM   6237 C  C6    . DA  E 2 6   ? 9.900   44.419  49.244  1.00 37.76 ? 1807 DA  H C6    1 
ATOM   6238 N  N6    . DA  E 2 6   ? 9.623   45.612  49.780  1.00 37.68 ? 1807 DA  H N6    1 
ATOM   6239 N  N1    . DA  E 2 6   ? 9.449   43.296  49.841  1.00 37.89 ? 1807 DA  H N1    1 
ATOM   6240 C  C2    . DA  E 2 6   ? 9.727   42.095  49.311  1.00 37.82 ? 1807 DA  H C2    1 
ATOM   6241 N  N3    . DA  E 2 6   ? 10.420  41.820  48.211  1.00 37.66 ? 1807 DA  H N3    1 
ATOM   6242 C  C4    . DA  E 2 6   ? 10.851  42.959  47.634  1.00 37.95 ? 1807 DA  H C4    1 
ATOM   6243 P  P     . DT  E 2 7   ? 11.643  39.401  42.504  1.00 41.92 ? 1808 DT  H P     1 
ATOM   6244 O  OP1   . DT  E 2 7   ? 11.897  37.945  42.357  1.00 42.76 ? 1808 DT  H OP1   1 
ATOM   6245 O  OP2   . DT  E 2 7   ? 11.926  40.305  41.365  1.00 42.07 ? 1808 DT  H OP2   1 
ATOM   6246 O  "O5'" . DT  E 2 7   ? 10.136  39.625  42.999  1.00 41.18 ? 1808 DT  H "O5'" 1 
ATOM   6247 C  "C5'" . DT  E 2 7   ? 9.474   38.563  43.678  1.00 40.34 ? 1808 DT  H "C5'" 1 
ATOM   6248 C  "C4'" . DT  E 2 7   ? 8.367   39.075  44.570  1.00 39.72 ? 1808 DT  H "C4'" 1 
ATOM   6249 O  "O4'" . DT  E 2 7   ? 8.736   40.331  45.174  1.00 38.66 ? 1808 DT  H "O4'" 1 
ATOM   6250 C  "C3'" . DT  E 2 7   ? 7.067   39.390  43.852  1.00 39.83 ? 1808 DT  H "C3'" 1 
ATOM   6251 O  "O3'" . DT  E 2 7   ? 6.284   38.207  43.738  1.00 41.31 ? 1808 DT  H "O3'" 1 
ATOM   6252 C  "C2'" . DT  E 2 7   ? 6.437   40.447  44.753  1.00 39.27 ? 1808 DT  H "C2'" 1 
ATOM   6253 C  "C1'" . DT  E 2 7   ? 7.541   40.810  45.740  1.00 38.57 ? 1808 DT  H "C1'" 1 
ATOM   6254 N  N1    . DT  E 2 7   ? 7.630   42.274  45.984  1.00 38.43 ? 1808 DT  H N1    1 
ATOM   6255 C  C2    . DT  E 2 7   ? 7.152   42.793  47.170  1.00 38.06 ? 1808 DT  H C2    1 
ATOM   6256 O  O2    . DT  E 2 7   ? 6.665   42.111  48.047  1.00 38.06 ? 1808 DT  H O2    1 
ATOM   6257 N  N3    . DT  E 2 7   ? 7.270   44.152  47.304  1.00 37.58 ? 1808 DT  H N3    1 
ATOM   6258 C  C4    . DT  E 2 7   ? 7.803   45.017  46.375  1.00 38.07 ? 1808 DT  H C4    1 
ATOM   6259 O  O4    . DT  E 2 7   ? 7.866   46.218  46.592  1.00 38.22 ? 1808 DT  H O4    1 
ATOM   6260 C  C5    . DT  E 2 7   ? 8.282   44.419  45.149  1.00 38.39 ? 1808 DT  H C5    1 
ATOM   6261 C  C7    . DT  E 2 7   ? 8.885   45.273  44.070  1.00 38.38 ? 1808 DT  H C7    1 
ATOM   6262 C  C6    . DT  E 2 7   ? 8.171   43.089  45.008  1.00 38.44 ? 1808 DT  H C6    1 
ATOM   6263 P  P     . DG  E 2 8   ? 4.852   38.202  43.017  1.00 42.84 ? 1809 DG  H P     1 
ATOM   6264 O  OP1   . DG  E 2 8   ? 4.483   36.797  42.738  1.00 42.93 ? 1809 DG  H OP1   1 
ATOM   6265 O  OP2   . DG  E 2 8   ? 4.880   39.208  41.930  1.00 42.90 ? 1809 DG  H OP2   1 
ATOM   6266 O  "O5'" . DG  E 2 8   ? 3.861   38.715  44.159  1.00 43.44 ? 1809 DG  H "O5'" 1 
ATOM   6267 C  "C5'" . DG  E 2 8   ? 3.788   38.039  45.416  1.00 44.23 ? 1809 DG  H "C5'" 1 
ATOM   6268 C  "C4'" . DG  E 2 8   ? 2.763   38.714  46.308  1.00 44.51 ? 1809 DG  H "C4'" 1 
ATOM   6269 O  "O4'" . DG  E 2 8   ? 3.241   40.026  46.713  1.00 44.25 ? 1809 DG  H "O4'" 1 
ATOM   6270 C  "C3'" . DG  E 2 8   ? 1.421   38.947  45.620  1.00 45.17 ? 1809 DG  H "C3'" 1 
ATOM   6271 O  "O3'" . DG  E 2 8   ? 0.384   38.615  46.528  1.00 46.65 ? 1809 DG  H "O3'" 1 
ATOM   6272 C  "C2'" . DG  E 2 8   ? 1.469   40.426  45.233  1.00 44.40 ? 1809 DG  H "C2'" 1 
ATOM   6273 C  "C1'" . DG  E 2 8   ? 2.289   41.017  46.371  1.00 43.82 ? 1809 DG  H "C1'" 1 
ATOM   6274 N  N9    . DG  E 2 8   ? 2.968   42.270  46.045  1.00 43.32 ? 1809 DG  H N9    1 
ATOM   6275 C  C8    . DG  E 2 8   ? 3.662   42.574  44.904  1.00 43.52 ? 1809 DG  H C8    1 
ATOM   6276 N  N7    . DG  E 2 8   ? 4.157   43.779  44.903  1.00 43.58 ? 1809 DG  H N7    1 
ATOM   6277 C  C5    . DG  E 2 8   ? 3.764   44.313  46.121  1.00 43.35 ? 1809 DG  H C5    1 
ATOM   6278 C  C6    . DG  E 2 8   ? 3.998   45.592  46.690  1.00 43.53 ? 1809 DG  H C6    1 
ATOM   6279 O  O6    . DG  E 2 8   ? 4.627   46.545  46.220  1.00 43.61 ? 1809 DG  H O6    1 
ATOM   6280 N  N1    . DG  E 2 8   ? 3.432   45.739  47.953  1.00 43.53 ? 1809 DG  H N1    1 
ATOM   6281 C  C2    . DG  E 2 8   ? 2.705   44.753  48.579  1.00 43.65 ? 1809 DG  H C2    1 
ATOM   6282 N  N2    . DG  E 2 8   ? 2.224   45.058  49.788  1.00 43.36 ? 1809 DG  H N2    1 
ATOM   6283 N  N3    . DG  E 2 8   ? 2.478   43.549  48.063  1.00 44.02 ? 1809 DG  H N3    1 
ATOM   6284 C  C4    . DG  E 2 8   ? 3.032   43.395  46.831  1.00 43.44 ? 1809 DG  H C4    1 
ATOM   6285 P  P     . DG  E 2 9   ? -1.158  38.720  46.120  1.00 47.83 ? 1810 DG  H P     1 
ATOM   6286 O  OP1   . DG  E 2 9   ? -1.812  37.500  46.643  1.00 47.90 ? 1810 DG  H OP1   1 
ATOM   6287 O  OP2   . DG  E 2 9   ? -1.286  39.084  44.689  1.00 47.43 ? 1810 DG  H OP2   1 
ATOM   6288 O  "O5'" . DG  E 2 9   ? -1.624  39.963  47.006  1.00 48.31 ? 1810 DG  H "O5'" 1 
ATOM   6289 C  "C5'" . DG  E 2 9   ? -1.346  39.959  48.416  1.00 48.77 ? 1810 DG  H "C5'" 1 
ATOM   6290 C  "C4'" . DG  E 2 9   ? -2.037  41.111  49.126  1.00 48.97 ? 1810 DG  H "C4'" 1 
ATOM   6291 O  "O4'" . DG  E 2 9   ? -1.305  42.342  48.902  1.00 48.97 ? 1810 DG  H "O4'" 1 
ATOM   6292 C  "C3'" . DG  E 2 9   ? -3.451  41.416  48.652  1.00 49.31 ? 1810 DG  H "C3'" 1 
ATOM   6293 O  "O3'" . DG  E 2 9   ? -4.228  41.857  49.750  1.00 50.16 ? 1810 DG  H "O3'" 1 
ATOM   6294 C  "C2'" . DG  E 2 9   ? -3.259  42.509  47.605  1.00 48.82 ? 1810 DG  H "C2'" 1 
ATOM   6295 C  "C1'" . DG  E 2 9   ? -2.109  43.289  48.222  1.00 48.52 ? 1810 DG  H "C1'" 1 
ATOM   6296 N  N9    . DG  E 2 9   ? -1.245  43.997  47.279  1.00 48.70 ? 1810 DG  H N9    1 
ATOM   6297 C  C8    . DG  E 2 9   ? -0.683  43.517  46.116  1.00 48.67 ? 1810 DG  H C8    1 
ATOM   6298 N  N7    . DG  E 2 9   ? 0.057   44.397  45.489  1.00 48.75 ? 1810 DG  H N7    1 
ATOM   6299 C  C5    . DG  E 2 9   ? -0.015  45.533  46.288  1.00 48.54 ? 1810 DG  H C5    1 
ATOM   6300 C  C6    . DG  E 2 9   ? 0.582   46.808  46.137  1.00 48.07 ? 1810 DG  H C6    1 
ATOM   6301 O  O6    . DG  E 2 9   ? 1.316   47.214  45.232  1.00 48.19 ? 1810 DG  H O6    1 
ATOM   6302 N  N1    . DG  E 2 9   ? 0.242   47.681  47.167  1.00 48.33 ? 1810 DG  H N1    1 
ATOM   6303 C  C2    . DG  E 2 9   ? -0.556  47.339  48.236  1.00 48.32 ? 1810 DG  H C2    1 
ATOM   6304 N  N2    . DG  E 2 9   ? -0.770  48.301  49.144  1.00 48.42 ? 1810 DG  H N2    1 
ATOM   6305 N  N3    . DG  E 2 9   ? -1.123  46.152  48.400  1.00 48.11 ? 1810 DG  H N3    1 
ATOM   6306 C  C4    . DG  E 2 9   ? -0.810  45.299  47.393  1.00 48.71 ? 1810 DG  H C4    1 
ATOM   6307 P  P     . DT  E 2 10  ? -5.818  41.947  49.633  1.00 51.28 ? 1811 DT  H P     1 
ATOM   6308 O  OP1   . DT  E 2 10  ? -6.361  41.592  50.969  1.00 51.04 ? 1811 DT  H OP1   1 
ATOM   6309 O  OP2   . DT  E 2 10  ? -6.291  41.274  48.396  1.00 50.76 ? 1811 DT  H OP2   1 
ATOM   6310 O  "O5'" . DT  E 2 10  ? -6.048  43.499  49.374  1.00 50.86 ? 1811 DT  H "O5'" 1 
ATOM   6311 C  "C5'" . DT  E 2 10  ? -5.803  44.448  50.398  1.00 50.23 ? 1811 DT  H "C5'" 1 
ATOM   6312 C  "C4'" . DT  E 2 10  ? -5.817  45.822  49.765  1.00 49.94 ? 1811 DT  H "C4'" 1 
ATOM   6313 O  "O4'" . DT  E 2 10  ? -4.867  45.853  48.679  1.00 50.39 ? 1811 DT  H "O4'" 1 
ATOM   6314 C  "C3'" . DT  E 2 10  ? -7.129  46.223  49.096  1.00 49.52 ? 1811 DT  H "C3'" 1 
ATOM   6315 O  "O3'" . DT  E 2 10  ? -7.851  47.083  49.969  1.00 48.40 ? 1811 DT  H "O3'" 1 
ATOM   6316 C  "C2'" . DT  E 2 10  ? -6.718  46.869  47.761  1.00 49.54 ? 1811 DT  H "C2'" 1 
ATOM   6317 C  "C1'" . DT  E 2 10  ? -5.202  46.970  47.899  1.00 49.89 ? 1811 DT  H "C1'" 1 
ATOM   6318 N  N1    . DT  E 2 10  ? -4.342  46.939  46.648  1.00 50.24 ? 1811 DT  H N1    1 
ATOM   6319 C  C2    . DT  E 2 10  ? -3.595  48.057  46.341  1.00 50.03 ? 1811 DT  H C2    1 
ATOM   6320 O  O2    . DT  E 2 10  ? -3.610  49.072  47.018  1.00 50.12 ? 1811 DT  H O2    1 
ATOM   6321 N  N3    . DT  E 2 10  ? -2.835  47.963  45.201  1.00 49.68 ? 1811 DT  H N3    1 
ATOM   6322 C  C4    . DT  E 2 10  ? -2.728  46.868  44.370  1.00 49.82 ? 1811 DT  H C4    1 
ATOM   6323 O  O4    . DT  E 2 10  ? -2.009  46.900  43.376  1.00 49.85 ? 1811 DT  H O4    1 
ATOM   6324 C  C5    . DT  E 2 10  ? -3.524  45.722  44.741  1.00 49.82 ? 1811 DT  H C5    1 
ATOM   6325 C  C7    . DT  E 2 10  ? -3.499  44.478  43.903  1.00 49.80 ? 1811 DT  H C7    1 
ATOM   6326 C  C6    . DT  E 2 10  ? -4.277  45.808  45.849  1.00 50.15 ? 1811 DT  H C6    1 
ATOM   6327 P  P     . DA  E 2 11  ? -9.351  47.493  49.649  1.00 46.65 ? 1812 DA  H P     1 
ATOM   6328 O  OP1   . DA  E 2 11  ? -10.010 47.756  50.939  1.00 46.92 ? 1812 DA  H OP1   1 
ATOM   6329 O  OP2   . DA  E 2 11  ? -9.961  46.542  48.698  1.00 47.61 ? 1812 DA  H OP2   1 
ATOM   6330 O  "O5'" . DA  E 2 11  ? -9.108  48.857  48.871  1.00 46.02 ? 1812 DA  H "O5'" 1 
ATOM   6331 C  "C5'" . DA  E 2 11  ? -8.525  49.933  49.572  1.00 45.77 ? 1812 DA  H "C5'" 1 
ATOM   6332 C  "C4'" . DA  E 2 11  ? -8.114  51.004  48.593  1.00 45.75 ? 1812 DA  H "C4'" 1 
ATOM   6333 O  "O4'" . DA  E 2 11  ? -7.149  50.420  47.696  1.00 44.88 ? 1812 DA  H "O4'" 1 
ATOM   6334 C  "C3'" . DA  E 2 11  ? -9.236  51.541  47.714  1.00 46.14 ? 1812 DA  H "C3'" 1 
ATOM   6335 O  "O3'" . DA  E 2 11  ? -9.600  52.830  48.165  1.00 49.38 ? 1812 DA  H "O3'" 1 
ATOM   6336 C  "C2'" . DA  E 2 11  ? -8.647  51.548  46.301  1.00 45.00 ? 1812 DA  H "C2'" 1 
ATOM   6337 C  "C1'" . DA  E 2 11  ? -7.192  51.148  46.496  1.00 43.45 ? 1812 DA  H "C1'" 1 
ATOM   6338 N  N9    . DA  E 2 11  ? -6.648  50.323  45.420  1.00 42.76 ? 1812 DA  H N9    1 
ATOM   6339 C  C8    . DA  E 2 11  ? -6.985  49.039  45.073  1.00 42.20 ? 1812 DA  H C8    1 
ATOM   6340 N  N7    . DA  E 2 11  ? -6.309  48.573  44.052  1.00 42.13 ? 1812 DA  H N7    1 
ATOM   6341 C  C5    . DA  E 2 11  ? -5.474  49.629  43.712  1.00 42.20 ? 1812 DA  H C5    1 
ATOM   6342 C  C6    . DA  E 2 11  ? -4.499  49.798  42.715  1.00 41.87 ? 1812 DA  H C6    1 
ATOM   6343 N  N6    . DA  E 2 11  ? -4.184  48.856  41.832  1.00 42.02 ? 1812 DA  H N6    1 
ATOM   6344 N  N1    . DA  E 2 11  ? -3.852  50.978  42.658  1.00 41.94 ? 1812 DA  H N1    1 
ATOM   6345 C  C2    . DA  E 2 11  ? -4.151  51.936  43.534  1.00 41.85 ? 1812 DA  H C2    1 
ATOM   6346 N  N3    . DA  E 2 11  ? -5.041  51.899  44.519  1.00 41.82 ? 1812 DA  H N3    1 
ATOM   6347 C  C4    . DA  E 2 11  ? -5.670  50.712  44.546  1.00 42.36 ? 1812 DA  H C4    1 
ATOM   6348 P  P     . DG  E 2 12  ? -10.851 53.602  47.539  1.00 51.73 ? 1813 DG  H P     1 
ATOM   6349 O  OP1   . DG  E 2 12  ? -11.897 53.697  48.589  1.00 59.96 ? 1813 DG  H OP1   1 
ATOM   6350 O  OP2   . DG  E 2 12  ? -11.170 52.987  46.239  1.00 53.05 ? 1813 DG  H OP2   1 
ATOM   6351 O  "O5'" . DG  E 2 12  ? -10.276 55.062  47.210  1.00 50.26 ? 1813 DG  H "O5'" 1 
ATOM   6352 C  "C5'" . DG  E 2 12  ? -8.924  55.294  46.791  1.00 47.75 ? 1813 DG  H "C5'" 1 
ATOM   6353 C  "C4'" . DG  E 2 12  ? -8.791  55.885  45.394  1.00 46.20 ? 1813 DG  H "C4'" 1 
ATOM   6354 O  "O4'" . DG  E 2 12  ? -7.981  54.977  44.589  1.00 45.13 ? 1813 DG  H "O4'" 1 
ATOM   6355 C  "C3'" . DG  E 2 12  ? -10.092 56.108  44.615  1.00 45.77 ? 1813 DG  H "C3'" 1 
ATOM   6356 O  "O3'" . DG  E 2 12  ? -10.103 57.297  43.796  1.00 47.43 ? 1813 DG  H "O3'" 1 
ATOM   6357 C  "C2'" . DG  E 2 12  ? -10.148 54.874  43.738  1.00 44.30 ? 1813 DG  H "C2'" 1 
ATOM   6358 C  "C1'" . DG  E 2 12  ? -8.675  54.708  43.383  1.00 41.88 ? 1813 DG  H "C1'" 1 
ATOM   6359 N  N9    . DG  E 2 12  ? -8.383  53.384  42.824  1.00 40.88 ? 1813 DG  H N9    1 
ATOM   6360 C  C8    . DG  E 2 12  ? -8.964  52.169  43.136  1.00 39.93 ? 1813 DG  H C8    1 
ATOM   6361 N  N7    . DG  E 2 12  ? -8.499  51.171  42.450  1.00 39.31 ? 1813 DG  H N7    1 
ATOM   6362 C  C5    . DG  E 2 12  ? -7.557  51.761  41.625  1.00 39.33 ? 1813 DG  H C5    1 
ATOM   6363 C  C6    . DG  E 2 12  ? -6.730  51.184  40.646  1.00 39.54 ? 1813 DG  H C6    1 
ATOM   6364 O  O6    . DG  E 2 12  ? -6.667  49.992  40.333  1.00 39.84 ? 1813 DG  H O6    1 
ATOM   6365 N  N1    . DG  E 2 12  ? -5.905  52.124  40.025  1.00 39.90 ? 1813 DG  H N1    1 
ATOM   6366 C  C2    . DG  E 2 12  ? -5.914  53.469  40.317  1.00 39.61 ? 1813 DG  H C2    1 
ATOM   6367 N  N2    . DG  E 2 12  ? -5.067  54.241  39.633  1.00 39.74 ? 1813 DG  H N2    1 
ATOM   6368 N  N3    . DG  E 2 12  ? -6.682  54.028  41.234  1.00 39.71 ? 1813 DG  H N3    1 
ATOM   6369 C  C4    . DG  E 2 12  ? -7.474  53.115  41.840  1.00 39.83 ? 1813 DG  H C4    1 
HETATM 6370 P  P     . 2DT E 2 13  ? -11.416 58.223  43.724  1.00 49.02 ? 1814 2DT H P     1 
HETATM 6371 O  OP1   . 2DT E 2 13  ? -10.978 59.599  44.040  1.00 48.40 ? 1814 2DT H OP1   1 
HETATM 6372 O  OP2   . 2DT E 2 13  ? -12.446 57.553  44.544  1.00 50.16 ? 1814 2DT H OP2   1 
HETATM 6373 O  "O5'" . 2DT E 2 13  ? -12.002 58.218  42.229  1.00 50.53 ? 1814 2DT H "O5'" 1 
HETATM 6374 N  N1    . 2DT E 2 13  ? -9.752  54.053  39.710  1.00 52.47 ? 1814 2DT H N1    1 
HETATM 6375 C  C6    . 2DT E 2 13  ? -10.714 53.513  40.559  1.00 51.86 ? 1814 2DT H C6    1 
HETATM 6376 C  C2    . 2DT E 2 13  ? -9.123  53.281  38.777  1.00 51.57 ? 1814 2DT H C2    1 
HETATM 6377 O  O2    . 2DT E 2 13  ? -8.292  53.774  38.045  1.00 51.97 ? 1814 2DT H O2    1 
HETATM 6378 N  N3    . 2DT E 2 13  ? -9.494  51.960  38.716  1.00 51.05 ? 1814 2DT H N3    1 
HETATM 6379 C  C4    . 2DT E 2 13  ? -10.425 51.353  39.531  1.00 52.10 ? 1814 2DT H C4    1 
HETATM 6380 O  O4    . 2DT E 2 13  ? -10.673 50.155  39.397  1.00 52.83 ? 1814 2DT H O4    1 
HETATM 6381 C  C5    . 2DT E 2 13  ? -11.071 52.214  40.507  1.00 51.66 ? 1814 2DT H C5    1 
HETATM 6382 C  C5M   . 2DT E 2 13  ? -12.109 51.651  41.434  1.00 51.66 ? 1814 2DT H C5M   1 
HETATM 6383 C  "C2'" . 2DT E 2 13  ? -9.864  56.372  38.644  1.00 53.88 ? 1814 2DT H "C2'" 1 
HETATM 6384 C  "C5'" . 2DT E 2 13  ? -11.687 57.256  41.234  1.00 52.11 ? 1814 2DT H "C5'" 1 
HETATM 6385 C  "C4'" . 2DT E 2 13  ? -10.237 57.388  40.784  1.00 53.57 ? 1814 2DT H "C4'" 1 
HETATM 6386 O  "O4'" . 2DT E 2 13  ? -9.623  56.093  40.978  1.00 54.22 ? 1814 2DT H "O4'" 1 
HETATM 6387 C  "C1'" . 2DT E 2 13  ? -9.289  55.497  39.740  1.00 52.99 ? 1814 2DT H "C1'" 1 
HETATM 6388 C  "C3'" . 2DT E 2 13  ? -9.971  57.739  39.319  1.00 54.38 ? 1814 2DT H "C3'" 1 
ATOM   6389 O  "O5'" . DA  F 3 3   ? -13.934 35.884  27.621  1.00 80.20 ? 1903 DA  J "O5'" 1 
ATOM   6390 C  "C5'" . DA  F 3 3   ? -13.829 37.060  28.422  1.00 80.18 ? 1903 DA  J "C5'" 1 
ATOM   6391 C  "C4'" . DA  F 3 3   ? -14.007 38.316  27.585  1.00 80.04 ? 1903 DA  J "C4'" 1 
ATOM   6392 O  "O4'" . DA  F 3 3   ? -15.424 38.613  27.454  1.00 80.85 ? 1903 DA  J "O4'" 1 
ATOM   6393 C  "C3'" . DA  F 3 3   ? -13.392 39.577  28.173  1.00 79.50 ? 1903 DA  J "C3'" 1 
ATOM   6394 O  "O3'" . DA  F 3 3   ? -13.002 40.500  27.142  1.00 77.38 ? 1903 DA  J "O3'" 1 
ATOM   6395 C  "C2'" . DA  F 3 3   ? -14.525 40.096  29.058  1.00 80.47 ? 1903 DA  J "C2'" 1 
ATOM   6396 C  "C1'" . DA  F 3 3   ? -15.807 39.636  28.360  1.00 81.57 ? 1903 DA  J "C1'" 1 
ATOM   6397 N  N9    . DA  F 3 3   ? -16.833 39.114  29.275  1.00 82.24 ? 1903 DA  J N9    1 
ATOM   6398 C  C8    . DA  F 3 3   ? -17.635 38.013  29.078  1.00 82.43 ? 1903 DA  J C8    1 
ATOM   6399 N  N7    . DA  F 3 3   ? -18.467 37.771  30.067  1.00 82.59 ? 1903 DA  J N7    1 
ATOM   6400 C  C5    . DA  F 3 3   ? -18.198 38.782  30.984  1.00 82.66 ? 1903 DA  J C5    1 
ATOM   6401 C  C6    . DA  F 3 3   ? -18.745 39.091  32.253  1.00 82.27 ? 1903 DA  J C6    1 
ATOM   6402 N  N6    . DA  F 3 3   ? -19.716 38.368  32.824  1.00 82.13 ? 1903 DA  J N6    1 
ATOM   6403 N  N1    . DA  F 3 3   ? -18.255 40.173  32.911  1.00 82.19 ? 1903 DA  J N1    1 
ATOM   6404 C  C2    . DA  F 3 3   ? -17.283 40.896  32.336  1.00 82.25 ? 1903 DA  J C2    1 
ATOM   6405 N  N3    . DA  F 3 3   ? -16.692 40.705  31.151  1.00 82.43 ? 1903 DA  J N3    1 
ATOM   6406 C  C4    . DA  F 3 3   ? -17.194 39.623  30.513  1.00 82.63 ? 1903 DA  J C4    1 
ATOM   6407 P  P     . DA  F 3 4   ? -12.351 41.934  27.476  1.00 75.58 ? 1904 DA  J P     1 
ATOM   6408 O  OP1   . DA  F 3 4   ? -13.436 42.947  27.419  1.00 74.85 ? 1904 DA  J OP1   1 
ATOM   6409 O  OP2   . DA  F 3 4   ? -11.131 42.106  26.645  1.00 75.31 ? 1904 DA  J OP2   1 
ATOM   6410 O  "O5'" . DA  F 3 4   ? -11.870 41.762  28.994  1.00 72.05 ? 1904 DA  J "O5'" 1 
ATOM   6411 C  "C5'" . DA  F 3 4   ? -11.439 42.881  29.756  1.00 68.49 ? 1904 DA  J "C5'" 1 
ATOM   6412 C  "C4'" . DA  F 3 4   ? -11.739 42.681  31.234  1.00 65.79 ? 1904 DA  J "C4'" 1 
ATOM   6413 O  "O4'" . DA  F 3 4   ? -12.721 41.636  31.454  1.00 65.67 ? 1904 DA  J "O4'" 1 
ATOM   6414 C  "C3'" . DA  F 3 4   ? -10.526 42.241  32.036  1.00 63.12 ? 1904 DA  J "C3'" 1 
ATOM   6415 O  "O3'" . DA  F 3 4   ? -9.968  43.383  32.637  1.00 57.34 ? 1904 DA  J "O3'" 1 
ATOM   6416 C  "C2'" . DA  F 3 4   ? -11.041 41.249  33.076  1.00 64.24 ? 1904 DA  J "C2'" 1 
ATOM   6417 C  "C1'" . DA  F 3 4   ? -12.516 41.090  32.742  1.00 65.61 ? 1904 DA  J "C1'" 1 
ATOM   6418 N  N9    . DA  F 3 4   ? -12.959 39.701  32.736  1.00 66.11 ? 1904 DA  J N9    1 
ATOM   6419 C  C8    . DA  F 3 4   ? -12.593 38.707  31.864  1.00 66.30 ? 1904 DA  J C8    1 
ATOM   6420 N  N7    . DA  F 3 4   ? -13.171 37.553  32.107  1.00 66.61 ? 1904 DA  J N7    1 
ATOM   6421 C  C5    . DA  F 3 4   ? -13.964 37.815  33.217  1.00 66.60 ? 1904 DA  J C5    1 
ATOM   6422 C  C6    . DA  F 3 4   ? -14.835 37.010  33.979  1.00 66.23 ? 1904 DA  J C6    1 
ATOM   6423 N  N6    . DA  F 3 4   ? -15.040 35.721  33.702  1.00 66.10 ? 1904 DA  J N6    1 
ATOM   6424 N  N1    . DA  F 3 4   ? -15.480 37.580  35.028  1.00 66.23 ? 1904 DA  J N1    1 
ATOM   6425 C  C2    . DA  F 3 4   ? -15.265 38.878  35.301  1.00 66.24 ? 1904 DA  J C2    1 
ATOM   6426 N  N3    . DA  F 3 4   ? -14.470 39.737  34.658  1.00 66.19 ? 1904 DA  J N3    1 
ATOM   6427 C  C4    . DA  F 3 4   ? -13.846 39.136  33.621  1.00 66.43 ? 1904 DA  J C4    1 
ATOM   6428 P  P     . DC  F 3 5   ? -8.630  44.027  32.078  1.00 52.08 ? 1905 DC  J P     1 
ATOM   6429 O  OP1   . DC  F 3 5   ? -8.098  43.230  30.948  1.00 52.47 ? 1905 DC  J OP1   1 
ATOM   6430 O  OP2   . DC  F 3 5   ? -7.763  44.300  33.249  1.00 52.37 ? 1905 DC  J OP2   1 
ATOM   6431 O  "O5'" . DC  F 3 5   ? -9.198  45.411  31.523  1.00 48.06 ? 1905 DC  J "O5'" 1 
ATOM   6432 C  "C5'" . DC  F 3 5   ? -9.481  45.614  30.141  1.00 43.42 ? 1905 DC  J "C5'" 1 
ATOM   6433 C  "C4'" . DC  F 3 5   ? -8.788  46.844  29.579  1.00 39.30 ? 1905 DC  J "C4'" 1 
ATOM   6434 O  "O4'" . DC  F 3 5   ? -9.313  48.030  30.226  1.00 37.37 ? 1905 DC  J "O4'" 1 
ATOM   6435 C  "C3'" . DC  F 3 5   ? -7.278  46.918  29.759  1.00 36.40 ? 1905 DC  J "C3'" 1 
ATOM   6436 O  "O3'" . DC  F 3 5   ? -6.761  47.562  28.592  1.00 35.31 ? 1905 DC  J "O3'" 1 
ATOM   6437 C  "C2'" . DC  F 3 5   ? -7.135  47.709  31.059  1.00 35.16 ? 1905 DC  J "C2'" 1 
ATOM   6438 C  "C1'" . DC  F 3 5   ? -8.305  48.680  30.962  1.00 34.45 ? 1905 DC  J "C1'" 1 
ATOM   6439 N  N1    . DC  F 3 5   ? -8.987  49.094  32.214  1.00 33.35 ? 1905 DC  J N1    1 
ATOM   6440 C  C2    . DC  F 3 5   ? -9.093  50.453  32.494  1.00 32.77 ? 1905 DC  J C2    1 
ATOM   6441 O  O2    . DC  F 3 5   ? -8.600  51.253  31.714  1.00 33.10 ? 1905 DC  J O2    1 
ATOM   6442 N  N3    . DC  F 3 5   ? -9.721  50.862  33.615  1.00 32.83 ? 1905 DC  J N3    1 
ATOM   6443 C  C4    . DC  F 3 5   ? -10.254 49.965  34.450  1.00 33.37 ? 1905 DC  J C4    1 
ATOM   6444 N  N4    . DC  F 3 5   ? -10.871 50.432  35.542  1.00 32.90 ? 1905 DC  J N4    1 
ATOM   6445 C  C5    . DC  F 3 5   ? -10.173 48.559  34.187  1.00 32.79 ? 1905 DC  J C5    1 
ATOM   6446 C  C6    . DC  F 3 5   ? -9.539  48.171  33.066  1.00 32.98 ? 1905 DC  J C6    1 
HETATM 6447 P  P     . 8OG F 3 6   ? -5.209  47.638  28.217  1.00 33.78 ? 1906 8OG J P     1 
HETATM 6448 O  OP1   . 8OG F 3 6   ? -5.107  48.206  26.835  1.00 36.12 ? 1906 8OG J OP1   1 
HETATM 6449 O  OP2   . 8OG F 3 6   ? -4.520  46.345  28.534  1.00 35.85 ? 1906 8OG J OP2   1 
HETATM 6450 O  "O5'" . 8OG F 3 6   ? -4.653  48.712  29.246  1.00 34.15 ? 1906 8OG J "O5'" 1 
HETATM 6451 C  "C5'" . 8OG F 3 6   ? -4.397  50.063  28.877  1.00 33.36 ? 1906 8OG J "C5'" 1 
HETATM 6452 C  "C4'" . 8OG F 3 6   ? -4.140  50.674  30.210  1.00 32.68 ? 1906 8OG J "C4'" 1 
HETATM 6453 O  "O4'" . 8OG F 3 6   ? -5.200  50.650  31.178  1.00 31.99 ? 1906 8OG J "O4'" 1 
HETATM 6454 C  "C3'" . 8OG F 3 6   ? -2.949  50.862  30.743  1.00 32.75 ? 1906 8OG J "C3'" 1 
HETATM 6455 O  "O3'" . 8OG F 3 6   ? -2.336  51.858  30.400  1.00 32.59 ? 1906 8OG J "O3'" 1 
HETATM 6456 C  "C2'" . 8OG F 3 6   ? -2.979  50.408  32.184  1.00 33.01 ? 1906 8OG J "C2'" 1 
HETATM 6457 C  "C1'" . 8OG F 3 6   ? -4.460  50.364  32.390  1.00 33.06 ? 1906 8OG J "C1'" 1 
HETATM 6458 N  N9    . 8OG F 3 6   ? -5.145  49.997  33.496  1.00 33.28 ? 1906 8OG J N9    1 
HETATM 6459 C  C8    . 8OG F 3 6   ? -5.390  48.754  33.879  1.00 33.19 ? 1906 8OG J C8    1 
HETATM 6460 N  N7    . 8OG F 3 6   ? -6.169  48.686  34.953  1.00 33.13 ? 1906 8OG J N7    1 
HETATM 6461 C  C5    . 8OG F 3 6   ? -6.465  49.957  35.225  1.00 32.72 ? 1906 8OG J C5    1 
HETATM 6462 C  C6    . 8OG F 3 6   ? -7.260  50.613  36.255  1.00 32.89 ? 1906 8OG J C6    1 
HETATM 6463 O  O6    . 8OG F 3 6   ? -7.849  49.937  37.123  1.00 32.85 ? 1906 8OG J O6    1 
HETATM 6464 N  N1    . 8OG F 3 6   ? -7.312  51.953  36.203  1.00 33.46 ? 1906 8OG J N1    1 
HETATM 6465 C  C2    . 8OG F 3 6   ? -6.683  52.709  35.275  1.00 33.50 ? 1906 8OG J C2    1 
HETATM 6466 N  N2    . 8OG F 3 6   ? -6.824  54.055  35.348  1.00 33.17 ? 1906 8OG J N2    1 
HETATM 6467 N  N3    . 8OG F 3 6   ? -5.924  52.175  34.297  1.00 33.36 ? 1906 8OG J N3    1 
HETATM 6468 C  C4    . 8OG F 3 6   ? -5.800  50.850  34.238  1.00 33.24 ? 1906 8OG J C4    1 
HETATM 6469 O  O8    . 8OG F 3 6   ? -4.897  47.719  33.317  1.00 33.39 ? 1906 8OG J O8    1 
ATOM   6470 P  P     . DC  F 3 7   ? -0.774  52.089  30.583  1.00 32.24 ? 1907 DC  J P     1 
ATOM   6471 O  OP1   . DC  F 3 7   ? -0.525  53.537  30.480  1.00 32.39 ? 1907 DC  J OP1   1 
ATOM   6472 O  OP2   . DC  F 3 7   ? -0.186  51.135  29.634  1.00 33.75 ? 1907 DC  J OP2   1 
ATOM   6473 O  "O5'" . DC  F 3 7   ? -0.344  51.572  32.031  1.00 34.13 ? 1907 DC  J "O5'" 1 
ATOM   6474 C  "C5'" . DC  F 3 7   ? 0.312   52.405  32.966  1.00 35.71 ? 1907 DC  J "C5'" 1 
ATOM   6475 C  "C4'" . DC  F 3 7   ? -0.657  53.354  33.661  1.00 36.12 ? 1907 DC  J "C4'" 1 
ATOM   6476 O  "O4'" . DC  F 3 7   ? -1.840  52.625  34.038  1.00 36.50 ? 1907 DC  J "O4'" 1 
ATOM   6477 C  "C3'" . DC  F 3 7   ? -0.122  53.938  34.958  1.00 36.22 ? 1907 DC  J "C3'" 1 
ATOM   6478 O  "O3'" . DC  F 3 7   ? 0.324   55.269  34.732  1.00 36.36 ? 1907 DC  J "O3'" 1 
ATOM   6479 C  "C2'" . DC  F 3 7   ? -1.281  53.895  35.946  1.00 36.00 ? 1907 DC  J "C2'" 1 
ATOM   6480 C  "C1'" . DC  F 3 7   ? -2.365  53.100  35.258  1.00 35.32 ? 1907 DC  J "C1'" 1 
ATOM   6481 N  N1    . DC  F 3 7   ? -2.915  51.954  36.058  1.00 34.52 ? 1907 DC  J N1    1 
ATOM   6482 C  C2    . DC  F 3 7   ? -3.727  52.264  37.144  1.00 33.77 ? 1907 DC  J C2    1 
ATOM   6483 O  O2    . DC  F 3 7   ? -3.918  53.437  37.413  1.00 34.50 ? 1907 DC  J O2    1 
ATOM   6484 N  N3    . DC  F 3 7   ? -4.273  51.286  37.889  1.00 33.99 ? 1907 DC  J N3    1 
ATOM   6485 C  C4    . DC  F 3 7   ? -4.040  50.012  37.584  1.00 34.93 ? 1907 DC  J C4    1 
ATOM   6486 N  N4    . DC  F 3 7   ? -4.622  49.096  38.365  1.00 34.49 ? 1907 DC  J N4    1 
ATOM   6487 C  C5    . DC  F 3 7   ? -3.212  49.646  36.472  1.00 34.52 ? 1907 DC  J C5    1 
ATOM   6488 C  C6    . DC  F 3 7   ? -2.672  50.641  35.744  1.00 34.84 ? 1907 DC  J C6    1 
ATOM   6489 P  P     . DT  F 3 8   ? 1.876   55.603  34.907  1.00 36.70 ? 1908 DT  J P     1 
ATOM   6490 O  OP1   . DT  F 3 8   ? 2.154   56.939  34.324  1.00 36.23 ? 1908 DT  J OP1   1 
ATOM   6491 O  OP2   . DT  F 3 8   ? 2.666   54.415  34.502  1.00 36.83 ? 1908 DT  J OP2   1 
ATOM   6492 O  "O5'" . DT  F 3 8   ? 1.954   55.735  36.486  1.00 35.02 ? 1908 DT  J "O5'" 1 
ATOM   6493 C  "C5'" . DT  F 3 8   ? 1.260   56.810  37.081  1.00 33.45 ? 1908 DT  J "C5'" 1 
ATOM   6494 C  "C4'" . DT  F 3 8   ? 0.845   56.433  38.481  1.00 32.36 ? 1908 DT  J "C4'" 1 
ATOM   6495 O  "O4'" . DT  F 3 8   ? -0.043  55.294  38.420  1.00 31.13 ? 1908 DT  J "O4'" 1 
ATOM   6496 C  "C3'" . DT  F 3 8   ? 1.981   55.978  39.389  1.00 31.64 ? 1908 DT  J "C3'" 1 
ATOM   6497 O  "O3'" . DT  F 3 8   ? 2.564   57.079  40.080  1.00 30.91 ? 1908 DT  J "O3'" 1 
ATOM   6498 C  "C2'" . DT  F 3 8   ? 1.277   54.989  40.313  1.00 31.73 ? 1908 DT  J "C2'" 1 
ATOM   6499 C  "C1'" . DT  F 3 8   ? -0.130  54.821  39.737  1.00 30.03 ? 1908 DT  J "C1'" 1 
ATOM   6500 N  N1    . DT  F 3 8   ? -0.564  53.399  39.777  1.00 29.06 ? 1908 DT  J N1    1 
ATOM   6501 C  C2    . DT  F 3 8   ? -1.587  53.039  40.607  1.00 29.01 ? 1908 DT  J C2    1 
ATOM   6502 O  O2    . DT  F 3 8   ? -2.202  53.833  41.293  1.00 29.72 ? 1908 DT  J O2    1 
ATOM   6503 N  N3    . DT  F 3 8   ? -1.906  51.713  40.585  1.00 28.55 ? 1908 DT  J N3    1 
ATOM   6504 C  C4    . DT  F 3 8   ? -1.288  50.729  39.859  1.00 28.61 ? 1908 DT  J C4    1 
ATOM   6505 O  O4    . DT  F 3 8   ? -1.663  49.574  39.922  1.00 29.41 ? 1908 DT  J O4    1 
ATOM   6506 C  C5    . DT  F 3 8   ? -0.207  51.149  39.017  1.00 29.25 ? 1908 DT  J C5    1 
ATOM   6507 C  C7    . DT  F 3 8   ? 0.536   50.150  38.169  1.00 29.12 ? 1908 DT  J C7    1 
ATOM   6508 C  C6    . DT  F 3 8   ? 0.106   52.453  39.026  1.00 29.29 ? 1908 DT  J C6    1 
ATOM   6509 P  P     . DA  F 3 9   ? 3.658   56.835  41.219  1.00 30.39 ? 1909 DA  J P     1 
ATOM   6510 O  OP1   . DA  F 3 9   ? 4.394   58.102  41.399  1.00 30.06 ? 1909 DA  J OP1   1 
ATOM   6511 O  OP2   . DA  F 3 9   ? 4.360   55.560  40.939  1.00 30.07 ? 1909 DA  J OP2   1 
ATOM   6512 O  "O5'" . DA  F 3 9   ? 2.767   56.630  42.532  1.00 31.00 ? 1909 DA  J "O5'" 1 
ATOM   6513 C  "C5'" . DA  F 3 9   ? 1.727   57.565  42.847  1.00 31.55 ? 1909 DA  J "C5'" 1 
ATOM   6514 C  "C4'" . DA  F 3 9   ? 1.136   57.304  44.216  1.00 31.54 ? 1909 DA  J "C4'" 1 
ATOM   6515 O  "O4'" . DA  F 3 9   ? 0.303   56.117  44.149  1.00 30.56 ? 1909 DA  J "O4'" 1 
ATOM   6516 C  "C3'" . DA  F 3 9   ? 2.212   57.059  45.263  1.00 31.97 ? 1909 DA  J "C3'" 1 
ATOM   6517 O  "O3'" . DA  F 3 9   ? 1.894   57.664  46.503  1.00 33.53 ? 1909 DA  J "O3'" 1 
ATOM   6518 C  "C2'" . DA  F 3 9   ? 2.263   55.539  45.354  1.00 31.56 ? 1909 DA  J "C2'" 1 
ATOM   6519 C  "C1'" . DA  F 3 9   ? 0.845   55.124  44.994  1.00 30.72 ? 1909 DA  J "C1'" 1 
ATOM   6520 N  N9    . DA  F 3 9   ? 0.786   53.826  44.329  1.00 30.58 ? 1909 DA  J N9    1 
ATOM   6521 C  C8    . DA  F 3 9   ? 1.511   53.358  43.264  1.00 30.36 ? 1909 DA  J C8    1 
ATOM   6522 N  N7    . DA  F 3 9   ? 1.207   52.130  42.902  1.00 30.17 ? 1909 DA  J N7    1 
ATOM   6523 C  C5    . DA  F 3 9   ? 0.218   51.769  43.799  1.00 30.17 ? 1909 DA  J C5    1 
ATOM   6524 C  C6    . DA  F 3 9   ? -0.536  50.591  43.975  1.00 30.31 ? 1909 DA  J C6    1 
ATOM   6525 N  N6    . DA  F 3 9   ? -0.416  49.491  43.225  1.00 29.84 ? 1909 DA  J N6    1 
ATOM   6526 N  N1    . DA  F 3 9   ? -1.437  50.588  44.981  1.00 30.12 ? 1909 DA  J N1    1 
ATOM   6527 C  C2    . DA  F 3 9   ? -1.578  51.673  45.748  1.00 30.11 ? 1909 DA  J C2    1 
ATOM   6528 N  N3    . DA  F 3 9   ? -0.933  52.833  45.682  1.00 29.75 ? 1909 DA  J N3    1 
ATOM   6529 C  C4    . DA  F 3 9   ? -0.047  52.805  44.681  1.00 30.33 ? 1909 DA  J C4    1 
ATOM   6530 P  P     . DC  F 3 10  ? 3.021   57.756  47.647  1.00 35.39 ? 1910 DC  J P     1 
ATOM   6531 O  OP1   . DC  F 3 10  ? 2.925   59.126  48.196  1.00 35.21 ? 1910 DC  J OP1   1 
ATOM   6532 O  OP2   . DC  F 3 10  ? 4.314   57.246  47.118  1.00 34.16 ? 1910 DC  J OP2   1 
ATOM   6533 O  "O5'" . DC  F 3 10  ? 2.493   56.732  48.762  1.00 35.80 ? 1910 DC  J "O5'" 1 
ATOM   6534 C  "C5'" . DC  F 3 10  ? 1.136   56.783  49.241  1.00 36.59 ? 1910 DC  J "C5'" 1 
ATOM   6535 C  "C4'" . DC  F 3 10  ? 0.750   55.455  49.866  1.00 37.35 ? 1910 DC  J "C4'" 1 
ATOM   6536 O  "O4'" . DC  F 3 10  ? 0.692   54.432  48.830  1.00 36.98 ? 1910 DC  J "O4'" 1 
ATOM   6537 C  "C3'" . DC  F 3 10  ? 1.738   54.958  50.933  1.00 38.18 ? 1910 DC  J "C3'" 1 
ATOM   6538 O  "O3'" . DC  F 3 10  ? 1.073   54.777  52.194  1.00 39.54 ? 1910 DC  J "O3'" 1 
ATOM   6539 C  "C2'" . DC  F 3 10  ? 2.300   53.656  50.350  1.00 37.63 ? 1910 DC  J "C2'" 1 
ATOM   6540 C  "C1'" . DC  F 3 10  ? 1.224   53.227  49.350  1.00 36.90 ? 1910 DC  J "C1'" 1 
ATOM   6541 N  N1    . DC  F 3 10  ? 1.689   52.321  48.214  1.00 36.38 ? 1910 DC  J N1    1 
ATOM   6542 C  C2    . DC  F 3 10  ? 1.013   51.114  47.968  1.00 36.36 ? 1910 DC  J C2    1 
ATOM   6543 O  O2    . DC  F 3 10  ? 0.054   50.791  48.674  1.00 37.06 ? 1910 DC  J O2    1 
ATOM   6544 N  N3    . DC  F 3 10  ? 1.418   50.307  46.960  1.00 36.03 ? 1910 DC  J N3    1 
ATOM   6545 C  C4    . DC  F 3 10  ? 2.449   50.644  46.197  1.00 36.25 ? 1910 DC  J C4    1 
ATOM   6546 N  N4    . DC  F 3 10  ? 2.781   49.790  45.231  1.00 35.85 ? 1910 DC  J N4    1 
ATOM   6547 C  C5    . DC  F 3 10  ? 3.165   51.861  46.414  1.00 36.52 ? 1910 DC  J C5    1 
ATOM   6548 C  C6    . DC  F 3 10  ? 2.755   52.655  47.422  1.00 36.68 ? 1910 DC  J C6    1 
ATOM   6549 P  P     . DC  F 3 11  ? 1.866   54.438  53.550  1.00 42.00 ? 1911 DC  J P     1 
ATOM   6550 O  OP1   . DC  F 3 11  ? 1.230   55.241  54.616  1.00 42.56 ? 1911 DC  J OP1   1 
ATOM   6551 O  OP2   . DC  F 3 11  ? 3.334   54.540  53.336  1.00 41.65 ? 1911 DC  J OP2   1 
ATOM   6552 O  "O5'" . DC  F 3 11  ? 1.512   52.898  53.812  1.00 41.11 ? 1911 DC  J "O5'" 1 
ATOM   6553 C  "C5'" . DC  F 3 11  ? 0.194   52.381  53.576  1.00 40.23 ? 1911 DC  J "C5'" 1 
ATOM   6554 C  "C4'" . DC  F 3 11  ? 0.199   50.862  53.613  1.00 39.40 ? 1911 DC  J "C4'" 1 
ATOM   6555 O  "O4'" . DC  F 3 11  ? 0.649   50.326  52.338  1.00 39.11 ? 1911 DC  J "O4'" 1 
ATOM   6556 C  "C3'" . DC  F 3 11  ? 1.131   50.236  54.637  1.00 38.80 ? 1911 DC  J "C3'" 1 
ATOM   6557 O  "O3'" . DC  F 3 11  ? 0.533   49.059  55.114  1.00 39.69 ? 1911 DC  J "O3'" 1 
ATOM   6558 C  "C2'" . DC  F 3 11  ? 2.381   49.938  53.820  1.00 38.34 ? 1911 DC  J "C2'" 1 
ATOM   6559 C  "C1'" . DC  F 3 11  ? 1.739   49.444  52.532  1.00 37.67 ? 1911 DC  J "C1'" 1 
ATOM   6560 N  N1    . DC  F 3 11  ? 2.588   49.431  51.272  1.00 37.16 ? 1911 DC  J N1    1 
ATOM   6561 C  C2    . DC  F 3 11  ? 2.435   48.386  50.343  1.00 36.65 ? 1911 DC  J C2    1 
ATOM   6562 O  O2    . DC  F 3 11  ? 1.623   47.481  50.572  1.00 36.70 ? 1911 DC  J O2    1 
ATOM   6563 N  N3    . DC  F 3 11  ? 3.188   48.383  49.214  1.00 36.11 ? 1911 DC  J N3    1 
ATOM   6564 C  C4    . DC  F 3 11  ? 4.063   49.359  48.985  1.00 36.43 ? 1911 DC  J C4    1 
ATOM   6565 N  N4    . DC  F 3 11  ? 4.785   49.311  47.865  1.00 36.39 ? 1911 DC  J N4    1 
ATOM   6566 C  C5    . DC  F 3 11  ? 4.237   50.432  49.904  1.00 36.74 ? 1911 DC  J C5    1 
ATOM   6567 C  C6    . DC  F 3 11  ? 3.492   50.428  51.017  1.00 36.86 ? 1911 DC  J C6    1 
ATOM   6568 P  P     . DA  F 3 12  ? 0.955   48.464  56.528  1.00 39.77 ? 1912 DA  J P     1 
ATOM   6569 O  OP1   . DA  F 3 12  ? 0.145   49.215  57.510  1.00 39.57 ? 1912 DA  J OP1   1 
ATOM   6570 O  OP2   . DA  F 3 12  ? 2.430   48.424  56.608  1.00 38.72 ? 1912 DA  J OP2   1 
ATOM   6571 O  "O5'" . DA  F 3 12  ? 0.452   46.941  56.505  1.00 42.61 ? 1912 DA  J "O5'" 1 
ATOM   6572 C  "C5'" . DA  F 3 12  ? 0.026   46.263  55.312  1.00 45.05 ? 1912 DA  J "C5'" 1 
ATOM   6573 C  "C4'" . DA  F 3 12  ? 0.685   44.899  55.164  1.00 46.54 ? 1912 DA  J "C4'" 1 
ATOM   6574 O  "O4'" . DA  F 3 12  ? 1.438   44.891  53.915  1.00 46.45 ? 1912 DA  J "O4'" 1 
ATOM   6575 C  "C3'" . DA  F 3 12  ? 1.688   44.509  56.253  1.00 47.90 ? 1912 DA  J "C3'" 1 
ATOM   6576 O  "O3'" . DA  F 3 12  ? 1.774   43.097  56.398  1.00 51.16 ? 1912 DA  J "O3'" 1 
ATOM   6577 C  "C2'" . DA  F 3 12  ? 2.957   45.107  55.675  1.00 47.18 ? 1912 DA  J "C2'" 1 
ATOM   6578 C  "C1'" . DA  F 3 12  ? 2.802   44.679  54.221  1.00 46.28 ? 1912 DA  J "C1'" 1 
ATOM   6579 N  N9    . DA  F 3 12  ? 3.671   45.406  53.303  1.00 45.90 ? 1912 DA  J N9    1 
ATOM   6580 C  C8    . DA  F 3 12  ? 4.056   46.720  53.363  1.00 45.72 ? 1912 DA  J C8    1 
ATOM   6581 N  N7    . DA  F 3 12  ? 4.862   47.080  52.396  1.00 45.47 ? 1912 DA  J N7    1 
ATOM   6582 C  C5    . DA  F 3 12  ? 5.022   45.921  51.661  1.00 45.59 ? 1912 DA  J C5    1 
ATOM   6583 C  C6    . DA  F 3 12  ? 5.759   45.636  50.500  1.00 45.77 ? 1912 DA  J C6    1 
ATOM   6584 N  N6    . DA  F 3 12  ? 6.495   46.556  49.871  1.00 45.85 ? 1912 DA  J N6    1 
ATOM   6585 N  N1    . DA  F 3 12  ? 5.699   44.376  50.011  1.00 45.79 ? 1912 DA  J N1    1 
ATOM   6586 C  C2    . DA  F 3 12  ? 4.953   43.466  50.647  1.00 45.73 ? 1912 DA  J C2    1 
ATOM   6587 N  N3    . DA  F 3 12  ? 4.220   43.617  51.750  1.00 45.84 ? 1912 DA  J N3    1 
ATOM   6588 C  C4    . DA  F 3 12  ? 4.299   44.878  52.206  1.00 45.74 ? 1912 DA  J C4    1 
ATOM   6589 P  P     . DT  F 3 13  ? 2.671   42.391  57.532  1.00 54.50 ? 1913 DT  J P     1 
ATOM   6590 O  OP1   . DT  F 3 13  ? 1.747   41.918  58.589  1.00 54.02 ? 1913 DT  J OP1   1 
ATOM   6591 O  OP2   . DT  F 3 13  ? 3.818   43.253  57.914  1.00 53.67 ? 1913 DT  J OP2   1 
ATOM   6592 O  "O5'" . DT  F 3 13  ? 3.280   41.133  56.745  1.00 56.29 ? 1913 DT  J "O5'" 1 
ATOM   6593 C  "C5'" . DT  F 3 13  ? 2.615   40.465  55.662  1.00 58.21 ? 1913 DT  J "C5'" 1 
ATOM   6594 C  "C4'" . DT  F 3 13  ? 3.632   39.860  54.705  1.00 59.85 ? 1913 DT  J "C4'" 1 
ATOM   6595 O  "O4'" . DT  F 3 13  ? 4.115   40.888  53.798  1.00 60.12 ? 1913 DT  J "O4'" 1 
ATOM   6596 C  "C3'" . DT  F 3 13  ? 4.886   39.264  55.350  1.00 61.03 ? 1913 DT  J "C3'" 1 
ATOM   6597 O  "O3'" . DT  F 3 13  ? 4.642   37.899  55.737  1.00 63.36 ? 1913 DT  J "O3'" 1 
ATOM   6598 C  "C2'" . DT  F 3 13  ? 5.946   39.436  54.262  1.00 60.62 ? 1913 DT  J "C2'" 1 
ATOM   6599 C  "C1'" . DT  F 3 13  ? 5.436   40.568  53.377  1.00 59.91 ? 1913 DT  J "C1'" 1 
ATOM   6600 N  N1    . DT  F 3 13  ? 6.318   41.803  53.402  1.00 59.61 ? 1913 DT  J N1    1 
ATOM   6601 C  C2    . DT  F 3 13  ? 7.152   42.058  52.329  1.00 59.28 ? 1913 DT  J C2    1 
ATOM   6602 O  O2    . DT  F 3 13  ? 7.219   41.339  51.349  1.00 59.23 ? 1913 DT  J O2    1 
ATOM   6603 N  N3    . DT  F 3 13  ? 7.904   43.204  52.422  1.00 58.88 ? 1913 DT  J N3    1 
ATOM   6604 C  C4    . DT  F 3 13  ? 7.920   44.098  53.471  1.00 59.08 ? 1913 DT  J C4    1 
ATOM   6605 O  O4    . DT  F 3 13  ? 8.641   45.090  53.453  1.00 58.96 ? 1913 DT  J O4    1 
ATOM   6606 C  C5    . DT  F 3 13  ? 7.039   43.780  54.571  1.00 59.21 ? 1913 DT  J C5    1 
ATOM   6607 C  C7    . DT  F 3 13  ? 6.976   44.684  55.766  1.00 59.32 ? 1913 DT  J C7    1 
ATOM   6608 C  C6    . DT  F 3 13  ? 6.291   42.664  54.488  1.00 59.40 ? 1913 DT  J C6    1 
ATOM   6609 P  P     . DC  F 3 14  ? 5.758   36.736  55.819  1.00 66.22 ? 1914 DC  J P     1 
ATOM   6610 O  OP1   . DC  F 3 14  ? 5.819   36.126  54.469  1.00 66.26 ? 1914 DC  J OP1   1 
ATOM   6611 O  OP2   . DC  F 3 14  ? 5.434   35.887  56.987  1.00 66.21 ? 1914 DC  J OP2   1 
ATOM   6612 O  "O5'" . DC  F 3 14  ? 7.148   37.460  56.174  1.00 67.35 ? 1914 DC  J "O5'" 1 
ATOM   6613 C  "C5'" . DC  F 3 14  ? 8.394   36.762  56.068  1.00 68.49 ? 1914 DC  J "C5'" 1 
ATOM   6614 C  "C4'" . DC  F 3 14  ? 8.896   36.720  54.628  1.00 69.53 ? 1914 DC  J "C4'" 1 
ATOM   6615 O  "O4'" . DC  F 3 14  ? 8.581   37.976  53.964  1.00 69.91 ? 1914 DC  J "O4'" 1 
ATOM   6616 C  "C3'" . DC  F 3 14  ? 10.399  36.498  54.475  1.00 70.22 ? 1914 DC  J "C3'" 1 
ATOM   6617 O  "O3'" . DC  F 3 14  ? 10.670  35.163  54.012  1.00 71.42 ? 1914 DC  J "O3'" 1 
ATOM   6618 C  "C2'" . DC  F 3 14  ? 10.857  37.542  53.456  1.00 70.20 ? 1914 DC  J "C2'" 1 
ATOM   6619 C  "C1'" . DC  F 3 14  ? 9.688   38.503  53.258  1.00 69.95 ? 1914 DC  J "C1'" 1 
ATOM   6620 N  N1    . DC  F 3 14  ? 10.006  39.912  53.716  1.00 69.86 ? 1914 DC  J N1    1 
ATOM   6621 C  C2    . DC  F 3 14  ? 10.753  40.755  52.874  1.00 69.80 ? 1914 DC  J C2    1 
ATOM   6622 O  O2    . DC  F 3 14  ? 11.139  40.348  51.768  1.00 69.57 ? 1914 DC  J O2    1 
ATOM   6623 N  N3    . DC  F 3 14  ? 11.039  42.016  53.294  1.00 69.67 ? 1914 DC  J N3    1 
ATOM   6624 C  C4    . DC  F 3 14  ? 10.626  42.455  54.483  1.00 69.73 ? 1914 DC  J C4    1 
ATOM   6625 N  N4    . DC  F 3 14  ? 10.942  43.708  54.830  1.00 69.57 ? 1914 DC  J N4    1 
ATOM   6626 C  C5    . DC  F 3 14  ? 9.867   41.616  55.356  1.00 69.69 ? 1914 DC  J C5    1 
ATOM   6627 C  C6    . DC  F 3 14  ? 9.587   40.369  54.942  1.00 69.80 ? 1914 DC  J C6    1 
ATOM   6628 P  P     . DC  F 3 15  ? 11.828  34.238  54.638  1.00 72.51 ? 1915 DC  J P     1 
ATOM   6629 O  OP1   . DC  F 3 15  ? 11.159  33.042  55.196  1.00 72.21 ? 1915 DC  J OP1   1 
ATOM   6630 O  OP2   . DC  F 3 15  ? 12.669  35.079  55.517  1.00 72.36 ? 1915 DC  J OP2   1 
ATOM   6631 O  "O5'" . DC  F 3 15  ? 12.735  33.775  53.395  1.00 73.77 ? 1915 DC  J "O5'" 1 
ATOM   6632 C  "C5'" . DC  F 3 15  ? 12.853  34.510  52.166  1.00 75.13 ? 1915 DC  J "C5'" 1 
ATOM   6633 C  "C4'" . DC  F 3 15  ? 14.047  35.458  52.142  1.00 76.05 ? 1915 DC  J "C4'" 1 
ATOM   6634 O  "O4'" . DC  F 3 15  ? 13.668  36.732  52.727  1.00 76.20 ? 1915 DC  J "O4'" 1 
ATOM   6635 C  "C3'" . DC  F 3 15  ? 15.308  35.023  52.896  1.00 76.75 ? 1915 DC  J "C3'" 1 
ATOM   6636 O  "O3'" . DC  F 3 15  ? 16.421  35.060  52.003  1.00 78.42 ? 1915 DC  J "O3'" 1 
ATOM   6637 C  "C2'" . DC  F 3 15  ? 15.447  36.046  54.028  1.00 76.48 ? 1915 DC  J "C2'" 1 
ATOM   6638 C  "C1'" . DC  F 3 15  ? 14.791  37.272  53.396  1.00 76.20 ? 1915 DC  J "C1'" 1 
ATOM   6639 N  N1    . DC  F 3 15  ? 14.338  38.425  54.286  1.00 76.07 ? 1915 DC  J N1    1 
ATOM   6640 C  C2    . DC  F 3 15  ? 14.099  39.680  53.683  1.00 76.07 ? 1915 DC  J C2    1 
ATOM   6641 O  O2    . DC  F 3 15  ? 14.261  39.823  52.463  1.00 76.06 ? 1915 DC  J O2    1 
ATOM   6642 N  N3    . DC  F 3 15  ? 13.695  40.729  54.445  1.00 75.83 ? 1915 DC  J N3    1 
ATOM   6643 C  C4    . DC  F 3 15  ? 13.521  40.573  55.754  1.00 75.87 ? 1915 DC  J C4    1 
ATOM   6644 N  N4    . DC  F 3 15  ? 13.123  41.645  56.444  1.00 75.84 ? 1915 DC  J N4    1 
ATOM   6645 C  C5    . DC  F 3 15  ? 13.754  39.315  56.397  1.00 75.96 ? 1915 DC  J C5    1 
ATOM   6646 C  C6    . DC  F 3 15  ? 14.154  38.278  55.640  1.00 75.95 ? 1915 DC  J C6    1 
ATOM   6647 P  P     . DA  F 3 16  ? 17.773  34.246  52.279  1.00 80.19 ? 1916 DA  J P     1 
ATOM   6648 O  OP1   . DA  F 3 16  ? 17.943  33.279  51.170  1.00 80.11 ? 1916 DA  J OP1   1 
ATOM   6649 O  OP2   . DA  F 3 16  ? 17.768  33.774  53.684  1.00 80.21 ? 1916 DA  J OP2   1 
ATOM   6650 O  "O5'" . DA  F 3 16  ? 18.898  35.379  52.157  1.00 81.43 ? 1916 DA  J "O5'" 1 
ATOM   6651 C  "C5'" . DA  F 3 16  ? 19.127  36.059  50.924  1.00 82.67 ? 1916 DA  J "C5'" 1 
ATOM   6652 C  "C4'" . DA  F 3 16  ? 19.767  37.420  51.156  1.00 83.49 ? 1916 DA  J "C4'" 1 
ATOM   6653 O  "O4'" . DA  F 3 16  ? 18.958  38.179  52.096  1.00 83.97 ? 1916 DA  J "O4'" 1 
ATOM   6654 C  "C3'" . DA  F 3 16  ? 21.193  37.385  51.718  1.00 83.92 ? 1916 DA  J "C3'" 1 
ATOM   6655 O  "O3'" . DA  F 3 16  ? 22.080  38.130  50.857  1.00 83.84 ? 1916 DA  J "O3'" 1 
ATOM   6656 C  "C2'" . DA  F 3 16  ? 21.057  37.982  53.122  1.00 84.18 ? 1916 DA  J "C2'" 1 
ATOM   6657 C  "C1'" . DA  F 3 16  ? 19.794  38.834  53.030  1.00 84.61 ? 1916 DA  J "C1'" 1 
ATOM   6658 N  N9    . DA  F 3 16  ? 19.056  38.997  54.286  1.00 84.94 ? 1916 DA  J N9    1 
ATOM   6659 C  C8    . DA  F 3 16  ? 18.810  38.041  55.239  1.00 85.08 ? 1916 DA  J C8    1 
ATOM   6660 N  N7    . DA  F 3 16  ? 18.115  38.478  56.265  1.00 85.20 ? 1916 DA  J N7    1 
ATOM   6661 C  C5    . DA  F 3 16  ? 17.881  39.814  55.968  1.00 85.27 ? 1916 DA  J C5    1 
ATOM   6662 C  C6    . DA  F 3 16  ? 17.194  40.845  56.658  1.00 85.12 ? 1916 DA  J C6    1 
ATOM   6663 N  N6    . DA  F 3 16  ? 16.593  40.666  57.840  1.00 84.97 ? 1916 DA  J N6    1 
ATOM   6664 N  N1    . DA  F 3 16  ? 17.149  42.072  56.084  1.00 85.03 ? 1916 DA  J N1    1 
ATOM   6665 C  C2    . DA  F 3 16  ? 17.753  42.251  54.897  1.00 85.02 ? 1916 DA  J C2    1 
ATOM   6666 N  N3    . DA  F 3 16  ? 18.426  41.362  54.158  1.00 85.08 ? 1916 DA  J N3    1 
ATOM   6667 C  C4    . DA  F 3 16  ? 18.456  40.150  54.750  1.00 85.15 ? 1916 DA  J C4    1 
ATOM   6668 P  P     . DA  F 3 17  ? 23.667  38.237  51.084  1.00 83.45 ? 1917 DA  J P     1 
ATOM   6669 O  OP1   . DA  F 3 17  ? 24.281  38.374  49.745  1.00 83.27 ? 1917 DA  J OP1   1 
ATOM   6670 O  OP2   . DA  F 3 17  ? 24.088  37.121  51.963  1.00 83.43 ? 1917 DA  J OP2   1 
ATOM   6671 O  "O5'" . DA  F 3 17  ? 23.851  39.619  51.894  1.00 83.13 ? 1917 DA  J "O5'" 1 
ATOM   6672 C  "C5'" . DA  F 3 17  ? 22.965  40.741  51.695  1.00 82.53 ? 1917 DA  J "C5'" 1 
ATOM   6673 C  "C4'" . DA  F 3 17  ? 23.275  41.961  52.563  1.00 82.12 ? 1917 DA  J "C4'" 1 
ATOM   6674 O  "O4'" . DA  F 3 17  ? 22.709  41.810  53.902  1.00 81.92 ? 1917 DA  J "O4'" 1 
ATOM   6675 C  "C3'" . DA  F 3 17  ? 24.758  42.300  52.775  1.00 81.87 ? 1917 DA  J "C3'" 1 
ATOM   6676 O  "O3'" . DA  F 3 17  ? 25.029  43.650  52.377  1.00 81.51 ? 1917 DA  J "O3'" 1 
ATOM   6677 C  "C2'" . DA  F 3 17  ? 24.947  42.105  54.278  1.00 81.82 ? 1917 DA  J "C2'" 1 
ATOM   6678 C  "C1'" . DA  F 3 17  ? 23.568  42.516  54.779  1.00 81.81 ? 1917 DA  J "C1'" 1 
ATOM   6679 N  N9    . DA  F 3 17  ? 23.304  42.247  56.200  1.00 81.76 ? 1917 DA  J N9    1 
ATOM   6680 C  C8    . DA  F 3 17  ? 24.050  41.494  57.074  1.00 81.65 ? 1917 DA  J C8    1 
ATOM   6681 N  N7    . DA  F 3 17  ? 23.565  41.456  58.294  1.00 81.62 ? 1917 DA  J N7    1 
ATOM   6682 C  C5    . DA  F 3 17  ? 22.427  42.244  58.227  1.00 81.76 ? 1917 DA  J C5    1 
ATOM   6683 C  C6    . DA  F 3 17  ? 21.456  42.610  59.191  1.00 81.78 ? 1917 DA  J C6    1 
ATOM   6684 N  N6    . DA  F 3 17  ? 21.491  42.203  60.466  1.00 81.67 ? 1917 DA  J N6    1 
ATOM   6685 N  N1    . DA  F 3 17  ? 20.443  43.414  58.790  1.00 81.66 ? 1917 DA  J N1    1 
ATOM   6686 C  C2    . DA  F 3 17  ? 20.409  43.821  57.512  1.00 81.61 ? 1917 DA  J C2    1 
ATOM   6687 N  N3    . DA  F 3 17  ? 21.260  43.544  56.522  1.00 81.59 ? 1917 DA  J N3    1 
ATOM   6688 C  C4    . DA  F 3 17  ? 22.256  42.744  56.945  1.00 81.66 ? 1917 DA  J C4    1 
ATOM   6689 P  P     . DC  F 3 18  ? 26.516  44.256  52.325  1.00 81.28 ? 1918 DC  J P     1 
ATOM   6690 O  OP1   . DC  F 3 18  ? 26.676  44.863  50.984  1.00 81.27 ? 1918 DC  J OP1   1 
ATOM   6691 O  OP2   . DC  F 3 18  ? 27.475  43.228  52.797  1.00 81.05 ? 1918 DC  J OP2   1 
ATOM   6692 O  "O5'" . DC  F 3 18  ? 26.484  45.438  53.410  1.00 80.58 ? 1918 DC  J "O5'" 1 
ATOM   6693 C  "C5'" . DC  F 3 18  ? 27.680  46.145  53.772  1.00 79.76 ? 1918 DC  J "C5'" 1 
ATOM   6694 C  "C4'" . DC  F 3 18  ? 27.375  47.508  54.383  1.00 79.16 ? 1918 DC  J "C4'" 1 
ATOM   6695 O  "O4'" . DC  F 3 18  ? 26.264  47.388  55.311  1.00 78.74 ? 1918 DC  J "O4'" 1 
ATOM   6696 C  "C3'" . DC  F 3 18  ? 28.529  48.144  55.161  1.00 78.82 ? 1918 DC  J "C3'" 1 
ATOM   6697 O  "O3'" . DC  F 3 18  ? 28.986  49.329  54.513  1.00 78.68 ? 1918 DC  J "O3'" 1 
ATOM   6698 C  "C2'" . DC  F 3 18  ? 27.956  48.450  56.545  1.00 78.63 ? 1918 DC  J "C2'" 1 
ATOM   6699 C  "C1'" . DC  F 3 18  ? 26.690  47.603  56.641  1.00 78.38 ? 1918 DC  J "C1'" 1 
ATOM   6700 N  N1    . DC  F 3 18  ? 26.825  46.256  57.324  1.00 78.15 ? 1918 DC  J N1    1 
ATOM   6701 C  C2    . DC  F 3 18  ? 25.722  45.706  58.008  1.00 77.98 ? 1918 DC  J C2    1 
ATOM   6702 O  O2    . DC  F 3 18  ? 24.649  46.324  58.056  1.00 77.76 ? 1918 DC  J O2    1 
ATOM   6703 N  N3    . DC  F 3 18  ? 25.858  44.494  58.612  1.00 78.03 ? 1918 DC  J N3    1 
ATOM   6704 C  C4    . DC  F 3 18  ? 27.019  43.832  58.558  1.00 78.04 ? 1918 DC  J C4    1 
ATOM   6705 N  N4    . DC  F 3 18  ? 27.105  42.645  59.167  1.00 78.00 ? 1918 DC  J N4    1 
ATOM   6706 C  C5    . DC  F 3 18  ? 28.148  44.366  57.869  1.00 77.93 ? 1918 DC  J C5    1 
ATOM   6707 C  C6    . DC  F 3 18  ? 28.008  45.559  57.275  1.00 78.01 ? 1918 DC  J C6    1 
HETATM 6708 P  PG    . DGT G 4 .   ? 2.059   5.271   -1.194  1.00 43.41 ? 414  DGT A PG    1 
HETATM 6709 O  O1G   . DGT G 4 .   ? 3.203   5.847   -0.367  1.00 40.34 ? 414  DGT A O1G   1 
HETATM 6710 O  O2G   . DGT G 4 .   ? 0.680   5.943   -1.187  1.00 42.11 ? 414  DGT A O2G   1 
HETATM 6711 O  O3G   . DGT G 4 .   ? 1.666   4.583   0.114   1.00 40.19 ? 414  DGT A O3G   1 
HETATM 6712 O  O3B   . DGT G 4 .   ? 2.205   3.807   -1.865  1.00 39.04 ? 414  DGT A O3B   1 
HETATM 6713 P  PB    . DGT G 4 .   ? 3.743   3.472   -2.146  1.00 35.13 ? 414  DGT A PB    1 
HETATM 6714 O  O1B   . DGT G 4 .   ? 4.426   4.533   -2.952  1.00 36.97 ? 414  DGT A O1B   1 
HETATM 6715 O  O2B   . DGT G 4 .   ? 3.725   2.193   -2.946  1.00 36.89 ? 414  DGT A O2B   1 
HETATM 6716 O  O3A   . DGT G 4 .   ? 4.357   3.215   -0.677  1.00 35.77 ? 414  DGT A O3A   1 
HETATM 6717 P  PA    . DGT G 4 .   ? 5.904   3.489   -0.375  1.00 34.97 ? 414  DGT A PA    1 
HETATM 6718 O  O1A   . DGT G 4 .   ? 6.258   2.963   0.977   1.00 36.69 ? 414  DGT A O1A   1 
HETATM 6719 O  O2A   . DGT G 4 .   ? 6.199   4.987   -0.359  1.00 38.11 ? 414  DGT A O2A   1 
HETATM 6720 O  "O5'" . DGT G 4 .   ? 6.827   2.665   -1.355  1.00 36.19 ? 414  DGT A "O5'" 1 
HETATM 6721 C  "C5'" . DGT G 4 .   ? 7.459   3.229   -2.504  1.00 35.91 ? 414  DGT A "C5'" 1 
HETATM 6722 C  "C4'" . DGT G 4 .   ? 7.756   2.042   -3.405  1.00 35.87 ? 414  DGT A "C4'" 1 
HETATM 6723 O  "O4'" . DGT G 4 .   ? 8.622   1.159   -2.701  1.00 34.56 ? 414  DGT A "O4'" 1 
HETATM 6724 C  "C3'" . DGT G 4 .   ? 6.516   1.219   -3.714  1.00 35.40 ? 414  DGT A "C3'" 1 
HETATM 6725 O  "O3'" . DGT G 4 .   ? 5.757   1.687   -4.837  1.00 35.76 ? 414  DGT A "O3'" 1 
HETATM 6726 C  "C2'" . DGT G 4 .   ? 7.103   -0.143  -3.924  1.00 36.48 ? 414  DGT A "C2'" 1 
HETATM 6727 C  "C1'" . DGT G 4 .   ? 8.310   -0.180  -3.006  1.00 36.82 ? 414  DGT A "C1'" 1 
HETATM 6728 N  N9    . DGT G 4 .   ? 7.916   -0.908  -1.801  1.00 37.62 ? 414  DGT A N9    1 
HETATM 6729 C  C8    . DGT G 4 .   ? 7.179   -0.469  -0.722  1.00 38.15 ? 414  DGT A C8    1 
HETATM 6730 N  N7    . DGT G 4 .   ? 6.991   -1.388  0.198   1.00 38.11 ? 414  DGT A N7    1 
HETATM 6731 C  C5    . DGT G 4 .   ? 7.615   -2.514  -0.314  1.00 37.84 ? 414  DGT A C5    1 
HETATM 6732 C  C6    . DGT G 4 .   ? 7.753   -3.834  0.198   1.00 38.40 ? 414  DGT A C6    1 
HETATM 6733 O  O6    . DGT G 4 .   ? 7.363   -4.352  1.269   1.00 38.67 ? 414  DGT A O6    1 
HETATM 6734 N  N1    . DGT G 4 .   ? 8.470   -4.630  -0.677  1.00 37.69 ? 414  DGT A N1    1 
HETATM 6735 C  C2    . DGT G 4 .   ? 8.993   -4.243  -1.872  1.00 37.26 ? 414  DGT A C2    1 
HETATM 6736 N  N2    . DGT G 4 .   ? 9.605   -5.156  -2.579  1.00 37.90 ? 414  DGT A N2    1 
HETATM 6737 N  N3    . DGT G 4 .   ? 8.874   -3.025  -2.342  1.00 37.94 ? 414  DGT A N3    1 
HETATM 6738 C  C4    . DGT G 4 .   ? 8.178   -2.221  -1.533  1.00 37.64 ? 414  DGT A C4    1 
HETATM 6739 CA CA    . CA  H 5 .   ? 7.895   6.411   0.304   1.00 37.82 ? 415  CA  A CA    1 
HETATM 6740 CA CA    . CA  I 5 .   ? 4.995   6.408   -1.742  1.00 38.63 ? 416  CA  A CA    1 
HETATM 6741 CA CA    . CA  J 5 .   ? 4.081   2.224   14.877  1.00 60.27 ? 417  CA  A CA    1 
HETATM 6742 P  PG    . DGT K 4 .   ? -16.796 62.926  38.233  1.00 36.44 ? 1414 DGT B PG    1 
HETATM 6743 O  O1G   . DGT K 4 .   ? -15.806 62.702  39.362  1.00 38.58 ? 1414 DGT B O1G   1 
HETATM 6744 O  O2G   . DGT K 4 .   ? -17.867 64.041  38.350  1.00 35.86 ? 1414 DGT B O2G   1 
HETATM 6745 O  O3G   . DGT K 4 .   ? -17.692 61.950  38.950  1.00 33.95 ? 1414 DGT B O3G   1 
HETATM 6746 O  O3B   . DGT K 4 .   ? -16.838 61.908  36.994  1.00 35.89 ? 1414 DGT B O3B   1 
HETATM 6747 P  PB    . DGT K 4 .   ? -15.308 61.614  36.575  1.00 32.64 ? 1414 DGT B PB    1 
HETATM 6748 O  O1B   . DGT K 4 .   ? -14.520 62.888  36.491  1.00 37.58 ? 1414 DGT B O1B   1 
HETATM 6749 O  O2B   . DGT K 4 .   ? -15.251 60.987  35.212  1.00 32.46 ? 1414 DGT B O2B   1 
HETATM 6750 O  O3A   . DGT K 4 .   ? -14.840 60.572  37.725  1.00 34.21 ? 1414 DGT B O3A   1 
HETATM 6751 P  PA    . DGT K 4 .   ? -13.419 60.649  38.477  1.00 32.21 ? 1414 DGT B PA    1 
HETATM 6752 O  O1A   . DGT K 4 .   ? -13.416 59.566  39.518  1.00 33.74 ? 1414 DGT B O1A   1 
HETATM 6753 O  O2A   . DGT K 4 .   ? -13.098 61.920  39.197  1.00 40.92 ? 1414 DGT B O2A   1 
HETATM 6754 O  "O5'" . DGT K 4 .   ? -12.309 60.305  37.406  1.00 30.96 ? 1414 DGT B "O5'" 1 
HETATM 6755 C  "C5'" . DGT K 4 .   ? -11.534 61.352  36.852  1.00 28.54 ? 1414 DGT B "C5'" 1 
HETATM 6756 C  "C4'" . DGT K 4 .   ? -11.038 60.817  35.541  1.00 25.74 ? 1414 DGT B "C4'" 1 
HETATM 6757 O  "O4'" . DGT K 4 .   ? -10.309 59.633  35.828  1.00 25.04 ? 1414 DGT B "O4'" 1 
HETATM 6758 C  "C3'" . DGT K 4 .   ? -12.203 60.416  34.669  1.00 24.63 ? 1414 DGT B "C3'" 1 
HETATM 6759 O  "O3'" . DGT K 4 .   ? -12.588 61.466  33.788  1.00 23.57 ? 1414 DGT B "O3'" 1 
HETATM 6760 C  "C2'" . DGT K 4 .   ? -11.669 59.216  33.930  1.00 25.69 ? 1414 DGT B "C2'" 1 
HETATM 6761 C  "C1'" . DGT K 4 .   ? -10.553 58.663  34.810  1.00 24.71 ? 1414 DGT B "C1'" 1 
HETATM 6762 N  N9    . DGT K 4 .   ? -11.033 57.373  35.325  1.00 24.42 ? 1414 DGT B N9    1 
HETATM 6763 C  C8    . DGT K 4 .   ? -11.940 57.134  36.329  1.00 24.53 ? 1414 DGT B C8    1 
HETATM 6764 N  N7    . DGT K 4 .   ? -12.184 55.866  36.520  1.00 24.43 ? 1414 DGT B N7    1 
HETATM 6765 C  C5    . DGT K 4 .   ? -11.391 55.236  35.575  1.00 24.12 ? 1414 DGT B C5    1 
HETATM 6766 C  C6    . DGT K 4 .   ? -11.203 53.874  35.287  1.00 24.25 ? 1414 DGT B C6    1 
HETATM 6767 O  O6    . DGT K 4 .   ? -11.732 52.894  35.838  1.00 24.34 ? 1414 DGT B O6    1 
HETATM 6768 N  N1    . DGT K 4 .   ? -10.306 53.693  34.234  1.00 24.23 ? 1414 DGT B N1    1 
HETATM 6769 C  C2    . DGT K 4 .   ? -9.647  54.671  33.534  1.00 24.35 ? 1414 DGT B C2    1 
HETATM 6770 N  N2    . DGT K 4 .   ? -8.810  54.340  32.548  1.00 24.09 ? 1414 DGT B N2    1 
HETATM 6771 N  N3    . DGT K 4 .   ? -9.837  55.937  33.833  1.00 25.09 ? 1414 DGT B N3    1 
HETATM 6772 C  C4    . DGT K 4 .   ? -10.699 56.146  34.837  1.00 24.00 ? 1414 DGT B C4    1 
HETATM 6773 CA CA    . CA  L 5 .   ? -11.532 62.964  40.560  1.00 47.45 ? 1415 CA  B CA    1 
HETATM 6774 CA CA    . CA  M 5 .   ? -13.996 63.916  38.494  1.00 40.39 ? 1416 CA  B CA    1 
HETATM 6775 CA CA    . CA  N 5 .   ? -13.990 53.887  49.598  1.00 64.83 ? 1417 CA  B CA    1 
HETATM 6776 O  O     . HOH O 6 .   ? 14.119  1.894   -2.258  1.00 37.69 ? 503  HOH A O     1 
HETATM 6777 O  O     . HOH O 6 .   ? 19.627  9.078   3.754   1.00 35.20 ? 506  HOH A O     1 
HETATM 6778 O  O     . HOH O 6 .   ? 17.067  0.627   -7.937  1.00 23.66 ? 508  HOH A O     1 
HETATM 6779 O  O     . HOH O 6 .   ? 14.285  15.209  -14.881 1.00 34.09 ? 509  HOH A O     1 
HETATM 6780 O  O     . HOH O 6 .   ? -7.858  2.655   -1.154  1.00 35.50 ? 510  HOH A O     1 
HETATM 6781 O  O     . HOH O 6 .   ? 26.825  -12.688 11.228  1.00 38.20 ? 513  HOH A O     1 
HETATM 6782 O  O     . HOH O 6 .   ? 10.831  -4.450  -18.981 1.00 41.63 ? 514  HOH A O     1 
HETATM 6783 O  O     . HOH O 6 .   ? 16.442  11.177  7.744   1.00 44.79 ? 515  HOH A O     1 
HETATM 6784 O  O     . HOH O 6 .   ? 11.479  5.826   -18.307 1.00 25.19 ? 516  HOH A O     1 
HETATM 6785 O  O     . HOH O 6 .   ? 13.143  -5.863  -10.685 1.00 30.86 ? 517  HOH A O     1 
HETATM 6786 O  O     . HOH O 6 .   ? 5.785   -3.976  3.315   1.00 30.43 ? 518  HOH A O     1 
HETATM 6787 O  O     . HOH O 6 .   ? 5.979   8.779   3.658   1.00 44.05 ? 520  HOH A O     1 
HETATM 6788 O  O     . HOH O 6 .   ? 17.048  6.385   -4.488  1.00 33.67 ? 521  HOH A O     1 
HETATM 6789 O  O     . HOH O 6 .   ? 17.372  -0.703  -10.317 1.00 33.51 ? 522  HOH A O     1 
HETATM 6790 O  O     . HOH O 6 .   ? 17.633  8.961   4.846   1.00 22.05 ? 523  HOH A O     1 
HETATM 6791 O  O     . HOH O 6 .   ? 5.755   -5.087  -14.878 1.00 24.37 ? 527  HOH A O     1 
HETATM 6792 O  O     . HOH O 6 .   ? 12.344  8.686   5.220   1.00 23.09 ? 529  HOH A O     1 
HETATM 6793 O  O     . HOH O 6 .   ? 28.816  -16.677 -10.581 1.00 43.17 ? 530  HOH A O     1 
HETATM 6794 O  O     . HOH O 6 .   ? 20.855  -8.754  1.379   1.00 28.68 ? 531  HOH A O     1 
HETATM 6795 O  O     . HOH O 6 .   ? -2.167  9.671   -9.306  1.00 41.24 ? 533  HOH A O     1 
HETATM 6796 O  O     . HOH O 6 .   ? -3.710  17.512  0.934   1.00 33.81 ? 537  HOH A O     1 
HETATM 6797 O  O     . HOH O 6 .   ? 9.509   32.250  -2.462  1.00 35.81 ? 538  HOH A O     1 
HETATM 6798 O  O     . HOH O 6 .   ? -0.138  7.324   6.275   1.00 35.82 ? 539  HOH A O     1 
HETATM 6799 O  O     . HOH O 6 .   ? 12.124  3.573   -17.294 1.00 30.87 ? 540  HOH A O     1 
HETATM 6800 O  O     . HOH O 6 .   ? 9.207   -10.154 -10.168 1.00 38.53 ? 541  HOH A O     1 
HETATM 6801 O  O     . HOH O 6 .   ? -1.003  15.737  -8.309  1.00 37.52 ? 542  HOH A O     1 
HETATM 6802 O  O     . HOH O 6 .   ? 1.285   15.782  -7.030  1.00 27.15 ? 543  HOH A O     1 
HETATM 6803 O  O     . HOH O 6 .   ? -3.115  -9.814  -14.515 1.00 38.31 ? 544  HOH A O     1 
HETATM 6804 O  O     . HOH O 6 .   ? 19.065  11.623  -10.171 1.00 36.65 ? 545  HOH A O     1 
HETATM 6805 O  O     . HOH O 6 .   ? -11.451 0.210   -6.693  1.00 52.12 ? 546  HOH A O     1 
HETATM 6806 O  O     . HOH O 6 .   ? 7.128   -0.825  -20.984 1.00 44.71 ? 547  HOH A O     1 
HETATM 6807 O  O     . HOH O 6 .   ? 40.880  -9.947  -1.502  1.00 44.41 ? 548  HOH A O     1 
HETATM 6808 O  O     . HOH O 6 .   ? 25.495  16.073  3.107   1.00 40.60 ? 550  HOH A O     1 
HETATM 6809 O  O     . HOH O 6 .   ? 15.772  8.525   -19.129 1.00 22.36 ? 553  HOH A O     1 
HETATM 6810 O  O     . HOH O 6 .   ? 8.691   -23.314 -10.219 1.00 46.66 ? 555  HOH A O     1 
HETATM 6811 O  O     . HOH O 6 .   ? 0.954   1.456   -23.270 1.00 38.56 ? 556  HOH A O     1 
HETATM 6812 O  O     . HOH O 6 .   ? 11.345  -2.727  -4.508  1.00 27.32 ? 558  HOH A O     1 
HETATM 6813 O  O     . HOH O 6 .   ? 15.520  5.609   16.245  1.00 48.37 ? 560  HOH A O     1 
HETATM 6814 O  O     . HOH O 6 .   ? 38.636  -16.907 1.545   1.00 35.79 ? 561  HOH A O     1 
HETATM 6815 O  O     . HOH O 6 .   ? 36.979  6.872   1.563   1.00 49.72 ? 562  HOH A O     1 
HETATM 6816 O  O     . HOH O 6 .   ? 30.450  1.080   4.697   1.00 43.53 ? 563  HOH A O     1 
HETATM 6817 O  O     . HOH O 6 .   ? -0.987  5.622   1.959   1.00 40.73 ? 564  HOH A O     1 
HETATM 6818 O  O     . HOH O 6 .   ? 20.707  11.727  -0.810  1.00 35.38 ? 566  HOH A O     1 
HETATM 6819 O  O     . HOH O 6 .   ? 15.932  7.435   -6.562  1.00 29.26 ? 567  HOH A O     1 
HETATM 6820 O  O     . HOH O 6 .   ? -4.840  14.582  0.366   1.00 37.74 ? 568  HOH A O     1 
HETATM 6821 O  O     . HOH O 6 .   ? 17.634  7.077   -17.708 1.00 32.86 ? 569  HOH A O     1 
HETATM 6822 O  O     . HOH O 6 .   ? 1.248   4.222   2.560   1.00 44.07 ? 570  HOH A O     1 
HETATM 6823 O  O     . HOH O 6 .   ? -5.345  -8.317  3.449   1.00 35.99 ? 571  HOH A O     1 
HETATM 6824 O  O     . HOH O 6 .   ? 11.130  -26.752 -0.587  1.00 37.31 ? 573  HOH A O     1 
HETATM 6825 O  O     . HOH O 6 .   ? 20.400  11.571  7.635   1.00 45.60 ? 576  HOH A O     1 
HETATM 6826 O  O     . HOH O 6 .   ? 17.401  33.154  1.749   1.00 45.58 ? 579  HOH A O     1 
HETATM 6827 O  O     . HOH O 6 .   ? 17.614  -26.017 -4.523  1.00 51.47 ? 582  HOH A O     1 
HETATM 6828 O  O     . HOH O 6 .   ? -5.266  -2.862  -19.338 1.00 38.65 ? 583  HOH A O     1 
HETATM 6829 O  O     . HOH O 6 .   ? 19.791  0.064   -6.813  1.00 42.04 ? 585  HOH A O     1 
HETATM 6830 O  O     . HOH O 6 .   ? 37.625  -17.514 -5.856  1.00 56.19 ? 589  HOH A O     1 
HETATM 6831 O  O     . HOH O 6 .   ? 14.111  -15.820 -5.614  1.00 28.93 ? 593  HOH A O     1 
HETATM 6832 O  O     . HOH O 6 .   ? 2.538   -0.848  -17.785 1.00 36.16 ? 594  HOH A O     1 
HETATM 6833 O  O     . HOH O 6 .   ? 2.204   8.623   -1.420  1.00 22.78 ? 595  HOH A O     1 
HETATM 6834 O  O     . HOH O 6 .   ? -6.560  6.840   -9.237  1.00 42.96 ? 596  HOH A O     1 
HETATM 6835 O  O     . HOH O 6 .   ? 10.075  26.034  11.127  1.00 45.61 ? 598  HOH A O     1 
HETATM 6836 O  O     . HOH O 6 .   ? 12.103  11.779  9.002   1.00 37.75 ? 601  HOH A O     1 
HETATM 6837 O  O     . HOH O 6 .   ? -11.330 -9.356  -8.321  1.00 44.19 ? 602  HOH A O     1 
HETATM 6838 O  O     . HOH O 6 .   ? 2.491   1.253   1.433   1.00 32.45 ? 603  HOH A O     1 
HETATM 6839 O  O     . HOH O 6 .   ? -3.255  17.981  -3.908  1.00 38.72 ? 604  HOH A O     1 
HETATM 6840 O  O     . HOH O 6 .   ? 12.906  -18.007 14.820  1.00 73.20 ? 607  HOH A O     1 
HETATM 6841 O  O     . HOH O 6 .   ? 7.180   -16.805 -8.455  1.00 31.36 ? 609  HOH A O     1 
HETATM 6842 O  O     . HOH O 6 .   ? 6.246   -22.988 -11.022 1.00 43.68 ? 610  HOH A O     1 
HETATM 6843 O  O     . HOH O 6 .   ? 7.508   -20.678 -10.781 1.00 33.87 ? 611  HOH A O     1 
HETATM 6844 O  O     . HOH O 6 .   ? 9.884   4.277   0.489   1.00 54.82 ? 614  HOH A O     1 
HETATM 6845 O  O     . HOH O 6 .   ? 6.968   5.710   2.131   1.00 21.94 ? 615  HOH A O     1 
HETATM 6846 O  O     . HOH O 6 .   ? 3.279   3.231   12.968  1.00 33.54 ? 616  HOH A O     1 
HETATM 6847 O  O     . HOH O 6 .   ? 2.637   -0.628  16.577  1.00 65.00 ? 618  HOH A O     1 
HETATM 6848 O  O     . HOH O 6 .   ? 5.435   3.616   13.928  1.00 30.61 ? 619  HOH A O     1 
HETATM 6849 O  O     . HOH O 6 .   ? 45.176  -3.434  4.441   1.00 51.56 ? 632  HOH A O     1 
HETATM 6850 O  O     . HOH P 6 .   ? -11.515 60.956  21.134  1.00 27.11 ? 501  HOH B O     1 
HETATM 6851 O  O     . HOH P 6 .   ? 3.080   55.773  29.831  1.00 23.81 ? 502  HOH B O     1 
HETATM 6852 O  O     . HOH P 6 .   ? -3.610  46.554  25.130  1.00 41.64 ? 511  HOH B O     1 
HETATM 6853 O  O     . HOH P 6 .   ? -17.721 57.220  34.929  1.00 32.82 ? 519  HOH B O     1 
HETATM 6854 O  O     . HOH P 6 .   ? -14.868 65.553  20.828  1.00 31.16 ? 526  HOH B O     1 
HETATM 6855 O  O     . HOH P 6 .   ? -13.894 56.028  38.615  1.00 39.72 ? 532  HOH B O     1 
HETATM 6856 O  O     . HOH P 6 .   ? 14.273  39.357  39.412  1.00 59.48 ? 554  HOH B O     1 
HETATM 6857 O  O     . HOH P 6 .   ? 5.365   47.127  43.515  1.00 39.70 ? 565  HOH B O     1 
HETATM 6858 O  O     . HOH P 6 .   ? -8.436  53.900  23.769  1.00 35.45 ? 572  HOH B O     1 
HETATM 6859 O  O     . HOH P 6 .   ? -16.900 51.683  20.339  1.00 52.22 ? 581  HOH B O     1 
HETATM 6860 O  O     . HOH P 6 .   ? -26.599 63.854  64.049  1.00 64.09 ? 584  HOH B O     1 
HETATM 6861 O  O     . HOH P 6 .   ? -7.433  57.310  32.400  1.00 33.96 ? 587  HOH B O     1 
HETATM 6862 O  O     . HOH P 6 .   ? 27.290  52.867  38.092  1.00 54.28 ? 588  HOH B O     1 
HETATM 6863 O  O     . HOH P 6 .   ? 19.067  64.098  41.291  1.00 61.76 ? 592  HOH B O     1 
HETATM 6864 O  O     . HOH P 6 .   ? -16.168 65.684  39.833  1.00 33.86 ? 597  HOH B O     1 
HETATM 6865 O  O     . HOH P 6 .   ? -12.452 61.582  42.516  1.00 42.35 ? 621  HOH B O     1 
HETATM 6866 O  O     . HOH P 6 .   ? -13.642 62.709  45.338  1.00 66.20 ? 622  HOH B O     1 
HETATM 6867 O  O     . HOH P 6 .   ? -16.973 60.902  43.657  1.00 59.16 ? 623  HOH B O     1 
HETATM 6868 O  O     . HOH P 6 .   ? -16.467 57.359  47.255  1.00 60.87 ? 624  HOH B O     1 
HETATM 6869 O  O     . HOH P 6 .   ? -15.603 51.825  49.293  1.00 45.74 ? 626  HOH B O     1 
HETATM 6870 O  O     . HOH P 6 .   ? -16.177 54.174  48.437  1.00 56.92 ? 627  HOH B O     1 
HETATM 6871 O  O     . HOH Q 6 .   ? 30.782  -8.654  11.312  1.00 47.97 ? 504  HOH D O     1 
HETATM 6872 O  O     . HOH Q 6 .   ? 16.026  -15.246 14.919  1.00 31.01 ? 512  HOH D O     1 
HETATM 6873 O  O     . HOH Q 6 .   ? 13.776  1.563   9.722   1.00 32.53 ? 525  HOH D O     1 
HETATM 6874 O  O     . HOH Q 6 .   ? 14.834  0.505   14.318  1.00 45.51 ? 534  HOH D O     1 
HETATM 6875 O  O     . HOH Q 6 .   ? 34.729  -13.775 10.935  1.00 31.31 ? 535  HOH D O     1 
HETATM 6876 O  O     . HOH Q 6 .   ? 10.396  4.682   3.046   1.00 39.38 ? 536  HOH D O     1 
HETATM 6877 O  O     . HOH Q 6 .   ? 23.168  -18.976 14.325  1.00 44.34 ? 574  HOH D O     1 
HETATM 6878 O  O     . HOH Q 6 .   ? 29.951  -2.103  19.021  1.00 48.90 ? 586  HOH D O     1 
HETATM 6879 O  O     . HOH Q 6 .   ? 4.950   1.168   12.968  1.00 30.43 ? 617  HOH D O     1 
HETATM 6880 O  O     . HOH Q 6 .   ? 6.761   -6.440  7.505   1.00 44.72 ? 620  HOH D O     1 
HETATM 6881 O  O     . HOH Q 6 .   ? 7.381   -1.026  10.325  1.00 38.98 ? 629  HOH D O     1 
HETATM 6882 O  O     . HOH Q 6 .   ? 4.936   3.064   8.203   1.00 40.27 ? 630  HOH D O     1 
HETATM 6883 O  O     . HOH Q 6 .   ? 9.335   -4.902  9.270   1.00 40.52 ? 631  HOH D O     1 
HETATM 6884 O  O     . HOH R 6 .   ? 10.898  -16.797 -0.726  1.00 31.49 ? 505  HOH E O     1 
HETATM 6885 O  O     . HOH R 6 .   ? 12.306  -14.493 4.323   1.00 29.83 ? 507  HOH E O     1 
HETATM 6886 O  O     . HOH R 6 .   ? 13.585  -3.555  -3.046  1.00 35.11 ? 528  HOH E O     1 
HETATM 6887 O  O     . HOH R 6 .   ? 23.017  -0.699  5.604   1.00 46.80 ? 605  HOH E O     1 
HETATM 6888 O  O     . HOH R 6 .   ? 21.243  -4.346  6.098   1.00 47.11 ? 606  HOH E O     1 
HETATM 6889 O  O     . HOH R 6 .   ? 1.185   -24.224 -5.736  1.00 49.34 ? 608  HOH E O     1 
HETATM 6890 O  O     . HOH S 6 .   ? -14.315 52.234  47.526  1.00 42.89 ? 625  HOH H O     1 
HETATM 6891 O  O     . HOH S 6 .   ? -11.064 47.378  39.304  1.00 62.49 ? 628  HOH H O     1 
HETATM 6892 O  O     . HOH T 6 .   ? -14.417 43.868  29.601  1.00 67.91 ? 599  HOH J O     1 
HETATM 6893 O  O     . HOH T 6 .   ? 2.847   50.030  35.440  1.00 59.37 ? 612  HOH J O     1 
HETATM 6894 O  O     . HOH T 6 .   ? 3.501   52.449  36.494  1.00 44.34 ? 613  HOH J O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1    1    GLY GLY A . n 
A 1 2   ILE 2   2    2    ILE ILE A . n 
A 1 3   VAL 3   3    3    VAL VAL A . n 
A 1 4   LEU 4   4    4    LEU LEU A . n 
A 1 5   PHE 5   5    5    PHE PHE A . n 
A 1 6   VAL 6   6    6    VAL VAL A . n 
A 1 7   ASP 7   7    7    ASP ASP A . n 
A 1 8   PHE 8   8    8    PHE PHE A . n 
A 1 9   ASP 9   9    9    ASP ASP A . n 
A 1 10  TYR 10  10   10   TYR TYR A . n 
A 1 11  PHE 11  11   11   PHE PHE A . n 
A 1 12  TYR 12  12   12   TYR TYR A . n 
A 1 13  ALA 13  13   13   ALA ALA A . n 
A 1 14  GLN 14  14   14   GLN GLN A . n 
A 1 15  VAL 15  15   15   VAL VAL A . n 
A 1 16  GLU 16  16   16   GLU GLU A . n 
A 1 17  GLU 17  17   17   GLU GLU A . n 
A 1 18  VAL 18  18   18   VAL VAL A . n 
A 1 19  LEU 19  19   19   LEU LEU A . n 
A 1 20  ASN 20  20   20   ASN ASN A . n 
A 1 21  PRO 21  21   21   PRO PRO A . n 
A 1 22  SER 22  22   22   SER SER A . n 
A 1 23  LEU 23  23   23   LEU LEU A . n 
A 1 24  LYS 24  24   24   LYS LYS A . n 
A 1 25  GLY 25  25   25   GLY GLY A . n 
A 1 26  LYS 26  26   26   LYS LYS A . n 
A 1 27  PRO 27  27   27   PRO PRO A . n 
A 1 28  VAL 28  28   28   VAL VAL A . n 
A 1 29  VAL 29  29   29   VAL VAL A . n 
A 1 30  VAL 30  30   30   VAL VAL A . n 
A 1 31  CYS 31  31   31   CYS CYS A . n 
A 1 32  VAL 32  32   32   VAL VAL A . n 
A 1 33  PHE 33  33   33   PHE PHE A . n 
A 1 34  SER 34  34   34   SER SER A . n 
A 1 35  GLY 35  35   35   GLY GLY A . n 
A 1 36  ARG 36  36   36   ARG ARG A . n 
A 1 37  PHE 37  37   37   PHE PHE A . n 
A 1 38  GLU 38  38   38   GLU GLU A . n 
A 1 39  ASP 39  39   39   ASP ASP A . n 
A 1 40  SER 40  40   40   SER SER A . n 
A 1 41  GLY 41  41   41   GLY GLY A . n 
A 1 42  ALA 42  42   42   ALA ALA A . n 
A 1 43  VAL 43  43   43   VAL VAL A . n 
A 1 44  ALA 44  44   44   ALA ALA A . n 
A 1 45  THR 45  45   45   THR THR A . n 
A 1 46  ALA 46  46   46   ALA ALA A . n 
A 1 47  ASN 47  47   47   ASN ASN A . n 
A 1 48  TYR 48  48   48   TYR TYR A . n 
A 1 49  GLU 49  49   49   GLU GLU A . n 
A 1 50  ALA 50  50   50   ALA ALA A . n 
A 1 51  ARG 51  51   51   ARG ARG A . n 
A 1 52  LYS 52  52   52   LYS LYS A . n 
A 1 53  PHE 53  53   53   PHE PHE A . n 
A 1 54  GLY 54  54   54   GLY GLY A . n 
A 1 55  VAL 55  55   55   VAL VAL A . n 
A 1 56  LYS 56  56   56   LYS LYS A . n 
A 1 57  ALA 57  57   57   ALA ALA A . n 
A 1 58  GLY 58  58   58   GLY GLY A . n 
A 1 59  ILE 59  59   59   ILE ILE A . n 
A 1 60  PRO 60  60   60   PRO PRO A . n 
A 1 61  ILE 61  61   61   ILE ILE A . n 
A 1 62  VAL 62  62   62   VAL VAL A . n 
A 1 63  GLU 63  63   63   GLU GLU A . n 
A 1 64  ALA 64  64   64   ALA ALA A . n 
A 1 65  LYS 65  65   65   LYS LYS A . n 
A 1 66  LYS 66  66   66   LYS LYS A . n 
A 1 67  ILE 67  67   67   ILE ILE A . n 
A 1 68  LEU 68  68   68   LEU LEU A . n 
A 1 69  PRO 69  69   69   PRO PRO A . n 
A 1 70  ASN 70  70   70   ASN ASN A . n 
A 1 71  ALA 71  71   71   ALA ALA A . n 
A 1 72  VAL 72  72   72   VAL VAL A . n 
A 1 73  TYR 73  73   73   TYR TYR A . n 
A 1 74  LEU 74  74   74   LEU LEU A . n 
A 1 75  PRO 75  75   75   PRO PRO A . n 
A 1 76  MET 76  76   76   MET MET A . n 
A 1 77  ARG 77  77   77   ARG ARG A . n 
A 1 78  LYS 78  78   78   LYS LYS A . n 
A 1 79  GLU 79  79   79   GLU GLU A . n 
A 1 80  VAL 80  80   80   VAL VAL A . n 
A 1 81  TYR 81  81   81   TYR TYR A . n 
A 1 82  GLN 82  82   82   GLN GLN A . n 
A 1 83  GLN 83  83   83   GLN GLN A . n 
A 1 84  VAL 84  84   84   VAL VAL A . n 
A 1 85  SER 85  85   85   SER SER A . n 
A 1 86  SER 86  86   86   SER SER A . n 
A 1 87  ARG 87  87   87   ARG ARG A . n 
A 1 88  ILE 88  88   88   ILE ILE A . n 
A 1 89  MET 89  89   89   MET MET A . n 
A 1 90  ASN 90  90   90   ASN ASN A . n 
A 1 91  LEU 91  91   91   LEU LEU A . n 
A 1 92  LEU 92  92   92   LEU LEU A . n 
A 1 93  ARG 93  93   93   ARG ARG A . n 
A 1 94  GLU 94  94   94   GLU GLU A . n 
A 1 95  TYR 95  95   95   TYR TYR A . n 
A 1 96  SER 96  96   96   SER SER A . n 
A 1 97  GLU 97  97   97   GLU GLU A . n 
A 1 98  LYS 98  98   98   LYS LYS A . n 
A 1 99  ILE 99  99   99   ILE ILE A . n 
A 1 100 GLU 100 100  100  GLU GLU A . n 
A 1 101 ILE 101 101  101  ILE ILE A . n 
A 1 102 ALA 102 102  102  ALA ALA A . n 
A 1 103 SER 103 103  103  SER SER A . n 
A 1 104 ILE 104 104  104  ILE ILE A . n 
A 1 105 ASP 105 105  105  ASP ASP A . n 
A 1 106 GLU 106 106  106  GLU GLU A . n 
A 1 107 ALA 107 107  107  ALA ALA A . n 
A 1 108 TYR 108 108  108  TYR TYR A . n 
A 1 109 LEU 109 109  109  LEU LEU A . n 
A 1 110 ASP 110 110  110  ASP ASP A . n 
A 1 111 ILE 111 111  111  ILE ILE A . n 
A 1 112 SER 112 112  112  SER SER A . n 
A 1 113 ASP 113 113  113  ASP ASP A . n 
A 1 114 LYS 114 114  114  LYS LYS A . n 
A 1 115 VAL 115 115  115  VAL VAL A . n 
A 1 116 ARG 116 116  116  ARG ARG A . n 
A 1 117 ASP 117 117  117  ASP ASP A . n 
A 1 118 TYR 118 118  118  TYR TYR A . n 
A 1 119 ARG 119 119  119  ARG ARG A . n 
A 1 120 GLU 120 120  120  GLU GLU A . n 
A 1 121 ALA 121 121  121  ALA ALA A . n 
A 1 122 TYR 122 122  122  TYR TYR A . n 
A 1 123 ASN 123 123  123  ASN ASN A . n 
A 1 124 LEU 124 124  124  LEU LEU A . n 
A 1 125 GLY 125 125  125  GLY GLY A . n 
A 1 126 LEU 126 126  126  LEU LEU A . n 
A 1 127 GLU 127 127  127  GLU GLU A . n 
A 1 128 ILE 128 128  128  ILE ILE A . n 
A 1 129 LYS 129 129  129  LYS LYS A . n 
A 1 130 ASN 130 130  130  ASN ASN A . n 
A 1 131 LYS 131 131  131  LYS LYS A . n 
A 1 132 ILE 132 132  132  ILE ILE A . n 
A 1 133 LEU 133 133  133  LEU LEU A . n 
A 1 134 GLU 134 134  134  GLU GLU A . n 
A 1 135 LYS 135 135  135  LYS LYS A . n 
A 1 136 GLU 136 136  136  GLU GLU A . n 
A 1 137 LYS 137 137  137  LYS LYS A . n 
A 1 138 ILE 138 138  138  ILE ILE A . n 
A 1 139 THR 139 139  139  THR THR A . n 
A 1 140 VAL 140 140  140  VAL VAL A . n 
A 1 141 THR 141 141  141  THR THR A . n 
A 1 142 VAL 142 142  142  VAL VAL A . n 
A 1 143 GLY 143 143  143  GLY GLY A . n 
A 1 144 ILE 144 144  144  ILE ILE A . n 
A 1 145 SER 145 145  145  SER SER A . n 
A 1 146 LYS 146 146  146  LYS LYS A . n 
A 1 147 ASN 147 147  147  ASN ASN A . n 
A 1 148 LYS 148 148  148  LYS LYS A . n 
A 1 149 VAL 149 149  149  VAL VAL A . n 
A 1 150 PHE 150 150  150  PHE PHE A . n 
A 1 151 ALA 151 151  151  ALA ALA A . n 
A 1 152 LYS 152 152  152  LYS LYS A . n 
A 1 153 ILE 153 153  153  ILE ILE A . n 
A 1 154 ALA 154 154  154  ALA ALA A . n 
A 1 155 ALA 155 155  155  ALA ALA A . n 
A 1 156 ASP 156 156  156  ASP ASP A . n 
A 1 157 MET 157 157  157  MET MET A . n 
A 1 158 ALA 158 158  158  ALA ALA A . n 
A 1 159 LYS 159 159  159  LYS LYS A . n 
A 1 160 PRO 160 160  160  PRO PRO A . n 
A 1 161 ASN 161 161  161  ASN ASN A . n 
A 1 162 GLY 162 162  162  GLY GLY A . n 
A 1 163 ILE 163 163  163  ILE ILE A . n 
A 1 164 LYS 164 164  164  LYS LYS A . n 
A 1 165 VAL 165 165  165  VAL VAL A . n 
A 1 166 ILE 166 166  166  ILE ILE A . n 
A 1 167 ASP 167 167  167  ASP ASP A . n 
A 1 168 ASP 168 168  168  ASP ASP A . n 
A 1 169 GLU 169 169  169  GLU GLU A . n 
A 1 170 GLU 170 170  170  GLU GLU A . n 
A 1 171 VAL 171 171  171  VAL VAL A . n 
A 1 172 LYS 172 172  172  LYS LYS A . n 
A 1 173 ARG 173 173  173  ARG ARG A . n 
A 1 174 LEU 174 174  174  LEU LEU A . n 
A 1 175 ILE 175 175  175  ILE ILE A . n 
A 1 176 ARG 176 176  176  ARG ARG A . n 
A 1 177 GLU 177 177  177  GLU GLU A . n 
A 1 178 LEU 178 178  178  LEU LEU A . n 
A 1 179 ASP 179 179  179  ASP ASP A . n 
A 1 180 ILE 180 180  180  ILE ILE A . n 
A 1 181 ALA 181 181  181  ALA ALA A . n 
A 1 182 ASP 182 182  182  ASP ASP A . n 
A 1 183 VAL 183 183  183  VAL VAL A . n 
A 1 184 PRO 184 184  184  PRO PRO A . n 
A 1 185 GLY 185 185  185  GLY GLY A . n 
A 1 186 ILE 186 186  186  ILE ILE A . n 
A 1 187 GLY 187 187  187  GLY GLY A . n 
A 1 188 ASN 188 188  188  ASN ASN A . n 
A 1 189 ILE 189 189  189  ILE ILE A . n 
A 1 190 THR 190 190  190  THR THR A . n 
A 1 191 ALA 191 191  191  ALA ALA A . n 
A 1 192 GLU 192 192  192  GLU GLU A . n 
A 1 193 LYS 193 193  193  LYS LYS A . n 
A 1 194 LEU 194 194  194  LEU LEU A . n 
A 1 195 LYS 195 195  195  LYS LYS A . n 
A 1 196 LYS 196 196  196  LYS LYS A . n 
A 1 197 LEU 197 197  197  LEU LEU A . n 
A 1 198 GLY 198 198  198  GLY GLY A . n 
A 1 199 ILE 199 199  199  ILE ILE A . n 
A 1 200 ASN 200 200  200  ASN ASN A . n 
A 1 201 LYS 201 201  201  LYS LYS A . n 
A 1 202 LEU 202 202  202  LEU LEU A . n 
A 1 203 VAL 203 203  203  VAL VAL A . n 
A 1 204 ASP 204 204  204  ASP ASP A . n 
A 1 205 THR 205 205  205  THR THR A . n 
A 1 206 LEU 206 206  206  LEU LEU A . n 
A 1 207 SER 207 207  207  SER SER A . n 
A 1 208 ILE 208 208  208  ILE ILE A . n 
A 1 209 GLU 209 209  209  GLU GLU A . n 
A 1 210 PHE 210 210  210  PHE PHE A . n 
A 1 211 ASP 211 211  211  ASP ASP A . n 
A 1 212 LYS 212 212  212  LYS LYS A . n 
A 1 213 LEU 213 213  213  LEU LEU A . n 
A 1 214 LYS 214 214  214  LYS LYS A . n 
A 1 215 GLY 215 215  215  GLY GLY A . n 
A 1 216 MET 216 216  216  MET MET A . n 
A 1 217 ILE 217 217  217  ILE ILE A . n 
A 1 218 GLY 218 218  218  GLY GLY A . n 
A 1 219 GLU 219 219  219  GLU GLU A . n 
A 1 220 ALA 220 220  220  ALA ALA A . n 
A 1 221 LYS 221 221  221  LYS LYS A . n 
A 1 222 ALA 222 222  222  ALA ALA A . n 
A 1 223 LYS 223 223  223  LYS LYS A . n 
A 1 224 TYR 224 224  224  TYR TYR A . n 
A 1 225 LEU 225 225  225  LEU LEU A . n 
A 1 226 ILE 226 226  226  ILE ILE A . n 
A 1 227 SER 227 227  227  SER SER A . n 
A 1 228 LEU 228 228  228  LEU LEU A . n 
A 1 229 ALA 229 229  229  ALA ALA A . n 
A 1 230 ARG 230 230  230  ARG ARG A . n 
A 1 231 ASP 231 231  231  ASP ASP A . n 
A 1 232 GLU 232 232  232  GLU GLU A . n 
A 1 233 TYR 233 233  233  TYR TYR A . n 
A 1 234 ASN 234 234  234  ASN ASN A . n 
A 1 235 GLU 235 235  235  GLU GLU A . n 
A 1 236 PRO 236 236  236  PRO PRO A . n 
A 1 237 ILE 237 237  237  ILE ILE A . n 
A 1 238 ARG 238 238  238  ARG ARG A . n 
A 1 239 THR 239 239  239  THR THR A . n 
A 1 240 ARG 240 240  240  ARG ARG A . n 
A 1 241 VAL 241 241  241  VAL VAL A . n 
A 1 242 ARG 242 242  242  ARG ARG A . n 
A 1 243 LYS 243 243  243  LYS LYS A . n 
A 1 244 SER 244 244  244  SER SER A . n 
A 1 245 ILE 245 245  245  ILE ILE A . n 
A 1 246 GLY 246 246  246  GLY GLY A . n 
A 1 247 ARG 247 247  247  ARG ARG A . n 
A 1 248 ILE 248 248  248  ILE ILE A . n 
A 1 249 VAL 249 249  249  VAL VAL A . n 
A 1 250 THR 250 250  250  THR THR A . n 
A 1 251 MET 251 251  251  MET MET A . n 
A 1 252 LYS 252 252  252  LYS LYS A . n 
A 1 253 ARG 253 253  253  ARG ARG A . n 
A 1 254 ASN 254 254  254  ASN ASN A . n 
A 1 255 SER 255 255  255  SER SER A . n 
A 1 256 ARG 256 256  256  ARG ARG A . n 
A 1 257 ASN 257 257  257  ASN ASN A . n 
A 1 258 LEU 258 258  258  LEU LEU A . n 
A 1 259 GLU 259 259  259  GLU GLU A . n 
A 1 260 GLU 260 260  260  GLU GLU A . n 
A 1 261 ILE 261 261  261  ILE ILE A . n 
A 1 262 LYS 262 262  262  LYS LYS A . n 
A 1 263 PRO 263 263  263  PRO PRO A . n 
A 1 264 TYR 264 264  264  TYR TYR A . n 
A 1 265 LEU 265 265  265  LEU LEU A . n 
A 1 266 PHE 266 266  266  PHE PHE A . n 
A 1 267 ARG 267 267  267  ARG ARG A . n 
A 1 268 ALA 268 268  268  ALA ALA A . n 
A 1 269 ILE 269 269  269  ILE ILE A . n 
A 1 270 GLU 270 270  270  GLU GLU A . n 
A 1 271 GLU 271 271  271  GLU GLU A . n 
A 1 272 SER 272 272  272  SER SER A . n 
A 1 273 TYR 273 273  273  TYR TYR A . n 
A 1 274 TYR 274 274  274  TYR TYR A . n 
A 1 275 LYS 275 275  275  LYS LYS A . n 
A 1 276 LEU 276 276  276  LEU LEU A . n 
A 1 277 ASP 277 277  277  ASP ASP A . n 
A 1 278 LYS 278 278  278  LYS LYS A . n 
A 1 279 ARG 279 279  279  ARG ARG A . n 
A 1 280 ILE 280 280  280  ILE ILE A . n 
A 1 281 PRO 281 281  281  PRO PRO A . n 
A 1 282 LYS 282 282  282  LYS LYS A . n 
A 1 283 ALA 283 283  283  ALA ALA A . n 
A 1 284 ILE 284 284  284  ILE ILE A . n 
A 1 285 HIS 285 285  285  HIS HIS A . n 
A 1 286 VAL 286 286  286  VAL VAL A . n 
A 1 287 VAL 287 287  287  VAL VAL A . n 
A 1 288 ALA 288 288  288  ALA ALA A . n 
A 1 289 VAL 289 289  289  VAL VAL A . n 
A 1 290 THR 290 290  290  THR THR A . n 
A 1 291 GLU 291 291  291  GLU GLU A . n 
A 1 292 ASP 292 292  292  ASP ASP A . n 
A 1 293 LEU 293 293  293  LEU LEU A . n 
A 1 294 ASP 294 294  294  ASP ASP A . n 
A 1 295 ILE 295 295  295  ILE ILE A . n 
A 1 296 VAL 296 296  296  VAL VAL A . n 
A 1 297 SER 297 297  297  SER SER A . n 
A 1 298 ARG 298 298  298  ARG ARG A . n 
A 1 299 GLY 299 299  299  GLY GLY A . n 
A 1 300 ARG 300 300  300  ARG ARG A . n 
A 1 301 THR 301 301  301  THR THR A . n 
A 1 302 PHE 302 302  302  PHE PHE A . n 
A 1 303 PRO 303 303  303  PRO PRO A . n 
A 1 304 HIS 304 304  304  HIS HIS A . n 
A 1 305 GLY 305 305  305  GLY GLY A . n 
A 1 306 ILE 306 306  306  ILE ILE A . n 
A 1 307 SER 307 307  307  SER SER A . n 
A 1 308 LYS 308 308  308  LYS LYS A . n 
A 1 309 GLU 309 309  309  GLU GLU A . n 
A 1 310 THR 310 310  310  THR THR A . n 
A 1 311 ALA 311 311  311  ALA ALA A . n 
A 1 312 TYR 312 312  312  TYR TYR A . n 
A 1 313 SER 313 313  313  SER SER A . n 
A 1 314 GLU 314 314  314  GLU GLU A . n 
A 1 315 SER 315 315  315  SER SER A . n 
A 1 316 VAL 316 316  316  VAL VAL A . n 
A 1 317 LYS 317 317  317  LYS LYS A . n 
A 1 318 LEU 318 318  318  LEU LEU A . n 
A 1 319 LEU 319 319  319  LEU LEU A . n 
A 1 320 GLN 320 320  320  GLN GLN A . n 
A 1 321 LYS 321 321  321  LYS LYS A . n 
A 1 322 ILE 322 322  322  ILE ILE A . n 
A 1 323 LEU 323 323  323  LEU LEU A . n 
A 1 324 GLU 324 324  324  GLU GLU A . n 
A 1 325 GLU 325 325  325  GLU GLU A . n 
A 1 326 ASP 326 326  326  ASP ASP A . n 
A 1 327 GLU 327 327  327  GLU GLU A . n 
A 1 328 ARG 328 328  328  ARG ARG A . n 
A 1 329 LYS 329 329  329  LYS LYS A . n 
A 1 330 ILE 330 330  330  ILE ILE A . n 
A 1 331 ARG 331 331  331  ARG ARG A . n 
A 1 332 ARG 332 332  332  ARG ARG A . n 
A 1 333 ILE 333 333  333  ILE ILE A . n 
A 1 334 GLY 334 334  334  GLY GLY A . n 
A 1 335 VAL 335 335  335  VAL VAL A . n 
A 1 336 ARG 336 336  336  ARG ARG A . n 
A 1 337 PHE 337 337  337  PHE PHE A . n 
A 1 338 SER 338 338  338  SER SER A . n 
A 1 339 LYS 339 339  339  LYS LYS A . n 
A 1 340 PHE 340 340  340  PHE PHE A . n 
A 1 341 ILE 341 341  341  ILE ILE A . n 
B 1 1   GLY 1   1001 1001 GLY GLY B . n 
B 1 2   ILE 2   1002 1002 ILE ILE B . n 
B 1 3   VAL 3   1003 1003 VAL VAL B . n 
B 1 4   LEU 4   1004 1004 LEU LEU B . n 
B 1 5   PHE 5   1005 1005 PHE PHE B . n 
B 1 6   VAL 6   1006 1006 VAL VAL B . n 
B 1 7   ASP 7   1007 1007 ASP ASP B . n 
B 1 8   PHE 8   1008 1008 PHE PHE B . n 
B 1 9   ASP 9   1009 1009 ASP ASP B . n 
B 1 10  TYR 10  1010 1010 TYR TYR B . n 
B 1 11  PHE 11  1011 1011 PHE PHE B . n 
B 1 12  TYR 12  1012 1012 TYR TYR B . n 
B 1 13  ALA 13  1013 1013 ALA ALA B . n 
B 1 14  GLN 14  1014 1014 GLN GLN B . n 
B 1 15  VAL 15  1015 1015 VAL VAL B . n 
B 1 16  GLU 16  1016 1016 GLU GLU B . n 
B 1 17  GLU 17  1017 1017 GLU GLU B . n 
B 1 18  VAL 18  1018 1018 VAL VAL B . n 
B 1 19  LEU 19  1019 1019 LEU LEU B . n 
B 1 20  ASN 20  1020 1020 ASN ASN B . n 
B 1 21  PRO 21  1021 1021 PRO PRO B . n 
B 1 22  SER 22  1022 1022 SER SER B . n 
B 1 23  LEU 23  1023 1023 LEU LEU B . n 
B 1 24  LYS 24  1024 1024 LYS LYS B . n 
B 1 25  GLY 25  1025 1025 GLY GLY B . n 
B 1 26  LYS 26  1026 1026 LYS LYS B . n 
B 1 27  PRO 27  1027 1027 PRO PRO B . n 
B 1 28  VAL 28  1028 1028 VAL VAL B . n 
B 1 29  VAL 29  1029 1029 VAL VAL B . n 
B 1 30  VAL 30  1030 1030 VAL VAL B . n 
B 1 31  CYS 31  1031 1031 CYS CYS B . n 
B 1 32  VAL 32  1032 1032 VAL VAL B . n 
B 1 33  PHE 33  1033 1033 PHE PHE B . n 
B 1 34  SER 34  1034 1034 SER SER B . n 
B 1 35  GLY 35  1035 1035 GLY GLY B . n 
B 1 36  ARG 36  1036 1036 ARG ARG B . n 
B 1 37  PHE 37  1037 1037 PHE PHE B . n 
B 1 38  GLU 38  1038 1038 GLU GLU B . n 
B 1 39  ASP 39  1039 1039 ASP ASP B . n 
B 1 40  SER 40  1040 1040 SER SER B . n 
B 1 41  GLY 41  1041 1041 GLY GLY B . n 
B 1 42  ALA 42  1042 1042 ALA ALA B . n 
B 1 43  VAL 43  1043 1043 VAL VAL B . n 
B 1 44  ALA 44  1044 1044 ALA ALA B . n 
B 1 45  THR 45  1045 1045 THR THR B . n 
B 1 46  ALA 46  1046 1046 ALA ALA B . n 
B 1 47  ASN 47  1047 1047 ASN ASN B . n 
B 1 48  TYR 48  1048 1048 TYR TYR B . n 
B 1 49  GLU 49  1049 1049 GLU GLU B . n 
B 1 50  ALA 50  1050 1050 ALA ALA B . n 
B 1 51  ARG 51  1051 1051 ARG ARG B . n 
B 1 52  LYS 52  1052 1052 LYS LYS B . n 
B 1 53  PHE 53  1053 1053 PHE PHE B . n 
B 1 54  GLY 54  1054 1054 GLY GLY B . n 
B 1 55  VAL 55  1055 1055 VAL VAL B . n 
B 1 56  LYS 56  1056 1056 LYS LYS B . n 
B 1 57  ALA 57  1057 1057 ALA ALA B . n 
B 1 58  GLY 58  1058 1058 GLY GLY B . n 
B 1 59  ILE 59  1059 1059 ILE ILE B . n 
B 1 60  PRO 60  1060 1060 PRO PRO B . n 
B 1 61  ILE 61  1061 1061 ILE ILE B . n 
B 1 62  VAL 62  1062 1062 VAL VAL B . n 
B 1 63  GLU 63  1063 1063 GLU GLU B . n 
B 1 64  ALA 64  1064 1064 ALA ALA B . n 
B 1 65  LYS 65  1065 1065 LYS LYS B . n 
B 1 66  LYS 66  1066 1066 LYS LYS B . n 
B 1 67  ILE 67  1067 1067 ILE ILE B . n 
B 1 68  LEU 68  1068 1068 LEU LEU B . n 
B 1 69  PRO 69  1069 1069 PRO PRO B . n 
B 1 70  ASN 70  1070 1070 ASN ASN B . n 
B 1 71  ALA 71  1071 1071 ALA ALA B . n 
B 1 72  VAL 72  1072 1072 VAL VAL B . n 
B 1 73  TYR 73  1073 1073 TYR TYR B . n 
B 1 74  LEU 74  1074 1074 LEU LEU B . n 
B 1 75  PRO 75  1075 1075 PRO PRO B . n 
B 1 76  MET 76  1076 1076 MET MET B . n 
B 1 77  ARG 77  1077 1077 ARG ARG B . n 
B 1 78  LYS 78  1078 1078 LYS LYS B . n 
B 1 79  GLU 79  1079 1079 GLU GLU B . n 
B 1 80  VAL 80  1080 1080 VAL VAL B . n 
B 1 81  TYR 81  1081 1081 TYR TYR B . n 
B 1 82  GLN 82  1082 1082 GLN GLN B . n 
B 1 83  GLN 83  1083 1083 GLN GLN B . n 
B 1 84  VAL 84  1084 1084 VAL VAL B . n 
B 1 85  SER 85  1085 1085 SER SER B . n 
B 1 86  SER 86  1086 1086 SER SER B . n 
B 1 87  ARG 87  1087 1087 ARG ARG B . n 
B 1 88  ILE 88  1088 1088 ILE ILE B . n 
B 1 89  MET 89  1089 1089 MET MET B . n 
B 1 90  ASN 90  1090 1090 ASN ASN B . n 
B 1 91  LEU 91  1091 1091 LEU LEU B . n 
B 1 92  LEU 92  1092 1092 LEU LEU B . n 
B 1 93  ARG 93  1093 1093 ARG ARG B . n 
B 1 94  GLU 94  1094 1094 GLU GLU B . n 
B 1 95  TYR 95  1095 1095 TYR TYR B . n 
B 1 96  SER 96  1096 1096 SER SER B . n 
B 1 97  GLU 97  1097 1097 GLU GLU B . n 
B 1 98  LYS 98  1098 1098 LYS LYS B . n 
B 1 99  ILE 99  1099 1099 ILE ILE B . n 
B 1 100 GLU 100 1100 1100 GLU GLU B . n 
B 1 101 ILE 101 1101 1101 ILE ILE B . n 
B 1 102 ALA 102 1102 1102 ALA ALA B . n 
B 1 103 SER 103 1103 1103 SER SER B . n 
B 1 104 ILE 104 1104 1104 ILE ILE B . n 
B 1 105 ASP 105 1105 1105 ASP ASP B . n 
B 1 106 GLU 106 1106 1106 GLU GLU B . n 
B 1 107 ALA 107 1107 1107 ALA ALA B . n 
B 1 108 TYR 108 1108 1108 TYR TYR B . n 
B 1 109 LEU 109 1109 1109 LEU LEU B . n 
B 1 110 ASP 110 1110 1110 ASP ASP B . n 
B 1 111 ILE 111 1111 1111 ILE ILE B . n 
B 1 112 SER 112 1112 1112 SER SER B . n 
B 1 113 ASP 113 1113 1113 ASP ASP B . n 
B 1 114 LYS 114 1114 1114 LYS LYS B . n 
B 1 115 VAL 115 1115 1115 VAL VAL B . n 
B 1 116 ARG 116 1116 1116 ARG ARG B . n 
B 1 117 ASP 117 1117 1117 ASP ASP B . n 
B 1 118 TYR 118 1118 1118 TYR TYR B . n 
B 1 119 ARG 119 1119 1119 ARG ARG B . n 
B 1 120 GLU 120 1120 1120 GLU GLU B . n 
B 1 121 ALA 121 1121 1121 ALA ALA B . n 
B 1 122 TYR 122 1122 1122 TYR TYR B . n 
B 1 123 ASN 123 1123 1123 ASN ASN B . n 
B 1 124 LEU 124 1124 1124 LEU LEU B . n 
B 1 125 GLY 125 1125 1125 GLY GLY B . n 
B 1 126 LEU 126 1126 1126 LEU LEU B . n 
B 1 127 GLU 127 1127 1127 GLU GLU B . n 
B 1 128 ILE 128 1128 1128 ILE ILE B . n 
B 1 129 LYS 129 1129 1129 LYS LYS B . n 
B 1 130 ASN 130 1130 1130 ASN ASN B . n 
B 1 131 LYS 131 1131 1131 LYS LYS B . n 
B 1 132 ILE 132 1132 1132 ILE ILE B . n 
B 1 133 LEU 133 1133 1133 LEU LEU B . n 
B 1 134 GLU 134 1134 1134 GLU GLU B . n 
B 1 135 LYS 135 1135 1135 LYS LYS B . n 
B 1 136 GLU 136 1136 1136 GLU GLU B . n 
B 1 137 LYS 137 1137 1137 LYS LYS B . n 
B 1 138 ILE 138 1138 1138 ILE ILE B . n 
B 1 139 THR 139 1139 1139 THR THR B . n 
B 1 140 VAL 140 1140 1140 VAL VAL B . n 
B 1 141 THR 141 1141 1141 THR THR B . n 
B 1 142 VAL 142 1142 1142 VAL VAL B . n 
B 1 143 GLY 143 1143 1143 GLY GLY B . n 
B 1 144 ILE 144 1144 1144 ILE ILE B . n 
B 1 145 SER 145 1145 1145 SER SER B . n 
B 1 146 LYS 146 1146 1146 LYS LYS B . n 
B 1 147 ASN 147 1147 1147 ASN ASN B . n 
B 1 148 LYS 148 1148 1148 LYS LYS B . n 
B 1 149 VAL 149 1149 1149 VAL VAL B . n 
B 1 150 PHE 150 1150 1150 PHE PHE B . n 
B 1 151 ALA 151 1151 1151 ALA ALA B . n 
B 1 152 LYS 152 1152 1152 LYS LYS B . n 
B 1 153 ILE 153 1153 1153 ILE ILE B . n 
B 1 154 ALA 154 1154 1154 ALA ALA B . n 
B 1 155 ALA 155 1155 1155 ALA ALA B . n 
B 1 156 ASP 156 1156 1156 ASP ASP B . n 
B 1 157 MET 157 1157 1157 MET MET B . n 
B 1 158 ALA 158 1158 1158 ALA ALA B . n 
B 1 159 LYS 159 1159 1159 LYS LYS B . n 
B 1 160 PRO 160 1160 1160 PRO PRO B . n 
B 1 161 ASN 161 1161 1161 ASN ASN B . n 
B 1 162 GLY 162 1162 1162 GLY GLY B . n 
B 1 163 ILE 163 1163 1163 ILE ILE B . n 
B 1 164 LYS 164 1164 1164 LYS LYS B . n 
B 1 165 VAL 165 1165 1165 VAL VAL B . n 
B 1 166 ILE 166 1166 1166 ILE ILE B . n 
B 1 167 ASP 167 1167 1167 ASP ASP B . n 
B 1 168 ASP 168 1168 1168 ASP ASP B . n 
B 1 169 GLU 169 1169 1169 GLU GLU B . n 
B 1 170 GLU 170 1170 1170 GLU GLU B . n 
B 1 171 VAL 171 1171 1171 VAL VAL B . n 
B 1 172 LYS 172 1172 1172 LYS LYS B . n 
B 1 173 ARG 173 1173 1173 ARG ARG B . n 
B 1 174 LEU 174 1174 1174 LEU LEU B . n 
B 1 175 ILE 175 1175 1175 ILE ILE B . n 
B 1 176 ARG 176 1176 1176 ARG ARG B . n 
B 1 177 GLU 177 1177 1177 GLU GLU B . n 
B 1 178 LEU 178 1178 1178 LEU LEU B . n 
B 1 179 ASP 179 1179 1179 ASP ASP B . n 
B 1 180 ILE 180 1180 1180 ILE ILE B . n 
B 1 181 ALA 181 1181 1181 ALA ALA B . n 
B 1 182 ASP 182 1182 1182 ASP ASP B . n 
B 1 183 VAL 183 1183 1183 VAL VAL B . n 
B 1 184 PRO 184 1184 1184 PRO PRO B . n 
B 1 185 GLY 185 1185 1185 GLY GLY B . n 
B 1 186 ILE 186 1186 1186 ILE ILE B . n 
B 1 187 GLY 187 1187 1187 GLY GLY B . n 
B 1 188 ASN 188 1188 1188 ASN ASN B . n 
B 1 189 ILE 189 1189 1189 ILE ILE B . n 
B 1 190 THR 190 1190 1190 THR THR B . n 
B 1 191 ALA 191 1191 1191 ALA ALA B . n 
B 1 192 GLU 192 1192 1192 GLU GLU B . n 
B 1 193 LYS 193 1193 1193 LYS LYS B . n 
B 1 194 LEU 194 1194 1194 LEU LEU B . n 
B 1 195 LYS 195 1195 1195 LYS LYS B . n 
B 1 196 LYS 196 1196 1196 LYS LYS B . n 
B 1 197 LEU 197 1197 1197 LEU LEU B . n 
B 1 198 GLY 198 1198 1198 GLY GLY B . n 
B 1 199 ILE 199 1199 1199 ILE ILE B . n 
B 1 200 ASN 200 1200 1200 ASN ASN B . n 
B 1 201 LYS 201 1201 1201 LYS LYS B . n 
B 1 202 LEU 202 1202 1202 LEU LEU B . n 
B 1 203 VAL 203 1203 1203 VAL VAL B . n 
B 1 204 ASP 204 1204 1204 ASP ASP B . n 
B 1 205 THR 205 1205 1205 THR THR B . n 
B 1 206 LEU 206 1206 1206 LEU LEU B . n 
B 1 207 SER 207 1207 1207 SER SER B . n 
B 1 208 ILE 208 1208 1208 ILE ILE B . n 
B 1 209 GLU 209 1209 1209 GLU GLU B . n 
B 1 210 PHE 210 1210 1210 PHE PHE B . n 
B 1 211 ASP 211 1211 1211 ASP ASP B . n 
B 1 212 LYS 212 1212 1212 LYS LYS B . n 
B 1 213 LEU 213 1213 1213 LEU LEU B . n 
B 1 214 LYS 214 1214 1214 LYS LYS B . n 
B 1 215 GLY 215 1215 1215 GLY GLY B . n 
B 1 216 MET 216 1216 1216 MET MET B . n 
B 1 217 ILE 217 1217 1217 ILE ILE B . n 
B 1 218 GLY 218 1218 1218 GLY GLY B . n 
B 1 219 GLU 219 1219 1219 GLU GLU B . n 
B 1 220 ALA 220 1220 1220 ALA ALA B . n 
B 1 221 LYS 221 1221 1221 LYS LYS B . n 
B 1 222 ALA 222 1222 1222 ALA ALA B . n 
B 1 223 LYS 223 1223 1223 LYS LYS B . n 
B 1 224 TYR 224 1224 1224 TYR TYR B . n 
B 1 225 LEU 225 1225 1225 LEU LEU B . n 
B 1 226 ILE 226 1226 1226 ILE ILE B . n 
B 1 227 SER 227 1227 1227 SER SER B . n 
B 1 228 LEU 228 1228 1228 LEU LEU B . n 
B 1 229 ALA 229 1229 1229 ALA ALA B . n 
B 1 230 ARG 230 1230 1230 ARG ARG B . n 
B 1 231 ASP 231 1231 1231 ASP ASP B . n 
B 1 232 GLU 232 1232 1232 GLU GLU B . n 
B 1 233 TYR 233 1233 1233 TYR TYR B . n 
B 1 234 ASN 234 1234 1234 ASN ASN B . n 
B 1 235 GLU 235 1235 1235 GLU GLU B . n 
B 1 236 PRO 236 1236 1236 PRO PRO B . n 
B 1 237 ILE 237 1237 1237 ILE ILE B . n 
B 1 238 ARG 238 1238 1238 ARG ARG B . n 
B 1 239 THR 239 1239 1239 THR THR B . n 
B 1 240 ARG 240 1240 1240 ARG ARG B . n 
B 1 241 VAL 241 1241 1241 VAL VAL B . n 
B 1 242 ARG 242 1242 1242 ARG ARG B . n 
B 1 243 LYS 243 1243 1243 LYS LYS B . n 
B 1 244 SER 244 1244 1244 SER SER B . n 
B 1 245 ILE 245 1245 1245 ILE ILE B . n 
B 1 246 GLY 246 1246 1246 GLY GLY B . n 
B 1 247 ARG 247 1247 1247 ARG ARG B . n 
B 1 248 ILE 248 1248 1248 ILE ILE B . n 
B 1 249 VAL 249 1249 1249 VAL VAL B . n 
B 1 250 THR 250 1250 1250 THR THR B . n 
B 1 251 MET 251 1251 1251 MET MET B . n 
B 1 252 LYS 252 1252 1252 LYS LYS B . n 
B 1 253 ARG 253 1253 1253 ARG ARG B . n 
B 1 254 ASN 254 1254 1254 ASN ASN B . n 
B 1 255 SER 255 1255 1255 SER SER B . n 
B 1 256 ARG 256 1256 1256 ARG ARG B . n 
B 1 257 ASN 257 1257 1257 ASN ASN B . n 
B 1 258 LEU 258 1258 1258 LEU LEU B . n 
B 1 259 GLU 259 1259 1259 GLU GLU B . n 
B 1 260 GLU 260 1260 1260 GLU GLU B . n 
B 1 261 ILE 261 1261 1261 ILE ILE B . n 
B 1 262 LYS 262 1262 1262 LYS LYS B . n 
B 1 263 PRO 263 1263 1263 PRO PRO B . n 
B 1 264 TYR 264 1264 1264 TYR TYR B . n 
B 1 265 LEU 265 1265 1265 LEU LEU B . n 
B 1 266 PHE 266 1266 1266 PHE PHE B . n 
B 1 267 ARG 267 1267 1267 ARG ARG B . n 
B 1 268 ALA 268 1268 1268 ALA ALA B . n 
B 1 269 ILE 269 1269 1269 ILE ILE B . n 
B 1 270 GLU 270 1270 1270 GLU GLU B . n 
B 1 271 GLU 271 1271 1271 GLU GLU B . n 
B 1 272 SER 272 1272 1272 SER SER B . n 
B 1 273 TYR 273 1273 1273 TYR TYR B . n 
B 1 274 TYR 274 1274 1274 TYR TYR B . n 
B 1 275 LYS 275 1275 1275 LYS LYS B . n 
B 1 276 LEU 276 1276 1276 LEU LEU B . n 
B 1 277 ASP 277 1277 1277 ASP ASP B . n 
B 1 278 LYS 278 1278 1278 LYS LYS B . n 
B 1 279 ARG 279 1279 1279 ARG ARG B . n 
B 1 280 ILE 280 1280 1280 ILE ILE B . n 
B 1 281 PRO 281 1281 1281 PRO PRO B . n 
B 1 282 LYS 282 1282 1282 LYS LYS B . n 
B 1 283 ALA 283 1283 1283 ALA ALA B . n 
B 1 284 ILE 284 1284 1284 ILE ILE B . n 
B 1 285 HIS 285 1285 1285 HIS HIS B . n 
B 1 286 VAL 286 1286 1286 VAL VAL B . n 
B 1 287 VAL 287 1287 1287 VAL VAL B . n 
B 1 288 ALA 288 1288 1288 ALA ALA B . n 
B 1 289 VAL 289 1289 1289 VAL VAL B . n 
B 1 290 THR 290 1290 1290 THR THR B . n 
B 1 291 GLU 291 1291 1291 GLU GLU B . n 
B 1 292 ASP 292 1292 1292 ASP ASP B . n 
B 1 293 LEU 293 1293 1293 LEU LEU B . n 
B 1 294 ASP 294 1294 1294 ASP ASP B . n 
B 1 295 ILE 295 1295 1295 ILE ILE B . n 
B 1 296 VAL 296 1296 1296 VAL VAL B . n 
B 1 297 SER 297 1297 1297 SER SER B . n 
B 1 298 ARG 298 1298 1298 ARG ARG B . n 
B 1 299 GLY 299 1299 1299 GLY GLY B . n 
B 1 300 ARG 300 1300 1300 ARG ARG B . n 
B 1 301 THR 301 1301 1301 THR THR B . n 
B 1 302 PHE 302 1302 1302 PHE PHE B . n 
B 1 303 PRO 303 1303 1303 PRO PRO B . n 
B 1 304 HIS 304 1304 1304 HIS HIS B . n 
B 1 305 GLY 305 1305 1305 GLY GLY B . n 
B 1 306 ILE 306 1306 1306 ILE ILE B . n 
B 1 307 SER 307 1307 1307 SER SER B . n 
B 1 308 LYS 308 1308 1308 LYS LYS B . n 
B 1 309 GLU 309 1309 1309 GLU GLU B . n 
B 1 310 THR 310 1310 1310 THR THR B . n 
B 1 311 ALA 311 1311 1311 ALA ALA B . n 
B 1 312 TYR 312 1312 1312 TYR TYR B . n 
B 1 313 SER 313 1313 1313 SER SER B . n 
B 1 314 GLU 314 1314 1314 GLU GLU B . n 
B 1 315 SER 315 1315 1315 SER SER B . n 
B 1 316 VAL 316 1316 1316 VAL VAL B . n 
B 1 317 LYS 317 1317 1317 LYS LYS B . n 
B 1 318 LEU 318 1318 1318 LEU LEU B . n 
B 1 319 LEU 319 1319 1319 LEU LEU B . n 
B 1 320 GLN 320 1320 1320 GLN GLN B . n 
B 1 321 LYS 321 1321 1321 LYS LYS B . n 
B 1 322 ILE 322 1322 1322 ILE ILE B . n 
B 1 323 LEU 323 1323 1323 LEU LEU B . n 
B 1 324 GLU 324 1324 1324 GLU GLU B . n 
B 1 325 GLU 325 1325 1325 GLU GLU B . n 
B 1 326 ASP 326 1326 1326 ASP ASP B . n 
B 1 327 GLU 327 1327 1327 GLU GLU B . n 
B 1 328 ARG 328 1328 1328 ARG ARG B . n 
B 1 329 LYS 329 1329 1329 LYS LYS B . n 
B 1 330 ILE 330 1330 1330 ILE ILE B . n 
B 1 331 ARG 331 1331 1331 ARG ARG B . n 
B 1 332 ARG 332 1332 1332 ARG ARG B . n 
B 1 333 ILE 333 1333 1333 ILE ILE B . n 
B 1 334 GLY 334 1334 1334 GLY GLY B . n 
B 1 335 VAL 335 1335 1335 VAL VAL B . n 
B 1 336 ARG 336 1336 1336 ARG ARG B . n 
B 1 337 PHE 337 1337 1337 PHE PHE B . n 
B 1 338 SER 338 1338 1338 SER SER B . n 
B 1 339 LYS 339 1339 1339 LYS LYS B . n 
B 1 340 PHE 340 1340 1340 PHE PHE B . n 
B 1 341 ILE 341 1341 1341 ILE ILE B . n 
C 2 1   DG  1   802  802  DG  G   D . n 
C 2 2   DT  2   803  803  DT  T   D . n 
C 2 3   DT  3   804  804  DT  T   D . n 
C 2 4   DG  4   805  805  DG  G   D . n 
C 2 5   DG  5   806  806  DG  G   D . n 
C 2 6   DA  6   807  807  DA  A   D . n 
C 2 7   DT  7   808  808  DT  T   D . n 
C 2 8   DG  8   809  809  DG  G   D . n 
C 2 9   DG  9   810  810  DG  G   D . n 
C 2 10  DT  10  811  811  DT  T   D . n 
C 2 11  DA  11  812  812  DA  A   D . n 
C 2 12  DG  12  813  813  DG  G   D . n 
C 2 13  2DT 13  814  814  2DT 2DT D . n 
D 3 1   DC  1   901  901  DC  C   E . n 
D 3 2   DT  2   902  902  DT  T   E . n 
D 3 3   DA  3   903  903  DA  A   E . n 
D 3 4   DA  4   904  904  DA  A   E . n 
D 3 5   DC  5   905  905  DC  C   E . n 
D 3 6   8OG 6   906  906  8OG 8OG E . n 
D 3 7   DC  7   907  907  DC  C   E . n 
D 3 8   DT  8   908  908  DT  T   E . n 
D 3 9   DA  9   909  909  DA  A   E . n 
D 3 10  DC  10  910  910  DC  C   E . n 
D 3 11  DC  11  911  911  DC  C   E . n 
D 3 12  DA  12  912  912  DA  A   E . n 
D 3 13  DT  13  913  913  DT  T   E . n 
D 3 14  DC  14  914  914  DC  C   E . n 
D 3 15  DC  15  915  915  DC  C   E . n 
D 3 16  DA  16  916  916  DA  A   E . n 
D 3 17  DA  17  917  917  DA  A   E . n 
D 3 18  DC  18  918  918  DC  C   E . n 
E 2 1   DG  1   1802 1802 DG  G   H . n 
E 2 2   DT  2   1803 1803 DT  T   H . n 
E 2 3   DT  3   1804 1804 DT  T   H . n 
E 2 4   DG  4   1805 1805 DG  G   H . n 
E 2 5   DG  5   1806 1806 DG  G   H . n 
E 2 6   DA  6   1807 1807 DA  A   H . n 
E 2 7   DT  7   1808 1808 DT  T   H . n 
E 2 8   DG  8   1809 1809 DG  G   H . n 
E 2 9   DG  9   1810 1810 DG  G   H . n 
E 2 10  DT  10  1811 1811 DT  T   H . n 
E 2 11  DA  11  1812 1812 DA  A   H . n 
E 2 12  DG  12  1813 1813 DG  G   H . n 
E 2 13  2DT 13  1814 1814 2DT 2DT H . n 
F 3 1   DC  1   1901 ?    ?   ?   J . n 
F 3 2   DT  2   1902 ?    ?   ?   J . n 
F 3 3   DA  3   1903 1903 DA  A   J . n 
F 3 4   DA  4   1904 1904 DA  A   J . n 
F 3 5   DC  5   1905 1905 DC  C   J . n 
F 3 6   8OG 6   1906 1906 8OG 8OG J . n 
F 3 7   DC  7   1907 1907 DC  C   J . n 
F 3 8   DT  8   1908 1908 DT  T   J . n 
F 3 9   DA  9   1909 1909 DA  A   J . n 
F 3 10  DC  10  1910 1910 DC  C   J . n 
F 3 11  DC  11  1911 1911 DC  C   J . n 
F 3 12  DA  12  1912 1912 DA  A   J . n 
F 3 13  DT  13  1913 1913 DT  T   J . n 
F 3 14  DC  14  1914 1914 DC  C   J . n 
F 3 15  DC  15  1915 1915 DC  C   J . n 
F 3 16  DA  16  1916 1916 DA  A   J . n 
F 3 17  DA  17  1917 1917 DA  A   J . n 
F 3 18  DC  18  1918 1918 DC  C   J . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 DGT 1  414  414  DGT DGT A . 
H 5 CA  1  415  415  CA  CA  A . 
I 5 CA  1  416  416  CA  CA  A . 
J 5 CA  1  417  417  CA  CA  A . 
K 4 DGT 1  1414 1414 DGT DGT B . 
L 5 CA  1  1415 1415 CA  CA  B . 
M 5 CA  1  1416 1416 CA  CA  B . 
N 5 CA  1  1417 1417 CA  CA  B . 
O 6 HOH 1  503  503  HOH HOH A . 
O 6 HOH 2  506  506  HOH HOH A . 
O 6 HOH 3  508  508  HOH HOH A . 
O 6 HOH 4  509  509  HOH HOH A . 
O 6 HOH 5  510  510  HOH HOH A . 
O 6 HOH 6  513  513  HOH HOH A . 
O 6 HOH 7  514  514  HOH HOH A . 
O 6 HOH 8  515  515  HOH HOH A . 
O 6 HOH 9  516  516  HOH HOH A . 
O 6 HOH 10 517  517  HOH HOH A . 
O 6 HOH 11 518  518  HOH HOH A . 
O 6 HOH 12 520  520  HOH HOH A . 
O 6 HOH 13 521  521  HOH HOH A . 
O 6 HOH 14 522  522  HOH HOH A . 
O 6 HOH 15 523  523  HOH HOH A . 
O 6 HOH 16 527  527  HOH HOH A . 
O 6 HOH 17 529  529  HOH HOH A . 
O 6 HOH 18 530  530  HOH HOH A . 
O 6 HOH 19 531  531  HOH HOH A . 
O 6 HOH 20 533  533  HOH HOH A . 
O 6 HOH 21 537  537  HOH HOH A . 
O 6 HOH 22 538  538  HOH HOH A . 
O 6 HOH 23 539  539  HOH HOH A . 
O 6 HOH 24 540  540  HOH HOH A . 
O 6 HOH 25 541  541  HOH HOH A . 
O 6 HOH 26 542  542  HOH HOH A . 
O 6 HOH 27 543  543  HOH HOH A . 
O 6 HOH 28 544  544  HOH HOH A . 
O 6 HOH 29 545  545  HOH HOH A . 
O 6 HOH 30 546  546  HOH HOH A . 
O 6 HOH 31 547  547  HOH HOH A . 
O 6 HOH 32 548  548  HOH HOH A . 
O 6 HOH 33 550  550  HOH HOH A . 
O 6 HOH 34 553  553  HOH HOH A . 
O 6 HOH 35 555  555  HOH HOH A . 
O 6 HOH 36 556  556  HOH HOH A . 
O 6 HOH 37 558  558  HOH HOH A . 
O 6 HOH 38 560  560  HOH HOH A . 
O 6 HOH 39 561  561  HOH HOH A . 
O 6 HOH 40 562  562  HOH HOH A . 
O 6 HOH 41 563  563  HOH HOH A . 
O 6 HOH 42 564  564  HOH HOH A . 
O 6 HOH 43 566  566  HOH HOH A . 
O 6 HOH 44 567  567  HOH HOH A . 
O 6 HOH 45 568  568  HOH HOH A . 
O 6 HOH 46 569  569  HOH HOH A . 
O 6 HOH 47 570  570  HOH HOH A . 
O 6 HOH 48 571  571  HOH HOH A . 
O 6 HOH 49 573  573  HOH HOH A . 
O 6 HOH 50 576  576  HOH HOH A . 
O 6 HOH 51 579  579  HOH HOH A . 
O 6 HOH 52 582  582  HOH HOH A . 
O 6 HOH 53 583  583  HOH HOH A . 
O 6 HOH 54 585  585  HOH HOH A . 
O 6 HOH 55 589  589  HOH HOH A . 
O 6 HOH 56 593  593  HOH HOH A . 
O 6 HOH 57 594  594  HOH HOH A . 
O 6 HOH 58 595  595  HOH HOH A . 
O 6 HOH 59 596  596  HOH HOH A . 
O 6 HOH 60 598  598  HOH HOH A . 
O 6 HOH 61 601  601  HOH HOH A . 
O 6 HOH 62 602  602  HOH HOH A . 
O 6 HOH 63 603  603  HOH HOH A . 
O 6 HOH 64 604  604  HOH HOH A . 
O 6 HOH 65 607  607  HOH HOH A . 
O 6 HOH 66 609  609  HOH HOH A . 
O 6 HOH 67 610  610  HOH HOH A . 
O 6 HOH 68 611  611  HOH HOH A . 
O 6 HOH 69 614  614  HOH HOH A . 
O 6 HOH 70 615  615  HOH HOH A . 
O 6 HOH 71 616  616  HOH HOH A . 
O 6 HOH 72 618  618  HOH HOH A . 
O 6 HOH 73 619  619  HOH HOH A . 
O 6 HOH 74 632  632  HOH HOH A . 
P 6 HOH 1  501  501  HOH HOH B . 
P 6 HOH 2  502  502  HOH HOH B . 
P 6 HOH 3  511  511  HOH HOH B . 
P 6 HOH 4  519  519  HOH HOH B . 
P 6 HOH 5  526  526  HOH HOH B . 
P 6 HOH 6  532  532  HOH HOH B . 
P 6 HOH 7  554  554  HOH HOH B . 
P 6 HOH 8  565  565  HOH HOH B . 
P 6 HOH 9  572  572  HOH HOH B . 
P 6 HOH 10 581  581  HOH HOH B . 
P 6 HOH 11 584  584  HOH HOH B . 
P 6 HOH 12 587  587  HOH HOH B . 
P 6 HOH 13 588  588  HOH HOH B . 
P 6 HOH 14 592  592  HOH HOH B . 
P 6 HOH 15 597  597  HOH HOH B . 
P 6 HOH 16 621  621  HOH HOH B . 
P 6 HOH 17 622  622  HOH HOH B . 
P 6 HOH 18 623  623  HOH HOH B . 
P 6 HOH 19 624  624  HOH HOH B . 
P 6 HOH 20 626  626  HOH HOH B . 
P 6 HOH 21 627  627  HOH HOH B . 
Q 6 HOH 1  504  504  HOH HOH D . 
Q 6 HOH 2  512  512  HOH HOH D . 
Q 6 HOH 3  525  525  HOH HOH D . 
Q 6 HOH 4  534  534  HOH HOH D . 
Q 6 HOH 5  535  535  HOH HOH D . 
Q 6 HOH 6  536  536  HOH HOH D . 
Q 6 HOH 7  574  574  HOH HOH D . 
Q 6 HOH 8  586  586  HOH HOH D . 
Q 6 HOH 9  617  617  HOH HOH D . 
Q 6 HOH 10 620  620  HOH HOH D . 
Q 6 HOH 11 629  629  HOH HOH D . 
Q 6 HOH 12 630  630  HOH HOH D . 
Q 6 HOH 13 631  631  HOH HOH D . 
R 6 HOH 1  505  505  HOH HOH E . 
R 6 HOH 2  507  507  HOH HOH E . 
R 6 HOH 3  528  528  HOH HOH E . 
R 6 HOH 4  605  605  HOH HOH E . 
R 6 HOH 5  606  606  HOH HOH E . 
R 6 HOH 6  608  608  HOH HOH E . 
S 6 HOH 1  625  625  HOH HOH H . 
S 6 HOH 2  628  628  HOH HOH H . 
T 6 HOH 1  599  599  HOH HOH J . 
T 6 HOH 2  612  612  HOH HOH J . 
T 6 HOH 3  613  613  HOH HOH J . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 C 2DT 13 D 2DT 814  ? DT "3'-DEOXYTHYMIDINE-5'-MONOPHOSPHATE" 
2 D 8OG 6  E 8OG 906  ? DG ?                                    
3 E 2DT 13 H 2DT 1814 ? DT "3'-DEOXYTHYMIDINE-5'-MONOPHOSPHATE" 
4 F 8OG 6  J 8OG 1906 ? DG ?                                    
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA trimeric 3 
2 author_and_software_defined_assembly PISA trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,G,H,I,J,O,Q,R 
2 1 B,E,F,K,L,M,N,P,S,T 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4010  ? 
1 MORE         -31.9 ? 
1 'SSA (A^2)'  21330 ? 
2 'ABSA (A^2)' 3740  ? 
2 MORE         -32.4 ? 
2 'SSA (A^2)'  21660 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1   OD1 ? A ASP 7   ? A ASP 7    ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O   ? A PHE 8   ? A PHE 8    ? 1_555 76.7  ? 
2   OD1 ? A ASP 7   ? A ASP 7    ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 OD2 ? A ASP 105 ? A ASP 105  ? 1_555 88.6  ? 
3   O   ? A PHE 8   ? A PHE 8    ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 OD2 ? A ASP 105 ? A ASP 105  ? 1_555 81.8  ? 
4   OD1 ? A ASP 7   ? A ASP 7    ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O1G ? G DGT .   ? A DGT 414  ? 1_555 99.3  ? 
5   O   ? A PHE 8   ? A PHE 8    ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O1G ? G DGT .   ? A DGT 414  ? 1_555 115.4 ? 
6   OD2 ? A ASP 105 ? A ASP 105  ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O1G ? G DGT .   ? A DGT 414  ? 1_555 162.3 ? 
7   OD1 ? A ASP 7   ? A ASP 7    ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O1B ? G DGT .   ? A DGT 414  ? 1_555 169.5 ? 
8   O   ? A PHE 8   ? A PHE 8    ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O1B ? G DGT .   ? A DGT 414  ? 1_555 92.8  ? 
9   OD2 ? A ASP 105 ? A ASP 105  ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O1B ? G DGT .   ? A DGT 414  ? 1_555 89.3  ? 
10  O1G ? G DGT .   ? A DGT 414  ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O1B ? G DGT .   ? A DGT 414  ? 1_555 85.6  ? 
11  OD1 ? A ASP 7   ? A ASP 7    ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O2A ? G DGT .   ? A DGT 414  ? 1_555 102.9 ? 
12  O   ? A PHE 8   ? A PHE 8    ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O2A ? G DGT .   ? A DGT 414  ? 1_555 160.3 ? 
13  OD2 ? A ASP 105 ? A ASP 105  ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O2A ? G DGT .   ? A DGT 414  ? 1_555 78.5  ? 
14  O1G ? G DGT .   ? A DGT 414  ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O2A ? G DGT .   ? A DGT 414  ? 1_555 84.2  ? 
15  O1B ? G DGT .   ? A DGT 414  ? 1_555 CA ? I CA . ? A CA 416  ? 1_555 O2A ? G DGT .   ? A DGT 414  ? 1_555 86.7  ? 
16  OD2 ? A ASP 7   ? A ASP 7    ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 OD1 ? A ASP 105 ? A ASP 105  ? 1_555 125.9 ? 
17  OD2 ? A ASP 7   ? A ASP 7    ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 OE2 ? A GLU 106 ? A GLU 106  ? 1_555 71.2  ? 
18  OD1 ? A ASP 105 ? A ASP 105  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 OE2 ? A GLU 106 ? A GLU 106  ? 1_555 108.7 ? 
19  OD2 ? A ASP 7   ? A ASP 7    ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 O2A ? G DGT .   ? A DGT 414  ? 1_555 100.5 ? 
20  OD1 ? A ASP 105 ? A ASP 105  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 O2A ? G DGT .   ? A DGT 414  ? 1_555 92.5  ? 
21  OE2 ? A GLU 106 ? A GLU 106  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 O2A ? G DGT .   ? A DGT 414  ? 1_555 158.3 ? 
22  OD2 ? A ASP 7   ? A ASP 7    ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 O   ? O HOH .   ? A HOH 614  ? 1_555 158.1 ? 
23  OD1 ? A ASP 105 ? A ASP 105  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 O   ? O HOH .   ? A HOH 614  ? 1_555 69.3  ? 
24  OE2 ? A GLU 106 ? A GLU 106  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 O   ? O HOH .   ? A HOH 614  ? 1_555 89.4  ? 
25  O2A ? G DGT .   ? A DGT 414  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 O   ? O HOH .   ? A HOH 614  ? 1_555 93.9  ? 
26  OD2 ? A ASP 7   ? A ASP 7    ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 O   ? O HOH .   ? A HOH 615  ? 1_555 78.1  ? 
27  OD1 ? A ASP 105 ? A ASP 105  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 O   ? O HOH .   ? A HOH 615  ? 1_555 155.0 ? 
28  OE2 ? A GLU 106 ? A GLU 106  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 O   ? O HOH .   ? A HOH 615  ? 1_555 84.3  ? 
29  O2A ? G DGT .   ? A DGT 414  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 O   ? O HOH .   ? A HOH 615  ? 1_555 74.2  ? 
30  O   ? O HOH .   ? A HOH 614  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 O   ? O HOH .   ? A HOH 615  ? 1_555 90.1  ? 
31  OD2 ? A ASP 7   ? A ASP 7    ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 OD2 ? A ASP 105 ? A ASP 105  ? 1_555 97.8  ? 
32  OD1 ? A ASP 105 ? A ASP 105  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 OD2 ? A ASP 105 ? A ASP 105  ? 1_555 44.4  ? 
33  OE2 ? A GLU 106 ? A GLU 106  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 OD2 ? A ASP 105 ? A ASP 105  ? 1_555 137.4 ? 
34  O2A ? G DGT .   ? A DGT 414  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 OD2 ? A ASP 105 ? A ASP 105  ? 1_555 62.3  ? 
35  O   ? O HOH .   ? A HOH 614  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 OD2 ? A ASP 105 ? A ASP 105  ? 1_555 103.5 ? 
36  O   ? O HOH .   ? A HOH 615  ? 1_555 CA ? H CA . ? A CA 415  ? 1_555 OD2 ? A ASP 105 ? A ASP 105  ? 1_555 135.0 ? 
37  O   ? A ALA 181 ? A ALA 181  ? 1_555 CA ? J CA . ? A CA 417  ? 1_555 O   ? A ILE 186 ? A ILE 186  ? 1_555 86.7  ? 
38  O   ? A ALA 181 ? A ALA 181  ? 1_555 CA ? J CA . ? A CA 417  ? 1_555 O   ? O HOH .   ? A HOH 616  ? 1_555 81.9  ? 
39  O   ? A ILE 186 ? A ILE 186  ? 1_555 CA ? J CA . ? A CA 417  ? 1_555 O   ? O HOH .   ? A HOH 616  ? 1_555 128.6 ? 
40  O   ? A ALA 181 ? A ALA 181  ? 1_555 CA ? J CA . ? A CA 417  ? 1_555 O   ? O HOH .   ? A HOH 619  ? 1_555 70.5  ? 
41  O   ? A ILE 186 ? A ILE 186  ? 1_555 CA ? J CA . ? A CA 417  ? 1_555 O   ? O HOH .   ? A HOH 619  ? 1_555 64.2  ? 
42  O   ? O HOH .   ? A HOH 616  ? 1_555 CA ? J CA . ? A CA 417  ? 1_555 O   ? O HOH .   ? A HOH 619  ? 1_555 64.7  ? 
43  O   ? A ALA 181 ? A ALA 181  ? 1_555 CA ? J CA . ? A CA 417  ? 1_555 O   ? Q HOH .   ? D HOH 617  ? 1_555 140.4 ? 
44  O   ? A ILE 186 ? A ILE 186  ? 1_555 CA ? J CA . ? A CA 417  ? 1_555 O   ? Q HOH .   ? D HOH 617  ? 1_555 90.0  ? 
45  O   ? O HOH .   ? A HOH 616  ? 1_555 CA ? J CA . ? A CA 417  ? 1_555 O   ? Q HOH .   ? D HOH 617  ? 1_555 69.6  ? 
46  O   ? O HOH .   ? A HOH 619  ? 1_555 CA ? J CA . ? A CA 417  ? 1_555 O   ? Q HOH .   ? D HOH 617  ? 1_555 72.6  ? 
47  OD1 ? B ASP 7   ? B ASP 1007 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O   ? B PHE 8   ? B PHE 1008 ? 1_555 83.6  ? 
48  OD1 ? B ASP 7   ? B ASP 1007 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 OD2 ? B ASP 105 ? B ASP 1105 ? 1_555 83.9  ? 
49  O   ? B PHE 8   ? B PHE 1008 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 OD2 ? B ASP 105 ? B ASP 1105 ? 1_555 76.9  ? 
50  OD1 ? B ASP 7   ? B ASP 1007 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O1G ? K DGT .   ? B DGT 1414 ? 1_555 96.9  ? 
51  O   ? B PHE 8   ? B PHE 1008 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O1G ? K DGT .   ? B DGT 1414 ? 1_555 119.9 ? 
52  OD2 ? B ASP 105 ? B ASP 1105 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O1G ? K DGT .   ? B DGT 1414 ? 1_555 163.1 ? 
53  OD1 ? B ASP 7   ? B ASP 1007 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O1B ? K DGT .   ? B DGT 1414 ? 1_555 170.3 ? 
54  O   ? B PHE 8   ? B PHE 1008 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O1B ? K DGT .   ? B DGT 1414 ? 1_555 87.1  ? 
55  OD2 ? B ASP 105 ? B ASP 1105 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O1B ? K DGT .   ? B DGT 1414 ? 1_555 96.8  ? 
56  O1G ? K DGT .   ? B DGT 1414 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O1B ? K DGT .   ? B DGT 1414 ? 1_555 85.2  ? 
57  OD1 ? B ASP 7   ? B ASP 1007 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O2A ? K DGT .   ? B DGT 1414 ? 1_555 101.6 ? 
58  O   ? B PHE 8   ? B PHE 1008 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O2A ? K DGT .   ? B DGT 1414 ? 1_555 164.0 ? 
59  OD2 ? B ASP 105 ? B ASP 1105 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O2A ? K DGT .   ? B DGT 1414 ? 1_555 88.4  ? 
60  O1G ? K DGT .   ? B DGT 1414 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O2A ? K DGT .   ? B DGT 1414 ? 1_555 74.9  ? 
61  O1B ? K DGT .   ? B DGT 1414 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O2A ? K DGT .   ? B DGT 1414 ? 1_555 88.1  ? 
62  OD1 ? B ASP 7   ? B ASP 1007 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O   ? P HOH .   ? B HOH 597  ? 1_555 55.2  ? 
63  O   ? B PHE 8   ? B PHE 1008 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O   ? P HOH .   ? B HOH 597  ? 1_555 65.9  ? 
64  OD2 ? B ASP 105 ? B ASP 1105 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O   ? P HOH .   ? B HOH 597  ? 1_555 126.0 ? 
65  O1G ? K DGT .   ? B DGT 1414 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O   ? P HOH .   ? B HOH 597  ? 1_555 66.1  ? 
66  O1B ? K DGT .   ? B DGT 1414 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O   ? P HOH .   ? B HOH 597  ? 1_555 117.9 ? 
67  O2A ? K DGT .   ? B DGT 1414 ? 1_555 CA ? M CA . ? B CA 1416 ? 1_555 O   ? P HOH .   ? B HOH 597  ? 1_555 129.5 ? 
68  OD2 ? B ASP 7   ? B ASP 1007 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 OD1 ? B ASP 105 ? B ASP 1105 ? 1_555 129.3 ? 
69  OD2 ? B ASP 7   ? B ASP 1007 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 OE2 ? B GLU 106 ? B GLU 1106 ? 1_555 93.8  ? 
70  OD1 ? B ASP 105 ? B ASP 1105 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 OE2 ? B GLU 106 ? B GLU 1106 ? 1_555 104.1 ? 
71  OD2 ? B ASP 7   ? B ASP 1007 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 O2A ? K DGT .   ? B DGT 1414 ? 1_555 105.3 ? 
72  OD1 ? B ASP 105 ? B ASP 1105 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 O2A ? K DGT .   ? B DGT 1414 ? 1_555 96.4  ? 
73  OE2 ? B GLU 106 ? B GLU 1106 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 O2A ? K DGT .   ? B DGT 1414 ? 1_555 132.8 ? 
74  OD2 ? B ASP 7   ? B ASP 1007 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 O   ? P HOH .   ? B HOH 621  ? 1_555 67.4  ? 
75  OD1 ? B ASP 105 ? B ASP 1105 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 O   ? P HOH .   ? B HOH 621  ? 1_555 160.0 ? 
76  OE2 ? B GLU 106 ? B GLU 1106 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 O   ? P HOH .   ? B HOH 621  ? 1_555 60.1  ? 
77  O2A ? K DGT .   ? B DGT 1414 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 O   ? P HOH .   ? B HOH 621  ? 1_555 87.9  ? 
78  OD2 ? B ASP 7   ? B ASP 1007 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 OD1 ? B ASP 7   ? B ASP 1007 ? 1_555 44.0  ? 
79  OD1 ? B ASP 105 ? B ASP 1105 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 OD1 ? B ASP 7   ? B ASP 1007 ? 1_555 98.1  ? 
80  OE2 ? B GLU 106 ? B GLU 1106 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 OD1 ? B ASP 7   ? B ASP 1007 ? 1_555 136.1 ? 
81  O2A ? K DGT .   ? B DGT 1414 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 OD1 ? B ASP 7   ? B ASP 1007 ? 1_555 80.3  ? 
82  O   ? P HOH .   ? B HOH 621  ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 OD1 ? B ASP 7   ? B ASP 1007 ? 1_555 101.9 ? 
83  OD2 ? B ASP 7   ? B ASP 1007 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 OD2 ? B ASP 105 ? B ASP 1105 ? 1_555 101.6 ? 
84  OD1 ? B ASP 105 ? B ASP 1105 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 OD2 ? B ASP 105 ? B ASP 1105 ? 1_555 44.2  ? 
85  OE2 ? B GLU 106 ? B GLU 1106 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 OD2 ? B ASP 105 ? B ASP 1105 ? 1_555 147.0 ? 
86  O2A ? K DGT .   ? B DGT 1414 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 OD2 ? B ASP 105 ? B ASP 1105 ? 1_555 70.6  ? 
87  O   ? P HOH .   ? B HOH 621  ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 OD2 ? B ASP 105 ? B ASP 1105 ? 1_555 152.9 ? 
88  OD1 ? B ASP 7   ? B ASP 1007 ? 1_555 CA ? L CA . ? B CA 1415 ? 1_555 OD2 ? B ASP 105 ? B ASP 1105 ? 1_555 59.2  ? 
89  O   ? B ALA 181 ? B ALA 1181 ? 1_555 CA ? N CA . ? B CA 1417 ? 1_555 O   ? B ILE 186 ? B ILE 1186 ? 1_555 84.2  ? 
90  O   ? B ALA 181 ? B ALA 1181 ? 1_555 CA ? N CA . ? B CA 1417 ? 1_555 OP1 ? E DG  12  ? H DG  1813 ? 1_555 163.1 ? 
91  O   ? B ILE 186 ? B ILE 1186 ? 1_555 CA ? N CA . ? B CA 1417 ? 1_555 OP1 ? E DG  12  ? H DG  1813 ? 1_555 78.9  ? 
92  O   ? B ALA 181 ? B ALA 1181 ? 1_555 CA ? N CA . ? B CA 1417 ? 1_555 O   ? P HOH .   ? B HOH 626  ? 1_555 56.1  ? 
93  O   ? B ILE 186 ? B ILE 1186 ? 1_555 CA ? N CA . ? B CA 1417 ? 1_555 O   ? P HOH .   ? B HOH 626  ? 1_555 64.8  ? 
94  OP1 ? E DG  12  ? H DG  1813 ? 1_555 CA ? N CA . ? B CA 1417 ? 1_555 O   ? P HOH .   ? B HOH 626  ? 1_555 115.8 ? 
95  O   ? B ALA 181 ? B ALA 1181 ? 1_555 CA ? N CA . ? B CA 1417 ? 1_555 O   ? P HOH .   ? B HOH 627  ? 1_555 64.8  ? 
96  O   ? B ILE 186 ? B ILE 1186 ? 1_555 CA ? N CA . ? B CA 1417 ? 1_555 O   ? P HOH .   ? B HOH 627  ? 1_555 124.8 ? 
97  OP1 ? E DG  12  ? H DG  1813 ? 1_555 CA ? N CA . ? B CA 1417 ? 1_555 O   ? P HOH .   ? B HOH 627  ? 1_555 126.5 ? 
98  O   ? P HOH .   ? B HOH 626  ? 1_555 CA ? N CA . ? B CA 1417 ? 1_555 O   ? P HOH .   ? B HOH 627  ? 1_555 59.9  ? 
99  O   ? B ALA 181 ? B ALA 1181 ? 1_555 CA ? N CA . ? B CA 1417 ? 1_555 O   ? S HOH .   ? H HOH 625  ? 1_555 103.8 ? 
100 O   ? B ILE 186 ? B ILE 1186 ? 1_555 CA ? N CA . ? B CA 1417 ? 1_555 O   ? S HOH .   ? H HOH 625  ? 1_555 79.3  ? 
101 OP1 ? E DG  12  ? H DG  1813 ? 1_555 CA ? N CA . ? B CA 1417 ? 1_555 O   ? S HOH .   ? H HOH 625  ? 1_555 73.9  ? 
102 O   ? P HOH .   ? B HOH 626  ? 1_555 CA ? N CA . ? B CA 1417 ? 1_555 O   ? S HOH .   ? H HOH 625  ? 1_555 49.6  ? 
103 O   ? P HOH .   ? B HOH 627  ? 1_555 CA ? N CA . ? B CA 1417 ? 1_555 O   ? S HOH .   ? H HOH 625  ? 1_555 66.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-05-19 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2011-12-07 
4 'Structure model' 1 3 2017-11-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Database references'       
4 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.classification'       
2 4 'Structure model' '_software.contact_author'       
3 4 'Structure model' '_software.contact_author_email' 
4 4 'Structure model' '_software.date'                 
5 4 'Structure model' '_software.language'             
6 4 'Structure model' '_software.location'             
7 4 'Structure model' '_software.name'                 
8 4 'Structure model' '_software.type'                 
9 4 'Structure model' '_software.version'              
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 12.7490 1.3471  2.6629  -0.3130 -0.3289 -0.1839 -0.0116 -0.0018 0.0142 2.0860 1.6380 0.9791 -0.4640 0.1647  0.1257  
-0.0561 0.0715  -0.0154 -0.1934 -0.0635 0.0653  0.1076 -0.0326 0.0537 'X-RAY DIFFRACTION' 
2 ? refined 21.2236 -7.1044 12.9956 -0.1300 -0.0218 -0.0949 0.0425  -0.0538 0.0310 2.0606 2.1659 1.9419 -0.7863 0.1298  0.0745  
-0.3960 0.2740  0.1220  -0.5980 0.0234  -0.2821 0.5973 -0.0997 0.3297 'X-RAY DIFFRACTION' 
3 ? refined -6.4650 57.2798 40.0899 -0.0473 0.0389  -0.1424 -0.0516 0.0392  0.0003 2.0316 1.3436 5.1958 -0.5943 -0.2355 -0.9737 
-0.0843 -0.0622 0.1465  -0.4650 -0.0294 -0.0029 0.1533 -0.0019 0.2095 'X-RAY DIFFRACTION' 
4 ? refined 3.9314  47.0289 46.8321 0.3002  0.6925  0.1861  0.0722  -0.0603 0.1275 2.1585 2.7420 4.9655 -0.7564 -1.1648 -1.5604 
-0.4096 -0.2704 0.6800  -0.7266 -0.2132 -0.5445 0.5643 0.3143  1.0631 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A A 341  ? 1    . . . . 'X-RAY DIFFRACTION' ? 
2 2 D D 814  ? 802  . . . . 'X-RAY DIFFRACTION' ? 
3 2 E E 918  ? 901  . . . . 'X-RAY DIFFRACTION' ? 
4 2 A A 414  ? 414  . . . . 'X-RAY DIFFRACTION' ? 
5 3 B B 1341 ? 1001 . . . . 'X-RAY DIFFRACTION' ? 
6 4 H H 1814 ? 1802 . . . . 'X-RAY DIFFRACTION' ? 
7 4 J J 1918 ? 1903 . . . . 'X-RAY DIFFRACTION' ? 
8 4 B B 1414 ? 1414 . . . . 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .        ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com      'data reduction'  http://www.hkl-xray.com/ 
?          ? 1 
SCALEPACK   .        ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com      'data scaling'    http://www.hkl-xray.com/ 
?          ? 2 
REFMAC      5.2.0019 ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 3 
PDB_EXTRACT 3.006    'June 11, 2008' package PDB                  help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 4 
HKL-2000    .        ?               ?       ?                    ?                     'data collection' ? ?          ? 5 
HKL-2000    .        ?               ?       ?                    ?                     'data reduction'  ? ?          ? 6 
AMoRE       .        ?               ?       ?                    ?                     phasing           ? ?          ? 7 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 C     A LYS 159  ? ? N     A PRO 160  ? ? CA    A PRO 160  ? ? 148.13 119.30 28.83  1.50 Y 
2  1 C     A LYS 159  ? ? N     A PRO 160  ? ? CD    A PRO 160  ? ? 102.55 128.40 -25.85 2.10 Y 
3  1 C     B LYS 1159 ? ? N     B PRO 1160 ? ? CA    B PRO 1160 ? ? 128.50 119.30 9.20   1.50 Y 
4  1 "O4'" D DG  802  ? ? "C4'" D DG  802  ? ? "C3'" D DG  802  ? ? 101.12 104.50 -3.38  0.40 N 
5  1 "O4'" D DG  802  ? ? "C1'" D DG  802  ? ? N9    D DG  802  ? ? 110.32 108.30 2.02   0.30 N 
6  1 "O4'" D DG  805  ? ? "C1'" D DG  805  ? ? N9    D DG  805  ? ? 112.01 108.30 3.71   0.30 N 
7  1 "O4'" D DG  809  ? ? "C1'" D DG  809  ? ? N9    D DG  809  ? ? 111.69 108.30 3.39   0.30 N 
8  1 "O4'" D DG  813  ? ? "C1'" D DG  813  ? ? N9    D DG  813  ? ? 113.40 108.30 5.10   0.30 N 
9  1 "O4'" E DA  903  ? ? "C1'" E DA  903  ? ? N9    E DA  903  ? ? 111.18 108.30 2.88   0.30 N 
10 1 "O4'" E DC  905  ? ? "C1'" E DC  905  ? ? N1    E DC  905  ? ? 103.19 108.00 -4.81  0.70 N 
11 1 P     E DC  907  ? ? "O5'" E DC  907  ? ? "C5'" E DC  907  ? ? 110.48 120.90 -10.42 1.60 N 
12 1 "O4'" E DC  907  ? ? "C4'" E DC  907  ? ? "C3'" E DC  907  ? ? 99.68  104.50 -4.82  0.40 N 
13 1 "C1'" E DC  907  ? ? "O4'" E DC  907  ? ? "C4'" E DC  907  ? ? 101.37 110.10 -8.73  1.00 N 
14 1 "O4'" E DC  907  ? ? "C1'" E DC  907  ? ? N1    E DC  907  ? ? 110.43 108.30 2.13   0.30 N 
15 1 "O4'" H DT  1803 ? ? "C1'" H DT  1803 ? ? N1    H DT  1803 ? ? 111.30 108.30 3.00   0.30 N 
16 1 "O4'" H DG  1805 ? ? "C1'" H DG  1805 ? ? N9    H DG  1805 ? ? 112.16 108.30 3.86   0.30 N 
17 1 "C3'" H DG  1805 ? ? "O3'" H DG  1805 ? ? P     H DG  1806 ? ? 128.44 119.70 8.74   1.20 Y 
18 1 "O4'" H DT  1808 ? ? "C1'" H DT  1808 ? ? N1    H DT  1808 ? ? 110.52 108.30 2.22   0.30 N 
19 1 "O4'" H DG  1813 ? ? "C1'" H DG  1813 ? ? N9    H DG  1813 ? ? 113.47 108.30 5.17   0.30 N 
20 1 "O4'" J DT  1908 ? ? "C1'" J DT  1908 ? ? N1    J DT  1908 ? ? 111.46 108.30 3.16   0.30 N 
21 1 "O4'" J DC  1910 ? ? "C1'" J DC  1910 ? ? N1    J DC  1910 ? ? 110.27 108.30 1.97   0.30 N 
22 1 "O4'" J DA  1912 ? ? "C1'" J DA  1912 ? ? N9    J DA  1912 ? ? 111.34 108.30 3.04   0.30 N 
23 1 "O4'" J DT  1913 ? ? "C1'" J DT  1913 ? ? N1    J DT  1913 ? ? 110.59 108.30 2.29   0.30 N 
24 1 "O4'" J DC  1914 ? ? "C1'" J DC  1914 ? ? N1    J DC  1914 ? ? 111.08 108.30 2.78   0.30 N 
25 1 "O4'" J DA  1917 ? ? "C1'" J DA  1917 ? ? N9    J DA  1917 ? ? 113.48 108.30 5.18   0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR A 10   ? ? 29.07   51.55   
2  1 LYS A 159  ? ? -42.73  152.46  
3  1 PRO A 160  ? ? 19.38   117.33  
4  1 ASN A 234  ? ? -151.83 34.32   
5  1 ASP A 277  ? ? 55.14   83.10   
6  1 LYS A 278  ? ? 89.52   -39.11  
7  1 TYR B 1010 ? ? 25.18   54.63   
8  1 ASP B 1039 ? ? 93.31   -6.69   
9  1 ARG B 1077 ? ? -115.95 74.24   
10 1 SER B 1112 ? ? 172.88  -42.18  
11 1 ASP B 1117 ? ? 113.18  133.13  
12 1 SER B 1145 ? ? -160.59 -163.37 
13 1 LYS B 1159 ? ? -61.36  -160.41 
14 1 PRO B 1160 ? ? -2.22   117.75  
15 1 ILE B 1199 ? ? -56.38  103.98  
16 1 SER B 1207 ? ? -150.82 51.23   
17 1 GLU B 1209 ? ? -56.19  95.09   
18 1 PHE B 1210 ? ? -6.09   -60.99  
19 1 ASN B 1234 ? ? -158.70 88.42   
20 1 ASP B 1277 ? ? 34.99   99.78   
21 1 LYS B 1278 ? ? 88.02   -47.64  
22 1 ASP B 1292 ? ? -95.20  34.20   
23 1 LEU B 1293 ? ? 55.88   19.69   
24 1 PRO B 1303 ? ? -90.33  38.43   
25 1 HIS B 1304 ? A -178.34 -136.86 
26 1 ASP B 1326 ? ? -164.86 118.35  
27 1 LYS B 1339 ? ? 53.35   75.33   
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 LYS A 159  ? ? PRO A 160  ? ? -109.98 
2 1 LYS B 1159 ? ? PRO B 1160 ? ? -121.76 
3 1 PRO B 1303 ? ? HIS B 1304 ? A 144.83  
# 
loop_
_pdbx_validate_chiral.id 
_pdbx_validate_chiral.PDB_model_num 
_pdbx_validate_chiral.auth_atom_id 
_pdbx_validate_chiral.label_alt_id 
_pdbx_validate_chiral.auth_asym_id 
_pdbx_validate_chiral.auth_comp_id 
_pdbx_validate_chiral.auth_seq_id 
_pdbx_validate_chiral.PDB_ins_code 
_pdbx_validate_chiral.details 
_pdbx_validate_chiral.omega 
1 1 "C1'" ? E 8OG 906  ? PLANAR . 
2 1 "C1'" ? J 8OG 1906 ? PLANAR . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 J DA 1903 ? P   ? F DA 3 P   
2 1 Y 1 J DA 1903 ? OP1 ? F DA 3 OP1 
3 1 Y 1 J DA 1903 ? OP2 ? F DA 3 OP2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 J DC 1901 ? F DC 1 
2 1 Y 1 J DT 1902 ? F DT 2 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
3GIL 'double helix'         
3GIL 'b-form double helix'  
3GIL 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DG  1  1_555 D DC  18 1_555 -0.556 0.942  0.740  -6.214  -18.282 14.059 1  D_DG802:DC918_E     D 802  ? E 918  ? ?  ? 
1 C DT  2  1_555 D DA  17 1_555 1.086  0.106  0.111  -5.254  -9.117  9.617  2  D_DT803:DA917_E     D 803  ? E 917  ? ?  1 
1 C DT  3  1_555 D DA  16 1_555 -0.156 0.227  -0.280 -0.041  -15.530 3.833  3  D_DT804:DA916_E     D 804  ? E 916  ? 20 1 
1 C DG  4  1_555 D DC  15 1_555 -0.508 0.041  -0.823 -4.323  -4.871  -2.083 4  D_DG805:DC915_E     D 805  ? E 915  ? 19 1 
1 C DG  5  1_555 D DC  14 1_555 -0.119 0.069  -0.022 3.153   -14.574 2.003  5  D_DG806:DC914_E     D 806  ? E 914  ? 19 1 
1 C DA  6  1_555 D DT  13 1_555 -0.219 0.062  0.024  -2.356  -18.188 1.015  6  D_DA807:DT913_E     D 807  ? E 913  ? 20 1 
1 C DT  7  1_555 D DA  12 1_555 0.117  0.050  -0.207 7.199   -10.305 2.429  7  D_DT808:DA912_E     D 808  ? E 912  ? 20 1 
1 C DG  8  1_555 D DC  11 1_555 0.127  -0.086 -0.516 -7.624  -4.487  -0.640 8  D_DG809:DC911_E     D 809  ? E 911  ? 19 1 
1 C DG  9  1_555 D DC  10 1_555 -0.162 -0.112 0.094  -7.468  -8.120  0.392  9  D_DG810:DC910_E     D 810  ? E 910  ? 19 1 
1 C DT  10 1_555 D DA  9  1_555 -0.357 -0.098 0.127  -2.868  -4.935  1.538  10 D_DT811:DA909_E     D 811  ? E 909  ? 20 1 
1 C DA  11 1_555 D DT  8  1_555 -0.276 -0.055 0.002  -3.932  -3.374  4.163  11 D_DA812:DT908_E     D 812  ? E 908  ? 20 1 
1 C DG  12 1_555 D DC  7  1_555 -0.296 -0.193 -0.254 2.136   -9.383  2.940  12 D_DG813:DC907_E     D 813  ? E 907  ? 19 1 
1 C 2DT 13 1_555 D 8OG 6  1_555 2.395  -0.634 0.033  -5.718  -14.620 -0.659 13 D_2DT814:8OG906_E   D 814  ? E 906  ? 28 ? 
1 E DG  5  1_555 F DC  14 1_555 -0.026 0.139  0.472  6.351   -24.452 6.925  14 H_DG1806:DC1914_J   H 1806 ? J 1914 ? 19 1 
1 E DA  6  1_555 F DT  13 1_555 -0.406 0.133  0.464  4.462   -28.462 13.113 15 H_DA1807:DT1913_J   H 1807 ? J 1913 ? ?  1 
1 E DT  7  1_555 F DA  12 1_555 0.964  0.032  -0.031 6.253   -12.007 7.163  16 H_DT1808:DA1912_J   H 1808 ? J 1912 ? ?  1 
1 E DG  8  1_555 F DC  11 1_555 -0.250 -0.062 -0.728 -5.992  -11.663 9.118  17 H_DG1809:DC1911_J   H 1809 ? J 1911 ? 19 1 
1 E DG  9  1_555 F DC  10 1_555 -0.424 -0.139 -0.385 -11.276 -10.895 3.666  18 H_DG1810:DC1910_J   H 1810 ? J 1910 ? 19 1 
1 E DT  10 1_555 F DA  9  1_555 0.498  -0.096 0.060  -3.779  -4.453  0.131  19 H_DT1811:DA1909_J   H 1811 ? J 1909 ? 20 1 
1 E DA  11 1_555 F DT  8  1_555 -0.072 -0.010 -0.215 -2.785  -13.575 5.399  20 H_DA1812:DT1908_J   H 1812 ? J 1908 ? 20 1 
1 E DG  12 1_555 F DC  7  1_555 -0.213 -0.172 0.117  6.456   -10.086 3.608  21 H_DG1813:DC1907_J   H 1813 ? J 1907 ? 19 1 
1 E 2DT 13 1_555 F 8OG 6  1_555 1.777  -0.408 0.299  -5.417  -16.316 3.799  22 H_2DT1814:8OG1906_J H 1814 ? J 1906 ? 28 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DG 1  1_555 D DC 18 1_555 C DT  2  1_555 D DA  17 1_555 -0.900 -0.624 3.334 3.520   -3.760 46.476 -0.468 1.432  3.300 -4.748 
-4.445  46.745 1  DD_DG802DT803:DA917DC918_EE       D 802  ? E 918  ? D 803  ? E 917  ? 
1 C DT 2  1_555 D DA 17 1_555 C DT  3  1_555 D DA  16 1_555 -0.608 -0.293 2.947 5.498   2.053  34.197 -0.769 1.766  2.796 3.460  
-9.265  34.682 2  DD_DT803DT804:DA916DA917_EE       D 803  ? E 917  ? D 804  ? E 916  ? 
1 C DT 3  1_555 D DA 16 1_555 C DG  4  1_555 D DC  15 1_555 0.596  1.441  3.436 6.104   10.774 32.573 0.539  0.064  3.760 18.401 
-10.425 34.788 3  DD_DT804DG805:DC915DA916_EE       D 804  ? E 916  ? D 805  ? E 915  ? 
1 C DG 4  1_555 D DC 15 1_555 C DG  5  1_555 D DC  14 1_555 -0.939 1.035  2.944 -10.166 7.134  33.725 0.684  0.104  3.231 11.811 
16.831  35.877 4  DD_DG805DG806:DC914DC915_EE       D 805  ? E 915  ? D 806  ? E 914  ? 
1 C DG 5  1_555 D DC 14 1_555 C DA  6  1_555 D DT  13 1_555 -0.341 -0.084 3.326 -1.228  6.147  36.678 -0.964 0.368  3.279 9.681  
1.935   37.192 5  DD_DG806DA807:DT913DC914_EE       D 806  ? E 914  ? D 807  ? E 913  ? 
1 C DA 6  1_555 D DT 13 1_555 C DT  7  1_555 D DA  12 1_555 0.471  -0.267 2.990 2.830   0.945  31.173 -0.659 -0.382 3.011 1.753  
-5.250  31.312 6  DD_DA807DT808:DA912DT913_EE       D 807  ? E 913  ? D 808  ? E 912  ? 
1 C DT 7  1_555 D DA 12 1_555 C DG  8  1_555 D DC  11 1_555 0.768  -0.159 3.719 4.251   7.910  35.177 -1.527 -0.551 3.664 12.832 
-6.896  36.270 7  DD_DT808DG809:DC911DA912_EE       D 808  ? E 912  ? D 809  ? E 911  ? 
1 C DG 8  1_555 D DC 11 1_555 C DG  9  1_555 D DC  10 1_555 -0.572 -0.329 3.287 -5.250  3.230  34.158 -1.055 0.144  3.293 5.443  
8.849   34.694 8  DD_DG809DG810:DC910DC911_EE       D 809  ? E 911  ? D 810  ? E 910  ? 
1 C DG 9  1_555 D DC 10 1_555 C DT  10 1_555 D DA  9  1_555 -0.085 -0.668 3.241 -1.113  2.396  30.053 -1.764 -0.060 3.180 4.610  
2.141   30.167 9  DD_DG810DT811:DA909DC910_EE       D 810  ? E 910  ? D 811  ? E 909  ? 
1 C DT 10 1_555 D DA 9  1_555 C DA  11 1_555 D DT  8  1_555 0.317  -0.717 3.353 -0.527  4.482  31.795 -2.109 -0.668 3.218 8.129  
0.956   32.106 10 DD_DT811DA812:DT908DA909_EE       D 811  ? E 909  ? D 812  ? E 908  ? 
1 C DA 11 1_555 D DT 8  1_555 C DG  12 1_555 D DC  7  1_555 0.208  -0.433 3.295 1.356   9.509  29.275 -2.656 -0.129 3.016 18.207 
-2.597  30.778 11 DD_DA812DG813:DC907DT908_EE       D 812  ? E 908  ? D 813  ? E 907  ? 
1 C DG 12 1_555 D DC 7  1_555 C 2DT 13 1_555 D 8OG 6  1_555 0.213  -0.930 3.597 -1.768  1.947  32.432 -2.031 -0.716 3.521 3.478  
3.159   32.536 12 DD_DG8132DT814:8OG906DC907_EE     D 813  ? E 907  ? D 814  ? E 906  ? 
1 E DG 5  1_555 F DC 14 1_555 E DA  6  1_555 F DT  13 1_555 -0.531 -0.365 3.103 -3.669  8.153  29.770 -2.162 0.326  2.945 15.436 
6.947   31.055 13 HH_DG1806DA1807:DT1913DC1914_JJ   H 1806 ? J 1914 ? H 1807 ? J 1913 ? 
1 E DA 6  1_555 F DT 13 1_555 E DT  7  1_555 F DA  12 1_555 0.310  -0.396 3.349 1.062   -6.610 39.558 0.203  -0.327 3.376 -9.682 
-1.555  40.098 14 HH_DA1807DT1808:DA1912DT1913_JJ   H 1807 ? J 1913 ? H 1808 ? J 1912 ? 
1 E DT 7  1_555 F DA 12 1_555 E DG  8  1_555 F DC  11 1_555 0.434  -0.261 3.624 9.938   11.404 29.518 -2.615 1.117  3.282 20.754 
-18.086 33.092 15 HH_DT1808DG1809:DC1911DA1912_JJ   H 1808 ? J 1912 ? H 1809 ? J 1911 ? 
1 E DG 8  1_555 F DC 11 1_555 E DG  9  1_555 F DC  10 1_555 -0.575 -0.193 3.376 -4.421  7.059  34.890 -1.365 0.276  3.322 11.571 
7.246   35.840 16 HH_DG1809DG1810:DC1910DC1911_JJ   H 1809 ? J 1911 ? H 1810 ? J 1910 ? 
1 E DG 9  1_555 F DC 10 1_555 E DT  10 1_555 F DA  9  1_555 0.007  -0.298 3.271 -2.558  1.045  32.922 -0.701 -0.445 3.250 1.840  
4.505   33.034 17 HH_DG1810DT1811:DA1909DC1910_JJ   H 1810 ? J 1910 ? H 1811 ? J 1909 ? 
1 E DT 10 1_555 F DA 9  1_555 E DA  11 1_555 F DT  8  1_555 0.411  -0.240 3.349 1.853   8.463  29.777 -2.114 -0.405 3.182 16.045 
-3.514  30.984 18 HH_DT1811DA1812:DT1908DA1909_JJ   H 1811 ? J 1909 ? H 1812 ? J 1908 ? 
1 E DA 11 1_555 F DT 8  1_555 E DG  12 1_555 F DC  7  1_555 -0.156 -0.211 3.137 -6.150  9.918  29.198 -2.171 -0.815 2.887 18.756 
11.631  31.397 19 HH_DA1812DG1813:DC1907DT1908_JJ   H 1812 ? J 1908 ? H 1813 ? J 1907 ? 
1 E DG 12 1_555 F DC 7  1_555 E 2DT 13 1_555 F 8OG 6  1_555 0.388  -0.471 3.626 -1.007  -0.230 31.769 -0.814 -0.913 3.616 -0.421 
1.839   31.785 20 HH_DG18132DT1814:8OG1906DC1907_JJ H 1813 ? J 1907 ? H 1814 ? J 1906 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 "2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE" DGT 
5 'CALCIUM ION'                       CA  
6 water                               HOH 
#